Page 1





Selasa, 4 September 2012



Edisi 136 „ Tahun X


Pejabat Pemko Diduga Terlibat


„ Seorang ibu menangis histeris setelah angkot yang ditumpanginya terbalik.


„ Bus Karya Agung yang menabrak angkot Ria Jaya.

SIANTAR- Ketua Tim Advokasi dan Investigasi Forum Komunikasi Simalungun Indonesia (FKSI) Rocky Marbun melaporkan kasus 13 PNS ke Polresta Siantar, Senin (3/9), sekira pukul 16.30 WIB. Sebanyak 13 PNS itu diduga memiliki data dan SK palsu. Rocky menduga, ada beberapa pejabat teras Pemko Siantar yang terlibat dalam kasus penipuan dan pemalsuan ini. „) Baca Pejabat Pemko ...Hal 6

Ria Jaya Terguling Ditabrak Karya Agung

SIANTAR- Minibus Karya Agung BL 7317 NL yang dikemudikan Karson Napitu (42) menerobos lampu merah di perempatan Jalan Sisingamangaraja- Rakuta Sembiring, Senin (3/9) pukul 15.30 WIB. Akibatnya, minibus ini menabrak angkot Ria Jaya BK 1637 TV

yang dikemudikan Hisar Hasibuan (44) hingga terguling. Sebanyak 12 penumpang Ria Jaya mengalami luka-luka. Namun tidak ada korban jiwa dalam peristiwa ini. Hanya saja, supir Hisar Hasibuan, warga Jalan Sei Rumpun, Stadion Sang-

naualuh, Siantar Utara, mengalami luka gugus di tangan dan kaki. Sementara penumpang Yogi Ashi Purba (11) dan ibunya Prenti Sihombing (37) warga Kelurahan Tanjung Pinggir „) Baca Ria Jaya ...Hal 6

Sumber: ITPRI

Surat keputusan tersebut lengkap ditandatangani Sekda Siantar Donvert Panggabean termasuk Walikota Siantar Hulman Sitorus. Selain itu surat dari BKD Siantar juga ditandatangani Pariaman Silaen selaku Kepala BKD Kota Siantar dan semuanya lengkap dengan menggunakan stempel.

Marlon: Kalau Merugikan, Lebih Baik TPL Hengkang SIMALUNGUN- Protes demi protes terus berdatangan dari para tokoh dan pemerhati atas kebera-

daan PT Toba Pulp Lestari (TPL). Mereka meminta agar sebaiknya perusahaan pengolahan bubur

kertas ini hengkang dari tanah Batak jika memang tidak menguntungkan masyarakat sekitar.

Hal itu disampaikan tokoh masyarakat asal Simalungun Marlon Purba, Senin (3/9) melalui selularnya. Kepa-

da METRO, Marlon mengaku sudah merasa gerah atas kehadiran PT TPL yang dianggap tidak ada memberi-

kan nilai lebih bagi kesejahteraan „) Baca Marlon:...Hal 6

Lajang 67 Tahun Tewas Usai Panen Petai


Rencana Bangun Dapur Gagal SIMALUNGUN- Ditinggal saat mengikuti Kebaktian Kebangunan Rohani (KKR) di Kampung Banjar, satu unit rumah hangus terbakar di Kampung Gajing, Nagori Panombeian Pane, Kecamatan Panombeian Pane, Senin (3/9) sekira pukul 20.30 WIB. Dalam kejadian tersebut tidak

SIANTAR- Selamat Siahaan, pria lajang yang sudah berusia 67 tahun, warga Jalan Rakutta Sembiring Gang Aman, Kelurahan Pondok Sayur, Siantar Martoba, ditemukan tewas di ladang cokelat di belakang rumahnya, tepat di samping rumah Asanuddin Lubis, Senin (3/8) sekira pukul 11.00 WIB

„) Baca Rencana ...Hal 6

„) Baca Lajang 67 Tahun ...Hal 7


„ Selamat Siahaan saat ditemukan tewas di ladang coklatnya, Gang Aman, Jalan Rakutta Sembiring, Senin (3/9). FOTO:DHEV FRETES BAKKARA

„ Penghuni rumah saat menyiram sisa-sisa api.


6 Warga SiantarSaat Masyarakat Menebang, Polisi Datang Simalungun Lulus IPDN MEDAN- Sebanyak 102 peserta dari 518 orang yang mengikuti tes dinyatakan lulus seleksi akademis pada penerimaan calon praja Institut Pemerintahan Dalam Negeri (IPDN) tahun ajaran 2012/2013. Sementara, dari Pematangsiantar 2 orang berhasil lulus, dan 4 orang dari Simalungun. „) Baca 6 Warga Siantar ...Hal 6

SIMALUNGUN- Sabeda Damanik, diduga pengusaha illegal logging sejak tanggal 5 September 2011 sampai sekarang bebas melakukan perambahan kayu hutan Sipolha. Puluhan kayu Ingul dari kawasan hutan Sipolha habis ditebanginya. Menurut warga sekitar yang di-

tanyai METRO, Senin (3/9), Sabeda bebas melakukan perambahan hutan Sipolha bertopengkan dengan mengaku-ngaku sebagai pemilik lahan dan mempunyai surat lengkap. Berdasarkan pengakuannya, Sabeda Damanik bebas melakukan perambahan.


„ Sejumlah guru yang mengurus sertifikasi di Disdik.

Disdik Peras Guru Untuk Diklat Sertifikasi

Kayu-kayu berusia puluhan tahun di kemeringan 60 derajat mulai habis ditebangi Sabeda. Warga sekitar sudah pernah membuat pengaduan resmi ke Polres Simalungun. Berdasarkan laporan itu polisi

SIANTAR- Lagi-lagi Dinas Pendidikan Kota Siantar melakukan pungutan liar (pungli) kepada sejumlah guru yang telah selesai melaksanakan pendidikan dan latihan (diklat) untuk memeroleh tunjungan sertifikasi. Selanjutnya setiap

„) Baca Saat Masyarakat ...Hal 7

„) Baca Disdik Peras Guru...Hal 7



4 September 2012

Mirip Kubangan Kerbau Kalau hujan datang, badan jalan Rakutta Sembiring mirip dengan kubangan kerbau. Kami masyarakat sangat miris melihat kondisi ini, karena sudah belasan tahun tidak diperbaiki. (mua)

Jalan Desa Maligas Butuh PPerbaikan erbaikan

Aris SH, Warga Jalan Rakutta Sembiring

Bupati Simalungun terhormat, tolong diperhatikan Jalan Desa Maligas, Kecamatan Huta Bayu Raja kondisinya rusak parah dan sangat membutuhkan perbaikan. Jalan tersebut merupakan jalan utama yang setiap hari dilalui masyarakat. 082366292xxx

Naikkan Gaji Guru Honor

Wali Kota Siantar terhormat, tolong dibuat kebijakan untuk menaikkan gaji guru honor sesuai UMR. Rasanya kami guru honor ini seperti tertindas, karena gajinya jauh di bawah UMR. 085261225xxx

Mengancam Keselamatan Pengendara Kerusakan jalan tersebut sangat mengancam keselamatan pengendara yang lewat dari sana. Kalau tidak segera diperbaiki, dikhawatirkan akan semakin banyak pengendara yang menjadi korbannya. (osi)

Henriko Manurung, Warga

Truk TPL PPenyebab enyebab Jalan RRusak usak

Jalan Rusak Rakutta Sembiring

Makan Korban Lagi

KOMISI PEMILIHAN UMUM KOTA PEMATANGSIANTAR Jalan Porsea No. 3 Pematangsiantar Telp. 0622 - 435432; 435433 Fax: 0622 - 435434 PENGUMUMAN

Nomor: 270/925/KPU-PS/IX/2012

SELEKSI CALON ANGGOTA PANITIA PEMELIHAN KECAMATAN (PPK) PEMILIHAN UMUM GUBERNUR DAN WAKIL GUBERNUR PROVINSI SUMATERA UTARA TAHUN 2013 KOTA PEMATANGSIANTAR Dalam rangka melaksanakan pasal 27 ayat (1) huruf d Peraturan KPU Nomor 63 tahun 2009 tentang pedoman penyusunan tata kerja KPU Provinsi, KPU Kab/Kota, PPK, PPS dalam pemilihan umum kepala daerah dan wakil kepala daerah, tugas dan wewenang KPU Kab/Kota dalam penyelenggaraan Pemilu Kepala Daerah dan Wakil Kepala Daerah adalah membentuk PPK, PPS dalam pemilu Kepala Daerah dan Wakil Kepala Daerah Provinsi serta Pemilu Kepala Daerah dan Wakil Kepala Daerah Kab/Kota dalam wilayah kerjanya, dan keputusan KPU Provinsi Sumatera Utara Nomor: 01/KPTS/KPU-Prov-002/2012 tentang tahapan program dan jadwal penyelenggaraan Pemilihan Gubernur Sumatera Utara Tahun 2013. Untuk hal tersebut diatas KPU Kota Pematangsiantar membuka pendaftaran calon anggota PPK se Kota Pematangsiantar, dengan persyaratan sebagai berikut: a. Warga Negara Indonesia; b. Berusia paling rendah 25 (dua puluh lima) tahun; c. Berpendidikan paling rendah SLTA; d. Berdomisili di wilayah Kecamatan yang dibuktikan dengan kartu tanda penduduk; e. Mengajukan surat lamaran (yang ditujukan kepada Ketua KPU Kota Pematangsiantar) dengan melampiri: 1. Fotocopy Kartu Tanda Penduduk (KTP) 2. Fotocopy ijazah yang dilegalisir oleh pejabat yang berwenang 3. Pas photo berwarna ukuran 3 x 4 sebanyak 3 lembar 4. Surat keterangan hasil pemeriksaan kesehatan jasmani dan rohani dari Puskesmas (Setelah dinyatakan lulus tes wawancara); 5. Surat keterangan tempat tinggal yang dikeluarkan oleh Kepala Kelurahan dan diketahui oleh Camat 6. Surat pernyataan yang masing-masing ditandatangani diatas materai Rp 6.000,- tentang: • Setia kepada Pancasila sebagai dasar Negara, Undang-Undahg Dasar Negara Republik Indonesia tahun 1945, dan cita-cita Proklamasi 17 Agustus 1945; • Surat pernyataan mempunyai integritas pribadi yang kuat, jujur dan adil • Surat pernyatan tidak menjadi anggota Partai Politik • Surat pernyataan dapat membaca dan menulis dalam bahasa Indonesia; • Surat pernyataan tidak pernah dipidana penjara berdasarkan putusan pengadilan yang telah memperoleh kekuatan hukum tetap karena melakukan tindak pidana yang diancam pidana penjara 5 (lima) tahun atau lebih. (Setelah dinyatakan lulus tes wawancara) • Surat pernyataan terdaftar sebagai pemilih dalam Daftar Pemilih Tetap (DPT) Pilkada Tahun 2010; f. Pelamar dapat melampirkan keterangan atau bukti lain yang mendukung kompetensi calon. g. Dibuat masing-masing rangkap 3 (tiga) terdiri dari 1 (satu) asli dan 2 (dua) fotocopy. h. Pengambilan dan penerimaan pendaftaran tanggal 4, 5, 6 dan 7 September 2012 I. Untuk keterangan lebih lanjut dapat dilihat di Kantor KPU Kota Pematangsiantar.

Pematangsiantar, 03 September 2012 Ketua dto RAJAINGAT SARAGIH SH




Menerima Mahasiswa/i Baru T.A. 2012/2013 Program Study:

aw y Dr Luck


Pendaftaran: 1 Mei 2012 s/d 30 September 2012

edia ultim er M mput it Ko u) Un t a 1 (s

Bagi Mahasiswa/i Baru TA. 2012/2013 Dapat Beasiswa dari Ketua Yayasan 25% uang Kuliah Setiap Tahun

Kami Ada Untuk Anda Senin-Jumat (08.00 s.d 17/00) Sabtu (08.00 s.d 14.00)


Jl. Asahan Komp. Megaland Blok A No.58-60 Telp. 0622 7070215 - 7553367 Pematangsiantar

Mutu dan Pelayanan Yang Utama & Unggul Kwalitas, Unggul Teknologi Ketua Yayasan dto


Direktur dto


SIANTAR-Jalan Rakutta Sembiring, Kelurahan Sigulanggulang, Kecamatan Siantar Utara yang kondisinya rusak parah kembali memakan korban. Hendriko Saragih (30) warga Jalan Tangki, terkapar dengan tangan dan kaki mengalami luka memar setelah sepedamotor Supra X tanpa plat yang ditumpanginya menabrak lubang menggangga di Jalan Rakutta Sembiring tepatnya 50

meter dari simpang Gang Selamat. Peristiwa yang dialami sopir angkot ini, Senin (3/9) sekira pukul 02.00 WIB. Menurut warga yang menolong korban mengatakan bahwa kecelakaan sudah sering terjadi akibat jalan rusak yang sudah belasan tahun tidak diperbaiki. Hampir tidak ada lagi badan jalan yang bisa dipilih untuk dilewati, kondisinya 90 persen berlubang-lubang. (mua/osi)

Bupati Simalungun terhormat, tolong diberikan tindakan tegas kepada pengusaha truk Toba Pulb Lestari (TPL) yang setiap hari lewat dari Jalan Siantar-Parapat, karena muatannya overtonase yang mengakibatkan jalan rusak dan longsor. 085275377xxx

Telepon Penting PMI (Palang Merah Indonesia) 118, 0622-433911 Alamat Jl Sutomo No. 248, Pematangsiantar Kantor Imigrasi Alamat: Jl. Raya Medan Km. 11,5 Pematang Siantar Telepon : (0622)465018, 465014 Samsat Dipendasu Jln Sangnawaluh No 37A 0622 7552345.

RS dr Djasamen Saragih Jln Sutomo No 230. 0622 (23824) Hotel Sapadia Jl.Diponegoro No.21 A P.Siantar Telp:0622-435922 Nice Trans Siantar-Medan Medan. (061) 4558844 Siantar (0622)7000200 085275144777


4 September 2012

Kepala Korlantas Polri Irjen Pudji Hartanto.

“Sebanyak 66 persen dari 5,796 insiden kecelaksaan selama arus mudik-balik Lebaran 2012 disebabkan disebabkan unsur manusia. Seperti mengantuk, kelelahan, mabuk, sakit, mengunakan handhone, menerobos, melanggar batas, pindah jalur dan mendahului,”

Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter

Sikap Kami

“Intelijen negara terus memberi masukan kepada pemerintah untuk berupaya agar isu suku, agama, ras dan antargolongan (SARA) tidak Kepala Badan Intelijen Negara tumbuh subur,” (BIN) Marciano Norman.

Syahganda Nainggolan.

Pemberdayaan Masyarakat Adat

“ Menguak Hak Ulayat Simalungun “(2)

Tabiat Buruk Penyerapan Anggaran KITA seperti nyaris kehilangan kata-kata ketika menyaksikan masih buruknya kinerja penyerapan anggaran oleh pemerintah. Penyakit tahunan itu amat sulit disembuhkan, bahkan ketika Presiden Susilo Bambang Yudhoyono sudah beberapa kali menyatakan kekecewaannya. Kondisi paling baru disampaikan Tim Evaluasi dan Pengawasan Penyerapan Anggaran (TEPPA) yang dibentuk Presiden. Tim itu terdiri dari Kepala Unit Kerja Presiden Bidang Pengawasan dan Pengendalian Pembangunan Kuntoro Mangkusubroto, Wakil Menteri Keuangan Anny Ratnawati, dan Kepala Badan Pengawasan Keuangan dan Pembangunan (BPKP) Mardiasmo. Berdasarkan laporan TEPPA, serapan khusus belanja modal 43 kementerian dan lembaga pada semester I 2012 masih rendah. Hingga saat ini baru 25 institusi yang kemampuan identifikasi paket pengadaannya di atas 60%. Sebanyak 37 institusi berkemampuan di bawah 60% dan 25 institusi tidak memiliki kejelasan pelaksanaan penyerapan. Amat mungkin mereka akan menumpuk penyerapan anggaran di akhir tahun. Masih banyak institusi yang belum memulai proses pengadaan lelang pada medio tahun ini. Padahal, hal itu menjadi indikator bagi tren realisasi penyerapan anggaran. Lebih parah lagi, TEPPA mencatat penyerapan anggaran belanja empat institusi hingga triwulan II 2012 masih 0%. Keempatnya ialah Kementerian Pemuda dan Olahraga, Badan Intelijen Negara, Badan Nasional Penanggulangan Terorisme, dan Dewan Kehutanan Nasional. Hingga kini, baru lima institusi yang mampu melelang paket kegiatan secara signifikan. Kelimanya ialah Badan Kepegawaian Negara dengan capaian lelang 100%, BP Batam 94%, BPKP 81,5%, Kementerian Pekerjaan Umum79,6%,danKementerianKoperasidanUsaha Kecil dan Menengah 67,3%. Fakta itu sungguh menjadi potret betapa respons aparatur kita terhadap percepatan ekonomi amat lamban. Padahal, di tengah perekonomian dunia yang murung akibat krisis, stimulus APBN amat penting untuk mempertahankan atau bahkan mendongkrak pertumbuhan. Lambatnya penyerapan anggaran jelas bisa menjadi inefisiensi bagi perekonomian kita. Ia juga sebagai penanda tidak beresnya perencanaan. Tiap tahun, belanja APBN terus meningkat. Di RAPBN 2013 pemerintah bahkan menargetkan belanja negara Rp1.657,9 triliun, naik Rp109,6 triliun (7,1%) ketimbang belanja APBNP 2012. Jika dibandingkandenganbelanjanegaradi2007,kenaikan belanja RAPBN 2013 malah mencapai dua kali lipat. Sayangnya, kenaikan belanja itu belum berbanding lurus dengan upaya keras membereskan hambatan penyerapan anggaran. Dari target penyerapan 50% di semester I, yang tercapai baru sekitar 30%. Untuk membereskan itu, sanksi tegas berupa pengurangan anggaran bagi institusi yang burukdalampenyerapanharusbenar-benarditegakkan. Sebaliknya, ganjaran harus diberikan kepada institusi yang signifikan dalam menyerap anggaran. Sekadar pidato kekecewaan jelas tidak akan pernah menyelesaikan persoalan. (**)

“Dahulu bangsa ini pernah mengalami junta militer dari Soekarno ke Soeharto. Namun setelah reformasi justru yang berkembang adalah desakan kapitalisme internasional, dengan kekuatan-kekuatan kapitalis di tanah air yang berusaha menguasai negeri dan kekuasaan politik secara nasional,”

: Herman Sipayung. “Koordinator Program Pemberdayaan Sumber Daya Manusia Lembaga Pelpem GKPS Jl. Pdt. J Wismar Saragih P.Siantar.” BERANGKAT dari realitas tersebut di atas, sebenarnya tidak ada alasan bagi pemerintah Negara Kesatuan Republik Indonesia (NKRI) untuk tidak mengakui eksistensi masyarakat adat demikian juga masyarakat adat simalungun, secara politik maupun hukum. Hal ini juga telah ditetapkan di dalam perubahan amandemen Undang-Undang Dasar 1945 tentang pengakuan dan penghormatan terhadap masyarakat adat, yaitu : 1.Pasal 18 B ayat (2), Negara mengakui dan menghormati kesatuan-kesatuan masyarakat hukum adat beserta hakhak tradisionalnya sepanjang masih hidup dan sesuai dengan perkembangan masyarakat dan prinsip Negara Kesatuan Republik Indonesia. Yang diatur dalam pasal ini memberikan posisi konstitusional kepada masyarakat adat dalam hubungannya dengan negara, serta menjadi landasan konstitusional bagi penyelenggara negara, bagaimana seharusnya komunitas diperlakukan. Dengan demikian pasal tersebut adalah satu deklarasi tentang : (a) kewajiban konstitusional negara untuk mengakui dan menghormati masyarakat adat, serta (b) hak konstitusional masyarakat adat untuk memperoleh pengakuan dan penghormatan terhadap hak-hak tradisionalnya. Pasal 28 i ayat (3) yang menyebutkan juga Identitas budaya dan hak masyarakat tradisional dihormati selaras dengan perkembangan zaman dan peradaban. 2.Undang–undang Pokok Agraria no. 5 tahun 1960 yang jauh sebelumnya telah ada dikeluarkan oleh pemerintahan Soekarno produk hukum yang pertama kali menegaskan pengakuannya atas hukum adat. Pada pasal 5 menyebutkan “ Hukum agraria yang berlaku di bumi, air dan ruang angkasa ialah hukum adat, sepanjang tidak bertentangan

dengan kepentingan nasional dan negara yang didasarkan atas persatuan bangsa 3.UU No. 32/2004 tentang Pemerintahan Daerah. Pasal 203 ayat (3), hak-hak masyarakat hukum adat untuk mengelola sistem politik dan pemerintahannya sesuai dengan ketentuan-ketentuan hukum adat setempat 4. Pada Peraturan Pemerintah No.72 Tahun 2005 tentang Desa, menetapkan bahwa Desa atau disebut dengan nama lain, selanjutnya disebut desa adalah kesatuan masyarakat hukum yang memiliki batas – batas wilayah yang wewenang untuk mengatur dan mengurus kepentingan masyarakat setempat, berdasarkan asal usul dan adat istiadat setempat yang diakui dan dihormati dalam sistem pemerintahan Negara Kesatuan Republik Indonesia. Desa menetapkan bahwa Desa atau disebut dengan nama lain, selanjutnya disebut desa adalah kesatuan masyarakat hukum yang memiliki batas – batas wilayah yang wewenang untuk mengatur dan mengurus kepentingan masyarakat setempat, berdasarkan asal usul dan adat istiadat setempat yang diakui dan dihormati dalam sistem pemerintahan Negara Kesatuan Republik Indonesia. Ke empat hal tersebut di atas dipahami menjadi sangat mendasar Pemerintahan Indonesia ikut serta Deklarasi Anggota Perserikatan Bangsa Bangsa (PBB) tentang HakHak Masyarakat Adat yang berisikan 46 pasal di tanda tangani tanggal 13 september 2007 di New York. Pada pasal 26 secara tegas menyebutkan : a. Masyarakat adat memiliki hak atas tanah-tanah, wilayah-wilayah dan sumber daya-sumber daya yang mereka miliki atau duduki secara tradisional atau sebaliknya tanah-tanah, wilayah-wilayah dan sumber daya –sumber daya yang telah digunakan atau didapatkan. b. Masyarakat adat memiliki hak untuk memiliki, menggunakan, mengembangkan, dan mengontrol tanah-tanah, wilayah-wilayah, sumber daya-sumber daya yang mereka miliki atas dasar kepemilikan tradisional atau penempatan dan pemanfaatan secara tradisional lainnya, juga tanah-


Menjual bahan bangunan Grosir penjualan kayu untuk bangunan Tersedia segala jenis ukuran

Jenis kayu sembarang hutan Meranti Hoting Duri dll

"Lang Dearan Bani Halak Dong Do Hita" Horas Simalungun Jaya Jl. H Ulakma Sinaga No. 45 Nagori Pamatang Simalungun Kec. Siantar Kabupaten Simalungun

Pengusaha na RM Br Simanjuntak Telp. 0622 - 7552445 HP 0821 6545 1004

tanah, wilayah-wilayah, sumberdaya-sumberdaya yang dimiliki dengan cara lain. c. Negara-negara akan memberikan pengakuan hukum dan perlindungan atas tanah-tanah, wilayah-wilayah, dan sumber daya-sumber daya tersebut. Pengakuan itu harus dilakukan sejalan dengan penghormatan-penghormatan atas kebiasan-kebiasan, tradisi-tradisi, dan sistem pengakuan tanah pada masyarakat adat yang bersangkutan. Secara administratif saat ini Kabupaten Simalungun salah satu daerah di Provinsi Sumatera Utara terdiri dari 31 Kecamatan dan 367 (345 Nagori, 22 Kelurahan) jumlah penduduk 817.720 jiwa dengan batas-batas wilayah sebagai berikut : sebelah utara berbatasan dengan Kabupaten Deli Serdang dan Serdang Bedagai, Timur Kabupaten Asahan, Selatan dengan Toba Samosir, Barat Kabupaten Karo dengan luas wilayah 457.960 Ha (BPS Simalungun, 2011) Dari data Badan Pertanahan Nasional (BPN) tahun 1998 luas wilayah Kabupaten Simalungun 438.660 ha (Rosnidar.2001:70) jikalau di hubungkan dengan data dari Badan Pusat Statistik (BPS) Simalungun tahun 2011 seluas 457.960 ha, berarti selama 13 tahun ada penambahan wilayah seluas 19.300 ha, kekurangan data BPS Simalungun tahun 2011 yang bersumber dari Pemerintahan Kabupaten Simalungun hanya menerbitkan data luas lahan yang sertifikat menurut kepemilikan, tidak menerangkan data penggunaan tanah, status pemilikan tanah demikian juga secara khusus tentang Luas Hak Guna Usaha (HGU) disetiap kecamatan dan secara keseluruhan di Kabupaten Simalungun. Status Penggunaan Tanah Di Kabupaten Simalungun (1998),(Rosnidar.2001: 138) No. STATUS PENGUASAAN TANAH LUAS Ha % 1. Hak Guna Usaha 126.762 28,91 2. Kawasan Hutan 72.111 16.44 3. Sertifikat Hak Milik, Pakai, Guna Bangunan dan Pengelolaan 10.199 2.32 4. Tanah Negara diusahai rakyat (belum sertifikat) 229.538 52.33 Pengakuan Masyarakat Hukum Adat inhen dengan adanya Hak Ulayat (A.P.Parlindungan, 1993:2). Hal ini sehubungan dengan terdapatnya sekumpulan orang juga harus berhubungan dengan wilayah yang dijadikan sebagai lingkungan kehidupan untuk dikelola, mengatur peruntukan, penguasaan, penggunaan dan pemeliharaan dimanfaatkan oleh para warga secara bersama sebagai sarana maupun sumber kehidupan. Jikalau ditetapkan hak ulayat warisan masyarakat adat yang dikelola secara bersama untuk keperluan kebutuhan hidup, dalam konteks simalungun tidak terlepas dengan sumber daya-sumber daya yang telah pernah dimiliki maupun dikuasai, juga menjadi warisan bagi marga-marga atau keturunan Raja Marpitu Simalungun, karena tanah untuk masyarakat adat simalungun bukan sekedar sebuah keperluan primer, tanah berkaitan dengan nilai religius. Hal ini disebutkan religius sehubungan dengan proses dan tata cara kepemilikan tanah secara Hukum Adat Simalungun diawali dengan perundingan dengan Penghulu (kepala Desa/Nagori) atas persetujuan Raja untuk menyelidiki hutan yang hendak “ diperladangi “ yang menurut istilah simalungunnya “ Manririt Harangan” yang dikerjakan paling cepat selama empat hari di hutan, hutan yang dikunjungi tanah diambil masing-masing sekepal dibawa pulang kekampung untuk dimimpikan, apakah berniali kesehatan dan kebahagian apabila tempat di perladangi. Tahap berikutnya disaat mimpi memberikan keberuntungan Pangulu (Kepala Desa) memberikan serta menentukan batas luas tanah menurut banyaknya keluarga. Bersambung


4 September 2012

Kapolri: Ada 1.629 Lokasi Potensi Konflik di Indonesia JAKARTA- Berkaca dari kasus Sampang, Polri memetakan lokasi-lokasi potensi konflik di Indonesia. Polri menginventarisir ada 1.629 lokasi berpotensi konflik. ”Polri pro aktif menginventarisir potensi konflik di seluruh Polda agar tidak berkembang, yaitu terdapat 1.629 lokasi potensi konflik,” ujar Kapolri Jenderal Timor Pradopo dalam ra-

pat dengan pendapat bersama Komisi III DPR, di Gedung DPR, Senayan, Jakarta, Senin (3/9). Menurutnya, lokasi-lokasi itu tersebar pada beberapa latar belakang kondisi

masyarakat. Terbanyak, lokasi potensi konflik terdapat pada sektor perkebunan. ”Lokasi terbanyak adalah perkebunan, pertanahan, agama, ekonomi sosial dan budaya, serta pertambangan,” tuturnya. Ia menjelaskan Polri telah menempatkan petugasnya di setiap desa guna mengantisipasi potensi konflik, mengetahui

masalah dan mencari solusi bersama dengan masyarakat. ”Polri juga senantiasa berkoordinasi dengan tokoh masyarakat untuk memediasi agar tidak muncul konflik. Dalam hal ini, Polri memainkan peran sebagai mediator yang membawa pesan perdamaian bagi masyarakat,” ujarnya. Selain itu, upaya yang dilakukan Polri dalam menyikapi lokasi po-

tensi konflik dilakukan dengan membangun kerukunan antar warga dan mengikuti perkembangannya secara terus menerus. ”Kami juga menambah kekuatan Polri sebanyak 10.000 anggota pada tahun 2012 ini juga melengkapi perlengkapan senjata dalam penanganan konflik,” kata Timor. (dtc/int)

Teroris Solo Gunakan Senjata dari Filipina JAKARTA- Terduga teroris di Solo menggunakan senjata dari Filipina saat beraksi. Kepolisian Filipina dilibatkan guna menelusuri senjata tersebut. ”Soal senjata Filipina, itu sedang ditelusuri,” kata Menko Polhukam Djoko Suyanto di Istana Negara, Jakarta, Senin (3/9). Menurut dia, proses penelusuran bersama Filipina sudah dilakukan. Indonesia juga menjalin kerjasama antiteror dengan negara lainnya mengingat teroris memiliki jaringan yang luas. ”Itulah fungsi dan kegunaannya sehingga kita bisa menelusuri apa yang terjadi,” ujarnya. Namun demikian, Djoko menolak membeberkan kemajuan penyelidikan. “Itu adalah buah dari kerja keras mereka. Mereka kan sudah ada di

„ Kapolri Jendral Timur Pradopo memberikan keterangan pers lokasilokasi yang rawan kericuhan di Indonesia. lapangan sejak lama,” kata dia. Kapolri Jenderal Timur Pradopo se-

belumnya menyebut terduga teroris di Solo menggunakan senjata dari Fil-

PELUMAS MOTOR Jl. Merdeka No. 1027, Perdagangan

ipina. Mereka diduga melakukan penyelundupan berbagai jenis senjata api dan amunisi dari Filipina. Sejumlah barang bukti juga diamankan antara lain 1 pucuk pistol pietro baretta, 3 buah magazine, 43 peluru kaliber 9 mm merk Luger, dan 9 holopoint CBC, 1 unit HP, beberapa dokumen, dan STNK. Motif untuk Balas Dendam Kepolisian RI memastikan bahwa rentetan penyerangan kelompok teroris di Solo, Jawa Tengah, selama Agustus 2012 bermotif balas dendam. Hal ini berdasarkan hasil pemeriksaan terhadap barang bukti dan pemeriksaan tersangka teroris yang ditangkap hidup oleh Densus 88 Anti Teror Polri Kepala Biro Penerangan Masyarakat Polri Brigadir Jenderal

Jaminkan BPKB Motor anda Proses Cepat - Aman - Mudah - Tepat DANA LANGSUNG CAIR HP 0821 6069 2290; 0853 7312 4777 (Hendrik Surya) Dapatkan cashback Rp 200.000 Menjual Segala jenis Sepeda Motor Baru dan Bekas Dengan Menjaminkan BPKB anda CASH & KREDIT ke PELUMAS MOTOR Jl.Merdeka No .1027 Perdagangan Bebas Adm dan Kendaraan di Assuransikan Juga SOLUSI DANA TUNAI SUPER CEPAT !!! Buktikan Dengan Anda Mengunjungi Dealer kami * Khusus kredit Spd Motor Mendapat Gratis OLI Selama Setahun dengan ketentuan Bayar Angsuran Tepat waktu

* Syarat Dan Ketentuan Berlaku

(Pol) Boy Rafli Amar mengatakan, selain magazen, di dalam tas pinggang yang dipakai Farhan (19), polisi menemukan banyak lembaran kertas. Dalam lembaran itu, kata Boy, terdapat surat yang ditulis tangan. “Ternyata di dalam surat itu cukup jelas untuk menyimpulkan motif. Secara ideologi memang mereka berjuang sebagaimana kelompok terdahulu seperti Jamaah Islamiyah yang ingin membentuk negara syariah Islam di Indonesia. Jadi kenapa mereka membalas, karena mereka merasa kecewa dengan penangkapan tokoh mereka selama ini sehingga mereka balas dendam,” kata Boy sebelum rapat kerja dengan Komisi III di Gedung Kompleks Parlemen Senayan, Jakarta, Senin ( 3/9/2012 ).

Dalam raker itu, Komisi III ingin mendengar penjelasan Kepala Polri Jenderal (Pol) Timur Pradopo mengenai penanganan Madura, dan Sigi, Sulawesi Tengah. Akan disinggung pula mengenai penanganan kasus terorisme di Solo. Boy menambahkan, dalam pemeriksaan terungkap pula sandi yang dipakai kelompok mereka, yakni “main bola”. Jika sandi “pengantin” untuk melakukan bom bunuh diri, sandi “main bola” dipakai untuk menyerang petugas kepolisian. “Itu terungkap dalam pemeriksaan ini. Kita melihat mereka sangat teliti, sampai menentukan hari (penyerangan) pun mereka sangat memikirkannya. Penentuan tanggal 17 Agustus dikaitkan bersamaan dengan hari proklamasi,” kata Boy. (dtc/int)

PELUMAS MOTOR Jl. Merdeka No. 1027, Perdagangan HP 0821 6069 2290; 0823 6516 1890

Anda SIBUK? Cukup Hubungi Kami , Kami siap MENJEMPUT Berkas Anda!

Pastikan BPKB dan uang Anda Bermanfaat Bagi Keluarga Anda! Bunga ringan dan terjangkau serta dealer terpercaya

Ayooo… Buruan !!! Segera Kunjungi dealer kami PELUMAS MOTOR PERDAGANGAN Dapatkan Segera THR Lebaran Ini


4 September 2012

SEKELUARGA LEMPARI RUMAH, PENGHUNI PINGSAN SIMALUNGUN- Salper Purba (35) dan istrinya Risma, dan dua anaknya Fredy Purba (22) dan Rio Purba (18) serta 6 orang sanak keluarganya terpaksa berurusan dengan Polres Simalungun. Mereka dipolisikan atas pengerusakan rumah tetangganya, Amen Sidauruk (67) warga Dolok Huluan, Nagori Dolok Huluan, Kecamatan Raya, Kabupaten Simalungun. Tersangka lainya adalah sanak keluarga Salper, yakni Aliden Purba, Adis Purba, Buha Manalu, Toni, dan Ferdi. Amen Sidauruk menceritakan bahwa rumah yang ditempatinya, Minggu (2/9) dini hari dirusak Salper Purba bersama sanak keluarganya. Dirinya bersama isterinya Noning Purba dan 2 orang putrinya saat kejadian itu ketakutan dan tidak berani keluar dari rumah. “Waktu kejadian itu kami sangat ketakutan. Tidak ada satu pun yang berani keluar rumah. Mulai Sabtu (1/9) pukul 21.00 WIB sampai Minggu pukul 03.00 WIB, rumah kami dilempari. Dan pintu depan rumah dicoba dibongkar paksa. Dinding rumah dan atap seng dilempari. Kami saat itu sangat ketakutan. Bahkan saat kejadian itu isteri saya pingsan,” papar Amen ketika dijumpai di kediamannya. Di sela-sela kejadian itu, Amen mengaku serasa tidak peduli lagi. Ia fokus mengobati isterinya Noning yang tengah pingsan. Beruntung saat itu isterinya langsung sadarkan diri. “Ketika isteri saya sudah sadarkan diri, saya kabur lewat pintu belakang. Memang sebelumnya saya sudah telepon teman untuk menjemput saya untuk melaporkan kejadian itu ke Polres Simalungun. Pulang membuat pengaduan, mereka sudah berhenti melempari rumah saya,” ujarnya. Setelah kejadian itu, dirinya memeriksa apa yang terjadi dengan rumahnya berukuran 6x8 meter berdinding papan itu. Akibat kejadian itu, atap seng rumahnya bocor-bocor, pintu depan rumah rusak, dinding rumah banyak bekas lemparan. Hingga saat ini batu dan kayu bekas lemparan masih dibiarkan. “Kami tidak mau bersihkan batu dan kayu di depan rumah ini sebelum dilihat polisi. Begitu juga dengan atap seng dan pintu depan yang rusak, kami tidak akan perbaiki supaya ada bukti,” tegasnya. Lebih lanjut Amen menyampaikan, peristiwa itu berawal saat Juli lalu dirinya menebang sebatang kayu Dosin milik mertuanya di ladang. Setelah penebangan itu, Salper Purba yang masih ada hubungan keluarga dengan Amen menanyakan maksud penebangan tersebut. “Isteri saya dan Salper masih abang adik. Kayu yang saya tebang itu di ladang milik mertua saya, dan sudah mendapat persetujuan dari keluarga mertua saya. Usai penebangan satu pohon itu, tiba-tiba keluarga Salper datang ke rumah mengatakan keberatan atas penebangan itu. Karena saya tidak mau cari masalah, saya sudah minta maaf dan akan mengganti rugi kayu tersebut,” ungkap Amen. Tetapi permohonan maaf Amen tidak diterima Salper dan keluarganya. Hari itu juga, Noning meminta maaf kepada adikadiknya atas penebangan kayu yang dilakukan suaminya. “Saya dan isteri saya sudah memohonkan maaf dan akan ganti rugi penebangan itu. Saya pun tidak tahu apa maksud mereka karena tidak memberikan jawaban. Padahal tanah itu masih milik mertua saya yang siapa saja dari keluarga isteri saya bisa mengelolanya,”ujarnya. Pasca penebangan itu, tepatnya tanggal 25 Juli, gubuk milik Amen di ladang dibakar oleh keluar Salper. Setelah itu, keluarga Amen juga diteror dengan ancamanancaman. “Puncaknya semalam. Saat kami tidur, rumah kami diserang lemparan. Kami pun tidak berani keluar. Hanya saja kami intip mereka dari jendela siapa-siapa saja yang melemparinya,”tukasnya. Salper yang hendak dikonfirmasi, tidak berada di rumahnya. Rumahnya berukuran 5 meter kali 6 meter berdinding papan tertutup rapat. Kapolres Simalungun AKBP M Agus Fajar SIK saat dikonfirmasi melalui Kasubag Humas AKP H Panggabean SH membenarkan telah menerima laporan pengaduan dari Amen. Akibat perbuatannya Salper dan keluarkannya disangkakan pasal 170 KUHP dan pasal 106 KUHP tentang pengerusakan barang secara bersama-sama. (osi)

Pejabat Pemko Diduga Terlibat Sambungan Halaman 1 Menurut Rocky, sesuai laporan pengaduan, mereka meminta kepada Kapolresta untuk menyelidiki dan menyidik hasil temuan pemalsuan dokumen dan penyalahgunaan kewenangan terkait adanya 13 PNS yang diyakini tidak memiliki legitimasi hukum sesuai dengan peraturan perundang-undangan yang berlaku. “Kami menduga adanya keterlibatan beberapa pejabat teras di Pemko Siantar, karena sesuai dengan hasil investigasi kami terkait keputusan walikota, ternyata keputusan walikota yang ditandatangani Sekda itu palsu,” ujarnya. Rocky yang didampingi Ketua Umum FKSI Daud RS Purba menyebutkan, sejak Mei, gaji 13 PNS siluman ini telah dicairkan Pemko Siantar. Untuk itu, mereka juga melaporkan ini terkait indikasi kerugian negara selama beberapa bulan kepada 13 PNS siluman ini. Ketua Lembaga Institut Trias Politika Republik Indonesia (ITPRI) Siantar Simalungun Jekson Hutahean juga menyebutkan, pejabat Pemko Siantar adalah penanggung jawab soal keberadaan sejumlah orang yang disebut sebagai PNS Siluman ini. Selain itu penegak hukum juga diminta jangan tutup mata soal kasus tersebut, sebab ditemukan pelanggaran tindak pidana tentang penipuan dan pemalsuan surat. ”Sungguh luar biasa, oknum-oknum yang tidak bertanggungjawab itu berani memalsukan dokumen negara melalui surat keputusan dari berbagai pejabat tinggi di sejumlah instansi, baik WalikotaSiantar,BKDPemerintahSumateraUtara serta Gubernur Sumatera Utara. Yang lebih parahnya, perbuatan tersebut berjalan mulus hingga 12 orang (menurut data ITPRI) yang mendapatSKpalsutersebutsempatmenerimagaji padabulanJulikemarin.“Inikanuangnegarayang mereka terima, jadi bagaiaman pemerintah mempertanggungjawabkan ini. Makanya saya mendugawalikotajugaturutsertabermaindisini,” terang Jekson. Masih kata Jekson, lembaganya telah melakukan upaya klarifikasi sejak 30 Juli kemarin dengan melayangkan surat ke BKD Kota Siantar dan juga BKD Provinsi Sumatera Utara. Namun ia sangat kecewa sebab surat yang dilayangkan dibalas denganpernyataanlisanyangmengatakanbahwa SK mutasi PNS tersebut tidak benar dan palsu. “Pada 28 Juli kemarin kami mengetahui infor-

Sambungan Halaman 1 mengalami trauma dan menangis di lokasi. Sedangkan penumpang Ria Jaya yang didominasisiswaituhanyamengalamilukaringan, antara lain Yehezkel Manullang (16) kelas II SMA Adven, Vijay (15) kelas 1 SMA Trisakti, Elfredo (15) siswa SMK Taman Siswa dan Eka (15) siswa SMA Muhammadiyah serta lima temannya yang lain juga mengalami luka ringan. Informasi dihimpun METRO, Ria Jaya melaju dengan kecepatan sedang dari Pasar Dwikora menuju Jalan Rakutta Sembiring. Posisi traffic light saat itu masih kuning, tiba-tiba dari arah Jalan Sisingamangaraja arah SPBU muncul minibus Karya Agung yang dikemudikan Karson Napitu dan langsung menabrak sebelah kiri angkot hingga mengakibatkan angkot ini terguling. Sesudah terguling sekali, penumpang yang didalam mobil terpaksa keluar dari pintu sebelah kiri. Beberapa penumpang mengalami luka memar di kaki dan tangan dan sebagian terlihat trauma, terutama Prenti Sihombing dan anaknya Yogi. Tidak lama kemudian, angkot ini dikem-

Sambungan Halaman 1 masyarakat sekitar unit usaha. “Kehidupan masyarakat di daerah sekitar usaha PT TPL tetap miskin. Tidak ada kelihatan kesejahteraan bagi masyarakat yang tinggal di sekitar TPL, padahal tanah Batak telah dimanfaatkan sesuka mereka,” kesal Marlon. PriayangpernahdudukdiDPRDSumateraUtara yang membidangi masalah lingkungan ini menambahkan,diasangatmendukungbilaadawacana PTTPLditutupdandiusirdaritanahBatak.Diajuga mengharapkanagarpemerintahjelidalammelihat operasional PT TPL dan hendaknya tegas dalam menindakperusahaanyangtidakadamanfaatnya,

nya, supir Karya Agung itulah yang menerobos lampu merah. Sementara supir Karya Agung Karson Napitu, warga Jalan Mual Nauli, Siantar Timur, menyebutkan, dia hendak membawa mobil ke loket, karena mini bus ini mau berangkat ke Bagan Siapi-Api pukul 16.00 WIB. Disinggung sikapnya yang menerobos lampu merah, Darson malah berang. “Sudahlah itu, yang penting sudah kuambil jalurku pas tadi lewat di sana. Biasalah itu supir, kalau dibilangnya seperti itu, saya yang dibilang meneroboslampumerah.Kebetulantadisewanya belum ada, belum ada penumpang. Masih mutarmutarnya tadi kubawa mobil itu,” jelasnya. Tidak lama kemudian, puluhan penumpang dan supir Ria Jaya dibawa ke Mapolres Siantar. Begitu juga supir Karya Agung ikut dibawa untuk kepentingan pemeriksaan. KanitLakaIptuSugengWahyudimembenarkan kecelakaan lalu lintas ini. Pihaknya masih menyelidiki penyebab pasti kecelakaan. Diduga kecelakaan terjadi karena kelalaian supir Karya Agung yang menerobos lampu merah. Kedua mobil sudah diamankan untuk kepentingan penyelidikan. (ral)

malahmerusaktanahmayarakat.“Tanahkitadihisap, dikuras,tanpaadatimbalbaliknya.Kalaumemang begitu,yalebihbaikdiusir,”ujarMarlon. Masihkatapriaberposturtinggibesarini,diajuga mengaku tidak yakin atas pernyataan pihak PT TPL yang mengatakan bahwa mereka melaksanakan seluruh prosedur dalam melaksanakan proses operasionalnya. “Saya tidak yakin semua itu. Kalau memang mereka bertindak sesuai prosedur, masyarakat tidak mungkin marah. Masyarakat kan marah karena mereka merasa dirugikan. Makanya pemerintah harus benarbenar peduli akan kesengsaraan masyarakat karena tindakan PT TPL ini,” ujarnya. Sebelum Marlon, banyak kalangan di seluruh

SumateraUtaradanIndonesiasecaraumumserius membincangkan soal kerusakan kelestarian Danau Toba. Seluruh perusahaan yang menyebabkan kerusakan lingkungan Danau Toba agar ditutup demi kelestarian Danau Toba dan tetap menjadi kebanggaan bangsa Indonesia, dan tetap menjadi salah satu icon dunia. Sementara, Humas TPL Lambertus Siregar membantah semua tudingan itu. Dia mengaku pihaknya mempunyai AMDAL yang baik dan TPL menaatinya dengan patuh dan setia dan tetap dimonitor serta dievaluasi pemerintah dengan baik. Dia juga menyebutkan, limbah dikelola dengan teknologiramahlingkungandanPTTPLjugatelah memeroleh ISO 14001 oleh SGS. (spy/ara)

6 Warga Siantar-Simalungun Lulus IPDN Sambungan Halaman 1 Kepala Badan Kepegawaian Daerah (BKD) Provinsi Sumut (Provsu), Suherman mengemukakan hal itu kepada wartawan, di Kantor Gubsu di Medan, Senin (3/9). Suhermanmenjelaskannama-namayanglulus ujian seleksi akademis ini lah yang berhak untuk mengikuti Wawancara Penentuan Akhir (Pantukhir) di Kampus Institut Pemerintahan Dalam Negeri, Jatinangor, Jawa Barat, sesuai dengan jadwal melapor yang telah ditentukan. Kelulusan ini, lanjutnya, berdasarkan Surat

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel)

Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

balikan ke posisi semula oleh warga. “Masih kuning tadi, belum merah Bang. Kami anak sekolah yang ada di angkot itu ada sembilan orang. Dua penumpang usianya masih muda, setelah kejadian, mereka langsung pergi begitu saja. Ada satu lagi penumpang di samping supir, dia sepertinya masih SMP atau SD. Sewanya penuh Bang, mulai dari samping supir sampai ke belakang,” ujar Yehezkel Manullang. Sementara Yogi Ashi Purba dan ibunya Prenti Sihombing terlihat menangis dan berpelukan di lokasi itu usai kejadian. Keduanya mengalami luka ringan.Yogi mengaku punggung dan bokongnya sakit sesudah kejadian itu. Sementara Prenti mengaku kepalanya pening akibat angkot yang mereka tumpangi terguling. “Inilah anakku satusatunya, ayahnya sudah lama meninggal. Kami baru pulang berobat tadi dari rumah sakit, dadaku masih sakit,” ujar Prenti menangis sembari memeluk anaknya. Supir Ria Jaya Hisar Hasibuan menyebutkan, posisi angkot mereka saat melintas, warna lampu masih kuning, belum merah. Dalam hal ini yang salah merupakan supir Karya Agung. Pengakuan-

Marlon: Kalau Merugikan, Lebih Baik TPL Hengkang

Anggota SPS No: 438/2003/02/A/2007 Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba

dari kantor Sekretaris Daerah. “Ada namanya kok, makannya dia juga gajian. Tapi saya tidak berani mengatakan dia PNS siluman atau tidak,” sebutnya. Ditanya mengapa tidak ada koordinasi dengan Sekda, Julham mengatakan bahwa dengan SK yang diberikan oleh orang yang bersangkutan tersebut cukup membuat dia yakin tanpa melakukan kroscek atas pertambahan bawahannya. Selain Julham, Sekretaris Camat Siantar Utara bermargaSembiringjugamengakuadasatuorang PNS siluman ditempatkan di Kecamatan Siantar Utara. Orang tersebut bernama Tomy Jhonathan Silalahi dan juga telah menerima gaji pada Juli kemarin. Namun Tomy tidak kelihatan lagi setelah kasus tersebut mencuat ke publik. Sedangkan bagian mutasi BKD Siantar menerangkan bahwa pihaknya tidak ada menerima SK PNS perpindahan dari luar daerah masuk ke Pemko Siantar. “Tidak ada itu. Saya tidak pernahmenerimaSKtersebutdannama-namaitu tidak ada terdaftar sebagai PNS di Pemko Siantar,” ujar pegawai bermarga Simorangkir saat METRO menunjukkan 12 orang nama PNS siluman itu. Informasi diperoleh METRO, oknum yang melakukan penipuan ini adalah PNS di Dinas Pendidikan Siantar berinisal A br M. Namun beberapa pegawai Disdik yang ditemui METRO mengaku bahwa A br M sudah beberapa hari tidak masuk kantor tanpa alasan jelas. Sementara Sekretaris Disdik Mansur Sinaga membantah adanya PNS siluman di Disdik Siantar. Selain itu, informasi diperoleh METRO, untuk mendapatkan SK tersebut, setiap orang harus mengeluarkan Rp120 juta kepada oknum PNS Disdik itu untuk memuluskan namanya terdaftar di penggajian. Jekson menambahkan, dia dan temannya juga sudah datang ke Pemkab Simalungun dan menemui Kepala BKD Simalungun dan dalam pertemuan tersebut, BKD Simalungun menemukan ada tiga NIP milik orang yang memang hendak mutasi dari luar daerah ke Pemkab Simalungun. Sehingga tiga orang PNS siluman’tersebut menggunakan NIP milik PNS luar daerah itu. “Yang jelas sindikat ini besar kemungkinan melibatkan pejabat teras Pemko Siantar. dan sangat tidak masuk akal apabila mereka tidak mengetahui keberadaan mereka sebelumnya,” kata Jekson.

Ria Jaya Terguling Ditabrak Karya Agung

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pemimpin Perusahaan Metro Asahan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

masinya dan telah mendapatkan fotocopy SK tersebut. Kami pun berusaha mencari kebenarannya. Dan ternyata setelah kami inventarisir, ternyata orang-orang tersebut memang bertugas di Pemko Siantar. Tapi BKD mengatakan bahwa mereka bukan PNS, makanya kami heran,” tambah Jekson. Dalam fotocopy tersebut, terlampir beberapa surat keputusan dari berbagai instansi seperti SK Walikota lengkap dengan tanda tangannya, surat keputusan dari Badan Kepegawaian Daerah (BKD) Siantar, BKD Provinsi Sumatera Utara, Sekretaris Daerah Kota Siantar. Dalam SK tersebut juga dijelaskan bahwa nama yang tercantum merupakan PNS di Pemkab Simalungun dan rata-rata memiliki golongan IIA, sehingga terlampir juga SK dari BKD Provinsi Sumatera Utara tetang mutasi dari Pemkab Simalungun ke Pemko Siantar. Selain itu, beberapa orang yang ditempatkan di UPTD kecamatan terlampir juga surat dari kepala dinas terkait yang menerangkan bahwa PNS tersebut mendapatkan tunjangan sebesar Rp180 ribu setiap bulan. Sedangkan dalam SK tersebut dikeluarkan pada bulan April, Mei dan Juni. KemudiansejumlahPNSsilumantersebuttidak segan-segan membawa SK tersebut dan kemudian menunjukkan kepada dinas terkait dimana mereka ditempatkan. Selanjutnya PNS Siluman tersebut masuk seperti PNS lainnya serta mengenakan pakaian PNS. Pada Juli kemarin, sejumlah PNS tersebut pun menerima gaji yang rata-ratanya sebesar Rp1,5 juta yang bersumber dari kas daerah. Namun akhir-akhir ini kasus tersebut mencuat kepermukaandanparaPNSsilumantersebutpun tidak masuk kantor lagi. Terpisah, beberapa pimpinan SKPD yang dikonfirmasi mengakui adanya PNS siluman di SKPD yang dipimpinnya. Kakan Satpol PP Kota SiantarJulhamSitumorangketikaditemuiMETRO mengaku bahwa salah seorang datang menemui diamengakubernamaJefriSamosirdanmembawa SK Sekda. Kemudian Julham pun menempatkan Jefry di bagian operasional dan pada Juli kemarin Jefrimenerimagaji. “Dia kemarin sudah masuk kantor, tapi karena mencuat ke permukaan, dia tidak masuk kantor lagi,” kata Julham. Julham pun menerangkan bahwa nama Jefri Samosir terdaftar di staf di bagian penerimaan gaji

Keputusan Mendagri No.892.1-585 Tahun 2012 Tanggal 30 Agustsu 2012, yang telah menetapkan calonprajayangdinyatakanlulusseleksiakademis pada seleksi penerimaan calon Praja IPDN Tahun Ajaran 2012/2013. “Peserta yang mengikuti Test sebanyak 518 orang, yang dinyatakan lulus seleksi akademis sebanyak 102 orang,” ulangnya. DaftarnamacalonPRajaIPDNyangdinyatakan lulus seleksi dapat dilihat di website pemprovsu yaitu atau di BKD Kabupaten/Kota se-Sumatera Utara. Kepada Calon Praja IPDN yang namanya tertera

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Chandro Purba, Nasa Putramaylanda, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Pala MD Silaban, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva

Rencana Bangun Dapur Gagal Sambungan Halaman 1 ada korban jiwa, tetapi pemilik rumah mengalami kerugian puluhan juta. Korban kebakaran, Jonny Giawa (43) didampingi istrinya Rolli br Saragih (43) mengaku saat itu mereka sedang tidak berada di rumah. "Semua warga kami sini tadi sedang mengikuti KKR yang diadakan di kampung sebelah. Cuma anak-anak saja yang tinggal di perkampungan ini," sebutnya.Diamengaku,sebelummeninggalkanrumah, ia sudah mengecek gas dan barang-barang elektronik. Saat itu rumah dalam kondisi kosong dan tertutup rapat. Kemudian mereka pun berangkat dan baru setengah jam berada di kampung Banjar untuk mengikuti KKR. "Kegiatan KKR itu tadi masih baru dimulai, tapi buru-buru warga kampung bilang ada kebakaran. Kebetulan itu lokasi kampung kami, ya kami langsung bergegas ke sana. Setibanya di lokasi, kami sudah melihat rumah panggung kami sudah dilalap si jago merah," sebut pria yang berprofesi sebagai petani tersebut. Dilanjutkan pria yang memiliki empat orang anak itu bahwa barangbarang mereka tidak ada yang sempat diselamatkan. Saat ini mereka hanya memiliki pakaian yangmenempeldibadanmerekamasing-masing. Denganwajahyangmasihtampakshok,Jhonny menyebutkan bahwa surat-surat berharga dan barang-barang mereka semuanya hangus terbakar. Tidak hanya itu, rencana untuk membangun dapurpungagalkarenauangRp6jutayangselama ini ia simpan ikut terbakar. "Anak saya ada empat orang, dua kos di Siantar dan dua lagi tinggal sama kami. Kalau yang tinggal sama kami terpaksa tidak bisa sekolah karena baju dan alat-alat sekolahnya juga terbakar. Anak saya yang dua itu yakni Rajahulu yang duduk di bangku kelas II SMP dan Angandewa yang duduk di bangku kelas V SD," ungkap pria yang bekerja sebagai petani tersebut. Katanya, untuk saat ini mereka tinggal di rumah keluarga yang tidak jauh dari kediamannya. Ia mengaku masih belum mengetahui rencana selanjutnya.(mua)


pada lampiran SK Mendagri dimaksud untuk melapor/pengarahandiBadanKepegawaianDaerah Provsu Kantor Gubernur Sumatera Utara Jalan Diponegoro No.30 Medan, pada Rabu (5/9 pukul 09.00WIBdenganmembawaKartuNomorUjianAsli. Sehubungan dengan ini, Pelaksana Tugas (Plt) Gubsu melalui Sekdaprovsu, Nurdin Lubis telah menyurati para bupati dan walikota se Sumut melaluiSuratEdaran(SE)No.800/17704/BKD/III/ 2012 Tanggal 3 September 2012 agar juga memberitahukan kepada calon praja IPDN yang namanya dinytakan lulus agar melapor ke BKD Sumutsebagaimanajadwalyangtelahdiatur. (ari)

Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Niko, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

Ganti Sekda dan BKD Ketua Fraksi PDI-Perjuangan DPRD Kota Pematangsiantar Rivai Siregar saat diminta komentarnya mengatakan bahwa Fraksi PDIPerjuangan berencana akan menyurati Pimpinan DPRD agar memanggil walikota untuk memberikan keterangan dan penjelasan soal keberadaan PNS siluman tersebut. Menurutnya,haliniterjadidisebabkanbobroknya birokrasi pemerintahan Kota Siantar sehingga Walikota Siantar harus bertanggung jawab atas persoalanini.IajugamengatakanSekdadanKepala BKDsebaiknyadigantisajakarenatidakmelakukan tugassebaikmungkinsehinggabisakebobolan. Pemko Ikut Melapor PemkoSiantarturutmelaporkan13PNSsiluman ke Polres Siantar, Senin (3/9) pukul 17.30 WIB. BerdasakanpemeriksaanInspektoratKotaSiantar, ke-13 PNS ini tidak dapat menunjukkan SK CPNS yang dikeluarkan BKAN. Pengakuan Pemko, merekamengetahuikasusinisejaktigaminggulalu. Kabag Humas Pemko Siantar Daniel Siregar datang bersama Kabag Hukum Robert Irianto dan dua staf dari Bagian Humas dan Bagian Hukum. Usai memberikan data dan melapor ke Polres Siantar, Daniel menyebutkan, mereka datang untuk melaporkan 13 PNS siluman ini ke Polres Siantar. Mereka juga melampirkan hasil pemeriksaan inspektorat terkait 13 PNS ini. DisinggungkapanPemkomengetahuimasalahini, Danielmenyebutkan,merekamengetahuinyasekitar dua atau tiga minggu lalu. Kemudian dilakukan pemeriksaan terkait data 13 PNS siluman ini yang melibatkanBKDdanInspektoratKotaSiantar. Daniel juga menyebutkan, awal mula mereka mengetahuikasusinikarenamerekamenemukan kejanggalandiDinasPendidikanKotaSiantarterkait gajiPNSdisanasejakMeilalu.KemudianBKDdan Inspektorat turun ke Dinas Pendidikan sekitar dua atautigaminggulalu.“Hasilpenyelidikaninspektorat sudahada,13PNSinitidakdapatmenunjukkanSK CPNSmerekadanketikadipanggilkeinspektorat,13 PNSinitidakmaudatang,”ujarnyalagi. Disinggung tanda tangan Sekda Donvert Panggabean dalam surat keputusan yang mengatasnamakanWalikotaSiantartersebut,Daniel menyebutkan,Sekdatelahmembantahitumelalui media.MenurutpenjelasanSekda,tandatangandia dalamsuratituadalahpalsu.”Untukitujugalahkita datang ke kantor polisi. Masalah itulah yang perlu pemeriksaandilakukanpolisi,”jelasnya.(ral/pra)

02130002 02130026 02250002 02250007 02250027 02250031

Achmad Fauzi Lubis Pematangsiantar Rahim Doli Patuan Sakti Siregar Pematangsiantar Adrian Immanuel Damanik Simalungun Dhayot Fridolinta Simarmata Simalungun Ony Letare Dumasty Saragih Simalungun Putri Mawar Suci Siahaan Simalungun

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



4 September 2012

TERUS DITEROR & DINTIMIDASI, HERTATI BERNIAT TIDUR DI POLRES Sambungan Halaman 8 AkibatnyaSenin(3/9), kondisiinimemeroleh reaksi keras pengamat hukum yang khawatirkasusiniakanberujungmenjadi kerusuhan. IskandarDamanikSH,PakarHukumasal Siantar, saat ditemui METRO, Senin (3/9) mengatakan,kondisiyangtengahdialami korban Hertati boru Sidabutar ini sangat berpeluangakanterjadinyaaksiyanglebih besar lagi. ”Saya turut mengesalkan sikap Polsek Tiga Dolok yang belum berhasil mengungkapkasusini,”katanya. Bahkan,melihatkondisidiDusunSilimapuluhini,IskandarDamanikmemintaagar PolresSimalungunmengambilalihkasus tersebut. Kemudian melakukan penyelidikanlangsungdiDusuntersebut,bahkan laporan yang selama ini sudah masuk ke

PolsekTigaDolokharusnyasegeraditindak lanjuti. Lalu petugas dapat melihat siapa yang menjadi aktor dan dalang dari kerusuhanwargaini.”Darilaporan–laporan korban harusnya Polsek Tiga Dolok bisa menyelidiki siapa dalang dibalik aksi ini, sebabsaatkejadiansaksidilokasitidakada. Sementarabuktikerusakanrumahsudah jelas. Sementara korban menyebutkan, pelakunyamerupakanseluruhnyawarga sekitar baik sebagai eksekutor maupun hanyamendukungsaja,”katanya. Iamengatakan,tidakadanyasaksidalam suatu perkara yang terjadi di lokasi itu merupakanhalbiasaterjadi.Menurutnya, Polsek Tiga Dolok sendiri dapat mencari tahuasalkejadianlalumencaritahusiapa provokotornya di Dusun tersebut. ”Kalau polisi bersiasat kasus ini sulit terungkap karena tak ada saksi, menurut saya posisi

saksidiPengadilanhanyasebagaipelangkap.Namunjikaditemukanbuktiyangjelas atasperusakanitumakapolisiharusmencaritahudulusiapadalangnya.Kemudian diinterogasi apakah ada tujuan tertentu dibaliksemuaini,”katanya. Korban Akan Tidur di Mapolres Simalungun. Keluarga korban Hertati boru Sidabutar berniatakanmelakukanaksitidurdipelataranMapolresSimalungun,JalanSiantar-Raya. Pasalnyakorbandankeluarganyainimerasa sudahtidakamanlagitinggaldikediamannya di Dusun Silimapuluh, Nagori Dolok, KecamatanDolokPanribuan,Simalungun. Sementarapelakupenganiayaanterhadapdirinyaselamainidianggapnyaseperti kebal hukum, karena masih tetap bebas berkeliaranhinggaiadankeluarganyaakan tidur di pelataran Mapolres Simalungun

agarlebihaman. EDamanik(60),abangiparkorbanyang ditemuiMETRO,diTigaDolokinimenyebutkan,selamainiiaadikiparnyainikerap mendapatkanterordariwargasekitaryang tidakterimadengankeberadaankorbandi kampung tersebut. Menurutnya, aksi ini merupakan aksi terorganisir dan dikendalikanolehsatuorangyangdiklaimingin menguasai ladang milik Jusen Damanik (52),suamikorbanyangmasihmenjalani persidangan di Pengadilan Negri Simalungun atas kasus penganiayaan tetangganya saat akan membela istrinya. ”Kami sekeluargasudahlelahmengusutkasusini danmencarikeadilan,sementaraadikipar kami sudah terancam keselamatannyadi Dusun Silimapuluh. Itu makanya supaya aman, dalam waktu dekat ini, kami akan tidur di pelataran Mapolres Simalungun

supaya Kapolres Simalungun tahu apa keluhankamiini,”katanya. Dijelakannya, kejadian penganiayaan tersebutpertamakaliterjadiMinggu(19/12) sekira pukul 10.00 WIB suami Hertetani boru Sudabutar, yaitu Jusen Damanik (52),warga Dusun Silimapuluh, Nagori Dolok, Kecamatan Dolok Panribuan, SimalungundianiayaRopianSilalahi(30), KaimanSamosir(29),danEsronSimarmata (27),tetangganyatanpasebabyangjelas. Berselang beberapa bulan kemudian, kejadian yang sama terjadi lagi, kali ini menimpa istrinya Hertati boru Sidabutar (35),yangdipukuliRoidinSitumorang(35), tetangganya pada Selasa (1/11), 2011 di kediaman Mutiara boru Pardede yang beradatakjauhdarikediamannya.Penganiayaanitumengakibatkankorbanmengalamilukaberat.Namunsetelahdilaporkan

danditerimaolehBripkaSLubisKaSPKB Polsek Tiga Dolok ini, pelakunya belum jugadiringkusbahkanpenyelidikanterkesanlamban. Marasa kebal Hukum, warga sekitar DahlanSimanjuntak(50),kembalimenganiaya korban di samping kediaman korban pada Jumat (8/6), sekira Pukul 22.00 WIB. Penyebabnya pelaku tidak terima ditegur korban yang memintanya untuk mengurangi suaranya saat bernyanyi di sampingrumahnya,hinggakorbanmerasa terganggu. Namun karena kesal selanjutnya tersangka langsung memukul korbanhinggalukaberat. KapolsekTigaDolokAKPWilsonHarianja, saatdihubungiMETRO,Senin(3/9)belum berhasil dikonfirmasi meskipun terdengar nada panggilan masuk namun pihaknya engganmengangkatnya.(mag-02)

Nginap di Mapolsek.. Truk Rombongan Brimob Poldasu Masuk Jurang Lelaki Berkain Sarung.. Sambungan Halaman 8 Bukanhanyaitu,Bungajugaseringmemandangke atap dan dan berceloteh dengan logat Aceh. Polsek Medan Sunggal sendiri kerepotan dengan tigkah si Bunga,apalagiBungatidakmaumakandanminum hanyaterdiamdantertawasendiri. Dan kejadian yang paling menghebohkan ketika Bunga berlari ke jalan depan Polsek Medan Sunggal danmencobabunuhdiridenganberdiriditengahjalan dan hampir di tabrak tronton. “Bingung kita untuk menanganinya,tadihampirmatidiaditabraktruk,”ujar KasihumasPolsekMedanSunggal. SetelahditenangkanakhirnyaBungamaudibujuk. Kejadian ini membuat macet ruas jalan dan heboh warga yang berdatangan untuk menyaksikan pertunjukanpercobaanbunuhdiri.“NgerijugaPolsek Sunggal ya melihara orang gila,” ujar warga yang menyaksikan. RencananyaBungaakandikirimkeDinasSosialoleh PolsekSunggaldanPolsekSunggalakanmenyelidiki asal usul cewek depresi tersebut. “Kita cari dululah keluarganyadannantikitakirimkedinassocial,”ujar KasiHumasPolsekSunggal.(mri/pmg)

Suami Tendang.. Sambungan Halaman 8 mendengarkan eksepsi terdakwa yang dibacakan pada sidang sebelumnya. Maka majelis hakim yang menyidangkan perkara ini memutuskan menolak eksepsi terdakwa. Sebab isi eksepsi tersebut sudah masukdalampokokperkara,”terangnya. Sambungnya,makapersidanganakandilanjutkan dandimintakankepadaJaksaViktorSitumoranguntuk menghadirkansaksi-saksidipersidangan.Selanjutnya sidangakandilanjutkanpadaKamis(7/9). Sebelumnya Jaksa Penuntut Umum (JPU) Viktor Situmorang menyebutkan, korban melaporkan suaminyaAgusSupriadikarenamelakukanKekerasan Dalam Rumah Tangga (KDRT). Peristiwa itu berlangsungpadaSenin(12/12)sekirapukul17.30WIB. Diamenerangkan,saatHelenmemintahutangkepada Sarlina,terjadilahpertengkaranmulutkarenakorban tidak mau membayar hutangnya. Mendengar keribuatanitu,terdakwapunmengambiljalantengah agar hutang istrinya dibagi dua pembayarannya. “Hutangtersebutsebagianakandibayarolehterdakwa dan sebagian lagi akan dibayar oleh orangtuanya. Selanjutnyatidakbeberapalamaterjadicekcokmulut antara orangtua terdakwa dengan korban tentang masalahhutang,”ungkapViktor. Karena merasa kesal, saat itu orangtua terdakwa mengatakan kepada korban ‘menantu kurang ajar’. Mendengaritukorbanpunmenjawab‘terserahkaumau jadiapakalianterserah’.Mendengarpernyataanistrinya tersebut terdakwa pun emosi. Saat itu terdakwa mendorongkorbandanmenunjangpahakanankorban sebanyaksatukalihinggaterjatuhketanah.(mua)

Sambungan Halaman 8 Kapolres Taput AKBP Wijadmika SIK kepada wartawanusiamembesukkorbandiRSUSwadana Tarutung membenarkan peristiwa itu. Ia mengatakan,berdasarkaninformasiyangmereka peroleh, peristiwa ini terjadi diduga karena rem blong. “Didugaremblongkarenakecepatanbushanya mencapai40KMperjam.Mungkinakibatremblong supir banting setir sehingga akhirnya terbalik ke jurang.Inimurnilakatunggal,”terangKapolres. Sebelumnya,kataKapolres,rombonganBrimob ini berangkat dari Deta Semen B Tebing Tinggi

tujuan BatangToru,TapanuliSelatan(Tapsel)dalam rangkabantuanpengamanandisana. “Brimob Poldasu deta semen B Tebing Tinggi yang berangkat ke Batang Toru, Tapanuli Selatan dalamrangkapengamanandisana,”ucapnya. LebihlanjutKapolresmengatakan, korbanluka berat atas nama M Sitorus saat ini sudah dilarikan langsungkeMedanuntuk dirujukkeRumahSakit Elisabet. Sedangkan ketujuh lainnya, dirawat intensifdiRSUTarutung. “Sedangkan personel yang selamat terus melanjutkanperjalanankeBatangToru,”ucapnya. PantauanwartawandiRSUTarutung,sejumlah korban hingga kini masih dirawat intensif oleh

petugas medis rumah sakit. Sedangkan Kapolres, hinggaberitainiditurunkan,masihtetapmemantau dirumahsakittersebut. Berdasarkan data yang dihimpun wartawan, kedelapankorbanlukamasing-masing,AswarAnas Tanjung (supir), Marihot Sitorus, Dedi Asmono, AhmadFahri,JayaSitanggang,RickydanYokia. Berdasarkaninformasidariwargasekitar,trukitu terbalik karena supir tidak bisa mengendalikan kemudisaatmaumenikungditikungantajamkilometer 12 Desa Parsikkaman, Adian Koting, Tarutung. Sedangkan kondisi truk ringsek setelah jatuh berguling-guling ke jurang sedalam empat meter.(cr-01/des)

tetapi setelah korban datang ke Perdagangan terdakwa tidak berada di tempat yang dimaksud. “Kemudian korban pun menghubungi terdakwa dan saat itu terdakwa mengatakan agar pembayaran dilakukan di rumahnya di Huta IV Mandaroh Nagori Panambean Baru, Kecamatan Bandar Masilam. Akan tetapi karena korban masihpunyapekerjaanlainnya,Susilomenyuruh adiknya Yono untuk mengambil uang hasil penjualan sawit sebanyak Rp11,620 juta,” ungkapnya. Sambung Sanggam, setelah adik korban datang ke rumah terdakwa justru terdakwa memberikan satu unit mobil Kijang Innova sebagai boroh penjualan sawit itu. Karena merasa curiga korban pun mendatangi keluarga terdakwa dan menanyakan siapa pemilik mobil tersebut. Kemudian keluarganya itu mengaku

bahwa mobil itu dirental oleh terdakwa. “Korban pun langsung mendatangi terdakwa dan mengembalikan kunci mobil tersebut. Selanjutnya korban meminta uang hasil penjualan sawit miliknya. Akan tetapi terdakwa hanya memberikan panjar atas penjualan sawit miliknya sebesar Rp3 juta. Korban pun tidak menerima karena merasa ditipu oleh terdakwa,” jelasnya. Untuk hal memberatkan perbuatan terdakwa meresahkan masyarakat khususnya saksi korban. Sementara hal meringankan terdakwa bersikap sopan di persidangan, berterus terang, mengku salah dan berjanji tidak mengulanginya kembali. Untuk itu jaksa memutuskan menuntut terdakwa 1,6 tahun penjara dikurangi selama masa tahanan.(mua)

saya dilokasi, saya lihat istri saya sudah pingsan. Saya sempat cari keliling-keliling Pasar Horas hingga pukul delapan malam, tapi tetap tidak ada juga dapat kreta itu,” ujar warga Jalan Meranti, Siantar Utara ini. Disebutkannya, mulai Sabtu hingga Senin, dia telah berusaha mencari lokasi kreta itu diberbagai lokasi di Kota Siantar. Namun usahanya ini belum berhasil, sehingga keluarganya memutuskan melaporkan masalah ini ke Polres Siantar. “Kata istriku, kreta itu memang tidak dikunci stangnya, makanya mudah dibawa lari. Memang salah istriku jugalah ini. Didalam jok kreta itu ada STNK dan surat-surat kredit kreta itu. Baru enam bulanlah kami pakai kreta itu,” ujarnya lagi. Sabtu Pagi, Yamaha Mio Hilang Sebelumnya, pada pagi hari sekitar pukul 08.30 WIB, satu unit Yamaha Mio hitam BK 6658 WZ milik Husni hilang dari Jalan Cipto

Gg Suzuki. Padahal selama ini korban selalu memarkirkan kretanya dilokasi itu selama bertahun-tahun. “Memang naas saya ini, saya hanya minum sebentar di kedai kopi Koktung Massa, paling lama setengah jam. Saya datang kesitu jam delapan pagi, saya pulang setengah sembilan. Saya pun heran, stang kreta itu saya kunci juga. Selama ini saya selalu parkir kreta disitu,” jelasnya. Dikatakan warga Jalan Mojopahit Siantar Utara ini, usai kejadian, dia berusaha mencari kreta itu di sekitaran Jalan Cipto, namun tidak berhasil. Disebabkan ada urusan mendesak di Medan, dia baru sempat melaporkan peristiwa ini ke Polres pada Senin. Kasubag Humas Polres Siantar AKP Altur Pasaribu membenarkan laporan pengaduan kedua korban. Saat ini, pihaknya sedang melakukan penyelidikan identitas pelaku yang mengambil kreta di dua lokasi di seputaran Pasar Horas Sabtu lalu.(ral)

Sucipto Dituntut 1,6 Tahun Penjara

Sambungan Halaman 8 menghubungi saksi korban Susilo dan menawarkan agar terdakwa menjualkan sawit milik korban yang baru dipanen. Kemudian terdakwa menawarkan harga sawit yang akan dijual Rp1.400 per kg,” sebutnya. Dia menerangkan, terdakwa juga berjanji akan membayarkan langsung uang penjualan itu usai di timbang di PKS Kerasaan. Mendengar itu korban pun tertarik dan akhirnya anggota terdakwa datang kerumah korban dan mengangkat sawit milik korban berjumlah 8,3 ton. Selanjutnya, setelah sawit dibawa, korban pun langsung menanyakan soal pembayaran kepada terdakwa. Kemudian terdakwa menyuruh korban untuk bertemu di Perdagangan. Akan

Sehari, 2 Kreta Matic Hilang di Pasar Horas

Sambungan Halaman 8 tempat biasa di Gedung I Lantai Dasar Pasar Horas. Namun bukan dilokasi parkir biasa dipinggir Jalan Sutomo. Lokasi parkiran kreta ini agak kedalam dan hanya berjarak sekitar 50 meter dari toko milik mereka. Namun diakuinya, lokasi parkir kreta ini tidak bisa dilihat langsung karena terhalang terpal dan agak sedikit berbelok dari tempat usahanya. Sekitar pukul 16.00 WIB, salah satu anggota keluarganya melintas dari lokasi parkir itu, kreta tersebut masih ada. Namun sekira pukul 18.00 WIB, sewaktu hendak pulang ke rumah, kreta tersebut sudah tidak ada lagi. Istrinya pun sangat terkejut dan sempat pingsan karena kreta miliknya hilang. Selama ini kreta itu selalu digunakan setiap hari ke tempat usaha di Pasar Horas. “Setelah kreta itu tidak ada, istri saya langsung menelpon saya. Setibanya

Sambungan Halaman 8 polisi.Dan,langsungmelakukanolahtempatkejadian perkara (TKP). Polisi memeriksa tubuh korban yang sudah kaku dan diduga telah meninggal di bawah 6 jam.Kemudianpolisimembawatubuhpriatersebut keruangmayatRSUDPspuntukmemastikanapakah padatubuhkorbanditemukantanda-tandakekerasan. “Daritubuhkorbantidakditemukanidentitasapapun, hanyabuntalankainberisipakaiandannasikotakdidalam plastikhitam.Priainimemilikitinggi1,61meterdanusia diperkirakan40tahunan,”terangAKPIndra. AKPIndramenambahkan,pihaknyamendugapria tersebut tuna wisma. Diduga, ia meninggal karena kelaparan dan kedinginan. “Tidak ada ditemukan tanda-tanda penganiayaan di tubuh pria ini. Diduga meninggal karena kelaparan dan kedinginan. Kita masihmencaritahuidentitaspriaini,”ucapnya. Sementaraitu,menurutwargasekitar,priainidatang ke lokasi sekitar dua minggu lalu dan mengaku dari Maga,KabupatenMandailingNatal(Madina).“Sekitar duamingguyanglalu,diangakunyadariMaga,Madina. Dansudahduamingguinitidurdipinggirjembatanitu. Melihat kondisinya kami menduga sakit disentri, karenawaktudatangduaminggulalu,sudahsakitdan tidak bisa berjalan. Kami juga pernah memberinya makan,”ujarwargasekitar.(phn/bram)

Mayat Pria Kepala.. Sambungan Halaman 8

dibawakeRumahSakitUmumDaerah(RSUD)Porsea. MenurutdrFreddySibaraniyangbertugasdiRSUD Porsea,dilihatdarikondisinya,mayatinisudahdibuang sekitarsebulan.“Sepertinyamayatinisudahdibuang sekitar sebulan lalu,” kata dr Freddi Sibarani saat memeriksamayatMrXdiruangmayatRSUDPorsea. KapolresTobaSamosirAKBPBudiSuhermanyang ditemuiMETROdisekitarruangmayatRSUDPorsea mengatakan, MrXdipastikankorbanpembunuhan. Pasalnya,seluruhbagianwajahkorbandilakban. Kapolresmengatakan,mayattersebutdiyakinibukan wargaTobasamelainkankirimandariluarTobasa. Adapunciri-ciriMrXtersebutsebagaiberikut,tinggi badanlebihkurang150centimeter,kepalabagiandepan botakdanrambutikal. MrXketikaditemukanmengenakanpakaiantigalapis yaknidibagianluarjaketwarnabirubermerekDenimologi, kemejaliriskotakwarnabirudongker,memakaikaosdalam, dancelanadalamwarnabiru,ikatpinggangmerekAX,sandalmerekcarvil,topiwarnabiru,gigidepanduaompong namuntidakdapatdipastikanapakahkeduagigitersebut sudahdemikiankeadaannyasebelumdibunuh. Pada kesempatan itu, ia mengimbau kepada masyarakatjikaadakehilangankeluargadenganciri-ciri diatasagarmelihatmayattersebutkeRSUDPorsea. “Bagiwargayangmerasakehilanganseperticiri-ciri yang saya sebutkan tadi, silahkan mendatangi RSUD Porsea,”imbaunya.(bram/des)

Sambungan Halaman Satu LAJANG 67 TAHUN TEWAS USAI PANEN PETAI Sambungan Halaman 1 usai memanen buah petai yang tumbuh di antara ladang coklat miliknya. Amatan METRO di lokasi kejadian, terdapat tangga terbuat dari bambu yang menyandar di pohon petai, di sana juga terdapat petai yang sudah dipanen korban, tak jauh dari jasad korban. Kepada METRO, tetangga korban, Sarin Sembiring (58) menceritakan, pagi itu sekira pukul 07.00 WIB korban baru selesai mengasah gergaji milik Jhon, temannya, yang dipinjam. Diketahui korban juga seorang pembuat perabotan rumah tangga selain mengurus lading miliknya. “Saat dia memberikan gergaji tersebut, saya juga memberikan tas kepada Jhon untuk tempat gergaji yang selesai diasahnya. Kami pun sempar bercanda,” ujar Jhon. Sarin juga mengatakan, pagi itu dia melihat kondisi Selamat masih sehat-sehat saja dan tidak tanda-tanda sakit. Selanjutnya sekira pukul 11.00 WIB, Bunga dan Jani, yang masih duduk di bangku TK berniat bermain di belakang rumah korban sembari mencari buah belimbing. Sampai di lokasi kejadian, Bunga sontak terkejut ketika melihat Selamat Siahaan tergeletak di antara ladang coklatnya itu. Mengetahui hal tersebut, Bunga dan Jani berlari pulang guna memberitahu kejadian itu kepada ibunya, TE br Saragih. Ibunya pun langsung mengecek ke lokasi yang dimaksud, dan melihat dari kejauhan ada seorang lelaki tergeletak di bawah pohon coklat. Lalu TE br Saragih memberitahu kepada Sarin Sembiring dan bersama RT 01 Kelurahan Pondok Sayur, Urip Muliadiana. “Saya kurang berani melihat mayat, jadi setelah kulihat dari jauh ada orang yang tergeletak di bawah pohon cokelat itu, saya langsung memberitahunya kepada Pak Sembiring, tetangga dekat korban dan pak RT,” kata TE br Saragih kepada METRO. Ketika Sarin dan Urip menuju lokasi kejadian, bersamaa itu pula warga yang mengetahui

informasi turut menyemut menyaksikan korban. Setelah memastikan korban sudah tidak bernyawa, Urip segera menuju kantor Polsek Martoba. Tak berapa lama, personel Polsek Siantar Martoba Bripka Nirwan MS bersama rekannya tiba di TKP. Sampai di sana, Nirwan menawarkan kepada keponakan korban, Kiki Siahaan untuk melakukan otopsi. Namun karena pihak keluarga menduga kamatian korban karena serangan jantung, mereka tidak bersedia untuk dilakukan otopsi menunggu keluarga yang dari jauh tiba, di rumah duka. Karena belum mendapat kepastian soal otopsi, Nirwan meminta warga sekitar menggotong jasad korban ke rumah duka untuk disemayamkan sambil menunggu pihak keluarga lainnya datang. Sementara RT 01 Keluruhan Pondok Sayur Urip Muliadiana mengatakan, korban tinggal sendiri di rumah itu dan belum pernah menikah. Diketahuikorbanmasaksendirisetiapharinyadan bekerja mengurus ladang yang ada di belakang rumahnya itu. “Selamat Siahaan warga saya. Setahu saya dia masih lajang. Ketepan korban juga tetangga dengan saya. Jadi ketika mengetahui kejadian tersebut saya langsung melaporkan kepada polisi,” kata Urip. Sementara Kiki Siahaan, anak dari kakak kandung korban mengatakan, sebelumnya korban memang sudah mengalami beberapa penyakit, seperti sakit lever dan serangan jantung. Jadi atas kejadian ini korban tidak perlu diotopsi. Sering Berobat Sendiri TE br Saragih, yang juga bertetangga dengan korban mengaku sering melihat korban naik becak sendiri untuk berobat. Hal yang sama juga disampaikan teman korban lainnya. Beberapa bulan ini Selamat Siahaan diketahui sering mengonsumsi obat penyakit darah tinggi. “Bererapa bulan ini saya sering melihat Selamat naik becak sendiri. Saat kutanya darimana, dia mengatakan baru beli obat,” kata TE br Saragih. (mag-4)

Saat Masyarakat Menebang, Polisi Datang Sambungan Halaman 1 turun langsung dan menyaksikan perambahan hutan tersebut. Tetapi sampai sekarang laporannya tidak ditindaklanjuti. Karena laporan tersebut tidak ditanggapi, masyarakatsekitarpunikut-ikutanmelakukanperambahan. Ketika masyarakat mulai ikut melakukan perambahan, Sabeda datang membawa polisi untuk melarang masyarakat ikut menebangi. Christian Damanik, salah seorang warga mengatakan sangat kesal dengan tindakan kepolisian Polres Simalungun yang tidak adil dan jujurmenerapkansupremasihukum.Dimanaketika Sabeda melakukan perambahan di Sipolha, polisi diamsaja.Sementaramasyarakatyangmempunyai surat alas tanah ketika melakukan penebangan langsung diberikan tindakan tegas. “Pak Kapolres terhormat,kamimerasatidakmendapatkeadilandi Simalungunini.SaatSabedamelakukanpenebangan di sana, polisi membiarkannya. Sementara ketika

yang melakukan penebangan keturunan Tuan SipolhaDamanik,TuanHubuanDamanik,danTuan BosarDamanikselakupemiliklahan,polisilangsung menindaknya. Padahal kayunya belum sempat dinikmatimasyarakatsekitar,”ujarnyasaatditemui usairapatmediasidiMapolresSimalungun. Menurut Christian, Sabeda tidak pernah mempunyai tanah di sana. Ia pun heran ketika ada orang yang bukan keturunan Tuan Sipolha Damanik,TuanHubuanDamanik,danTuanBosar Damanik mengklaim sebagai pemilik tanah di Sipolha. “Dari dulu tanah seluas 25 ha itu sudah dikelola masyarakat keturunan ketiga raja itu. Dan tahun ke tahun, kami yang selalu membayar pajak atas lahan tersebut. Tetapi kenapa sekarang ini lahan yang sudah puluhan tahun kami kelola diunjuk sebagai kawasan hutan,” kesalnya. KasatReskrimPolresSimalungunAKPAdenanSIK mengatakan bahwa kawasan yang diperebutkan kedua kubu masyarakat tersebut adalah termasuk kawasanhutan.Halitulangsungdiungkapkanpihak

DinasKehutananProvinsiberdasarkanhasilcrossingmerekakelokasi.“Dinaskehutananyangpunya domain mengatakan, lokasi yang diperkarakan masyarakat itu masuk kawasan hutan. Itu artinya sudahdiberlakukanundang-undang41tahun1999 tentang hutan. Kedua belah pihak tidak bisa mengelolahutantersebut.Disanasudahdipasang garis polisi. Sementara pelaku penebangan sebelumnyasegeraditindakdandikenakanundangundang41tahun1999,”tegasnya. Perwakilan Dinas Kehutanan Provinsi Sumut yang dimintai keterangan di Polres Simalungun engganmemberikankomentarkepadawartawan. Dalam rapat mediasi sebelumnya, pria yang memakai papan nama bermarga Parhusip itu mengatakan tegas bahwa lokasi 25 ha di Sipolha itu adalah kawasan hutan. Bagi siapa yang melakukan penebangan di sana dijerat undang-undang 41 tahun 1999. “Nantilah kalau mau tanya-tanya.Sayamasihmaudiperiksa,”katanyausairapat mediasi dan enggan menyebut namanya. (osi)

Disdik Peras Guru Untuk Diklat Sertifikasi Sambungan Halaman 1 guru yang akan mengambil sertifikat di minta untuk membayar Rp150 ribu. Informasi dihimpun METRO saat sejumlah guru-guru datang ke Kantor Dinas Pendidikan Kota Siantar di Jalan Merdeka, Senin (3/9), sejumlahgurutersebutterlihatlangsungmasukke dalam suatu ruangan dan kemudian menyerahkan uang sebesar Rp150 ribu. Sebab sebelumnya guru-guru tersebut terlebih dahulu mendapat SMS yang mengaku dari disdik bahwa untuk pengurusan supaya sertifikatnya keluar maka dikenakan Rp150 ribu. Sedikitnya sekitar 20 guru-guru rela memberikan uang tersebut kepada salah seorang petugas bernama Juntar Sinaga. Sementara itu sejumlah guru yang lain menolak untuk menyerahkan uang karena tidak jelas tujuannya. S br Siregar, seorang guru SD saat ditemui di lingkungan Disdik mengaku bahwa pungutan

oleh petugas Disdik tersebut tidak jelas arahnya. Ia pun menceritakan saat ia hendak mengurus sertifikat ke salah satu ruangan. Saat masuk ke dalam ruangan, Juniar Sinaga pun langsung mengatakan bahwa untuk mengurus sertifikat tersebut dikutip biaya Rp150 ribu. Selanjutnya Br Siregar pun memenuhinya dengan cacatan Juniar membuat kwitansinya. Mendengar itu Juniar pun mengatakan bahwa tidakadapakaisuratketerangankarenaRp150ribu tersebut merupakan kutipan. Mendengar hal itu, BrSiregarpuntidakjadimemberikanuangtersebut danmengatakankepadaMETRObahwaapayang dilakukan petugas disdik tersebut merupakan pemerasan. Diterangkan, jumlah guru yang menang dalam diklat sertifikasi untuk memerolah tunjangan profesi lebih kurang 700 orang. Sebelumnya pada April lalu, pada saat pendaftaran, guru-guru tersebut juga dikutip biaya Rp500 ribu setiap orangdanDisdikmemberialasanbahwauangterse-

but digunakan untuk biaya sosialisasi dan diklat. Selanjutnya pegawai Disdik juga dituding meminta uang sebesar Rp2 juta supaya guru tersebut lulus dan mendapatkan sertifikasi. Menurutnya, sertifikat diklat tersebut untuk melengkapi pemberkasan yang akan dikirim ke pusat untuk mendapatkan tunjangan profesi. Sementara itu guru yang lain, Boru Saragih yang bertugas di SDN menerangkan tidak akan memberikan kutipan tersebut kalau memang pihak Dinas Pendidikan tidak berani membuat berita acaranya atau tujuan uang tersebut. Bila dihitung dari jumlah guru yang lulus diklat sebanyak 700 orang dikalikan Rp150 ribu maka pegawai Disdik akan meraup uang sebanyak Rp1.050.000.000. Sementara itu Serkretaris Disdik Drs Mansur Sinaga membantah telah melakukan pungutan liar. “Tidak ada itu. Kalau ada oknum-oknum yang melakukan kutipan itu saya kurang tahu,” ujarnya sembari berlalu. (pra)



Sehari, 2 Kreta Matic Hilang di Pasar Horas (FOTO:DEV BAKKARA)

BUAT LAPORAN- Harianto Sinaga (50) saat membuat laporan di Mapolres, Senin (3/9).

SIANTAR- Dua kreta matic hilang dari seputaran Pasar Horas, Sabtu (1/9). Satu unit Yamaha Mio hitam BK 6658 WZ hilang dari Jalan Cipto Gg Suzuki milik Husni (46) pukul 08.30 WIB. Sementara satu unit Honda Vario BK 5763 TAM milik Mariana br Silalahi (45) hilang dari Gedung I Lantai Dasar Pasar Horas pada pukul 17.00 WIB.


SUCIPTO DITUNTUT 1,6 TAHUN PENJARA SIMALUNGUN– Sucipto alias Cipto (28) warga Huta IV Nagori Panambean Baru, Kecamatan Bandar Masilam dituntut 1,6 tahun penjara. Terdakwa terbukti secara sah dan meyakinkan melakukan tindak pidana penipuan dan penggelapan uang hasil penjualan sawit sebanyak 8,3 ton sebesar Rp11,620 juta. Hal itu disampaikan Jaksa Penuntut Umum, Sanggam Siagian di hadapan majelis hakim Ramses Pasaribu beranggotakan Monalisa dan Gabe Doris di PN Simalungun, Senin (3/9). Menurutnya, berdasarkan keterangan saksi dan terdakwa di persidangan terungkap perbuatan terdakwa melanggar pasal 372 KUHPidana. “Peristiwa itu berlangsung Senin (12/12) sekira pukul 12.30 WIB di Huta V Nagori Pematang Kerasaan. Saat itu terdakwa „) Baca Sucipto ..Hal 7

Lelaki Berkain Sarung Tewas Kelaparan

Menurut suami Mariana br Silalahi, Harianto Sinaga (50) ditemui di Pasar Horas, Senin (3/ 9), pada Sabtu pagi pukul 08.00 WIB, seperti biasa istrinya berangkat kerja untuk berjualan kain di Lantai Dasar Pasar Horas. Kreta inipun lalu diparkirkan di

„) Baca Sehari..Hal 7

(Foto Parlindungan Pohan)

„ Mayat pria berkain sarung diperiksa petugas kesehatan di ruang jenazah RSUD Psp, Senin (3/9).

TIGA DOLOK– Polres Simalungun didesak melakukan penyelidikan terhadap kasus yang menimpa Hertati boru Sidabutar (35) di Dusun Silimapuluh, Nagori Dolok, Kecamatan Dolok Panribuan, Simalungun yang dianiaya di kediamannya. Pasalnya korban yang berulangkali dianiaya warga kerap diintimidasi dan diteror. „) Baca Terus Diteror ..Hal 7


„ Cewek stres di Polsek Sunggal

MEDAN- Sungguh kasian nasib perempuan yang depresi satu ini, bagaimana tidak sudah dua hari cewek depresi ini menginap di Polsek Medan Sunggal, sejak Sabtu (1/9) dan merepotkan jajaran Polsek Sunggal. Sebut saja namanya Bunga (19), cewek berparas manis ini jika disaksikan sekilas tidak tampak jika dirinya depresi atau stress. Namun jika terus-terusan diperhatikan maka akan tau jika cewek ini stres karena sering tertawa dengan sendirinya dan menangis serta menyebutnyebut lelaki dan sering berteriak tak menentu. Dugaan sementara, cewek strees berkulit bersih ini diperkosa. Hal ini terbukti dari ocehan si cewek strees ini. “Jangan sentuh aku, jangan buka celanaku, sakit anuku,” ujar Bunga.

„) Baca Nginap di Mapolsek ..Hal 7

„) Baca Lelaki Hal 7

Terus Diteror & Dintimidasi Hertati Berniat Tidur di Polres

FOTO Bernad L Gaol

Nginap di Mapolsek Coba Bunuh Diri

mas AKP Indra F Dalimunte, mayat ini ditemukan warga sekira pukul 18.00 WIB dengan posisi telentang atau seperti tertidur dengan penyangganya badan jembatan. Selanjutnya, warga melaporkan penemuan tersebut kepada


„ Truk rombongan Brimob Poldasu yang terguling setelah dievakuasi. Kapolres Taput AKBP Wijadmika SIK membesuk korban di RSU Tarutung (insert).


SIDIMPUAN- Pria tanpa identitas dan hanya mengenakan kain sarung ditemukan meninggal di trotoar pinggiran jembatan Siborang, perbatasan Kelurahan Kantin dan Wek V, Kecamatan Padangsidimpuan (Psp) Selatan, Senin (3/9). Menurut Kapolres Psp AKBP Andi S Taufik melalui Kabag Hu-

TARUTUNG- Truk petugas yang membawa rombongan 22 personel Brimob Poldasu deta semen B Tebing Tingg No Polisi 15201 II Aans Tanjung, terbalik dan masuk ke jurang sedalam 4

meter di kawasan tikungan manis KM 12, Desa Parsingkaman, Kecamatan Adian Koting atau 45 kilometer dari Tarutung, Taput, Senin (3/9) sore. Peristiwa ini mengakibatkan

satu orang personel mengalami luka berat, tujuh luka ringan, sedangkan sisanya hanya mengalami lika gores.

„) Baca Truk ..Hal 7


HAKIM TOLAK EKSEPSI TERDAKWA SIMALUNGUN– Hakim Pengadilan Negeri (PN) Simalungun memutuskan men olak eksepsi terdakwa Agus Supriadi (31) yang mendorong kepala dan menendang paha istrinya Sarlina Saragih yang tengah hamil 16 minggu. Menurut hakim, eksepsi warga Kampung Baru, Kelurahan Ke-

rasaan I, Kecamatan Pematang Bandar tersebut sudah masuk ke dalam poko k materi perkara. Hal itu disampaikan majelis hakim yang diel Ginting berSamu in pimp anggotakan Adria dan Heriyanti yang digelar di PN Simalungun, Senin (3/9). “Setelah

„) Baca Suami ..Hal 7

Mayat Pria Kepala Botak Membusuk di Jembatan KAKI DIIKAT, WAJAH DILAKBAN Foto:Bram Situmorang

MAYAT: MR X yang ditemukan di kolong jembatan Sosopan Pintu Pohan Meranti.

PORSEA- Seorang pria tanpa identitas ditemukan membusuk di bawah jembatan di Desa Sosopan Pintu Pohan Meranti, Tobasa, Senin (3/9) sekira pukul 15.30 Wib. Dugaan sementara, korban dibunuh. Sebab, kedua kakinya diikat

dan mulut dilakban. Informasi yang diperoleh METRO, penemuan itu berawal dari kecurigaan warga yang mencium aroma bau busuk sejak tanggal 31 Agustus lalu. Setelah ditelusuri beberapa hari kemudian, sumber aroma bau busuk itu berasal dari sebuah karung plastik warna hitam yang berada di kolong jembatan.

Selanjutnya, warga langsung melaporkan ke Polsek Porsea. Ternyata benar, begitu polisi tiba di TKP langsung membuka karung dimaksud. Spontan warga geger begitu melihat isi karung tersebut sesosok manusia. Untuk penyelidikan lebih lanjut, mayat tersebut

„) Baca Mayat Pria ..Hal 7


4 September 2012 (FOTO: DHEV FRETES BAKKARA)

DIMUSNAHKAN 219 botol miras senilai Rp70 juta hasil operasi pekat selama Bulan Ramadan, dimusnahkan di halaman Mapolres Pematangsiantar, Senin (3/9).

Miras Senilai Rp70 Juta Dimusnahkan SIANTAR- 219 botol minuman keras berbagai merk yang diperkirakan bernilai Rp70 juta, dimusnahkan di halaman Polres Pematangsiantar, Senin (3/9) pukul 10.00 WIB. Mirasmiras ini merupakan hasil operasi pekat pada Bulan Ramadhan lalu, yang disita dari UD Makmur Jaya, di Jalan MH Sitorus, Siantar Barat. Beberapa merk ternama yang dimusnahkan, antara lain red label, balleys, gordons, martini, jose cuervo, black label, dan winner. Selain itu ada

martil, civas regal dan beberapa merk minuman keras lain dari dalam dan luar negeri. Pemusnahan disaksikan jaksa fungsional Hari Darmawan dan Kasipidum R Parulian Lumbantoruan yang mewakili Kejari Pematangsiantar. Sementara dari Polres Siantar, diwakili Kasat Narkoba AKP Sofyan dan puluhan personil polisi dari berbagai satuan. Turut juga hadir Ketua Front

Baca Miras ...Hal 10

Dugaan Mark-up Proyek Peningkatan Jalan FOTO:DHEV FRETES BAKKARA.

Petugas tampak memungut retribusi masuk ke gerbang menuju objek wisata Danau Toba.

Soal Retribusi Gerbang Masuk Parapat

Warga Minta Bupati Ganti Rekanan

PARAPAT- Sejumlah warga Kelurahan Parapat, Kecamatan Girsang Sipangan Bolon, Simalungun, meminta Bupati Simalungun JR Saragih mengganti rekanan yang mengelola retribusi gerbang masuk objek wisata Parapat. Warga meminta Pemkab Simalungun

memberi kesempatan kepada putra daerah menjadi pengelola. Ditemui METRO, Senin (3/ 9), sejumlah warga Parapat mengatakan, mereka akan menyurati Bupati Simalungun JR

Baca Warga ...Hal 10

LPPKP Ancam Mengadu ke Kejatisu SIMALUNGUN- Lembaga Pengkajian dan Peningkatan Kapasitas Pemerintah (LPPKP) akan melaporkan dugaan penyimpangan proyek peningkatan jalan umum SidamanikGorbus ke Kejatisu di Medan. Hal itu dikatakan Ketua LPPKP Sahrul SH yang ditemui di kediamannya, Senin (3/9). Menurutnya jika tidak ada halangan, pihaknya akan berangkat ke Kejatisu di Medan guna melaporkan dugaan mark up pada proyek ini. “Besok (hari ini, red) kami akan berangkat ke Kejatisu. Namun yang kami laporkan ini masih bersifat temu-

an awal. Selanjutnya kita beharap pihak Kejatisu yang melakukan pengembangan penyelidikan,” katanya. Ditambahkannya, pihaknya juga menduga kuat bahwa Kadis PU Simalungun Jon Sabiden Purba, menghunjuk langsung rekanan proyek ini tanpa proses tender. ”Sekarang waktu kerja mereka ber-

kisar tiga puluh hari lagi. Kalau diperhatikan dari identitas proyek ini saja, sudah tidak jelas. Makanya kita tidak perlu menunggu terlalu lama untuk melaporkan Kadis PU ke Kejatisu. Hal itu dimaksudkan agar pihak Kejatisu mudah mengusut dan memantau, karena proyek masih berlangsung,” ungkapnya. Pantauan METRO, proyek peningkatan jalan yang dikerjakan oleh CV Simta ini maish berlangsung. Setelah hampir 60 hari kerja berlangsung, para pekerja masih tampak membangun

Sebulan Tak Dapat Air, Retribusi Tetap Ditagih SIMALUNGUN- Sudah satu bulan lamanya 22 kepala keluarga yang tinggal di Nagori Sionggang Simanindo, Kecamatan Siantar, Simalungun, tidak mendapat pasokan air bersih. Meski begitu, pihak Nagori Silau Malaha tetap mengutip retribusi bulanan. Informasi dihimpun METRO, beberapa tahun lalu kampung mereka mendapat bantuan penampungan air untuk memenuhi kebutuhan warga. Namun saat proses pembuatan bak atau galon air, setiap KK dikutip sebesar Rp100 ribu.

Baca Sebulan Hal 10

saluran drainase. Sementara menurut warga sekitar Liston Simaremare (43) dan P Saragih (50), mereka belum melihat adanya aktifitas pada perbaikan jalan sesuai plang proyek yang tertera. Para pekerja hanya berkutan pada pembuatan saluran drainase sepanjang 500 meter. ”Sudah delapan minggu mereka mengerjakan proyek ini, tapi hanya drainase saja yang dikerjakan. Sementara perbaikan jalan tidak terlaksana

Baca LPKKP ...Hal 10

SUGIATI BAGI UANG DI DEPAN BUPATI MEDAN- Sidang lanjutan dugaan korupsi mantan Bendahara Umum Daerah Pemkab Simalungun Sugiati SE, kembali digelar di PN Tipikor Medan, Senin (3/9). Pada sidang lanjutan itu, Jaksa Penuntut Umum (JPU) dari Kejari Simalungun menghadirkan tiga saksi, masing-masing Y Silalahi selaku staff pemegang kas, Wol Simarmata dan Romauli Damanik, keduanya PNS di Dispenda pada tahun 2006. Fakta terungkap dipersidangan, FOTO : EKO HENDRIAWAN

Rosmaida br Saragih (memegang selang) memperlihatkan air bersih dari penampungan yang sudah satu bulan tidak mengalir, Senin (3/9).

Baca Sugiati ...Hal 10

KPU Buka Pendaftaran PPK Pemilu Bantuan Hukum

Parpol akan Diverifikasi

SIANTAR- Sesuai surat Komisi Pemilihan Umum (KPU) Nomor 270/925/KPU-PS/IX tahun 2012, KPU Kota Pematangsiantar akan melakukan penerimaan dan seleksi calon anggota panitia pemelihan kecamatan (PPK) dan Pilgubsu tahun 2013. Ketua Divisi Teknik KPU Kota Pematangsiantar Batara Manurung, Senin (3/9) di Kantor KPU Jalan Porsea Nomor 3 mengatakan, dalam rangka melaksanakan pasal

27 ayat (1) huruf d Peraturan KPU Nomor 63 tahun 2009 tentang Pedoman Penyusunan Tata Kerja KPU Provinsi, KPU Kab/Kota, PPK, PPS dalam pemilihan umum kepala daerah dan wakil kepala daerah, tugas dan wewenang KPU Kab/Kot dalam penyelenggaraan Pilkada adalah membentuk PPK, PPS dalam pilkada Provinsi serta Pilkada Kab/Kota dalam wilayah kerjanya. “Hal ini juga sesuai dengan keputusan KPU Provinsi Sumatera Batara Manurung

Baca KPU Buka ...Hal 10

Gratis untuk Rakyat Miskin

SIMALUNGUNMengingat banyaknya perkara pidana yang dilakukan sebagian orang, khususnya masyarakat yang kurang mampu di wilayah hukum Simalungun, Pengadilan Negeri Simalungun

Baca Bantuan Hal 10

Waktu Pendaftaran Ormas Diperpanjang SIANTAR- Untuk validasi database secara nasional, Kesbanglinmas Pemko Pematangsiantar memperpanjang waktu pendaftaran keberadaan Ormas dan LSM yang ada di Kota Siantar. Waktunya hingga 28 September mendatang. Hal itu diutarakan Kepala

Baca Waktu Hal 10


4 September 2012

LPPKP Ancam Mengadu ke Kejatisu Sambungan Halaman 9 sampai sekarang,” ujar kedua pria ini. Diungkapkannya, rekanan yang mengerjakan proyek itu diduga sengaja terlebih dulu mengerjakan drainase untuk mengalihkan perhatian warga. Itu dimaksudkan agar pihaknya bisa memark-up harga proyek. Pasalnya jumlah pagu anggaran yang tertera di plang proyek, sudah tidak sesuai dengan yang dikerjakan. Bahkan ongkos serta biaya materialnya diperkirakan sudah melebihi. ”Pertama, kami juga bingung. Pada plang

KPU Buka Pendaftaran PPK Pemilu Sambungan Halaman 9 Utara Nomor 01/KPTS/KPU-Prov-002/2012 tentang Tahapan Program dan Jadwal Penyelenggaraan Pemilihan Gubernur Sumatera Utara Tahun 2013,” kata Batara. Untuk hal tersebut, tambah Manurung, KPU Kota Pematangsiantar membuka pendaftaran calon anggota PPK se Kota Pematangsiantar, dengan persyaratan sebagai berikut; WNI, berusia paling rendah 25 tahun, berpendidikan paling rendah SLTA, berdomisili di wilayah kecamatan yang dibuktikan dengan KTP, serta mengajukan surat lamaran kepada Ketua KPU Kota Pematangsiantar. “Ketika mendaftar, pelamar harus membawa fotokopi KTP, fotokopi ijazah yang dilegalisir oleh pejabat yang berwenang, pasfoto, surat sehat jasmani dan rohani, serta surat keterangan tempat tinggal yang dikeluarkan oleh Kepala Kelurahan dan diketahui oleh Camat,” tambahnya. Pengambilan dan penerimaan pendaftaran tanggal 4, 5, 6 dan 7 September 2012. Namun, untuk keterangan lebih lanjut dapat dilihat di Kantor KPU Kota Pematangsiantar. Parpol akan Diverifikasi KPU Kota Pematangsiantar juga bakal melakukan verifikasi ulang seluruh partai politik (Parpol) yang akan mengikuti pemilu 2014. Verifikasi ada dua tahap yakni verifikasi administrasi dan verifikasi faktual. Verifikasi administrasi akan dilaksanakan mulai 10 September hingga 4 Oktober. Sedangkan verifikasi factual dilaksanakan 4 Oktober hingga 20 November. “Kami akan melakukan verifikasi ulang mulai bulan pertengahan September ini sesuai dengan keputusan MK,” kata Ketua Divisi Tekni KPU Kota Pematangsiantar Batara Manurung. Dijelaskan Batara, sesuai dengan Pasal 8 Ayat (1) UU Nomor 8/2012 tentang pemilu yang yang dibatalkan MK itu berbunyi, ”Partai politik peserta pemilu pada pemilu terakhir yang memenuhi ambang batas perolehan suara dari jumlah suara sah secara nasional ditetapkan sebagai partai politik peserta pemilu pada pemilu berikutnya.” Sedang Pasal 208 yang dibatalkan adalah pemberlakuan ambang batas 3,5 persen secara nasional dan menyatakan ambang batas 3,5 persen hanya berlaku untuk DPR. Dengan pembatalan MK itu, kata Batara, berarti seluruh parpol baik yang lama maupun baru, memiliki kursi di parlemen atau tidak, harus mengikuti verifikasi di KPU untuk jadi peserta Pemilu 2014. Walaupun agenda KPU Kota Pematangsiantar padat dengan masuknya tahapan Pilgubsu 2013, pihaknya siap melakukan verifikasi parpol calon peserta Pemilu 2014. Batara menambahkan, bulan September ini akan diadakan sosialisasi verifikasi parpol menjadi peserta Pemilu 2014 dengan mengundang semua parpol, baik yang lama maupun yang baru. Bentuk verifikasi faktual parpol tingkat kabupaten/kota, yaitu mengenai kepengurusan, keterwakilan perempuan, kantor parpol dan verifikasi keanggotaan parpol. (mer)

disebutkan proyek peningkatan jalan, tapi kok yang dibuat drainase. Kemudian menurut amatan kami, besar sekali anggaran untuk proyek ini. Kalau hanya pembuatan drainase, anggaran itu sudah terlalu besar,” katanya. Bahkan menurutnya, mereka juga mengancam akan melakukan demonstrasi ke kantor Dinas PU Simalungun.Hal itu jika perbaikan Jalan Umum SarimatondangGorbus ini tidak juga dikerjakan. ”Kami serius dan berharap soal perbaikan Jalan ini. Soalnya sudah sering sekali terjadi

kecelakaan. Banyak pengendara asal Sidamanik yang terjatuh saat melintasi jalan yang rusak. Kalau tidak juga dikerjakan, kami akan mendatangi kantor Dinas PU Pemkab Simalungun dan meminta penjelasan Kadis,” katanya. Sebelumnya, proyek pembangunan drainase di Jalan Besar Sarimatondang Kelurahan Sarimatondang, Sidamanik ini menelan anggaran senilai Rp790.790.000. Namun setelah diamati dan dikalkulasi, ada dugaan penyimpangan pada pengerjaannya.

Pada plang tertera bahwa proyek dimaksudkan untuk peningkatan jalan. Sementara di lokasi, pekerja terlihat membuat saluran drainase. Nah, jika dikalkulasi untuk material, upah pekerja sampai biaya tak terduga, jumlah Rp790.790.900 itu terlalu besar. Semestinya untuk membuat drainase sepanjang 500 meter, bisa diselesaikan dengan dana Rp300 juta. Hingga kini pengerjaan proyek itu sudah berlangsung delapan pekan, terhitung sejak Senin (9/7). (mag-02/hez)

Sugiati Bagi Uang di Depan Bupati Sambungan Halaman 9 bahwa Sugiati yang saat itu bertindak sebagai bendahara telah membagi-bagikan uang PBB Over Target senilai Rp753.446.727 yang belum disahkan DPRD Simalungun melalui rapat APBD 2005-2006. Uang itu dibagikan kepada beberapa pejabat Simalungun. Hal itu dikatakan Y Silalahi saat dimintai keterangan di persidangan. “Uang itu diberikan pemegang kas daerah di ruangan ibu Sugiati. Dan ada SK Bupati untuk pembagiannya pak. Pembagian upah pungut,” beber saksi di hadapan Ketua Majelis Hakim P Simarmata. Lanjutnya, beberapa pejabat yang menerima uang tersebut diantaranya Bupati, Wakil Bupati, Sekda,Asisten danbeberapa kepala dinas. Namun

dalam hal ini, saksi juga mengaku, bahwa dirinya sempat menerima uang tersebut. Hanya saja, setelah mengetahui uang itu dari PBB Over Target yang belum ditampung dan disahkan pada rapat APBD, saksi kemudian mengembalikannya. “Memang saya juga sempat menerimanya. Tapi begitu saya tahu itu belum ditampung dalam APBD, saya langsung mengembalikannya,” ujarnya sembari menyebutkan bahwa tiap-tiap pejabat Pemkab Simalungun menerima dengan nominal yang bervariasi. Penasaran, hakim mempertanyakan apakah uang kas bisa dikeluarkan, walaupun belum disahkan di dalam rapat pengesahan APBD. “Biasanya bisa pak. Dengan menggunakan istilah panjar,” jawab saksi. Dijelaskannya, prosedur penggunaan uang panjar itu biasanya diajukan melalui nota dinas.

“Itu ditandatangani kepala dinas yang bersangkutan, kemudian dilanjutkan kepada Bupati,” jelasnya. Usai mendengar keterangan saksi, majelis hakim melanjutkan persidangan untuk mendengarkan keterangan Wol Simarmata. Dalam keterangannya, Wol menyebutkan bahwa Bupati Simalungun saat itu, Zulkarnain Damanik (berkas terpisah,red), juga menerima uang tersebut. “Waktu itu Pak Bupati menerima Rp17,2 juta. Dan dia (Zulkarnain, red) setuju dengan pencairan itu,” sebut Wol di persidangan. “Ya pasti dia (Bupati-red) setujulah. Karena dia kan juga dapat,” kata majelis hakim. Karena keterangan masing-masing saksi hampir tak jauh beda, majelis hakim kemudian menunda persidangan hingga satu pekan kemudian dengan agenda keterangan saksi lainnya. (Gib/smg)

Sebulan Tak Dapat Air, Retribusi Tetap Ditagih Sambungan Halaman 9 Pengutipan juga terjadi jika terjadi kerusakan terhadap pompa air. Setiap KK akan dikutip oleh petugas nagori uang perbaikan sebesar Rp100 ribu. Parahnya, sebulan belakangan air tidak mengalir lagi. Sehingga warga yang tinggal di sana tidak mendapat pasokan air bersih. Untuk memenuhi kebutuhan, mereka beramairamai mengambil air dari masjid di Kampung Lombang, lokasinya di desa seberang, sekitar 3 kilometer dari tempat tinggal mereka. Tentu saja itu tidak untuk semua warga. Sebab, bagi yang tidak memiliki kendaraan

untuk mengangkut air, mereka memilih membeli air dari rumah tetangga di kampung seberang, jaraknya lebih dekat dari masjid. Namun anehnya, aparat nagori seolah tak peduli terhadap keadaan ini. Bahkan menurut beberapa warga, aparat nagori masih saja mengutip retribusi air Rp10 ribu per bulan, meski sudah sebulan mereka tak menikmati air. “Beginilah keadaannya, setiap kali ingin membeli air ke kampung seberang, saya tetap mengecek kran air. Siapa tahu tiba-tiba air mengalir. Soalnya sudah hampir satu bulan air di sini mati total,” kata warga R br Saragih (62). Ditambahkannya, banyak warga yang mengeluh dengan keadaan ini. Sebab mereka se-

lalu membayar apa yang dirasa menjadi kewajiban. “Setiap bulan kami bayar Rp10 ribu. Kalau pompanya rusak, kami bayar Rp100 ribu untuk perbaikan,” kesalnya. Hal Senada dikatakan Ita Sinaga (39) dan Dewi Situmorang (30), warga sekitar. “Kami tidak tahu ke mana uang kutipan itu dibuat. Sebab sebelum kejadian ini, pasokan air bersih untuk Nagori Sionggang Simanindo kerap mengalami kerusakan. Terkadanag air mati, alasannya karena pompa rusak. Jika ada kerusakan kami juga dikutip uang Rp100 ribu,” ungkap mereka beramai-ramai. (mag4/hez)

Bantuan Hukum Gratis untuk Rakyat Miskin Sambungan Halaman 9 menyediakan Pos Bantuan Hukum (Posbakum) yang di berikan gratis bagi mereka yang memiliki perkara pidana. Hal itu dikatakan Ketua PN Simalungun Abdul Siboro, Minggu (2/9). Menurutnya, di wilayah kerja mereka banyak terdakwa ataupun yang memiliki perkara pidana, namun tidak mampu mengeluarkan uang untuk menyewa pengacara. “Sesuai arahan Mahkamah Agung, PN Simalungun sudah menyediakan Posbakum secara gratis. Sementara biaya untuk pengacara yang siap melayani ataupun membantu proses hukum pada saat persidangan, akan ditanggung Negara,” paparnya. Dia menerangkan, tak dapat disangkal lagi di Simalungun ini umumnya, masyarakat berpro-

fesi sebagai petani. Selain itu banyak di antara mereka yang buta terhadap hukum, hingga Posbakum dimanfaatkan untuk memberikan pelayanan bantuan hukum secara cuma-cuma. Tetapi ada beberapa persyaratan yang haris dilengkapi untuk mendapatkan pelayanan. “Yakni surat gugatan atau surat permohonan, surat keterangan tidak mampu yang dapat diperoleh dari lurah setempat. Kemudian surat pernyataan tidak mampu yang ditandatangani si pemohon dan Ketua Pengadilan,” paparnya. Sambungnya, mereka yang berperkara berhak melakukan konsultasi hukum untuk berbagai perkara. Selanjutnya bantuan untuk memperoleh layanan pengacara, serta bantuan untuk memperoleh pembebasan biaya perkara. Sementara bagi terdakwa yang melakukan tindak pidana dengan ancaman hukuman lebih

dari 5 tahun penjara, berhak mendapatkan bantuan hukum gratis juga. “Tapi itu tergantung kepada pihak yang berperkara. Sebab ada saja terdakwa yang tidak ingin didampingi pengacara, meski secara gratis. PN Simalungun tetap menyediakan pengacara prodeo yang gajinya diperoleh dari Negara,” jelas Siboro. Sementara bagi terdakwa yang ancaman hukumannya sampai 15 tahun ke atas, namun tidak bisa menghadirkan pengacara, PN Simalungun akan langsung menghunjuk penasehat hukum gratis. “Biasanya itu diberlakukan untuk kasus pencabulan, pembunuhan dan lainnya. Anggaran untuk ini yang dikeluarkan negara pada 2011 mencapai Rp180 juta. Sementara untuk tahun 2012, sebesar Rp100 juta. (mua/hez)

Waktu Pendaftaran Ormas Diperpanjang Sambungan Halaman 9 Badan Kesbanglinmas Gunawan Purba melalui Kabid Pembinaan Politik Dalam Negeri Sofian Purba, Senin (3/9). Dikatakannya, pendaftaran diperlukan sebagai database dan laporan ke Kementrian Dalam Negeri, terkait keberadaan dan jumlah ormas ini.

Hal itu sudah diatur pada Peraturan Dalam Negeri RI Nomor 33 Tahun 2012 tentang Pedoman Pendaftaran Organisasi kemasyarakatkan di Lingkungan Kementrian Dalam Negeri dan Pemerintah Daerah. Pada pasal 2 ayat 1 dan 2 disebutkan, ormas dan LSM wajib mendaftarkan keberadaannya. Sebagai syarat pendaftarannya, ormas yang bersangkutan harus melampirkan atau

akte pendiriannya, termasuk Anggaran Dasar (AD) dan Anggaran Rumah Tangga (ART). Selain itu, susunan kepengurusan juga diperlukan dengan identitas lengkap yang harus dilampirkan, termasuk keberadaan kantornya. “Sebuah organisasi juga dilarang menggunakan lambang Negara,” tukasnya. (pra/ hez)

Miras Senilai... Sambungan Halaman 9 Pembela Islam (FPI) Kota Siantar Muhammad Syahril Chan. Secara simbolis, tiga botol minuman keras ini dilemparkan ke arah alat berat silinder oleh tiga orang yang mewakili kejari dan polisi. Lalu perlahan alat berat ini menggilas semua botol minuman keras yang sudah ditumpuk di aspal. Hari Darmawan mengatakan, 219 miras ini dimusnahkan atas putusan Pengadilan Negeri Pematangsiantar Nomor 01 Pid C/2012/PN PMS tertanggal 13 Agustus 2012. Ditambahkan Hari, pemusnahan sempat tertunda dari jadwal yang ditentukan. Itu disebabkan karena suasana lebaran beberapa waktu lalu, sehingga pemusnahan baru bisa terlaksana kemadin, Senin (3/9). “Tidak ada unsur kesengejaan terkait penundaan pemusnahan ratusan botol miras ini. Miras yang dimusnahkan hari ini, sudah sesuai dengan yang tertera di kepolisian dan kejaksaan. Tidak ada bedanya sama sekali. Saya kira tidak ada masalah dengan itu,” ujarnya. Sementara Ketua FPI Kota Siantar Muhammad Syahril Chan mengungkapkan rasa terima kasihnya kepada aparat kepolisian atas pemusnahan yang dilakukan. Mereka menghargai kinerja polisi dan berharap agar terus ditingkatkan. “Peredaran miras sudah menyeluruh di Kota Siantar, kita berharap polisi meningkatkan kinerjanya dalam pemberantasan miras,” ungkapnya. (ral/hez)

Warga Desak Bupati Ganti Rekanan Sambungan Halaman 9 Saragih agar segera mengganti rekanan ini. Menurut Hasan Damanik (46) dan Horis Siregar (41), selama ini warga setempat tidak pernah diberikan kesempatan mengelola objek wisata Parapat. Bahkan untuk mendirikan beberapa pondok wisata saja, warga dikutip retribusi dan izin usaha. ”Kami yang penduduk asli, dikutip retribusi saat mendirikan pondok wisata,” kata Hasan yang diamini Horis Siregar. Ditambahkannya, selama ini kendaraan yang masuk ke objek wisata Parapat dikutip retribusi Rp20 ribu untuk sekali masuk. Diperkirakan dalam sehari, ada lima ratus kendaraan yang datang dan berkunjung ke objek wisata ini. Sehingga rekanan ini mampu meraup penghasilan belasan juta per hari. ”Mereka itu kerja 24 jam, dan pengunjung di Parapat ini kebanyakan datang di malam hari. Terkadang kalau dari luar kota, mereka suka beramai-ramai. Perkiraan kami, paling sedikit omzet mereka sekitar Rp10 juta per hari,” katanya. Namun ditambahkannya, hasil itu hanya dirasakan oleh pihak rekanan dan realisasinya belum dirasakan masyarakat. Warga sekitar juga pernah menanyakan target PAD dari gerbang masuk objek wisata Parapat ini kepada Kadispenda Simalungun Wilson Manihuruk. Saat itu pihak Dispenda menjelaskan bahwa besaran target pada tahun 2012 berkisar Rp385.700.000 per tahun. “Kalau kita hitung-hitung omzetnya dari hasil pengutipan, diperkirakan mencapai Rp3.850.700.000 per tahun. Sehingga uang akan bersisa Rp3.431.000.000,” tambahnya. Artinya, ada hasil yang tak masuk ke kas derah dan itu terus berlanjut hingga bertahun-tahun. “Wisata Parapat ini bukan milik Kadispenda atau rekanan. Ini milik semua warga Simalungun,” katanya. Terpisah, Kadispenda Simalungun Wilson Manihuruk dan rekanan pengutip retribusi gerbang masuk objek wisata Parapat yang coba dikonfirmasi, belum berhasil dihubungi. Bahkan saat ditelepon berkali-kali ke telepon selulernya, Wilson tak mengangkat telepon. (mag-02/hez)


4 September 2012

Sedan Kupe Terkencang di Tanah Air Akan Hadir Tahun Depan „ Ferrari F12 Berlinetta

Indonesia Negara Pengguna BlackBerry Terbesar Injeksi Masuk

Ninja 250 Lama Langka JAKARTA- Sebulan sudah Kawasaki Ninja 250 injeksi dirilis di Indonesia, namun harga sepedamotor bekas (mokas) model lamanyatetaptinggi.Dibeberapagerai,Ninja250versilamajustru “menghilang” alias sulit didapat. Ada barang pun, harganya tak jauh dari ketika beli baru. Sejak launching Ninja 250 injeksi, jarang Ninja250lamayangdijualkeshowroom.“Terakhirseminggulalu, itupun dapatnya sudah mahal. Jualnya 43,5 juta untuk tahun 2010,” ujar Budiwan, pemilik shoowroom. Analisis Budiwan, kemungkinan pemilik Ninja 250 lama masih menyimpansepedamotornyaketikamerekamembelikendaraan roda dua dengan cc lebih besar atau Ninja 250 injeksi. “Banyak yang bilang lebih enak Ninja lama, mungkin karena terbiasa saja,” bebernya. Lain halnya dengan kondisi di Berkah Motor, salah satu pedagang mokas di Palmerah Barat, Jakarta Selatanyang selaludapatlimpahanNinja250bekas.Meskibegitu, perputarannya sangat cepat. Misalkan hari ini datang barang, kemungkinan besar keesokannya sudah terjual. “Dicat ulang pun banyak yang mau beli. Dulu, sekitar enam bulan sebelum launching yang baru (injeksi) harganya masih di bawah Rp 40 jutaan untuk tahun produksi 2009-2010. Setelah ada yang baru, harganya naik karena orang banyak yang nunggu bekasnya.Banyakyangmintaistilahnya,”jelasChaerudin,pemilik Berkah Motor. Pria yang akrab disapa Juleng itupun menjelaskan bahwa saking banyaknya peminat, ada barang dengan jumlah dan harga berapa pun pasti terjual. “Apalagi saat banjir Thailand, Ninja 250 jaditambahmahalbekasnya.Soalnyapasokanturun.Inisajabaru datang, tapi udah ada yang pesan,” ujarnya sambil menunjuk salah satu Ninja 250 versi karburator. Berdasarkan penjelasan Juleng, harga Kawasaki Ninja 250 versi lamaberkisardiangkaRp38juta-Rp39jutauntuktahun2008,Rp39 juta-Rp40 juta untuk tahun 2009, Rp42 juta-Rp43 juta untuk tahun 2010, dan Rp43 juta-Rp43,5 juta untuk tahun 2011. Sejak dikenalkan pada 2008, PT Kawasaki Motor Indonesia (KMI) sudah berhasil menjual lebih dari 40.000 unit Kawasaki Ninja 250. Pasokan versi lama memang sudah dihentikan, dan di gudangKawasakikawasanPulogadung,JakartaTimur,jumlahnya tak sampai 200 unit, dan sudah akan dikirim ke berbagai dealer di Indonesia. Menurut Mitsuhiko Okada, Direktur Marketing KMI, fenomena tingginya harga Ninja 250 bekas tak akan mengganggu penjualanNinja250injeksi.“Hinggasaatinikamitetapfokuspada target 200 unit per bulan. Dan terus banyak permintaan yang masuk untuk model baru. Kami tidak khawatir,” ujarnya. Menurutnya, justru dengan melambungnya harga Ninja 250 bekas menjadi kebanggaan tersendiri untuk KMI. “Itu semua tergantung pasar. Karena permintaan Ninja 250 lama juga masih banyak, sementara barangnya sulit (didapat). Makanya hal itu terjadi,” jelasnya. (int)

LOWONGAN PEKERJAAN Sebuah perusahan yang bergerak dibidang Otomotif membutuhkan segera tenaga kerja dibidang : SALES EXECUTIVE Syarat-Syarat : 1. Pria maximal 28 tahun. 2. Berpengalaman dibidang sales min,2 tahun 3. Pendidikan minimal tamatan SMA. 4. Cekatan, Jujur, Dipsilin dan Bertanggung jawab. 5. Memiliki SIM C. 6. Memiliki kendaraan sendiri. 7. Bersedia ditugaskan keluar kota. Surat lamaran lengkap di alamatkan ke:

PT SUTAN INDO ANEKA MOBIL ( Authorized TOYOTA Dealer ) Jln. Medan Km 2,8 P.Siantar. Surat lamaran ditunggu Paling lambat 08 September 2012 dengan melampirkan Fotocopy KTP Fotocopy SIM C,Fotocopy ijazah,Daftar nilai, daftar riwayat hidup dan phasphoto terbaru ukuran 3x4 sebanyak 2 lembar. (TIDAK MELAYANI LEWAT TELEPON)

JAKARTA-Sudah sejak lama Indonesia dinobatkan sebagai negara dengan pengguna BlackBerry terbanyakdidunia.Bahkanhingga Agustus 2012, gelar itu masih disandang Indonesia, setidaknya di kawasan Asia Pasifik. Penelitian Ericsson ConsumerLab yang dirilis Agustus lalu, mencatat Indonesia sebagai negara

dengan pengguna BlackBerry terbanyak di kawasan Asia Pasifik. Penelitian ini mencatat pertumbuhan sistem operasi ponsel pintar oleh pengguna layanan seluler prabayar di negara-negara Asia Pasifik. Namun, penelitian ini tidak membahas soal pengguna yang memiliki lebih dari satu ponsel pintar.

Sistem operasi BlackBerry mendominasi pasar ponsel pintar di Indonesia dengan 27%, diikuti Symbian 20%, dan Android 10%. Posisi ke empat dan ke lima diduduki Windows Phone sebesar 8% dan iOS 2%.Pemakaian ponsel pintar di Indonesia lebih banyak digunakan untuk layanan pesan teks (92%), panggilan telepon (71%) dan jejaring sosial 57%. Negara lain di Asia Pasifik yang penduduknya masih banyak menggunakan BlackBerry adalah Thailand, dengan 17%, lalu dibayang-bayangi oleh Android dengan 16%. Sistem operasi Symbian dan iOS sama-sama meraih pangsapasar7%,danterakhirWindows Phone dengan 4%. DiSingapura,sistemoperasiiOS milik Apple-lah yang berjaya. Di Selandia Baru dan Malaysia, Android lebih mendominasi pasar. Sementara di Vietnam, Symbian besutan Nokia masih paling populer. (kom/int)

Triumph Tiger 800 XC, Siap Berpetualang!

„ Triumph Tiger 800 XC

MENAMBAHpilihan di segmen adventure, Triumph merilisTiger800XC,yangmerupakanderetanvariandari TigerExplorer.Sepedamotorinikhususdidesainsebagai kendaraanpenjelajahdimedan(bisa)aspal,lumpur,dan pasir, yang akhir-akhir ini banyak dipakai bikers untuk turing jarak jauh. Tampangnya sekilas mirip BMW R1200GS dengan dua mata yang bergandengan. Kekokohannya ada padarangkadansejumlahpelindungbajayangterdapat di sekujur bodinya. Pelek terbuat dari besi dengan jarijari aluminium untuk mengurangi berat. Diameter ban depan 19 inci sementara belakang 17 inci, diklaim untuk memberikan handling sempurna di segala medan. Untuk mendukungnya sebagai penjelajah, Triumph dibekali ban jenis run flat yang tetap bisa jalan ketika terhantam benda keras atau tajam. Lampu utamanya didukung dua lampu kabut yang masing-masing berkekuatan 55 watt untuk berkendara malam hari atau menerpa badai dan kabut tebal. (kom/int)

JAKARTA- Setelah muncul di Geneva Motor Show Maret lalu, giliran Indonesia mendapat jatah memperkenalkan Ferrari tercepat F12 Berlinetta lewat dealer resminya Citra Langgeng Otomotif (CLO), di Jakarta. Namun sosok yang muncul saat itu masih berstatus mobil demo dengan model setir kiri. Tahun depan, CLO resmi mendatangkan versi setir kanan yang akan dikirim kepada 16 orang pemesan. Dengan hadirnya F12, berarti klaim tenaga terbesar yang ada di Tanah Air sebelumnya dipegang McLaren MP4-12C beralih ke sedan berlogo kuda jingkrak tersebut. Betapa tidak, dari mesin tipe V12 dengan sudut kemiringan 65 derajat, berkapastas 6,3 liter yang terletak di depan mampu menghembuskan daya 740 PS (MP4-12C 600 PS) dan torsi 690 Nm. Sebagai pemindah tenaga mengadopsi jenis yang sama dengan 458 Italia, California dan FF, yakni otomatis 7 percepatan dengan kopling ganda. Untuk memberikan sensasi mengendari mobil F1, pengemudi bisa memindahkan posisi gigi memakai paddle shift yang berada di balik setir. Istimewanya, kendati memiliki tenaga besar, pengganti 599 ini ditanamkan fitur pe-

nunjang efisiensi bahan bakar, di antaranya teknologi start/ stop. Hasilnya, diklaim penggunaan bahan bakar mencapai 6,3 kpl, 30 persen lebih baik dari 599. Sedangkan tingkat emisi gas buang bisa dicekek sampai 350 g/km. Untuk performa, mobil seberat 1,5 ton ini mampu melesat hingga 100 kpj dari posisi diam dalam waktu 3,1 detik. Sedangkan kecepatan maksimum bisa digeber hingga 340 kpj. Performa tersebut tak lepas dari desain hasil kerja bareng Ferrari Styling Center dan Pininfarina yang menciptakan lekuk body aerodinamis. Daya tahanan angin yang dihasilkan 0,299. Dari hasil ujicoba mereka, daya tekan (downforce) saat melaju 200 kpj mencapai 123 kg atau mengalami peningkatan 76 persen dari 599 GTB. (int)

Helm Ini Dilengkapi Penglihatan X-Ray PERUSAHAANpertahananasal Inggris, mengembangkan inovasi terbarunya yang menampilkan helm khusus pilot pesawat jet dengan dibekali kemampuan penglihatan X-ray. Helm tersebut memiliki nama Striker HMSS yang dikeluarkan BAE System. Dilansir BBC, Senin (3/9), helm khusus tersebut diperuntukkan untuk pilot pesawat jet tempur. Apabila pilot melihat pesawat musuh, atau posisi pesawat musuh berada di dekat pesawat, pilot tidak perlu mengamati pesawat musuh secara manual. Pilot hanya tinggal melihatnya melalui layar helm, memastikan simbol kecil yang tertampil di helm selaras dengan objek, kemudian menekan tombol dan menembaknya. Pilot menggunakan helm Striker HMSS dari BAE Systems, yang dilengkapi pula dengan teknologi augmented reality, seperti yang digunakan pada video game. Teknologi tersebut juga dapat diterapkan untuk bidang militer. Kamera yang terletak di sekitar pesawat jet tempur terhubung secara nirkabel dengan helmet BAE. Sistem akan memeriksa terkait arah yang sedang dilihat oleh pilot, lalu menampilkan display

pandangan sesungguhnya melalui visor helm secara real time. Helm ini didukung dengan fitur helmet-mounted display (HMD) dan dirancang untuk membantu pilot berkomunikasi dengan pesawat.HMDmerupakansatulangkah lebih maju dari teknologi bernama head-up displays (HUD) yang pernah ada saat 1970. HMDmenunjukkandatakunci, seperti kecepatan, ketinggian dan arah. Sehingga memungkinkan pilot untuk menjaga mata mereka pada pandangan yang ada di depannya, ketimbang secara konstanharusmelihatkebawahuntuk memeriksa instrumen mereka. “Pilot memakai helm Striker, yang pada dasarnya adalah sebuah helm dengan layar terintegrasi.Ketikapilotmelihatsesuatu di tanah, ia hanya tinggal menolehkan kepala, menempatkan simbol pada posisi bidik, menekan tombol dan sistem akan menghitung objek koordinat,” terang Alan Jowett dari BAE Systems. Ia mengatakan, pesawat dapat mengaktifkan sensornya, kamera atau senjata pada arah tersebut. Sehingga, bisa melakukan dialog langsung antara pesawat dan pilot. (oz/int)


SELASA 4 September 2012




Jl. Jawa (Simpang Mayat) Pematangsiantar

HP 0852 7020 6105 Tersedia

Harga Mulai

Rp 15 Jt


Peluang Usaha

Mengadakan Segala Jenis Sparepart Depot Air Minum Ayo Buruan......................

(Bergaransi Resmi Nasional)


• Depot Air Minum • RO & Mineral • Air Minum Dalam Kemasan (AMDK)

Tinta Printer Canon & Epson ( Beli 4 Gratis 1) Modem Gsm Flash, Xl,vodafone, Smartfren , Super Murah!! Printer Canon & Epson Tinta Infus Tabung Besar! Wowww!!!! Assesoris Komputer Dengan Harga Super Murah Kredit Komputer Dan Laptop (proses Cepat) Tanpa Dp !!!!!!!

Optik BUKA MATA Jl. Merdeka No. 200 P. Siantar Telp. 0622 - 7143999

• Gratis periksa mata dengan Komputer sistim • Gratis servis kaca mata • Menerima resep Dokter mata • Frame + lensa dimulai dari harga Rp 200 rb-an • Kenyamanan kaca mata kita beri garansi • Pesanan kaca mata dapat diselesaikan dalam waktu 10 menit • Softlens center • Sunglasses • Frame • Lensa Bawa potongan iklan ini untuk dapatkan Diskon

Telah Hadir di

Kota P. Siantar

CELLULAR Jl. Merdeka No.188 P. Siantar (Depan Showroom Honda)









• HP Baru layar warna Rp 150 rb • HP China Rp 159 rb • BB 8520 Rp 1.499 rb


h& Casedit Kr

TERIMA PESANAN SIAP ANTAR Hub. Ibu Sriningsing HP 0852 9673 4769



A. Untuk Refleksi dan Massage B. Umur 30-45 tahun (pria/wanita) C. Berpenampilan rapi, menarik, sopan, jujur dan rajin D. Pengalaman tidak diutamakn E. Mengikuti peraturan dan perintah dengan baik Kirim surat lamaran, photocopy KTP, daftar riwayat hidup dan pasphoto anda ke: RAJA OUKOP, Jl. Merdeka No. 118 P. Siantar. Telp. 0823 6765 9999; 0622 - 432993 (Tidak Melayani SMS)

PT Wesly Tour & Travel Melayani Penjualan Tiket Pesawat dan Tiket Kapal Laut Nokia 1280 Rp. 195.000

Nokia X1-01 Rp. 380.000 + MMC 2 Gb

Nokia X2-02 Rp. 705.000 + MMC 2 Gb

Nokia C1-01 Rp. 485.000 + MMC 2 Gb

Nokia C2-03 Rp. 820.000 + MMC 2 Gb

Nokia X2-01 Rp. 685.000 + MMC 2 Gb

Nokia N100 Rp. 240.000

Nokia X2.00 Rp. 890.000 + MMC 2 Gb

Nokia N101 Rp. 325.000 + MMC 2 Gb

s Plu ua na m Se erda si P an Gar Coy al ion s a N

Paket Holyland : Ziarah Tour 11 Hari 27 Agts, USD 2450 12, 20 Agts, USD 3150 3, 10 Sept, USD 2450 18, 15, 22 Oktbr, USD 2450 6, 19, 26 Nov, USD 2450

3 Des, USD 2550 20, 21 Des, USD 2850 21 Des, USD 3100 25 Des, USD 3100

Harga & tgl sewaktu2 dapat berubah Jl. Kesatria No. 18 BDB Simp. Lor. 21 P. Siantar HP 0813 7007 5873; 0813 6200 9333

RUMAH DISEWAKAN Ukuran 9 x 30 M, 2 kamar tidur, 8 jt/tahun, lokasi di Jl. Siantar Timur, Lorong 32 No. 89 BDB.


HP 0813 8028 0955 LOWONGAN KERJA


1. Driver 2. Resepsionis

Dibutuhkan wanita tamatan SD, SMP, SMA sederajat, Akper untuk di didik dan di pekerjakan menjadi: • Baby Sister • KakakAsuh • Perawat Jompo

Dengan syarat: • Pria (1, 4) / wanita (2, 3) • Penampilan menarik (1- 4) • Min. tamatan SMAsederajat (1-4) • Jujur, tekun dan bertanggung jawab (1-4) • Memiliki minimal SIMA(1) • Diutamakan lulusan SMK perhotelan (2, 3) • Mampu mengoperasikan komputer (2, 3) Lamaran langsung diantar ke:

Gaji Rp 700 rb s.d 1.300 rb / bulan bersih

Hubungi: YAYASAN MUTIARA HATI Jl. Binjai KM 10.8 Komp. Villa Mulia Mas Blok A 1/3 Medan

Hotel Sing A Song Jl. Asahan No. 02 KM 2,5 PEMATANGSIANTAR

Telp. 061 - 76220497; 0813 7707 4679


Obat kuat terbaru saat ini paten, membuat ereksi lebih lama, tanpa efek samping isi 10 tablet tanpa bekas


Terobosan terbaru obat VIMAX menambah ukuran alat vitl secara permanent sekaligus menambah kejantanan pria, isi 30 capsule

PUSAT PELANGSING HERBAL PELANGSING SUPER CEPAT Cukup 1 pak Fatloss langsung terbukti turun berat badan 8 - 12 Kg dalam jangka 1 Minggu, 100& alami dan tanpa efek samping, dijamin CREAM PYDR + VACUUM 100% original import 1 kali pakar langsung terbukti besar, kencang, padat dan mengembalikan payudara, baik gadis atau ibu-ibu dijamin PENINGGI BADAN SUPER



Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0813 6017 0199; 0852 7695 4557

Melayani pengobatan


Full Body Refleksi Khaki Terapi Lilin Kop / Bekam


Spontan kuat keras dan tahan lama 3 X lebih kuat dari obat kuat lainnya, aman di konsumsi tanpa efek samping


Sekali semprot ampuh Capsul USAtelah dan terbukti meninggikan tambah gairah seks pria badan dengan cepat, memperkuat daya ingat, 1-2 minggu bertambah tinggi 5 - 8 CM tanah lama, tanpa pasti (semua umur) menimbulkan rasa kebas, panas, aman dan tanpa TERSEDIA: •Gemuk Badan •Obat Jerawat •Pemerah Bibir •Pembesar Pantat •Sedia aneka kondom antik r efek samping a Ant IS !Melayani pesanan luar kota dan kebutuhan sex P/W dewasa AT Via Transfer - Paket Kilat R G PIN BB 295597B6

ASEN HP 0852 7558 7299 HERBAL

Peter Refleksi

BESAR & KERAS SinShe Aciu / Aling BLAK MAMBA Oil

Jl. Tanah Jawa No. 83 (depan ruko baru, Simp Jl Cokro) ) P. Siantar Jl. Cokro No. 349 Simp. Malik Kisaran Jl. Sirandorung NO, 63 Simp. Jl. Pardamean Rantau Prapat

3. Cleaning Servis 4. Security

Buka : Jam 09.00 - 21.00 WIB NB:Lagi membutuhkan beberapa anggota di peter refleksi yang berpengalaman di Bidang Refleksi


JASA TEKNIK REALTY Ahlinya JUAL SEWA BELI Properti Lahan - Rumah - Ruko - Gudang


Alamat kantor

Jl. Melanthon Siregar No. 44 P. Siantar Telp. 0622 - 430946; HP 0821 6336 6709 Aman, Cepat & Terpercaya

0852 7551 8062 Khusus Pematangsiantar sekitarnya


4 September 2012


bunda komedian Aming, Emin Rumiah meninggal dunia di usia 82 tahun pada Senin (3/9) pagi. Menurut sang manajer, Iyus Aming shock pertama kali mendengar kabar duka itu.

Angelina Jolie

Kesal Putrinya Suka Madonna

ANGELINA Jolie marah begitu tahu ketiga putrinya, Zahara, Shiloh, dan Vivienne kecanduan lagu Madonna. Cewek jagoan Lara Croft di film Tomb Raider i n i , mengaku kesal bagaimana lagu Madonna bisa digemari anakanaknya padahal dia benci. ”Bukan rahasia lagi kalau Jolie bukanlah fans Madonna. Kata dia (Jolie) musiknya benar-benar mengerikan,” kata sumber yang dirilis tabloid terbitan Amerika Serikat, National Enquirer. Selera musik Jolie dan lagu yang dinyanyikan Madonna memang bertolak belakang. Sejak muda, Jolie yang kelahiran 4 Juni 1975 lebih menggemari musik punk rock dan new wave, sementara aliran musik yang diusung Madonna adalah pop. Jadi tak heran jika pasangan hidup Brad Pitt ini sama sekali tak suka lagu ataupun musik Madonna. Siapa sangka kini Jolie harus tahan mendengarnya di rumah setiap saat sebab ketiga putrinya fans berat Madonna. Meski agak tersiksa, Jolie berharap kegemaran anak-anaknya itu hanyalah fase yang harus dilalui dan akan hilang dengan sendirinya seiring mereka dewasa. “Bagi Jolie, mendengar musik Madonna seperti bunyi derit kapur bergesek dengan papan tulis,” tutup sumber tersebut. (pra/jpnn)

”Aming seperti yang lainnya ya, shock ketika denger kabar tersebut. Maklumlah ibunya kan motivator dia juga, jadi benarbenar spesial” kata Iyus saat dihubungi. Iyus menuturkan, ibunda

Aming meninggal karena sakit. Masalah pencernaan dan faktor usia juga menjadi penyebab kepergian ibunda Aming. ”Udah udzur juga dan karena pencernaan juga,” jelasnya. Dijelaskan Iyus, saat

PENYANYI dangdut Ikke Nurjanah bersama artis ibukota, Hudson tampil menghibur ribuan penonton dalam Pesta Rakyat Indonesia di

Wassenaar, Belanda. Pesta Rakyat yang diselenggarakan Sabtu (1/9) oleh KBRI Den Haag, Belanda itu mejadi acara tahunan yang meriah dalam rangka menyambut Hari Kemerdekaan Indonesia, demikian keteerangan pers KBRI Denhaag, Minggu (03/09) Artis Hudson

kepergian sang ibunda, bintang film ‘Madame X’ itu sedang berada di Jakarta. Kini Aming pun sudah berada di Bandung untuk menemani sang bunda ke peristirahatan terkahir. (dtc/int)

dengan busana kebaya yang menonjolkan peran sebagai Jessica dan sekaligus dirinya sendiri mengalunkan lagu-lagu Indonesia dan barat, di antaranya Keong Racun, Cinta Semalam, Getuk dan Terajana. Sementara itu Ikke Nurjanah dengan busana yang menonjolkan pakaian tradisi Indonesia yang sangat anggun melantunkan lagu Terlena, Kegagalan Cinta dan Biduan. Di samping Hudson dan Ikke Nurjanah, juga ikut tampil meramaikan adalah Tim Kesenian Sekolah Indonesia, Biroe Band, Persatuan

Pelajar Utrecht, Tim Kesenian Samosir, Night Breaker band, Ray Jeffryn, dan Marabunta Band. Cuaca yang sangat cerah, dengan sinar matahari yang hangat, telah mendorong para penonton yang terdiri berbagai lapisan masyarakat maupun warga Belanda dan asing lainya tetap bertahan di arena pertunjukan dan bejoget mengikuti irama lagu. Pesta Rakyat tahun 2012 yang dipandu oleh pembawa acara Feba dan Juniarti tersebut, dibuka secara resmi Dubes RI, Retno L.P. Marsudi yang dalam sambutannya menegaskan kembali bahwa kebahagiaan menyambut Hari Kemerdekaan. Lebih dari 32 stand makanan menyajikan beragam masakan Indonesia. Rujak cingur, sate ayam, makanan padang, gudeg, soto, empekempek, aneka

MODEL majalah Playboy, Tiara Lestari terus berjuang untuk meminta pembatalan putusan soal hak asuh putri semata wayangnya, Rania Kancana Tadya Dalima Sjarief dari mantan suaminya, Andi Sjarief. Dia ingin anaknya tidak lagi hidup berpindah dari rumahnya ke rumah mantan suaminya. Segala upaya dilakukan oleh Tiara, salah satunya membawa saksi ahli, Seto Mulyadi atau Kak Seto untuk didengar kesaksiannya. “Kenapa kita menghadirkan Kak Seto karena akan sangat diperlukan sekali pendapat Kak Seto. Anak berumur 5 tahun dan harus berpindah itu kan sangat melelahkan. Dampaknya untuk anak itu akan didengar dari Kak Seto,” ujar pengacara Tiara, Kartika Yosodiningrat, saat ditemui di Pengadilan Agama, Jakarta Selatan, Senin (3/9). Keterangan Kak Seto tidak langsung bisa didengarkan dalam persidangan, masih harus dijadwalkan. Sementara pihak Andi juga tidak keberatan dengan adanya saksi ahli seperti Seto Mulyadi. “Sah-sah saja mereka membawa Kak Seto. Tapi kan nanti ada agendanya sendiri. Saat ini masih pembuktianpembuktian secara surat-surata saja,” ujar pengacara Andi, Indra Prasetya. Sidangnya sendiri akan kembali dilanjutkan, Senin (10/9) dengan agenda pembuktian. (kpl/int)


Meskipun hubungannya dengan Gaston Castano kembali lengket, namun status Julia Perez masih sendiri. Setelah ditinggal sang ustad pilihan ibunda, Jupe belum mau menjalani hubungan spesial dengan lelaki mana pun. Artis yang kerap berbusana seksi itu pun mengaku sedang happy menjalani statusnya sebagai janda. Pelantun ‘Goyang 69’ itu mengaku banyak dilirik lelaki karena statusnya itu. ”Saya lagi senang jadi janda, saya

banyak dilirik orang, Brad Pitt saja nengok ke saya,” selorohnya saat ditemui di studio RCTI, Jakarta Barat, Senin (3/9). Jupe menjelaskan, terkadang image janda mengundang cibiran ke arahnya. Namun, Jupe mengaku tak ambil pusing. ”Lebih baik janda daripada perawan tua, saya pernah rasain jatuh-bangunnya. Kawin atau nggak urusan saya,” tuturnya. “Tapi saya harus kawin karena harus punya keturunan the next Jupe,” tambahnya mengoreksi.

ersonel Mahadewi, Puri telah resmi dilamar oleh kekasihnya yang berprofesi sebagai dokter berinisial ‘H’ usai Lebaran lalu. Acara pertunangan yang digelar pada 26 Agustus itu pun dihadiri keluarga besar Puri dan calon suami. Segala sesuatunya pun telah dipersiapkan Puri untuk langkah selanjutnya. Pelantun ‘Dokter Cinta’ itu akan segera menggelar akad nikah. Kapan? ”Akad nikahnya 1 November,” ungkap rekan Puri di Mahadewi, Gwen, Senin (3/ 9). Sebagai sahabat, Gwen pun senang Puri akan melepas lajang. “Senenglah, pas deh dia kan udah 27 tahun juga ya udah waktunya, support-lah ini kan baik ya.” katanya. Gwen yang menggantikan Tata Janeta, personel Mahadewi yang sebelumnya hengkang pun mengaku siap mempersembahkan lagu jika diminta sahabatnya bernyanyi di hari bahagia itu. ”Siap aja kalau di-request yang punya hajat sih siap,” tuturnya ramah. (dc/int)



4 September 2012 METRO SIANTAR

Nyaris Timpa Alonso, Grosjean Minta Maaf PEMBALAP Lotus, Romain Grosjean, minta maaf atas manuvernya yang mengakibatkan kecelakaan di F1 GP Belgia, Minggu 2 September 2012. Grosjean merasa terpukul dengan sanksi larangan tampil di GP Italia. Atas tindakannya di GP Belgia, Grosjean menerima sanksi satu larangan tampil dan denda €50 ribu (setara Rp599 juta). Dengan demikian pembalap asal Prancis itu harus absen di GP Italia, akhir pekan ini. Sebuah manuver berbahaya Grosjean di awal balapan GP Belgia mengakibatkan kecelakaan yang melibatkan sejumlah mobil. Usai menyenggol ban kiri depan pembalap McLaren, Lewis Hamilton, mobil Grosjean kemudian melayang dan nyaris menimpa pembalap Ferrari Fernando Alonso. Pembalap Sauber, Sergio Perez dan Kamui Kobayashi, juga terlibat dalam kecelakaan

tersebut. Namun, nama terakhir mampu melanjutkan balapan dan finish di posisi 13. “Saya tidak bermaksud membuat pembalap lain tertekan ke tembok. Saya tidak berusaha menghentikan balapan di tikungan pertama. Saya minta maaf, dan lega tidak ada yang terluka,” ujar Grosjean seperti dilansir Autosport. “Saya melakukan kesalahan dan salah menghitung jarak dengan Hamilton. Saya yakin telah melewati dia. Jadi, kesalahan kecil yang mengakibatkan kecelakaan besar,” lanjutnya. Grosjean menilai sanksi larangan tampil di GP Italia membuatnya sangat terpukul. “Ketika Anda cinta balapan, hukuman ini sangat berat. Tapi, saya menerima kesalahan. Saya marah dengan diri sendiri,” tuntasnya.

Lega Fernando Alonso menyesal tidak berhasil mendapatkan poin di Grand Prix Belgia. Namun, Alonso mengaku beruntung tidak mengalami cedera parah akibat insiden itu. Seperti diketahui, mobil Romain Grosjean yang kehilangan kendali menabrak mobil pemuncak klasemen pembalap itu dan juga Lewis Hamilton. Insiden itu memaksa Alonso finis dari lomba lebih awal. Sementara itu, Sebastian Vettel mampu finis diperingkatkeduapadabalapankemarin.Dengan hasilini,pembalapRedBullitumampumemangkas ketinggalan poin menjadi 24 angka dari pemuncak klasemen Alonso. “Saya sangat kecewa karena kehilangan poin. Namun,sayamerasasangatberuntungkarenabisa mengemudikan mobil dalam waktu lima hari mendatang di Monza,” jelas Alonso, dilaporkan Autosport, Senin (3/9). (int)

Paralimpik di London

Panitia Sediakan Bus Gratis

Untuk Warga ke Venue PON XVIII

PANITIA Besar PON Riau menyediakan 45 unit bus untukmasyarakatsecaragratis. Businiakankhususmembawa wargamenujuberbagaitempat pertandingan. Demikian disampaikan Humas PB PON Riau, Chairul Riski, Senin (3/9) di Pekanbaru. Riski menjelaskan, penyediaan bus ini guna mempermudah masyarakat untuk menonton langsung pertandingan yang ada di Pekanbaru. Bus angkutan khusus ke venue PON ini akan mulai beroperas pada 9 September. “Masyarakat dapat memanfaatkan bus tersebut secara gratis menuju lokasi pertandingan. Ini guna merangsang warga untuk menyaksikan jalannya pertandingan olahraga,” kata Riski. Masih menurut Riski, 45 bus gratis itu akan ditandai stiker berlambang PON. Bus ini akan melayani rayon Kecamatan Tampan, tepatnya di sekitar kampus Universitas Riau (Unri). Selanjutnya Rayon Marpoyan di sekitar kampus Universitas Islam Riau (UIR). Dan bus juga akan melayani mewuju sport center di Kecamatan Rumbai. “Bus ini selama dua pekan akan terus beroperasi guna memberikan kemudahan kepada masyarakat yang akan menyaksikan pertandingan olahraga PON. Masyarakat tentunya akan sangat terbantu dengan adanya shuttle bus seperti ini,” kata Riski. Disebutkannya, pelayanan jasa transportasi memang menjadi perhatian serius dari PB PON, tidak hanya untuk para atlet, ofisial dan tamu PON lainnya. Masyarakat yang ingin menyaksikan pertandinganpertandingan olahraga pun harus difasilitasi. “Kita memberikan sarana transportasi gratis ini akan tetap beroperasi sejak pagi hingga pertandingan usai. Kiranya masyarakatdapatmemanfaatkanfasilitasini,”kataRiski.(int)

YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 /bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari YAYASAN MAHAGA SEJAHTERA: membutuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515 1742 Pengajar Bhs. Inggris, DIBUTUHKAN SEGERA: Matematika, IPA,, alamat Jl. Menambin No. 8 Kel. Timbang Galung P. Siantar, Sumut, HP 0813 3814 0437; 0853 2638 7586

DIBUTUHKAN SEGERA: Tenaga kerja wanita usia 17-40 Tahun dengan posisi sbb:Baby Sister,Perawat jompo/Pribadi, PRT, syarat fc.ijazah, KTP, KK, gaji bersih 700rb s.d 1.500rb/ bulan + bonus + THR, makan, asrama, dijemput loket, gratis. hub YYS Marel Mandiri. Jl.Cengkeh Raya No 18.C Medan HP 0813 6199 9211: 0878 6968 7879. MNC GRUP: Mencari mitra bisnis yang berpengalaman untuk menjadi AM/FC penempatan di Siantar. Pria dan wanita usia min 22 tahun, mampu berbahaa Hokien / Mandarin, min tamatan Diploma, diutamakan yang sudah berpengalaman di asuransi, penghasilan 12 jt/bulan, bunus, jalan-jalan keluar Negeri geratis, hub. Agnes Silaen HP 0813 6135 5203 MNC GRUP: Mencari mitra bisnis yang berpengalaman untuk menjadi AM/FC penempatan di Siantar. Pria dan wanita usia min 22 tahun, mampu berbahaa Hokien / Mandarin, min tamatan Diploma, diutamakan yang sudah berpengalaman di asuransi, penghasilan 12 jt/ bulan, bunus, jalan-jalan keluar Negeri geratis, hub. Magda HP 0812 6581 0012 LOWONGAN KERJA: Perusahaan yang bergerak dibidang distributor membutuhkan karyawan/ti, usia max 32 tahun, pendidikan SMA/ SMK sederajat, D1, D3 dan S1 (semua jurusan) untuk posisi Adm, Staf Gudang, Marketing, Pengawas, OB/OG, Asmen dan Kabag, bawa lamaran langsung test ke: CV Sentosa Abadi Jl. Medan KM 6.0 No. 58 (+ 5 M dari Simp. HKBP / Radio Diakoni Bongbongan) P. Siantar. Fasilitas: Gaji pokok, jenjang karir, komisi, mess (tempat tinggal) dan bonus DICARI: Tukang pangkas rambut, tempat depan Station Kereta Api, Cafe Obaja, diberikan Rp 25.000/hari, rame bagi dua, hub. GP 0813 9702 5775

DIBUTUHKAN: 2 orang pria tukang las listrik, umur 24-45 tahun, berpengalaman 2 tahun dalam mengelas, langsung wawancara di Jl. Cipto No. 39 Pematangsiantar

DICARI: Karyawan wanita, yang berpenampilan menarik, sopan, jujur, ramah tamah, buat jaga ponsel, hub. HP 0821 6488 0068, lamaran diantar ke: KPM Jaya Ponsel Jl. Persatuan No. 58 Parluasan (Samp. Loket Karya Agung) DIBUTUHKAN SEGERA: 1 Pembantu RT wanita, berusia 20-50 tahun, dipekerjakan Jl. Melanthon Siregar P. Siantar, bersedi tinggal di rumah dan berikan gaji 1 jt/bln, yang berminat hub. Ny. Sitohang HP 0853 6107 9998; 0853 6059 4005

Indonesia meraih medali pertama di ajang Paralimpik London, lewat petenis meja Dian David Michael Jacobs (32). David Jacobs berhasil meraih medali perunggu setelah menundukkan lawannya dari Spanyol José Manuel Ruiz Reyes dalam pertandingan semifinal di gedung Excel, London,Minggumalam. AtletkelahiranMakassar 21Juni1977inimulaiberkenalandengantenis meja sejak umur 10 tahun berhasil menundukkan pemain terbaik Eropa dengan 3-1. Dalam pertandingan yang cukup menegangkan, David yang awalnya menempati peringkat 40 dunia kelas 10, mendapat dukungan dari sang ayah Jan Jacobs yang berusia71tahundanistrinyaJeanny Palarserta kakak lelaki yang khusus datang dari Kenya. Keberhasilan David mempersembahkan medali perunggu merupakan sejarah tersendiri bagi Indonesia, mengingat untuk pertama kalinya Indonesia berhasil meraih

MENERIMA LOWONGAN KERJA : Wanita usia 17-45 thn, tamatan SD, SMP, SMU sederajat, dengan honor : 900 rb s/d 1.500.000/bulan bersih, utk merawat anak & orang tua Alamat Jl. Pasar 3 no. 45 A Krakatau, Hub : 0811 602 145, 0852 6114 3441. DIJUAL: TOYOTA KIJANG LGX TAHUN 2004 1.8 EFI, HUB. HP 0853 7078 6233 (NO SMS) DIJUAL: Kijang kapsul diesel ‘97, hijau metalik, BK Siantar, VR, tape, PS, sangat mulus, siap pakai, harga 95 jt, hub. HP 0813 2824 8610 (J Sinaga) DAIHATSU PAKET MURAH 100% DP Angsuran • All N Xenia 24 jt 4.440.000 • Terios 24 jt 4.981.000 • Luxio 20 jt 4.902.000 • Pick up 11 jt 2.600.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0821 6308 7454. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio


• All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya

CAPELLA PEMATANGSIANTAR • All New Xenia Ready stok • Terios Ready stok • Luxio Dp 15%(hadiah menarik) • Sirion Dp 15 % • Pick up Dp 15 % • Mini Bus Dp 15 % hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Proses cepat data dijemput. Menyediakan TEST DRIVE!!


· All New Avanza ..Ready Stock ! Bonus Lengkap ! · All New Avanza VELOZ ... Bonus Lengkap !! · YARIS...Ready Stok,Diskon besar, Buruan !! · New Rush ..... Ready Stok !! · Grand New Innova .... Ready Stock !! · Grand New Fortuner ... Ready Stock !! · Hilux S-Cab/D-Cab .... Bensin/Diesel !! HUB. HUB. RICKY. M - 0853 7199 9499- 0812 6505 3191 SALES EXECUTIVE TOYOTA SIANTAR. Data dijemput, Cash/Credit PROSES ASTRA DAIHATSU 100% BARU CEPAT..!!

MENYAMBUT RAMADHAN • All New Xenia Dp 15% •Terios Dp 15% •Luxio Dp 15% •Pick Up Dp 15% •Grand Max Dp 15% Pastikan Anda Lebaran Mudik Dengan Mobil Baru Hub : Daud 0853 6123 3733

SUZUKI 100% BARU PT. Trans Sumatera Agung • Carry Pick Up 95,6Jt • APV Pick Up 105,6Jt • APV GL Arena 149,3Jt • APV Luxury 177,6Jt • Ertiga 155,2Jt • Splash 152,8Jt • Karimun Estillo 120,3Jt • Swift 181Jt • SX4 Cross Over 213,3Jt • Grand Vitara 305,3Jt Cash & Credit, Data dijemput David Sinaga, 0813 6132 4071

medali diajang pesta olahraga difabel (penyandangcacat)palingbergengsiduniaitu. Ketua Umum Komite Paralympic Indonesia Senny Marbun mengatakan bahwa suatu kebanggaan akhirnya David berhasil mempersembahkan medali bagi Indonesia. “Pertama kami berterima kasih kepada Tuhan yang telah mengizinkan David mendapatkan medali yang merupakan medali pertama Indonesia dalam Paralimpik,” ujar Senny usai acara pengibaran bendera. Pertarungan tenis meja di kelas 10 ini pertandingan David sendiri cukup menegangkan, set pertama dimenangkannya 11-9, dibabak kedua Ruiz Reyes bangkit dan menang 11-7. Namun dengan ketenangan David babak ketiga dan empat diraih dengan mudah 11-5 dan 11-6. Usai pertandingan, David tampak tidak dapat menahan haru dan bahkan sempat berlutut dan airmatanya pun menetes sambil melambaikan tangannya ke arah suporter Indonesia, yang mengibarkan bendera Merah Putih. Sang pelatih Pribadi mengakui meski-

PROMO KHUSUS HONDA READY STOCK ALL TYPE HONDA • Honda Brio • Honda Jazz • Honda Freed • Honda CRV • Honda City • Honda Civic • Honda Accord • Honda Odyssey Dapatkan promo khusus Honda CRV bunga 0% sampai 3 tahun. Hub: Donnie R (Sales Executive Honda Arista Perwakilan Siantar) 085296664487. CASH & CREDIT: Menyediakan rumah dan tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

LESTARI MOTOR: Menjual segala jenis sepeda motor Honda, Suzuki, Yamaha dan second, cash n kredit: • Honda Absolute Revo • Honda SX 125 • Scoopy, Vario Techno • Mio, Mio Soul • Jupiter Z • Satria FU, Spin, hub. 0622 - 22305; 24077; HP 0853 7070 9507; 0852 7601 5848. Jl. Merdeka No. 330 P. Siantar

DIJUAL: Ruko tingkat 2, luas 441 M2, SHM, cocok untuk Bank, Kantor, Usaha, tempat strategis (lokasi) Jl, Melanthonn Siregar 31 B Pematngsiantar, parkir luas, isi peralatan bengkel di lelang, hub, HP 0813 6176 6036; 0852 7502 6059 (TP) CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 150 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan. Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 tahun + Rp 16 jt per bulan selama 15 tahun + Rp 1,3 jt per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Rp 100 jt, DP 20 jt, angsuran selama 10 thn + Rp 1 jt per bulan, selama 15 thn + 800 rb per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar. CASH & CREDIT: 10 x 21,8 m Rp 76 jt, 20 x 22 m Rp 154 jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar Pasang Iklan Anda Hub. Hub.: 0622 -


Dian David Michael Jacobs, peraih medali pertama Paralimpik di London dari cabang tenis meja.

CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Rp 200 jt, Dp Rp 50 jt, angsuran selama 10 thn + 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan. Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Rp 200 jt, DP 50 jt, angsuran selama 10 thn + Rp 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan, Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 5 x 20 m Rp 17 jt, 10 x 20 m Rp 34 jt, 15 x 20 m Rp 51 jt, 20 x 20 m Rp 68 jt. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Rp 175 jt, DP 40 jt, angsuran selama 10 thn + Rp 2 jt per bulan, selama 15 thn + 1,6 jt per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: 1.908 M2 Rp 300 jt, cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No. Telp. 0813 7612 2445; 0812 6207 631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Rp 150 jt, DP 30 Jt, angsuran selama 10 thn + 1,7 juta per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

pun baru pertama kali mengikuti kejuaraan Paralimpic,Davidlangsungmemberikanyang terbaik buat bangsanya. “Paralimpik di London merupakan ajang pertama bagi David dan kita bersyukur akhirnya bisa mempersembahkan medali,” ujar Pribadi. Sementara itu Ketua Kontingen Indonesia James Tangkudung menyampaikan terimah kasih kepada masyarakat Indonesia yang bermukim di London dan masyarakat Indonesia pada umumnya atas doa dan dukungannya. “ Ini prestasi terbaik tim paralimpic Indonesia,” ujar mantan Deputi Menteri Bidang Pembudayaan Olahraga Kementerian Pemuda dan Olahraga. Walaupun pertandingan telah berakhir, suporter Indonesia tak satu pun beranjak meninggalkan tempat duduknya menantikan upacara penyerahan medali dan pengibaran bendera merah putih yang merupakan saat saat bersejarah bagi bangsa Indonesia khususnya penghormatan bagi para penyandang cacat di Indonesia. (int)

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Rp 95 jt, Dp 20 jt, angsuran selama 10 tahun + Rp 950 rb per bulan, selama 15 tahun + Rp 752 rb per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 47 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; 7070442 P. Siantar

KAVLING AMELYA: Dijual persil uk. 20 x 18 M (360 M) harga 68 jt (Rp 188.000 / M2) di Jl. Medan Pasar 7 Kel. Sinaksak, Kec. Tapian Dolok (Masuk 700 M dari Samp. Restoran Burung Goreng Sinaksak) harga sudah termasuk surat-surat, pajak, Sertifikat Hak Milik (SHM), An. pembeli, lebar jalan kavling 6,5 M hub R br Purba HP 0852 7539 0076; Naibaho HP 0813 9781 8088 (Ukuran 10 x 18 M = 35 jt) CASH & CREDIT TANAH: 5 x 25 m Rp 25 jt, 5 x 20 m Rp 20 jt, cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar DIJUAL TANAH KAVLING: • luas tanah 224 m2; 114 m2; 106 m2; 117 m2, lokasi di Dusun Tambunan Jl. Parapat KM 4,5 P. Siantar (masuk dari depan Flora In) surat Camat, posisi tanah depan jalan uk. 4 m, harga nego, hub. Br Simanjuntak HP 0852 9635 8913 Peter Refleksi SinShe Aciu / Aling: Mengobati segala penyakit •Asam lambung •Asam urat •Ambeian •Gula •Kolestrol dll Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0852 7695 4557; 0813 6017 0199 Buka : Jam 09.00 21.00 WIB REMBANG KATIKA UD JORENA: Menyediakan minyak karo yang dapat menyembuhkan •Gigitan binatang berbisa •Segala jenis luka bakar •Gegar otak dll, hub. SD Tarigan HP 0852 6290 3828 JL. Mangga No. 11 P. Siantar PIJAT DAN LULURAN “MBAK SARI”: Jika Anda Capek, Pegal, Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan Badan, Urut Bayi, Terkilir serta Luluran. Hub: kami di Jl. Usgara No. 1 (Masuk dari Jl. Bali samp. SMK Negeri) P. Siantar HP. 0812 635 5430 PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852.7600 0031; 0813.9688 9800.

PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar Hp. 0813 7658 8917 Pijat dan Luluran “ IBU RESTU” Jika anda capek, Pegel Linu , Lesuh, Lelah Kurang bergairah, turun perut,Menyegarkan badan,Urut bayi,terkilir,serta luluran. Jl. Simpang Viyata Yudha Komplek kelapa 2 dekat sekolah RK Katolik Asisi Pematangsiantar HP 0821 6681 7943. ULI DE ANGEL TOUR & TRAVEL: Melayani jasa penjualan online: •Tiket pesawat domestik dan internasional •Paket wisata dan hotel •Paket Ziarah Lourdes & holy land • Rental mobil (Avanza, Xenia, Innova dll), hub. Uli Gultom HP 0812 1059 0815; Daniel Samosir HP 0852 7565 0001. BUTIK OLYA: Menjual segala jenis pakaian jadi pria, wanita dan aneka ragam corak batik jenis kain katun, sanwos. Semua pakaian jadi dan bahan batik langsung berasal dari Solo, harga terjangkau dan kelas menengah kebawah, alamat. Jl. Melanthon Siregar Gg. PD P. Siantar HP 0812 6339 2197 ARMADA SARANA TEHNIK: Service perbaikan, isi freon •AC •Kulkas •Dispenser •Frezer •Mesin cuci, hub. Armada Purba, HP 0812 6406 6568 Jl. Handayani No. 8 P. Siantar HASMIDA SALON: Diskon besar-besaran: • Make up/sanggul 30 rb - 50 rb •Rias pengantin 500 rb - 700 rb •Perawatan rambut 25 rb - 50 rb • Smoting 100 rb = 150 rb • Bonding 80 rb - 100 rb dan menerima rangkaian bunga, bunga salib dan juga menerima anak kost wanita. Jl. Rakkuta Sembiring No. 156 P. Siantar hub. HP 0852 6203 4593 GOODS MEUBEL: Promo besar-besaran/cuci gudang. Menjual: Perabotan rumah tangga dll, alamat Jl. Sutomo No. 11 -13 (Depan Bank Mandiri Sutomo) Telp. 0622 - 433788; 0813 9744 8215 HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” TANAM GAHARU INVESTASI MELEBIHI EMAS! Jual bibit gaharu aquilaria malaccensis tinggi mulai 20-100 CM, sedia fusarium ingul dan teknik mokulasi, sedia bibit kemenyan toba dll. Jl. Viyata Yudha Pematangsiantar. hub. HP 0813 1476 2472; 0812 2756 8840 LA ROSS SALON & FLORIST: Menerima: Make up dan sanggul, Rias pengantin, perawatan rambut, shomoting rambut. Juga menerima Roncean melati, Bunga tangan, Bunga papan, Bunga saub, Dekorasi pelaminan dll. Jl. Sisingamangaraja No. 324 Telp.08126382759

HORISON PHOTO: Spesial: •Pengadaan mesin photo copy, servis spare parts Fotocopy Rp 125/ lbr •Pasphoto/cetak photo. Jl. Justin Sihombing (Simp. Jl. Pantai Timur) No. 7 B P. Siantar HP 0813 6100 1200 (Jhon Purba) AMANAH TOURS AND TRAVEL: Tiket promo, Medan - Jakarta - Singapura - Bangkok dll. Garuda, Lion, Batavia, Sriwijaya, dll. Hotel Promo Domestik dan Internasional. Tiket taman hiburan universal studio dll. Info: Jl. Patuan Anggi No. 159 P. Siantar. Telp. 0622 - 22115; 0813 6443 2665 dan menerima agen tiket

SELASA 4 September 2012

Van Persie Tentang Kegagalan Penaltinya

„ Robin van Persie tampil memukau saat membuat trigol untuk memenangkan Manchester United atas Southampton

SOUTHAMPTON-RobinvanPersie tampil memukau saat membuat trigol untuk memenangkan Manchester United atas Southampton. Tapi,kenapadiasampaigagaldalam eksekusipenaltialaPanenkaitu? Di menit 69, saat MU tertinggal 1-2 di St Mary’s Stadium, Minggu (2/9/2012),VanPersiemajusebagai algojo penalti setelah dirinya dijatuhkan seorang pemain lawan di kotak 16 meter. Sebagaimana orang selalu tak menyangka jika penendang penalti melakukannya dengan mencungkil bola — diciptakan oleh Antonin Panenka dari Cekoslowakia di final Piala Dunia 1976, terakhir dilakukan oleh Andrea Pirlo di Piala Eropa 2012 -–, begitu pula yang dilakukan Van Persie. Sial buat dia, cungkilannya buruk dan bisa dihalau oleh kiper Kelvin Davis. Untungnya bagi dia, eks bintang Arsenal bisa mencetak gol lagi di menit 86 dan injury time, sehinggaMUmenang3-2,danVan Persie tetap jadi pahlawan. “Aku tidak tahu apa yang aku pikirkan

Napoli Atasi Fiorentina Lazio Hantam Palermo NAPLES - Napoli tak kehilangan angka saat menjadi tuan rumah untuk Fiorentina di pekan kedua Seri A. Lazio juga meraih kemenangan cukup telak atas tamunya Palermo. Menjamu La Viola di San Paolo, Minggu (2/ 9) malam, Napoli menang tipis 2-1. Di Olimpico, Lazio mengungguli Rosanero dengan skor 3-0.

membuatnyadimenit39dan82. Satu gol lain dari Biancoceleste diukir gelandang Antonio Candreva di menit 56. Sama seperti Juve dan Napoli, Lazio juga telah memiliki enam angka dari dua pertandingan. Mereka duduk di tempat ketiga hanyakarenataklebihbaikselisih golnya dari kedua rivalnya itu.

„ Marek Hamsik

Susunan Pemain


emenangan Napoli dibuka oleh Marek Hamsik di menit ke-10 babak kedua. Dari tendangan bebas yang dilepaskan Juan Zuniga, Hamsik menyundul bola, yang kemudian sempat mengenai Borja Valero dan bersarang di gawang Emiliano Viviano. Gol ini dicatat sebagai bunuh diri Valero. Di menit 75 Il Patenopei menggandakan keunggulannya. Blerim Dzemaili meluncurkan tembakan setengah voli dari

depan kotak penalti dan mengubah kedudukan menjadi 20. Fiorentina tidak menyerah dan mencoba menekan Napoli di sisa pertandingan. Atas upayanya itu mereka menghasilkan satu gol dari tendangan lengkung nan menawan dari Stevan

Jovetic di menit 87. Tapi itu tak cukup untuk menghindarkan skuat Vincenzo Montella dari kekalahan. Kemenangan kedua dari dua pertandingannya itu membuat Napoli berada di urutan kedua klasemen sementara. Mereka hanya kalah selisih gol dari Ju-

ventus, yang juga telah mengutip enam angka dari dua laga. Fiorentina, yang di pekan pertama menang 2-1 atas Udinese, turun ke peringkat 11. Sementara itu Miroslav Klose mencetakduadaritigagolkemenangan Lazio atas Palermo. Bomber veteran Jerman itu

Napoli: De Sanctis; Campagnaro, Cannavaro, Britos; Maggio, Behrami (Inler 52), Dzemaili, Hamsik (Donadel 89), Zuniga; Insigne (Vargas 81); Cavani Fiorentina: Viviano; Roncaglia, Gonzalo Rodriguez, Tomovic; Cuadrado, Romulo (Seferovic 85), Pizarro, Borja Valero, Pasqual (Fernandez 78); El Hamdaoui (Ljajic 69), Jovetic Lazio: Marchetti; Konko, Biava, Dias, Lulic; Ledesma; Mauri (Onazi 80), Gonzalez, Hernanes (Scaloni 86), Candreva; Klose (Kozak 89) Palermo: Ujkani; Pisano, Cetto, Von Bergen, Garcia; Giorgi (Arevalo Rios 51), Kurtic (Hernandez 58), Barreto, Bertolo; Ilicic, Miccoli (Dybala 58)

dengan penalti itu. Tadinya aku ingin menendang keras, sebagaimana selalu aku lakukan. Tapi di detik terakhir aku berubah pikiran,” ungkap pria 29 tahun itu kepada MUTV. “Tak cukup baik, makanya aku sedikit down. Jujur saja, aku kecewa. Aku memasang standar tertentu untuk permainanku, dan ketika hal seperti itu terjadi, apalagi saat tim Anda tertinggal 2-1, mestinya Anda tak boleh mengambil penalti seperti itu.” Van Persie menambahkan, dia siap disalahkan jika efek kegagalan penaltinya itu buruk buat tim. Dia pun berjanji akan belajar dari pengalaman ini, serta sangat lega karena akhirnya MU menang. “Saya kaget dia melakukannya dengan cara begitu,” komentar pelatih Sir Alex Ferguson. “Biasanya dia melesakkannya ke gawang. Setiap kali saya melihat menembak keras ke kiri dan kanan. Mungkin dia terlalu percaya diri. Tapi dia telah membayarnya dengan dua gol berikutnya.” (int)

Rodgers: Sahin Akan Semakin Bagus LIVERPOOL- Manajer Liverpool Brendan Rodgers mengaku puas dengan penampilan Nuri Sahin di laga melawan Arsenal, Minggu (2/9) malam WIB. Sahin diyakini cocok dengan gaya Liverpool dan tampil kian bagus. PertandingandiAnfieldtersebut menandai debut Sahin bersama Liverpool setelah resmi dipinjamkan oleh Real Madrid. Pesepakbola berdarah Turki itu diplot sebagai starter dan digantikan Jonjo Shelvey di menit 67. Sayangnya, debut Sahin tidak berakhir manis. The Reds dibungkam dua gol tanpa balas oleh Arsenal lewat Lukas Podolski dan Santi Cazorla. Meski tak menuntaskan laga, Sahin telah memberikan kesan positif buat Rodgers. Eks bintang Borussia Dortmund ini dipercaya akan berperan penting untuk Liverpool di musim ini. “Dia tidak punya waktu bermain yang banyak, Nuri, jadi mendapatkan 65 menit bagus untuk dia,” ucap Rodgers yang dikutip dari situs resmi klub. “Dia menunjukkan bahwa dia

„ Nuri Sahin adalah seorang pesepakbola yang hebat dan dia akan cocok dengan gaya permainan kami. Dia seorangpemudayangbaikdandiakini semakin bugar dan kuat dia akan tampil semakin bagus,” yakin eks manajer Swansea itu. Walau gagal bersama Madrid, Sahinpunyastatistikokesaatmasih bersama Dortmund. Di musim 2010-11 ia berperan besar dalam sukses Dortmund menjadi kampiun sekaligus menyabet pemain terbaik Bundesliga. (int)

„ Wenger

Wenger Tetap Percaya Giroud LONDON-Setelahmenjalanitiga lagabersamaArsenal,OlivierGiroud belumjugamamputampilimpresif. Kendatidemikian,manajerArsene WengerpercayabahwaGiroudbisa suksesdiPremierLeague. Pemain Prancis ini jadi satusatunya pemain rekrutan utama The Gunners yang ditunggu golnya. Soalnya Lukas Podolski dan Santi Cazorla sudah mencatatkan nama mereka di papan skor dalam kemenangan 2-0 atas Liverpool di Anfield, kemarin malam. Statistiknya pun tidak terlalu bagus; total tujuh tembakan, tanpa assist, sehingga tak ayal top skorerLigue1dimusimlaluinipun mulaidiragukan,apakahdiamam-




Punya kendaraan roda 2 (dua)? anda Pria/Wanita tamatan SLTA, bergabunglah bersama kami. Fasilitas yang didapat: • Insentive • Bonus • Karir • Komisi Kirimkan lamaran anda ke:


Jl. Sangnawaluh Komp. Megaland Blok A No. 24 P. Siantar

Tuliskan kode KARIR di sudut kanan amplop & cantumkan nomor Telp/HP yang bisa dihubungi

LOWONGAN KERJA Distributor mesin-mesin penggandaan / cetak di Sumut dn NAD, kantor pusat di Jakarta membutuhkan SEGERA tenaga Sales Representatif (SR) dan Teknisi (Tak) dengan persyaratan sbb: 1. Pria, usia max. 30 tahun untuk SR dan 23 tahun untuk Tek 2. Pendidikan min. D3 untuk SR dan SMK Elektronika untuk Tek 3. Dapat mengoperasikan komputer (Ms. Office) 4. Memiliki kendaraan sendiri SR 5. Berbadan sehat, ramah, pekerja keras dan tidak sedang kuliah 6. Untuk ditempatkan di P. Siantar Kami menawarkan status pegawi tetap, insentif, tunjangan kesehatan, asuransi, jamsostek dan peningkatan karir Surat lamaran lengkap pasphoto terakhir dapat langsung atau dikirim ke: Perwakilan PT SETIAWAN SEDJATI Jl. Bendungan No. 10 Kel. Aek Nauli, Siantar Barat Pematangsiantar Telp. 0622 - 435825; HP 0853 6298 2300 (Paul)

pu memenuhi ekspektasi. Wenger menganggap penilaian negatif yang dialamatkan terhadapGiroudmasihterlaludini.Laga ketat melawan The Reds diyakini akan jadi proses pembelajaran untuk pemainnya itu. “Saya percaya dengan dia,” ucap Wenger seperti diwartakan Mirror. “Giroud sedang dalam masa adaptasi. Dia sudah menunjukkan bahwa dia siap dalam sebuah pertarungan dan saya yakin dia akan beradaptasi dengan intensitas striker Inggris.” “Melawan (Martin) Skrtel dia telah menemukan bagaimana sebenarnya Premier League itu,” pungkas The Professor. (int/int)

SELASA 4 September 2012

ENGLISH PREMIER LEAGUE No 1 2 3 4 5 6 7 8 9 10

Team Chelsea Swansea City West Brom Man City Man United Everton West Ham Arsenal Wigan Newcastle

M 3 3 3 3 3 3 3 3 3 3

M 3 2 2 2 2 2 2 1 1 1

S 0 1 1 1 0 0 0 2 1 1

K 0 0 0 0 1 1 1 0 1 1

SG 8-2 10-2 6-1 8-5 6-5 4-3 4-3 2-0 4-4 3-4

Nilai 9 7 7 7 6 6 6 5 4 4

TOP SCORER Gol 4 4 3

Nama Klub Michu Swansea City R. van Persie Manchester United C. Tévez Manchester City

SPANISH LA LIGA No 1 2 3 4 5 6 7 8 9 10

Team M Barcelona 3 Mallorca 3 Málaga 3 Rayo Vallecano 3 Real Valladolid 3 Deportivo 3 Sevilla 3 Getafe 3 Atlético Madrid 2 Levante 3

M 3 2 2 2 2 1 1 1 1 1

S 0 1 1 1 0 2 2 1 1 1

K 0 0 0 0 1 0 0 1 0 1

SG 8-2 4-2 3-1 3-1 3-2 6-4 3-2 4-4 5-1 4-5

Nilai 9 7 7 7 6 5 5 4 4 4





TOP SCORER Gol 4 3 3

Nama L. Messi R. Falcao T. Hemed

Klub Barcelona Atlético Madrid Mallorca

BARCELONA- Gol tunggal Adriano membuat laga Barcelona versus Valencia di Camp Nou dimenangi tuan rumah. Los Cules pun tetap memuncaki klasemen sementara Liga Spanyol. Dari 14 tembakan yang dilakukan Barca, lima di antaranya mengarah ke gawang, tapi yang

Juventus Napoli Lazio Sampdoria Roma Catania Torino Genoa Internazionale Milan

2 2 2 2 2 2 2 2 2 2

2 2 2 2 1 1 1 1 1 1

0 0 0 0 1 1 1 0 0 0

TOP SCORER Gol 3 3 2

Nama S. Jovetiæ G. Pazzini G. Bergessio

Klub Fiorentina Milan Catania

menit Barca mendapatkan peluang lagi dari kerja sama Pedro dan Cesc Fabregas, tapi penyelesaian akhirnya tidak membuahkan gol. Tim tamu mencoba lebih berani menyerang di babak kedua. Namun mereka kesulitan menandangi penguasaan bola yang sudah jadi trade mark Barca. Statistik mencatat, ball possession tuan rumah 67% sedangkan El Che 33%.

Kesempatan terbaik Barca di babak kedua terjadi ketika Alexis Sanchez berhasil membuka pertahanan lawan, tapi tembakan lanjutan dari Fabregas melambung. Valencia sempat menggetarkan gawang Victor Valdes melalui tendangan Victor Ruiz, tapi gol tersebut dianulir wasit karena terjadi offside. Sampai pertandingan selesai

skor tidak berubah, tetap 1-0. Susunan pemain: Barcelona: Valdes; Alves (Alba 46), Pique, Mascherano, Adriano; Fabregas (Iniesta 64), Xavi, Song; Alexis (Busquets 87), Messi, Pedro Valencia: Diego Alves; Pereira, Rami, V. Ruiz, Cissokho; Feghouli (Valdez 81), T.Costa, Abelda (Gago 77), Guardado (Viera 77); Jonas, Soldado

Roma Tekuk Inter 3-1 di Meazza Rumor-Rumor di Belakang

ITALIAN SERIE A 1 2 3 4 5 6 7 8 9 10

menembus gawang Diego Alves adalah yang dihasilkan Adriano di menit 23, menjadikan pertandingan ini berakhir 1-0. Pemain berpaspor Brasil membuat gol tersebut setelah mendapatkan bola dari sepak pojok pendek, lalu dari sudut kotak penalti melepaskan tembakan ke bagian atas tiang jauh gawang Valencia. Gol itu membuat permainan lebih terbuka. Berselang lima

0 0 0 0 0 0 0 1 1 1

6-1 5-1 4-0 3-1 5-3 5-4 3-0 4-3 4-3 3-2

6 6 6 5 4 4 3 3 3 3

MILAN-ASRomamemetikkemenangan pertamanya di musim ini. Bertandang ke Giuseppe Meazza, Roma menang 3-1 atas Inter Milan. Di laga yang dimainkan di Giuseppe Meazza, Senin (3/9) dinihari WIB, Roma unggul lebih dulu saat laga berjalan 15 menit. Umpan Francesco Totti dari sisi kiri disundul oleh Alessandro Florenzi yang berdiri bebas di dalam kotak penalti Inter. Tertinggalsatugol,Intermengambil inisiatif menyerang. Tapi peluang Inter lewat Diego Milito di menit ke17 masih mampu digagalkan oleh Maarten Stekelenburg. Inter kembali mendapat peluang, kali ini lewat tendangan bebas Wesley Sneijder. Namun bola eksekusi Sneijder bisa diamankan oleh Stekelenburg. Di ujung babak pertama, Inter menyamakan kedudukan lewat sepakanAntonioCassano.Tembakannya mengenai Nicolas Burdisso dan mengecoh Stekelenburg. Hingga turun minum, skor imbang 1-1 tetap bertahan. Roma mendapat peluang emas di awal babak kedua. Berawal dari umpan Panagiotis Tacthsidis, Pablo Osvaldo yang berdiri bebas kemudianmelepaskantembakan.Tapisial bagi Osvaldo, upayanya masih belum menemui sasaran.

Osvaldo membawa Roma unggul di menit ke-67. Meneruskan umpan Totti, Osvaldo mencungkil bola melewati Luca Castelazzi dan mengubah skor menjadi 2-1. Marquihno menambah keunggulan Roma di menit ke-79. Menerima umpan dari Osvaldo, Marquinho yang bergerak dari sisi kiri kemudian melepaskan tembakan dari sudut sempit ke pojok gawang Cas-

telazzi. Di masa injury time, Roma harus bermain dengan 10 orang. Osvaldo menerima kartu kuning kedua setelah melakukan handball. Hingga peluit panjang berbunyi, skor 3-1 untuk keunggulan Roma tetap tidak berubah. Dengan kemenangan ini, Roma merangkak ke peringkat lima dengan empat poin. Sementara Inter tertahan di posisi delapan dengan tiga poin.

„ Roma Tekuk Inter 3-1 di Meazza Susunan Pemain: Inter: Castellazzi; Zanetti, Silvestre, Ranocchia, Nagatomo; Guarin, Gargano (Coutinho 76), Pereira (Cambiasso 66); Sneijder; Cassano (Palacio 50), Milito

Roma: Stekelenburg; Piris, Burdisso, Castan, Balzaretti (Taddei 56); Florenzi, Tachtsidis, De Rossi (Marquinho 32); Destro (Lamela 69), Osvaldo, Totti

Wajah Sedih CR7 MADRID-Belumdiketahuisecara pastiapayangmenyebabkanCristiano Ronaldobersedihhati.Spekulasimenyebut,sipemaininginmeninggalkan Real Madrid karena beberapa persoalan tertentu. Wajah sendu pemain Portugal itu jelasterlihatsetelahmencetakduagol daritigagolMadridkegawangGranada padaSenin(3/9)diniharitadi.Jangankan melakukan selebrasi, ia bahkan tidaktersenyum. Seusaipertandingan,Ronaldomengungkapkan kepada media bahwa dia sedang tidak bahagia dan klub mengetahui situasi tersebut. Namun demikian,pemainterbaikdunia2008 initidakmenjelaskanlebihlanjutsoal permasalahan ini. Dugaan bahwa Ronaldomarahdengankemenangan Andres Iniesta dalam pemilihan pemainterbaikUEFA2011/12bukanlah alasannya. “Tidak ada hubungannya denganitu.Iniestapantasmendapatkannya,”ujarRonaldo. Lantas apa? Dilansir Football Espana, radio terkemuka Spanyol CadenaSERmengklaimRonaldotelah mengungkapkanketidaknyamannya diMadridkepadaPresidenFlorentino Perez dan direktur umum Jose Angel SanchezdalampertemuanpadaSabtu (1/9).

Ditambahkan pula ada isu bahwa Ronaldotidakakurdenganbeberapa rekan satu timnya. Mantan pemain Manchester United itu kabarnya tak senang dengan Marcelo yang barubaruiniberkomentarbahwakiperIker Casillas lebih pantas memperoleh Balon d’Or ketimbang dirinya, yang mana itu diyakini akan merugikan Ronaldo. Sedangkandarikabaryangdidapat Telegraph, penyebab Ronaldo gusar adalahperlakuanklubterhadapKaka. Pemain Brasil tersebut kini tidak jelas masa depannya karena tak ada klub yangbersediamenggaetnyalantaran gajinya yang tinggi, namun juga tak masukdalamrencanaJoseMourinho. RonaldosudahbermukimdiMadrid selamatigatahundanselamaitupula ia menjadi pemain terbaik mereka dengan andil besarnya dalam sukses meraihCopadelReydanjuaraLaLiga. Musim lalu, Ronaldo mengatakan akan senang untuk menghabiskan kariernya bersama Los Merengues. Tampaknyaitumenjadiindikasibahwa dia menginginkan sebuah kontrak baru,namunsampaisaatiniklubbelum menunjukkan tanda-tanda akan menawarikesepakatanbaru. Well,apayangsebenarnyaterjadidenganRonaldo?(int)




Edisi 49 „ Tahun IX


8 Peserta Asal Sibolga-Tapteng Lulus Seleksi Akademis CALON PRAJA IPDN MEDAN- Sebanyak 102 peserta dari 518 orang yang mengikuti tes dinyatakan lulus seleksi akademis pada penerimaan calon praja Institut Pemerintahan Dalam Negeri (IPDN) tahun ajaran 2012/ 2013. Delapan di antaranya



berasal dari Sibolga dan Tapteng. Kepala Badan Kepegawaian Daerah (BKD) Provinsi Sumut (Provsu), Suherman mengemukakan hal itu kepada ‹ ‹ Baca

8 Peserta..Hal 6

Diancam, Bonaran Polisikan Muchtar MEDAN- Bupati Tapteng Raja Bonaran Situmeang melaporkan anggota DPRD Sibolga Muchtar Nababan ke ‹ ‹ Baca

Diancam..Hal 6


„ Personel Polres Sibolga melakukan olah TKP di lokasi tewasnya Lie Leng Wan, Senin (3/9).


„ Pancuran tempat korban menyuci.

Lie Leng Wan Tewas di Pancuran Santeong “Memang Lie Leng Wan sudah sering sakit-sakitan, apalagi dia sudah berumur dan tidak ada yang merawatnya setiap hari,” tutur Anim (52) yang merupakan

SIBOLGA- Lie Leng Wan alias Carles (50) ditemukan tewas dengan hanya mengenakan celana dalam di sebuah pancuran di Santeong, Kelurahan Pancuran Gerobak, Sibolga, Senin (3/9) sekira pukul 10.00 WIB. Pihak keluarga menduga warga Jalan SM Raja, Gang Suka Jadi, Pancuran Gerobak ini meregang nyawa karena sakit yang dideritanya.

‹ ‹ Baca

Lie Leng..Hal 6

Pakai Solar Subsidi, Truk Mitra TPL akan Ditindak HUMBAHAS- Polres Humbang Hasundutan akan menindak tegas pengemudi maupun pengusaha truk angkutan kayu milik pabrik pulp (bubur kertas) PT Toba Pulp Lestari (TPL) jika tetap menggunakan BBM jenis solar bersubsidi. “Kita telah mendapat TR (telegram) dari Polda Sumatera Utara

Tidak ada alasan lagi nantinya tidak tau aturan.

terkait Peraturan Menteri Energi dan Sumber Daya Mineral (ESDM) Nomor 12 Tahun 2012 tentang pengendalian penggunaan BBM,” ujar Kapolres Humbahas AKBP Verdy H Kalele saat ditemui METRO di Mapolres setempat, Senin (3/9).

AKBP Verdy H Kalele Kapolres Humbahas

‹ ‹ Baca


4 Tewas, 15 Luka-luka AEKKANOPAN- Kecelakaan lalu-lintas antara bus Medan Jaya BK 7448 DK dan dump truk BH 8320 BO terjadi di Jalinsum Asahan-Labuhanbatu tepatnya di km 228229, Dusun Pertanian, Desa Damuli Pekan, Kualuh Selatan, Labuhanbatu Utara, Senin (3/9) sekira pukul 01.00 WIB. Akibat insiden ini, 4 penumpang bus tewas, dan 15 luka-luka. Informasi diperoleh dari beberapa warga, Heri (30), Eko (33) dan Eri (27) mengatakan, bus Medan Jaya yang dikemudikan Bemo Sebayang (kabur setelah kejadian, red) melaju dengan kecepatan ‹ ‹ Baca

4 Tewas..Hal 6

Pakai..Hal 6

Diduga Idap AIDS, Mantan Honorer Meninggal

„ Bonaran Situmeang


„ dr Donna Pandiangan saat melakukan sosialisasi penyakit HIV AIDS dan penanggulangannya kepada warga Sibolga Julu, Senin (3/9) di Sibolga.

SIBOLGA- Setelah sempat mendapat perawatan sekitar empat jam di RSU Adam Malik Medan, nyawa H (32) warga Sibolga tidak ‹ ‹ Baca

Diduga..Hal 7

Ketika Para Pesepak Bola Indonesia Bergaya di Catwalk

Ponaryo Menahan Senyum, Jajang Sempat Gemetar Sejumlah pemain sepak bola menjadi model dadakan atas permintaan mantan punggawa timnas yang kini menyambi desainer, Isnan Ali. Hanya berlatih sekali, ada yang santai, ada pula yang sampai berkeringat dingin. M Ali Mahrus, JAKARTA

‹ ‹ Baca

Pria..Hal 6

TATAPAN matanya lurus. Di bawah sorot lampu disko dan

iringan musik mengentak, bibirnya tampak menahan senyum. Dengan langkah mantap, dia bergaya bak model profesional memamerkan pakaian yang dikenakan. Padahal, catwalk sama sekali bukan panggungnya. ‘Tempat bermainnya’ sehari-hari justru di lapangan hijau. Ya, dia adalah Ponaryo Astaman, mantan kapten timnas Indonesia, yang kemarin malam bergaya mengenakan kaus hitam dengan celana dilipat di bawah lutut ber-

dampingan dengan model wanita cantik. Ponaryo tak sendirian di fashion show bertema UIFashionWeek di salah satu mal di kawasan Jakarta Selatan yang berlangsung Sabtu malam lalu (1/9) itu. Melenggang tepat di belakangnya, Jajang Mulyana. Striker tinggi besar asal klub Mitra Kukar itu juga tampak percaya diri menjadi model. Wajahnya dingin dan langkahnya ‹ ‹ Baca

Ponaryo..Hal 7


„ Jajang Mulyana saat bergaya di catwalk bertema UIFashionWeek di salah satu mal di kawasan Jakarta Selatan, Sabtu malam lalu (1/9).



4 September 2012

Banyak Warga Tak Diundang Pendataan e-KTP TAPIAN NAULI-Camat Tapian Nauli J Sirait, SH dituding warga Tapian Nauli I Dusun I dan Dusun V hanya berpihak pada satu kelompok saat pelaksanaan pilkades, menyebabkan banyak warga tidak mendapatkan undangan untuk pendataan e-KTP.


HAHAL BIHALAL- Pengurus dan anggota Osibisa Sibolga-Tapteng kompak bersama saat Halal Bihalal, kemarin malam.

OSIBISA Gelar Halal Bihalal

Tetap Eksis di Usia 5 Tahun PANDAN-Organisasi Sosial Serba Bisa (Osibisa) SibolgaTapteng menggelar Halal Bihalal sekaligus silaturahmi Idul Fitri 1 Syawal 1433 H di Lapo Harambir Hotel Bumi Asih Pandan, kemarin malam. Hadir segenap pengurus dan anggota organisasi yang telah berusia 5 tahun itu. “Halal Bihalal ini merupakan momentum memupuk jalinan silaturahmi antar keluarga besar Osibisa, yang bertepatan pula

pada momen Hari Raya Idul Fitri,” tutur ketua Osibisa Sibolga-Tapteng, Baim Lubis dalam sambutannya. Halal Bihalal digelar secara sederhana, namun penuh nuansa kekeluargaan. Dikemas dengan acara makan bersama dengan selingan lagu-lagu yang dibawakan para anggota yang menyumbangkan suaranya. Baim menambahkan, sesudah berdiri 5 tahun, Osibisa tetap eksis. Bahkan, keluarga

besar Osibisa turut bersyukur karena ada beberapa anggotanya yang akan berangkat ke tanah suci untuk menunaikan ibadah haji. Ada juga keluarga Sufahmat yang baru kembali ke SIbolga yang merupakan kampung halaman. “Kami bersyukur, Osibisa tetap eksis dengan jumlah anggota sebanyak 50an KK. Organisasi ini bukanlah organisasi politik. Tapi bersifat sosial kemasyarakatan. Ada pegawai negeri, pensiuanan,

pengusaha swasta, dan dari berbagai latar belakang profesi lainnya,” timpal Baim. Selama perjalanannya, Osibisa aktif dalam kegiatan sosial kemasyrakatan. Seperti menggelar arisan rutin tiap bulan. Touring Komunitas Sepedamotor Osibisa pada hari libur ke ke luar daerah, seperti ke Padang Sumbar, Riau dan Pekan Baru, Berastagi, dan daerah lainnya, sambil mempromosikan objek-objek wisata yang ada di

Sibolga-Tapteng. Osibisa juga telah menunjukkan kehadirannya ke tengah masyarakat dengan turut memberi bantuan kepada para korban bencana alam yang terjadi di Sibolga dan Tapteng. “Jadi Osibisa ini bukan organisasi untuk hoga-hoga,” pungkas Baim. Di kesempatan itu, Zufrianto Hutagalung SH yang mewakili anggota juga menyampaikan sambutan dan sepatah kata dalam momen Idul Fitri. (mor/nasa)

Sukran Bagikan Buku “Si Anak Singkong”

SI ANAK SINGKONG- Wabup Tapteng, H Sukran Jamilan Tanjung SE menerima secara simbolis seribu eks buku “Chairul Tanjung Si Anak Singkong” langsung dari Chairul Tanjung (kanan), untuk dibagikan gratis kepada masyarakat Tapteng dan Sibolga, kemarin di Jakarta.

PANDAN-Wabup Tapteng H Sukran Jamilan Tanjung SE membagikan buku “Chairul Tanjung Si Anak Singkong” kepada para tamu di acara Open House Idul Fitri di rumah Dinas Wabup Jalan R Junjungan Lubis, Pandan, Senin (3/9). Di mana sebelumnya, Chairul Tanjung sendiri yang menitipkan seribu eksemplar buku itu kepada Wabup untuk dibagikan gratis kepada warga Tapteng dan Sibolga. “Beberapa hari yang lalu Bang Chairul Tanjung yang langsung menyerahkan seribu eksemplar bukunya. Beliau titip salam kepada seluruh masyarakat Tapteng dan Sibolga yang merupakan kampung halamannya. Ayah beliau lahir di daerah kita ini,” tukas Wabup, mengawali sambutannya sebelum membagikan buku itu. Buku “Chairul Tanjung Si Anak Singkong” diluncurkan bertepatan usia Chairul Tanjung (CT) setengah abad. CT, demikian nama panggilannya, adalah peng-

KELUHAN MAAG HILANG KARENA MINUM YANG ALAMI Sakit maag s e l a l u diidentikkan dengan telat makan. Itu jugalah yang dialami oleh Ernawati, SE yang telah 6 t a h u n menderita maag. Penyakit yang bisa menyerang anak-anak sampai orang dewasa ini memang bukan hal yang baru di masyarakat kita, "Kalau sakit maag saya kambuh, lambung sering terasa mual dan nyeri," ujar wanita berusia 51 tahun itu menceritakan keluhan yang dirasakannya. Ia selalu berupaya untuk mengatasi keluhannya itu, namun belum menunjukkan perkembangan yang berarti, sampai akhirnya Ia mengetahui tentang Gentong Mas, minuman herbal dengan bahan utamanya yaitu Gula Aren dan Nigella Sativa (Habbatussauda) yang salah satu manfaatnya dapat mengatasi maag, "Sudah 10 bulan ini saya minum Gentong Mas secara rutin. Puji Tuhan sekarang keluhan saya sudah tidak ada." Terang PNS tersebut dengan gembira. Gastritis atau lebih dikenal sebagai maag berasal dari bahasa Yunani yaitu Gastro, yang berarti perut/lambung dan Itis yang berarti inflamasi atau peradangan dengan gejala-gejala seperti perih atau sakit seperti terbakar pada perut bagian atas yang

dapat menjadi lebih baik atau lebih buruk ketika makan, mual, muntah, kehilangan selera, kembung, terasa penuh pada perut bagian atas setelah makan, kehilangan berat badan. Beberapa bentuk Gastritis kronis dapat meningkatkan risiko kanker lambung dan jika dibiarkan tidak terawat dapat menyebabkan peptic ulcers dan pendarahan pada lambung. Pengalaman mengatasi maag dengan Gentong Mas yang dirasakan oleh ibu 3 orang anak itu membuatnya tergerak untuk membagi pengalamannya dengan orang lain, "Semoga pengalaman saya ini bermanfaat." Harap warga Cinta Damai, Medan, Sumatera Utara tersebut. Habbatussauda dalam Gentong Mas bermanfaat untuk memelihara pembuluh darah, perbaikan sistem saraf, optimalisasi aktifitas hormon, meningkatkan proses penyembuhan dinding lambung, meningkatkan daya tahan tubuh dan bersifat anti bakteri. Selain itu juga, Habbatussauda dapat mengatasi gangguan tidur dan relaksasi. Cabe Jawa yang terdapat dalam Gentong Mas bermanfaat untuk mempercepat penyembuhan mukosa lambung. Sedangkan kandungan yang terdapat dalam Kayu Manis bersifat anti kembung dan mules. Kapulaga dalam Gentong Mas bermanfaat sebagai

anti muntah serta radang lambung. Dan Gula Aren bermanfaat untuk menurunkan penyerapan lemak dan perbaikan sistem saraf. Untuk hasil cepat dan maksimal dianjurkan untuk makan teratur, hindari alkohol, rokok, kendalikan stress, dan jika memungkinkan hindari obat penghilang nyeri. Manfaat yang hebat bagi kesehatan dan rasa yang lezat membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/ toko obat terdekat atau hubungi: Medan : 081384 777787 Sidikalang: 081384777787 Humbahas : 0821 6864 2805 Gunung tua : 081384777787 Batubara : 081384777787 Tobasa : 0813 8477 7787 Nias : 0813 8477 7787 Tebing Tinggi : 0813 2209 9495 Siantar : 082167538848 Binjai : 0813 9866 6166 Lbk Pakam : 0813 6227 3308 Karo : 0821 6753 8828 Langkat : 0813 6227 3308 Kisaran : 0623 7014 362 Tj. Balai : 0812 6349 5563 Labura : 0813 7059 0972 Labuhan batu: 0852 7784 4950 P. Sidimpuan : 0821 6346 6597 Sibolga : 0813 7625 2569 Taput : 081263243034 Madina : 082163466597 Dolok Sanggul : 0821 2928 4752. Depkes:P-IRT:812.3205.01.114

usaha Indonesia yang sukses dalam wirausahanya dan memperluas usahanya. Dalam pengantar buku itu, dituliskan CT adalah anak muda yang sukses. Kesuksesannya dirintis, dikembangkan, dan diperoleh berkat kerja keras, bekerja tuntas, punya komitmen, dan sedikit banyak digerakkan ambisi. Biografi Chairul Tanjung diawali dengan kisah bagaimana di tengah keterbatasan kondisi ekonomi keluarga, CT mampu melanjutkan pendidikan ke perguruan tinggi. Kedua orangtua sangat tegas dalam mendidik anakanaknya, termasuk CT. Orangtuanya mempunyai prinsip agar bisa keluar dari jerat kemiskinan, pendidikan merupakan langkah yang harus ditempuh dengan segala daya dan upaya. Apa pun akan mereka upayakan agar anak-anak mereka dapat melanjutkan pendidikan tinggi sebagai bekal utama kehidupan masa depan. Bab-bab berikutnya masih menceritakan kehidupan masa muda CT. Saat menjadi mahasiswa sampai kisah awalnya menjadi wirausaha. Tahun 1987, CT menjadi kontraktor pembangunan pabrik sumpit di Citeureup, Bogor, seluas 800 meter persegi. Tapi yang jadi malah pabrik sandal. Buku ini juga mengisahkan kehidupan rumah tangga dan keluarga CT, ketika CT bertemu dengan perempuan Jawa, Anita Ratnasari, yang tegas dan tegar. Dalam buku ini, CT mengungkapkan bahwa baginya ibu adalah segalanya. CT percaya bahwa surga ada di telapak kaki ibu. Bila kita benar-benar berbakti kepada ibu sepenuh hati dan ikhlas, maka surga akan kita gapai di dunia. Itu yang saya alami sendiri, CT berpendapat. CT juga menyampaikan pandangan-pandangannya tentang persoalan ekonomi dan menceritakan aktivitasnya sebagai pengusaha. CT mengembangkan Para Group, kemudian mengganti nama perusahaannya menjadi CT Corp. Secara umum CT Corp terdiri atas tiga perusahaan subholding yaitu Mega Corp, Trans Corp, dan CT Global Resources. Mega Corp adalah perusahaan induk untuk jasa keuangan yang melayani masya-

rakat di sektor perbankan, asuransi, pembiayaan, dan pasar modal. Trans Corp adalah perusahaan induk yang bergerak di bisnis media, gaya hidup, dan hiburan. Dalam perusahaan ini, terdapat dua stasiun TV, yaitu Trans TV dan Trans 7, portal berita Detik, dan perusahaan ritel Careefour. Selain itu juga ada perusahaan yang bergerak di bidang makanan dan minuman, hotel, biro perjalanan, dan sejumlah department store yang menyediakan kebutuhan fashion merek terkenal dan highend. Sedangkan CT Global Resources adalah perusahaan induk yang fokus pada bisnis perkebunan. Buku ini menarik dibaca dan bermanfaat bagi siapa saja yang ingin mengetahui bagaimana seorang CT berhasil menjadi pengusaha sukses dengan hasil kerja kerasnya dan hasil keringatnya sendiri, dan bukan warisan keluarga konglomerat. “Buku ini berisi kisah hidup Bang Chairul Tanjung. Dari anak desa yang suskses menjadi pengusaha dan konglomerat. Tapi beliau tetap rendah hati hingga digelari “Si Anak Singkong”. Buku ini bisa memotivasi kita untuk meraih suskes dan sangat inspiratif. Buku ini saya bagikan gratis kepada masyarakat Tapteng dan Sibolga, ke perpustakaan, sekolah, dan lembaga sosial lainnya. Beliau sendiri berkeinganan datang ke Tapteng dalam waktu dekat ini,” pungkas Sukran. Hadir di acara itu, Bupati Tapteng, Raja Bonaran Situmeang SH MHum bersama Ketua TP PKK Ny Normaida Br Simatupang dan jajaran pimpinan SKPD, para camat dan lurah serta para PNS di lingkungan Pemkab Tapteng. Hadir juga Walikota Sibolga Drs HM Syarfi Hutauruk dan jajaran. Kapolres Tapteng AKBP Dicky Patrianegara SH SIK MSi beserta jajaran, Dansatradar 234 Sibolga, Dandenpom 1-2 Sibolga, Dandim 0211 TT. Hadir juga para pimpinan perbankan, tokoh agama dan masyarakat Tapteng dan Sibolga, pengurus dan anggota OKP, para pimpinan dan anggota DPRD Tapteng dan Sibolga, serta segenap elemen masyarakat lainnya. (mor/nasa)

Menurut salah seorang warga Tapian Nauli I, E Siagian (40), hingga saat ini dirinya belum mendapat undangan untuk pendataan e-KTP di kantor Camat Tapian Nauli, dan masih disebutkannya masih banyak warga lain yang mengalami hal serupa. “Paling menyedihkan undangan itu diberikan pada warga lainnya melalui orang-orangnya calon kades Erwin Sibagariang, yang mengesankan seolah-olah calon kades E Sibagariang sudah resmi menjadi kepala desa. Bahkan pakai memo dari E Sibagariang sudah bisa dilayani petugas, berarti camat juga tidak akan suka sama kami karena memang kami bukan pendukung E Sibagariang. Padahal undangan untuk perekaman data e-KTP seharusnya melalui kepala desa yang saat ini masih menjabat,” tuturnya. Menurut dia, dirinya sempat mempertanyakan undangan perekaman data e-KTP kepada kepala desa, namun kepala desa Tapian Nauli I justru mengatakan bahwa undangan tidak pernah diketahuinya beredar di tengah-tengah masyarakat. Untuk itu, dirinya selaku warga Tapian Nauli I meminta kepada Bupati Tapteng agar memperhatikan mereka selaku warga untuk dapat didata dalam e-KTP tanpa melalui Camat Tapian Nauli. Sedangkan Kepala desa Tapian Nauli I, Marwan Hutagalung yang dikonfirmasi METRO Senin (3/9) di kediamannya, mengatakan bahwa dirinya me-

mang didatangi banyak warga Tapian Nauli I terutama Dusun I dan V untuk mempertanyakan masalah undangan perekaman e-KTP. “Hingga saat ini, saya belum pernah ada koordinasi dengan pihak kecamatan untuk penyampaian undangan perekaman e-KTP di Tapian Nauli I, bahkan saya dengar undangan itu langsung diserahkan melalui orang-orang tertentu,” katanya. Kepala Desa Tapian Nauli I Marwan Hutagalung mengaku heran mengapa bukan aparat desa yang menyebar undangan pada warga Tapian Nauli I. “Kenapa seorang camat melayani warga seperti itu? Apakah memang calon kades itu sudah dilantik menjadi Kades Tapian Nauli? Kita sudah cek ke warga yang ternyata memang benar bahwa hingga saat ini mereka belum menerima undangan perekaman data e-KTP, bahkan jika undangan tidak ada, oknum calon kades itu dapat mengeluarkan memo secarik kertas yang dibawa ke kantor Camat Tapian Nauli agar dapat dilayani oleh petugas. Peraturan bagaimana itu?,” ujarnya. Sedangkan Camat Tapian Nauli Juminta Sirait saat dikonfirmasi, mengatakan bahwa undangan yang datang ke kantor kecamatan untuk perekaman data e-KTP dibatasi, dan nantinya semua akan dipanggil. Sedangkan terkait adanya Memo yang dikeluarkan oleh calon kades, dirinya membantah hal tersebut. “Tidak ada itu,” ujarnya singkat. (tim/nasa)

Tagih Janji Kampanye

Mahasiswa Demo Bupati MADINA- Puluhan mahasiswa dari Himpunan Mahasiswa Islam (HMI) Cabang Mandailing Natal (Madina) unjukrasa menuntut Bupati Madina Hidayat Batubara merealisasikan janji-janji kampanyenya, Senin (3/9). Mahasiswa menilai Hidayat Batubara sudah melenceng dari apa yang dijanjikan di hadapan ratusan ribu masyarakat Madina, termasuk dalam hal pemberantasan tindak pidana korupsi dan penyalahgunaan jabatan. Koordinator aksi Abdul Muluk dalam orasinya mengatakan, sejak Hidayat Batubara-Dahlan Hasan Nasution dilantik sebagai Bupati dan Wabup Madina pada tanggal 28 Juni tahun lalu, belum ada perubahan sama sekali di Madina. Menurut HMI, Madina saat ini di ambang kehancuran dan sebagian masyarakat Madina tidak percaya Hidayat-Dahlan mampu membawa Madina ke arah yang lebihbaik,bahkanmenurutmahasiswa, mereka atas nama HMI sudah pernah mengingatkan Bupati Madina agar tidak melakukan KKN sebab sewaktu masih sebagai calon bupati pasangan ini selalu menyuarakan pasangan yang anti KKN. “Kami dari HMI Madina meminta Bupati agar menjalankan roda pemerintahan sesuai dengan janji-janji kampanye dulu,” seru mahasiswa. Dalam pernyataan sikap mereka, mahasiswa meminta Bupati Madinaagarkomitmenmenjalankan roda pemerintahan sesuai dengan visi-misi (pendidikan gratis, kesehatan gratis dan lapangan kerjabaru).HMI melihatbelumada satupun yang sudah terealisasi bahkan yang ada sebaliknya yaitu meningkatnya angka pengangguran baru termasuk rencana pemangkasan tenaga honorer. “Dan banyak temuan kami mengenai kebobrokan pemkab Madina di

bawah kepemimpinan Hidayat Batubara, kami ingatkan tanda orang munafik adalah orang yang tidak menepati janji dan selalu berbohong,” teriak massa. Lalu, mahasiswa juga meminta Bupati Madina mencopot dan mengganti Plt Kadis PU Ir Parlaungan Lubis yang telah mencoreng nama baik Pemkab Madina terbukti dengan terkuaknya suap-menyuap untuk memeroleh paket proyek dan pembatalan tender.Ketikaitupararekanansempat mendatangi rumah dinas Bupati meminta pertanggungjawaban danuangmerekadikembalikan.Ini sudah menjatuhkan martabat pemerintahan. ”Kami juga meminta Bupati sebagai orangtua di Madina ini agar memikirkan kepentingan dan hajat hidup masyarakat daripada mengikuti balapan. Ingat Anda adalah orangtua seluruh masyarakat Madina. Dan apabila tuntutan kami ini diindahkan maka kami akan membawa masyarakat Madinauntukmenuntutjanji-janji bapakselakuBupatiMadina,”kata pengunjukrasa. Sebelum meninggalkan lokasi perkantoran, para pengunjukrasa sempat memasuki sekretariat Pemkab Madina bahkan hendak mencari bupati di ruang kerjanya, namun dengan pengawalan yang ketat dari aparat Polres dan Satpol PP Madina, pengunjukrasa ditahan di pintu awal ruang kerja Bupati dan terjadi aksi saling dorong denga petugas. Akhirnya, massa mahasiswa membubarkan diri karena tidak ada seorang pun perwakilan pemkab. Bupati Madina HM Hidayat Batubara yang dikonfirmasi METRO lewat telepon selulernya tidak bersedia menerima telepon wartawan. Saat dimintai tanggapan lewat pesan singkat, ia juga tidak memberikan jawaban apapun. (wan)

„ Mahasiswa saat berdemo di kantor Bupati.


4 September 2012

Kepala Korlantas Polri Irjen Pudji Hartanto.

“Sebanyak 66 persen dari 5,796 insiden kecelaksaan selama arus mudik-balik Lebaran 2012 disebabkan disebabkan unsur manusia. Seperti mengantuk, kelelahan, mabuk, sakit, mengunakan handhone, menerobos, melanggar batas, pindah jalur dan mendahului,”

“Intelijen negara terus memberi masukan kepada pemerintah untuk berupaya agar isu suku, agama, ras dan antargolongan (SARA) tidak Kepala Badan Intelijen Negara tumbuh subur,” (BIN) Marciano Norman.

Syahganda Nainggolan.

“Dahulu bangsa ini pernah mengalami junta militer dari Soekarno ke Soeharto. Namun setelah reformasi justru yang berkembang adalah desakan kapitalisme internasional, dengan kekuatan-kekuatan kapitalis di tanah air yang berusaha menguasai negeri dan kekuasaan politik secara nasional,”

Kirim Opini Anda ke email: metrotapanuli Maksimal tulisan 5.000 karakter

Sikap Kami Tabiat Buruk Penyerapan Anggaran KITA seperti nyaris kehilangan kata-kata ketika menyaksikan masih buruknya kinerja penyerapan anggaran oleh pemerintah. Penyakit tahunan itu amat sulit disembuhkan, bahkan ketika Presiden Susilo Bambang Yudhoyono sudah beberapa kali menyatakan kekecewaannya. Kondisi paling baru disampaikan Tim Evaluasi dan Pengawasan Penyerapan Anggaran (TEPPA) yang dibentuk Presiden. TimituterdiridariKepalaUnitKerjaPresidenBidangPengawasan dan Pengendalian Pembangunan Kuntoro Mangkusubroto, Wakil Menteri Keuangan Anny Ratnawati, dan Kepala Badan PengawasanKeuangandanPembangunan(BPKP)Mardiasmo. Berdasarkan laporan TEPPA, serapan khusus belanja modal 43kementeriandanlembagapadasemesterI2012masihrendah. Hingga saat ini baru 25 institusi yang kemampuan identifikasi paket pengadaannya di atas 60%. Sebanyak 37 institusi berkemampuan di bawah 60% dan 25 institusi tidak memiliki kejelasanpelaksanaanpenyerapan.Amatmungkinmerekaakan menumpuk penyerapan anggaran di akhir tahun. Masih banyak institusi yang belum memulai proses pengadaan lelang pada medio tahun ini. Padahal, hal itu menjadi indikator bagi tren realisasi penyerapan anggaran. Lebih parah lagi, TEPPA mencatat penyerapan anggaran belanja empat institusi hingga triwulan II 2012 masih 0%. Keempatnya ialah Kementerian Pemuda dan Olahraga, Badan Intelijen Negara, Badan Nasional Penanggulangan Terorisme, dan Dewan Kehutanan Nasional. Hingga kini, baru lima institusi yang mampu melelang paket kegiatan secara signifikan. Kelimanya ialah Badan Kepegawaian Negaradengancapaianlelang100%,BPBatam94%,BPKP81,5%, Kementerian Pekerjaan Umum 79,6%, dan Kementerian Koperasi dan Usaha Kecil dan Menengah 67,3%. Fakta itu sungguh menjadi potret betapa respons aparatur kita terhadap percepatan ekonomi amat lamban. Padahal, di tengah perekonomian dunia yang murung akibat krisis, stimulus APBN amat penting untuk mempertahankan atau bahkan mendongkrak pertumbuhan. Lambatnya penyerapan anggaran jelas bisa menjadi inefisiensi bagi perekonomian kita. Ia juga sebagai penanda tidak beresnya perencanaan. Tiap tahun, belanja APBN terus meningkat. Di RAPBN 2013 pemerintah bahkan menargetkan belanja negara Rp1.657,9 triliun,naikRp109,6triliun(7,1%)ketimbangbelanjaAPBNP2012. Jika dibandingkan dengan belanja negara di 2007, kenaikan belanja RAPBN 2013 malah mencapai dua kali lipat. Sayangnya, kenaikan belanja itu belum berbanding lurus dengan upaya keras membereskan hambatan penyerapan anggaran.Daritargetpenyerapan50%disemesterI,yangtercapai baru sekitar 30%. Untuk membereskan itu, sanksi tegas berupa pengurangan anggaran bagi institusi yang buruk dalam penyerapan harus benar-benar ditegakkan. Sebaliknya, ganjaran harus diberikan kepada institusi yang signifikan dalam menyerap anggaran. Sekadar pidato kekecewaan jelas tidak akan pernah menyelesaikan persoalan. (**)

Peraturan Baru Izin Lingkungan Banyak penanam modal asing (PMA) menginvestasikan sahamnya untuk pendidikan industri di Indonesia. Hal ini secara langsung akan memberikan dampak kepada taraf ekonomi nasional dengan meningkatnya penyerapan tenaga kerja, produk domestik bruto, maupun pajak arus distribusi produk. Namun, salah satu pertimbangan kuat dari perusahaan PMA adalah keadaan geografis yang strategis untuk membuang limbah industri ke badan lingkungan. Kegiatan industri di kota Cilegon mencatat sebanyak 84 perusahaan PMA dan 48 perusahaan PMDN.


Gugi Yogaswara

LIMBAH industri yang dihasilkan sangat bergantung dari jenis usaha yang diselenggarakan. Mayoritas industri yang bertempat di kawasan industri Cilegon adalah industri-industri petrokimia, logam, dan maupun manufaktur yang notabene menghasilkan limbah B3 yang dapat dikelola hanya setelah mendapatkan izin pengelolaan dari KLH. Aktifitas penanam modal tersebut sebenarnya sudah berlangsung dari tahun 90-an. Hal ini menjadi kesempatan yang baik untuk industri-industri asing tersebut. Pasalnya, perizinan lingkungan perusahaan dirasa masih belum mengikat aktifitas industri yang memiliki dampak lingkungan untuk turut serta manjaga bumi indonesia dari aktifitas pembuangan limbah industri. Pada tahun 1993, pemerintah membuat Peraturan nomor 51 tentang Analisis Mengenai Dampak Ling-

kungan (AMDAL) sebagai perbaikan dari PP No. 23 Tahun 1986. Istilah AMDAL kita kenal sebagai dokumen studi dampak dari aktifitas perusahaan terhadap lingkungan yang disusun pemrakarsa (pihak pemiliki industri) untuk disetorkan kepada pemerintah dalam rangka memperoleh izin mendirikan perusahaan. Kemudian, seiring perkembangan waktu, pemerintah memperbaiki PP No. 51 tahun 1993 menjadi PP No. 27 tahun 1999. Perbaikan ini dilakukan untuk menyeimbangkan aturan lingkungan dengan sistem kepemerintahan otonomi daerah, sehingga peraturan No. 27 tahun 1999 memberikan wewenang lebih bagi pemerintah daerah untuk memutuskan pertimbangan dampak lingkungan bagi kegiatan atau usaha yang dibangun di daerah masing-masing. Pembangunan kegiatan industri semakin marak terjadi di seluruh penjuru Indonesia. Mayoritas industri membangun lapak pabrik di lokasi dengan badan lingkungan yang strategis seperti di pinggir laut, pinggir danau, pinggir sungai, maupun di daerah dataran rendah. Hal ini sematamata untuk menunjang sumberdaya kegiatan industri dan mempermudah pembuangan limbah. Lokasi-lokasi tersebut adalah lokasi yang dapat menunjang penghematan perusahaan dalam mengolah limbah. Lokasi dekat badan air dapat menghemat biaya distribusi pembuangan limbah dengan hanya membuat saluran pendek pembuangan air limbah yang bermuara di laut atau badan air lainnya. Daerah dengan angin kencang dapat mempercepat dispersi pencemaran udara dari sumber emisi tak bergerak. Lalu, lokasi lapak pabrik yang dekat dengan pelabuhan dapat menghemat biaya pengangkutan limbah B3 pada pihak ketiga. Hal inilah yang terjadi pada daerah Cilegon dan sekitarnya yang menjadi pusat industri provinsi Banten. Aspek-aspek geografis tersebut dipe-

rebutkan oleh penanam modal untuk membangun lapak pabrik industri. Sementara, pihak badan lingkungan hidup daerah (BLHD) yang memiliki andil dalam menerapkan kebijakan lingkungan di daerah sepertinya kewalahan dalam menangani aktifitas pengelolaan limbah industri yang semakin lama semakin marak. Bahkan, peraturan pemerintah No. 27 Tahun 1999 seolah tidak mengantisipasi kualitas SDM pelaksana kebijakan dengan diberikannya wewenang lebih pada pemerintah daerah untuk mengelola kebijakan lingkungan. Hal ini menyebabkan penilaian aktifitas pengelolaan dampak lingkungan perusahaan samar terlihat. Laporan pengelolaan lingkungan perusahaan dinilai baik hanya karena parameter pencemar berada di bawah baku mutu limbah (BML). Di samping itu, komisi penilai AMDAL cenderung mereduksi makna AMDAL sebagai kajian ilmiah. Ini mengakibatkan studi AMDAL maupun UKL & UPL dipandang sebagai formalitas belaka. Hal yang serupa terjadi pada aspek hukum studi AMDAL. Penerapan hukum atas pelanggaran tidak difasilitasi secara khusus, mengingat AMDAL dan UKL & UPL adalah bukan keputusan Tata Usaha Negara (TUN). Kekurangan-kekurangan tersebut melandasi pemerintah merevitalisasi Peraturan Pemerintah No 27 tahun 1999 tentang Analisis Mengenai Dampak Lingkungan menjadi PP No. 27 Tahun 2012 tentang Izin Lingkungan. Beberapa perubahan mendasar yang terdapat dalam PP No. 27 tahun 2012 adalah reduksi jumlah dokumen AMDAL dari 5 dokumen menjadi 3 dokumen, reduksi waktu penilaian dokumen dari 180 hari menjadi selama 125 hari saja. Kemudian, PP baru ini juga mengembalikan makna AMDAL dan UKL & UPL sebagai kajian ilmiah yang harus dinilai secara ilmiah pula. Sehingga, penilaian dapat lebih jelas mengacu pada standar baku mutu yang sudah ditetapkan. Perubahan hukum juga terjadi pada skema izin lingkungan yang termasuk dalam keputusan Tata Usaha Negara. Hal ini menjadikan izin lingkungan memiliki sifat enforceable dan memiliki konsekuensi hukum atas pelanggaran yang terjadi. Lahirnya PP 27 Tahun 2012 ini diharapkan dapat menjadi landasar instrumen perlindungan dan pengelolaan lingkungan di indonesia. Aktifitas pengelolaan limbah industri telah banyak mencemari lingkungan, baik itu pencemaran air, tanah, maupun udara. Hal ini akan diperburuk jika penegakan hukum lingkungan tidak digalakkan dengan berintegritas di seluruh negeri. (**) Penulis adalah Mahasiswa Fakultas Teknologi Pertanian, Jurusan Teknik Sipil dan Lingkungan, alumnus SMAN 1 Kota Serang.



4 September 2012

SUAMI TENDANG ISTRI HAMIL HAKIM TOLAK EKSEPSI TERDAKWA SIMALUNGUN– Hakim Pengadilan Negeri (PN) Simalungun memutuskan menolak eksepsi terdakwa Agus Supriadi (31) yang mendorong kepala dan menendang paha istrinya Sarlina Saragih yang tengah hamil 16 minggu. Menurut hakim, eksepsi warga Kampung Baru, Kelurahan Kerasaan I, Kecamatan Pematang Bandar tersebut sudah masuk ke dalam pokok materi perkara. Hal itu disampaikan majelis hakim yang dipimpin Samuel Ginting beranggotakan Adria dan Heriyanti yang digelar di PN Simalungun, Senin (3/9). “Setelah mendengarkan eksepsi terdakwa yang dibacakan pada sidang sebelumnya. Maka majelis hakim yang menyidangkan perkara ini memutuskan menolak eksepsi terdakwa. Sebab isi eksepsi tersebut sudah masuk dalam pokok perkara,” terangnya. Sambungnya, maka persidangan akan dilanjutkan dan dimintakan kepada Jaksa Viktor Situmorang untuk menghadirkan saksi-saksi di persidangan. Selanjutnya sidang akan dilanjutkan pada Kamis (7/9). Sebelumnya Jaksa Penuntut Umum (JPU) Viktor Situmorang menyebutkan, korban melaporkan suaminya Agus Supriadi karena melakukan Kekerasan Dalam Rumah Tangga (KDRT). Peristiwa itu berlangsung pada Senin (12/12) sekira pukul 17.30 WIB. “Saat itu terdakwa datang

bersama istrinya ke rumah orangtua terdakwa yang terletak di Kampung Baru Kelurahan Kerasaan I Kecamatan Pematang Bandar. Tidak beberapa lama saksi Helen yang merupakan warga Perumnas Kerasaan datang ke rumah orangtua terdakwa. Kedatangan Helen bermaksud untuk menagih hutang kepada korban,” sebutnya. Dia menerangkan, saat Helen meminta hutang kepada Sarlina, terjadilah pertengkaran mulut karena korban tidak mau membayar hutangnya. Mendengar keribuatan itu, terdakwa pun mengambil jalan tengah agar hutang istrinya dibagi dua pembayarannya. “Hutang tersebut sebagian akan dibayar oleh terdakwa dan sebagian lagi akan dibayar oleh orangtuanya. Selanjutnya tidak beberapa lama terjadi cek cok mulut antara orangtua terdakwa dengan korban tentang masalah hutang,” ungkap Viktor. Karena merasa kesal, saat itu orangtua terdakwa mengatakan kepada korban ‘menantu kurang ajar’. Mendengar itu korban pun menjawab ‘ terserah kau mau jadi apa kalian terserah’. Mendengar pernyataan istrinya tersebut terdakwa pun emosi. Saat itu terdakwa mendorong korban dan menunjang paha kanan korban sebanyak satu kali hingga terjatuh ke tanah. (mua)


Ada Martil, Black Label, dan Civas Regal SIANTAR- Sebanyak 219 botol minuman keras (miras) berbagai merek dimusnahkan Polres Siantar di halaman Mapolres, Senin (3/9), sekira pukul 10.07 WIB. Minuman keras ini terdiri dari berbagai merek, red label, balleys, gordons, martini, jose cuervo, black label, winner, martil, civas regal, dan berbagai merek minuman keras lain dari dalam dan luar negeri.


DIMUSNAHKAN- 219 botol miras senilai Rp70 juta, dimusnahkan di halaman Mapolres Pematangsiantar, Senin (3/9).

Botol miras ini merupakan hasil operasi pekat selama bulan suci Ramadan tahun ini yang disita dari UD Makmur Jaya Jalan MH Sitorus. Kegiatan pemusnahan dilaksanakan di halaman Mapolres Siantar. Dihadiri jaksa fungsional Hari Darmawan dan Kasipidum R Parulian dari Kejari Siantar. Sementara dari Polres Siantar diwakili Kasat Narkoba AKP Sofyan dan puluhan personel polisi dari berbagai satuan. Turut hadir Ketua Front Pembela Islam (FPI) Kota Siantar Muhammad Syahril Chan. Secara simbolis, tiga botol minuman keras ini dilemparkan ke arah alat berat silinder oleh tiga orang yang mewakili kejari dan polisi. Secara perlahan alat berat ini menggilas semua botol minuman keras yang sudah ditumpuk di aspal. Usai pemusnahan, mewakili Kejari Siantar, Jaksa Hari Darmawan menyebutkan, nomor putusan pengadilan pemusnahan 219 miras ini yaitu Nomor:01 Pid

C/2012/PN PMS, tertanggal 13 Agustus 2012. Hari menambahkan, tertundanya pemusnahan ini dari jadwal yang ditentukan disebabkan Hari Raya Lebaran. Sehingga pemusnahan baru dapat dilaksanakan, Senin (3/9). “Tidak ada unsur kesengejaan terkait penundaan pemusnahan ratusan botol miras ini. Data yang dimusnahkan hari ini sesuai dengan yang tertera di kepolisian dan kejaksaan, tidak ada beda sama sekali. Saya kira tidak ada masalah dengan itu,” ujarnya. Sementara Ketua FPI Kota Siantar Muhammad Syahril Chan mengucapkan terima kasih kepada aparat kepolisian atas pemusnahan yang dilakukan. Mereka menghargai kinerja polisi dan berharap agar terus ditingkatkan. “Peredaran miras sudah menyeluruh di Kota Siantar, kita berharap polisi meingkatkan kinerjanya dalam pemberantasan miras ini. Jika sudah baik saat ini, untuk terus ditingkatkan kedepan,” jelasnya. (ral/dro)




BUAT LAPORAN- Harianto Sinaga (50) saat membuat laporan di Mapolres, Senin (3/9). Korban kehilangan Honda Vario BK 5763 TAM dari Gedung I Pasar Horas.

Satu Hari, Dua Kreta Matic Hilang

DARI SEPUTARAN PASAR HORAS SIANTAR- Dua kreta matic hilang dari seputaran Pasar Horas, Sabtu (1/9). Satu unit Yamaha Mio hitam BK 6658 WZ hilang dari Jalan Cipto Gg Suzuki milik Husni (46) pukul 08.30 WIB. Sementara satu unit Honda Vario BK 5763 TAM milik Mariana br Silalahi (45) hilang dari Gedung I Lantai Dasar Pasar Horas pada pukul 17.00 WIB. Menurut suami Mariana br Silalahi, Harianto Sinaga (50) ditemui di Pasar Horas, Senin (3/9), pada Sabtu pagi pukul 08.00 WIB, seperti biasa istrinya berangkat kerja untuk berjualan kain di Lantai Dasar Pasar Horas. Kreta inipun lalu diparkirkan di tempat biasa di Gedung I Lantai Dasar Pasar Horas. Namun bukan dilokasi parkir biasa dipinggir Jalan Sutomo. Lokasi parkiran kreta ini agak kedalam dan hanya berjarak sekitar 50 meter dari toko milik mereka. Namun diakuinya, lokasi parkir kreta ini tidak bisa dilihat langsung karena terhalang terpal dan agak sedikit berbelok dari tempat usahanya. Sekitar pukul 16.00 WIB, salah satu anggota keluarganya melintas dari lokasi parkir itu, kreta tersebut masih ada. Namun sekira pukul 18.00 WIB, sewaktu hendak pulang ke rumah, kreta tersebut sudah tidak ada lagi. Istrinya pun sangat terkejut dan sempat pingsan karena kreta miliknya hilang. Selama ini kreta itu selalu digunakan setiap hari ke tempat usaha di Pasar Horas. “Setelah kreta itu tidak ada, istri saya langsung menelpon saya. Setibanya saya dilokasi, saya lihat istri saya sudah pingsan. Saya sempat cari keliling-keliling Pasar Horas hingga pukul delapan malam, tapi tetap tidak ada juga dapat kreta itu,” ujar warga Jalan

Meranti, Siantar Utara ini. Disebutkannya, mulai Sabtu hingga Senin, dia telah berusaha mencari lokasi kreta itu diberbagai lokasi di Kota Siantar. Namun usahanya ini belum berhasil, sehingga keluarganya memutuskan melaporkan masalah ini ke Polres Siantar. “Kata istriku, kreta itu memang tidak dikunci stangnya, makanya mudah dibawa lari. Memang salah istriku jugalah ini. Didalam jok kreta itu ada STNK dan surat-surat kredit kreta itu. Baru enam bulanlah kami pakai kreta itu,” ujarnya lagi. Sabtu Pagi, Yamaha Mio Hilang Sebelumnya, pada pagi hari sekitar pukul 08.30 WIB, satu unit Yamaha Mio hitam BK 6658 WZ milik Husni hilang dari Jalan Cipto Gg Suzuki. Padahal selama ini korban selalu memarkirkan kretanya dilokasi itu selama bertahun-tahun. “Memang naas saya ini, saya hanya minum sebentar di kedai kopi Koktung Massa, paling lama setengah jam. Saya datang kesitu jam delapan pagi, saya pulang setengah sembilan. Saya pun heran, stang kreta itu saya kunci juga. Selama ini saya selalu parkir kreta disitu,” jelasnya. Dikatakan warga Jalan Mojopahit Siantar Utara ini, usai kejadian, dia berusaha mencari kreta itu di sekitaran Jalan Cipto, namun tidak berhasil. Disebabkan ada urusan mendesak di Medan, dia baru sempat melaporkan peristiwa ini ke Polres pada Senin. Kasubag Humas Polres Siantar AKP Altur Pasaribu membenarkan laporan pengaduan kedua korban. Saat ini, pihaknya sedang melakukan penyelidikan identitas pelaku yang mengambil kreta di dua lokasi di seputaran Pasar Horas Sabtu lalu.(ral)

SIMALUNGUN– Sucipto alias Cipto (28) warga Huta IV Nagori Panambean Baru, Kecamatan Bandar Masilam dituntut 1,6 tahun penjara. Terdakwa terbukti secara sah dan meyakinkan melakukan tindak pidana penipuan dan penggelapan uang hasil penjualan sawit sebanyak 8,3 ton sebesar Rp11,620 juta. Hal itu disampaikan Jaksa Penuntut Umum, Sanggam Siagian di hadapan majelis hakim Ramses Pasaribu beranggotakan Monalisa dan Gabe Doris di PN Simalungun, Senin (3/9). Menurutnya, berdasarkan keterangan saksi dan terdakwa di persidangan terungkap perbuatan terdakwa melanggar pasal 372 KUHPidana. “Peristiwa itu berlangsung Senin (12/12) sekira pukul 12.30 WIB di Huta V Nagori Pematang Kerasaan. Saat itu terdakwa menghubungi saksi korban Susilo dan menawarkan agar terdakwa menjualkan sawit milik korban yang baru dipanen. Kemudian terdakwa menawarkan harga sawit yang akan dijual Rp1.400 per kg,” sebutnya. Dia menerangkan, terdakwa juga berjanji akan membayarkan langsung uang

penjualan itu usai di timbang di PKS Kerasaan. Mendengar itu korban pun tertarik dan akhirnya anggota terdakwa datang kerumah korban dan mengangkat sawit milik korban berjumlah 8,3 ton. Selanjutnya, setelah sawit dibawa, korban pun langsung menanyakan soal pembayaran kepada terdakwa. Kemudian terdakwa menyuruh korban untuk bertemu di Perdagangan. Akan tetapi setelah korban datang ke Perdagangan terdakwa tidak berada di tempat yang dimaksud. “Kemudian korban pun menghubungi terdakwa dan saat itu terdakwa mengatakan agar pembayaran dilakukan di rumahnya di Huta IV Mandaroh Nagori Panambean Baru, Kecamatan Bandar Masilam. Akan tetapi karena korban masih punya pekerjaan lainnya, Susilo menyuruh adiknya Yono untuk mengambil uang hasil penjualan sawit sebanyak Rp11,620 juta,” ungkapnya.

Sambung Sanggam, setelah adik korban datang ke rumah terdakwa justru terdakwa memberikan satu unit mobil Kijang Innova sebagai boroh penjualan sawit itu. Karena merasa curiga korban pun mendatangi keluarga terdakwa dan menanyakan siapa pemilik mobil tersebut. Kemudian keluarganya itu mengaku bahwa mobil itu dirental oleh terdakwa. “Korban pun langsung mendatangi terdakwa dan mengembalikan kunci mobil tersebut. Selanjutnya korban meminta uang hasil penjualan sawit miliknya. Akan tetapi terdakwa hanya memberikan panjar atas penjualan sawit miliknya sebesar Rp3 juta. Korban pun tidak menerima karena merasa ditipu oleh terdakwa,” jelasnya. Untuk hal memberatkan perbuatan terdakwa meresahkan masyarakat khususnya saksi korban. Sementara hal meringankan terdakwa bersikap sopan di persidangan, berterus terang, mengku salah dan berjanji tidak mengulanginya kembali. Untuk itu jaksa memutuskan menuntut terdakwa 1,6 tahun penjara dikurangi selama masa tahanan.(mua)

Tidur di Mapolsek Coba Bunuh Diri

„ Cewek depresi MEDAN- Sungguh kasian nasib perempuan yang depresi satu ini, bagaimana tidak sudah dua hari cewek depresi ini menginap di Polsek Medan Sunggal, sejak Sabtu (1/9) dan merepotkan jajaran Polsek Sunggal. Sebut saja namanya Bunga (19), cewekberparasmanisinijikadisaksikan sekilas tidak tampak jika dirinya depresi atau stress. Namun jika terus-terusan diperhatikan maka akan tau jika cewek ini stres karena sering tertawa dengan sendirinyadanmenangissertamenyebut-nyebut lelaki dan sering berteriak tak menentu. Dugaan sementara, cewek strees berkulit bersih ini diperkosa. Hal ini terbukti dari ocehan si

cewek strees ini. “Jangan sentuh aku, jangan buka celanaku, sakit anuku,” ujar Bunga. Bukan hanya itu, Bunga juga sering memandang ke atap dan dan berceloteh dengan logat Aceh. Polsek Medan Sunggal sendiri kerepotan dengan tigkah si Bunga, apalagi Bunga tidak mau makandanminumhanyaterdiam dan tertawa sendiri. Dankejadianyangpalingmenghebohkan ketika Bunga berlari ke jalan depan Polsek Medan Sunggal dan mencoba bunuh diri denganberdiriditengahjalandanhampir di tabrak tronton. “Bingung kita untuk menanganinya, tadi hampir mati dia ditabrak truk,” ujar Kasi humas Polsek Medan Sunggal. Setelah ditenangkan akhirnya Bunga mau dibujuk. Kejadian ini membuat macet ruas jalan dan heboh warga yang berdatangan untuk menyaksikan pertunjukan percobaan bunuh diri. “Ngeri juga Polsek Sunggal ya melihara orang gila,” ujar warga yang menyaksikan. RencananyaBungaakandikirim keDinasSosialolehPolsekSunggal dan Polsek Sunggal akan menyelidiki asal usul cewek depresi tersebut. “Kita cari dululah keluarganya dannantikitakirimkedinassocial,” ujar Kasi Humas Polsek Sunggal. (mri/pmg)

Nenek-nenek Diperkosa Minta Nambah Agaknya Sarif (29), memang lelaki pecinta benda purbakala. Melihat nenek-nenek yang pantas jadi ibunya, masih nafsu juga. Maka sang ibu kos, Ny Jamila (56), digaulinya sebanyak 3 kali. Uniknya, katanya suka sama suka kok tahu-tahu si nenek lapor ke polisi. “Saya tidak memerkosa, wong dia malah minta nambah,” ujar Sarif di depan petugas. Anak muda yang menggemari benda-benda purbakala, biasanya kuliah di Fakultas Ilmu Budaya pada sebuah perguruan tinggi. Dia mengambil jurusan sejarah atau kepurbakalaan. Bila ketemu fosil (benda perbakala) dipelototi, direkareka untuk mengungkap budaya masa lalu, khususnya di zaman benda itu berasal. Lihat tulang binatang, dianalisa apakah ini jenis erectus soloensis di Sangiran apa bukan. Padahal aslinya, itu hanya tulang sapi bekas hewan korban 5 taun lalu! Sarif yang tinggal di Bone Sulawesi Selatan dan tak pernah kuliah di FIB Universitas Hasanudin, ternyata juga pemerhati

benda-benar purbakala. Cuma bila fosil dan artefak itu lazimnya barang mati, obyek studi Sarif justru masih punya nafas dengan tarikan rata-rata 15-20 kali dalam satu menit. Maklum, obyek yang disasar adalah Ny Jamila yang hidup di zaman pasca sejarah, dengan usia juga baru 29.433.600 jam. Kalaupun Sarif tertarik pada benda purbakala semacam itu, sebenarnya yang memancingmancing justru si nenek sendiri. Mereka memang tinggal serumah. Ny Jamila pemilik rumah kos, sedangkan Sarif adalah anak kos di situ. Kebetulan pula kamar mereka berhadapan, dan kebetulan atau sengaja, kamar janda tua itu sering diablak, sehingga aktivitas manusia di dalamnya bisa terlihat dengan nyata. Nah, beberapa kali Sarif melihat tuan rumah tiduran dengan posisi seronok, yakni telentang dan rok tersingkap. Padahal meski pun sudah nenek-nenek, paha Ny Jamila masih mulus dan putih mirip punya Mulan Jamila. Maka sebagai lelaki nor-

mal, pendulum Sarif pun jadi kontak dibuatnya. Dan ternyata pemandangan spektakuler itu nyaris menjadi menu seharihari. Akhirnya, setan pun bilang “Sikat saja Bleh, telaten amat!” Awalnya Sarif deg-degan, tapi ternyata si nenek malah mapan. Maka untuk kali pertama si anak kos itu menggarap si pemilik koskosan sambil ngos-ngosan . Anehnya, si nenek tak puas hanya satu ronde. Dia minta partai tambahan, sehingga setelah turun minum: theng……partai

tambahan itu dimulai. Gara-gara aksi mesum itu, bulan berikutnya ketika uang kos telat bayar malah dianggap lunas. Sarif sebetulnya nggak enak, karena ini kan sama saja gratifikasi. Tapi karena dirinya memang bukan pejabat publik, dia tenang-tenang saja tanpa takut diawasi pihak KPK. Makanya, lain hari dia ambil inisiatif lagi, kembali menggauli si nenek untuk gelombang kedua. Dan sejak itu Sarif benarbenar jadi pencinta benda per-

bakala dalam arti sesungguhnya. Selama beberapa bulan tinggal di rumah Ny Jamila Jalan Peristiwa Teneteriattang, Bone, paling sedikit Sarif sudah tiga kali menggauli tuan rumah. Aksi mesum ini hanya menjadi rahasia berdua, tanpa pihak tetangga menaruh curiga. Maklumlah, dalam kacamata umum dan normal, mana mau Sarif berhubungan intim dengan nenek-nenek. Tapi mendadak beberapa hari lalu heboh, karena Ny Jamila melaporkan Sarif ke Polres Bone dengan tuduhan perkosaan. Katanya, sudah 3 kali dia diperkosa anak kosnya. Dua kali berhasil, ketiga kalinya gagal karena Jamila tidak mood. Garagara laporan ini, Sarif ditangkap dan diperiksa. Namun dalam interogasi dia membantah segala keterangan si nenek. “Kalau saya perkosa, mana mungkin dia mancing-mancing dan malah minta nambah….?” ujar Sarif lantang. Nenek kan pelupa, dimaklumi saja Nak. (pk/int)



4 September 2012

8 Peserta Asal Sibolga-Tapteng Lulus Seleksi Akademis

Lie Leng Wan Tewas di Pancuran Santeong

Sambungan Halaman 1

Sambungan Halaman 1

dapat dilihat di website pemprovsu yaitu atau di BKD Kabupaten/Kota seSumatera Utara. Kepada calon praja IPDN yang namanya tertera pada lampiran SK Mendagri dimaksud untuk melapor/pengarahan di Badan Kepegawaian Daerah Provsu kantor Gubernur Sumatera Utara Jalan Diponegoro No.30 Medan, pada Rabu (5/9) pukul 09.00 WIB dengan membawa Kartu Nomor Ujian Asli. Sehubungan dengan ini, Pelaksana Tugas (Plt) Gubsu melalui Sekdaprovsu Nurdin Lubis telah menyurati para bupati dan walikota se Sumut melalui Surat Edaran (SE) No.800/17704/ BKD/III/2012 Tanggal 3 September 2012 agar juga memberitahukan kepada calon praja IPDN yang namanya dinyatakan lulus agar melapor ke BKD Sumut sebagaimana jadwal yang telah diatur. (ari/smg)

wartawan, di kantor Gubsu di Medan, Senin (3/9). Suherman menjelaskan namanama yang lulus ujian seleksi akademis ini lah yang berhak untuk mengikuti Wawancara Penentuan Akhir (Pantukhir) di Kampus Institut Pemerintahan Dalam Negeri, Jatinangor, Jawa Barat, sesuai dengan jadwal melapor yang telah ditentukan. Kelulusan ini, lanjutnya, berdasarkan Surat Keputusan Mendagri No.892.1-585 Tahun 2012 Tanggal 30 Agustus 2012, yang telah menetapkan calon praja yang dinyatakan lulus seleksi akademis pada seleksi penerimaan calon Praja IPDN Tahun Ajaran 2012/2013. “Peserta yang mengikuti test sebanyak 518 orang, yang dinyatakan lulus seleksi akademis sebanyak 102 orang,” ulangnya. Daftar nama calon Praja IPDN yang dinyatakan lulus seleksi

4 Tewas, 15 Luka-luka Sambungan Halaman 1

Ginting (64). Sementara korban yang tewas di lokasi kejadian yakni Imanta Barus (44) kernet bus Medan Jaya. Setelah polisi datang, warga mengevakuasi para korban dan berusaha mengeluarkan korban yang terjepit di dalam bus. Marina (26) salah seorang penumpang bus mengaku peristiwa ini terjadi di saat seluruh penumpang bus tertidur lelap dan dengan tiba-tiba terdengar suara benturan sehingga seluruh penumpang langsung terbangun. Namun sejak awal berangkat dari Medan, sopir sudah membawa bus dengan kecepatan tinggi. Pantauan METRO di lokasi kejadian, bus Medan Jaya yang mengalami ringsek berat sudah diamankan di kantor pos pengatur lalu-lintas Kualuh Hulu dan sudah ditutup pakai terpal. Parno (35) warga Aekkanopan ketika ditemui di kantor polisi mengaku merinding melihat bagian depan bus Medan Jaya yang rusak berat apalagi di jok bangku sopir yang sudah ringsek masih menempel darah yang belum dibersihkan. Kanit Lantas Polsek Kualuh Hulu Aiptu Joe Makir membenarkan peristiwa ini. Joe mengatakan saat ini bus Medan Jaya sudah dievakuasi dan sopir bus dalam pengejaran polisi. (put/st)

tinggi datang dari arah Medan menuju Rantauprapat. Sopir bus yang membawa 28 penumpang itu tampak ugalugalan di jalan raya. Tiba di lokasi kejadian, sopir bus langsung menghantam bagian belakang dump truk yang sedang parkir untuk mengangkut tanah. Suara benturan yang keras membuat warga yang tinggal tak jauh dari lokasi kejadian langsung terkejut. Dalam hitungan detik warga berhamburan menuju arah suara dan warga melihat bagian depan bus Medan Jaya ringsek berat. Sementara para penumpangnya terkapar. Melihat itu warga lalu berusaha menolong para penumpang dan sebagian lagi menghubungi polisi. Saat itu warga baru tahu jika salah seorang penumpang tewas di lokasi kejadian akibat luka yang dideritanya cukup parah. Setelah dikeluarkan warga dari dalam bus, tiga penumpang yang duduk di sebelah sopir sekarat dan dilarikan ke Puskesmas Sidua-dua Gunting Saga dan RS Indra Husada Mambang Muda. Namun sesampainya di puskesmas dan di RS, ketiganya meninggal dunia. Ketiga korban yang tewas tersebut yakni R br Purba (48), Timbul Siahaan (59), dan Pitti br

NAMA KORBAN TEWAS 1. Imanta Barus (44) kernet warga Langkat 2. R br Purba (48) warga Pancur Batu 3. Piti Br Ginting (64) warga Jalan Handayani II Pekanbaru 4. Timbul Siahaan (59) warga Medan Petisa

Korban Luka-luka 1. Devi Putra Jaya (19) warga Simpang Beo Tebing Tinggi 2. India Marnani (47) warga Kandis Simpang Belutu Riau 3. Andre Sembiring Meliala (26) warga Kabanjahe 4. Gudrion Sitanggang (23) warga Namo Rambe Medan 5. Idorani Pandia Sembiring (20) warga Barus 6. Nimrot Manurung (44) warga Duri Riau 7. Rasmawati br Sembiring (39) warga Bagan Sinembah 8. Dominika (23) warga Tanjung Ledong Tanjungbalai Asahan 9. Pardomuan Melian (38) warga Perumnas Simalingkar Medan 10. Mangandar Siringo-ringo (53) warga Kandis 11. Irwan Rudini (22) warga Pekanbaru Riau 12. Marina br Harahap (22) 13. Yudha (17) warga Pasar V Tembung Medan 14. Rahmansyah (25) warga Pasar VI Labuhan Deli Medan

Tak Menolak Dijodohin Ustad Sambungan Halaman 1 PENYANYI seksi Vicky Shu belum juga menunjukkan tandatanda akan menikah. Meski sudah berusia 25 tahun, Vicky Shu tetap saja menjomblo. “Betah enggak betah sih. Betah karena aku biasa mandiri, kalo enggak betahnya kangen juga masa-masa punya cinta,” kata Vicky Shu di Studio RCTI Kebon Jeruk Jakarta Barat, Senin (3/9). Vicky mengaku pernah dijodoh-jodohkan oleh beberapa pria semasa kuliah. Tapi sekarang

orang tua Vikcy Shu sudah tak pernah lagi menyodorkan pria. Saat ditanya apa punya keinginan berpacaran dengan ustad, Vicky menyatakan tidak akan menolak jika ternyata cocok. Apalagi Vicky memang berkeinginan punya pasangan dari kalangan bukan artis. “Sama ustad ya Alhamdulillah, aku apa ajalah yang terbaik buat aku dan keluargaku. Kebetulan ada keinginan untuk yang berbeda profesi biar ada variasi,” ungkap Vicky. (abu/jpnn)

Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan : Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

keluarga korban. Anim menerangkan, korban sering sakit seperti angin duduk. Sehingga menurut pihak keluarga, kematian Lie Leng Wan diduga kuat karena penyakit angin duduknya tiba-tiba kambuh. “Mungkin sudah waktunya, kami tidak menuduh yang lain-lain. Sebab menurut pihak kepolisian juga tidak ada tanda-tanda kekerasan pada tubuhnya. Kita semayamkanlah jasadnya dengan baik,” terangnya. Informasi dihimpun METRO dari beberapa warga sekitar lokasi kejadian menyebutkan, saat itu seperti biasanya Lie Leng Wan sedang menyuci pakaiannya di tempat pemandian tersebut sekaligus

mandi. Namun entah apa sebabnya, salah seorang warga yang melintas tiba-tiba melihat Lie Leng Wan tergeletak tak jauh dari pancuran. Posisinya seperti tertidur miring ke sebelah kanan. “Kami tidak tau apa penyebabnya kenapa korban tiba-tiba tergeletak. Karena tak berani, kami pun langsung melaporkan hal ini ke polisi,” tutur sejumlah warga di lokasi kejadian. Mendengar laporan ini, beberapa personel Polres Sibolga Kota dan Polsek Sibolga Sambas turun ke lokasi dan melakukan olah TKP. Namun dari hasil pemeriksaan polisi, tidak ada ditemukan adanya penganiayaan di tubuh pria keturunan tersebut. “Tidak ada tanda-tanda kekerasan yang

ditemukan di tubuhnya. Meskipun ada sedikit memar pada lutut sebelah kanan korban, kita duga itu karena terbentur,” tutur Kapolres Sibolga Kota AKBP Joas Feriko Panjaitan melalui Kasubbag Humas Aiptu Ramadhansyah Sormin saat dikonfirmasi METRO, Senin (3/9). Sormin menerangkan, meskipun keluarga korban menolak untuk dilakukan otopsi, pihak kepolisian mencoba membawa jenazah Lie Leng Wan ke RSUD FL Tobing Sibolga untuk divisum. “Pihak keluarga menolak untuk dilakukan otopsi. Namun demi hukum, kita membawa korban ke RSUD FL Tobing untuk dilakukan visum. Dari hasil visum luar menyatakan tidak ada ditemukan tanda-tanda kekerasan. Akhirnya,

Diancam, Bonaran Polisikan Muchtar Sambungan Halaman 1 Poldasu, Senin (3/9) sekira pukul 14.30 WIB, terkaitdugaanancamanyangditerimanyadari Muchtar yang dimuat salah satu media massa beberapawaktulalu.Laporanitusesuaidengan nomor polisi LP/924/IX/2012/SPKT II. Bonaran mengaku, ancaman tersebut dilontarkan Muchtar, politis Golkar, di surat kabar terbitan lokal tertanggal Kamis (30/8) Edisi 317. Disebutkan, Muchtar yang mengajak warga Sibolga akan mengkapling rumah dinas Bonaran jika tetap memerintahkan Satpol PP Tapteng untuk menghentikan pembangunan kantor Dinas Pendidikan di Sibolga. “Dalam surat kabar itu, oknum tersebut mengancam saya dengan mengatakan ‘Dia harus ingat kalau dia masih tinggal di Kota Sibolga, bukan Tapteng. Jadi kalau memang dia masih tetap melanjutkan tindakannya, maka saya bersama masyarakat akan mengkapling rumah dinasnya, dan ingat jangan pancing harimau yang sedang tidur, kaukau’,”ucapBonaranmenirukanperkataan Muchtar. Meskisama-samaberasaldaripartai berlambang pohon beringin, -Bonaran terpilih menjadi Bupati yang dicalonkan Golkar- namun, Bonaran mengaku tidak mengenal Muchtar. Bahkan, Bonaran mengaku, karena takut dengan ancaman tersebut, dirinya terpaksa meminta pengamanan lebih ketat dari Poldasu dan AMPI Sibolga. “Saya sangat terganggu, terlebih lagi keluarga saya. Ini tidak main-main, dia berani mengancam saya melalui media. Apalagi ancamannya inikan pasti dibaca khalayak ramai. Saya kenalnya dia dari pemberitaan ini. Meski kami dari partai yang sama, tapi saya tidak mengenal oknum ini. Opung saya denganopungdiajugatidaksalingkenal.Kami juga tidak pernah berhubungan. Saya takut nanti rumah saya dikapling,” urainya. “Ancaman yang dilakukannya memang luar biasa. Ada pengkaplingan rumah saya

dengan cara membawa masyarakat. Dalam surat kabar itu, oknum tadi mengatakan akan menghabisisayadenganmembuatgambaran bahwa dia adalah seperti harimau tidur. Sepanjang saya jadi Bupati, baru ini diteror,” lanjutnya. Menurut Bonaran, ancaman yang diterimanya dari Muchtar, berawal dari aset Pemkab Tapteng di Sibolga yang akan dibangun oleh Dinas Pendidikan Sibolga. Karena bangunan tersebut adalah aset Pemkab Tapteng, maka aset tersebut juga tertulis dalam laporan keuangan Pemkab. Jika akan diambil alih pihak lain, maka harus melalui dua cara yaitu ruilslagh dan ganti rugi. “Jadi sebenarnya aset ini terdaftar di buku besar Pemkab Tapteng. Oleh mereka aset ini mau dibangun menjadi Dinas Pendidikan Sibolga. Tapi kita tak memperbolehkan, karena ini aset Pemkab Tapteng. Memang mereka ada ajukan permohonan ke saya, tapi belum saya proses, mereka sudah kuasai bangunan itu tanpa sepengetahuan kita. Kan nggak boleh dong, ini harus dipertahankan. Kalau pun mau diserahkan harus ada prosedurnyayangdiikuti.Diantaranyadengan dibentuknya tim, harus ada persetujuan dari anggota DPRD, Pemkab Tapteng. Saya bilang tinggalkan dulu lokasi ini, baru kita rundingkan.Tapimerekatakmau,danmulaimembongkar bangunan aset Pemkab Tapteng tadi. Jadi saya perintahkan Satpol PP untuk mengamankannya. Dari situlah oknum ini tadi tak setuju dan lantas mengancam saya,” jelasnya. Bahkan, kata Bonaran, pada Rabu (29/8) lalu, dirinya langsung menugaskan salah seorang staf untuk menemui pihak Dinas Pendidikan Sibolga agar pembongkaran bangunan tersebut dihentikan. Tapi Dinas Pendidikan Sibolga dan Muchtar Nababan malah menolak. “Stafsaya,ErnawatiPohansayaperintahkan untuk menemui mereka. Tapi ya itu tadi, mereka tak mau. Kemudian saya perintahkan SatpolPPsupayamengamankanasettersebut.

Ternyata mereka malah menyerang hingga hampir terjadi bentrok,” sebutnya. Begitupun, lanjut Bonaran, meski ada ketentuan apabila akan dilakukan pemeriksaan terhadap anggota DPRD, maka diperlukan persetujuan tertulis dari Gubsu, Bonaran meminta agar Poldasu mengesampingkan peraturan tersebut. Bonaran juga membuat laporan yang ditujukan kepada Ketua Umum Partai Golkar agar Muchtar diberi tindakan sesuai ADRT PartaiGolkar.“SayamintasupayapihakPoldasu mengesampingkan hal tersebut. Tapi mengedepankanpasallainyangintinyaapabilatindak pidana yang dilakukan menyangkut kemanusiaan, maka tidak perlu izin tertulis dari Gubsu,”tukasnya. Bahkan,Bonaranmengaku sudah membuat surat yang ditujukan kepada Plt Gubsu Gatot Pudjo Nugroho bila memang izin tersebut diperlukan. “Begitupun, hari ini saya sudah buat surat kepada Gubsu, jika diperlukan izin tertulis, maka diberikan penanganan prioritas, karena inimenyangkutkeamanansaya.Nahsekarang saya juga menunggu tindak lanjut dari Partai Golkar mengingat saya adalah Bupati yang dicalonkan Partai Golkar. Karena ini menyangkut nyawa saya,” bebernya. Sementara itu Kepala Siaga II Sentra Pelayanan Kepolisian Terpadu (SPKT) Poldasu Kompol Efendi Sinaga saat dikonfirmasi membenarkan Bupati Bonaran telah membuat laporan di Mapoldasu. “Ya, tadi beliau ada buat laporan ke SPKT,” ujarnya, Senin (3/9) malam. Efendi mengatakan selanjutnya laporan tersebut akan diserahkan pihaknya ke Direktorat Reserse Kriminal Umum (Ditreskrimum) Poldasu. “Nanti laporan itu akan kami serahkan ke Ditreskrimum untuk ditindaklanjuti. Saya tak berhak memberi keterangan panjang lebar. Silakan konfirmasi ke Kabid Humas saja,” ungkapnya. Menanggapi hal tersebut, Wakil Direktur Reserse Kriminal Umum Poldasu AKBP

berdasarkan permintaan pihak keluarga korban dan mereka juga menilai kematian Lie Leng Wan wajar karena sakit. Otopsi pun tidak dilakukan, setelah pihak keluarga membuat pernyataan penolakan otopsi,” terangnya menambahkan. Diketahui, usai jenazah divisum di RSUD FL Tobing, polisi mengembalikan jasad korban kepada pihak keluarga untuk disemayamkan sesuai kepercayaannya. Lie Leng Wan alias Carles yang hidup sendiri ini diketahui kesehariannya bekerja sebagai penjaga malam sarang burung walet di Nauli Swalayan. Sesuai pengakuan beberapa orang keluarganya, korban yang sering sakit-sakitan ini diduga kuat meninggal karena penyakitnya angin duduknya tiba-tiba kambuh. (cr-1) Mashudi mengatakan, setelah menerima laporan tersebut, yang pertama kali dilakukan pihaknya yakni memanggil pelapor. “Ya, nanti kami pasti akan memanggil si pelapor terlebih dahulu. Kami akan pelajari permasalahannya, apakah memang ada unsur tindak pidana dalam ancaman yang diterima Bupati Tapteng tersebut,” ujarnya. Mashudi mengatakan, pihaknya juga akan mencoba mengumpulkan bukti-bukti terkait ancaman yang diterima korban. “Ya,siapapunyangmelaporpastiakankami tindaklanjuti. Saya tidak bisa berandai-andai sekarang. Ya pasti kami juga akan mengumpulkan bukti-bukti terkait ancaman yangtertuangdalamlaporantersebut.Jikaada unsur tindak pidana, baru kami masuk ke proses penyidikan,” pungkasnya. Terpisah, anggota DPRD Sibolga Muchtar Nababan yang dihubungi METRO via selelur mengatakan, sebagai warga, Raja Bonaran Situmeang punya hak untuk melaporkan segala sesuatu perbuatan yang dianggap mengancam dirinya. “Namun perlu saya tegaskan, kedatangan saya ke lokasi sengketa eks SPK Pemkab Tapteng yang dipakai Dinas Pendidikan Sibolga karena menjalankan tugas yang diberikan kepada saya sebagai anggota DPRD Sibolga,” tukas Muchtar. Saat itu, sambung Muchtar, dirinya memang ada mengeluarkan beberapapernyataanantaralainagarPemkab Tapteng yang dipimpin Raja Bonaran Situmeang untuk tidak mencari masalah dengan Pemko Sibolga. “Itu yang saya katakan dan kemudian saya mengatakan jangan membangunkan harimau yang sedang tidur, maksudnya masyarakat Sibolga yang sudah hidup damai selamaini.Namunyangpastisaatitusayatidak ada mengatakan kata usir atau mengusir Bonaran saat itu kepada wartawan, dan saya nggak tau kenapa itu bisa dikembangkan oleh media massa. Sebab saya kurang paham bagaimana aturan ataupun sistem kerja sebuah media,” tandas Muchtar. (far/mag12/tob)

Pakai Solar Subsidi, Truk Mitra TPL akan Ditindak Sambungan Halaman 1 Saat dicecar terkait implementasi pelaksaan Permen ESDM tersebut, secara tegas, pihaknya akan melakukan penindakan terhadap pengemudi atau pengusaha truk jika tertangkap mengisi solar subsidi di SPBU. “Tapi sebelum kita lakukan penindakan, kita akan segera memanggil seluruh pengusaha angkutan barang hasil perkebunan dan pertambangan di daerah ini untuk sosialisasi. Jadi, tidak ada alasan lagi nantinya tidak tau aturan,” tegas Verdy. Di tempat terpisah, Kepala Kantor Pertambangan dan Energi Humbahas Minrod Sigalingging saat ditemui di kompleks gedung DPRD Humbahas mengatakan, dirinya belum mengetahui tentang keberadaan Permen ESDM Nomor 12 Tahun 2012. “Saya belum tau ada Permen itu. Nanti akan kami pelajari dulu,” ujar Minrod. Namun, saat dijelaskan terkait larangan kendaraan angkutan hasil perkebunan dan pertambangan mengisi BBM jenis solar subsidi di SPBU, sesuai pasal 6 Permen ESDM Nomor 12 Tahun 2012, Minrod menuturkan, bahwa dilema kenaikan harga bahan tambang akan muncul jika Permen tersebut diterapkan. “Jika pengusaha angkutan tambang terpaksa harus mengisi BBM non subsidi, maka dilemanya akan ada. Harga hasil tambang seperti galian C akan dinaikkan. Tentu hal itu akan berdampak luas, khususnya bagi pembangunan daerah,” tukas Minrod. Meski demikian, sambung Minrod, pihaknya akan berkoordinasi dengan Dinas Pertambangan dan Energi Sumatera Utara untuk mempertanyakan penerapan Permen ESDM tersebut. “Jadi, bisa saja khusus untuk bahan tambang ada aturan khusus, semisal tipe jenis bahan tambang galian A, B atau C,” pungkasnya. Sebelumnya, Humas PT TPL Lambertus Siregar saat dihubungi METRO melalui ponselnya, Jumat (31/8) lalu mengatakan, pihaknya menyerahkan penggunaan BBM non subsidi tersebut kepada pengusaha truk

pengangkut kayu milik TPL. “Kita serahkan kepada pengusaha mitra kita saja dan pemerintah,” kata Lambertus. Ditanya apakah pihaknya sudah mensosialisasikan Peraturan Menteri ESDM tersebut, Lambertus mengaku, sebagian pengusaha truk mitra TPL sudah diberitahukan. “Sebagian sudah kita beritahukan, tapi masih sebatas pemberitahuan lisan,” katanya. Sementara itu, Kepala Bagian Perekonomian Pemkab Tobasa Robet Hutajulu, Senin (3/9) mengatakan, Pemkab belum membuat kebijakan terkait pelarangan tersebut. Pemkab masih menunggu perkembangan pembangunan SPBU yang menjual BBM non subsidi. Diutarakannya, jika dilakukan pelarangan bagi angkutan perkebunan dan pertambangan yakni harus menggunakan BBM non subsidi sesuai Permen ESDM Nomor 12 Tahun 2012, dikhawatirkan terjadi gangguan ekonomi. “Seharusnya disertai dengan kelengkapan fasilitas di SPBU, supaya kami bisa mengambil tindakan jika diketahui melanggar,” ujar Robet di kantornya. Terkait dengan pelaksanaan Permen ini, pihaknya telah berkoordinasi dengan pertamina. Pertamina berjanji akan membangun SPBU non subsidi di daerah Pardinggaran Kecamatan Bonatua Lunasi. “Sekarang masih tahap pengerjaan. Jika sudah selesai maka seluruh pengguna BBM non subisidi mengisi ke sana,” tambahnya. Robet mengungkapkan, tahun ini, satu SPBU akan melayani BBM jenis pertamax. Fasilitas pelayanan pertamax direncanakan di SPBU 14.223.305 Hutabarat di Jalan Balige-Tarutung. “Intinya kita bentuk tim dulu dan melakukan koordinasi dengan pihak kepolisian, Kodim, Satpol PP dan pertamina,” tandasnya. Koordinator wilayah SPBU Pertamina untuk enam kabupaten, Aris mengatakan, untuk tahap pertama, Balige akan melayani BBM jenis pertamax tahun ini. Untuk sementara, pertamina akan menyediakan 40 mobil tangki berisi 6.000 kilo liter yang

Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana:... Kordinator Liputan Ridwan Butarbutar, Asisten Kordinator Liputan (Bonapasogit): Horden Silalahi. Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Marihot Simamora, Freddy Tobing, Masril Rambe , Rinawati Marbun (koresponden barus), Jonter (Humbahas), Bernard Lumbangaol, Hengki Tobing (Taput), Hermanto Turnip, Brams Situmorang (Tobasa) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel),

akan diparkir di sejumlah SPBU. Untuk Tobasa, SPBU yang menyediakan BBM non subsidi direncanakan di SPBU Hutabarat dan Trisno Pangaribuan yang berada di Pardinggaran. Terpisah, pengawas SPBU 14.223.305 Hutabarat, Hotman Marpaung mengatakan kesiapan mereka untuk menjual BBM non subisidi. Area SPBU masih memungkinkan untuk dibangun fasilitas untuk BBM non subsidi. Bahkan, kata Hotman, pihaknya telah menyediakan tangki khusus untuk menjual pertamax berisi 36.000 ton. Namun, karena pasokan pertamax dari pertamina tidak diperoleh, maka sementara tangki tersebut diisi premium. “Pompa nomor 3 sudah kita siapkan jauh sebelumnya untuk penjualan pertamax, tapi karena tidak memperoleh pertamax akhirnya dipakai untuk premium,” katanya. Hotman mengaku belum menjalankan isi Permen ESDM tersebut lantaran masih belum tersedianya fasilitas. Kasat Reskrim Polres Tobasa AKP Robert Sembiring ketika dikonfirmasi melalui ponselnya mengaku belum membaca Permen ESDM tersebut. Oleh karena itu, pihaknya belum bisa mengambil tindakan hukum. Temukan Truk ‘Minum’ Solar Nonsubsidi, Laporkan! Operational Head Terminal BBM Pertamina Sibolga Purwanta melalui Aris Irmi, Sales Representative Retail Wilayah V Sumut mengatakan, bagi masyarakat, organisasi, maupun elemen masyarakat lainnya diminta segera melapor ke petugas kepolisian jika menemukan atau mendapati truk-truk perusahaan atau perkebunan yang mengisi BBM subsidi di sejumlah SPBU yang ada. “Kami dari PT Pertamina tentunya harus mengikuti Permen ESDM Nomor 12 Tahun 2012 yang sudah diberlakukan sejak September ini yakni seluruh kendaraan pengangkutan milik perusahaan atau industri lainnya diwajibkan menggunakan solar nonsubsidi,” kata Aris Irmi saat dihubungi METRO via seluler, Senin (3/9) di Sibolga.

Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan

Bahkan,sebutAris,pihakPertaminasendiri sudah menerapkan Permen ESDM tersebut, di mana mobil tangki miilik Pertamina tidak menggunakan solar bersubsidi, dan itu sudah dilakukan secara bertahap. “Dan hal itu tentunya harus dipatuhi oleh seluruh pihak terkait seperti yang termaktub dalam Permen ESDM. Silakan lapor kepada petugas kepolisian jika menemukan itu di SPBU-SPBU yang ada. Sebab itu sudah termasuk dalam pelanggaran terhadap peraturan yang dibuat,” tukasnya. Meskipun demikian, sambungnya, sebenarnya untuk mengenali mana truk perusahaan yang harus menggunakan solar nonsubsidi yakni dengan adanya stiker yang seharusnya dipasang oleh Himpunan Pengusaha Swasta Minyak dan Gas (Hiswanamigas). “Untuk mengenali mana truk yang harus menggunakan solar nonsubsidi, ada semacam stiker yang harusnya ditempelkan pada kendaraan-kendaraan itu oleh Hiswanamigas. Artinya jika truk yang ditempel stiker itu masih menggunakan solar subsidi, silakan lapor kepada polisi,” ujarnya. Menurut Aris, hingga saat ini masih ada ditemukan truk yang sudah ditempeli stiker tadi masih ngotot menggunakan solar subsidi dari sejumlah SPBU. “Biasanya hal ini terjadi jika sopir kendaraan tersebut yang memaksa petugas di SPBU untuk diisi solar bersubsi. Meskipun sebenarnya hal itu jelas sudah dilarang sesuai Permen ESDM yang sudah diberlakukan, dan ini tentunya juga menjadi tanggung jawab kita bersama,” pungkasnya. Terkait sanksi yang diberikan kepada perusahaan yang melanggar Permen ESDM, sambungnya, bisa saja dilakukan dengan mencabut perusahaan yang melanggar Permen ESDM itu. “Sanksi bisa diberikan dengan mencabut izin perusahaan. Itu sebabnya, petugas di SPBU sebaiknya mencatat nomor polisi, jenis kendaraan bahkan bila perlu identitas sopir itu jika melanggar Permen ESDM dimaksud,” tandas Aris. (tob/hsl/cr-03)

Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



4 September 2012

Habiskan Dana Hampir Rp300 Juta Sambungan Halaman 8 warga termasuk anak-anak berangkat dari Batahan menuju gedung DPRD untuk menyampaikan tuntutan hak milik mereka bahkan sempat melakukan aksi menginap di gedung dewan beberapa malam. Akhirnya ketika itu, Pemkab Madina mengeluarkan surat penghentian sementara atas lahan bermasalah dan DPRD membentuk Pansus. ”Ketika dibentuk pansus, warga ketika itu sangat bergembira mendengar adanya komitmen DPRD Madina yang akan menindaklanjuti persoalan yang mereka hadapi. Namun, lebih 4 bulan, hasil kinerja Pansus belum diketahui dan kami menduga ada permainan di dalamnya,” sebut Toguan. Kata Toguan, seharusnya pansus konsisten atas apa yang disampaikan di hadapan masyarakat danb jangan hanya omong kosong belaka. Sebab, persoalan ini tidak seharusnya memakan waktu sampai 4 bulan untuk menghasilkan rekomendasi untuk diparipurnakan. ”Jika pansus serius menindaklanjuti persoalan inim, tidak sampai 4 bulan sudah selesai bekerja dan mengeluarkan,” ujarnya.

Untuk itulah, sambungnya, Pansus PT Palmaris perlu dipertanyakan dan dievaluasi kinerja dan dievaluasi pertanggungjawaban penggunaan dana yang sudah menelan ratusan juta rupiah. ”Jangan-jangan ada permainan di dalamnya, karena sampai sekarang belum ada paripurna hasil Pansus,” tambahnya. Sekretaris DPRD Madina, Zulkarnain Siregar membenarkan, masa kerja Pansus PT Palmaris kurang lebih 4 bulan dan sudah terjadi dua kali perpanjangan waktu. Kelambatan ini disebabkan ada sejumlah agenda yang belum terselesaikan. Ketika ditanyai masalah anggaran, Zulkarnain menyebutkan, total anggaran belum bisa diketahui secara final. Kalau totalnya belum direkafitulasi, tetapi di atas Rp200 juta, untuk biaya perjalanan kerja mereka seperti ke Jakarta dan turun ke lapangan. Ketua Pansus, Bahri Efendi yang dikonfirmasi lewat telepon selulernya tidak mau memberikan konfirmasi. Ketika dimintai keterangan lewat pesan singkat, juga tidak memberikan jawaban dan dicari ke gedung dewan juga tidak berhasil ditemui. (wan/mer)

Dukung Pemberantasan Narkoba Sambungan Halaman 8 narkoba termasuk memberi informasi kepada polisi. “Peran serta seluruh elemen masyarakat akan sangat membantu pihak kepolisian untuk membekuk pelaku narkoba,” kata pemerhati kepolisian Malik Assalih Harahap ST, Senin (3/9). Malik Assalih Harahap mendukung komitmen Kapolda Sumut, Irjen Pol Wisjnu Amat Sastro beserta jajarannya untuk memberantas penyalagunaan narkoba di Sumut. Walaupun kadang di lapangan sering terjadi penghadangan dari warga akibat markas mereka digrebek polisi, tapi itupun tidak membuat surut aparat kepolisian untuk tetap menyikat habis para bandar narkoba yang sengaja merusak moral terutama para generasi muda. Apa yang dilakukan para pelaku narkoba patut dihukum berat, karena mereka telah merusak moral bangsa ini. Apa yang dilakukan Kapolda Sumut dengan menempatkan baliho atau spanduk bertulis-

kan berantas narkoba di Sumut di tempat umum atau di polsek-polsek di wilayah Sumut menandakan Kapolda berkomitmen memberantas narkoba di Sumut. “Apalagi Kapolda sebagai aparat keamanan putra Sumut, tentunya berkewajiban secara moral untuk menyikat habis pengguna narkoba. Saya kenal betul pribadi Kapoldasu karena sering komunikasi. Yang penting, semua elemen harus mendukung program Kapoldasu untuk memberantas narkoba yang juga salah satu program dan atensi Kapolri,” tegas Malik Assalih Harahap. Malik menambahkan, penyalagunaan narkoba akan menghadapi banyak masalah terutama masalah sosial bagi penggunanya yang kebanyakan kalangan pelajar. Mereka cenderung menjadi orang yang tidak berguna karena tidak mampu memikul tanggung jawab. Di samping itu, pengguna narkoba akan cenderung menjadi pelaku kejahatan untuk memenuhi kebutuhannya. (phn/mer)

Air Laut Masuk Rumah Sambungan Halaman 8 sak,” tukasnya. Untuk itu, ia dan warga setempat lainnya berharap agar Pemko Sibolga memberikan perhatian misalnya dengan membangun tembok penahan yang kokoh guna menahan derasnya hantaman gelom-

bang air laut yang sedang mengamuk. “Artinya sebagai warga kami berharap perhatian pemerintah untuk membangun tembok penahan yang kuat, bukan asal dibangun. Sebab gelombang laut atau ombak di pantai Ujung Sibolga ini lebih kuat dibanding beberapa pantai lainnya

yang ada,” ujarnya. Senada itu, Infust Hutapea, salah seorang warga setempat lainnya membenarkan adanya kekuatiran warga akan gelombang laut yang cukup tinggi dalam beberapa hari ini, yang dikuatirkan bisa merusak rumah warga lainnya seperti yang sudah-

sudah. “Jangankan rumah warga yang pondasinya tidak terlalu kuat. Bangunan menara pantai Ujung atau kami sebut menara kastel ini saja bisa roboh akibat kuatnya hantaman ombak,” tukasnya. Jika dilihat, sambungnya, memang gelombang pasang yang muncul beberapa hari ini

SDN 081240 Jadi Duta Perpustakaan Sambungan Halaman 8 perpustakaan dengan biaya gratis. Diharapkan dalam pembinaan ini SDN 40 ini menjadi duta arsip dan dokumentasi perpustakaan se Sumut. “Hal ini merupakan kesempatan bagi kita khususnya SDN 40 untuk meningkatkan mutu perpustakaannya, termasuk juga dalam arsip dan dokumentasi perpustakaan kita,” tutur Muhammad Yazid SPd MAP yang merupakan penanggung jawab sekaligus sebagai kepala SD 40 Yazid, Senin (3/9). Katanya, perjuangan untuk mencapai peringkat pertama perpustakaan terbaik se Sumut harus dibarengi keseriusan dan pengabdian yang tulus. “Bukan hanya dengan tenaga dan pikiran saja. Intinya pengabdian,” tukas Yazid. Diterangkannya, sesuai dengan misi Perpustakaan ini yakni, minat baca sebagai barometer kualitas pendidikan, sebagai tempat untuk mencari bahan berkreasi dan berinovasi, serta perpustakaan menjadi koleksi buku dan koleksi ilmu.

“Basis yang kita upayakan saat ini yakni mencari minat dan bakat anak, membuat anak kreatif dan inofatif. Kita upayakan ada terobosan baru di dunia perpustakaan. Seperti yang telah kita lakukan di SDN 40, kita bekerja sama dengan Konsul Jepang dan Pekerjaan Umum Propsu untuk pengadaan 1500 eks buku tentang konstruksi rumah tahan gempa,” bebernya. Menurutnya dengan menyalurkan buku berisi konstruksi bangunan ini, sudah banyak ilmu yang di paparkan kepada anak dan masyarakat yang mempunyai nilai kompetitif tinggi. “Buku ini sederhana, namun kreatif, karena perpustakaan di sinergikan dengan pekerjaan umum untuk merangkul semua kalangan, mulai dari anak-anak, remaja , dan orang tua,” pungkasnya. Diketahui, proses pencapaian predikat perpustakaan terbaik se Sumut yang di raih SDN 40 ini dilakukan dengan beberapa tahapan. Awalnya penilaian dari Perpustakaan Arsip dan Dokumentasi Kota Sibolga, kemudian tim penilai Badan Perpusta-

kaan Arsip dan Dokumentasi Propinsi Sumut melakukan pemeriksaan langsung ke Perpustakaan SDN 40, Rabu (27/6). Atas penilaian tersebut SDN 40 kembali di undang ke Hotel Madani Medan untuk melakukan presentasi langsung terkait perpustakaan, Selasa (10/7). Selama 2 hari, yang dimulai sejak Senin (9/7) hingga Selasa (10/7), sebanyak 6 perpustakaan dari beberapa SD se Sumut yang memenuhi syarat klasifikasi perpustakaan terbaik beradu untuk menjadi yang terbaik. Foktor yang dinilai adalah presentase pemaparan perpustakaan meliputi manajemen perpustakaan dan terobosan perpustakaan. Berhasil, akhirnya SDN 40 di tetapkan menjadi juara pertama. Rencananya, dalam bulan ini SDN 40 akan menerima hadiah langsung dari Gubernur Sumatera Utara. Meski belum di tentukan waktunya, namun selain hadiah yang akan diberikan Gubsu, mereka juga akan di persilahkan menghadiri studi banding ke perpustakaan terbaik tingkat SD se Indonesia. (Cr-1/nasa)

Belum Pulangkan Mobil Dinas Sambungan Halaman 8 Ada yang kunci mobilnya dibawa sedangkan mobil parkir di rumah. Ada juga yang tidak diketahui di mana keberadaan mantan pejabat itu. “Dan yang terakhir kendaraannya juga tidak ditemukan, begitu juga orang yang memakainya selama ini. Bahkan surat yang kita berikan tidak pernah sampai kepada pemakai kendaraan dinas,” ucapnya. Menangggapi hal ini, aktivis Gerakan

Rakyat Berjuang (GRB) Palas Mardan Hanafi Hasibuan tidak mampu menarik kendaraan dinas, khususnya roda empat yang masih dipakai mantan pejabat Pemkab Palas. Mardan Hanafi mengaku kecewa dengan kinerja tim Pemkab Palas. Sebab, hampir satu bulan tim bekerja, belum menuai hasil. “Bahkan surat perjalanan dinas hingga ke luar daerah juga sudah dikeluarkan oleh Plt Bupati Palas. Namun, hasilnya tidak ada. Bahkan hingga saat ini Plt

Sekda Palas masih saja memakai kendaraan pribadi,” ucap Mardan. Mardan sangat menyayangkan lemahnya kinerja bawahan Plt Bupati Palas dalam mengamankan aset Pemda, karena dikhawatirkan akan terjadi penggelapan pada aset tersebut yang akan merugikan negara. “Kita khawatir akan terjadi penggelapan pada aset Pemkab Palas tersebut. Apalagi sampai saat ini, realisasi tim tidak berhasil,” ucap Mardan. (amr)

cukup besar bahkan tingginya bisa mencapai 2 meter. “Ini memang setiap tahun terjadi, namun tak sebesar tahun ini. Wajarlah kalau warga setempat menjadi was-was atau kuatir dengan hal itu, dan kami berharap agar hal ini dapat menjadi perhatian pemerintah,” tandasnya. (tob/nasa)

Lepas 259 Mahasiswa/i PPLT Sambungan Halaman 8 Dalam pengarahannya, Wali Kota Sibolga menyarankan kepada seluruh mahasiswa/i STKIP St Maria Berbelas Kasih yang akan dilepas untuk melaksanakan kegiatan PPLT secara sungguh-sungguh dan tidak menyia-nyiakan kesempatan tersebut. Karena menurutnya PPLT selain untuk melatih kemampuan mengajar, juga melatih kemampuan mahasiswa untuk bermasyarakat. “Diharapkan agar mahasiswa/i STKIP mampu mengajar dan bermasyarakat di lingkungannya,” tutur Syarfi memberikan arahan. Hal yang senada juga disampaikan oleh ketua Yayasan Santa maria Berbelas Sr Dionesia Marbun SCMM. Ia mengimbau agar seluruh mahasiswa yang melaksanakan PPLT memberikan yang terbaik. “Kepada mahasiswa-mahasiswi kami, kami harapkan agar jangan bermainmain dalam melaksanakan kegiatan PPLT ini. Apalagi ini merupakan PPLT perdana bagi kampus kita. Kalianlah mahasiswa/i angkatan pertama yang akan mencerminkan wajah STKIP ke permukaan. Untuk itu berikanlah yang terbaik,” ujar Sr Dionesia. Sementara ketua panitia Drs L Sinaga dalam laporannya menyampaikan, bahwa mahasiswa/i yang akan melaksanakan PPLT di Sibolga Tapteng terdiri dari 44 orang Program Studi Pendidikan Matematika, 59 orang Program studi Pendidikan Bahasa Inggris dan 155 orang program studi Pendidikan Guru Sekolah Dasar (PGSD). “Mereka akan di kirim ke 39 SD, 11 SMP, dan 12 SMA di Sibolga Tapteng,” pungkasnya. (Cr-1/nasa)

Stop Statemen Provokatif! Sambungan Halaman 8 sama ketua DPC PPM Tapteng, Zimmi Saragi, Senin (3/9) di Pandan. Menurut keduanya, pernyataan provokatif justru menambah panjang permasalahan dan bagian dari pem-

bodohan publik. Larena itu, masyarakat Sibolga dan Tapteng pun mesti jeli dan objektif menyikapi pernyataanpernyataan berbagai pihak khususnya yang dimuat di media massa. “Bukankah harusnya yang dikemukakan itu pencerahan

dan bagaimana solusinya. Jangan malah tuding menuding atau hujat menghujat seperti orang yang tidak berpendidikan,” kecam mereka. Menurut keduanya, apapaun alasannya, tidak dapat dipungkiri bahwa Tapteng dan Sibolga adalah dua daerah

yang bertetangga, bersaudara dan saling membutuhkan satu dengan yang lain. Karena itu, persoalan pemakaian aset hendaknya diselesaikan secara arif dan bijaksana. “Masyarakat Sibolga dan Tapteng tidak ada masalah. Ini hanya masalah administrasi

yang gawenya oleh pemerintahan kedua daerah. Artinya, jangan dibawa-bawa masyarakatnya. Yang mestinya bijaksana dan arif itu pemerintahnya. Silahkan diselesaikan dengan duduk bersama untuk mencapai solusi,” pungkas mereka. (mor/nasa)

Ponaryo Menahan Senyum, Jajang Sempat Gemetar Sambungan Halaman 1 di catwalk meyakinkan. Dia mengenakan kemeja kotak-kotak berwarna merah dan memakai tutup kepala. Secara berurutan kemudian muncul penggawa Persela Lamongan yang dikabarkan baru saja putus dengan sang kekasih, penyanyi Pinkan Mambo, Febrianto Wijaya. Disusul pemain Pelita Jaya Riyandi ‘Angky’ Ramadhana Putra. Suasana menjadi lebih heboh ketika sosok seorang ‘model’ bule muncul mengenakan kemeja kotak-kotak merah dengan jins hitam dan sepatu putih. Dialah Simon McMenemy, eks pelatih Mitra Kukar dan timnas Filipina asal Inggris yang dua tahun silam pernah menjadi perbincangan saat foto-foto

mesranya dengan Rahma Azhari beredar di internet. Para model dadakan dari lapangan hijau masing-masing muncul dua kali di catwalk dengan mengenakan dua busana berbeda. Sebetulnya gelandang timnas Firman Utina juga dijadwalkan tampil. Tapi, karena ada musibah yang menimpa salah seorang keluarganya, Firman batal menjadi model. Para pemain dan pelatih tersebut menjadi model DEIJE a.k.a denim is jeans yang salah satu owner dan desainernya adalah mantan penggawa timnas Merah Putih Isnan Ali. Setahun terakhir, bersama dua rekannya, Raka Zaipul dan Adri Naufal, pemain yang saat ini tercatat sebagai salah seorang penggawa Mitra Kukar itu serius me-

ngembangkan bisnis di luar lapangan bola. “Gila. Ini lebih tegang daripada melakoni pertandingan penting di lapangan hijau. Saya sangat gugup tadi sampai gemetar saat berjalan. Keringat mengucur deras,” ujar Jajang, lantas tertawa ngakak. Pemain yang pernah menimba ilmu di Brasil itu mengatakan, dirinya dan pemain yang lain sama sekali tidak berlatih dahulu sebelum berlenggak-lenggok di catwalk. “Latihannya ya cuma gladi resik sebelum tampil. Baru kemarin saya dihubungi Isnan,” sambungnya. Lain halnya dengan Febrianto Wijaya. Pemain yang sempat menjalani latihan di klub Vfb Stuttgart (Bundesliga Jerman) itu mengaku enjoy tampil di catwalk.

Diduga Idap AIDS, Mantan Honorer Meninggal Sambungan Halaman 1 terselamatkan. Pria yang pernah bekerja sebagai honorer di Pemkab ini meninggal dunia karena diduga terkena penyakit HIV AIDS, Senin (3/9) sekira pukul 05.00 WIB. “H sempat mendapat perawatan beberapa jam atau sekitar 4 jam di RSU Adam Malik Medan atas penyakit yang dideritanya. Namun Tuhan rupanya berkehendak lain. Sekira pukul 05.00 WIB pagi tadi, H meninggal dunia akibat penyakit yang dideritanya,” terang TT, salah seorang keluarga H, Senin (3/9) di Sibolga. Menurut TT, almarhum yang merupakan anak kedua dari tiga bersaudara itu rencananya akan tiba di kediamannya di Sibolga dan disemayamkan, untuk selanjutnya dikebumikan. “Pemakamam H direncanakan besok (hari ini, red) sekitar pukul 09.00 WIB di Sibolga. Kami berdoa dan berharap agar almarhum diterima di sisi Tuhan dan tak

lupa kami menyampaikan terima kasih kepada saudara Muchtar Nababan anggota DPRD Sibolga yang sudah memfasilitasi transportasi almarhum menuju Medan kemarin,” tukasnya. Pada kesempatan itu, TT mengungkapkan kekecewaannya kepada petugas kesehatan di RSU dr FL Lumban Tobing Sibolga yang terkesan lamban dalam menangani penyakit yang dialami H. “Apalagi petugasnya sampai mengembalikan H ke rumahnya beserta seprei yang dipakainya di RSU Sibolga dengan alasan takut menularkan penyakit yang diderita H kepada warga lainnya. Kami berharap agar Wali Kota Sibolga dapat mengevaluasi kinerja petugas kesehatan di RSU Sibolga, agar hal ini tidak terulang lagi kepada masyarakat lainnya yang mengalami penyakit yang bisa menular,” tukas TT. Semestinya, sambung TT, pihak RSU Sibolga dan Dinas Kesehatan juga mela-

kukan tindakan tanggap darurat. Artinya tidak harus mengembailkan pasien ke rumahnya dan langsung merujuk pasien ke RSU di Medan guna mendapat pengobatan. “Semestinya kalau hasil diagnosa mengarah kepada penyakit berbahaya semisal HIV AIDS, korban tidak lagi dikembalikan ke rumahnya, namun sebisa mungkin langsung dirujuk ke RSU di Medan atau mengisolasi korban agar tidak menimbulkan keresahan di masyarakat,” tandasnya lantas menambahkan agar kejadian ini menjadi pengalaman berharga bagi seluruh masyarakat, khususnya kepada petugas kesehatan. Terpisah, Direktur RSU dr FL Tobing Sibolga, drg Tunggul Sitanggang membantah kalau pihaknya menyatakan penyakit yang diderita H penyakit HIV AIDS. “Kami tidak ada langsung memvonis H mengidap HIV AIDS. Dan setelah kami cek, petugas hanya mengakui kalau H suspect HIV AIDS, sehingga kami

Febrianto mengatakan sangat tertarik dengan fashion. “Saya rasa fashion perlu juga untuk pemain bola,” katanya. Febri bahkan menyatakan bersedia jika ada yang “mem-booking-nya” kembali menjadi model.Bagaimana kesan Ponaryo Astaman? “Ini benar-benar pengalaman yang berbeda yang tidak akan pernah saya lupakan. Bayangkan saja, saya biasa tampil di lapangan, tapi tiba-tiba saja menjadi model di catwalk,” ujar Ponaryo. Karena yang menjadi bintang di acara fashion show adalah para pemain bola, para penontonnya pun banyak yang selama ini berkecimpung di lapangan hijau. Dalam pagelaran tadi malam, dari jajaran pemain yang tampak hadir, antara lain, Hamka Hamzah (Mitra

Kukar), Rahmat Latif (Persiba Balikpapan), dan mantan pemain PSM Junior yang sempat berguru ke Ajax Amsterdam Irvin Museng. Tampak pula menyaksikan, Media Officer Persija Viola Kurniawati dan Ketua Panpel Macan Kemayoran -sebutan Persija- Hanifditya. Dia hadir bersama sang kekasih Alycia Evyta, presenter BPL di MNC TV. Dan, masih banyak lagi insan bola lainnya yang hadir. “Ini terobosan baru yang sangat menarik dan membuktikan pemain bola tidak kalah kelas dari model sesungguhnya. Tapi, saya rasa para pemain yang tampil masih kurang banyak,” ujar Viola Kurniawati. “Penampilan Ponaryo dan Simon santai walaupun terlihat dewasa,” timpal

Alycia. Sedangkan Hanifditya menyatakan tak mengira Isnan Ali punya bakat terpendam di dunia fashion. “Ponaryo dan Simon terlihat percaya diri. Tenyata Isnan punya bakat terpendam,” tutur pria berkacamata itu. Isnan Ali mengungkapkan, dirinya dan rekan bisnisnya akan terus mengembangkan bisnis tersebut. Selama ini pemasaran banyak dilakukan memanfaatkan jaringan para pemain sepak bola yang bermain di kompetisi tanah air. Baik pemain lokal maupun asing. Pemasaran juga dilakukan lewat online. “Untuk model-model jins dan pakaian lainnya, kami sendiri yang menentukan,” ujarnya. (jpnn)

merujuknya ke Medan agar dapat dirawat serta memastikan penyakit yang dideritanya. Warga Diminta Tak Panik Dinas Kesehatan (Dinkes) Sibolga melakukan sosialisasi dan penyuluhan penanggulangan perkembangan HIV/ AIDS kepada masyarakat Kelurahan Huta Barangan dan Kelurahan Angin Nauli, Kecamatan Sibolga Utara, Kota Sibolga, Senin (3/9) di Aula Gereja HKBP Sibolga Julu. Sosialisasi ini menyusul terjadinya keresahan di tengah-tengah warga akibat simpangsiurnya informasi terkait meninggalnya H, yang disebut-sebut akibat penyakit HIV AIDS yang diduga diidapnya. Kepala Dinas Kesehatan Sibolga M Yusuf Batubara melalui Kepala Bidang Pencegahan, Pemberantasan Penyakit dan Penyehatan Lingkungan dr Donna Pandiangan dalam sosialisasi itu menyampaikan, HIV adalah virus penyebab AIDS. “Virus tersebut menyerang sistem kekebalan tubuh, sehingga menyebabkan

orang yang telah terinfeksi HIV menjadi sangat rentan terhadap berbagai penyakit yang dapat mengancam hidupnya,” terang dr Donna. Orang dengan HIV/ AIDS (ODHA), sambungnya, tidak ada bedanya dengan manusia lainnya dimana mereka juga (penderita, red) mempunyai hak, keuntungan dan kesempatan yang sama dengan orang lain yang menderita penyakit serius lainnya. “HIV/AIDS menular melalui hubungan seks yang tidak terlindungi dengan orang yang telah terinfeksi HIV, penggunaan jarum suntik secara bergantian/bekas/tidak steril, transplantasi organ dan transfusi darah,” bebernya. Namun demikian, lanjutnya, HIV tidak ditularkan melalui bekerja bersama dengan orang yang terinfeksi HIV, digigit nyamuk/serangga lain, berpegangan tangan atau saling berpelukan dengan penderita HIV AIDS, keringat, bersalaman, berbagi makanan atau menggunakan alat makan bersama, menggunakan toilet bersama dan terpapar batuk

atau bersin. “Jadi, kami berharap dan mengimbau agar warga tidak resah dan panik mendengar informasi yang tidak jelas soal penularan penyakit HIV AIDS. Artinya, tidak ada masalah jika warga sekalian melayat ke rumah duka H yang meninggal dunia diduga terkena penyakit HIV AIDS,” tandas dr Donna. Muchtar S Nababan, anggota DPRD Sibolga yang turut dalam sosialisasi itu menyampaikan, meskipun pengidap HIV/AIDS tidak bisa disembuhkan namun untuk pencegahan penularannya dapat dilakukan dengan cara sosialisasi. “Untuk itu, dalam menanggulangi HIV/AIDS, peran pemerintah dan instansi terkait sangat diharapkan. Khususnya kepada instansi terkait, untuk lebih proaktif lagi memberikan menjelaskan soal HIV/AIDS, bagaimana cara penyebaran dan pencegahannya, mau dan mampu melakukan dan berperan aktif dalam pencegahannya, serta melindungi diri dan keluarganya dari penularannya,” pungkas Muchtar. (tob)


4 September 2012


Habiskan Dana Hampir Rp300 Juta MADINA-Walaupun sudah dua kali penamabahan waktu kerja dan sudah menghabiskan anggaran sekira Rp300 juta, kinerja panitia khusus (Pansus) PT Palmaris Raya di DPRD Mandailing Natal (Madina) belum jelas. Hingga saat ini rekeomendasi hasil kerjanya tak ada. Sejumlah elemen masyarakat meminta kepada Pansus PT Palmaris Raya DPRD Madina agar segera merekomendasikan hasil kerjanya yang sudah berjalan lebih dari 4 bulan terhitung mulai bulan April lalu. Mereka menilai, pansus ini sudah melukai hati masyarakat Kecamatan Batahan, yang belasan dianiaya perusahaan. Selama itu pula masyarakat menggantungkan harapan kepada Pansus PT Palmaris yang dibentuk paska aksi nginap di gedung dewan beberapa waktu lalu. Ketua Forum Komunikasi Indonesia Bersatu wilayah Pantai Barat, Toguan Lubis kepada METRO, Senin (3/9) menyampaikan, masyarakat di Kecamatan Batahan khususnya yang bermasalah lahan dengan pihak perusahaan, sudah terlalu lama menantikan keputusan yang dari persengketaan yang mereka hadapi saat ini. Pasalnya, warga merasa belasan tahun dizalimi perusahaan. Terakhir, puncak kekesalan warga terjadi pada tanggal 9 April lalu, dimana ratusan ‹ ‹ Baca

Habiskan ...Hal 7

Basyrah Lubis

Belum Pulangkan Mobil Dinas PALAS – Mantan Bupati Padang Lawas (Palas) Basyrah Lubis hingga saat ini belum memulangkan mobil dinas milik pemkab. Selain Basyrah, mantan Sekda Palas Gusnar Hasibuan dan lima mantan pejabat lainnya juga melakukan „ Basyrah Lubis hal serupa. Kabag Umum Pemkab Palas Bustami Harahap menerangkan, masih ada tujuh unit kendaraan roda empat yang belum tertarik, termasuk kendaraan yang dipakai mantan bupati, mantan sekda, dan pejabat lainnya. “Saat ini sudah masuk tiga minggu, tim bersama Polres Tapsel mencari kendaraan dinas tersebut,” ucap Bustami. Namun, kata Bustami, ada yang menjadi kendala yang menyebabkan mobil dinas susah ditarik. Misalnya, mantan pejabat yang memakai kendaraan dinas terkadang tidak di rumah. ‹ ‹ Baca

Belum ...Hal 7

Air Laut Masuk Rumah

WARGA PONDOK REFORMASI RESAH SIBOLGA- Warga Pondok Reformasi, Kelurahan Kota Beringin, Kecamatan Sibolga Kota, resah karena air laut kerap membanjiri rumah penduduk di sekitar bibir Pantai Ujung, Sibolga. Peristiwa ini terjadi dalam beberapa hari belakangan, terutama pada malam hari deburan ombak terasa semakin besar.


OMBAK BESAR, Gelombang besar yang terjadi di Pantai ujung Sibolga mencapai pemukiman warga. Foto dijepret, Senin (3/9) di Sibolga

“Seperti semalam, disaat aku tidur di rumah jadi kaget sebab tiba-tiba air laut bisa menyiram wajah dan badanku. Kalaupun misalnya terjadi pasang gembung (gelombang pasang,red), belum pernah terjadi seperti ini,” kata Hendra, salah seorang warga yang rumahnya tak jauh dari bibir pantai, Senin (3/9) kemarin. Menurut Hendra, setiap tahunnya warga Pondok Reformasi memang menjadi langganan hantaman gelombang

air laut, bahkan sudah ada beberapa rumah warga setempat yang rusak total akibat dihantam gelombang laut yang besar tersebut. “Kalupun setiap tahun seprti ini, namun untuk tahun ini cukup besar dan membuat kami warga resah. Apalagi kami kuatirkan, kuatnya hantaman gelombang pasang dan hantaman ombak khususnya membuat tembok penahan yang ada menjadi ru‹ ‹ Baca

Air Laut ...Hal 7


Stop Statemen Provokatif! PANDAN- Forum Sarjana Perintis, Penggerak dan Pemerhati Pembangunan (FORSA P4) Tapteng Sibolga dan DPC Pemuda Panca Marga (PPM) Tapteng menyesalkan pernyataan berbau provokasi dari beberapa pihak tertentu terkait permasalahan aset Pemkab Tapteng yang dipakai oleh Pemko Sibolga.

Yakni sebidang tanah dan bangunan eks SPK Tapteng yang digunakan sementara menjadi kantor Dinas Pendidikan Sibolga. “Kami sangat menyesalkan sikap dan pernyataan sejumlah pihak yang cenderung berbau provokasi. Sebenarnya sah-sah saja berkomentar di media, tapi hendaknya pakai etika

dan sopan santun. Jangan asal membuat statemen padahal sesungguhkan tidak paham persoalannya. Lalu media pun jangan asal tampung statemen-statemen yang tidak mendidik,” ujar wakil ketua Forsa P4 Tapteng, M Ikhsan Siregar SH ber‹ ‹ Baca

Stop ...Hal 7


Lepas 259 Mahasiswa/i PPLT

„ Wali Kota Sibolga Drs HM Syarfi Hutauruk saat melaksanakan pelepasan mahasiswa/I STIKIP, Jumat (31/9).

SIBOLGA- Sekolah Tinggi Keguruan dan Ilmu Pendidikan (STKIP) St Santa Maria Sibolga menggelar acara pelepasan 259 mahasiswa/i untuk melaksanakan Program Pengalaman Lapangan Terpadu (PPLT) ke sejumlah sekolah di Sibolga dan Tapteng, di Aula STKIP Santa Maria Jumat (31/8) sekira pukul 16.00 WIB. Pelepasan mahasiswa PPLT dilakukan langsung oleh Wali Kota Sibolga Drs HM Syarfi Hutauruk yang didampingi oleh Ketua Yayasan Santa Maria Berbelas Kasih Sr Dionesia Marbun SCMM serta disaksikan oleh sejumlah pejabat Kota Sibolga beserta pengurus yayasan, dan seluruh Dosen. ‹ ‹ Baca

Lepas ...Hal 7

Dukung Pemberantasan Narkoba SIDIMPUAN- Memberantas penyalagunaan narkotika dan obat-obat terlarang (Narkoba, red) diperlukasn tindakan tegas dari aparat penegak hukum. Tujuannya, ada efek jera terhadap pelaku atau pemakai serta

bandar bahkan dapat juga mempersempit ruang gerak para pengedar atau bandar. Disamping tindakan tegas aparat penegak hukum, juga

diharapkan peran serta orang tua, kepala lingkungan (Kepling), pendidik, ulama, pendeta, LSM, tokoh politik, organisasi mahasiswa dan pemerintah untuk ikut bersama dalam memberantas penyalahgunaan ‹ ‹ Baca

Dukung ...Hal 7

„ Muhammad Yazid SPd MAP saat menerima buku tentang arsip dan dokumentasi Perpustakaan dari Kabid Pembinaan Perpustakaan Sumut Dra Murjani MSi di Kantor Badan Perpustakaan Arsip dan Dokumentasi Provinsi Sumut.

SDN 081240 Jadi Duta Perpustakaan SIBOLGA- SDN No 081240 Sibolga kembali mendapat penghargaan untuk mengikuti pembinaan tentang perpustakaan. Setelah keberhasilan SD yang biasa dikenal dengan SDN 40 ini menjadi juara pertama perpustakaan terbaik tingkat provinsi, sekolah ini kembali mendapat kesempatan untuk mengikuti pem-

binaan tentang perpustakaan kearsipan dan dokumentasi yang dilaksanakan selama 2 hari di Kantor Badan Perpustakaan Arsip dan Dokumentasi Provinsi Sumut. Pembinaan yang dilaksanakan sejak Jumat (31/8) hingga Sabtu (1/9) itu tentang ke‹ ‹ Baca

SDN 081240 ...Hal 7

„ Malik Assalih Harahap bersama Kapoldasu, Irjen Pol Wisjnu Amat Sastro.



METRO BONAPASOGIT Teraktual dari Tarutung, Balige, Humbahas dan Samosir

Selasa 4 September 2012


Foto Bernad L Gaol

TERBAKAR: Masyarakat membersihkan puing-puing kebakaran di gedung sekolah minggu dan rumah dinas Bibelvrou HKBP Unte Mungkur, Muara, Taput usai kebakaran, Senin (3/9).

Rumah Bibelvrouw HKBP Terbakar TARUTUNG- Satu unit gedung sekolah minggu dan rumah dinas Bibelvrouw HKBP di Desa Unte Mungkur, Kecamatan Muara, Taput hangus dilalap si jago merah, Senin (3/9) pukul 04.30 Wib “Kedua gedung yang terbakar itu milik Ressort HKBP Unte Mungkur,” kata Kasubbag Humas Polres Taput

Aipda W Baringbing kepada wartawan, Senin (3/9). Dia menyampaikan, kebakaran pertama kali diketahui Pendeta HKBP Unte Mungkur Pdt M Hutasoit. Selanjutnya pendeta langsung membunyikan lonceng gereja untuk memberitahukan kepada masyarakat.

Dia menyebutkan, pada saat peristiwa kebakaran, Bibelvrouw HKBP Nova Laropa (24) yang menempati rumah dinas itu tidak berada di tempat. “Bibelvrouw yang menempati rumah itu saat kejadian tidak berada di tempat,” ucapnya. Katanya, tidak ada harta benda yang bisa diselamatkan para korban,

hanya baju di badan yang tersisa. Pihaknya telah melakukan olah TKP dan akan memeriksa saksi-saksi guna menyelidiki lebih lanjut penyebab terjadinya kebakaran itu. “Kita belum tahu sumber apinya, nanti kita konfirmasi ke saksi-saksi

„) Baca Rumah ..Hal 10

Poldasu Bekuk 2 Polisi Terlibat Narkoba 145 GRAM SABU, 1 PISTOL DAN 6 PELURU DISITA

FOTO Bernad L Gaol

„ Truk rombongan Brimob Poldasu yang terguling setelah dievakuasi.

Truk Rombongan Brimob Poldasu Masuk Jurang

HUMBAHAS- Direktorat Reserse Narkoba (Diresnarkoba) Kepolisian Daerah (Polda) Sumatera Utara (Sumut) membekuk dua polisi yang terlibat kasus narkoba. Keduanya masih menjalani pemeriksaan di Mapolda Sumut di Medan, Senin (3/9). Kedua oknum penegak hukum tersebut masingmasing Briptu Surya Dharma dan Briptu Amrul, mereka bertugas di Samapta Polres Humbang Hasundutan (Humbahas). Keduanya diringkus bersama seorang bandar narkoba, Zulham Simangunsong (27), warga Jl Ahmad Yani, Sejahtera, Kota Tanjung Balai. Direktur Resnarkoba Polda Sumut Kombes

Andjar Dewanto mengatakan, ketiga tersangka ditangkap setelah petugas bertransaksi dengan menyaru sebagai pembeli di kawasan Tanjungbalai Selatan, Tanjung Balai, Kamis (30/8) lalu. Dari tangan tersangka, petugas berhasil menyita barang bukti sabu-sabu seberat 145 gram. Selain itu ditemukan juga satu pucuk pistol jenis revolver dan 6 butir peluru. ”Pistol itu bukan senjata standar Polri. Kemungkinan senjata tersebut ilegal,” jelas Andjar kepada wartawan.

„) Baca Poldasu ..Hal 10

TARUTUNG- Truk petugas yang membawa rombongan 22 personel Brimob Poldasu deta semen B Tebing Tingg No Polisi 15201 II Aans Tanjung, terbalik dan masuk ke jurang sedalam 4 meter di kawasan tikungan manis KM 12, Desa Parsingkaman, Kecamatan Adian Koting atau 45 kilometer dari Tarutung, Taput, Senin (3/9) sore. Peristiwa ini mengakibatkan satu orang personel mengalami luka berat, tujuh luka ringan, sedangkan sisanya hanya mengalami lika gores. Kapolres Taput AKBP Wijadmika SIK kepada wartawan usia membesuk korban di RSU Swadana Tarutung membenarkan peristiwa itu. Ia mengatakan, berdasarkan informasi yang mereka peroleh, peristiwa ini terjadi diduga karena rem blong. “Diduga rem blong karena kecepatan bus hanya mencapai 40 KM per jam. Mungkin akibat rem blong supir banting setir sehingga akhirnya terbalik ke jurang. Ini murni laka tunggal,” terang Kapolres. Sebelumnya, kata Kapolres, rombongan Brimob ini berangkat dari Deta Semen B Tebing Tinggi tujuan Batang Toru, Tapanuli Selatan (Tapsel) dalam rangka bantuan pengamanan di

„) Baca Truk Rombongan ..Hal 10

Mayat Pria Kepala Botak Membusuk di Jembatan KAKI DIIKAT, WAJAH DILAKBAN PORSEA- Seorang pria tanpa identitas ditemukan membusuk di bawah jembatan di Desa Sosopan Pintu Pohan Meranti, Tobasa, Senin (3/9) sekira pukul 15.30 Wib. Dugaan sementara, korban dibunuh. Sebab, kedua kakinya diikat dan mulut dilakban. Informasi yang diperoleh METRO, penemuan itu berawal dari kecurigaan warga yang mencium aroma bau busuk sejak tanggal 31 Agustus lalu. Setelah ditelusuri beberapa hari kemudian, sumber aroma bau busuk itu berasal dari sebuah karung plastik warna hitam yang berada di kolong jembatan. Selanjutnya, warga langsung melaporkan ke Polsek Porsea. Ternyata benar, begitu polisi tiba di TKP langsung membuka karung dimaksud.

„) Baca

Mayat ..Hal 10

Foto: Hengki Tobing

RUSAK: Salah seorang pengendara melintas dari satu ruas jalan di Siatas Barita, Taput, yang rusak parah dan butuh perbaikan.

Petani Kewalahan Angkut Hasil Tani Akibat Jalan Rusak TAPUT- Kondisi infrastruktur jalan di Tapanuli Utara saat ini memprihatinkan. Dimana-mana terdapat lubang, bahkan masih ada yang belum tersentuh aspal sama sekali. Sehingga membuat petani kesulitan mengangkut hasil pertanian mereka. “Ini harus menjadi perhatian khusus oleh pemerintah daerah. misalnya di Pangaribuan, infra-

struktur jalan di sana masih memprihatinkan. Hal ini saya temukan ketika melakukan reses ke daerah itu. Teman-teman Dewan yang lain juga menemukan hasil yang serupa. Mereka menilai perbaikan jalan di Taput harus lebih diperhatikan lagi,” kata

„) Baca Petani ..Hal 10

Foto:Bram Situmorang

MAYAT: MR X yang ditemukan di kolong jembatan Sosopan Pintu Pohan Meranti.

Diputusi Pacar, Pria Asal Siborongborong Minum Racun SIBORONGBORONG- Cinta memang benar bisa membuat buta. Hal itu pula yang membuat Gunawan Gultom (32) pria asal Siborong-Borong nekat menghabisi nyawanya dengan cara menenggak minuman yang telah dicampur dan dikemas dalam plastik. Kematian pria yang baru tiba di Medan Senin (3/9) sekitar pukul 09.00 Wib membuat warga sekitar Jalan Waringin belakang Gedung Putih terkejut Senin


Edisi 49 „ Tahun IX

sore pukul 18.00 Wib. Pasalnya, sekitar pukul 14.00 Wib korban masih dilihat warga duduk di salah satu rumah milik warga yang tak jauh dari kos-kosan kekasihnya bernama Desi br Siburian (21). Informasi dihimpun POSMETRO (Grup METRO) menyebutkan, kematian Gunawan Gultom ini pertama kali diketahui

„) Baca

Diputusi ..Hal 10

Miras Senilai Rp70 Juta Dimusnahkan SIANTAR- 219 botol minuman keras berbagai merk yang diperkirakan bernilai Rp70 juta, dimusnahkan di halaman Polres Pematangsiantar, Senin (3/9) pukul 10.00 WIB. Mirasmiras ini merupakan hasil operasi pekat pada Bulan Ramadhan lalu, yang disita dari UD Makmur Jaya, di Jalan MH Sitorus, Siantar Barat. Beberapa merk ternama yang dimusnahkan, antara lain red label,

balleys, gordons, martini, jose cuervo, black label, dan winner. Selain itu ada martil, civas regal dan beberapa merk minuman keras lain dari dalam dan luar negeri. Pemusnahan disaksikan jaksa fungsional Hari Darmawan dan Kasipidum R Parulian Lumbantoruan yang mewakili Kejari Pematangsian-

„) Baca Miras ..Hal 10


4 September 2012

Bantuan Hukum Gratis untuk Rakyat Miskin SIMALUNGUN- Mengingat banyaknya perkara pidana yang dilakukan sebagian orang, khususnya masyarakat yang kurang mampu di wilayah hukum Simalungun, Pengadilan Negeri Simalungun menyediakan Pos Bantuan Hukum (Posbakum) yang diberikan gratis bagi mereka yang memiliki perkara pidana. Hal itu dikatakan Ketua PN Simalungun Abdul Siboro, Minggu (2/9). Menurutnya, di wilayah kerja mereka banyak terdakwa ataupun yang memiliki perkara pidana, namun tidak mampu mengeluarkan uang untuk menyewa pengacara. “Sesuai arahan Mahkamah Agung, PN Simalungun sudah menyediakan Posbakum secara gratis. Sementara biaya untuk pengacara yang siap melayani ataupun membantu proses hukum pada saat persidangan, akan ditanggung Negara,” paparnya. Dia menerangkan, tak dapat disangkal lagi di Simalungun ini umumnya, masyarakat berprofesi sebagai petani. Selain itu banyak di antara mereka yang buta terhadap hukum, hingga Posbakum dimanfaatkan untuk memberikan pelayanan bantuan hukum secara cumacuma. Tetapi ada beberapa persyaratan yang haris dilengkapi untuk mendapatkan pelayanan. “Yakni surat gugatan atau surat permohonan, surat keterangan tidak mampu yang dapat diperoleh dari lurah setempat. Kemudian surat pernyataan tidak mampu yang ditandatangani si pemohon dan Ketua Pengadilan,” paparnya. Sambungnya, mereka yang berperkara berhak melakukan konsultasi hukum untuk berbagai perkara. Selanjutnya bantuan untuk memperoleh layanan pengacara, serta bantuan untuk memperoleh pembebasan biaya perkara. Sementara bagi terdakwa yang melakukan tindak pidana dengan ancaman hukuman lebih dari 5 tahun penjara, berhak mendapatkan bantuan hukum gratis juga. “Tapi itu tergantung kepada pihak yang berperkara. Sebab ada saja terdakwa yang tidak ingin didampingi pengacara, meski secara gratis. PN Simalungun tetap menyediakan pengacara prodeo yang gajinya diperoleh dari Negara,” jelas Siboro. Sementara bagi terdakwa yang ancaman hukumannya sampai 15 tahun ke atas, namun tidak bisa menghadirkan pengacara, PN Simalungun akan langsung menghunjuk penasehat hukum gratis. “Biasanya itu diberlakukan untuk kasus pencabulan, pembunuhan dan lainnya. Anggaran untuk ini yang dikeluarkan negara pada 2011 mencapai Rp180 juta. Sementara untuk tahun 2012, sebesar Rp100 juta. (mua/hez)

Mayat Pria Kepala Botak Membusuk di Jembatan Sambungan Halaman 9 Spontan warga geger begitu melihat isi karung tersebut sesosok manusia. Untuk penyelidikan lebih lanjut, mayat tersebut di bawa ke Rumah Sakit Umum Daerah (RSUD) Porsea. Menurut dr Freddy Sibarani yang bertugas di RSUD Porsea, dilihat dari kondisinya, mayat ini sudah dibuang sekitar sebulan. “Sepertinya mayat ini sudah dibuang sekitar sebulan lalu,” kata dr Freddi Sibarani saat memeriksa mayat Mr X di ruang mayat RSUD Porsea. Kapolres Toba Samosir AKBP Budi Suherman yang ditemui METRO di sekitar ruang mayat RSUD Porsea mengatakan, Mr X dipastikan korban pembunuhan. Pasalnya, seluruh bagian wajah korban dilakban. ”Seluruh bagian wajahnya ditutupi pakai

lakban warna kuning dan dilehernya ditemukan kawat jeratan, kemudian kedua kakinya diikat pakai lakban juga. Maka dipastikan, korban merupakan pembunuhan,” kata Kapolres yang juga didamping Kasat Reskrim AKP Robert Sembiring, Kapolsek Porsea AKP Manson Nainggolan. Kapolres mengatakan, mayat tersebut diyakini bukan warga Tobasa melainkan kiriman dari luar Tobasa. “Kita katakan demikian karena kita tidak ada menerima laporan dari masyarakat yang merasa kehilangan anggota keluarganya. Selanjutnya kita akan adakan penyelidikan dan penyidikan dan mayat akan dibawa ke Pematangsiantar ke bagian forensik. Sampai besok kita tunggu dulu apakah ada laporan masyarakat yang kehilangan anggota keluarga,” ujarnya. Adapun ciri-ciri Mr X tersebut sebagai

berikut, tinggi badan lebih kurang 150 centimeter, kepala bagian depan botak dan rambut ikal. Mr X ketika ditemukan mengenakan pakaian tiga lapis yakni dibagian luar jaket warna biru bermerek Denimologi, kemeja liris kotak warna biru dongker, memakai kaos dalam, dan celana dalam warna biru, ikat pinggang merek AX, sandal merek carvil, topi warna biru, gigi depan dua ompong namun tidak dapat dipastikan apakah kedua gigi tersebut sudah demikian keadaannya sebelum dibunuh. Pada kesempatan itu, ia mengimbau kepada masyarakat jika ada kehilangan keluarga dengan ciri-ciri di atas agar melihat mayat tersebut ke RSUD Porsea. “Bagi warga yang merasa kehilangan seperti ciri-ciri yang saya sebutkan tadi, silahkan mendatangi RSUD Porsea,” imbaunya. (bram/des)

Petani Kewalahan Angkut Hasil Tani Akibat Jalan Rusak

Sambungan Halaman 9 Kuat dugaan, tersangka merupakan sindikat peredaran narkoba antarnegara melalui Pelabuhan Laut Tanjung Balai. “Petugas masih memburu seorang tersangka lagi dalam kasus ini,” sebut Andjar. Sementara Kapolres Humbahas AKBP Verdy Kalele saat dihubungi METRO tadi malam sekira pukul 19.30 Wib membenarkan penangkapan kedua anggotanya tersebut. “Ia benar, kedua saat ini sedang diproses di Polda Sumut,” singkatnya via telepon selulernya. (dc/hsl/des)

Rumah Bibelvrou HKBP Terbakar Sambungan Halaman 9 dan keluarga korban. Kerugian juga akan kita hitung setelah pihak korban memberi kesaksian,” ujarnya. Hingga kini Baringbing menyampaikan, pihaknya masih melakukan penyelidikan terkait penyebab terjadinya kebakaran. ”Kita belum tahu dari mana sumber api, saat ini kita masih melakukan olah TKP dan menyeidiki penyebab terjadinya kebakaran,” tandasnya. Sekjend HKBP Tinjau Lokasi Mengetahui terjadinya peristiwa kebakaran itu, Sekretaris jendral (Sekjend) HKBP Pearaja Tarutung Pdt Ramlan Hutahaean MT didamping Kepala Biro Humas Puji Handoko Aritonang langsung meninjau lokasi kejadian. “Gedung Sekolah Minggu dan rumah dinas Bibelvrouw hangus terbakar semua,” tandas Puji. Dia mengatakan sampai saat ini pihak HKBP masih melakukan upaya penanggulangan terhadap kerugian kebakaran tersebut. (cr-01/ des)

Sambungan Halaman 9 Ketua DPRD Taput Fernando Simanjuntak ditemui di kantornya, Senin (3/9). Ia menilai, perbaikan infrastruktur jalan di daerah ini salah satu hal yang paling dibutuhkan melihat masih banyaknya jalan rusak yang mengakibatkan masyarakat kewalahan memasarkan dam mengerjakan lahan pertanian mereka. Tetapi Fernando tidak memungkiri, perbaikan tersebut akibat keterbatasan dana APBD. Sehingga perbaikan jalan rusak tidak dapat sekaligus dilakukan. Ketua LSM Predikat Sumut Asman Sihombing kepada METRO membenarkan infrastruktur jalan di Taput kini sudah banyak rusak. Soal keterbatasan dana APBD seperti yang diungkapkan Ketua DPRD Taput, Asman justru berpendapat bahwa pemerintah daerah harus bekerja lebih maksimal lagi. Caranya, jangan hanya berpatok terhadap anggaran tersebut. Melainkan pemerintah harus mencari dana dengan melakukan loby ke pusat. “Dinas Pekerjaan Umum harus mengetahui seberapa banyak jalan yang butuh perbaikan dan berapa dana yang dibutuhkan. Apabila sudah diketahui berapa jumlah untuk itu, pemerintah harus mencari cara lain. Jadi jangan hanya mengharapkan dana alokasi umum yang bersumber dari APBD saja. Itu tugas pemerintahan untuk mencari dana lainnya. Seperti, Dana Alokasi Khusus (DAK) dari Pusat. Atau mungkin dana percepatan pembangunan daerah tertinggal. Kalau itu maksimal dilakukan, niscaya keterbatasan dana itu bisa diatasai,” bebernya.

Poldasu Bekuk 2 Polisi Terlibat Narkoba

Foto: Hengki Tobing

RUSAK: Salah seorang pengendara melintas dari satu ruas jalan di Siatas Barita, Taput, yang rusak parah dan butuh perbaikan. Selain itu, lanjut Asman yang juga mantan angggota DPRD Taput ini, DPRD selaku wakil rakyat juga harus proaktif melihat apa-apa saja yang dibutuhkan oleh masyarakat. “Dewan harus mengkaji lebih dalam kebijakan umum anggaran. Hal-hal yang tidak dibutuhkan, saya rasa seperti kegiatan seremonial seharusnya diminimalkan. Contohnya, acara HUT Pemkab Taput yang dilakukan 10 hari. Memang boleh saja itu dirayakan. Namun saya mau tanya apa rupanya keuntungan yang dihasilkan dengan dilakukannya acara seremonial itu. Jadi acara seremonial seperti itu harus dikurangi dan dana yang harusnya

diperuntukkan untuk acara itu bisa dialihkan ke perbaikan jalan,” imbaunya. Selain itu, tambah Asman, kompetisi olahraga di Tapanuli Utara dinilai tidak terlalu penting untuk digemborkan. Karena menurutnya, saat ini olahraga di daerah itu masih sebatas hiburan tanpa adanya prestasi. “Nah, hal-hal seperti itulah yang perlu Dewan pikirkan dan harus berani mengatakan agar hal itu ditunda dulu dan mencari solusi dengan mengarahkan ke yang lebih penting seperti pembangunan infrastruktur tadi misalnya,” pungkasnya. (cr-02/des)

Hal tersebut disampaikan rekan Desi bernama Selfi (23). “Memang beberapa hari ini Desi cerita samaku kalau dia ada masalah dengan pacarnya. Katanya, dia putus sama pacarnya yang ada di Siborong-Borong, jadi mungkin pacarnya itu datangkeMedanmaumenjumpaisiDesiitubang. Tadi orang itu sempat ketemu di Petisah terus berantam lewat handphone,” beber wanita berambut sebahu ini. Sementara itu kekasih korban Desi br Siburian kepadaPOSMETROmembenarkandiasudahtak lagi menjalani hubungan asmara sejak 4 hari lalu. Hal itu dikarenakan jarak antara keduanya sangat jauh. Desimengakutaktahandenganhubunganjarak jauhyangdilakonikeduanya.Wanitaberkulitputih ini pun mengatakan jika Gunawan menelpon dia saattibadiMedandanmengajakbertemudiPasar Petisahdimanaiabekerja.KarenaDesimerasatak memiliki hubungan lagi dengan Gunawan, Desi memilih cuek. Namun tanpa diduga, Gunawan menghubungi Desi dan mengatakan akan meminum racun jika dia tak mau menemui Gunawan yang saat itu sudah berada di Petisah. “Aku tak menyangka kalau dia benar-benar bunuh diri. Tadi dia datang dari kampung mau menemui aku. Tapi karena aku sudah putus sama dia,akutakmaumenjumpaidia.Terusakuditelpon diadanmengancamakanminumracunkalauaku tidak menemuinya. Saya kira itu hanya ancaman biasa makanya aku tetap cuek. Ternyata dia meninggal dekat kosku,” kata wanita asal Lintong Nihutainiserayamenangisdanmenyesalitindakan cueknya.

Mondar-mandirUsaiMinumRacun Informasi lain, setelah meminum racun, GunawanlangsungmenujukekosDesibrSiburian di Jl Waru tepat di belakang Gedung Putih. Disitu korban berjalan sendiri layaknya orang kebingungan. Korban tampak memegangi dadanya dan telihat mondar-mandir di Jl Waru hingga Jl Waringin tak jauh dari kos kekasihnya itu. Wajah korban terlihat mulai memucat dan sesekalimerintihkesakitansambilterusmemegang dadanya. Melihat itu, anak-anak di sekitar lokasi sempat mendekati korban dan menanyakan apa yang terjadi, namun tak dijawab. Hingga akhirnya seorang pemuda Fedrick (22) sempat mendengar rintihan korban yang mengatakan dalam bahasa batak toba “Pajumpang di surgo ma hita ito (Ketemu di surgalah kita sayang)” dan kemudian tertidur di bangku papan dimana korban ditemukan tak bernyawa. Semula Fedrick mengaku mengira jika korban hendak tertidur karena lelah. “Aku kira dia itu mau tidur, kami tak kenal sama dia. Cuma tadi dia itu merintih-rintih kesakitan lah sambil memegang dadanya. Masih kudengar lagi kalau dia merintih denganbahasabatak,“pajumpangdisurgomahita ito” terus tidur lah dia. Sekitar pukul 16.00 Wib lah tadi itu. Rupanya sekitar pukul 18.00 Wib, kami mendengar kabar kalau dia sudah meninggal,” terang pria berbadan tegap ini. Kematian Gunawan Gultom pun menyisakan kesedihan bagi Desi br Siburian yang sempat menangisdisekitarjasadkorbandanterlihatshock. Desi pun diboyong ke Polsek Medan Baru untuk dimintai keterangan. (wel)

FOTO Bernad L Gaol

„ Kapolres Taput AKBP Wijadmika SIK membesuk korban di RSU Tarutung.

Truk Rombongan Brimob Poldasu Diputusi Pacar, Pria Asal Siborongborong Minum Racun Masuk Jurang Sambungan Halaman 9

Agustina (58) pemilik rumah dimana korban menumpang duduk menunggu kekasihnya Desi br Siburian.Agustinasaatituterkejutmelihat kondisi Gunawan yang semula duduk di bangku papandepanrumahnyatelahtertidurdenganmata setengah terbuka. Curiga, Agustina langsung melaporkan hal tersebut ke kantor Koramil. Bersama seorang anggota Koramil Serma Gunawan dan wanita paruhbayaitumelihatpemudaberkulithitamyang mengenakan kemeja dan kaos cokelat yang tertidur di depan rumahknya. Setelah diperiksa, ternyata korban sudah tak bernyawa lagi. Warga sekitar yang mendengar temuan itu langsung berkerumun di sekitar lokasi dan melaporkannya ke Polsek Medan Baru. “Akutadipasmaumengambilkainkarenasudah sore, rupanya kuperhatikan si anak muda itu tertidur tapi perutnya tak bergerak. Dia itu dari jam 2 siang kesini, permisi numpang duduk. Ya, namanya minta tolong numpang kita kasih lah. Setelahkamiperiksarupanyadiasudahmati,”jelas Agustina. Beredar kabar yang menyebut, jika kematian korban dikarenakan baru saja putus cinta dengan kekasihnya Desi br Siburian setelah bertengkar lewat telpon seluler. Korban dan kekasihnya bertengkar di Pasar Petisah karena korban diputuskan secara sepihak. Tak terima, korban nekat membeli racun dan mencampurnya ke minuman yang dikemas dalam plastik. Setelah diminum,korbanlangsungmenujukoskekasihnya


Wa n i t a ( G a d i s / J a n d a ) dipekerjakan di Medan untuk jaga anak, perawat orang sakit, gaji Rp 700.000 s.d 1.2 jt/bulan (bersih) + bonus, asrama + makan gratis. Hubungi: CAHAYA 2 Jl. Gatot Subroto / Ayahanda 44 E Telp. 0813 6262 7635; 0852 6207 9555

Sampai di Medan (Terminal kami siap menjemput)



Digital Printing Batu Nisan Neon Box Merk Toko Prasasti Baliho Stempel Otomomatis Jl. Pattimura No. 42 P. Siantar Telp. 0622 - 27521 HP 0813 6234 7943 (Belakan Ramayana P. Siantar)

di Jalan Waru. Namun, saat ditunggu Desi tak kunjung datang, hingga korban memilih duduk di rumah Agustina. “Kalau kabar-kabarnya, dia ini baru datang dari Siborong-borong. Dia putus cinta sama pacarnya bernama Desi yang kos disekitar sini. Pertama kali diadiketahuimeninggalsamayangpunyarumah,” kata Kahirul Purba, Kepling VII Sekip. TimidentifikasidariPolrestaMedandanpetugas Polsek Medan Baru, tiba di lokasi dan langsung memasanggarispolisi(policeline).DariTKP,polisi menemukan satu unit handphone cina, kabel charger, dompet berisi identitas di dekat korban. Korban langsung dibawa ke RS Pirngadi untuk kepentingan autopsi. Kapolsek Medan Baru Kompol Budi Hendrawan dan Wakapolsek AKP S Siagian tampak di sekitar lokasi dimana jasad pria itu ditemukan. “Tidak ditemukan tanda-tanda kekerasan, belum diketahui penyebab pasti kematian korban, masih lidik,” singkat Kapolsek. KorbanTakTerimaDiputuskan Kematian Gunawan Gultom membuat warga sekitarbertanya-tanyadengansosokpriatersebut. Pasalnya, warga menilai bahwa tindakan korban terbilang nekat dan bodoh. Karena diputuskan kekasihnya, Gunawan nekat menghabisi nyawanya sendiri dengan racun yang dicampur keminuman. Maksud kedatangan korban adalah untuk meluruskan permasalahan yang terjadi antara dia dengan kekasihnya Desi br Siburian. Korban tak terima jika dia diputuskan secara sepihak oleh kekasihnya itu.

TOYOTA PEMATANGSIANTAR Authorized Toyota Dealer • All new Avanza ready !!! • Veloz accesories full !!! • Grand new innova ready !!!! • Yaris bonus paling lengkap dan full discount • New Rush ready !!! Hub. David Maruhawa, HP 0813 9648 7188; 0831 9355 3180. PIN BB 26C3BF8D (Sales Executive). Data dijemput !!! proses cepat !!!. NB: Harga Siantar sama dengan harga Medan TOYOTA PAKET LEBARAN • Dapatkan New Toyota dengan bunga khusus , Innova dan Fortuner 0% • Dapatkan juga diskon khusus dibulan ini • Proses cepat dan bisa tukar tambah Hub: Predy Simatupang, 0813 6165 1801, 0853 6207 2000 BUTUH EXTRA INCOME !!! KERJA SAMPINGAN / FULL TIME !!! MNC LIFE ( MNC GROUP ) media terbesar di Indonesia, membutuhkan beberapa FINANCIAL CONSULTANT / AGENCY MANAGER yang handal untuk berkarir dan berpenghasilan lebih. Jika anda serius dan membutuhkan informasi tentang syarat-syarat dan proses selanjutnya, segera hubungi bagian Rekruitmen kami : IBU WATI Hp.0823 6888 4343

LOWONGAN KERJA Daerah operasional : Tobasa, Taput, Humbahas, Sibolga dan Tapteng. Dibutuhkan beberapa orang untuk ditempatkan pada posisi : 1. Sales 3. Sales Promotion Girl 2. Merchandiser 4. Sales Representative Persyaratan : 1. Pria (1, 2, 4) wanita (3, 4) 2. Berorientasi target (1, 2, 3, 4) 3. Pendidikan min. SMA sederajat (1, 2, 3) D3 (4) 4. Usia max 30 tahun (1, 2, 3, 4) 5. Memiliki sepeda motor (1, 2, 4) 6. Memiliki SIM C (1, 2, 4) 7. Bersedia menjalani masa training (1, 2, 3, 4) 8. Jujur dan Bertanggung Jawab (1, 2, 3, 4) 9. Berpenampilan menarik (3, 4) 10. Menguasai Ms. Office dan Internet (4)


Jl. Suprapto No. 74 B Sibolga - Jl. Pemuda No. 8 G Balige Informasi lebih lanjut hubungi Bpk. Siswandi HP 0819 880 881

Sambungan Halaman 9 sana. “Brimob Poldasu deta semen B Tebing Tinggi yang berangkat ke Batang Toru, Tapanuli Selatan dalam rangka pengamanan di sana,” ucapnya. Lebih lanjut Kapolres mengatakan, korban luka berat atas nama M Sitorus saat ini sudah dilarikan langsung ke Medan untuk dirujuk ke Rumah Sakit Elisabet. Sedangkan ketujuh lainnya, dirawat intensif di RSU Tarutung. “Sedangkan personel yang selamat terus melanjutkan perjalanan ke Batang Toru,” ucapnya. Pantauan wartawan di RSU Tarutung, sejumlah korban hingga kini masih dirawat intensif oleh petugas medis rumah sakit. Sedangkan Kapolres, hingga berita ini diturunkan, masih tetap memantau di rumah sakit tersebut. Berdasarkan data yang dihimpun wartawan, kedelapan korban luka masing-masing, Aswar Anas Tanjung (supir), Marihot Sitorus, Dedi Asmono, Ahmad Fahri, Jaya Sitanggang, Ricky dan Yokia. Berdasarkan informasi dari warga sekitar, truk itu terbalik karena supir tidak bisa mengendalikan kemudi saat mau menikung di tikungan tajam kilometer 12 Desa Parsikkaman, Adian Koting, Tarutung. Sedangkan kondisi truk ringsek setelah jatuh berguling-guling ke jurang sedalam empat meter. (cr-01/des)

Miras Senilai Rp70 Juta Dimusnahkan Sambungan Halaman 9 tar. Sementara dari Polres Siantar, diwakili Kasat Narkoba AKP Sofyan dan puluhan personil polisi dari berbagai satuan. Turut juga hadir Ketua Front Pembela Islam (FPI) Kota Siantar Muhammad Syahril Chan. Secara simbolis, tiga botol minuman keras ini dilemparkan ke arah alat berat silinder oleh tiga orang yang mewakili kejari dan polisi. Lalu perlahan alat berat ini menggilas semua botol minuman keras yang sudah ditumpuk di aspal. Hari Darmawan mengatakan, 219 miras ini dimusnahkan atas putusan Pengadilan Negeri Pematangsiantar Nomor 01 Pid C/ 2012/PN PMS tertanggal 13 Agustus 2012. Ditambahkan Hari, pemusnahan sempat tertunda dari jadwal yang ditentukan. Itu disebabkan karena suasana lebaran beberapa waktu lalu, sehingga pemusnahan baru bisa terlaksana kemadin, Senin (3/9). “Tidak ada unsur kesengejaan terkait penundaan pemusnahan ratusan botol miras ini. Miras yang dimusnahkan hari ini, sudah sesuai dengan yang tertera di kepolisian dan kejaksaan. Tidak ada bedanya sama sekali.


DIMUSNAHKAN- 219 botol miras senilai Rp70 juta, dimusnahkan di halaman Mapolres Pematangsiantar, Senin (3/9). Saya kira tidak ada masalah dengan itu,” menghargai kinerja polisi dan berharap agar ujarnya. terus ditingkatkan. Sementara Ketua FPI Kota Siantar Mu“Peredaran miras sudah menyeluruh di hammad Syahril Chan mengungkapkan rasa Kota Siantar, kita berharap polisi meningterima kasihnya kepada aparat kepolisian atas katkan kinerjanya dalam pemberantasan pemusnahan yang dilakukan. Mereka miras,” ungkapnya. (ral/hez)


4 September 2012

Kapolri: Ada 1.629 Lokasi Potensi Konflik di Indonesia JAKARTA- Berkaca dari kasus Sampang, Polri memetakan lokasi-lokasi potensi konflik di Indonesia. Polri menginventarisir ada 1.629 lokasi berpotensi konflik. ”Polri pro aktif menginventarisir potensi konflik di seluruh Polda agar tidak berkembang, yaitu terdapat 1.629 lokasi potensi konflik,” ujar Kapolri Jenderal Timor Pradopo dalam rapat dengan pendapat bersama Komisi III DPR, di Gedung DPR, Senayan, Jakarta, Senin (3/9).

Menurutnya, lokasi-lokasi itu tersebar pada beberapa latar belakang kondisi masyarakat. Terbanyak, lokasi potensi konflik terdapat pada sektor perkebunan. ”Lokasi terbanyak adalah perkebunan, pertanahan, agama, ekonomi sosial dan budaya, serta pertambangan,” tuturnya. Ia menjelaskan Polri telah menempatkan petugasnya di setiap desa guna mengantisipasi potensi konflik, mengetahui masalah dan mencari solusi bersama dengan masyarakat. ”Polri juga senantiasa berkoordinasi dengan tokoh masyarakat untuk memediasi agar tidak muncul konflik.

Pesawat AS Serang Yaman

13 ORANG TEWAS SANAA- Pesawat tak berawak milik Amerika Serikat kembali melancarkan serangan-serangan udara di Yaman. Sedikitnya 13 warga sipil dilaporkan tewas dalam serangan terbaru tersebut. Seorang pejabat kepolisian Yaman mengatakan, serangan udara itu terjadi di daerah Radaa pada Minggu, 2 September sekitar pukul 16.00 waktu setempat. Radaa berlokasi sekitar 130 kilometer sebelah tenggara Sanaa, ibukota Yaman. Menurut pejabat Yaman yang tidak disebutkan namanya itu seperti diberitakan Press TV, Senin (3/9), serangan udara pesawat tanpa awak AS tersebut mengenai dua kendaraan. Dikatakannya, dua wanita termasuk di antara para korban tewas. Militer AS telah menggunakan pesawat-pesawat tanpa awak untuk melancarkan serangan-serangan udara di Pakistan, Afghanistan, Yaman dan Somalia. Washington mengklaim serangan-serangan itu untuk menargetkan para militan. Namun pada kenyataannya, banyak warga sipil yang menjadi korban serangan-serangan tersebut. Sejumlah media Barat bahkan memberitakan, badan intelijen AS alias CIA berupaya meningkatkan serangan-serangan pesawat tanpa awak di Yaman. (dtc/int)

Dalam hal ini, Polri memainkan peran sebagai mediator yang membawa pesan perdamaian bagi masyarakat,” ujarnya. Selain itu, upaya yang dilakukan Polri dalam menyikapi lokasi potensi konflik dilakukan dengan membangun kerukunan antar warga dan mengikuti perkembangannya secara terus menerus. ”Kami juga menambah kekuatan Polri sebanyak 10.000 anggota pada tahun 2012 ini juga melengkapi perlengkapan senjata dalam penanganan konflik,” kata Timor. (dtc/int)

600 WNI Selamat dari Bencana Badai Tropis di Lousiana „ Miranda memberikan penjelasan di hadapan Majelis Hakim di Pengadilan Tipikor Jakarta.

Masa Tahanan Miranda Segera Berakhir JAKARTA- Majelis hakim Pengadilan Tipikor memutuskan mempercepat rangkaian sidang perkara suap cek pelawat dengan terdakwa Miranda Swaray Gultom. Alasannya, masa penahanan Miranda hanya sebulan lagi. ”Setelah kami perhatikan masa penahanan terdakwa paling lambat tanggal 7 Oktober. Kami tidak putus tanggal 7 Oktober karena masa pikir-pikir selama 7 hari. Paling lambat 30 September untuk masuk masa pikir-pikir (atas putusan),” kata Ketua Majelis Hakim Gusrizal di awal persidangan Miranda di Pengadilan Tipikor Jakarta, Senin (3/9). Gusrizal kembali mengigatkan hal ini ketika hendak menutup persidangan. “Ini kesempatan terakhir bagi penuntut umum untuk hadirkan saksi. Apakah akan dikonfrontir, ini kesempatan terakhir,” ujarnya. Hakim juga meminta penasihat hukum menyiapkan pemanggilan terhadap ahli atau pun saksi meringankan untuk dihadirkan pada hari Senin (10/9) pekan depan. ”Tanggal 10 itu kita langsung pemeriksaan terdakwa karena tidak ada waktu lagi,” imbuh Gusrizal. Sidang Miranda akan dilanjutkan hari Kamis 6 September dengan menghadirkan saksi yang dijadwalkan penuntut umum. Rencananya, penuntut juga akan mengupayakan menghadirkan Hamka Yandhu, Endin Soefihara dan Paskah Suzetta untuk dikonfrontir terkait keterangan berbeda mengenai pertemuan di kediaman Nunun. (dtc/int)

JAKARTA- 600 WNI selamat dari bencana badai tropis ‘Isaac’ di Lousiana, AS. Mereka, saat badai itu mengamuk di kawasan itu pada pekan lalu, mengungsi ke tempat aman. Dipastikan tidak ada korban WNI akibat bencana badai tersebut. Seperti disampaikan Konjen RI di Houston, dalam siaran pers, Senin (3/9/ 2012), para WNI sebagian besar banyak mengungsi ke kota-kota yang aman seperti Baton Rouge, Lafayette, dan bahkan sampai ke Houston, Texas, 570 km dari New Orleans. Akibat badai itu, ribuan rumah penduduk tenggelam, pohon-pohon bertumbangan, listrik mati dan ribuan penduduk mengungsi. Saat ini seluruh masyarakat Indonesia telah kembali ke rumah masing-masing. Konsul Jenderal RI di Houston, Al

Busyra Basnur dan isteri Wenny Busyra Basnur pun menyempatkan mengunjungi masyarakat Indonesia yang menjadi korban. Pada pertemuan dalam bentuk makan siang bersama itu, Al Busyra menanyakan langsung kondisi masyarakat Indonesia dan pengalaman mereka selama badai berlangsung. Hadir sekitar 80 orang masyarakat Indonesia. Mengingat kawasan itu sering dilanda bencana alam, Al Busyra Basnur, juga menyampaikan imbauan kepada para WNI. Mereka diminta waspada, memperhatikan setiap peringatan, dan mengikuti petunjuk dari pemerintah setempat serta segera menghubungi KJRI Houston. Dua hari sebelum badai Isaac datang, Konjen Al Busyra juga telah melakukan komunikasi intensif dengan masyarakat Indonesia di kawasan bencana untuk

melakukan monitoring dan memberikan arahan kepada masyarakat. Bahkan KJRI Houston membentuk satuan tugas untuk membantu masyarakat Indonesia di sana. Dalam kesempatan itu, Ketua Indonesian American Community Association (IACA), Indah D. Kusuma, mengatakan bahwa sebelum dan pada saat badai masyarakat Indonesia di Louisiana selalu saling memberikan informasi satu sama lain untuk mengetahui kondisi masingmasing. Sementara itu, Bambang Arifatmi, seorang mahasiswa program doktor di New Orleans, mengatakan bahwa kondisi dan keberadaan masyarakat Indonesia pada saat badai, dapat diketahui dengan baik berkat adanya koordinasi yang erat setiap saat dengan pihak KJRI Houston. (dtc/int)

DAMASKUS- Para pejuang oposisi di Suriah mengklaim telah menguasai sebuah pangkalan udara militer Suriah di Provinsi Deir el-Zour, Suriah timur. Para pemberontak juga menyandera setidaknya 16 tentara dan menyita senjata-senjata dan amunisi mereka. Kekerasan berlanjut dengan insiden dua bom mobil yang meledak dekat kantor kepala staf gabungan militer Suriah di Damaskus pada Minggu, 2 September malam waktu setempat. Empat perwira terluka. Demikian seperti diberitakan stasiun televisi Suriah seperti dilansir kantor berita AFP, Senin (3/9). Sebelumnya pada Sabtu, 1 September, sebuah bom mobil lainnya meledak di dekat kamp pengungsi Palestina di Damaskus dan menewaskan 15 orang. Dalam sejumlah video yang beredar di internet terlihat situasi pasca serangan pemberontak di pangkalan pertahanan udara di al-Bukamal, dekat perbatasan Suriah dengan Irak. Di salah satu video terlihat para pemberontak berkumpul di depan sebuah gedung, dengan jasad dua tentara pemerintah tergeletak di tanah. Sementara itu, juru runding baru Suriah untuk PBB dan Liga Arab, Lakhdar Brahimi, akan pergi ke Damaskus dalam beberapa hari ini. Diplomat veteran Aljazair tersebut berniat untuk bermarkas di Damaskus guna menjalankan misinya. ”Damaskus merupakan tempat yang tepat,” kata Brahimi. “Apakah itu mungkin atau tidak, saya akan segera mengetahuinya,” tandasnya. (dtc/int)

Kepala Badan Luar Angkasa Rusia Dipecat

KPKJaminPenyidiknya Profesional Periksa Perwira Polri JAKARTA- Komisi Pemberantasan Korupsi menjamin penyidiknya akan profesional dalam memeriksa para perwira Polisi yang menjadi saksi kasus dugaan korupsi proyek simulator ujian surat izin mengemudi (SIM) Korps Lalu Lintas (Korlantas) Polri 2011. Hal tersebut disampaikan Juru Bicara KPK, Johan Budi, di Jakarta, Senin (3/9/2012). “Saya kira kita menghormati profesionalitas penyidik KPK. Ketika dia sudah bekerja di KPK, tentu dia akan melakukan tugas-tugas sebagai penyidik untuk kepentingan KPK,” katanya. Seperti diketahui, hampir semua penyidik yang bertugas di KPK berasal dari institusi Polri sementara sebagian lainnya dari institusi Kejaksaan Agung. Menurut Johan, untuk kasus simulator SIM ini, semua penyidik berasal dari Kepolisian. Rata-rata penyidik KPK yang menjadi ketua satuan tugas (satgas) penyidikan suatu kasus, berpangkat Ajun Komisaris Besar Polisi atau AKBP. “Ada juga yang kombes (komisaris besar) ketua satgasnya,” tambah Johan. Dia juga mengatakan, KPK tidak akan mengganti tim penyidiknya dengan yang berpangkat tinggi-tinggi saat memeriksa Inspektur Jenderal (Irjen) Polisi Djoko Susilo nantinya. “Jadi gini, setiap kasus itu ada timnya. Nah setiap tim itu dipimpin oleh seorang ketua yaitu kasatgas. Jadi siapa yang diperiksa, tentu tidak mengubah dari tim yang sudah ada,” tutur Johan. Sejauh ini, KPK belum memeriksa Djoko sebagai tersangka kasus dugaan korupsi proyek simulator SIM. Menurut Johan, Djoko akan diperiksa dalam satu hingga dua pekan ke depan. Hari ini KPK memeriksa tiga perwira Polisi sebagai saksi untuk Djoko. Mereka adalah Kepala Kepolisian Resort Temanggung, Jawa Tengah, AKBP Susilo Wardono, Kepala Subdit Pendidikan dan Rekayasa Direktorat Lalu Lintas Polda Jawa Tengah, AKBP Indra Darmawan, dan Kepala Polres Kebumen, Jawa Tengah, AKBP Heru Trisasono. Pada Jumat (31/8) lalu, KPK memeriksa empat perwira Polisi yang menjadi panitia pengadaan proyek simulator SIM 2011. Keempatnya adalah AKBP Wisnhu Buddhaya, AKBP Wandi Rustiwan, Komisaris Polisi (Kompol) Endah Purwaningsih, dan Kompol Ni Nyoman Suwartini. (kmc/int)

Pemberontak Kuasai Pangkalan Udara

„ Jenazah teroris Solo dibawa ke rumah sakit untuk diotopsi.

Teroris Solo Gunakan Senjata dari Filipina JAKARTA- Terduga teroris di Solo menggunakan senjata dari Filipina saat beraksi. Kepolisian Filipina dilibatkan guna menelusuri senjata tersebut. ”Soal senjata Filipina, itu sedang ditelusuri,” kata Menko Polhukam Djoko Suyanto di Istana Negara, Jakarta, Senin (3/9). Menurut dia, proses penelusuran bersama Filipina sudah dilakukan. Indonesia juga menjalin kerjasama antiteror dengan negara lainnya mengingat teroris memiliki jaringan yang luas. ”Itulah fungsi dan kegunaannya sehingga kita bisa menelusuri apa yang terjadi,” ujarnya. Namun demikian, Djoko menolak membeberkan kemajuan penyelidikan. “Itu adalah buah dari kerja keras mereka. Mereka kan sudah ada di lapangan sejak lama,” kata dia. Kapolri Jenderal Timur Pradopo sebelumnya menyebut terduga teroris di Solo menggunakan senjata dari Filipina. Mereka diduga melakukan penyelundupan berbagai jenis senjata api dan amunisi dari Filipina. Sejumlah barang bukti juga diamankan antara lain 1 pucuk pistol pietro baretta, 3 buah magazine, 43 peluru kaliber 9 mm merk Luger, dan 9 holopoint CBC, 1 unit HP, beberapa dokumen, dan STNK.

Motif untuk Balas Dendam Kepolisian RI memastikan bahwa rentetan penyerangan kelompok teroris di Solo, Jawa Tengah, selama Agustus 2012 bermotif balas dendam. Hal ini berdasarkan hasil pemeriksaan terhadap barang bukti dan pemeriksaan tersangka teroris yang ditangkap hidup oleh Densus 88 Anti Teror Polri Kepala Biro Penerangan Masyarakat Polri Brigadir Jenderal (Pol) Boy Rafli Amar mengatakan, selain magazen, di dalam tas pinggang yang dipakai Farhan (19), polisi menemukan banyak lembaran kertas. Dalam lembaran itu, kata Boy, terdapat surat yang ditulis tangan. “Ternyata di dalam surat itu cukup jelas untuk menyimpulkan motif. Secara ideologi memang mereka berjuang sebagaimana kelompok terdahulu seperti Jamaah Islamiyah yang ingin membentuk negara syariah Islam di Indonesia. Jadi kenapa mereka membalas, karena mereka merasa kecewa dengan penangkapan tokoh mereka selama ini sehingga mereka balas dendam,” kata Boy sebelum rapat kerja dengan Komisi III di Gedung Kompleks Parlemen Senayan, Jakarta, Senin ( 3/9/2012 ). Dalam raker itu, Komisi III ingin mendengar penjelasan Kepala Polri Jenderal (Pol) Timur Pradopo mengenai penanga-

nan Madura, dan Sigi, Sulawesi Tengah. Akan disinggung pula mengenai penanganan kasus terorisme di Solo. Boy menambahkan, dalam pemeriksaan terungkap pula sandi yang dipakai kelompok mereka, yakni “main bola”. Jika sandi “pengantin” untuk melakukan bom bunuh diri, sandi “main bola” dipakai untuk menyerang petugas kepolisian. “Itu terungkap dalam pemeriksaan ini. Kita melihat mereka sangat teliti, sampai menentukan hari (penyerangan) pun mereka sangat memikirkannya. Penentuan tanggal 17 Agustus dikaitkan bersamaan dengan hari proklamasi,” kata Boy. Seperti diberitakan, Jumat malam lalu, Detasemen Khusus (Densus) Antiteror menyergap tiga terduga pelaku teror yang menembak seorang polisi di Pos Polisi Singosaren, Ajun Inspektur Dua (anumerta) Dwi Data Subekti, hingga tewas. Dua di antaranya, yakni Farhan (19) dan Mukhsin (19), tewas dalam baku tembak di Jalan Veteran, Kelurahan Tipes, Kecamatan Serengan, Solo. Terduga lainnya, Bayu (24), warga Tipes, ditangkap di kediaman mertuanya, Wiji Siswo Suwito, di Desa Bulurejo, Kecamatan Gondangrejo, Kabupaten Karanganyar, Jateng. Kepolisian masih mengembangkan penyidikan untuk mencari tahu ada tidaknya keterlibatan pihak lain. (dtc/int)

MOSKOW- Presiden Rusia Vladimir Putin memecat Kepala Badan Luar Angkasa Khrunichev, Vladimir Nesterov dari jabatannya. Pemecatan ini dilakukan menyusul sejumlah kegagalan peluncuran program ke luar angkasa oleh Rusia. Menurut dekrit presiden yang dikeluarkan tanggal 31 Agustus, Nesterov telah resmi dilengserkan dari jabatannya. Dekrit tersebut dipublikasikan dalam situs resmi Kremlin pada hari ini dan dilansir AFP, Senin (3/9). Pria berusia 63 tahun ini telah menjabat sebagai Direktur Umum Produksi Pusat Ruang Angkasa dan Riset Nasional Khrunichev sejak tahun 2005. Biro Ruang Angkasa Khrunichev merupakan badan luar angkasa terbesar di Rusia yang bermarkas di Moskow, yang selama ini memproduksi dan melakukan peluncuran roket-roket Proton ke luar angkasa. Bulan lalu, muncul laporan bahwa Rusia kehilangan 10 satelit dalam jangka waktu 1,5 tahun terakhir. Terhadap laporan tersebut, Perdana Menteri Dmitry Medvedev memanggil sejumlah pejabat terkait isu ruang angkasa untuk memberikan penjelasan kepada pemerintah. Dalam pertemuan dengan para pejabat tersebut, PM Medvedev menyebut serangkaian kegagalan tersebut ‘telah melemahkan reputasi Rusia di mata internasional sebagai negara yang memimpin dalam misi luar angkasa.’ Nesterov yang juga hadir dalam pertemuan tanggal 14 Agustus tersebut, kemudian diminta untuk mengundurkan diri. Diketahui bahwa pada 6 Agustus lalu, 2 buah satelit milik Rusia hilang setelah upaya peluncuran menggunakan roket Proton-M gagal mencapai orbit. Satelit telekomunikasi, milik Rusia MD2 dan milik Indonesia Telkom3, tidak bisa melakukan kontak. Komisi penyelidikan pun dibentuk untuk menyelidiki kegagalan tersebut. Hasilnya menunjukkan adanya masalah pada Briz-M, bagian atas roket Proton-M. Otoritas Rusia pun langsung memerintahkan inspeksi terhadap seluruh hasil produksi Briz-M dan upaya peluncuran dalam beberapa waktu ke depan terpaksa ditunda. Selain itu, masalah pada program ruang angkasa Rusia juga diwarnai oleh adalah persoalan teknis yang berujung pada hilangnya belasan satelit dan penjelajah Rusia sejak tahun lalu, termasuk kendaraan luar angkasa pembawa Progress yang bertugas mengangkut sejumlah perlengkapan ke Stasiun Ruang Angkasa Internasional. (dtc/int)


4 September 2012

Selamatkan Sungai Sigeaon! TARUTUNG- Pemkab Taput diminta memperhatikan dan menyelamatkan Sungai Sigeaon, Tarutung. Caranya dengan melarang jika ada aksi para penambang pasir yang menggunakan alat sedot maupun alat berat di sungai tersebut.

Interaktif Tapanuli Perbaiki Jalan Aek Parombunan

Hal ini diungkapkan Rinto Aritonang, salah satu pemerhati lingkungan, kemarin. Dikatakan Rinto, penambangan pasir secara modern akan merusak alam sekitar. Seperti terjadinya pendangkalan sungai di saat musim kemarau yang mengakibatkan saluran irigasi ke pertanian tidak berjalan baik.

Dan, tentunya ulah itu akan merugikan banyak masyarakat. “Memang itu mata pencarian mereka. Namun masyarakat harus mengetahui kalau hal itu dapat mengakibatkan terjadinya erosi pinggiran sungai jika musim penghujan yang dapat merugikan banyak orang,” ujarnya. (cr-02)

Pak Walikota yang terhormat, saya warga Kota Sibolga ingin melaporkan bahwa Jalan Aek Parombunan sudah rusak parah. Kendaraan susah lewat, bahkan ada yang kendaraan hampir terbalik jatuh dan anak sekolah pun susah lewat. Jadi tolong Pak perbaiki jalan tersebut. Terima kasih. Pengirim: 087767366XXX

Tolong Perbaiki Jalan Tukka Bapak Bupati yang terhormat, kapan jalan menuju Tukka diperbaiki? Kami resah melewatinya Pak karena banyak kubangan air di sana. Terima kasih. Pengirim: 08236709XXX

Tolong Bersihkan Parit Pak Kadis Kebersihan Sibolga, tolong dibersihkan parit belakang Sibolga baru arah laut, sudah bau menyengat kalau musin hujan. Sudah bertahun-tahun tidak pernah dibersihkan. Terima kasih. Pengirim: 08126333XXX

Perbaiki Beronjong di bawah Jembatan Sibuluan Bapak Bupati Tapteng, tolong diperbaiki beronjong pas di bawah jembatan Sibuluan, karena kalau hujan turun seringkali kebanjiran, dan warga pun merasa tidak nyaman. Pengirim:085276665XXX

MASYARAKAT diharapkan tidak hanya mementingkan diri sendiri dengan mengabaikan kepentingan masyarakat lainnya. Selain itu juga diharapkannya, Pemkab terus menertibkan dan menghentikan aksi penambang pasir yang menggunakan mesin maupun alat berat di Sungai Sigeaon. “Pemkab Taput harus terus mengawasi jangan sampai ada pengerukan pasir di Sungai Sigeaon menggunakan alat mesin maupun alat berat. Pengerukan pasir sebaiknya tetap menggunakan alat tradisional. Tapi kalau melarang mereka untuk sama sekali tidak mengeruk pasir, ya jelas tidak mungkin. Karena itu adalah mata pencarian mereka. Para penambang pasir menggantungkan hidupnya dari situ,” lanjutnya.

Julford Tambunan, Warga Tarutung

„ Sejumlah pengeruk pasir tampak sedang beristirahat usai melakukan aktifitasnya mengeruk pasir Sungai Sigeaon tepatnya di dekat Jalan Rangkae Sipagagan, Tarutung, kemarin.

ANEH TAPI NYATA Berpisah dengan Istri

Pria Inggris Habisi Nyawa 2 Anaknya LONDON- Seorang ayah tega menghabisi nyawa kedua putranya yang masih berusia 11 tahun dan 3 tahun gara-gara perpisahannya dengan sang istri. Setelah melakukan perbuatan keji terhadap kedua buah hatinya, pria berusia 36 tahun ini pun nekat gantung diri.

Dalam 26 Jam

Coofey Ditangkap 4 Kali WASHINGTON- Di New Hampshire, Amerika Serikat (AS) seorang perempuan paruh baya tersangkut sejumlah kasus hukum.Bahkandalam26jamterakhir,perempuanyangbernama Joyce Coffey ini sudah empat kali ditangkap. Kasus hukum pertama terjadi ketika para tetangga mengeluhkan tindakan Coffey yang memutar musik rock terlalu keras. Tidak tahan dengan perilaku Coffey para tetangga pun melaporkan kejadian ini ke pihak berwenang. Tak lama petugas pun datang dan memberikan Coffey peringatan. Namun, polisi terpaksa harus kembali ke rumah Coffey setelah munculnya keluhan kedua. Coffey yang menolak menurunkan mengecilkan suara musik rocknya pun terpaksa digiring ke kantor polisi. Namun perempuan berusia 53 tahun dilepaskan setelah membayar denda sekira USD500 atau Rp4,7 juta (Rp9.535 per USD). Mendekam di penjara ternyata tidak kunjung menimbulkan efek jera pada diri Coffey sampai akhirnya ia kembali ditangkap kedua kalinya akibat perbuatan yang sama. Untuk kedua kalinya pula Coffey dapat bebas setelah membayar denda lebih besar USD1000 atau sekira Rp9,5 juta “Coffeyberjanjibahwaiatidakakanmengulangiperbuatannya serta menjaga kenyamanan lingkungan sekitar.” tulis petugas polisi Matt Blonigen, seperti dikutip Upi, Senin (3/9). Namun ketika Blonigen mengecek kondisi sekitar rumah Coffey keesokan harinya, musik rock masih terdengar. Tanpa butuh keluhan dari tetangga Coffey pun ditangkap untuk ketiga kalinya.Kaliinidakwaanmelanggarjaminanjugaturutdiarahkan pada Coffey. Untuk kali ketiganya Coffey berhasil bebas setelah membayar jaminansekiraRp95juta.Sejumlahaturanpundiberlakukanpolisi diantaranya Coffey dilarang menyetel musik sebelum pukul 10 pagi dan setelah pukul 20.00 malam waktu setempat. Polisi mengira Coffey akan jera dan menyadari perbuatannya namun ternyata hal itu terjadi. Karena ternyata tidak lama kemudianmunculkembalipengaduanterkaitulahCoffey.Kaliini pengaduantersebutlangsungdatangdarikeponakanCoffey,Dan Letourneau.MenurutLetourneau,tiba-tibasajaCoffeymarahdan melemparkan wajan ke arahnya ketika ia berusaha mengambil beberapa barang miliknya di rumah. Maka hal ini pun membuat Coffey kembali ditangkap untuk keempat kalinya. (ok/int)

Marah Diselingkuhi

Wanita Peru

Jasad Graham Anderson dan kedua buah hatinya ini baru ditemukan oleh sang pemilik apartemenyangdihuniolehGrahamdi wilayah Tidworth, Wiltshire, Inggris,padaSabtu(1/9)waktusetempat. Saat itu sang pemilik apartemen tengah menunjukkan sejumlah apartemen lainnya kepada calon penyewa baru. Semenjak kedua orangtuanya berpisah, kedua bocah tersebut tinggal bersama ibu mereka di Andover, Hampshire. Namun kemudian keduanya secara rutin datang mengunjungi Graham di kediamannya. Sang ibu, Victoria Jones (30) telah melihat jasad korban dan memastikan bahwa 2 anak yang telah tak bernyawa tersebut merupakan buah hatinya, yakni Jack (11) dan Bryn (3). Tidak dijelaskan lebih lanjut bagaimana kondisi jasad ketiganya saat ditemukan. Tidak diketahuijugabagaimanacaraGraham

menghabisi nyawa kedua buah hatinya. Demikian seperti dilansir Daily Mail, Senin (3/9). Kepolisian setempat masih menangani kasus ini. Meski mengkategorikan kematian korban dalam kasus ini cukup mencurigakan, namun kepolisian setempat tidak mencurigaiadanyapelakulaindalamkasus ini. Motif Graham melakukan perbuatan ini diduga karena masih tidak bisa menerima perpisahannya dengan sang istri. Meski belum mengetahui secara pasti kronologi insiden ini, namun kepolisian mencurigai aksi keji Graham tersebut dilakukan pada Kamis (30/8) pagi waktu setempat. “Sang ibu sangat-sangat terkejut mengetahui hal ini. Kami menyampaikan duka mendalam bagi pihak keluarga dan kerabat korban,” ujar Kepala Detektif setempat, Inspektur Ian Saunders. (dtc/int)

Potong Alat Kelamin Kekasih LIMA- Seorang wanita marah besar karena mengetahui kekasihnya telah berselingkuh. Saking marahnya, dia memotong alat kelamin ke-

kasihnya itu dengan pisau dapur! Peristiwa ini terjadi di Peru seperti diberitakan kantor berita AFP, Senin (3/9).

Julia Munoz Huaman, wanita Peru berumur 41 tahun tersebut, mengaku telah memotong alat kelamin pasangannya, Ramon Arias (46) karena dibakar api cemburu. Media lokal memberitakan, Huaman memotong alat kelamin Arias ketika pria itu sedang terlelap tidur. Potongan ‘burung’ tersebut kemudian dibuang Huaman ke toilet. Insiden mengerikan itu terjadi di sebuah penginapan di kawasan Brena, Lima. Warga setempat pun dibuat gempar dengan kejadian itu. Para petugas keamanan menangkap Huaman dan membawanya ke kantor polisi. Sementara Aria yang mengerang kesakitan, langsung dilarikan ke rumah sakit. Saat ini pria tersebut masih dirawat secara intensif di ruang ICU. (dtc/int)

Berusia 1 Tahun

Aditya Berkumis BIHAR- Seorang balita di Distrik Bihar, India, Aditya Kumar menderita penyakit Sindrom Cushing dan penyakit membuatnya terlihat semakin tua. Balita berusia 18 bulan itu berbadan besar layaknya seorang bocah berusia enam tahun dan memiliki kumis. Sindrom Cushing merupakan penyakit yang memiliki sangkut

paut dengan hormon. Aditya lahir dalam kondisi normal dan sehat. Namun pada saat ulang tahunnya yang ke-satu, Aditya tumbuh besar secara cepat. Tubuh balita itu membesar, tangannya pun berbulu dan kumis pun muncul di wajahnya. Bobot badan Aditya langsung meroket dan wajah balita itu terlihat semakin tua. (ok/int)


4 September 2012

Angelina Jolie

Kesal Putrinya Suka Madonna

ANGELINA Jolie marah begitu tahu ketiga putrinya, Zahara, Shiloh, dan Vivienne kecanduan lagu Madonna. Cewek jagoan Lara Croft di film Tomb Raider ini, mengaku kesal bagaimana lagu Madonna bisa digemari anak-anaknya padahal dia benci. ”Bukan rahasia lagi kalau Jolie bukanlah fans Madonna. Kata dia (Jolie) musiknya benar-benar mengerikan,” kata sumber yang dirilis tabloid terbitan Amerika Serikat, National Enquirer. Jadi tak heran jika pasangan hidup Brad Pitt ini sama sekali tak suka lagu ataupun musik Madonna. Siapa sangka kini Jolie harus tahan mendengarnya di rumah setiap saat sebab ketiga putrinya fans berat Madonna. (pra/jpnn)

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober)

Di hari ini hampir tidak ada gangguan yang berarti yang akan membikin kacau. Karena suasana dan situasi cukup mendukung bisnis Anda, maka jangan ragu untuk melakukan manuver-manuver yang berbahaya sekalipun.


(21 Desember -19 Januari)

Tak perlu ragu untuk mencoba memulai hal baru, walaupun semua itu memang berat untuk di awalnya, akan tetapi yang terpenting jalani dulu semua itu. Resiko dan hambatan di kemudian hari sebaiknya dipikir sambil jalan.


(20 Januari - 18 Februari)

Teruslah berupaya meraih hasil yang terbaik. Tidak perlu menyerah dengan keadaan karena ibarat orang berjalan pasti tidak akan selalu mulus jalannya, maka dari itu tetaplah optimis dan yakin.


19 Februari - 20 Maret

Waspadalah, omongan yang berhembus itu anggaplah angin lalu. Tak perlu ditanggapi toh nantinya akan hilang dengan sendirinya ditiup angin. Cobalah lebih konsentrasi pada apa yang sedang Anda hadapi. Tak perlu memikirkan yang bukan-bukan.


(21 April - 20 Mei)

Tak ada gunanya mengobral janji kalau akhirnya hanya akan membuat beban Anda saja di kemudian hari. Bicaralah terus terang dan tak perlu menutup-tutupi kesulitan yang lagi Anda hadapi saat ini.


(21 Mei - 20 Juni)

Peruntungan cukup mujur sehingga sangat baik untuk digunakan menyelesaikan masalah yang terkatungkatung itu. Hanya saja jangan mudah percaya dengan orang lain sebelum Anda melihat sendiri buktinya.


(21 Juni- 20 Juli)

Optimis memang perlu tetapi untuk saat ini sebaiknya jangan terlalu berambisi karena situasi di sekitar Anda sulit untuk Anda prediksi. Lebih baik Anda melangkah dengan sabar tetapi sangat terencana agar kesuksesan tetap dapat Anda raih.


(21 Juli-21 Agustus)

Apapun resiko yang akan muncul sebaiknya keyakinan tetap tidak boleh bergeser, untuk itu hindari membicarakan persoalan pada orang lain agar pikiran dan visi Anda tidak sampai terganggu.


(23 Oktober - 22 November)

Jangan biarkan kecerobohan mengganggu kinerja dan kelangsungan bisnis Anda, apalagi kompetitor tampak selalu memperhatikan setiap gerak-gerik Anda.


matahari yang hangat, telah mendorong para penonton yang terdiri berbagai lapisan masyarakat maupun warga Belanda dan asing lainya tetap bertahan di arena pertunjukan dan bejoget mengikuti irama lagu. Pesta Rakyat tahun 2012 yang dipandu oleh pembawa acara Feba dan Juniarti tersebut, dibuka secara resmi Dubes RI, Retno L.P. Marsudi yang dalam sambutannya menegaskan kembali bahwa kebahagiaan menyambut Hari Kemerdekaan. Lebih dari 32 stand makanan menyajikan beragam masakan Indonesia. Rujak cingur, sate ayam, makanan padang, gudeg, soto, empek-empek, aneka kue tradisional, makanan

Aming meninggal karena sakit. Masalah pencernaan dan faktor usia juga menjadi penyebab kepergian ibunda Aming. ”Udah udzur juga dan karena pencernaan juga,” jelasnya. Dijelaskan Iyus, saat

kepergian sang ibunda, bintang film ‘Madame X’ itu sedang berada di Jakarta. Kini Aming pun sudah berada di Bandung untuk menemani sang bunda ke peristirahatan terkahir. (dtc/int)

MODEL majalah Playboy, Tiara Lestari terus berjuang untuk meminta pembatalan putusan soal hak asuh putri semata wayangnya, Rania Kancana Tadya Dalima Sjarief dari mantan suaminya, Andi Sjarief. Dia ingin anaknya tidak lagi hidup berpindah dari rumahnya ke rumah mantan suaminya. Segala upaya dilakukan oleh Tiara, salah satunya membawa saksi ahli, Seto Mulyadi atau Kak Seto untuk didengar kesaksiannya. “Kenapa kita menghadirkan Kak Seto karena akan sangat diperlukan sekali pendapat Kak Seto. Anak berumur 5 tahun dan harus berpindah itu kan sangat melelahkan. Dampaknya untuk anak itu akan didengar dari Kak Seto,” ujar pengacara Tiara, Kartika Yosodiningrat, saat ditemui di Pengadilan Agama, Jakarta Selatan, Senin (3/9). Keterangan Kak Seto tidak langsung bisa didengarkan dalam persidangan, masih harus dijadwalkan. Sementara pihak Andi juga tidak keberatan dengan adanya saksi ahli seperti Seto Mulyadi. “Sah-sah saja mereka membawa Kak Seto. Tapi kan nanti ada agendanya sendiri. Saat ini masih pembuktianpembuktian secara surat-surata saja,” ujar pengacara Andi, Indra Prasetya. Sidangnya sendiri akan kembali dilanjutkan, Senin (10/9) dengan agenda pembuktian. (kpl/int)

manado, bakso, nasi campur, batagor, sejak pagi tidak henti-hentinya melayani masyarakat Indonesia untuk menikmati hidangan khas Indonesia. Baik yang langsung dinikmati di tempat maupun dibawa pulang. (kl/int)

Meskipun hubungannya dengan Gaston Castano kembali lengket, namun status Julia Perez masih sendiri. Setelah ditinggal sang ustad pilihan ibunda, Jupe belum mau menjalani hubungan spesial dengan lelaki mana pun. Artis yang kerap berbusana seksi itu pun mengaku sedang happy menjalani statusnya sebagai janda. Pelantun ‘Goyang 69’ itu mengaku banyak dilirik lelaki karena statusnya itu. ”Saya lagi senang jadi janda, saya banyak dilirik orang, Brad Pitt saja nengok ke saya,” selorohnya saat ditemui di studio RCTI, Jakarta Barat, Senin (3/9). Jupe menjelaskan, terkadang image janda mengundang cibiran ke arahnya. Namun, Jupe mengaku tak ambil pusing. ”Lebih baik janda daripada perawan tua, saya pernah rasain jatuh-bangunnya. Kawin atau nggak urusan saya,” tuturnya. “Tapi saya harus kawin karena harus punya keturunan the next Jupe,” tambahnya mengoreksi. Kini di usianya yang sudah tak muda lagi, bintang film ‘Arwah Goyang Karawang’ itu ingin lebih berhati-hati dalam memutuskan menikah lagi. (dtc/int)

(23 Agustus-22 September)

.Tetaplah melangkah maju karena sudah kepalang tanggung untuk melangkah mundur. Lebih baik yang ada dijalani dengan kesungguhan dan kemantapan hati.


PENYANYI dangdut Ikke Nurjanah bersama artis ibukota, Hudson tampil menghibur ribuan penonton dalam Pesta Rakyat Indonesia di Wassenaar, Belanda. Pesta Rakyat yang diselenggarakan Sabtu (1/ 9) oleh KBRI Den Haag, Belanda itu mejadi acara tahunan yang meriah dalam rangka menyambut Hari Kemerdekaan Indonesia, demikian keteerangan pers KBRI Denhaag, Minggu (03/09) Artis Hudson dengan busana kebaya yang menonjolkan peran sebagai Jessica dan sekaligus dirinya sendiri mengalunkan lagu-lagu Indonesia dan barat, di antaranya Keong Racun, Cinta Semalam, Getuk dan Terajana. Sementara itu Ikke Nurjanah dengan busana yang menonjolkan pakaian tradisi Indonesia yang sangat anggun melantunkan lagu Terlena, Kegagalan Cinta dan Biduan. Di samping Hudson dan Ikke Nurjanah, juga ikut tampil meramaikan adalah Tim Kesenian Sekolah Indonesia, Biroe Band, Persatuan Pelajar Utrecht, Tim Kesenian Samosir, Night Breaker band, Ray Jeffryn, dan Marabunta Band. Cuaca yang sangat cerah, dengan sinar

”Aming seperti yang lainnya ya, shock ketika denger kabar tersebut. Maklumlah ibunya kan motivator dia juga, jadi benarbenar spesial” kata Iyus saat dihubungi. Iyus menuturkan, ibunda

(21 Maret - 20 April)

Peluang yang tinggi sebaiknya bisa diimbangi juga dengan kerja keras jangan sampai loyo ataupun tidak ada peningkatan dalam prestasi kerjanya. Di hari ini peruntungan cukup mujur sehingga selalu ada saja jalan setiap menemui suatu permasalahan.



bunda komedian Aming, Emin Rumiah meninggal dunia di usia 82 tahun pada Senin (3/9) pagi. Menurut sang manajer, Iyus Aming shock pertama kali mendengar kabar duka itu.

( 23 November - 20 Desember)

Jangan hanya diam saja melihat sikap orang lain meremehkan kemampuan diri Anda. Segera lakukan gebrakan karena bagaimanapun juga mereka ternyata tidak bisa dihadapi dengan halus.

Personel Mahadewi, Puri telah resmi dilamar oleh kekasihnya yang berprofesi sebagai dokter berinisial ‘H’ usai Lebaran lalu. Acara pertunangan yang digelar pada 26 Agustus itu pun dihadiri keluarga besar Puri dan calon suami. Segala sesuatunya pun telah dipersiapkan Puri untuk langkah selanjutnya. Pelantun ‘Dokter Cinta’ itu akan segera menggelar akad nikah. Kapan? ”Akad nikahnya 1 November,” ungkap rekan Puri di Mahadewi, Gwen, Senin (3/9).

Sebagai sahabat, Gwen pun senang Puri akan melepas lajang. “Senenglah, pas deh dia kan udah 27 tahun juga ya udah waktunya, support-lah ini kan baik ya.” katanya. Gwen yang menggantikan Tata Janeta, personel Mahadewi yang sebelumnya hengkang pun mengaku siap mempersembahkan lagu jika diminta sahabatnya bernyanyi di hari bahagia itu. ”Siap aja kalau di-request yang punya hajat sih siap,” tuturnya ramah. (dc/int)



4 September 2012 METRO TAPANULI

Nyaris Timpa Alonso, Grosjean Minta Maaf PEMBALAP Lotus, Romain Grosjean, minta maaf atas manuvernya yang mengakibatkan kecelakaan di F1 GP Belgia, Minggu 2 September 2012. Grosjean merasa terpukul dengan sanksi larangan tampildiGPItalia.Atastindakannya di GP Belgia, Grosjean menerima sanksi satu larangan tampil dan denda €50 ribu (setara Rp599 juta). Dengan demikian pembalap asal Prancis itu harus absen di GP Italia, akhir pekan ini. Sebuah manuver berbahaya Grosjean di awal balapan GP Belgia mengakibatkan kecelakaan yang melibatkan sejumlah mobil. Usai menyenggol ban kiri depan pembalap McLaren, Lewis Hamilton, mobil Grosjean kemudian melayang dan nyaris menimpa pembalap Ferrari Fernando Alonso. Pembalap Sauber, Sergio Perez dan Kamui Kobayashi, juga terlibat


dalam kecelakaan tersebut. Namun,namaterakhirmampumelanjutkan balapan dan finish di posisi 13. “Saya tidak bermaksud membuat pembalap lain tertekan ke tembok. Saya tidak berusaha menghentikan balapan di tikungan pertama. Saya minta maaf, dan lega tidak ada yang terluka,” ujar Grosjean seperti dilansir Autosport. “Saya melakukan kesalahan dan salah menghitung jarak dengan Hamilton. Saya yakin telah melewati dia. Jadi, kesalahan kecil yang mengakibatkan kecelakaan besar,” lanjutnya. Grosjean menilai sanksi larangan tampil di GP Italia membuatnya sangat terpukul. “Ketika Anda cinta balapan, hukumaninisangatberat.Tapi,saya menerima kesalahan. Saya marah dengan diri sendiri,” tuntasnya. Lega Fernando Alonso menyesal tidak

berhasil mendapatkan poin di Grand Prix Belgia. Namun, Alonso mengaku beruntung tidak mengalamicederaparahakibatinsidenitu. Seperti diketahui, mobil Romain Grosjean yang kehilangan kendali menabrak mobil pemuncak klasemen pembalap itu dan juga Lewis Hamilton. Insiden itu memaksa Alonso finis dari lomba lebih awal. Sementara itu, Sebastian Vettel mampu finis di peringkat kedua pada balapan kemarin. Dengan hasil ini, pembalap Red Bull itu mampu memangkas ketinggalan poin menjadi 24 angka dari pemuncak klasemen Alonso. “Saya sangat kecewa karena kehilangan poin. Namun, saya merasa sangat beruntung karena bisa mengemudikan mobil dalam waktu lima hari mendatang di Monza,” jelas Alonso, dilaporkan Autosport, Senin (3/9). (int)

Paralimpik di London

Panitia Sediakan Bus Gratis

Untuk Warga ke Venue PON XVIII PANITIA Besar PON Riau menyediakan 45 unit bus untuk masyarakat secara gratis. Bus ini akan khusus membawa warga menuju berbagai tempat pertandingan. Demikian disampaikan Humas PB PON Riau, Chairul Riski, Senin (3/9) di Pekanbaru. Riski menjelaskan, penyediaan bus ini guna mempermudah masyarakat untuk menonton langsung pertandingan yang ada di Pekanbaru. Bus angkutan khusus ke venue PON ini akan mulai beroperas pada 9 September. “Masyarakat dapat memanfaatkan bus tersebut secara gratis menuju lokasi pertandingan. Ini guna merangsang warga untuk menyaksikan jalannya pertandingan olahraga,” kata Riski. Masih menurut Riski, 45 bus gratis itu akan ditandai stiker berlambang PON. Bus ini akan melayani rayon Kecamatan Tampan, tepatnya di sekitar kampus Universitas Riau (Unri). Selanjutnya Rayon Marpoyan di sekitar kampus Universitas Islam Riau (UIR). Dan bus juga akan melayani mewuju sport center di Kecamatan Rumbai. “Bus ini selama dua pekan akan terus beroperasi guna memberikan kemudahan kepada masyarakat yang akan menyaksikan pertandingan olahraga PON. Masyarakat tentunya akan sangat terbantu dengan adanya shuttle bus seperti ini,” kata Riski. Disebutkannya, pelayanan jasa transportasi memang menjadi perhatian serius dari PB PON, tidak hanya untuk para atlet, ofisial dan tamu PON lainnya. Masyarakat yang ingin menyaksikan pertandingan-pertandingan olahraga pun harus difasilitasi. “Kita memberikan sarana transportasi gratis ini akan tetap beroperasi sejak pagi hingga pertandingan usai. Kiranya masyarakat dapat memanfaatkan fasilitas ini,” kata Riski. (int)


Tantang Bartoli di Perempatfinal PETENIS unggulan ketiga, Maria Sharapova, akhirnya berhasil melenggang ke babak perempatfinal US Open 2012 dengan mengalahkan petenis dari Rusia, Nadia Petrova, Senin (3/9). Sharapova terlibat pertandingan yang cukup sengit saat berhadapan dengan Petrova. Ia membutuhkan tiga set untuk mengkandaskan Pertova dengan skor 6-1, 4-6 dan 6-4. Dengan kemenangan ini, Sharapova akan berhadapan dengan petenis dari Prancis, Marion Bartoli, untuk merebutkan tiket ke semifinal US Open. Sebelumnya, Bartoli berhasil mengalahkan Petra Kvitova di babak keempat dengan skor akhir 1-6, 6-2, 6-0. Hasil Lengkap Babak Keempat US Open Putri: Samantha Stosur - Laura Robson 6-4, 6-4. Victoria Azarenka - Anna Tathishvili 6-2, 6-2 Maria Sharapova - Nadia Petrova Marion Bartoli - Petra Kvitova 1-6, 6-2, 6-0

Indonesia meraih medali pertama di ajang Paralimpik London, lewat petenis meja Dian David Michael Jacobs (32). David Jacobs berhasil meraih medali perunggu setelah menundukkan lawannya dari Spanyol José Manuel Ruiz Reyes dalam pertandingan semifinal di gedung Excel, London, Minggu malam. Atlet kelahiran Makassar 21 Juni 1977 ini mulai berkenalan dengan tenis meja sejak umur 10 tahun berhasil menundukkan pemain terbaik Eropa dengan 3-1. Dalam pertandingan yang cukup menegangkan, David yang awalnya menempati peringkat 40 dunia kelas 10, mendapat dukungan dari sang ayah Jan Jacobs yang berusia 71 tahun dan istrinya Jeanny Palar serta kakak lelaki yang khusus datang dari Kenya. Keberhasilan David mempersembahkan medali perunggu merupakan sejarah tersendiri bagi Indonesia, mengingat untuk pertama kalinya Indonesia berhasil meraih medali diajang pesta olahraga difabel (penyandang cacat) paling bergengsi dunia itu. Ketua Umum Komite Paralympic Indonesia Senny Marbun mengatakan bahwa suatu kebanggaan akhirnya David berhasil mempersembahkan medali bagi Indonesia.

“Pertama kami berterima kasih kepada Tuhan yang telah mengizinkan David mendapatkan medali yang merupakan medali pertama Indonesia dalam Paralimpik,” ujar Senny usai acara pengibaran bendera. Pertarungan tenis meja di kelas 10 ini pertandingan David sendiri cukup menegangkan, set pertama dimenangkannya 11-9, dibabak kedua Ruiz Reyes bangkit dan menang 11-7. Namun dengan ketenangan David babak ketiga dan empat diraih dengan mudah 11-5 dan 11-6. Usai pertandingan, David tampak tidak dapat menahan haru dan bahkan sempat berlutut dan airmatanya pun menetes sambil melambaikan tangannya ke arah suporter Indonesia, yang mengibarkan bendera Merah Putih. Sang pelatih Pribadi mengakui meskipun baru pertama kali mengikuti kejuaraan Paralimpic, David langsung memberikan yang terbaik buat bangsanya. “Paralimpik di London merupakan ajang pertama bagi David dan kita bersyukur akhirnya bisa

mempersembahkan medali,” ujar Pribadi. Sementara itu Ketua Kontingen Indonesia James Tangkudung menyampaikan terimah kasih kepada masyarakat Indonesia yang bermukim di London dan masyarakat Indonesia pada umumnya atas doa dan dukungannya. “ Ini prestasi terbaik tim paralimpic Indonesia,” ujar mantan Deputi Menteri Bidang Pembudayaan Olahraga Kementerian Pemuda dan Olahraga. Walaupun pertandingan telah berakhir, suporter Indonesia tak satu pun beranjak meninggalkan tempat duduknya menantikan upacara penyerahan medali dan pengibaran bendera merah putih yang merupakan saat saat bersejarah bagi bangsa Indonesia khususnya penghormatan bagi para penyandang cacat di Indonesia. (int)

Dian David Michael Jacobs, peraih medali pertama Paralimpik di London dari cabang tenis meja.

Button Rayakan Kemenangan DENGAN JESSICA PEMBALAP McLaren Mercedes Jenson Button sukses meraih kemenangan di GP Belgia. Ini merupakan kemenangan kedua Button di musim ini setelah balapan pembuka musim 2012 di GP Australia. Button tampil menawan dengan terus memimpin jalannya balapan dari pole-position. Performa Button yang sempat diperkirakan akan melemah di tengah musim justru tidak terlihat di Spa Francorchamps. Mantan pembalap Williams ini pun menutup GP Belgia dengan gembira. Usai penyerahan piala dan wawancara dengan media, Button langsung merayakannya dengan seluruh kru McLaren. Tak hanya itu, kekasih Button, Jessica Michibata juga tampak hadir. Model 27 tahun itu bahkan mengenakan seragam tim McLaren yang berwarna oranye dan terlihat akrab dengan kru McLaren lainnya bahkan dengan rekan setim Button, Lewis Hamilton. Jessica dan Jenson sudah berpacaran selama dua tahun dan Jessica cukup dikenal di paddock F1 karena sering menemani B u t t o n balapan di beberapa Grand Prix. (int)

SELASA 4 September 2012

Van Persie Tentang Kegagalan Penaltinya

„ Robin van Persie tampil memukau saat membuat trigol untuk memenangkan Manchester United atas Southampton

SOUTHAMPTON-RobinvanPersie tampil memukau saat membuat trigol untuk memenangkan Manchester United atas Southampton. Tapi,kenapadiasampaigagaldalam eksekusipenaltialaPanenkaitu? Di menit 69, saat MU tertinggal 1-2 di St Mary’s Stadium, Minggu (2/9/2012),VanPersiemajusebagai algojo penalti setelah dirinya dijatuhkan seorang pemain lawan di kotak 16 meter. Sebagaimana orang selalu tak menyangka jika penendang penalti melakukannya dengan mencungkil bola — diciptakan oleh Antonin Panenka dari Cekoslowakia di final Piala Dunia 1976, terakhir dilakukan oleh Andrea Pirlo di Piala Eropa 2012 -–, begitu pula yang dilakukan Van Persie. Sial buat dia, cungkilannya buruk dan bisa dihalau oleh kiper Kelvin Davis. Untungnya bagi dia, eks bintang Arsenal bisa mencetak gol lagi di menit 86 dan injury time, sehinggaMUmenang3-2,danVan Persie tetap jadi pahlawan. “Aku tidak tahu apa yang aku pikirkan

Napoli Atasi Fiorentina Lazio Hantam Palermo NAPLES - Napoli tak kehilangan angka saat menjadi tuan rumah untuk Fiorentina di pekan kedua Seri A. Lazio juga meraih kemenangan cukup telak atas tamunya Palermo. Menjamu La Viola di San Paolo, Minggu (2/ 9) malam, Napoli menang tipis 2-1. Di Olimpico, Lazio mengungguli Rosanero dengan skor 3-0.

membuatnyadimenit39dan82. Satu gol lain dari Biancoceleste diukir gelandang Antonio Candreva di menit 56. Sama seperti Juve dan Napoli, Lazio juga telah memiliki enam angka dari dua pertandingan. Mereka duduk di tempat ketiga hanyakarenataklebihbaikselisih golnya dari kedua rivalnya itu.

„ Marek Hamsik

Susunan Pemain


emenangan Napoli dibuka oleh Marek Hamsik di menit ke-10 babak kedua. Dari tendangan bebas yang dilepaskan Juan Zuniga, Hamsik menyundul bola, yang kemudian sempat mengenai Borja Valero dan bersarang di gawang Emiliano Viviano. Gol ini dicatat sebagai bunuh diri Valero. Di menit 75 Il Patenopei menggandakan keunggulannya. Blerim Dzemaili meluncurkan tembakan setengah voli dari

depan kotak penalti dan mengubah kedudukan menjadi 20. Fiorentina tidak menyerah dan mencoba menekan Napoli di sisa pertandingan. Atas upayanya itu mereka menghasilkan satu gol dari tendangan lengkung nan menawan dari Stevan

Jovetic di menit 87. Tapi itu tak cukup untuk menghindarkan skuat Vincenzo Montella dari kekalahan. Kemenangan kedua dari dua pertandingannya itu membuat Napoli berada di urutan kedua klasemen sementara. Mereka hanya kalah selisih gol dari Ju-

ventus, yang juga telah mengutip enam angka dari dua laga. Fiorentina, yang di pekan pertama menang 2-1 atas Udinese, turun ke peringkat 11. Sementara itu Miroslav Klose mencetakduadaritigagolkemenangan Lazio atas Palermo. Bomber veteran Jerman itu

Napoli: De Sanctis; Campagnaro, Cannavaro, Britos; Maggio, Behrami (Inler 52), Dzemaili, Hamsik (Donadel 89), Zuniga; Insigne (Vargas 81); Cavani Fiorentina: Viviano; Roncaglia, Gonzalo Rodriguez, Tomovic; Cuadrado, Romulo (Seferovic 85), Pizarro, Borja Valero, Pasqual (Fernandez 78); El Hamdaoui (Ljajic 69), Jovetic Lazio: Marchetti; Konko, Biava, Dias, Lulic; Ledesma; Mauri (Onazi 80), Gonzalez, Hernanes (Scaloni 86), Candreva; Klose (Kozak 89) Palermo: Ujkani; Pisano, Cetto, Von Bergen, Garcia; Giorgi (Arevalo Rios 51), Kurtic (Hernandez 58), Barreto, Bertolo; Ilicic, Miccoli (Dybala 58)

Persib Umumkan Skuad Sementara

„ Wenger

Wenger Tetap Percaya Giroud LONDON-Setelahmenjalanitiga lagabersamaArsenal,OlivierGiroud belumjugamamputampilimpresif. Kendati demikian, manajer Arsene WengerpercayabahwaGiroudbisa suksesdiPremierLeague. Pemain Prancis ini jadi satusatunya pemain rekrutan utama The Gunners yang ditunggu golnya. Soalnya Lukas Podolski dan Santi Cazorla sudah mencatatkan nama mereka di papan skor dalam kemenangan 2-0 atas Liverpool di Anfield, kemarin malam. Statistiknya pun tidak terlalu bagus; total tujuh tembakan, tanpa assist, sehingga tak ayal top skorer Ligue 1 di musim lalu ini pun mulai diragukan, apakah dia mampu

memenuhi ekspektasi. Wenger menganggap penilaian negatif yang dialamatkan terhadap Giroud masih terlalu dini. Laga ketat melawan The Reds diyakini akan jadi proses pembelajaran untuk pemainnya itu. “Saya percaya dengan dia,” ucap Wenger seperti diwartakan Mirror. “Giroud sedang dalam masa adaptasi. Dia sudah menunjukkan bahwa dia siap dalam sebuah pertarungan dan saya yakin dia akan beradaptasi dengan intensitas striker Inggris.” “Melawan (Martin) Skrtel dia telah menemukan bagaimana sebenarnya Premier League itu,” pungkas The Professor. (int/int)

BANDUNG–SkuadPersibBandung yang akan berkompetisi di Indonesia Super League (ISL) 2012-2013 belum sepenuhnya hadir dalam pertemuan yang digelar PT Persib Bandung Bermartabat (PT PBB), Senin (3/9). Hal itu diketahui setelah pengurus Persib dan ofisial tim melakukanpertemuandikantorPTPBB. Didampingi pelatih Jajang Nurjaman,sebanyak10pemainmusim lalu melakukan pembicaraan mengenai persiapan menghadapi kompetisi musim depan. Jajang mengumumkan22namapemain yang akan menjadi skuad Persib musim depan. Dari komposisi itu, 50% adalah pemain lama. Dari pemain musim lalu, sebanyak11namapemaindipertahankan yaitu Cecep Supriatna, Rizky Bagja, Maman Abdurahman, AbandaHerman,JajangSukmara, Tony Sucipto, M Agung Pribadi, Atep, Hariono, Sigit Hermawan dan Airlangga Sucipto. Hanya saja Abanda Herman yang termasuk sebagai pemain yang dipertahankan Persib berhalangan hadir di Graha Persib tersebut. “Hari ini konsolidasi pertama dengan para pemain yang dipertahankan. Hari initidakjadilatihan,hanyakumpul saja. Pemain lama yang dipertahankan sudah datang, tinggal menunggu yang baru,” ungkap Jajang kepada wartawan. Semula, Jajang berencana melakukan tes medis pada Senin (3/ 9). Namun dijadwal ulang pada

Selasa (4/9). Mantan asisten pelatihPeliaJayainipunmenegaskan para pemain yang hadir sudah dipastikan akan berkostum Persib meski secara resmi akan melakukan penandatangan kontrak 10 September mendatang. “Saya pastikan mereka tetap bersama Persib. Saya juga sudah meminta komitmen mereka untuk tetap bersama Persib musim depan,” jelas Jajang. Terhadap skuad lama yang tidak dipertahankan, Jajang mengaku sudah menyampaikan secara baik-baik. Ada empat pemain penting musim lalu yang tidak dipertahankan yakni Zulkifli Syukur, Muhammad Ilham, Muhammad Nasuha, dan Aliyudin. Menurutnya, keputusan diambilberdasarpertimbangandan pengamatannya selama ini terhadap kebutuhan komposisi Persib di mana kontribusi keempat pemainitudinilaikurangmaksimal terhadap tim. Salah satunya M Nasuha yang sering diistirahatkan karena mendapatkan cedera. Manajer tim Persib yang juga menjabat sebagai Komisaris PT PBB Umuh Muchtar mengaku sangat berat dengan melepas para pemain tersebut. Menurutnya, keputusan melepas beberapa pemain sudah sesuai pertimbangan tim pelatih. “Saya sudah beri tahu mereka secara baik-baik. Saya hanya menjalankan perekrutan dan melakukan negoisasi sesuai dengan keinginan pelatih dan berdasarkan keputusan ber-

sama-sama,” terangnya. Sementara, soal perekrutan pemain baru Umuh mengatakan, tidak ada lagi masalah. “Rasanya tidakakanadamasalahkarenakita sudah mengikuti aturan yang benar.Kitabicaralangsungdengan pemain dan sudah deal. Bahkan, sebagian sudah diberikan DP,” jelasnya. Para pemain baru akan menandatangani kontrak pada 10 September mendatang.(int) PEMAIN LAMA Cecep Supriatna Rizky Bagja Maman Abdurahman Abanda Herman Jajang Sukmara Tony Sucipto M Agung Pribadi Atep Hariono Sigit Hermawan Airlangga Sucipto PEMAIN BARU IMadeWirawan(Persiba/Penjagagawang) Shahar Ginanjar (Pelita Jaya/ Penjaga gawang) Jamie Coyne (Sriwijaya FC/Bek) Supardi (SFC/Bek) Aang Suparman (Persibo-Bek) Asri Akbar (Persiba/Gelandang) Firman Utina (Sriwijaya FC/ Gelandang) M Ridwan (Sriwijaya FC/Gelandang) Mbida Messi (Kamerun/Gelandang) Kenji Adachihara (Persiba/Striker) Dzumafo Epandi (Arema/Striker)

dengan penalti itu. Tadinya aku ingin menendang keras, sebagaimana selalu aku lakukan. Tapi di detik terakhir aku berubah pikiran,” ungkap pria 29 tahun itu kepada MUTV. “Tak cukup baik, makanya aku sedikit down. Jujur saja, aku kecewa. Aku memasang standar tertentu untuk permainanku, dan ketika hal seperti itu terjadi, apalagi saat tim Anda tertinggal 2-1, mestinya Anda tak boleh mengambil penalti seperti itu.” Van Persie menambahkan, dia siap disalahkan jika efek kegagalan penaltinya itu buruk buat tim. Dia pun berjanji akan belajar dari pengalaman ini, serta sangat lega karena akhirnya MU menang. “Saya kaget dia melakukannya dengan cara begitu,” komentar pelatih Sir Alex Ferguson. “Biasanya dia melesakkannya ke gawang. Setiap kali saya melihat menembak keras ke kiri dan kanan. Mungkin dia terlalu percaya diri. Tapi dia telah membayarnya dengan dua gol berikutnya.” (int)

Rodgers: Sahin Akan Semakin Bagus LIVERPOOL- Manajer Liverpool Brendan Rodgers mengaku puas dengan penampilan Nuri Sahin di laga melawan Arsenal, Minggu (2/9) malam WIB. Sahin diyakini cocok dengan gaya Liverpool dan tampil kian bagus. PertandingandiAnfieldtersebut menandai debut Sahin bersama Liverpool setelah resmi dipinjamkan oleh Real Madrid. Pesepakbola berdarah Turki itu diplot sebagai starter dan digantikan Jonjo Shelvey di menit 67. Sayangnya, debut Sahin tidak berakhir manis. The Reds dibungkam dua gol tanpa balas oleh Arsenal lewat Lukas Podolski dan Santi Cazorla. Meski tak menuntaskan laga, Sahin telah memberikan kesan positif buat Rodgers. Eks bintang Borussia Dortmund ini dipercaya akan berperan penting untuk Liverpool di musim ini. “Dia tidak punya waktu bermain yang banyak, Nuri, jadi mendapatkan 65 menit bagus untuk dia,” ucap Rodgers yang dikutip dari situs resmi klub. “Dia menunjukkan bahwa dia

„ Nuri Sahin adalah seorang pesepakbola yang hebat dan dia akan cocok dengan gaya permainan kami. Dia seorangpemudayangbaikdandiakini semakin bugar dan kuat dia akan tampil semakin bagus,” yakin eks manajer Swansea itu. Walau gagal bersama Madrid, Sahinpunyastatistikokesaatmasih bersama Dortmund. Di musim 2010-11 ia berperan besar dalam sukses Dortmund menjadi kampiun sekaligus menyabet pemain terbaik Bundesliga. (int)

„ Andik Virmansyah

Bakal Berlatih di AS Andik Ngaku Terkendala Bahasa SURABAYA-AndikVirmansyah mengaku senang kala mendapatkan undangan berlatih dari salahsatu klub Amerika Serikat. Namun, ada satu yang jadi masalah: bahasa. Meski ada rumor yang beredar bahwaklubyangmengundangnya adalah DC United, Andik belum mau membenarkannya. Namun, menurut pengakuannya, klub tersebut berasal dari MLS. Menurut Andik, undangan tersebut adalah mimpi yang jadi kenyataan—meski hanya undangan latihan bersama. Namun. pemain bernomor punggung 10 di Persebaya ini membantah jika dirinya akan dikontrak permanen oleh klub itu. “Ini bukan seleksi, tapi ikut latihan di klub yang berlaga di MLS,” katanya disela-sela latihan fisik di Lapangan Persebaya, Jalan Karanggayam Surabaya, Senin (3/ 9). Akan tetapi pemuda kelahiran 23 November 1991 ini berharap, dengan adanya undangan latihan bersama ini dia bisa mewujudkan mimpinya untuk bermain di luar negeri. “Mohon doa restunya. Siapa tahu cuma ikut latihan terus bisa dikontrak permanen,” harapnya. Andik juga mengungkapkan, jika klub yang mengundang dirinya untuk berlatih bersama meng-

inginkan agar dirinya segera bergabung usai menerima undangan yang diterimanya saat bulan puasa. “Karena saat itu saya masih dalam proses penyembuhan cedera dan kondisi fisik saya drop karena puasa, maka saya meminta pengunduran keberangkatan dan alhamdulillahmerekamemaklumi kondisi saya,” ungkap Andik. Meski mengaku sudah siap dan bersyukur bisa berlatih di luar negeri, anak pasangan Saman dan Jumiah ini mengaku ada beberapa hal yang membuat dirinya minder, yakni masalah bahasa untuk berkomunikasi. Hal lainnya, ia mengaku sama sekali buta soal cuaca di Negeri Paman Sam itu. “Kalau masalah skill, fisik, saya siap bersaing. Tapi untuk masalah komunikasi ini yang saya takutkan. Bisanyabisatapikanlittle-littlealias pasif,” ujarnya. “Kalau makanan sudah terbiasa, kalau cuaca saya kurang tahu. Selain itu lama di sana sehingga pasti bisa adaptasi. Sedangkan nama klubnya, mohon maaf saya tidak bisa sebut,” kata Andik. Dengan diterimanya undangan latihan bersama tersebut, Andik juga dipastikan tidak bisa memperkuat timnas U-22, yang akan melakoni laga persahabatan dengan Vietnam di Surabaya, 9 September 2012. (int)

SELASA 4 September 2012

ENGLISH PREMIER LEAGUE No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Team Chelsea Swansea City West Brom Man City Man United Everton West Ham Arsenal Wigan Newcastle Fulham Stoke City Sunderland Tottenham Norwich City Reading Aston Villa Liverpool QPR Southampton

M 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 2 3 3 3 3

M 3 2 2 2 2 2 2 1 1 1 1 0 0 0 0 0 0 0 0 0

S 0 1 1 1 0 0 0 2 1 1 0 3 2 2 2 1 1 1 1 0

K 0 0 0 0 1 1 1 0 1 1 2 0 0 1 1 1 2 2 2 3

SG 8-2 10-2 6-1 8-5 6-5 4-3 4-3 2-0 4-4 3-4 7-6 3-3 2-2 3-4 2-7 3-5 2-5 2-7 2-9 4-8

Nilai 9 7 7 7 6 6 6 5 4 4 3 3 2 2 2 1 1 1 1 0

TOP SCORER Gol 4 4 3

Nama Klub Michu Swansea City R. van Persie Manchester United C. Tévez Manchester City

SPANISH LA LIGA No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Team M Barcelona 3 Mallorca 3 Málaga 3 Rayo Vallecano 3 Real Valladolid 3 Deportivo 3 Sevilla 3 Getafe 3 Atlético Madrid 2 Levante 3 Real Madrid 3 Real Betis 2 Real Sociedad 3 Real Zaragoza 3 Celta de Vigo 3 Athletic Club 3 Valencia 3 Granada 3 Espanyol 3 Osasuna 3

M 3 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0

S 0 1 1 1 0 2 2 1 1 1 1 0 0 0 0 0 2 1 0 0

BARCELONA K 0 0 0 0 1 0 0 1 0 1 1 1 2 2 2 2 1 2 3 3

SG 8-2 4-2 3-1 3-1 3-2 6-4 3-2 4-4 5-1 4-5 5-3 6-5 3-7 2-3 3-3 5-9 4-5 1-5 4-7 1-6

Nilai 9 7 7 7 6 5 5 4 4 4 4 3 3 3 3 3 2 1 0 0

TOP SCORER Gol 4 3 3

Nama L. Messi R. Falcao T. Hemed

BARCELONA- Gol tunggal Adriano membuat laga Barcelona versus Valencia di Camp Nou dimenangi tuan rumah. Los Cules pun tetap memuncaki klasemen sementara Liga Spanyol. Dari 14 tembakan yang dilakukan Barca, lima di antaranya mengarah ke gawang, tapi yang

menembus gawang Diego Alves adalah yang dihasilkan Adriano di menit 23, menjadikan pertandingan ini berakhir 1-0. Pemain berpaspor Brasil membuat gol tersebut setelah mendapatkan bola dari sepak pojok pendek, lalu dari sudut kotak penalti melepaskan tembakan ke bagian atas tiang jauh gawang Valencia. Gol itu membuat permainan lebih terbuka. Berselang lima



menit Barca mendapatkan peluang lagi dari kerja sama Pedro dan Cesc Fabregas, tapi penyelesaian akhirnya tidak membuahkan gol. Tim tamu mencoba lebih berani menyerang di babak kedua. Namun mereka kesulitan menandangi penguasaan bola yang sudah jadi trade mark Barca. Statistik mencatat, ball possession tuan rumah 67% sedangkan El Che 33%.

Klub Barcelona Atlético Madrid Mallorca

Juventus Napoli Lazio Sampdoria Roma Catania Torino Genoa Internazionale Milan Fiorentina Chievo Parma Cagliari Udinese Bologna Palermo Pescara Atalanta Siena

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

2 2 2 2 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0

0 0 0 0 1 1 1 0 0 0 0 0 0 1 0 0 0 0 1 1

TOP SCORER Gol 3 3 2

Nama S. Jovetiæ G. Pazzini G. Bergessio

Klub Fiorentina Milan Catania

0 0 0 0 0 0 0 1 1 1 1 1 1 1 2 2 2 2 1 1

6-1 5-1 4-0 3-1 5-3 5-4 3-0 4-3 4-3 3-2 3-3 2-2 2-2 1-3 2-6 1-5 0-6 0-6 1-2 1-2

Kesempatan terbaik Barca di babak kedua terjadi ketika Alexis Sanchez berhasil membuka pertahanan lawan, tapi tembakan lanjutan dari Fabregas melambung. Valencia sempat menggetarkan gawang Victor Valdes melalui tendangan Victor Ruiz, tapi gol tersebut dianulir wasit karena terjadi offside. Sampai pertandingan selesai

skor tidak berubah, tetap 1-0. Susunan pemain: Barcelona: Valdes; Alves (Alba 46), Pique, Mascherano, Adriano; Fabregas (Iniesta 64), Xavi, Song; Alexis (Busquets 87), Messi, Pedro Valencia: Diego Alves; Pereira, Rami, V. Ruiz, Cissokho; Feghouli (Valdez 81), T.Costa, Abelda (Gago 77), Guardado (Viera 77); Jonas, Soldado

Rumor-Rumor di Belakang Wajah Sedih CR7

ITALIAN SERIE A 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20


6 6 6 5 4 4 3 3 3 3 3 3 3 1 0 0 0 0 -1 -5

Roma Tekuk Inter 3-1 di Meazza MILAN-ASRomamemetikkemenangan pertamanya di musim ini. Bertandang ke Giuseppe Meazza, Roma menang 3-1 atas Inter Milan. Di laga yang dimainkan di Giuseppe Meazza, Senin (3/9) dinihari WIB, Roma unggul lebih dulu saat laga berjalan 15 menit. Umpan Francesco Totti dari sisi kiri disundul oleh Alessandro Florenzi yang berdiri bebas di dalam kotak penalti Inter. Tertinggal satu gol, Inter mengambil inisiatif menyerang. Tapi peluang Inter lewat Diego Milito di menit ke17 masih mampu digagalkan oleh Maarten Stekelenburg. Inter kembali mendapat peluang, kali ini lewat tendangan bebas Wesley Sneijder. Namun bola eksekusi Sneijder bisa diamankan oleh Stekelenburg. Di ujung babak pertama, Inter menyamakan kedudukan lewat sepakanAntonioCassano.Tembakannya mengenai Nicolas Burdisso dan

mengecoh Stekelenburg. Hingga turun minum, skor imbang 1-1 tetap bertahan. Roma mendapat peluang emas di awal babak kedua. Berawal dari umpan Panagiotis Tacthsidis, Pablo Osvaldo yang berdiri bebas kemudianmelepaskantembakan.Tapisial bagi Osvaldo, upayanya masih belum menemui sasaran. Osvaldo membawa Roma unggul di menit ke-67. Meneruskan umpan Totti, Osvaldo mencungkil bola melewati Luca Castelazzi dan mengubah skor menjadi 2-1. Marquihno menambah keung-

gulan Roma di menit ke-79. Menerima umpan dari Osvaldo, Marquinho yang bergerak dari sisi kiri kemudian melepaskan tembakan dari sudut sempit ke pojok gawang Castelazzi. Di masa injury time, Roma harus bermain dengan 10 orang. Osvaldo menerima kartu kuning kedua setelah melakukan handball. Hingga peluit panjang berbunyi, skor 3-1 untuk keunggulan Roma tetap tidak berubah. Dengan kemenangan ini, Roma merangkak ke peringkat lima dengan empat poin. Sementara Inter tertahan di posisi delapan dengan tiga poin.

Susunan Pemain: Inter: Castellazzi; Zanetti, Silvestre, Ranocchia, Nagatomo; Guarin, Gargano (Coutinho 76), Pereira (Cambiasso 66); Sneijder; Cassano (Palacio 50), Milito

Roma: Stekelenburg; Piris, Burdisso, Castan, Balzaretti (Taddei 56); Florenzi, Tachtsidis, De Rossi (Marquinho 32); Destro (Lamela 69), Osvaldo, Totti

MADRID-Belumdiketahuisecara pasti apa yang menyebabkan Cristiano Ronaldo bersedih hati. Spekulasi menyebut, si pemain ingin meninggalkan Real Madrid karena beberapa persoalan tertentu. Wajah sendu pemain Portugal itu jelasterlihatsetelahmencetakduagol dari tiga gol Madrid ke gawang Granada pada Senin (3/9) dinihari tadi. Jangankan melakukan selebrasi, ia bahkan tidak tersenyum. Seusai pertandingan, Ronaldo mengungkapkankepadamediabahwa dia sedang tidak bahagia dan klub mengetahui situasi tersebut. Namun demikian,pemainterbaikdunia2008 initidakmenjelaskanlebihlanjutsoal permasalahan ini. Dugaan bahwa Ronaldo marah dengan kemenangan Andres Iniesta dalam pemilihan pemain terbaik UEFA 2011/12 bukanlah alasannya. “Tidak ada hubungannya dengan itu. Iniesta pantas mendapatkannya,” ujar Ronaldo. Lantas apa? Dilansir Football Espana, radio terkemuka Spanyol Cadena SER mengklaim Ronaldo

telah mengungkapkan ketidaknyamannya di Madrid kepada Presiden Florentino Perez dan direktur umum Jose Angel Sanchez dalam pertemuan pada Sabtu (1/9). Ditambahkan pula ada isu bahwa Ronaldotidakakurdenganbeberapa rekan satu timnya. Mantan pemain Manchester United itu kabarnya tak senang dengan Marcelo yang barubaru ini berkomentar bahwa kiper Iker Casillas lebih pantas memperoleh Balon d’Or ketimbang dirinya, yang mana itu diyakini akan merugikan Ronaldo. Sedangkan dari kabar yang didapat Telegraph, penyebab Ronaldo gusar adalah perlakuan klub terhadap Kaka. Pemain Brasil tersebut kini tidak jelas masa depannya karena tak ada klub yang bersedia menggaetnya lantaran gajinya yang tinggi, namun juga tak masuk dalam rencana Jose Mourinho. Ronaldo sudah bermukim di Madrid selama tiga tahun dan selama itu pula ia menjadi pemain terbaik mereka dengan andil besarnya dalam suksesmeraihCopadelReydanjuara La Liga. Musim lalu, Ronaldo mengatakan akan senang untuk menghabiskan kariernya bersama Los Merengues. Tampaknya itu menjadi indikasi bahwa dia menginginkan sebuah kontrak baru, namun sampai saat ini klub belum menunjukkan tanda-tandaakanmenawari kesepakatan baru. Well, apa yang sebenarnya terjadi dengan Ronaldo? (int)





Selasa, 4 September 2012

Ditabrak BUS Altra Mobil Yaris Masuk Jurang ke dalam jurang setelah ditabrak Bus Altra BK 7892 DM, Senin (3/9) sekira

‹‹ Baca Ditabrak ...Hal 6

2012, Pemkab Batubara Tak Menerima CPNS BATUBARA-Untuk tahun 2012, Pemkab Batubara menegaskan tidak akan melakukan seleksi penerimaan Calon Pegawai Negeri Sipil (CPNS). Bahkan,

Edisi 205 „ Tahun V

„ Petugas mengevakuasi mobil Yaris yang masuk jurang setelah ditabrak bus Altra.

PULAU RAKYAT-Peristiwa kecelakaan terjadi di Jalinsum Asaahan KM 197198 Desa Sibayak Kecamatan Pulau Rakyat. Mobil Yaris BM 1568 PB masuk



Mayat Pria Membusuk Kaki Diikat, Wajah Dilakban PORSEA-Seorang pria tanpa identitas ditemukan membusuk di bawah jembatan di Desa Sosopan Pintu Pohan Meranti, Tobasa, Senin (3/9) sekira pukul 15.30 WIB. Dugaan sementara, korban dibunuh. Sebab, kedua kakinya diikat dan mulut dilakban.

untuk pengakatan CPNS dari tenaga honorer dan guru Bantu juga tidak dilakukan. Kepala Badan

Inalum Layak Dikelola Pemerintah

‹‹ Baca 2012, ...Hal 6

INFORMASI yang diperoleh METRO, penemuan itu berawal dari kecurigaan warga yang mencium aroma bau busuk sejak tanggal 31 Agustus lalu. Setelah ditelusuri beberapa hari kemudian, sumber aroma bau busuk itu berasal dari sebuah karung plastik warna hitam yang

BATUBARA- Ketua Dewan Pimpinan Daerah Relawan Pejuang Demokrasi (DPD Repdem) Sumatera Utara Heri SH mendukung, jika pengelolaan PT Inalum dikelola pemerintah khususnya pemerintah daerah. Dia berharap,

Pria Berkain Sarung Tewas Kelaparan SEMENTARA di pingir jembatan Siborang perbatasan Kelurahan Kantin dan Wek V Kecamatan Padangsidempuan, juga ditemukan mayat pria bersarung tidak memiliki identitas, Senin (3/9). Menurut Kapolres Psp AKBP Andi S Taufik melalui Kabag Humas AKP Indra F Dalimunte, mayat ini ditemukan warga sekira pukul 18.00 WIB dengan posisi telentang atau seperti tertidur dengan penyangganya badan jembatan.



‹‹ Baca Pria ...Hal 6

24 Kepala SMP Dipungli Rp1 Juta

‹‹ Baca Inalum, ...Hal 6

Disebut Biaya Kirim Berkas SPj ke Jakarta

Foto:Bram Situmorang

MAYAT: MR X yang ditemukan di kolong jembatan Sosopan Pintu Pohan Meranti dan kini dibaringkan di ruang mayat RSUD Porsea.

KISARAN-Sebanyak 24 kepala SMP di Asahan mengaku dipungli (dipaksa,red) memberikan uang sebesar Rp1 juta kepada Kabid Dikdas Dinas Pendidikan Asahan Herlis SPd. Informasi dihimpun METRO, pengutipan biaya itu disebut Kabid Dikdas

adalah untuk biaya pengiriman berkas Surat Pertanggujawaban (SPj) ke Jakarta, bagi sekolah-sekolah yang mendapatkan dana rehabilitasi sekolah dari dana blockgrren.

102 Lolos Seleksi, Calon Praja IPDN MEDAN-Sebanyak 102 peserta dari 518 orang yang mengikuti tes dinyatakan lulus seleksi akademis pada penerimaan calon praja Institut Pemerintahan Dalam Negeri (IPDN) tahun ajaran 2012/2013. Dari jumlah itu, 16 orang berasal dari

‹‹ Baca 102 Lolos ...Hal 6 PENYANYI seksi Vicky Shu belum juga menambahkan tanda-tanda akan menikah. Meski sudah berusia 32 tahun, Vicky Shu tetap saja menjomblo. “Betah enggak betah sih. Betah karena aku biasa mandiri, kalo gak betahnya kangen juga masa-masa punya cinta,” kata Vicky Shu di Studio RCTI Kebon Jeruk Jakarta Barat, Senin (3/9). Vicky mengaku pernah dijodohjodohkan oleh beberapa pria semasa kuliah. Tapi sekarang orang tua Vicky Shu sudah tak pernah lagi menyodorkan pria. “Zamanku dulu waktu kuliah malah sering, tapi begitu udah lulus kuliah udah kerja, enggak lagi. Kapok,” terang pemilik nama lengkap Vicky Veranita Yudhasoka itu. Ia juga mengakui dirinya sulit membuka hati kepada pria. Hal itu dilakukan karena dirinya ingin mencari sosok yang pas. “Daripada gua gonta-ganti, karena tujuannya memang bukan pacaran tapi nikah.

‹‹ Baca Ponaryo ...Hal 7

BANDAR SABU PEMBACOK TUKANG PARKIR BERKELIARAN KISARAN-Pria yang disebut bandar sabu-sabu berinisal AB, pelaku pembacokan terhadap Marnaek Butar-butar (45), tukang parkir 16 Agustus lalu di Kawasan Kampung Tengah Kisaran Timur,

hingga saat ini belum ditangkap dan masih terlihat berkeliaran. Kepada METRO di kawasan Mutiara, Ramayanti istri Marnaek mengatakan, hingga

‹‹ Baca Bandar Sabu...Hal 7

Ketika Para Pesepak Bola Indonesia Bergaya di Catwalk

Ponaryo Menahan Senyum, Jajang Sempat Gemetar Sejumlah pemain sepak bola menjadi model dadakan atas permintaan mantan punggawa timnas yang kini menyambi desainer, Isnan Ali. Hanya berlatih sekali, ada yang santai, ada pula yang sampai berkeringat dingin. M Ali Mahrus, Jakarta

TATAPAN matanya lurus. Di bawah sorot lampu disko dan iringan musik mengentak, bibirnya tampak menahan senyum. Dengan langkah mantap, dia bergaya bak model profesional memamerkan pakaian yang dikenakan. Padahal, catwalk sama sekali bukan panggungnya. ‘Tempat bermainnya’ sehari-hari justru di

‹‹ Baca Ponaryo ...Hal 7

Foto: M Ali Mahrus/JAWA POS

„ Ponaryo saat bergaya di catwalk bertema UIFashionWeek di salah satu mal di kawasan Jakarta Selatan, Sabtu malam lalu (1/9).

‹‹ Baca 24 Kepala ...Hal 6



4 September 2012

Kapolri: Ada 1.629 Lokasi Potensi Konflik di Indonesia JAKARTA- Berkaca dari kasus Sampang, Polri memetakan lokasi-lokasi potensi konflik di Indonesia. Polri menginventarisir ada 1.629 lokasi berpotensi konflik. ”Polri pro aktif menginventarisir potensi konflik di seluruh Polda agar tidak berkembang, yaitu terdapat 1.629 lokasi potensi konflik,” ujar Kapolri Jenderal Timor Pradopo dalam rapat dengan pendapat bersama Komisi III DPR, di Gedung DPR, Senayan, Jakarta, Senin (3/9).

Menurutnya, lokasi-lokasi itu tersebar pada beberapa latar belakang kondisi masyarakat. Terbanyak, lokasi potensi konflik terdapat pada sektor perkebunan. ”Lokasi terbanyak adalah perkebunan, pertanahan, agama, ekonomi sosial dan budaya, serta pertambangan,” tuturnya. Ia menjelaskan Polri telah menempatkan petugasnya di setiap desa guna mengantisipasi potensi konflik, mengetahui masalah dan mencari solusi bersama dengan masyarakat. ”Polri juga senantiasa berkoordinasi dengan tokoh masyarakat untuk memediasi agar tidak muncul konflik.

Pesawat AS Serang Yaman

13 ORANG TEWAS SANAA- Pesawat tak berawak milik Amerika Serikat kembali melancarkan serangan-serangan udara di Yaman. Sedikitnya 13 warga sipil dilaporkan tewas dalam serangan terbaru tersebut. Seorang pejabat kepolisian Yaman mengatakan, serangan udara itu terjadi di daerah Radaa pada Minggu, 2 September sekitar pukul 16.00 waktu setempat. Radaa berlokasi sekitar 130 kilometer sebelah tenggara Sanaa, ibukota Yaman. Menurut pejabat Yaman yang tidak disebutkan namanya itu seperti diberitakan Press TV, Senin (3/9), serangan udara pesawat tanpa awak AS tersebut mengenai dua kendaraan. Dikatakannya, dua wanita termasuk di antara para korban tewas. Militer AS telah menggunakan pesawat-pesawat tanpa awak untuk melancarkan serangan-serangan udara di Pakistan, Afghanistan, Yaman dan Somalia. Washington mengklaim serangan-serangan itu untuk menargetkan para militan. Namun pada kenyataannya, banyak warga sipil yang menjadi korban serangan-serangan tersebut. Sejumlah media Barat bahkan memberitakan, badan intelijen AS alias CIA berupaya meningkatkan serangan-serangan pesawat tanpa awak di Yaman. (dtc/int)

Dalam hal ini, Polri memainkan peran sebagai mediator yang membawa pesan perdamaian bagi masyarakat,” ujarnya. Selain itu, upaya yang dilakukan Polri dalam menyikapi lokasi potensi konflik dilakukan dengan membangun kerukunan antar warga dan mengikuti perkembangannya secara terus menerus. ”Kami juga menambah kekuatan Polri sebanyak 10.000 anggota pada tahun 2012 ini juga melengkapi perlengkapan senjata dalam penanganan konflik,” kata Timor. (dtc/int)

600 WNI Selamat dari Bencana Badai Tropis di Lousiana

„ Miranda memberikan penjelasan di hadapan Majelis Hakim di Pengadilan Tipikor Jakarta.

JAKARTA- 600 WNI selamat dari bencana badai tropis ‘Isaac’ di Lousiana, AS. Mereka, saat badai itu mengamuk di kawasan itu pada pekan lalu, mengungsi ke tempat aman. Dipastikan tidak ada korban WNI akibat bencana badai tersebut. Seperti disampaikan Konjen RI di Houston, dalam siaran pers, Senin (3/9/ 2012), para WNI sebagian besar banyak mengungsi ke kota-kota yang aman seperti Baton Rouge, Lafayette, dan bahkan sampai ke Houston, Texas, 570 km dari New Orleans. Akibat badai itu, ribuan rumah penduduk tenggelam, pohon-pohon bertumbangan, listrik mati dan ribuan penduduk mengungsi. Saat ini seluruh masyarakat Indonesia telah kembali ke rumah masing-masing. Konsul Jenderal RI di Houston, Al

Busyra Basnur dan isteri Wenny Busyra Basnur pun menyempatkan mengunjungi masyarakat Indonesia yang menjadi korban. Pada pertemuan dalam bentuk makan siang bersama itu, Al Busyra menanyakan langsung kondisi masyarakat Indonesia dan pengalaman mereka selama badai berlangsung. Hadir sekitar 80 orang masyarakat Indonesia. Mengingat kawasan itu sering dilanda bencana alam, Al Busyra Basnur, juga menyampaikan imbauan kepada para WNI. Mereka diminta waspada, memperhatikan setiap peringatan, dan mengikuti petunjuk dari pemerintah setempat serta segera menghubungi KJRI Houston. Dua hari sebelum badai Isaac datang, Konjen Al Busyra juga telah melakukan komunikasi intensif dengan masyarakat Indonesia di kawasan bencana untuk

melakukan monitoring dan memberikan arahan kepada masyarakat. Bahkan KJRI Houston membentuk satuan tugas untuk membantu masyarakat Indonesia di sana. Dalam kesempatan itu, Ketua Indonesian American Community Association (IACA), Indah D. Kusuma, mengatakan bahwa sebelum dan pada saat badai masyarakat Indonesia di Louisiana selalu saling memberikan informasi satu sama lain untuk mengetahui kondisi masingmasing. Sementara itu, Bambang Arifatmi, seorang mahasiswa program doktor di New Orleans, mengatakan bahwa kondisi dan keberadaan masyarakat Indonesia pada saat badai, dapat diketahui dengan baik berkat adanya koordinasi yang erat setiap saat dengan pihak KJRI Houston. (dtc/int)

Masa Tahanan Miranda Segera Teroris Solo Gunakan Senjata dari Filipina Berakhir JAKARTA- Majelis hakim Pengadilan Tipikor memutuskan mempercepat rangkaian sidang perkara suap cek pelawat dengan terdakwa Miranda Swaray Gultom. Alasannya, masa penahanan Miranda hanya sebulan lagi. ”Setelah kami perhatikan masa penahanan terdakwa paling lambat tanggal 7 Oktober. Kami tidak putus tanggal 7 Oktober karena masa pikir-pikir selama 7 hari. Paling lambat 30 September untuk masuk masa pikir-pikir (atas putusan),” kata Ketua Majelis Hakim Gusrizal di awal persidangan Miranda di Pengadilan Tipikor Jakarta, Senin (3/9). Gusrizal kembali mengigatkan hal ini ketika hendak menutup persidangan. “Ini kesempatan terakhir bagi penuntut umum untuk hadirkan saksi. Apakah akan dikonfrontir, ini kesempatan terakhir,” ujarnya. Hakim juga meminta penasihat hukum menyiapkan pemanggilan terhadap ahli atau pun saksi meringankan untuk dihadirkan pada hari Senin (10/9) pekan depan. ”Tanggal 10 itu kita langsung pemeriksaan terdakwa karena tidak ada waktu lagi,” imbuh Gusrizal. Sidang Miranda akan dilanjutkan hari Kamis 6 September dengan menghadirkan saksi yang dijadwalkan penuntut umum. Rencananya, penuntut juga akan mengupayakan menghadirkan Hamka Yandhu, Endin Soefihara dan Paskah Suzetta untuk dikonfrontir terkait keterangan berbeda mengenai pertemuan di kediaman Nunun. (dtc/int)

JAKARTA- Terduga teroris di Solo menggunakan senjata dari Filipina saat beraksi. Kepolisian Filipina dilibatkan guna menelusuri senjata tersebut. ”Soal senjata Filipina, itu sedang ditelusuri,” kata Menko Polhukam Djoko Suyanto di Istana Negara, Jakarta, Senin (3/9). Menurut dia, proses penelusuran bersama Filipina sudah dilakukan. Indonesia juga menjalin kerjasama antiteror dengan negara lainnya mengingat teroris memiliki jaringan yang luas. ”Itulah fungsi dan kegunaannya sehingga kita bisa menelusuri apa yang terjadi,” ujarnya. Namun demikian, Djoko menolak membeberkan kemajuan penyelidikan. “Itu adalah buah dari kerja keras mereka. Mereka kan sudah ada di lapangan sejak lama,” kata dia. Kapolri Jenderal Timur Pradopo sebelumnya menyebut terduga teroris di Solo menggunakan senjata dari Filipina. Mereka diduga melakukan penyelundupan berbagai jenis senjata api dan amunisi dari Filipina. Sejumlah barang bukti juga diamankan antara lain 1 pucuk pistol pietro baretta, 3 buah magazine, 43 peluru kaliber 9 mm merk Luger, dan 9 holopoint CBC, 1 unit HP, beberapa dokumen, dan STNK. Motif untuk Balas Dendam Kepolisian RI memastikan bahwa rentetan penyerangan kelompok teroris di Solo, Jawa Tengah, selama Agustus 2012 bermotif balas dendam. Hal ini berdasarkan hasil pemeriksaan terhadap barang bukti dan pemeriksaan tersangka teroris yang ditangkap hidup oleh

„ Jenazah teroris Solo dibawa ke rumah sakit untuk diotopsi. Densus 88 Anti Teror Polri Kepala Biro Penerangan Masyarakat Polri Brigadir Jenderal (Pol) Boy Rafli Amar mengatakan, selain magazen, di dalam tas pinggang yang dipakai Farhan (19), polisi menemukan banyak lembaran kertas. Dalam lembaran itu, kata Boy, terdapat surat yang ditulis tangan. “Ternyata di dalam surat itu cukup jelas untuk menyimpulkan motif. Secara ideologi memang mereka berjuang sebagaimana kelompok terdahulu seperti Jamaah Islamiyah yang ingin membentuk negara syariah Islam di Indonesia. Jadi kenapa mereka membalas, karena mereka merasa kecewa dengan penangkapan tokoh mereka selama ini sehingga mereka balas dendam,” kata Boy sebelum rapat kerja dengan Komisi III di Gedung Kompleks Parlemen Senayan, Jakarta, Senin ( 3/9/2012 ). Dalam raker itu, Komisi III ingin mendengar penjelasan Kepala Polri Jenderal (Pol) Timur Pradopo mengenai penanganan Madura, dan Sigi, Sulawesi Tengah. Akan disinggung pula mengenai penanganan kasus terorisme di Solo. Boy menambahkan, dalam pemerik-

saan terungkap pula sandi yang dipakai kelompok mereka, yakni “main bola”. Jika sandi “pengantin” untuk melakukan bom bunuh diri, sandi “main bola” dipakai untuk menyerang petugas kepolisian. “Itu terungkap dalam pemeriksaan ini. Kita melihat mereka sangat teliti, sampai menentukan hari (penyerangan) pun mereka sangat memikirkannya. Penentuan tanggal 17 Agustus dikaitkan bersamaan dengan hari proklamasi,” kata Boy. Seperti diberitakan, Jumat malam lalu, Detasemen Khusus (Densus) Antiteror menyergap tiga terduga pelaku teror yang menembak seorang polisi di Pos Polisi Singosaren, Ajun Inspektur Dua (anumerta) Dwi Data Subekti, hingga tewas. Dua di antaranya, yakni Farhan (19) dan Mukhsin (19), tewas dalam baku tembak di Jalan Veteran, Kelurahan Tipes, Kecamatan Serengan, Solo. Terduga lainnya, Bayu (24), warga Tipes, ditangkap di kediaman mertuanya, Wiji Siswo Suwito, di Desa Bulurejo, Kecamatan Gondangrejo, Kabupaten Karanganyar, Jateng. Kepolisian masih mengembangkan penyidikan untuk mencari tahu ada tidaknya keterlibatan pihak lain. (dtc/int)

KPK Jamin Penyidiknya Profesional Periksa Perwira Polri JAKARTA- Komisi Pemberantasan Korupsi menjamin penyidiknya akan profesional dalam memeriksa para perwira Polisi yang menjadi saksi kasus dugaan korupsi proyek simulator ujian surat izin mengemudi (SIM) Korps Lalu Lintas (Korlantas) Polri 2011. Hal tersebut disampaikan Juru Bicara KPK, Johan Budi, di Jakarta, Senin (3/ 9/2012). “Saya kira kita menghormati profesionalitas penyidik KPK. Ketika dia sudah bekerja di KPK, tentu dia akan melakukan tugas-tugas sebagai penyidik untuk kepentingan KPK,” katanya. Seperti diketahui, hampir semua penyidik yang bertugas di KPK berasal dari institusi Polri sementara sebagian lainnya dari institusi Kejaksaan Agung. Menurut Johan, untuk kasus simulator SIM ini, semua penyidik be-

rasal dari Kepolisian. Rata-rata penyidik KPK yang menjadi ketua satuan tugas (satgas) penyidikan suatu kasus, berpangkat Ajun Komisaris Besar Polisi atau AKBP. “Ada juga yang kombes (komisaris besar) ketua satgasnya,” tambah Johan. Dia juga mengatakan, KPK tidak akan mengganti tim penyidiknya dengan yang berpangkat tinggi-tinggi saat memeriksa Inspektur Jenderal (Irjen) Polisi Djoko Susilo nantinya. “Jadi gini, setiap kasus itu ada timnya. Nah setiap tim itu dipimpin oleh seorang ketua yaitu kasatgas. Jadi siapa yang diperiksa, tentu tidak mengubah dari tim yang sudah ada,” tutur Johan. Sejauh ini, KPK belum memeriksa Djoko sebagai tersangka kasus dugaan korupsi proyek simulator SIM.

Menurut Johan, Djoko akan diperiksa dalam satu hingga dua pekan ke depan. Hari ini KPK memeriksa tiga perwira Polisi sebagai saksi untuk Djoko. Mereka adalah Kepala Kepolisian Resort Temanggung, Jawa Tengah, AKBP Susilo Wardono, Kepala Subdit Pendidikan dan Rekayasa Direktorat Lalu Lintas Polda Jawa Tengah, AKBP Indra Darmawan, dan Kepala Polres Kebumen, Jawa Tengah, AKBP Heru Trisasono. Pada Jumat (31/8) lalu, KPK memeriksa empat perwira Polisi yang menjadi panitia pengadaan proyek simulator SIM 2011. Keempatnya adalah AKBP Wisnhu Buddhaya, AKBP Wandi Rustiwan, Komisaris Polisi (Kompol) Endah Purwaningsih, dan Kompol Ni Nyoman Suwartini. (kmc/int)

Pemberontak Kuasai Pangkalan Udara DAMASKUS- Para pejuang oposisi di Suriah mengklaim telah menguasai sebuah pangkalan udara militer Suriah di Provinsi Deir el-Zour, Suriah timur. Para pemberontak juga menyandera setidaknya 16 tentara dan menyita senjata-senjata dan amunisi mereka. Kekerasan berlanjut dengan insiden dua bom mobil yang meledak dekat kantor kepala staf gabungan militer Suriah di Damaskus pada Minggu, 2 September malam waktu setempat. Empat perwira terluka. Demikian seperti diberitakan stasiun televisi Suriah seperti dilansir kantor berita AFP, Senin (3/9). Sebelumnya pada Sabtu, 1 September, sebuah bom mobil lainnya meledak di dekat kamp pengungsi Palestina di Damaskus dan menewaskan 15 orang. Dalam sejumlah video yang beredar di internet terlihat situasi pasca serangan pemberontak di pangkalan pertahanan udara di al-Bukamal, dekat perbatasan Suriah dengan Irak. Di salah satu video terlihat para pemberontak berkumpul di depan sebuah gedung, dengan jasad dua tentara pemerintah tergeletak di tanah. Sementara itu, juru runding baru Suriah untuk PBB dan Liga Arab, Lakhdar Brahimi, akan pergi ke Damaskus dalam beberapa hari ini. Diplomat veteran Aljazair tersebut berniat untuk bermarkas di Damaskus guna menjalankan misinya. ”Damaskus merupakan tempat yang tepat,” kata Brahimi. “Apakah itu mungkin atau tidak, saya akan segera mengetahuinya,” tandasnya. (dtc/int)

Kepala Badan Luar Angkasa Rusia Dipecat MOSKOW- Presiden Rusia Vladimir Putin memecat Kepala Badan Luar Angkasa Khrunichev, Vladimir Nesterov dari jabatannya. Pemecatan ini dilakukan menyusul sejumlah kegagalan peluncuran program ke luar angkasa oleh Rusia. Menurut dekrit presiden yang dikeluarkan tanggal 31 Agustus, Nesterov telah resmi dilengserkan dari jabatannya. Dekrit tersebut dipublikasikan dalam situs resmi Kremlin pada hari ini dan dilansir AFP, Senin (3/9). Pria berusia 63 tahun ini telah menjabat sebagai Direktur Umum Produksi Pusat Ruang Angkasa dan Riset Nasional Khrunichev sejak tahun 2005. Biro Ruang Angkasa Khrunichev merupakan badan luar angkasa terbesar di Rusia yang bermarkas di Moskow, yang selama ini memproduksi dan melakukan peluncuran roket-roket Proton ke luar angkasa. Bulan lalu, muncul laporan bahwa Rusia kehilangan 10 satelit dalam jangka waktu 1,5 tahun terakhir. Terhadap laporan tersebut, Perdana Menteri Dmitry Medvedev memanggil sejumlah pejabat terkait isu ruang angkasa untuk memberikan penjelasan kepada pemerintah. Dalam pertemuan dengan para pejabat tersebut, PM Medvedev menyebut serangkaian kegagalan tersebut ‘telah melemahkan reputasi Rusia di mata internasional sebagai negara yang memimpin dalam misi luar angkasa.’ Nesterov yang juga hadir dalam pertemuan tanggal 14 Agustus tersebut, kemudian diminta untuk mengundurkan diri. Diketahui bahwa pada 6 Agustus lalu, 2 buah satelit milik Rusia hilang setelah upaya peluncuran menggunakan roket Proton-M gagal mencapai orbit. Satelit telekomunikasi, milik Rusia MD2 dan milik Indonesia Telkom3, tidak bisa melakukan kontak. Komisi penyelidikan pun dibentuk untuk menyelidiki kegagalan tersebut. Hasilnya menunjukkan adanya masalah pada Briz-M, bagian atas roket Proton-M. Otoritas Rusia pun langsung memerintahkan inspeksi terhadap seluruh hasil produksi Briz-M dan upaya peluncuran dalam beberapa waktu ke depan terpaksa ditunda. Selain itu, masalah pada program ruang angkasa Rusia juga diwarnai oleh adalah persoalan teknis yang berujung pada hilangnya belasan satelit dan penjelajah Rusia sejak tahun lalu, termasuk kendaraan luar angkasa pembawa Progress yang bertugas mengangkut sejumlah perlengkapan ke Stasiun Ruang Angkasa Internasional. (dtc/int)


4 September 2012

Kepala Korlantas Polri Irjen Pudji Hartanto.

“Sebanyak 66 persen dari 5,796 insiden kecelaksaan selama arus mudik-balik Lebaran 2012 disebabkan disebabkan unsur manusia. Seperti mengantuk, kelelahan, mabuk, sakit, mengunakan handhone, menerobos, melanggar batas, pindah jalur dan mendahului,”

Kirim Opini Anda ke email: metroasahan Maksimal tulisan 5.000 karakter

“Intelijen negara terus memberi masukan kepada pemerintah untuk berupaya agar isu suku, agama, ras dan antargolongan (SARA) tidak Kepala Badan Intelijen Negara tumbuh subur,” (BIN) Marciano Norman.

Syahganda Nainggolan.

Peraturan Baru Izin Lingkungan

Sikap Kami Tabiat Buruk Penyerapan Anggaran KITA seperti nyaris kehilangan kata-kata ketika menyaksikan masih buruknya kinerja penyerapan anggaran oleh pemerintah. Penyakit tahunan itu amat sulit disembuhkan, bahkan ketika Presiden Susilo Bambang Yudhoyono sudah beberapa kali menyatakan kekecewaannya. Kondisi paling baru disampaikan Tim Evaluasi dan Pengawasan Penyerapan Anggaran (TEPPA) yang dibentuk Presiden.TimituterdiridariKepalaUnitKerjaPresidenBidang Pengawasan dan Pengendalian Pembangunan Kuntoro Mangkusubroto, Wakil Menteri Keuangan Anny Ratnawati, dan Kepala Badan Pengawasan Keuangan dan Pembangunan (BPKP) Mardiasmo. Berdasarkan laporan TEPPA, serapan khusus belanja modal 43 kementerian dan lembaga pada semester I 2012 masih rendah. Hingga saat ini baru 25 institusi yang kemampuan identifikasi paket pengadaannya di atas 60%. Sebanyak 37 institusi berkemampuan di bawah 60% dan 25 institusi tidak memiliki kejelasan pelaksanaan penyerapan. Amat mungkin mereka akan menumpuk penyerapan anggaran di akhir tahun. Masih banyak institusi yang belum memulai proses pengadaan lelang pada medio tahun ini. Padahal, hal itu menjadi indikator bagi tren realisasi penyerapan anggaran. Lebih parah lagi, TEPPA mencatat penyerapananggaranbelanjaempatinstitusihinggatriwulanII2012 masih 0%. Keempatnya ialah Kementerian Pemuda dan Olahraga, Badan Intelijen Negara, Badan Nasional Penanggulangan Terorisme, dan Dewan Kehutanan Nasional. Hinggakini,barulimainstitusiyangmampumelelangpaket kegiatan secara signifikan. Kelimanya ialah Badan Kepegawaian Negara dengan capaian lelang 100%, BP Batam 94%, BPKP 81,5%, Kementerian Pekerjaan Umum 79,6%, dan Kementerian Koperasi dan Usaha Kecil dan Menengah 67,3%. Fakta itu sungguh menjadi potret betapa respons aparatur kita terhadap percepatan ekonomi amat lamban. Padahal, di tengah perekonomian dunia yang murung akibat krisis, stimulus APBN amat penting untuk mempertahankan atau bahkan mendongkrak pertumbuhan. Lambatnya penyerapan anggaran jelas bisa menjadi inefisiensi bagi perekonomian kita. Ia juga sebagai penanda tidak beresnya perencanaan. Tiaptahun,belanjaAPBNterusmeningkat.DiRAPBN2013 pemerintah bahkan menargetkan belanja negara Rp1.657,9 triliun, naik Rp109,6 triliun (7,1%) ketimbang belanja APBNP 2012. Jika dibandingkan dengan belanja negara di 2007, kenaikan belanja RAPBN 2013 malah mencapai dua kali lipat. Sayangnya, kenaikan belanja itu belum berbanding lurus dengan upaya keras membereskan hambatan penyerapan anggaran. Dari target penyerapan 50% di semester I, yang tercapai baru sekitar 30%. Sebaliknya, ganjaran harus diberikan kepada institusi yang signifikan dalam menyerap anggaran. Sekadar pidato kekecewaan jelas tidak akan pernah menyelesaikan persoalan. (**)

“Dahulu bangsa ini pernah mengalami junta militer dari Soekarno ke Soeharto. Namun setelah reformasi justru yang berkembang adalah desakan kapitalisme internasional, dengan kekuatan-kekuatan kapitalis di tanah air yang berusaha menguasai negeri dan kekuasaan politik secara nasional,”

Banyak penanam modal asing (PMA) menginvestasikan sahamnya untuk pendidikan industri di Indonesia. Hal ini secara langsung akan memberikan dampak kepada taraf ekonomi nasional dengan meningkatnya penyerapan tenaga kerja, produk domestik bruto, maupun pajak arus distribusi produk. Namun, salah satu pertimbangan kuat dari perusahaan PMA adalah keadaan geografis yang strategis untuk membuang limbah industri ke badan lingkungan. Kegiatan industri di kota Cilegon mencatat sebanyak 84 perusahaan PMA dan 48 perusahaan PMDN.


Gugi Yogaswara

LIMBAH industri yang dihasilkan sangat bergantung dari jenis usaha yang diselenggarakan. Mayoritas industri yang bertempat di kawasan industri Cilegon adalah industri-industri petrokimia, logam, dan maupun manufaktur yang notabene menghasilkan limbah B3 yang dapat dikelola hanya setelah mendapatkan izin pengelolaan dari KLH. Aktifitas penanam modal tersebut sebenarnya sudah berlangsung dari tahun 90-an. Hal ini menjadi kesempatan yang baik untuk industri-industri asing tersebut. Pasalnya, perizinan lingkungan perusahaan dirasa masih belum mengikat aktifitas industri yang memiliki dampak lingkungan untuk turut serta manjaga bumi indonesia dari aktifitas pembuangan limbah industri. Pada tahun 1993, pemerintah membuat Peraturan nomor 51 tentang Analisis Mengenai Dampak Lingkungan (AMDAL) sebagai perbaikan dari PP No. 23 Tahun 1986. Istilah AMDAL kita kenal sebagai dokumen

studi dampak dari aktifitas perusahaan terhadap lingkungan yang disusun pemrakarsa (pihak pemiliki industri) untuk disetorkan kepada pemerintah dalam rangka memperoleh izin mendirikan perusahaan. Kemudian, seiring perkembangan waktu, pemerintah memperbaiki PP No. 51 tahun 1993 menjadi PP No. 27 tahun 1999. Perbaikan ini dilakukan untuk menyeimbangkan aturan lingkungan dengan sistem kepemerintahan otonomi daerah, sehingga peraturan No. 27 tahun 1999 memberikan wewenang lebih bagi pemerintah daerah untuk memutuskan pertimbangan dampak lingkungan bagi kegiatan atau usaha yang dibangun di daerah masing-masing. Pembangunan kegiatan industri semakin marak terjadi di seluruh penjuru Indonesia. Mayoritas industri membangun lapak pabrik di lokasi dengan badan lingkungan yang strategis seperti di pinggir laut, pinggir danau, pinggir sungai, maupun di daerah dataran rendah. Hal

ini semata-mata untuk menunjang sumberdaya kegiatan industri dan mempermudah pembuangan limbah. Lokasi-lokasi tersebut adalah lokasi yang dapat menunjang penghematan perusahaan dalam mengolah limbah. Lokasi dekat badan air dapat menghemat biaya distribusi pembuangan limbah dengan hanya membuat saluran pendek pembuangan air limbah yang bermuara di laut atau badan air lainnya. Daerah dengan angin kencang dapat mempercepat dispersi pencemaran udara dari sumber emisi tak bergerak. Lalu, lokasi lapak pabrik yang dekat dengan pelabuhan dapat menghemat biaya pengangkutan limbah B3 pada pihak ketiga. Hal inilah yang terjadi pada daerah Cilegon dan sekitarnya yang menjadi pusat industri provinsi Banten. Aspek-aspek geografis tersebut diperebutkan oleh penanam modal untuk membangun lapak pabrik industri. Sementara, pihak badan lingkungan hidup daerah (BLHD) yang memiliki andil dalam menerapkan kebijakan lingkungan di daerah sepertinya kewalahan dalam menangani aktifitas pengelolaan limbah industri yang semakin lama semakin marak. Bahkan, peraturan pemerintah No. 27 Tahun 1999 seolah tidak mengantisipasi kualitas SDM pelaksana kebijakan dengan diberikannya wewenang lebih pada pemerintah daerah untuk mengelola kebijakan lingkungan. Hal ini menyebabkan penilaian aktifitas pengelolaan dampak lingkungan perusahaan samar terlihat. Laporan pengelolaan lingkungan perusahaan dinilai baik hanya karena parameter pencemar berada di bawah baku mutu limbah (BML). Di samping itu, komisi penilai AMDAL cenderung mereduksi makna AMDAL sebagai kajian ilmiah. Ini mengakibatkan studi AMDAL maupun UKL & UPL dipandang sebagai formalitas belaka. Hal yang serupa terjadi pada aspek hukum studi AMDAL. Penerapan hukum atas pelanggaran tidak difasilitasi secara khusus, mengingat AMDAL dan UKL & UPL adalah bukan keputusan Tata Usaha Negara (TUN). Kekurangan-kekurangan tersebut melandasi pemerintah merevitalisasi Peraturan Pemerintah No 27 tahun 1999 tentang Analisis Mengenai Dampak Lingkungan menjadi PP No. 27 Tahun 2012 tentang Izin Lingkungan. Beberapa perubahan mendasar yang terdapat dalam PP No. 27 tahun 2012 adalah reduksi jumlah dokumen AMDAL dari 5 dokumen menjadi 3 dokumen, reduksi waktu penilaian dokumen dari 180 hari menjadi selama 125 hari saja. Kemudian, PP baru ini juga mengembalikan makna AMDAL dan UKL & UPL sebagai kajian ilmiah yang harus dinilai secara ilmiah pula. Sehingga, penilaian dapat lebih jelas mengacu pada standar baku mutu yang sudah ditetapkan. Perubahan hukum juga terjadi pada skema izin lingkungan yang termasuk dalam keputusan Tata Usaha Negara. Hal ini menjadikan izin lingkungan memiliki sifat enforceable dan memiliki konsekuensi hukum atas pelanggaran yang terjadi. Lahirnya PP 27 Tahun 2012 ini diharapkan dapat menjadi landasar instrumen perlindungan dan pengelolaan lingkungan di indonesia. Aktifitas pengelolaan limbah industri telah banyak mencemari lingkungan, baik itu pencemaran air, tanah, maupun udara. Hal ini akan diperburuk jika penegakan hukum lingkungan tidak digalakkan dengan berintegritas di seluruh negeri. (**) Penulis adalah Mahasiswa Fakultas Teknologi Pertanian, Jurusan Teknik Sipil dan Lingkungan, alumnus SMAN 1 Kota Serang.



4 September 2012

SUAMI TENDANG ISTRI HAMIL HAKIM TOLAK EKSEPSI TERDAKWA SIMALUNGUN– Hakim Pengadilan Negeri (PN) Simalungun memutuskan menolak eksepsi terdakwa Agus Supriadi (31) yang mendorong kepala dan menendang paha istrinya Sarlina Saragih yang tengah hamil 16 minggu. Menurut hakim, eksepsi warga Kampung Baru, Kelurahan Kerasaan I, Kecamatan Pematang Bandar tersebut sudah masuk ke dalam pokok materi perkara. Hal itu disampaikan majelis hakim yang dipimpin Samuel Ginting beranggotakan Adria dan Heriyanti yang digelar di PN Simalungun, Senin (3/9). “Setelah mendengarkan eksepsi terdakwa yang dibacakan pada sidang sebelumnya. Maka majelis hakim yang menyidangkan perkara ini memutuskan menolak eksepsi terdakwa. Sebab isi eksepsi tersebut sudah masuk dalam pokok perkara,” terangnya. Sambungnya, maka persidangan akan dilanjutkan dan dimintakan kepada Jaksa Viktor Situmorang untuk menghadirkan saksi-saksi di persidangan. Selanjutnya sidang akan dilanjutkan pada Kamis (7/9). Sebelumnya Jaksa Penuntut Umum (JPU) Viktor Situmorang menyebutkan, korban melaporkan suaminya Agus Supriadi karena melakukan Kekerasan Dalam Rumah Tangga (KDRT). Peristiwa itu berlangsung pada Senin (12/12) sekira pukul 17.30 WIB. “Saat itu terdakwa datang

bersama istrinya ke rumah orangtua terdakwa yang terletak di Kampung Baru Kelurahan Kerasaan I Kecamatan Pematang Bandar. Tidak beberapa lama saksi Helen yang merupakan warga Perumnas Kerasaan datang ke rumah orangtua terdakwa. Kedatangan Helen bermaksud untuk menagih hutang kepada korban,” sebutnya. Dia menerangkan, saat Helen meminta hutang kepada Sarlina, terjadilah pertengkaran mulut karena korban tidak mau membayar hutangnya. Mendengar keribuatan itu, terdakwa pun mengambil jalan tengah agar hutang istrinya dibagi dua pembayarannya. “Hutang tersebut sebagian akan dibayar oleh terdakwa dan sebagian lagi akan dibayar oleh orangtuanya. Selanjutnya tidak beberapa lama terjadi cek cok mulut antara orangtua terdakwa dengan korban tentang masalah hutang,” ungkap Viktor. Karena merasa kesal, saat itu orangtua terdakwa mengatakan kepada korban ‘menantu kurang ajar’. Mendengar itu korban pun menjawab ‘ terserah kau mau jadi apa kalian terserah’. Mendengar pernyataan istrinya tersebut terdakwa pun emosi. Saat itu terdakwa mendorong korban dan menunjang paha kanan korban sebanyak satu kali hingga terjatuh ke tanah. (mua)




Ada Martil, Black Label, dan Civas Regal SIANTAR- Sebanyak 219 botol minuman keras (miras) berbagai merek dimusnahkan Polres Siantar di halaman Mapolres, Senin (3/9), sekira pukul 10.07 WIB. Minuman keras ini terdiri dari berbagai merek, red label, balleys, gordons, martini, jose cuervo, black label, winner, martil, civas regal, dan berbagai merek minuman keras lain dari dalam dan luar negeri.


DIMUSNAHKAN- 219 botol miras senilai Rp70 juta, dimusnahkan di halaman Mapolres Pematangsiantar, Senin (3/9).

Botol miras ini merupakan hasil operasi pekat selama bulan suci Ramadan tahun ini yang disita dari UD Makmur Jaya Jalan MH Sitorus. Kegiatan pemusnahan dilaksanakan di halaman Mapolres Siantar. Dihadiri jaksa fungsional Hari Darmawan dan Kasipidum R Parulian dari Kejari Siantar. Sementara dari Polres Siantar diwakili Kasat Narkoba AKP Sofyan dan puluhan personel polisi dari berbagai satuan. Turut hadir Ketua Front Pembela Islam (FPI) Kota Siantar Muhammad Syahril Chan. Secara simbolis, tiga botol minuman keras ini dilemparkan ke arah alat berat silinder oleh tiga orang yang mewakili kejari dan polisi. Secara perlahan alat berat ini menggilas semua botol minuman keras yang sudah ditumpuk di aspal. Usai pemusnahan, mewakili Kejari Siantar, Jaksa Hari Darmawan menyebutkan, nomor putusan pengadilan pemusnahan 219 miras ini yaitu Nomor:01 Pid

C/2012/PN PMS, tertanggal 13 Agustus 2012. Hari menambahkan, tertundanya pemusnahan ini dari jadwal yang ditentukan disebabkan Hari Raya Lebaran. Sehingga pemusnahan baru dapat dilaksanakan, Senin (3/9). “Tidak ada unsur kesengejaan terkait penundaan pemusnahan ratusan botol miras ini. Data yang dimusnahkan hari ini sesuai dengan yang tertera di kepolisian dan kejaksaan, tidak ada beda sama sekali. Saya kira tidak ada masalah dengan itu,” ujarnya. Sementara Ketua FPI Kota Siantar Muhammad Syahril Chan mengucapkan terima kasih kepada aparat kepolisian atas pemusnahan yang dilakukan. Mereka menghargai kinerja polisi dan berharap agar terus ditingkatkan. “Peredaran miras sudah menyeluruh di Kota Siantar, kita berharap polisi meingkatkan kinerjanya dalam pemberantasan miras ini. Jika sudah baik saat ini, untuk terus ditingkatkan kedepan,” jelasnya. (ral/dro)




BUAT LAPORAN- Harianto Sinaga (50) saat membuat laporan di Mapolres, Senin (3/9). Korban kehilangan Honda Vario BK 5763 TAM dari Gedung I Pasar Horas.

Satu Hari, Dua Kreta Matic Hilang DARI SEPUTARAN PASAR HORAS SIANTAR- Dua kreta matic hilang dari seputaran Pasar Horas, Sabtu (1/9). Satu unit Yamaha Mio hitam BK 6658 WZ hilang dari Jalan Cipto Gg Suzuki milik Husni (46) pukul 08.30 WIB. Sementara satu unit Honda Vario BK 5763 TAM milik Mariana br Silalahi (45) hilang dari Gedung I Lantai Dasar Pasar Horas pada pukul 17.00 WIB. Menurut suami Mariana br Silalahi, Harianto Sinaga (50) ditemui di Pasar Horas, Senin (3/9), pada Sabtu pagi pukul 08.00 WIB, seperti biasa istrinya berangkat kerja untuk berjualan kain di Lantai Dasar Pasar Horas. Kreta inipun lalu diparkirkan di tempat biasa di Gedung I Lantai Dasar Pasar Horas. Namun bukan dilokasi parkir biasa dipinggir Jalan Sutomo. Lokasi parkiran kreta ini agak kedalam dan hanya berjarak sekitar 50 meter dari toko milik mereka. Namun diakuinya, lokasi parkir kreta ini tidak bisa dilihat langsung karena terhalang terpal dan agak sedikit berbelok dari tempat usahanya. Sekitar pukul 16.00 WIB, salah satu anggota keluarganya melintas dari lokasi parkir itu, kreta tersebut masih ada. Namun sekira pukul 18.00 WIB, sewaktu hendak pulang ke rumah, kreta tersebut sudah tidak ada lagi. Istrinya pun sangat terkejut dan sempat pingsan karena kreta miliknya hilang. Selama ini kreta itu selalu digunakan setiap hari ke tempat usaha di Pasar Horas. “Setelah kreta itu tidak ada, istri saya langsung menelpon saya. Setibanya saya dilokasi, saya lihat istri saya sudah pingsan. Saya sempat cari keliling-keliling Pasar Horas hingga pukul delapan malam, tapi tetap tidak ada juga dapat kreta itu,” ujar warga Jalan

Meranti, Siantar Utara ini. Disebutkannya, mulai Sabtu hingga Senin, dia telah berusaha mencari lokasi kreta itu diberbagai lokasi di Kota Siantar. Namun usahanya ini belum berhasil, sehingga keluarganya memutuskan melaporkan masalah ini ke Polres Siantar. “Kata istriku, kreta itu memang tidak dikunci stangnya, makanya mudah dibawa lari. Memang salah istriku jugalah ini. Didalam jok kreta itu ada STNK dan surat-surat kredit kreta itu. Baru enam bulanlah kami pakai kreta itu,” ujarnya lagi. Sabtu Pagi, Yamaha Mio Hilang Sebelumnya, pada pagi hari sekitar pukul 08.30 WIB, satu unit Yamaha Mio hitam BK 6658 WZ milik Husni hilang dari Jalan Cipto Gg Suzuki. Padahal selama ini korban selalu memarkirkan kretanya dilokasi itu selama bertahun-tahun. “Memang naas saya ini, saya hanya minum sebentar di kedai kopi Koktung Massa, paling lama setengah jam. Saya datang kesitu jam delapan pagi, saya pulang setengah sembilan. Saya pun heran, stang kreta itu saya kunci juga. Selama ini saya selalu parkir kreta disitu,” jelasnya. Dikatakan warga Jalan Mojopahit Siantar Utara ini, usai kejadian, dia berusaha mencari kreta itu di sekitaran Jalan Cipto, namun tidak berhasil. Disebabkan ada urusan mendesak di Medan, dia baru sempat melaporkan peristiwa ini ke Polres pada Senin. Kasubag Humas Polres Siantar AKP Altur Pasaribu membenarkan laporan pengaduan kedua korban. Saat ini, pihaknya sedang melakukan penyelidikan identitas pelaku yang mengambil kreta di dua lokasi di seputaran Pasar Horas Sabtu lalu.(ral)

SIMALUNGUN– Sucipto alias Cipto (28) warga Huta IV Nagori Panambean Baru, Kecamatan Bandar Masilam dituntut 1,6 tahun penjara. Terdakwa terbukti secara sah dan meyakinkan melakukan tindak pidana penipuan dan penggelapan uang hasil penjualan sawit sebanyak 8,3 ton sebesar Rp11,620 juta. Hal itu disampaikan Jaksa Penuntut Umum, Sanggam Siagian di hadapan majelis hakim Ramses Pasaribu beranggotakan Monalisa dan Gabe Doris di PN Simalungun, Senin (3/9). Menurutnya, berdasarkan keterangan saksi dan terdakwa di persidangan terungkap perbuatan terdakwa melanggar pasal 372 KUHPidana. “Peristiwa itu berlangsung Senin (12/12) sekira pukul 12.30 WIB di Huta V Nagori Pematang Kerasaan. Saat itu terdakwa menghubungi saksi korban Susilo dan menawarkan agar terdakwa menjualkan sawit milik korban yang baru dipanen. Kemudian terdakwa menawarkan harga sawit yang akan dijual Rp1.400 per kg,” sebutnya. Dia menerangkan, terdakwa juga berjanji akan membayarkan langsung uang

penjualan itu usai di timbang di PKS Kerasaan. Mendengar itu korban pun tertarik dan akhirnya anggota terdakwa datang kerumah korban dan mengangkat sawit milik korban berjumlah 8,3 ton. Selanjutnya, setelah sawit dibawa, korban pun langsung menanyakan soal pembayaran kepada terdakwa. Kemudian terdakwa menyuruh korban untuk bertemu di Perdagangan. Akan tetapi setelah korban datang ke Perdagangan terdakwa tidak berada di tempat yang dimaksud. “Kemudian korban pun menghubungi terdakwa dan saat itu terdakwa mengatakan agar pembayaran dilakukan di rumahnya di Huta IV Mandaroh Nagori Panambean Baru, Kecamatan Bandar Masilam. Akan tetapi karena korban masih punya pekerjaan lainnya, Susilo menyuruh adiknya Yono untuk mengambil uang hasil penjualan sawit sebanyak Rp11,620 juta,” ungkapnya.

Sambung Sanggam, setelah adik korban datang ke rumah terdakwa justru terdakwa memberikan satu unit mobil Kijang Innova sebagai boroh penjualan sawit itu. Karena merasa curiga korban pun mendatangi keluarga terdakwa dan menanyakan siapa pemilik mobil tersebut. Kemudian keluarganya itu mengaku bahwa mobil itu dirental oleh terdakwa. “Korban pun langsung mendatangi terdakwa dan mengembalikan kunci mobil tersebut. Selanjutnya korban meminta uang hasil penjualan sawit miliknya. Akan tetapi terdakwa hanya memberikan panjar atas penjualan sawit miliknya sebesar Rp3 juta. Korban pun tidak menerima karena merasa ditipu oleh terdakwa,” jelasnya. Untuk hal memberatkan perbuatan terdakwa meresahkan masyarakat khususnya saksi korban. Sementara hal meringankan terdakwa bersikap sopan di persidangan, berterus terang, mengku salah dan berjanji tidak mengulanginya kembali. Untuk itu jaksa memutuskan menuntut terdakwa 1,6 tahun penjara dikurangi selama masa tahanan.(mua)

Tidur di Mapolsek Coba Bunuh Diri

„ Cewek depresi MEDAN- Sungguh kasian nasib perempuan yang depresi satu ini, bagaimana tidak sudah dua hari cewek depresi ini menginap di Polsek Medan Sunggal, sejak Sabtu (1/9) dan merepotkan jajaran Polsek Sunggal. Sebut saja namanya Bunga (19), cewekberparasmanisinijikadisaksikan sekilas tidak tampak jika dirinya depresi atau stress. Namun jika terus-terusan diperhatikan maka akan tau jika cewek ini stres karena sering tertawa dengan sendirinyadanmenangissertamenyebut-nyebut lelaki dan sering berteriak tak menentu. Dugaan sementara, cewek strees berkulit bersih ini diperkosa. Hal ini terbukti dari ocehan si

cewek strees ini. “Jangan sentuh aku, jangan buka celanaku, sakit anuku,” ujar Bunga. Bukan hanya itu, Bunga juga sering memandang ke atap dan dan berceloteh dengan logat Aceh. Polsek Medan Sunggal sendiri kerepotan dengan tigkah si Bunga, apalagi Bunga tidak mau makandanminumhanyaterdiam dan tertawa sendiri. Dankejadianyangpalingmenghebohkan ketika Bunga berlari ke jalan depan Polsek Medan Sunggal dan mencoba bunuh diri denganberdiriditengahjalandanhampir di tabrak tronton. “Bingung kita untuk menanganinya, tadi hampir mati dia ditabrak truk,” ujar Kasi humas Polsek Medan Sunggal. Setelah ditenangkan akhirnya Bunga mau dibujuk. Kejadian ini membuat macet ruas jalan dan heboh warga yang berdatangan untuk menyaksikan pertunjukan percobaan bunuh diri. “Ngeri juga Polsek Sunggal ya melihara orang gila,” ujar warga yang menyaksikan. RencananyaBungaakandikirim keDinasSosialolehPolsekSunggal dan Polsek Sunggal akan menyelidiki asal usul cewek depresi tersebut. “Kita cari dululah keluarganya dannantikitakirimkedinassocial,” ujar Kasi Humas Polsek Sunggal. (mri/pmg)


Terus Diteror dan Dintimidasi Hertati Berniat Tidur di Polres TIGA DOLOK– Polres Simalungun didesak melakukan penyelidikan terhadap kasus yang menimpa Hertati boru Sidabutar (35) di Dusun Silimapuluh, Nagori Dolok, Kecamatan Dolok Panribuan, Simalungun yang dianiaya di kediamannya. Pasalnya korban yang berulangkali dianiaya warga kerap diintimidasi dan diteror. Akibatnya Senin (3/9), kondisi ini memeroleh reaksi keras pengamat hukum yang khawatir kasus ini akan berujung menjadi kerusuhan. Iskandar Damanik SH, Pakar Hukum asal Siantar, saat ditemui METRO, Senin (3/9) mengatakan, kondisi yang tengah dialami korban Hertati boru Sidabutar ini sangat berpeluang akan terjadinya aksi yang lebih besar lagi. ”Saya turut mengesalkan sikap Polsek Tiga Dolok yang belum berhasil mengungkap kasus ini,” katanya. Bahkan, melihat kondisi di Dusun Silimapuluh ini, Iskandar Damanik meminta agar Polres Simalungun mengambil alih kasus tersebut. Kemudian melakukan penyelidikan langsung di Dusun tersebut, bahkan laporan

yang selama ini sudah masuk ke Polsek Tiga Dolok harusnya segera ditindak lanjuti. Lalu petugas dapat melihat siapa yang menjadi aktor dan dalang dari kerusuhan warga ini. ”Dari laporan–laporan korban harusnya Polsek Tiga Dolok bisa menyelidiki siapa dalang dibalik aksi ini, sebab saat kejadian saksi di lokasi tidak ada. Sementara bukti kerusakan rumah sudah jelas. Sementara korban menyebutkan, pelakunya merupakan seluruhnya warga sekitar baik sebagai eksekutor maupun hanya mendukung saja,” katanya. Ia mengatakan, tidak adanya saksi dalam suatu perkara yang terjadi di lokasi itu merupakan hal biasa terjadi. Menurutnya, Polsek Tiga Dolok sendiri dapat mencari tahu asal kejadian lalu mencari tahu siapa provokotornya di Dusun tersebut. ”Kalau polisi bersiasat kasus ini sulit terungkap karena tak ada saksi, menurut saya posisi saksi di Pengadilan hanya sebagai pelangkap. Namun jika ditemukan bukti yang jelas atas perusakan itu maka polisi harus mencari tahu dulu siapa dalangnya. Kemudian diinterogasi apakah ada tujuan

tertentu dibalik semua ini,” katanya. Korban Akan Tidur di Mapolres Simalungun Keluarga korban Hertati boru Sidabutar berniat akan melakukan aksi tidur di pelataran Mapolres Simalungun, Jalan Siantar-Raya. Pasalnya korban dan keluarganya ini merasa sudah tidak aman lagi tinggal di kediamannya di Dusun Silimapuluh, Nagori Dolok, Kecamatan Dolok Panribuan, Simalungun. Sementara pelaku penganiayaan terhadap dirinya selama ini dianggapnya seperti kebal hukum, karena masih tetap bebas berkeliaran hingga ia dan keluarganya akan tidur di pelataran Mapolres Simalungun agar lebih aman. E Damanik (60), abang ipar korban yang ditemui METRO, di Tiga Dolok ini menyebutkan, selama ini ia adik iparnya ini kerap mendapatkan teror dari warga sekitar yang tidak terima dengan keberadaan korban di kampung tersebut. Menurutnya, aksi ini merupakan aksi terorganisir dan dikendalikan oleh satu orang yang diklaim ingin menguasai ladang milik Jusen Damanik (52),

suami korban yang masih menjalani persidangan di Pengadilan Negri Simalungun atas kasus penganiayaan tetangganya saat akan membela istrinya. ”Kami sekeluarga sudah lelah mengusut kasus ini dan mencari keadilan, sementara adik ipar kami sudah terancam keselamatannya di Dusun Silimapuluh. Itu makanya supaya aman, dalam waktu dekat ini, kami akan tidur di pelataran Mapolres Simalungun supaya Kapolres Simalungun tahu apa keluhan kami ini,” katanya. Dijelakannya, kejadian penganiayaan tersebut pertama kali terjadi Minggu (19/12) sekira pukul 10.00 WIB suami Hertetani boru Sudabutar, yaitu Jusen Damanik (52),warga Dusun Silimapuluh, Nagori Dolok, Kecamatan Dolok Panribuan, Simalungun dianiaya Ropian Silalahi (30), Kaiman Samosir (29),dan Esron Simarmata (27), tetangganya tanpa sebab yang jelas. Berselang beberapa bulan kemudian, kejadian yang sama terjadi lagi, kali ini menimpa istrinya Hertati boru Sidabutar

(35), yang dipukuli Roidin Situmorang (35), tetangganya pada Selasa (1/11), 2011 di kediaman Mutiara boru Pardede yang berada tak jauh dari kediamannya. Penganiayaan itu mengakibatkan korban mengalami luka berat. Namun setelah dilaporkan dan diterima oleh Bripka S Lubis Ka SPK B Polsek Tiga Dolok ini, pelakunya belum juga diringkus bahkan penyelidikan terkesan lamban. Marasa kebal Hukum, warga sekitar Dahlan Simanjuntak (50), kembali menganiaya korban di samping kediaman korban pada Jumat (8/6), sekira Pukul 22.00 WIB. Penyebabnya pelaku tidak terima ditegur korban yang memintanya untuk mengurangi suaranya saat bernyanyi di samping rumahnya, hingga korban merasa terganggu. Namun karena kesal selanjutnya tersangka langsung memukul korban hingga luka berat. Kapolsek Tiga Dolok AKP Wilson Harianja, saat dihubungi METRO, Senin (3/9) belum berhasil dikonfirmasi meskipun terdengar nada panggilan masuk namun pihaknya enggan mengangkatnya. ( mag-02)


4 September 2012

Inalum Layak Dikelola Pemerintah

Marlon: Kalau Merugikan, Lebih Baik TPL Hengkang

Sambungan Halaman 1 Pemkab Batubara harus membeli saham PT Inalum demi kesejahteraan masyarakat Batubara. “Bila penting, demi kesejahteraan rakyat, Pemkab Batubara harus membeli saham Inalum,” katanya. Terpisah Kabag Pengembangan Sumber Daya Alam dan Aset Pemkab Batubara Jhon Viktor Nababan SE MM ketika dimintai pendapatnya, mengaku tidak berkomentar atas peralihan dan pengembangan pengelolaan jika PT Inalum dikelola Pemkab Batubara. Sebab, dia yakin pemerintah pusat tidak akan melepaskan aset itu begitu saja. (CK-1)

SIMALUNGUN- Protes demi protes terus berdatangan dari para tokoh dan pemerhati atas keberadaan PT Toba Pulp Lestari (TPL). Mereka meminta agar sebaiknya perusahaan pengolahan bubur kertas ini hengkang dari tanah Batak jika memang tidak menguntungkan masyarakat sekitar. Hal itu disampaikan tokoh masyarakat asal Simalungun Marlon Purba, Senin (3/ 9) melalui selularnya. Kepada METRO, Marlon mengaku sudah merasa gerah atas kehadiran PT TPL yang dianggap tidak ada memberikan nilai lebih bagi kesejahteraan masyarakat sekitar unit usaha. “Kehidupan masyarakat di daerah sekitar usaha PT TPL tetap miskin. Tidak ada kelihatan kesejahteraan bagi masyarakat yang tinggal di sekitar TPL, padahal tanah Batak telah dimanfaatkan sesuka mereka,” kesal Marlon. Pria yang pernah duduk di DPRD Sumatera Utara yang membidangi masalah lingkungan ini menambahkan, dia sangat mendukung bila ada wacana PT TPL ditutup dan diusir dari tanah Batak. Dia juga mengharapkan agar pemerintah jeli dalam melihat operasional PT TPL dan hendaknya tegas dalam menindak perusahaan yang tidak ada manfaatnya, malah merusak tanah mayarakat. “Tanah kita dihisap, dikuras, tanpa ada timbal baliknya. Kalau memang begitu, ya lebih baik diusir,” ujar Marlon. Masih kata pria berpostur tinggi besar ini, dia juga mengaku tidak yakin atas pernyataan pihak PT TPL yang mengatakan bahwa mereka melaksanakan seluruh prosedur dalam melaksanakan proses operasionalnya. “Saya tidak yakin semua itu. Kalau memang mereka bertindak sesuai prosedur, masyarakat tidak mungkin marah. Masyarakat kan marah karena mereka merasa dirugikan. Makanya pemerintah harus benar-benar peduli akan kesengsaraan masyarakat karena tindakan PT TPL ini,” ujarnya. Sebelum Marlon, banyak kalangan di seluruh Sumatera Utara dan Indonesia secara umum serius membincangkan soal kerusakan kelestarian Danau Toba. Seluruh perusahaan yang menyebabkan

2012, Pemkab Batubara Tak Menerima CPNS Sambungan Halaman 1 Kepegawaian Daerah (BKD) Batubara Saut Siahaan SE kepada METRO, Senin (3/9) menerangkan, bahwa penerimaan dan pengangkatan CPNS untuk tahun 2012, tidak dilakukan karena anggaran untuk seleksi CPNS tidak dianggarkan dalam APBD. Selain itu, pemkab beranggapan untuk sementara perekrutan dan pengangkatan CPNS tidak perlu dilakukan. Terpisah, Mila (26) guru honorer di salah satu sekolah mengaku kecewa dengan kebijakan Pemkab Batubara yang tidak melakukan pengangkatan CPNS dari honorer dan tenaga sukarela.(CK-1)

102 Lolos Seleksi, Calon Praja IPDN Sambungan Halaman 1 daerah Batubara, Asahan, Tanjungbalai, Labura, Labuhanbatu dan Labusel (lihat tabel). Kepala Badan Kepegawaian Daerah (BKD) Provinsi Sumut (Provsu), Suherman mengemukakan hal itu kepada wartawan, di Kantor Gubsu di Medan, Senin (3/9). Suherman menjelaskan nama-nama yang lulus ujian seleksi akademis ini lah yang berhak untuk mengikuti Wawancara Penentuan Akhir (Pantukhir) di Kampus Institut Pemerintahan Dalam Negeri, Jatinangor, Jawa Barat, sesuai dengan jadwal melapor yang telah ditentukan. Kelulusan ini, lanjutnya, berdasarkan Surat Keputusan Mendagri No.892.1-585 Tahun 2012 Tanggal 30 Agustsu 2012, yang telah menetapkan calon praja yang dinyatakan lulus seleksi akademis pada seleksi penerimaan calon PRaja IPDN Tahun Ajaran 2012/2013. “Peserta yang mengikuti Test sebanyak 518 orang, yang dinyatakan lulus seleksi akademis sebanyak 102 orang,” ulangnya. Daftar nama calon PRaja IPDN yang dinyatakan lulus seleksi dapat dilihat di website pemprovsu yaitu atau di BKD Kabupaten/Kota se-Sumatera Utara. Kepada Calon Praja IPDN yang namanya tertera pada lampiran SK Mendagri dimaksud untuk melapor/pengarahan di Badan Kepegawaian Daerah Provsu Kantor Gubernur Sumatera Utara Jalan Diponegoro No.30 Medan, pada Rabu (5/9) pukul 09.00 WIB dengan membawa Kartu Nomor Ujian Asli. Sehubungan dengan ini, Pelaksana Tugas (Plt) Gubsu melalui Sekdaprovsu, Nurdin Lubis telah menyurati para bupati dan walikota se Sumut melalui Surat Edaran (SE) No.800/17704/BKD/III/2012 Tanggal 3 September 2012 agar juga memberitahukan kepada calon praja IPDN yang namanya dinytakan lulus agar melapor ke BKD Sumut sebagaimana jadwal yang telah diatur.(ari/ smg)

Sambungan Halaman 1 berada di kolong jembatan. Selanjutnya, warga langsung melaporkan ke Polsek Porsea. Ternyata benar, begitu polisi tiba di TKP langsung membuka karung dimaksud. Spontan warga geger begitu melihat isi karung tersebut sesosok manusia. Untuk penyelidikan lebih lanjut, mayat tersebut di bawa ke Rumah Sakit Umum Daerah (RSUD) Porsea. Menurut dr Freddy Sibarani yang bertugas di RSUD Porsea, dilihat dari kondisinya, mayat ini sudah dibuang sekitar sebulan. “Sepertinya mayat ini sudah dibuang sekitar sebulan lalu,” kata dr Freddi Sibarani saat memeriksa mayat Mr X di ruang mayat RSUD Porsea. Kapolres Toba Samosir AKBP Budi Suherman yang ditemui METRO di sekitar ruang mayat RSUD Porsea mengatakan, Mr X dipastikan korban pembunuhan. Pasalnya,

Sambungan Halaman 1

Asal Labusel

9. 02290006 Rizky Sanjaya Nasution Labusel

Selanjutnya, warga melaporkan penemuan tersebut kepada polisi. Dan, langsung melakukan olah tempat kejadian perkara (TKP). Polisi memeriksa tubuh korban yang sudah kaku dan diduga telah meninggal di bawah 6 jam. Kemudian polisi membawa tubuh pria tersebut ke ruang mayat RSUD Psp untuk memastikan apakah pada tubuh korban ditemukan tanda-tanda kekerasan. “Dari tubuh korban tidak ditemukan

Adapun ciri-ciri Mr X tersebut sebagai berikut, tinggi badan lebih kurang 150 centimeter, kepala bagian depan botak dan rambut ikal. Mr X ketika ditemukan mengenakan pakaian tiga lapis yakni dibagian luar jaket warna biru bermerek Denimologi, kemeja liris kotak warna biru dongker, memakai kaos dalam, dan celana dalam warna biru, ikat pinggang merek AX, sandal merek carvil, topi warna biru, gigi depan dua ompong namun tidak dapat dipastikan apakah kedua gigi tersebut sudah demikian keadaannya sebelum dibunuh. Pada kesempatan itu, ia mengimbau kepada masyarakat jika ada kehilangan keluarga dengan ciri-ciri di atas agar melihat mayat tersebut ke RSUD Porsea. “Bagi warga yang merasa kehilangan seperti ciri-ciri yang saya sebutkan tadi, silahkan mendatangi RSUD Porsea,” imbaunya. (bram/des)

identitas apapun, hanya buntalan kain berisi pakaian dan nasi kotak di dalam plastik hitam. Pria ini memiliki tinggi 1,61 meter dan usia diperkirakan 40 tahunan,” terang AKP Indra. AKP Indra menambahkan, pihaknya menduga pria tersebut tuna wisma. Diduga, ia meninggal karena kelaparan dan kedinginan. “Tidak ada ditemukan tandatanda penganiayaan di tubuh pria ini. Diduga meninggal karena kelaparan dan kedinginan. Kita masih mencari tahu

identitas pria ini,” ucapnya. Sementara itu, menurut warga sekitar, pria ini datang ke lokasi sekitar dua minggu lalu dan mengaku dari Maga, Kabupaten Mandailing Natal (Madina). “Sekitar dua minggu yang lalu, dia ngakunya dari Maga, Madina. Dan sudah dua minggu ini tidur di pinggir jembatan itu. Melihat kondisinya kami menduga sakit disentri, karena waktu datang dua minggu lalu, sudah sakit dan tidak bisa berjalan. Kami juga pernah memberinya makan,” ujar warga sekitar. (phn)


11. 02300009 Wahyyu Pratama


12. 02070011

Arief Kurniawan Siregar


13. 02070021 Ikhsan Alpi Sahri Siregar


Sambungan Halaman 1

14. 02070032

Nora Wahyuni


15. 02070037

RR Putri Yunda Rambe


Salah seorang kepala SMP kepada METRO menuturkan, pihaknya diharuskan menyetorkan dana Rp1 juta hanya untuk mengantarkan laporan SPJ rehab sekolah ke Jakarta. “Inikan


Anggota SPS No.: 438/2003/02/A/2007

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

membangun SPBU non subsidi di daerah Pardinggaran Kecamatan Bonatua Lunasi. “Sekarang masih tahap pengerjaan. Jika sudah selesai maka seluruh pengguna BBM non subisidi mengisi ke sana,” tambahnya. Robet mengungkapkan, tahun ini, satu SPBU akan melayani BBM jenis pertamax. Fasilitas pelayanan pertamax direncanakan di SPBU 14.223.305 Hutabarat di Jalan Balige-Tarutung. “Intinya kita bentuk tim dulu dan melakukan koordinasi dengan pihak kepolisian, Kodim, Satpol PP dan pertamina,” tandasnya. Koordinator wilayah SPBU Pertamina untuk enam kabupaten, Aris mengatakan, untuk tahap pertama, Balige akan melayani BBM jenis pertamax tahun ini. Untuk sementara, pertamina akan menyediakan 40 mobil tangki berisi 6.000 kilo liter yang akan diparkir di sejumlah SPBU. Untuk Tobasa, SPBU yang menyediakan BBM non subsidi direncanakan di SPBU Hutabarat dan Trisno Pangaribuan yang berada di Pardinggaran. Terpisah, pengawas SPBU 14.223.305 Hutabarat, Hotman Marpaung mengatakan kesiapan mereka untuk menjual BBM non subisidi. Area SPBU masih memungkinkan untuk dibangun fasilitas untuk BBM non subsidi. Bahkan, kata Hotman, pihaknya telah menyediakan tangki khusus untuk menjual pertamax berisi 36.000 ton. Namun, karena pasokan pertamax dari pertamina tidak diperoleh, maka sementara tangki tersebut diisi premium. “Pompa nomor 3 sudah kita siapkan jauh sebelumnya untuk penjualan pertamax, tapi karena tidak memperoleh pertamax akhirnya dipakai untuk premium,” katanya. Hotman mengaku belum menjalankan isi Permen ESDM tersebut lantaran masih belum tersedianya fasilitas. Kasat Reskrim Polres Tobasa AKP Robert Sembiring ketika dikonfirmasi melalui ponselnya mengaku belum membaca Permen ESDM tersebut. Oleh karena itu, pihaknya belum bisa mengambil tindakan hukum. (spy/ara/hsl/cr-03/tob)

Ditabrak BUS Altra Mobil Yaris Masuk Jurang Sambungan Halaman 1 pukul 16.00 WIB. Edi warga Sibayak yang melihat kejadan itu, menceritakan sebelum peritiwa terlihat mobil Yaris melintas dari arah Medan menuju arah Baganbatu. Tiba-tiba dari arah berlawanan, Bus Altra mendahului beberapa truk dan tepat di lokasi kejadian, langsung menabrak mobil Yaris. Amril (33), warga Bagan Batu supir mobil Yaris kepada METRO menuturkan, dia mengendarai mobil dengan kecepatan sedang. Tiba-tiba dari arah berlawanan muncul Bus Altar, sehingga dia tidak bisa mengelakkan tabrakan. “Bus itu langsung menabrak bagia mobil, sehingga terpelanting ke jurang dekat sawah-sawah,” katanya. Sementara, warga yang melihat kejadian itu langsung berhamburan ke lokasi kejadian, untuk memberikan pertolongan. Namun tidak diketahui, setelah tabrakan terjadi, supir bus langsung melarikan diri meninggalkan bus dan penumpangnya. Diketahui, 5 penumpang bus mengalami luka ringan dan langsung melanjutkan perjalanan menaikan bus lainnya. Kapos Lantas Pulau Raja Aiptu Maradun didampingi Aipda M Damanik ketika dikonfirmasi, membenarkan peristiwa itu. Namun, pihaknya sudah tidak ada menemukan penumpang bus di lokasi dan pihaknya mengamankan Bus Altra dan mobil Yaris.(sof)

24 Kepala SMP Dipungli Rp1 Juta

10. 02290007 Zainul Ihsan Harahap

Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

seluruh bagian wajah korban dilakban. ”Seluruh bagian wajahnya ditutupi pakai lakban warna kuning dan dilehernya ditemukan kawat jeratan, kemudian kedua kakinya diikat pakai lakban juga. Maka dipastikan, korban merupakan pembunuhan,” kata Kapolres yang juga didamping Kasat Reskrim AKP Robert Sembiring, Kapolsek Porsea AKP Manson Nainggolan. Kapolres mengatakan, mayat tersebut diyakini bukan warga Tobasa melainkan kiriman dari luar Tobasa. “Kita katakan demikian karena kita tidak ada menerima laporan dari masyarakat yang merasa kehilangan anggota keluarganya. Selanjutnya kita akan adakan penyelidikan dan penyidikan dan mayat akan dibawa ke Pematangsiantar ke bagian forensik. Sampai besok kita tunggu dulu apakah ada laporan masyarakat yang kehilangan anggota keluarga,” ujarnya.

Pria Berkain Sarung Tewas Kelaparan

Sambungan Halaman 1

16. 02070042 Yusrica Mawaddah

bahwa dilema kenaikan harga bahan tambang akan muncul jika Permen tersebut diterapkan. “Jika pengusaha angkutan tambang terpaksa harus mengisi BBM non subsidi, maka dilemanya akan ada. Harga hasil tambang seperti galian C akan dinaikkan. Tentu hal itu akan berdampak luas, khususnya bagi pembangunan daerah,” tukas Minrod. Meski demikian, sambung Minrod, pihaknya akan berkoordinasi dengan Dinas Pertambangan dan Energi Sumatera Utara untuk mempertanyakan penerapan Permen ESDM tersebut. “Jadi, bisa saja khusus untuk bahan tambang ada aturan khusus, semisal tipe jenis bahan tambang galian A, B atau C,” pungkasnya. Sebelumnya, Humas PT TPL Lambertus Siregar saat dihubungi METRO melalui ponselnya, Jumat (31/8) lalu mengatakan, pihaknya menyerahkan penggunaan BBM non subsidi tersebut kepada pengusaha truk pengangkut kayu milik TPL. “Kita serahkan kepada pengusaha mitra kita saja dan pemerintah,” kata Lambertus. Ditanya apakah pihaknya sudah mensosialisasikan Peraturan Menteri ESDM tersebut, Lambertus mengaku, sebagian pengusaha truk mitra TPL sudah diberitahukan. “Sebagian sudah kita beritahukan, tapi masih sebatas pemberitahuan lisan,” katanya. Sementara itu, Kepala Bagian Perekonomian Pemkab Tobasa Robet Hutajulu, Senin (3/9) mengatakan, Pemkab belum membuat kebijakan terkait pelarangan tersebut. Pemkab masih menunggu perkembangan pembangunan SPBU yang menjual BBM non subsidi. Diutarakannya, jika dilakukan pelarangan bagi angkutan perkebunan dan pertambangan yakni harus menggunakan BBM non subsidi sesuai Permen ESDM Nomor 12 Tahun 2012, dikhawatirkan terjadi gangguan ekonomi. “Seharusnya disertai dengan kelengkapan fasilitas di SPBU, supaya kami bisa mengambil tindakan jika diketahui melanggar,” ujar Robet di kantornya. Terkait dengan pelaksanaan Permen ini, pihaknya telah berkoordinasi dengan pertamina. Pertamina berjanji akan

Mayat Pria Membusuk Kaki Diikat, Wajah Dilakban

DAFTAR CALON PRAJA IPDN LOLOS SELEKSI No Pendaftaran Nama 8. 02290003 Lestari

kerusakan lingkungan Danau Toba agar ditutup demi kelestarian Danau Toba dan tetap menjadi kebanggaan bangsa Indonesia, dan tetap menjadi salah satu icon dunia. Sementara, Humas TPL Lambertus Siregar membantah semua tudingan itu. Dia mengaku pihaknya mempunyai AMDAL yang baik dan TPL menaatinya dengan patuh dan setia dan tetap dimonitor serta dievaluasi pemerintah dengan baik. Dia juga menyebutkan, limbah dikelola dengan teknologi ramah lingkungan dan PT TPL juga telah memeroleh ISO 14001 oleh SGS. Pakai Solar Subsidi, Truk Mitra TPL akan Ditindak Polres Humbang Hasundutan akan menindak tegas pengemudi maupun pengusaha truk angkutan kayu milik pabrik pulp (bubur kertas) PT Toba Pulp Lestari (TPL) jika tetap menggunakan BBM jenis solar bersubsidi. “Kita telah mendapat TR (telegram) dari Polda Sumatera Utara terkait Peraturan Menteri Energi dan Sumber Daya Mineral (ESDM) Nomor 12 Tahun 2012 tentang pengendalian penggunaan BBM,” ujar Kapolres Humbahas AKBP Verdy H Kalele saat ditemui METRO di Mapolres setempat, Senin (3/9). Saat dicecar terkait implementasi pelaksaan Permen ESDM tersebut, secara tegas, pihaknya akan melakukan penindakan terhadap pengemudi atau pengusaha truk jika tertangkap mengisi solar subsidi di SPBU. “Tapi sebelum kita lakukan penindakan, kita akan segera memanggil seluruh pengusaha angkutan barang hasil perkebunan dan pertambangan di daerah ini untuk sosialisasi. Jadi, tidak ada alasan lagi nantinya tidak tau aturan,” tegas Verdy. Di tempat terpisah, Kepala Kantor Pertambangan dan Energi Humbahas Minrod Sigalingging saat ditemui di kompleks gedung DPRD Humbahas mengatakan, dirinya belum mengetahui tentang keberadaan Permen ESDM Nomor 12 Tahun 2012. “Saya belum tau ada Permen itu. Nanti akan kami pelajari dulu,” ujar Minrod. Namun, saat dijelaskan terkait larangan kendaraan angkutan hasil perkebunan dan pertambangan mengisi BBM jenis solar subsidi di SPBU, sesuai pasal 6 Permen ESDM Nomor 12 Tahun 2012, Minrod menuturkan,

tidak masuk akal,” katanya sembari meminta namanya tidak dipublikasikan. Sementara itu beberapa informasi yang didapat dari sekolah-sekolah SMP yang sudah menyetorkan dana itu adalah SMP Negeri Air Batu, SMP Negeri Mandoge dan

Departemen Redaksi METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin PurbaEva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput)

SMP Negeri Tinggi Raja. Kadis Pendidikan Asahan Drs Ismail yang dikonfirmasi melalui telepon terkait pengutipan itu, menolak berkomentar dan mengarahkan konfirmasi ke Kabid Dikdas Herlis SPd. Terpisah Kabid Dikdas Herlis SPd ketika

METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ardi, Roy Amarta, Ferdinan. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

dihubungi, juga tidak bisa memberikan komentar ketika ditanyai dengan alasan di rumahnya sedang ada tamu sembari berjanji akan menelepon ulang METRO. “Maaf Dek di rumah lagi ada tamu dan nanti saya bel Dek,” jawabnya singkat.(Mar/Ing)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


SELASA 4 September 2012

Berawal Dari Bantuan Hukum Gratis untuk Rakyat Miskin Memperbaiki Printer di Medan Sambungan Halaman 8

folio F4 warna putih merek cocorde ukuran 215 x 330 milimeter di Medan. Uang palsu tersebut hendak diedarkan, sebelum tertangkap, Sabtu (1/ 9) di kawasan Bondang Air Joman menuju Tanjungbalai. Ricky dan Rudi Salam Hasibuan (25), warga Kuala Tanjung Batubara diringkus polisi bersama barang bukti sekira pukul 14.00 WIB. Dari hasil keterangan keduanya, Fikri Perdana, warga Jalan Inalum Dusun II Desa Pakam Raya Kecamatan Medang Deras, Batubara, ditangkap dari kediamannya. Dari rumah Fikri diamankan mesin

printer merek Cannon type Pixma MP 287, tinta infuse dan 3 pisau cutter merek sailor man. 1 unit sepedamotor BK4828NAF, juga diamankan. “Kami menyesal, tetapi memang belum sempat diedarkan,” kata Ricky dan Fikri. Kapolres Tanjungbalai AKBP Edward P Sirait mengatakan, ketiga tersangka melanggar pasal 244 sub pasal 245 KUHP, pasal 36 ayat 2 dan 3 UU Nomor 7 tahun 2011 tentang mata uang dengan ancaman hukuman 15 tahun penjara. “Bagi masyarakat yang dirugikan, kami harapkan segera melapor,” kata Edwar P Sirait. (ilu)

Parpol Harus Punya 50 Persen Pengurus di Kecamatan Sambungan Halaman 8

tersebut dalam acara sosialisasi yang dilaksanakan oleh KPUD Asahan, Senin (3/9) di aula Hotel Bintang Jalan Imam Bonjol, Kisaran. “Untuk partai politik yang menjadi peserta pemilu terakhir yang melewati ambang batas perolehan suara dari jumlah suara sah, ditetap sebagai peserta pemilu berikutnya,” katanya. Dijelaskannya, parti politik yang tidak melewati ambang batas harus kembali mengikuti tahapan sejak awal termasuk persyaratan kepengurusan dan keterwakilan perempuan sebanyak 30 persen. “Partai politik sekurang-kurangnya memiliki anggota 1.000 orang yang ditunjukkan dengan kepemilikan kartu anggota, memiliki kantor tetap baik di provinsi, kabupaten/kota dan kecamatan, mengajukan nama

dan lambing parpol serta menyerahkan nomor rekening dana kampanye pemilu masing-masing untuk pusat, provinsi dan kabupaten/kota,” katanya. Hadir dalam acara sosialisasi peraturan KPU, Ketua KPU Asahan Linda Sari Agustina SH, Anggota KPU Asahan Ibnu Azhar Saragih SH, Syafrialsyah SE, Ir M Yusuf Sinambela, Syafrida Rasahan SH dan Seketaris KPUD Asahan H Bactiar. Mewakili partai Amir Hakim (Golkar), Rahelna (Demokrat), Abdul Kholik Harahap (PAN), Haidir Muksin (PDI-P), Ahmad Kosim Marpaung (PKS), Jamyus Silalahi (PPP), Jhon F Sianturi (PDS), Warisno (Hanura), Syamsir Nasution (Gerindra), Mas’ad Mahdi (PKB), Asrial (PBB), Ponara Siagian (PKPB), Legimin Roy (Nasrep), Anas Pauji Lubis (Nasdem), LSM dan tokoh masyarakat. (van)

SIMALUNGUN-Mengingatbanyaknya perkara pidana yang dilakukan sebagian orang, khususnya masyarakat yang kurang mampu di wilayah hukum Simalungun, Pengadilan Negeri Simalungun menyediakan Pos Bantuan Hukum (Posbakum) yang diberikan gratis bagi mereka yang memiliki perkara pidana. Hal itu dikatakan Ketua PN Simalungun Abdul Siboro, Minggu (2/9). Menurutnya, di wilayah kerja mereka banyak terdakwa ataupun yang memiliki perkara pidana, namun tidak mampu mengeluarkan uang untuk menyewa pengacara. “Sesuai arahan Mahkamah Agung, PN Simalungun sudah menyediakan Posbakum secara gratis. Sementara biaya untuk pengacara yang siap melayani ataupun membantu proses hukum pada saat persidangan, akan ditanggung Negara,” paparnya. Dia menerangkan, tak dapat

disangkal lagi di Simalungun ini umumnya, masyarakat berprofesi sebagai petani. Selain itu banyak di antara mereka yang buta terhadap hukum,hinggaPosbakumdimanfaatkan untuk memberikan pelayanan bantuan hukum secara cuma-cuma. Tetapi ada beberapa persyaratan yang haris dilengkapi untuk mendapatkan pelayanan. “Yakni surat gugatan atau surat permohonan, surat keterangan tidak mampu yang dapat diperoleh dari lurah setempat. Kemudian surat pernyataan tidak mampu yang ditandatangani si pemohon dan Ketua Pengadilan,” paparnya. Sambungnya, mereka yang berperkara berhak melakukan konsultasi hukum untuk berbagai perkara. Selanjutnya bantuan untuk memperoleh layanan pengacara, serta bantuan untuk memperoleh pembebasan biaya perkara. Sementara bagi terdakwa yang

melakukan tindak pidana dengan ancaman hukuman lebih dari 5 tahun penjara, berhak mendapatkan bantuan hukum gratis juga. “Tapi itu tergantung kepada pihak yang berperkara. Sebab ada saja terdakwa yang tidak ingin didampingi pengacara, meski secara gratis. PN Simalungun tetap menyediakan pengacara prodeo yang gajinya diperoleh dari Negara,” jelas Siboro. Sementara bagi terdakwa yang ancaman hukumannya sampai 15 tahun ke atas, namun tidak bisa menghadirkan pengacara, PN Simalungun akan langsung menghunjuk penasehat hukum gratis. “Biasanya itu diberlakukan untuk kasus pencabulan, pembunuhan dan lainnya. Anggaran untuk ini yang dikeluarkan negara pada 2011 mencapai Rp180 juta. Sementara untuk tahun 2012, sebesar Rp100 juta. (mua/hez)

Empat Pengurus Kwarcab Pramuka Asahan Dipecat Sambungan Halaman 8

tiga staf pegawai di kantor Kwarcab Pramuka Asahan di Kelurahan Mekar Baru, Kecamatan Kisaran Barat tidak sesuai prosedur dan dianggap sebagai tindakan semena-mena. Dijelaskannya, sebagai kepala Sekretariat Kwarcab yang bertanggungjawab dalam bidang administrasi, dirinya juga menjabat sebagai Sekretaris Gerakan Pramuka Kwarcab Asahan demisioner, dimana kepengurusan akan berhenti jika telah dilantik pengurus yang defenitif. “Amir Hakim (ketua kwarcab terpilih, red) belum memiliki keabsahan untuk melakukan pemecatan, karena belum menjalani tahapan sesuai AD/ART yakni pengesahan, pengukuhan dan pelantikan,” katanya. Ditambahkannya, Amir Hakim harusnya disahkan kemudian dikukuhkandandilantikolehKepala Gerakan Pramuka Kwartir Daerah Provinsi Sumatera Utara, bersama pengurus lain yang dipilih oleh formateur bersama Amir Hakim. Kepengurusan bersifat kolektif

kolegial. “Kami sedang menyusun surat protes yang akan disampaikan ke Kwarda Provinsi Sumut, agar diketahui telah terjadi pelanggaran AD dan ART yang dapat mengancam kemajuanGerakanPramukaKwarcab Asahan ke depan. Gerakan Pramukajugamemilikiaturanyang sangat demokratis dan bukan diktator dan terlebih kediktatoran tersebutmenyalahiperaturanyang ada pada tubuh pramuka itu sendiri,” terang Basuki. Sementara tiga rekan Basuki, yakni Suwarno, Rudi Santoso Marpaung dan Zulfawati mengaku tidak ada surat peringatan tertulis maupun peringatan lisan sebelum surat pemberhentian diberikan. “Kami tidak ada peringatan tertulis sebelumnya tentang kesalahankami,tiba-tibakamidiberhentikan dengan surat menggunakan kopGerakan Pramuka Kwarcab Asahan. Bila memakai kop surat tersebut mestinya ada Sekretaris yang menandatanganinya dan bukan ketua saja, sebab Gerakan Kwarcab Asahan punya Sekretaris dan itu diatur dalam administrasi,” ujar Suwarno.(van)

Dua Polisi Humbahas Diamankan Sambungan Halaman 8


DIMUSNAHKAN- 219 botol miras senilai Rp70 juta, dimusnahkan di halaman Mapolres Pematangsiantar, Senin (3/9).

Pertama kali ditangkap adalah Briptu Surya Dharma. Saat itu dia menjual 145 gram sabusabu kepada petugas yang menyamar. Surya mengaku barang ilegal itu dia dapat dari Briptu Amrul. Oknum polisi ini pun ditangkap. “Amrul mengaku mendapat dari Zulham. Dari tangannya kita sita airsoft gun jenis revolver dengan 6 butir peluru. Seorang lagi masuk dalam DPO yaitu Fauzi. Zulham mengaku mendapat sabu-sabu dari dia,” jelas Andjar. Penangkapan Briptu Amrul membuat Direktorat Reserse Narkoba Polda Sumut tidak kehilangan uang tunai Rp 140 juta. Sebab, sehari sebelumnya uang itu dilarikan Amrul ketika transaksi undercover buy berlangsung. Ketiga tersangka dikenakan

pasal pengedar. Briptu Surya Dharma dan Briptu Amrul pun bisa dipecat jika terbukti bersalah. “Kita sudah koordinasikan kasus ini ke Propam, juga ke Kapolres Humbang Hasundutan, bahkan ke Kapolda,” jelas Andjar. Dalam kasus terpisah, Direktorat Reserse Narkoba Polda Sumut juga menangkap dua pengedar narkoba dari Binjai. Kedua tersangka yang diringkus masing-masing Erwin Chandra dan Budi alias A Wi. Keduanya ditangkap di Jalan Seroja, Perumahan Seroja Permai, Sunggal Medan, Minggu (2/9). Mereka juga ditangkap setelah bertransaksi dengan petugas yang menyamar. Dari tangan keduanya disita 80 gram sabusabu. “Dalam kasus ini kita masih memburu bandarnya seorang perempuan, dengan nama panggilan Kakak, warga Binjai,” pungkas Andjar. (dtk)

Miras Senilai Rp70 Juta Dimusnahkan Kistim Juara Gerak Jalan, Pulau Rakyat SKJ Mohon Pemasangan Jaringan Listrik Sambungan Halaman 8

Sambungan Halaman 8

Haornas melibatkan pihak ASIAFI, POMI di bawah koordinasi guru olahraga. “Kita mengundang 25 kecamatan, tetapi 5 diantaranya tidak hadir yakni Kecamatan Rawang Panca Arga, Silau Laut, Air Batu, Sei Kepayang Timur dan Bandar Pulau. Kami sangat menyesalkan hal ini, dan sangat berharap kepada Bupati Asahan agar memberikan teguran

keras, agar ke depan hal ini tidak terjadi lagi,” katanya. Hasil kejuaraan lomba gerak jalan Kecamatan Kisaran Timur nilai 2693 meraih juara I, juara II Kecamatan Air Joman nilai 2630, juara III Kecamatan Meranti. Untuk lomba senam kesegaran jasmani (SKJ) juara I Kecamatan Pulau Rakyat nilai 2008, juara II Kecamatan Sei Dadap, juara III Kecamatan Sei Kepayang Barat. (mar)

Pematangsiantar. Sementara dari Polres Siantar, diwakili Kasat Narkoba AKP Sofyan dan puluhan personil polisi dari berbagai satuan. Turut juga hadir Ketua Front Pembela Islam (FPI) Kota Siantar Muhammad Syahril Chan. Secara simbolis, tiga botol minuman keras ini dilemparkan ke arah alat berat silinder oleh tiga orang yang mewakili kejari dan polisi. Lalu perlahan alat berat ini menggilas semua botol minuman keras yang sudah ditumpuk di aspal.

Hari Darmawan mengatakan, 219 miras ini dimusnahkan atas putusan Pengadilan Negeri Pematangsiantar Nomor 01 Pid C/2012/PN PMS tertanggal 13 Agustus 2012. Ditambahkan Hari, pemusnahan sempat tertunda dari jadwal yang ditentukan. Itu disebabkan karena suasana lebaran beberapa waktu lalu, sehingga pemusnahan baru bisa terlaksana kemadin, Senin (3/9). “Tidak ada unsur kesengejaan terkait penundaan pemusnahan ratusan botol miras ini. Miras yang dimusnahkan hari ini, sudah sesuai dengan yang

tertera di kepolisian dan kejaksaan. Tidak ada bedanya sama sekali. Saya kira tidak ada masalah dengan itu,” ujarnya. Sementara Ketua FPI Kota Siantar Muhammad Syahril Chan mengungkapkan rasa terima kasihnya kepada aparat kepolisian atas pemusnahan yang dilakukan. Mereka menghargai kinerja polisi dan berharap agar terus ditingkatkan. “Peredaran miras sudah menyeluruh di Kota Siantar, kita berharap polisi meningkatkan kinerjanya dalam pemberantasan miras,” ungkapnya. (ral/ hez)

Sambungan Halaman 8

pang menjelaskan, warga ingin PLN bersedia memasukkan jaringan, sementara untuk tiang besi yang dibutuhkan, warga bersedia untuk membeli. “Keluarga kami sangat membutuh listrik, kasihan anak-anak jika hanya mengandalkan lampu

teplok dan lilin untuk belajar pada malam hari,” kata Simatupang. Sementara Taib, petugas keamanan yang menerima permohonan mengatakan akan menyampaikan kepada atasannya. “Kami akan sampaikan, dan kami juga yakin permohonan ini akan dipertimbangkan,” katanya. (ilu)

Sambungan Metro Asahan

Bandar Sabu Pembacok Tukang Parkir Berkeliaran Sambungan Halaman 1 hari ini nyaris belum ada perkembangan berarti menyangkut kasus yang menimpa suaminya. Bahkan, hingga saat ini Marnaek, yang menjadi korban,belumdimintaiketeranganolehpolisidan pelaku masih terlihat berkeliaran di kawasan Kisaran.“Suamisayabelumdiperiksasamapolisi,” kata Ramayanti. Menurut Ramayanti, setelah 2 minggu berlalu, dirinya mulai merasa seolah tidak dianggap oleh pihak penegak hukum, dalam upayanya menuntut keadilan atas tindak pidana penganiayaan yang menimpa suaminya. Belum lagi, beberapa waktu belakangan, dirinya mendengar isu, bahwa kasus yang menimpa suaminya tidak akan dituntaskan karena AB mempunyai koneksi kepada sejumlah oknum polisi. “Aku dapat informasi, katanya si AB itu

TAK MENOLAK DIJODOHIN USTAD Sambungan Halaman 1 Sebetulnya tdk sepemilih itu cuman yang simpel aja,” jelasnya. Vicky Shu membantah kedekatan dirinya dengan seorang pengusaha dan penyanyi. “Pengusaha mana? Bukan, doain aja. Ama penyanyi? Enggak, udah lewat,” jelas Vicky. Saat ditanya apa punya keinginan berpacaran dengan ustads, Vicky menyatakan tidak akan menolak jika ternyata cocok. Apalagi Vicky memang berkeinginan punya pasangan dari kalangan bukan artis. “Sama ustad ya Alhamdulillah, aku apa ajalah yang terbaik buat aku dan keluargaku. Kebetulan ada keinginan untuk yang berbeda profesi biar ada variasi,” ungkap Vicky. (abu/ jpnn)

bekawan-kawan sama oknum polisi, makanya aku sempat patah semangat juga Bang,” sebutnya. Terpisah, sumber METRO di Polres Asahan menyatakan, kasus yang menimba Marnaek terus mendapat penanganan yang serius dari pihak kepolisian. Bahkan, polisi sudah mengirimkan SPDP kepada pihak korban, sebagai bentuk informasi perkembangan kasus itu. “SPDP nya sudah dikirim, dan mungkin besok (hari ini,red) pemeriksaan

akan kembali dilakukan,” ujar sumber ini. Terkait SPDP ini, Ramayanti juga membenarkannya. Kata Ramayanti, 2 hari yang lalu, dia didatangi petugas kepolisian mengantarkan surat SPDP, bernomor B/768/VII/2012, tertanggal 25 Agustus 2012. Dalam surat yitu, pihak polisi menyatakan akan terus menangani kasus tersebut. “Tadi dihubungi lagi, katanya besok, mau diperiksa

lagi Bang, sekalian ngambil hasil visum di RSUD Kisaran. Tolonglah Bang, kami berharap, polisi segera menuntaskan kasus ini,” pintanya. Sebagaimana diberitakan sebelumnya, Marnaek Butar-butar, seorang tukang parkir, dibacok oleh seorang bandar sabu di Kampung Tengah. Marnaek, yang sehari-hari bekerja sebagai tukang parkir ini, harus mendapatkan sejumlah jahitan di kepala dan lengannya, yang

sebelumnya terluka dibacok AB, seorang pria yang dikenal sebagai bandar sabu. Sejauh ini, belum apa motif yang memicu terjadinya pembacokan tersebut. Kepada METRO saat di rumah sakit, Marnaek menceritakan, persoalan ini bermula saat dirinya datang ke kawasan Kampung Tengah menemui salahseorang rekannya. “ Aku ke sana (Kampung Tengah,red) ada urusan jumpain kawan lae,” katanya.(Ing)

Ponaryo Menahan Senyum, Jajang Sempat Gemetar Sambungan Halaman 1 lapangan hijau. Ya, dia adalah Ponaryo Astaman, mantan kapten timnas Indonesia, yang kemarin malam bergaya mengenakan kaus hitam dengan celana dilipat di bawah lutut berdampingan dengan model wanita cantik. Ponaryo tak sendirian di fashion show bertema UIFashionWeek di salah satu mal di kawasan Jakarta Selatan yang berlangsung Sabtu malam lalu (1/9) itu. Melenggang tepat di belakangnya, Jajang Mulyana. Striker tinggi besar asal klub Mitra Kukar itu juga tampak percaya diri menjadi model. Wajahnya dingin dan langkahnya di catwalk meyakinkan. Dia mengenakan kemeja kotakkotak berwarna merah dan memakai tutup kepala. Secara berurutan kemudian muncul penggawa Persela Lamongan yang dikabarkan baru saja putus dengan sang kekasih, penyanyi Pinkan Mambo, Febrianto Wijaya. Disusul pemain Pelita Jaya Riyandi ‘Angky’ Ramadhana Putra. Suasana menjadi lebih heboh ketika sosok seorang ‘model’ bule muncul mengenakan kemeja kotak-kotak merah dengan jins hitam dan sepatu putih. Dialah Simon McMenemy, eks pelatih Mitra Kukar dan timnas Filipina

asal Inggris yang dua tahun silam pernah menjadi perbincangan saat foto-foto mesranya dengan Rahma Azhari beredar di internet. Para model dadakan dari lapangan hijau masing-masing muncul dua kali di catwalk dengan mengenakan dua busana berbeda. Sebetulnya gelandang timnas Firman Utina juga dijadwalkan tampil. Tapi, karena ada musibah yang menimpa salah seorang keluarganya, Firman batal menjadi model. Para pemain dan pelatih tersebut menjadi model DEIJE a.k.a denim is jeans yang salah satu owner dan desainernya adalah mantan penggawa timnas Merah Putih Isnan Ali. Setahun terakhir, bersama dua rekannya, Raka Zaipul dan Adri Naufal, pemain yang saat ini tercatat sebagai salah seorang penggawa Mitra Kukar itu serius mengembangkan bisnis di luar lapangan bola. “Gila. Ini lebih tegang daripada melakoni pertandingan penting di lapangan hijau. Saya sangat gugup tadi sampai gemetar saat berjalan. Keringat mengucur deras,” ujar Jajang, lantas tertawa ngakak. Pemain yang pernah menimba ilmu di Brasil itu mengatakan, dirinya dan pemain yang lain sama sekali tidak berlatih dahulu sebelum berlenggak-lenggok di catwalk. “Latihannya ya cuma gladi resik sebelum

tampil. Baru kemarin saya dihubungi Isnan,” sambungnya. Lain halnya dengan Febrianto Wijaya. Pemain yang sempat menjalani latihan di klub Vfb Stuttgart (Bundesliga Jerman) itu mengaku enjoy tampil di catwalk. Febrianto mengatakan sangat tertarik dengan fashion. “Saya rasa fashion perlu juga untuk pemain bola,” katanya. Febri bahkan menyatakan bersedia jika ada yang “mem-booking-nya” kembali menjadi model. Bagaimana kesan Ponaryo Astaman? “Ini benar-benar pengalaman yang berbeda yang tidak akan pernah saya lupakan. Bayangkan saja, saya biasa tampil di lapangan, tapi tibatiba saja menjadi model di catwalk,” ujar Ponaryo. Karena yang menjadi bintang di acara fashion show adalah para pemain bola, para penontonnya pun banyak yang selama ini berkecimpung di lapangan hijau. Dalam pagelaran tadi malam, dari jajaran pemain yang tampak hadir, antara lain, Hamka Hamzah (Mitra Kukar), Rahmat Latif (Persiba Balikpapan), dan mantan pemain PSM Junior yang sempat berguru ke Ajax Amsterdam Irvin Museng. Tampak pula menyaksikan, Media Officer Persija Viola Kurniawati dan Ketua Panpel

Macan Kemayoran -sebutan PersijaHanifditya. Dia hadir bersama sang kekasih Alycia Evyta, presenter BPL di MNC TV. Dan, masih banyak lagi insan bola lainnya yang hadir. “Ini terobosan baru yang sangat menarik dan membuktikan pemain bola tidak kalah kelas dari model sesungguhnya. Tapi, saya rasa para pemain yang tampil masih kurang banyak,” ujar Viola Kurniawati. “Penampilan Ponaryo dan Simon santai walaupun terlihat dewasa,” timpal Alycia. Sedangkan Hanifditya menyatakan tak mengira Isnan Ali punya bakat terpendam di dunia fashion. “Ponaryo dan Simon terlihat percaya diri. Tenyata Isnan punya bakat terpendam,” tutur pria berkacamata itu. Isnan Ali mengungkapkan, dirinya dan rekan bisnisnya akan terus mengembangkan bisnis tersebut. Selama ini pemasaran banyak dilakukan memanfaatkan jaringan para pemain sepak bola yang bermain di kompetisi tanah air. Baik pemain lokal maupun asing. Pemasaran juga dilakukan lewat online. “Untuk model-model jins dan pakaian lainnya, kami sendiri yang menentukan,” ujarnya. (jpnn)

SELASA Edisi 205 th V

4 September 2012

Jadwal Keberangkatan Kereta Api

Kasus Rp12,5 Juta Upal Gagal Edar

Berawal dari Memperbaiki Printer di Medan TANJUNGBALAI-Dua dari tiga tersangka pengedar uang palsu senilai Rp12,5 juta yang tertangkap di Tanjungbalai, ternyata berstatus mahasiswa salah satu perguruan tinggi di Medan dan Jakarta. Mereka mengakui seluruh uang yang dicetak belum sempat diedarkan. Ricky merupakan mahasiswa salah satu perguruan tinggi di Medan sementara Fikri berstatus mahasiswa di Jakarta.


Berangkat (Tanjung)

Tiba (Medan)

KA Putri Deli

I. 06.50 WIB

11.17 WIB

KA Putri Deli

II. 12.50 WIB

17.27 WIB

KA Putri Deli III. 17.50 WIB

22.15 WIB

Sumber: Stasiun Kereta Api Tanjungbalai



Kami menyesal, tetapi memang belum sempat diedarkan.” Ricky dan Fikri


i Mapolres Tanjungbalai, Senin (3/9) ketiga tersangka mengakui perbuatannya. Berawal ketika diminta untuk memperbaiki printer komputer temannya di Medan, Ricky dan Fikri mengaku tergiur untuk mencoba mencetak uang palsu (upal) pecahan Rp50 ribu dan Rp100 ribu menggunakan kerta

„) Baca Berawal...Hal 7


„ BARANG BUKTI-Kapolres Tanjungbalai AKBP Edward P Sirait bersama tiga tersangka pengedar uang palsu, Rudi, Fikri dan Ricky ketika menggelar jumpa pers, Senin (3/9) di Mapolres Tanjungbalai.

13 Warga Simpang Empat Datangi Kantor PLN

Mohon Pemasangan Jaringan Listrik TANJUNGBALAI-Sebanyak 13 kepala keluarga warga Kecamatan Simpang Empat Kabupaten Asahan mendatangi Kantor PLN Tanjungbalai, Senin (2/ 9). Kedatangan warga ini mewakili puluhan warga di Simpang Empat yang membutuhkan jaringan PLN, karena rumah warga belum dijangkau jaringan listrik. Surianto didampingi Sela-

mat, Iryanto, Suyatno, Tumiyem, Sanuri dan seorang yang bermarga Simatupang menyerahkan berkas permohonan kepada Taib, salah seorang petugas keamanan di Kantor PLN Tanjungbalai, karena Menjer PLN Cabang Tanjungbalai Ir Khalik tidak berada di kantor. Kepada METRO, Simatu-

„) Baca Mohon ....Hal 7

B a k ombur Wak Alang: Makin rusak moral panogak hukum kito ni, katangkap pulo jual sabu di daerah kito. Wak Ongah: Iyo, harusnya mereka menangkap tersangka sabu, bukan malah mengedarkan. (**)

Edarkan Narkoba di Tanjungbalai

Dua Polisi Humbahas Diamankan MEDAN-Personel Sabhara Polres Humbang Hasundutan, Sumatera Utara diringkus tim dari Direktorat Reserse Narkoba Polda Sumut. Keduanya tertangkap tangan mengedarkan narkoba di Kota Tanjung Balai.

Dua polisi yang ditangkap masingmasing Briptu Surya Dharma dan Briptu Amrul. Selain keduanya, diringkus pula Zulham Simangusong. Ketiganya ditangkap di Jalan Arteri, Tanjung Balai Selatan, Tanjung Balai, Sumut.

“Mereka kita tangkap Kamis 30 Agustus sekitar pukul 21.10 WIB,” ujar Direktur Direktorat Reserse Narkoba Polda Sumut Kombes Andjar Dewanto, Senin (3/9).

„) Baca Dua....Hal 7

„) Baca Empat Pengurus ....Hal 7

Parpol Harus Punya Pengurus Kecamatan 50 Persen


Empat Pengurus Kwarcab Pramuka Asahan Dipecat KISARAN-Kepala Sekretariat Gerakan Pramuka Kwartir Cabang (Kwarcab) Kabupaten Asahan Drs Basuki MPd dan bersama Suwarno, Rudi Santoso Marpaung dan Zulfawati dipecat Ketua Kwarcab terpilih pada Muscab yang digelar 4 Juli 2012 lalu. Kepada METRO, Minggu (2/9), Basuki menjelaskan, pemecatan dirinya bersama

KPU Asahan Gelar Sosialisasi

„ Peserta sosialiasi yang digelar KPU Asahan saat istirahat setelah menerima penjelasan dari nara sumber.

Lahir di Jakarta, 7 Oktober 1973 adalah aktor dan penyanyi Indonesia. Mantan vokalis dari Modulus Band ini sempat bermain dalam sinetron Gerhana bersama Pierre Rolland. Setelah keluar dari Modulus Band, Ia sempat mengeluarkan album solo. (int)

Miras Senilai Rp70 Juta Dimusnahkan

KISARAN-Peraturan Komisi Pemilihan Umum (KPU) Nomor 8 Tahun 2012 mengharuskan peserta pemilu melalui tahapan-tahapan pemilu yakni pendaftaran, verifikasi dan penetapan parti politik peserta pemilu anggota DPR, DPRD Provinsi dan DPRD Kabupaten/Kota. Undangundang yang baru ini juga mengharuskan seluruh partai politik peserta pemilu memiliki kepengurusan ditingkat kecamatan kabupaten/kota minimal 50 persen dan 75 persen untuk tingkat provinsi. Anggota KPU Provinsi Sumatera Utara Turunan Gulo menjelaskan hal

SIANTAR- 219 botol minuman keras berbagai merk yang diperkirakan bernilai Rp70 juta, dimusnahkan di halaman Polres Pematangsiantar, Senin (3/9) pukul 10.00 WIB. Miras-miras ini merupakan hasil operasi pekat pada Bulan Ramadhan lalu, yang disita dari UD Makmur Jaya, di Jalan MH Sitorus, Siantar Barat. Beberapa merk ternama yang dimusnahkan, antara lain red label, balleys, gordons, martini, jose cuervo, black label, dan winner. Selain itu ada martil, civas regal dan beberapa merk minuman keras lain dari dalam dan luar negeri. Pemusnahan disaksikan jaksa fungsional Hari Darmawan dan Kasipidum R Parulian Lumbantoruan yang mewakili Kejari

„) Baca Parpol....Hal 7

„) Baca Miras...Hal 7

Kistim Juara Gerak Jalan Pulau Rakyat Juara SKJ KISARAN-Kecamatan Kisaran Timur (Kistim) berhasil meraih nilai tertinggi pada lomba gerak jalan yang dilaksanakan, Senin (3/9) Stadion Mutiara, Kisaran. Sementara untuk lomba senam kesegaran jasmani (SKJ) diraih Kecamatan Pulau Rakyat, disusul Kecamatan Sei Dadap dan Kecamatan Sei Kepayang Barat. Kasi Orkesjas Dispora Asaha

Swanto, kepada METRO menjelaskan, seluruh piagam dan tropy akan diserahkan pada puncak peringatan Hari Olahraga Nasional (Haornas) yang akan dilaksanakan 10 September mendatang, karena ( September (Haornas) tepat pada hari Minggu. Pertandingan untuk memeriahkan

„) Baca Kistim....Hal 7


„ Panitia pelaksana SKJ dan gerak jalan se-Kabupaten Asahan.

Selasa, 4 September 2012



„ Wadir Reskrimum Poldasu AKBP Mashudi memberikan keterangan penangkapan pembacok polisi kepada sejumlah wartawan, Senin (3/9). „ Warga melihat bus yang menabrak dump truk yang mengakibatkan 4 penumpang meninggal dunia, Senin (3/9).



AEKKANOPAN- Musibah kecelakaan lalulintas antara Bus Medan Jaya BK 7448 DK dan dump truk BH 8320 BO terjadi Jalinsum Asahan-Labuhanbatu tepatnya di km 228-229 di Dusun Pertanian Desa Damuli Pekan Kecamatan Kualuh Selatan Labuhanbatu Utara (Labura), Senin (3/9) sekitar pukul 01.00 WIB. Akibat insiden ini, 4 penumpang bus tewas, dan 15 orang luka-luka.


„ Dump truk yang ditabrak Bus Medan Jaya tersorong ke parit setelah ditabrak dari belakang, Senin (3/9).

„) Baca 4 Tewas,...Hal 10

2012 Tak Ada Penerimaan CPNS di Labuhanbatu NGAKU SUDAH BAYAR GANTI RUGI

RANTAU- Pemerintah Kabupaten Labuhanbatu akan kembali mengusulkan formasi perekrutan Calon Pegawai Negeri Sipil (CPNS) pada tahun 2013 mendatang. Pengusulan itu seiring dengan dicabutnya kebijakan moratorium (pemberhentian semen-

tara) penerimaan CPNS yang dilakukan oleh pemerintah pusat. “Tahun depan kebijakan moratorium dicabut dan kita baru akan kembali mengusulkan formasi penerimaan CPNS di Kabupaten Labuhanbatu,” ujar Kepala Badan Kepega-

waian Daerah (BKD) Kabupaten Labuhanbatu, Aswad, Senin (3/9). Menurut Aswad, Pemkab Labuhanbatu telah memberlakukan kebijakan moratorium penerimaan CPNS „) Baca 2012 Tak Ada ...Hal 10

Pemilik Galian C Ajak Warga Musyawarah

Poldasu Ringkus 4 Tersangka Pembacok Polisi MEDAN- Kepolisian Daerah Sumatera Utara (Poldasu) menangkap 4 pelaku penganiayaan dan perampas senjata Aiptu Satar Tampubolon. Turut diamankan satu pucuk senjata laras panjang jenis SS1-V2 seri ACF005128 yang sempat diram-

pas pelaku dari korban. Para tersangka masih diperiksa di Poldasu Jalan Medan– Tanjung Morawa, Medan, Senin (3/9). Wakil Direktur (Wadir) Reserse Kriminal Umum (Res„) Baca Poldasu ...Hal 10


„ Surat undangan pernikahan Shelly Hazlina Harahap (anak tiri Bupati Labusel, red) dan Hasanul Basry.

Surat Undangan Pernikahan Anak Tiri Bupati Labusel Diperotes AYAH KANDUNG TAK TERIMA SHELLY DISEBUT ANAK PERTAMA WILDAN KOTAPINANG- Surat undangan pernikahan Shelly Hazlina Harahap (25) dan Hasanul Basry (27) anak tiri Bupati Labuhanbatu Selatan (Labusel) Wildan Aswan Tanjung berbuntut panjang. Pasalnya ayah kandung

KOTAPINANG- Pemilik usaha galian C di Desa Huta Godang, Kecamatan Sungai Kanan, Kabupaten Labuhanbatu Selatan (Labusel) Edi Parapat (50) warga Desa Hotagudang mengaku sudah membayar ganti rugi. Bilamana ada warga yang merasa

Shelly tidak terima jika dalam undangan Shelly disebutkan kalau Shelly adalah anak pertama dari Wildan Aswan Tanjung. Ali Gaga Harahap (50) ayah „) Baca Surat ...Hal 10

„) Baca Pemilik Galian ...Hal 10

KPU Bakal Verifikasi Ulang Seluruh Parpol RANTAU – Komisi Pemilihan Umum (KPU) Labuhanbatu bakal melakukan verifikasi ulang seluruh Partai Politik (Parpol) yang akan mengikuti pemilu 2014. Verifikasi ulang seluruh parpol tersebut rencananya dilaksanakan mulai pertengahan September. „) Baca KPU Bakal ...Hal 10

PTPN 3 Diminta Desak Polisi AEKKANOPAN– Pihak perkebunan PTPN 3 di Kecamatan Kualuh Hulu Kabupaten Labura diminta mendesak polisi untuk menahan Sunarto (40) di Dusun Suka Rendah Kelurahan Aekkanopan Timur yang ditangkap mencuri Tandan Buah Segar (TBS) sawit milik „) Baca PTPN 3 ...Hal 10


„ Para pengunjuk rasa berorasi di depan kantor Bupati Labuhanbatu, Senin (3/9). Para pengunjuk rasa meminta agar Pemkab Labuhanbatu menutup SPBU Ahmad Yani Rantauprapat.

Tutup SPBU Ahmad Yani! PERMINTAAN DEMONSTRAN PADA PEMKAB RANTAU– Sejumlah aktivis yang menamakan dirinya Gerakan Muda Sumut Foundation (GMSF) melakukan aksi unjuk rasa di kantor Bupati Labuhanbatu, Senin (3/9). Mereka meminta agar Stasiun Pengisian Bahan Bakar Umum (SPBU) nomor 14.214.225 yang terletak di Jalan Ahmad Yani Rantauprapat ditutup. Permintaan aktivis tersebut karena SPBU yang baru terbakar beberapa

waktu lalu itu tidak memiliki izin ganguan/Human Ordonancy (HO) sejak tahun 2011 lalu. Koordinator aksi demo Azlansyah Hasibuan mengatakan, tidak seharusnya SPBU tersebut beroperasi kembali dengan tidak mengantongi izin ganguan. Padahal SPBU tersebut juga menjual gas. Para aktivis tersebut membeberkan, pasca terbakarnya SPBU tersebut, Pemkab Labuhanbatu telah me-

Wajah Tak Mirip, Bayi Dicekik Sekarang ini setiap orang tak suka disebut “mirip- mirip” dengan Gayus Tambunan. Tapi Gito, 22, dari Wonogiri (Jateng) justru marah besar begitu anak pertamanya sama sekali tak mirip dengannya. Dia pun lalu curiga bahwa Tatik, 20, istrinya selingkuh dengan pria lain. Bayi merah tak berdosa itu itu langsung dicekiknya hingga wasalam.

Gito dari Desa Geneng Kecamatan Bulukerto Kabupaten Wonogiri, agaknya tak pernah salat Jumat, meski dalam KTP-nya ditulis beragama Islam. Karenanya dia tak pernah dapat pencerahan dari mimbar Jumat, tak pernah mendengarkan kata-kata arif dari para khotib. Karena tak lagi mengenal batal dan haram itulah, membunuh bayi dianggap macam membunuh anak kucing saja. Padahal itu bayi merupakan darah daging sendiri. Gito sejak lama pacaran dengan Tatik, gadis dari Desa Ngroto kecamatan yang sama. Mungkin karena tetangga desa, sopir angkot ini jadi kurang tahu persis kwalitas calon „) Baca Wajah Tak ...Hal 10

layangkan surat untuk menutup SPBU tersebut. Namun kata mereka, fakta yang terjadi SPBU tersebut kembali beroperasi seperti biasa bahkan tetap menjual gas tanpa izin dari pemerintah setempat. “Kami melihat bahwa Pemkab Labuhanbatu tidak memiliki ketegasan dalam mengambil sikap dalam „) Baca Tutup ...Hal 10


„ Bupati memberikan kunci rumah kepada Samijem untuk menempati rumah barunya, Sabtu (1/9).

Janda Korban Kebakaran Tempati Rumah Baru AEKKANOPAN- Janda korban musibah kebakaran, Samijem (53) warga di Lingkungan XI Blok 80 Kelurahan Aekkanopan Timur Kecamatan Kualuh Hulu pada bulan Juli lalu menerima hadiah rumah baru dari Bupati Labura Kharuddin Syah.

Khirudin dalam sambutannya saat memberikan rumah baru kepada Samijem, Sabtu (1/9) mengatakan, rencana membangunkan kembalirumah Samijem terjadi pada bulan „) Baca Janda ...Hal 10


4 September 2012

Ada 405 Titik Api di Sumut

SALAH-SATUNYA DI LABUHANBATU MEDAN- Terkait kebakaran hutan di Provinsi Riau atau tepatnya Kota Pakan Baru, beberapa waku belakangan menyebababkan kabut asap yang menyelimuti Provinsi Jambi hingga mengakibatkan jarak pandang 800 Meter jauh dari normal yakni 2000 meter. Namun kiriman asap tersebut belum begitu berpengaruh terhadap Kota Medan. Pasalnya hingga saat ini belum tampak kepulan asap yang berpotensi mempengaruhi jarak pandang. Hal ini disampaikan Kepala Seksi Data dan Informasi BMKG Polonia Medan, Saat dikonfirmasi Minggu (2/9). “Sampai saat masih normal karena belum tampak adanya kabut asap yang mengganggu jarak pandang,”ujar Mega. Hanya saja bilang Mega, saat ini ada 405 titik api yang terdapat di seluruh wilayah Sumatera. Dimana titik api tersebut tersebar di bebrapa Provinsi diantaranya yakni Jambi Sumatera Selatan, Riau dan Sumatera Utara. “Untuk Sumatera Utara titik api terdapat di beberapa kabupaten/kota yakni Samosir, Tapanuli Tengah, dan Labuhanbatu,” ujarnya. Masih menurut Mega, jika aktifitas titik api terus bertambah di wilayah Sumatera , tidak menutup kemungkinan Medan bakal imbas asap tersebut. Sementara saat disinggung mengenai aktivitas di Bandara Polonia Medan, Mega mengaku masih berjalan normal seperti biasanya. “Sampai saat ini belum ada laporan yang kita terima mengenai adanya delay keberangkatan terkait kabut asap,” sebutnya lagi. Restu (29) salah satu penumpang Lion Air asal Medan dengan tujuan Pakan Baru, menggunakan nomor penerbangan JT 295, dengan keberangkat sekitar pukul 16.40 WIB mengaku penerbangan berjalan normal dan tidak ada pengunduran jadwal keberangkatan. “Kita berangkat tepat dan waktu, selama perjalanan juga tidak mengalami gangguan apapun,”ujar Restu saat dikonfirmasi melalui selulernya. (uma)

Labuhanbatu Tuan Rumah Kejurda Volly LABUHANBATUKabupaten Labuhanbatu dipastikan akan menjadi pelaksana sekaligus tuan rumah Kejuaraan Daerah (Kejurda) Volly Ball Putra Putri Junior tahun 2012 tingkat provinsi. Pelaksanaan tersebut direncanakan akan dimulai 14-22 Oktober 2012 mendatang. “Jika tidak ada halangan, Labuhanbatu akan menjadi tuan rumah Kejurda Volly Ball Junior,” kata Ketua Persatuan Volly Ball Seluruh Indonesia (PBVSI) cabang Labuhanbatu DR H Freddy Simangunsong MBA kepada Sumut Pos (grup koran ini, red), Senin (3/9) di Rantauprapat. Selaku ketua panitia pelaksana nantinya, pihaknya akan mengundang seluruh PBVSI se-Sumut untuk berperan serta menurunkan tim voly ball-nya dalam Kejurda itu. “Kita akan segera mengirimkan undangan ke seluruh pengurus cabang PBVSI se Sumut dan diharapkan seluruh PBVSI menurunkan timnya,” paparnya. Pelaksanaan event itu sendiri jelas Freddy, memperebutkan piala Bupati Labuhanbatu dengan tempat pelaksanaan di Gedung Olah Raga (GOR) Rantauprapat. “Ini akan kita upayakan menjadi agenda tahunan, untuk kali ini akan dibuka oleh Ketua KONI Sumut Gus Irawan,” ujarnya. Lebih jauh diterangkan Freddy, pemimpin pertandingan selama berlangsungnya event tersebut sengaja mendatangkan dari Medan. “Tujuannya melakukan seleksi atlit-atlit Volly Ball yang akan menjadi duta Sumut di tingkat nasional,” ujarnya sembari menambahkan tim Labuhanbatu patut dipertimbangkan sejalan dengan keberhasilan tim volleyball pelajar menjadi duta Sumut di tingkat nasional. (mag-16/smg)

KPU Bakal Verifikasi Ulang Seluruh Parpol Sambungan Halaman 9 “Kami akan melakukan verifikasi ulang mulai bulan pertengahan September ini sesuai dengan keputusan MK,” kata Ketua Divisi Sosialisasi KPU Labuhanbatu M Sofyan MA. Dijelaskan Sofyan, sesuai dengan Pasal 8 Ayat (1) UU Nomor 8/2012 tentang pemilu yang yang dibatalkan MK itu berbunyi, ”Partai politik peserta pemilu pada pemilu terakhir yang memenuhi ambang batas perolehan suara dari jumlah suara sah secara nasional ditetapkan sebagai partai politik peserta pemilu pada pemilu berikutnya.” Sedang Pasal 208 yang dibatalkan adalah pemberlakuan ambang batas 3,5 persen secara nasional dan menyatakan ambang batas 3,5 persen hanya berlaku untuk DPR. Dengan pembatalan MK itu, katanya, berarti seluruh partai politik baik lama maupun baru, memiliki kursi di parlemen atau tidak, harus mengikuti verifikasi di KPU untuk jadi peserta Pemilu 2014. Walaupun agenda KPU Labuhanbatu padat dengan masuknya tahapan Pilgubsu 2013, pihaknya siap melakukan verifikasi parpol calon peserta Pemilu 2014. Sofyan menambahkan, bulan September ini akan diadakan sosialisasi verifikasi parpol menjadi peserta Pemilu 2014 dengan mengundang semua parpol, baik yang lama maupun yang baru. Bentuk verifikasi faktual parpol tingkat kabupaten/kota, yaitu mengenai kepengurusan, keterwakilan perempuan, kantor parpol dan verifikasi keanggotaan parpol. (riz)

4 TEWAS, 15 LUKA-LUKA Sambungan Halaman 9 Informasi diperoleh dari beberapa warga, Heri (30), Eko (33) dan Eri (27) mengatakan, Bus Medan Jaya yang dikemudikan Bemo Sebayang (kabur/lari setelah kejadian, red) melaju dengan kecepatan tinggi datang dari arah Medan menuju Rantauprapat. Sopir bus yang membawa 28 penumpang itu tampak ugal-ugalan di jalan raya. Tiba di lokasi kejadian, sopir bus langsung menghantam bagian belakang dump truk yang sedang parkir untuk mengangkut tanah. Suara benturan yang keras membuat warga yang tinggal tak jauh dari lokasi kejadian langsung terkejut. Dalam hitungan detik warga berhamburan menuju arah suara dan warga melihat bagian depan Bus Medan Jaya ringsek berat. Sementara para penumpangnya tampak terkapar. Melihat itu warga lalu berusaha menolong para penumpang dan sebagian lagi menghubungi polisi. Saat itu warga baru tahu jika

salah seorang penumpang tewas di lokasi kejadian akibat luka yang dideritanya cukup parah. Setelah dikeluarkan warga dari dalam bus, tiga penumpang yang duduk di sebalh sopir sekarat dan dilarikan ke Puskesmas Siduadua Gunting Saga dan RS Indra Husada Mambang Muda. Namun sesampainya di puskesmas dan di RS, ketiganya meninggal dunia. Ketiga korban yang meninggal yakni tersebut R br Purba (48), Timbul Siahaan (59), dan Pitti br Ginting (64). Sementara korban yang tewas di lokasi kejadian yakni Imanta Barus (44) kernek Bus Medan Jaya. Setelah polisi datang, warga mengevakuasi para korban dan berusaha mengeluarkan korban yang terjepit di dalam bus. Marina (26) salah seorang penumpang bus mengaku peristiwa ini terjadi disaat seluruh penumpang bus tertidur lelap dan dengan tibatiba terdengar suara benturan sehingga seluruh penumpang langsung terbangun. Namun sejak awal berangkat dari Medan sopir sudah membawa bus dengan kecepatan tinggi.

Pantauan METRO di lokasi kejadian, Bus Medan Jaya yang mengalami ringsek berat sudah diamankan di kantor Pos Pengatur lalulintas Kualuh Hulu dan sudah di tutup pakai terpal. Parno (35) warga Aekkanopan ketika di temui di kantor polisi mengaku merinding melihat bagian depan Bus Medan Jaya yang rusak berat apalagi dijok bangku supir yang sudah ringsek masih menempel sisa otak segar kepala manusia yang belum sempurna di bersihkan. Dikatakan parno jika dilihat otak yang masih tersisa itu dipastikan milik Imanta Barus (44) warga Dusun Raja Tengah Kecamatan Kuala Langkat Kabupaten Langkat yang merupakan kernek bus Medan Jaya yang tewas di lokasi kejadian. Kanit Lantas Polsek Kualuh Hulu Aiptu Joe Makir membenarkan peristiwa ini. Joe mengatakan saat ini Bus Medan Jaya sudah dievakuasi dan sopir bus dalam pengejaran polisi. (put/st)

KORBAN TEWAS 1. Imanta Barus (44) kernek warga Langkat 2. R br Purba (48) warga Pancur Batu 3. Piti Br Ginting (64) warga Jalan Handayani II Pekan Baru 4. Timbul Siahaan (59) warga Medan Petisa KORBAN LUKA-LUKA 1. Devi Putra Jaya (19) warga Simpang Beo Tebing Tinggi 2. India Marnani (47) warga Kandis Simpang Belutu Riau 3. Andre Sembiring Meliala (26) warga Kabanjahe 4. Gudrion Sitanggang (23) warga Namo Rambe Medan 5. Idorani Pandia Sembiring (20) warga Barus 6. Nimrot Manurung (44) warga Duri Riau 7. Rasmawati br Sembiring (39) warga Bagan Sinembah 8. Dominika (23) warga Tanjung Ledong TanjungbalaiAsahan 9. Pardomuan Melian (38) warga Perumnas Simalingkar Medan 10. Mangandar Siringo-ringo (53) warga Kandis 11. Irwan Rudini (22) warga Pekanbaru Riau 12. Marina br Harahap (22) 13. Yudha (17) warga Pasar V Tembung Medan 14. Rahmansyah (25) warga Pasar VI Labuhan Deli Medan

Poldasu Ringkus 4 Tersangka Pembacok Polisi 2012 TAK ADA... Sambungan Halaman 9 krimum) Poldasu AKBP Mashudi menyatakan, keempat tersangka ini merupakan seluruh pelaku dalam kasus itu. “Ini sudah semuanya, tidak ada tersangka lainnya, tetapi penyelidikan masih kita kembangkan. Mereka dikenakan pasal 365 dan pasal 351 KUHP, dengan ancaman hukuman hingga 15 tahun,” kata Mashudi kepada wartawan. Disebutkan Mashudi, polisi berhasil menangkap para para tersangka di beberapa tempat terpisah setelah mengembangkan penyelidikan. Tersangka pertama yang berhasil diamankan yakni Indra Jaya Dalimunte (34). Dia ditangkap di Jalan Krakatau, dekat pintu tol Tanjung Mulia, Medan, pada 31 Agustus sekitar pukul 19.30 WIB. Berikutnya pada 1 September pukul 21.00 polisi menangkap Muktar alias Kendoi (34) di kawasan Ring Road, Sunggal, Medan. Lantas pada 1 September sekitar pukul 07.30 diamankan Juniper Manurung (34) di Jalan Baru, Glugur, Rantauprapat, Labuhanbatu, kemudian pada pukul 12.00 ditangkap lagi Agus Irwansyah (31) di SPBU Simpang Brohol, Tebing Tinggi. Kasus penganiayaan dan perampasan senjata api itu terjadi pada 24 Agustus 2012 sekitar pukul 21.00 di kawasan perkebunan

PTPN IV di Serbelawan, Kabupaten Simalungun. Rencananya para tersangka ingin mencuri motor travel alat berat yang ada di perkebunan itu. Saat kejadian, anggota Polsek Serbelawan Aiptu Satar Tampubolon tengah melakukan pengamanan di sana. Begitu melihat penjaga, tersangka Indra memukulnya dengan pipa besi. Tindakan itu dibantu Muktar yang memukul dengan kunci shock. Muktar kemudian mengambil senjata laras panjang milik korban dari tenda penjaga, dan senjata itu kemudian dibawa Indra yang seterusnya menyimpan senjata itu disimpan di rumah mertuanya di Rantauprapat. Saat kejadian, tersangka Juniper Manurung berperan sebagai supir mobil Xenia warna putih untuk angkutan para tersangka, sementara Agus Irwansyah memantau situasi di luar Tempat Kejadian Perkara dan menjemput tersangka Indra dan Juniper dari tempat persembunyian. Setelah berhasil melumpuhkan korban, para pelaku kemudian melarikan diri, karena terlihat ada rekan Aiptu Sathar yang datang naik sepeda motor. “Senjata api yang dirampas pelaku sudah kita peroleh, berikut magazin dan peluru. Dari 10 peluru dalam senjata, ada satu peluru yang sudah dipergunakan tersangka,” kata Mashudi.

Berdasarkan pengakuan, para tersangka ini sudah beberapa kali melakukan tindak kriminal pencurian spare part alat berat dari perkebunan sepanjang tahun ini. Antara lain di Balam, Labuhanbatu pada Juni 2012, kemudian di Tanjung Pasir, Asahan pada bulan Juli, dan di Gunung Pamela, Tebing Tinggi, pada bulan Agustus. Terpisah, Kabag Humas Polres Labuhanbatu AKP MT Aritonang, Senin (3/9), usai melakukan pengamanan unjukrasa di halaman kantor Pemkab Labuhanbatu mengatakan pihaknya sudah melimpahkan tersangka Juniper Manurung ke Poldasu. “Tersangkanya sudah dibawa ke Poldasu, karena kasusnya langsung ditangani di sana,” katanya. Dijelaskannya, penangkapan terhadap seorang tersangka itu dilakukan oleh tim gabungan dari Poldasu bersama Polres Simalungun dan dibantu petugas Polres Labuhanbatu. “Makanya begitu tersangka tertangkap langsung di bawa ke Polda,” katanya. Aritonang juga membenarkan, dari tangan tersangka tim gabungan tersebut juga telah mengamankan satu pucuk senjata api laras panjang jenis V2 milik Aiptu Satar Tampubolon yang sempat dibawa kabur. “Senjata itu ditemukan di salah satu rumah di Sigambal,” terangnya. (cr1)

Tutup SPBU Ahmad Yani! Sambungan Halaman 9 menjalankan peranan dan fungsinya dengan arti kata Labuhanbatu mandul,” kata Azlansyah. Sementara Imam Marpaung dalam orasinya menegaskan, fungsi pengawasan DPRD Labuhanbatu yang mengawasi kinjerja pemkab hanya berjalan di tempat. Sehingga mereka menyebut lembagga dewan tersebut amburadul. Ada pun empat tuntutan para pengunjuk

rasa yakni meminta agar Bupati Labuhanbatu dr Tigor Panusunan Siregar menutup SPBU 14.214.225. Setelah beberapa lama menyampaikan orasinya, sejumlah perwakilan aksi kemudian diterima oleh Asisten Pemerintahan Pemkab Labuhanbatu Sarbaini untuk membicarakan persoalan tersebut. Sarbaini mengakui memang SPBU tersebut beroperasi tanpa memenang izin HO yang telah habis massa berlakunya sejak tahun 2011. Namun katanya, pihak SPBU tersebut

telah mengajukan perpanjangan HO dengan melengkapi persyaratan yang ada. Namun sampai saat ini belum ada pihak perusahan yang berniat untuk mengambil izin tersebut. Sementara itu disinggung dengan adanya masyarakat sekitar yang menentang perpanjangan izin HO tersebut, Sabraini membenarkanya. Hanya saja Sabrani menjelaskan jika SPBU tersebut ditutup maka otomatis akan mengurangi pasokan BBM di Rantauprapat dan menyulitkan masyarakat untuk mengisi BBM. (riz)

Pemilik Galian C Ajak Warga Musyawarah Sambungan Halaman 9 keberatan, Edi memintanya untuk membahasnya secara musyawarah. “Ayo kita musyawarahkan, jangan ngadu kepada pihak ketiga, zaman sudah demokrasi kok,” katanya, Minggu (1/9). Menurut Edi, sesuai peraturan, galian C itu sudah disepakati 5 meter dari batas yang digali, habis digali kemudian ditutup. Edi menambahkan, masalah izin sedang dalam pengurusan ke Pemkab Labusel. Bahkan menurut Edi, pihak Pemkab Labura sudah melakukan peninjauan ke lokasi usaha galian C miliknya. Sementara sejumlah warga yang tinggal di Desa Huta Godang, Kecamatan Sungai Kanan, Labusel mengeluhkan aktivitas penambangan galian C di Batang Air Sungai Kanan.

Pasalnya warga khawatir akibat penambangan itu dapat menimbulkan erosi. Salah seorang warga Desa Huta Godang Kecamatan Sungai Kanan, Kabupaten Labusel, Dahrum (60) mengatakan, akibat aktivitas galian C yang persis berada di samping lahan perkebunan sawit miliknya, membuat tanah di kebun sawitnya mengalami erosi. “Sudah berlongsoran tanah saya akibat pengerukan galian C itu. Kami segera menyurati dan melaporkan ke kantor perizinan dan polisi atas kasus ini,” kata Dahrum. Menurutnya, akibat adanya galian C itu, tidak hanya lahannya yang bakal terancam, sejumlah lahan milik warga lainnya juga bakal mengalami dampak buruk. Bahkan banjir bandang juga dapat mengancam warga. Pasalnya pengusaha galian C mengalihkan

aliran sungai ke lokasi lain agar kendaraan damp truk pengangkut hasil galian dapat menyeberangi sungai. Senada dikatakan warga lainnya, Maklan (29), dan Hendra (32). Menurut keduanya, warga sudah pernah meminta agar pengusaha galian C menghentikan kegiatannya, namun pihak pengusaha tidak menghiraukan permintaan tersebut. Terpisah Kepala Badan Perizinan Pelayanan dan Terpadu (BPPT) Zulkarnain Siregar ketika dikonfirmasi mengatakan, hingga saat ini belum ada izin dikeluarkan untuk operasioal penambangan galian C di Sungai Kanan. “Memang belum ada izinnya itu. Saya belum melihat ada permohonan masuk untuk operasioanl galian C itu,” katanya. (mhr)

PTPN 3 Diminta Desak Polisi Sambungan Halaman 9 PTPN 3. Pasalnya hingga, Minggu (2/9) tersangka belum dijeblosan ke penjara dengan alasan belum cukup bukti. Jika Sunarto tidak ditahan, hal ini akan membuat kecemburaan bagi warga yang tinggal di sekitar perusahaan tersebut. Permintaan ini disampaikan Surya Darma, selaku Ketua Lembaga Swadaya Masyarakat Potret Indonesia. Menurut Surya, terkait kasus pencurian TBS dari lokasi areal Afdeling II, perkebunan Membang Muda, tanggal 23 Juli lalu. Di mana petugas keamanan kebun sudah berhasil menemukan buah yang dicuri

Sunarto dan disimpan di belakang rumah Sunarto. Namun persoalan itu hingga kini tetap menjadi gunjingan warga. Karena sesudah tersangka dibawa ke kantor polisi, Sunarto dilepas. “Kedaaan itu tentunya dapat berpotensi menimbulkan kecemburuan sosial, karena dalam kasus serupa pencurian aset milik perusahaan PTPN 3 sudah banyak warga yang ditangkap lalu dijebloskan ke dalam penjara untuk menjalani hukuman,” kata Surya. Disebutkan Surya, jika pihak PTPN 3 beranggapan apa yang dilakukan mereka dalam menangani kasus pencurian di lakukan Sunarato sudah sesuai prosedur, mereka jangan tinggal diam dan hanya menunggu

surat pemberitahuan perkembangan penyidikan (SP2HP) dari polisi, “Pihak perkebunan harus serius dan benarbenar mengamankan asetnya, dan bentuk keseriusan itu bisa ditunjukan dengan mempertanyakan alasan pelepasan itu,” katanya. Terpisah, Kapolsek Kualuh Hulu AKP Arifin Marpaung mengatakan, meskipun Sunarto tidak ditahan dalam kasus itu, namun prosesnya tetap dilanjutkan. “Tidak ditahanya Sunarto karena kurangnya bukti untuk dilakukan penahanan. Karena meskipun buah sawit yang dicuri ditemukan dari belakang rumahnya, namun Sunarto tidak mengakui perbuatannya,” kata apolsek. (put)

Sambungan Halaman 9 tersebut sejak tahun 2010 lalu. Katanya, kebijakan itu diterapkan pemerintah karena besarnya biaya yang ditanggung APBD Labuhanbatu untuk membayar gaji pegawai. “Misalnya di tahun 2012 ini, hampir 80 persen APBD itu dibayarkan untuk gaji pegawai. Makanya moratorium itu diberlakukan,” katanya. Untuk itu, dipastikan Aswad, ditahun 2012 ini, Pemkab Labuhanbatu tidak akan melakukan perekrutan CPNS untuk semua formasi. “Kita pastikan ditahun 2012 ini pemkab labuhanbatu tidak melakukan perekrutan atau penerimaan CPNS karena kebijakan moratorium itu masih diberlakukan,” tambahnya. (cr1)

SURAT UNDANGAN... Sambungan Halaman 9 kandung Shelly, Senin (3/9) mengatakan, dirinya tak pernah menghalangi atau berupaya menggagalkan pernikahan putri pertamanya itu dengan Hasanul Basry yang akan dilangsungkan pada 6 September mendatang. Namun Ali mengaku tersinggung atas undangan pesta tersebut yang telah disebarkan kepada masyarakat luas. Di mana dalam undangan itu disebutkan jika Shelly merupakan anak pertama dari Bupati Labusel Wildan Aswan Tanjung. Padahal Shelly merupakan anak dari Ali Gaga Harahap dengan mantan istrinya Hasnah (kini istri Wildan Aswan Tanjung, red). “Sedikitpun saya tidak pernah menghalangi pernikahan tersebut. Namun sebagai ayah kandung Shelly saya merasa keberatan atas adanyatulisantersebut.KarenaShellyituputripertama saya, bukan putri pertama bupati,” katanya. Ali mengatakan, sejak awal adanya rencana pernikahan itu sekira tiga bulan lalu, putrinya dan calon menantunya telah meminta restu untuk menikah.Sebagaiayahdiatelahmemberikanrestu bahkan sempat memberikan nasihat kepada Shelly dan Hasanul. Bahkan, Ali bersedia memberikan hak menikahkan kepada wali hakim agar pesta dapat berjalan sesuai rencana. “Sayasudahmerestuipernikahananaksayaitu,” katanya. Namun Ali merasa terkejut setelah mengetahuijikadidalamundangantertulisbahwa Shelly merupakan putri pertama Bupati Labusel Wildan Aswan Tanjung. Karenanya dia merasa perlu meluruskan kekeliruan tersebut. Dia mengakui bahwa sejak perceraianya dengan Hasna,ShellymengikutHasnah.KemudianHasna menikahdenganWildanAswanTanjungyangsaat itu belum menjadi bupati. Ali menambahkan, meskidirinyatelahberceraidenganHasna,dirinya tetap ayah kandung dari Shelly. “Saya hanya meluruskan apa yang menjadi hak saya,” katanya. Sementara Bupati Labusel H Wildan Aswan Tanjung ketika dimintai keterangannya terkait hal tersebut enggan berkomentar. (mhr)

JANDA KORBAN... Sambungan Halaman 9 Ramadan lalu. Kharuddin mengaku kasihan dengan Samijem setelah meninjau langsung ke rumah Samijem yang terbakar. Kemudian Kharuddin berniat akan membangunakan rumah baru untuk Samijem. Setelah itu, Kharuddin menceritakan niatnya membangun rumah Samijem kepada para kerabatnya dan para kadis di Labura. Ternyata niat Kharuddin mendapat sambutan dari para sahabat dan para kadis. Akhirnya setelah ada kata sepakat, dikumpulkanlah dana pembangunan rumah untuk Samijem. Setelah dana terkumpul, lalu dibangunlah rumah untuk Samijem dengan ukuran 6 x 8 meter. “Jadi pembangunan rumah Samijem murni merupakan hasil sumbangan dari para dermawan yang peduli dengan kesedihan Samijem. Tidak ada sedikitpun dana pemerintah mengalir untuk pembangunan itu,” kata Kharuddin.(put)

Wajah Tak Mirip, Bayi Dicekik Sambungan Halaman 9 istrinya. Tahunya Tatik gadis yang setia, yang hanya menerima cinta Gito seorang. Padahal, selain si sopir angkot gadis kembang desa itu juga menebar jaring-jaring asmara pada cowok lain. Mungkin dia mau meniru Partai Golkar, mau membangun koalisi besar! Koalisi besar itu benar-benar dipraktekkan Tatik, dalam arti dua cowok sekaligus dipacarinya. Padahal bagi anak muda sekarang, koalisi tanpa eksekusi, sama saja bohong. Dan itu pula yang dilakukan Tatik

terhadap kedua kekasihnya. Selain asrah jiwa raga pada Gito, si gadis juga mTatikerahkan kehormatannya pada cowok yang satunya lagi. Ternyata Tatik memang mahir mengatur jaringan asmaranya. Artinya, kedua kekasihnya tak pernah amprok, mereka tak pernah tahu bahwa dijadikan ban cadangan. Entah “saham” dari mana yang berlaku, tahutahu Tatik hamil. Diapun segera menuntut Gito untuk menikahinya. Merasa bahwa itu hasil perbuatannya, sopir angkot itu pun menikahinya. Hanya beberapa bulan berselang setelah pernikahan, bayi lahir perempuan. Baik

Tatik maupun Gito menyambut gembira kelahiran bayi itu. Dari rumah bersalin segera dibawa pulang ke rumah dengan angkot yang dikendarai selama ini. “Makin cepat tinggalkan rumahsakit, berarti bisa menekan biaya perawatan,” begitu dalih Gito yang termasuk lelaki elit (ekonomi sulit). Sungguh di luar dugaan, di atas kendaraan keduanya malah cekcok. Pangkal persoalannya, Gito merasa kaget sebab bayi itu sama sekali tak ada miripnya sama sekali dengan dirinya, ya itemnya, ya jabriknya. Langsung saja dia menuduh istrinya pernah selingkuh.

Karena Tatik tak mau mengaku, Gito menjadi geram. Sungguh celaka, yang jadi sasaran justru si bayi tanpa dosa. Orok usia 7 jam itu langsung dicekik hingga tewas, sementara Tatik tak mampu mencegahnya. Diam-diam Gito menguburkan bayi itu di belakang rumahnya dengan alasan istrinya keguguran. Tapi warga yang sempat membezuk di RS, tahu persis kondisi bayi itu saat lahir. Dia segera lapor polisi Polsek Bulukerto, dan Gito pun segera ditangkap. Awalnya dia mungkir, tapi setelah Tatik bicara bla-bla bla depan polisi, suami sadis tersebut tak berkutik. (mdc/int)


4 September 2012

Pria Inggris Habisi Nyawa 2 Anaknya mengkategorikan kematian korban dalam kasus ini cukup mencurigakan, namun kepolisian setempat tidak mencurigai adanya pelaku lain dalam kasus ini. Motif Graham melakukan perbuatan ini diduga karena masih tidak bisa menerima perpisahannya dengan sang istri. Meski belum mengetahui secara pasti kronologi insiden ini, namun kepolisian mencurigai aksi keji Graham tersebut dilakukan pada Kamis (30/8) pagi waktu setempat. “Sang ibu sangat-sangat terkejut mengetahui hal ini. Kami menyampaikan duka mendalam bagi pihak keluarga dan kerabat korban,” ujar Kepala Detektif setempat, Inspektur Ian Saunders. (dtc/int)

LONDON- Seorang ayah tega menghabisi nyawa kedua putranya yang masih berusia 11 tahun dan 3 tahun gara-gara perpisahannya dengan sang istri. Setelah melakukan perbuatan keji terhadap kedua buah hatinya, pria berusia 36 tahun ini pun nekat gantung diri. Jasad Graham Anderson dan kedua buah hatinya ini baru ditemukan oleh sang pemilik apartemen yang dihuni oleh Graham di wilayah Tidworth, Wiltshire, Inggris, pada Sabtu (1/9) waktu setempat. Saat itu sang pemilik apartemen tengah menunjukkan sejumlah apartemen lainnya kepada calon penyewa baru. Semenjak kedua orangtuanya berpisah, kedua bocah tersebut tinggal bersama ibu mereka di

Andover, Hampshire. Namun kemudian keduanya secara rutin datang mengunjungi Graham di kediamannya. Sang ibu, Victoria Jones (30) telah melihat jasad korban dan memastikan bahwa 2 anak yang telah tak bernyawa tersebut merupakan buah hatinya, yakni Jack (11) dan Bryn (3). Tidak dijelaskan lebih lanjut bagaimana kondisi jasad ketiganya saat ditemukan. Tidak diketahui juga bagaimana cara

„ Lokasi kejadian Graham menghabisi nyawa kedua buah hatinya. Demikian

Berusia 1 Tahun Aditya Berkumis

Bayi Kembar Beda Ras Pamela Frazer sudah tahu akan memiliki anak kembar sejak masa kehamilan. Tapi, sama sekali tak terbayang di benaknya bahwa dua buah hatinya itu terlahir dengan dua ras berbeda, empat pekan lalu. Candice Anne membawa sifat genetik: kulit hitam, rambut hitam, dan mata hitam. Sedangkan Aleisha Lilly menuruni sifat genetik: kulit putih, rambut pirang, dan mata cokelat. “Setidaknya aku tidak akan bisa salah memanggi anak-anakku,” ujarnya sambil bercanda, seperti dilansir The Sun. Meski langka, kasus itu masih bisa mendapat penjelasan secara medis. Ini mengingat Pamela dan suaminya, Oswald memiliki garis keturunan dari ras campuran. Pamela terlahir dari ibu keturunan Jamaika, Afrika, Irlandia, dan ayah keturunan Yahudi berkulit putih. Sedangkan Oswald terlahir dari ibu keturunan Jamaika, irlandia, dan ayah keturunan Jamaika. “Dokter mengatakan bahwa kasus semacam ini biasanya

maklum terjadi pada kakak dan adik yang tidak kembar. Namun, untuk kasus kembar sangat sangat jarang terjadi, kemungkinannya bisa jadi hanya satu dari setiap satu juta kelahiran,” ujar Pamela. Berdasar penjelasan dokter, dua sel telur Pamela kemungkinan besar mengalami pembuahan dari dua sperma berbeda. Ini artinya, masing-masing benih memiliki sifat genetik berbeda yang akan menentukan karakter fisiknya. Terlepas perbedaan karakter ras putri kembarnya, Pamela dan Oswald bersyukur

Kepolisian setempat masih menangani kasus ini. Meski

seperti dilansir Daily Mail, Senin (3/9).

memiliki keturunan yang sehat. “Kami sangat mencintai mereka dan tak akan pernah membedabedakan,” Oswald menambahkan. Bukan Kasus Pertama Kasus serupa juga menimpa Shirley Wales yang melahirkan bayi kembar dengan ras berbeda. Yang lakilaki menuruni gennya yang seorang Grenadian: kulit gelap, mata coklat, dan rambut ikal coklat. Sedang bayi perempuannya menuruni gen mantan suaminya: kulit putih, mata biru, dan rambut pirang. Lewat operasi caecar di

Dewsbury District Hospital, West Yorkshire, dua bayi itu lahir sehat dan selamat pada 2009. “Saya tahu akan punya anak kembar dampit, tapi saya syok ketika perawat memberi tahu mereka punya warna kulit berbeda,” ujar Wales. Kelahiran bayi kembar itu sempat menyita perhatian media dan orang-orang di sekitarnya. Tak kurang 100 orang datang berkunjung di dua hari awal pascapersalinan. “Kalau saya cuma menggendong Hope, orang pasti akan mengira itu keponakan saya,” katanya sambil terbahak. (int)

BIHAR- Seorang balita di Distrik Bihar, India, Aditya Kumar menderita penyakit Sindrom Cushing dan penyakit membuatnya terlihat semakin tua. Balita berusia 18 bulan itu berbadan besar layaknya seorang bocah berusia enam tahun dan memiliki kumis. Sindrom Cushing merupakan penyakit yang memiliki sangkut paut dengan hormon. Aditya lahir dalam kondisi normal dan sehat. Namun pada saat ulang tahunnya yang ke-satu, Aditya tumbuh besar secara cepat. Tubuh balita itu membesar, tangannya pun berbulu dan kumis pun muncul di wajahnya. Bobot badan Aditya langsung meroket dan wajah balita itu terlihat semakin tua. Orangtua Aditya langsung panik dan membawa putranya ke dokter. Dokter yang ditemuinya tidak dapat menolong bocah malang itu. Dokter itu memutuskan untuk mengirim

Aditya ke rumah sakit dan pada saat itulah Aditya menjalani pemeriksaan kesehatan. Menurut Dr Krishna, Aditya harus menjalani proses operasi atau terapi radiasi untuk menyebuhkan Sindrom Cushing. Krishna mengatakan bahwa penyakit itu muncul akibat gangguan hormonal. “Saya sudah melihat laporan dari tes ultrasonografi bocah ini. Ada tumor di dalam kelenjar adrenalin yang terletak di atas ginjal Aditya. Hal ini menjadi pemicu sekresi dari hormon itu,” ujar Krishna, seperti dikutip Daily Mail, Senin (3/9). Kondisi finansial orangtua Aditya juga kurang baik. Pada awalnya, mereka ingin putranya dirawat di Patna, namun Krishna menyarankannya agar pergi ke All India Institute of Medical Sciences (AIIMS) di New Delhi. Bocah itupun siap menjalani sejumlah tes untuk menyelidiki penyakitnya. (ok/int)

12 Menit, TTelan elan 191 Sayap Ayam BUFFALO – Sebuah lomba makan sayap ayam digelar di Buggalo, Amerika Serikat (AS). Juaranya sanggup menelan 191 sayap alam dalam waktu 12 menit! Penyelenggara National Buffalo Wing Festival menyatakan, Joey Chestnut sanggup menyantap 191 sayap ayam dalam waktu sesingkat itu. Chestnut mencetak rekor lomba makan sayap ayam yang digelar setiap tahun di Buffalo, sebuah kota di Negara Bagian New York. Rekor sebelumnya, 183 sayap ayam yang dicetak


Avanza Angs 3 Jt-an Inova Angs 4,5 Jt-an Rush Angs 4,5 Jt-an Yaris Angs 4,4 Jt-an -Stock ReadyInfo:0811 6152 000; 0853 6058 2000


Dp Dp Dp Dp Dp

25 25 25 20 25

%, %, %, %, %,

angsuran angsuran angsuran angsuran angsuran

2 3 3 2 3

Jt-an Jt-an Jt-an Jt-an Jt-an

Proses cepat data dijemput

Hub: L. Rivai Sembiring 0812 6457 0000 AUTO 2000 KISARAN PROMO LEBARAN Dp 15%, AVANZA, VELOZ, INOVA, FORTUNER, YARIS, RUSH, Angsuran Ringan. Info Hubungi: 0821 6300 6266; 0821 6078 3848 NEW NISSAN: Grand Livina, Juke, X-Trail. Navara, Murano. Ready Stock, cash/credit.

Hub: Mili 0852 7033 7739

SUZUKI MOBIL BARU • Carry P.Up FD Dp. 15Jt • APV P.Up Dp. 20,5Jt • APV Arena Dp. 23Jt • Ertiga Dp. 40Jt Tersedia : Swift, Splash, Gran Vitara, SX4 Hub : 0853 7003 2838


• Carry Pick Up Dp. 15,7Jt Angs 2Jt • APV Mega Carry Pick Up Dp. 23Jt angs 2Jt • APV Dp. 29Jt angs 3Jt • Ertiga Dp. 35Jt angs 3Jt • Swift Dp. 35Jt angs 4Jt • SX4 Dp. 40Jt angs 4Jt • Grand Vitara Dp. 70Jt angs 5Jt Proses Cepat, Angsuran Ringan dan data bisa dijemput. Hub: Ardi Oslan Lubis 0812 6582 0292 Mitsubishi Ready Stock: Pajero Sport, Outlander Sport, Mirage, Strada Triton, Lancer, (Chasis, Box, Tangki, Bus, Dump Truck Colt Diesel & Fuso, Pick Up & Minibus L300 & T120ss), Pesan Segera Hubungi DONI: 0813 6224 2904 ; 0852 6130 5040

oleh Sonya Thomas alias Black Widow, nama panggungnya. Awal tahun ini, Chestnut yang warga California memenangkan gelar keempat berturut-turut sebagai juara lomba makan hot dog.Ia menyantap 68 hot dog dalam waktu 10 menit. Akhir pekan ini, festival sayap ayam masih digelar di Buffalo. Termasuk di antaranya, penyajian 100 macam menu masakan sayap ayam. (int)

MITSUBISHI RANTO “PROMO” LEBARAN: Pajero Sport, Triton, Colt Diesel Dump Truck, Chasis, L-300, & Colt T120SS PickUp. DP 11% atau bunga mulai 0%. Hubungi: UNAS 0813 6333 3000

CASH&CREDITELEKTRONIKFURNITURE, Proses cepat syarat ringan. Membutuhkan : Tenaga Marketing. Hub : Ir Salam , Interyasa Mitra Mandiri, Alamat : Jl. M. Ibrahim No. 25 Kisaran, Hp : 0812 6390 1055


COLUMBIA CASH & CREDIT: Dibutuhkan segera : Tenaga Marketing & Kolektor TF. Fasilitas Mobil kerja, uang makan 8000 s/d 15000. Gaji pokok 350.000 s/d 1 Juta, komisi 4 % s/d 8 % + intensif. Alamat : Jl. Cokroaminoto Kisaran & JL. Koptu Mahmun Lubis Aek Kanopan Tlp . 0623 44260 E XC E LC I S E C O M P U T E R Lembaga kursus pelatihan Komputer. Kami melayani dan menerima murid baru serta menerima ketikan surat , kantor, pengetikan skripsi, majalah, proposal & surat lainnya. Kunjungi alamat kami : Jl. Malik Ibrahim No. 27 Kisaran. HP: 0813 6112 9333 ; 0812 6053 8000 DIJU AL: Tanah kapling uk 6x12M, harga mulai DIJUAL: 35jt-an, bisa nego. Lokasi strategus sebelah kolam renang Wahyu. Hub alamat: Kolam Renang Wahyu, Jl. St. Alisyah Bana, dengan Bpk IRWAN EDWIN (Buyung) Hp: 0813 7596 2988 *Juga menerima pelatihan renang yg diasuh oleh Pelatih bersertifikat & berpengalaman.

Hitam tahun 2008. Body/ Mesin mulus.Hub 0813 7015 5910; 0813 6163 1463


Menjual : Laptop, Komputer, Accessories & Service Komputer, ATK, Kamera digital, Ipad / Tablet –PC, Belangko Undangan, Lion, Kertas HVS secara ecer dan grosir, juga melayani Cash & Credit. Alamat : Jl.Imam Bonjol No.149 Kisaran, Dpn Hotel Wisata.Tlp : 0623 41353

SYUSUF PONSEL 4 Pusat Servis Handphone bergaransi dan Cuci photo dengan kualitas terbaik. Jl. M.Yamin Simp. Kedai Ledang Kisaran. Telah Hadir di Kisaran, “RUMAH JAMUR” menyediakan menu masakan ala jamur, Lontong sate jamur, Bakso jamur, Sop jamur Ayam kampung, Mie jamur ayam kampong, Krispy jamur, es jamur, Dll. Buka setiap hari Kecuali “Jumat” mulai jam 12.00 siang sampai malam. Kunjungi alamat kami : Jl. Budi Utomo No. 116 Siumbut-umbut Kisaran. HP : 0877 4878 2775

BUTUH DANA TUNAI? Satu jam cair bawa BPKB sepeda motor anda ke: UD.JAYA MOTOR AEK LOBA Jl. Cokroaminoto Samp.SPBU kisaran,juga melayani Cash & Kredit Sepeda Motor Bekas. Hub: Hermanto: 0813 7633 2981; 0812 6295 222 BUTUH DANA TUNAI: Lamhot Jaya Motor jaminan hanya BPKB Sepeda motor anda, persyaratan ringan, 1 jam cair, juga melayani jual beli sepeda motor. Hubungi alamat Pusat kami : Jl Diponogoro No.149, Kisaran. Telp 0623 43921 Hp : 081361505214 BUTUH DANA TUNAI: Lamhot Jaya Motor jaminan hanya BPKB Sepeda motor anda persyarat ringan. 1 jam cair juga melayani jual beli sepeda motor. Hubungi alamat Cabang kami : Jl. Lintas Siantar, Simp Tangsi. HP : 085373430808. Alamat Unit kami: Jl. Lintas Sei Mati, Ds Mekar Sari. HP : 085361450914 KLINIK GAURY Pengobatan mata herbal seperti : katarak, min plus, gloukoma, silinder, mata merah,berlemak, dll. Lemah syahwat, ambeyen, diabetes. Alamat Jl. Mas Mansyur No.65 Kisaran. Hub: Mr Mohan 0813 6613 7952

BAKSO MONAS Menyediakan menu bakso Gong, Bakso kaget & Mie Ayam herbal. NB: Bukan makan tepung tetapi bakso daging, Dilayani karyawan dari kraton Solo, Halal, Bersih, Nikmat dan Ramah. Alamat : Jl. Merpati Simp. Gambir Baru Kisaran. WARUNG LESEHAN MBAK NUR Menyediakan : Menu Ikan Lele, Ikan Mas, Mujair, Gurami, Nasi Uduk, Ayam Kampung & Bebek goreng, serta aneka Juice. Kunjungi Alamat kami :Jl. A. Yani Simp.Tg. Alam Kisaran PURI COLLECTION Menjual : Berbagai macam pakaian, Pria dewasa, celana & baju perempuan, pakaian remaja anakanak, dan Accessories lainnya seperti Dompet, tas Dll. Kunjungi alamat kami : Jl. Ir Sutami No.17 Dekat KFC Simp Bunut Kisaran. BATIKITA ACCESSORIES Menjual aneka pakaian batik, Tas batik, Kaos, Sabun Herbal, mainan kunci dan accessories lainnya. Dapat kan produknya di: Jl.SM.Raja No. 35 B, Kisaran. Dekat Rel KA. SEHAT SERVICE Melayani: Doorsmeer, Ganti Oli, Pispot, Balancing Ban, Tubless, Angin, Hidrogen, Ban luar, Radial. Jl. A Yani No. 6/8 Kisaran


nilah ebiasan uruk ria dalam esehatan

Tak semua orang bisa mengelola uang dengan baik. Banyak di antara kita yang tak punya tabungan, tak punya dana darurat, dan tenggelam dalam tumpukan utang. Kami bertanya pada pengusaha dan blogger finansial Fitz Villafuerte: apa kesalahan utama kita, dan apa yang harus dilakukan untuk memperbaikinya? 1. Kita memprioritaskan pengeluaran daripada simpanan sehingga tidak menyisakan apapun. "Setiap mereka mendapatkan gaji mereka, mereka biasanya membelanjakan terlebih dahulu, dan kalau ada sisanya, itulah yang akan mereka tabung," kata Fitz Villafuerte. "Pada umumnya, tidak ada yang tersisa pada akhir bulan." Solusi: Balik prosesnya. Pertama pisahkan sebagian dari gaji Anda untuk menabung, kemudian silakan habiskan sisanya. Villafuerte juga merekomendasikan untuk minta HRD perusahaan Anda untuk membantu: "Kamu bisa mendebet tabungan Anda secara otomatis. Minta HRD Anda untuk mengirimkan sebagian dari gaji Anda ke rekening lain di bank penggajian (payroll) kantor Anda." Metode proaktif ini membuat menabung tidak begitu menyusahkan. "Dengan begitu Anda tidak merasa kalau Anda menabung," kata Villafuerte. "Kamu tidak merasa bersalah jika menghabiskan apa yang tersisa. Menabung terasa lebih ringan dan menguntungkan." 2. Kita berinvestasi sebelum membuat dana darurat. Villafuerte mengamati kalau kesalahan kedua yang sering dilakukan orang ketika mereka mendapatkan uang ekstra adalah berinvestasi sebelum mereka menyisihkan sebagian untuk dana darurat. "Mereka tidak menggunakannya terlebih dahulu untuk menyiapkan dana darurat," katanya. Dana darurat adalah fondasi dasar dari portfolio setiap or-

ang, yang jumlahnya adalah: uang senilai enam kali biaya pengeluaran bulanan rumah tangga Anda, disimpan untuk kebutuhan darurat. So lusi: Villafuerte Merekomendasikan memiliki dana tersebut sebelum Anda menginvestasikan uang Anda. Bukannya dia tidak menganggap penting untuk membuat uang Anda bertambah, namun seperti masalah sebelumnya, masalah yang akan dihadapi ini adalah sesuatu yang merupakan prioritas. "Biaya rumah sakit, perbaikan mobil atau rumah yang mendadak tidak bisa Anda kesampingkan." Tanpa adanya dana darurat, kamu akan mencari utang atau mencairkan investasi Anda dengan segera. 3. Kita menghindari

bursa saham. Villafuerte menganggap bursa saham disalahartikan banyak orang. "Ketika Anda berbicara mengenai bursa saham, orang berpikir mengenai perdagangan saham, dan mereka jadi ketakutan, karena mereka pikir itu seperti berjudi," jelasnya. "Itu alasan mengapa hal itu kurang diberdayakan sebagai kendaraan investasi." Selalu ingat: Perdagangan saham hanya merupakan sebagian kecil dari bursa saham. "Terdapat juga investasi bursa saham, yang lebih berupa jangka panjang," papar Villafuerte. "Jika warga lebih terdidik mengenai investasi [mengenai membeli saham atau menahannya untuk lima sampai tujuh tahun] Anda akan melihat kalau Anda

irip erarti odoh

ANDA tentu sering mendengar pernyataan ini, kan: 'Pasangan yang mirip, berarti jodoh'? Well, sekarang sudah ada bukti yang solid. Para dokter di University of Michigan baru saja menyelesaikan sebuah riset mendalam tentang hubungan antara kemiripan wajah dengan kelanggengan sebuah hubungan. Hasilnya menunjukkan, wajah mirip menandakan bahwa pasangan tersebut juga memiliki beberapa karakteristik genetik yang sama. Maka rasa "familiar" ini membuat hubungan lebih solid. Nah, bagaimana dengan Anda dan pasangan?(int)

mendapatkan lebih banyak dibandingkan jika Anda hanya menaruh uang Anda di deposito berjangka." Namun Vilafuerte tidak mau memberikan nasihat mengenai bursa saham. Ia lebih memilih untuk mereferensikan brokernya: "Mereka menawarkan seminar gratis mengenai investasi bursa saham." Terdapat banyak masukan berkualitas di luar sana — namun Anda harus teliti mengenai hal itu. 4. Kita mendapatkan saran finansial dari orang yang salah. Villafuerte telah melihat ini terlalu sering — pengusaha baru yang bertanya kepada temannya untuk nasihat bisnis gratis dan kena batunya. "Kita suka mengambil jalan pintas," tambahnya. "Mereka tidak melihat segala hal dari segi bisnis; mereka tidak bertanya kepada seorang pengusaha, 'bagaimana Anda menjalankan bisnis Anda?' jadi hal itu meningkatkan resiko kegagalan mereka." Selalu ingat: Ada alasannya mengapa informasi tertentu gratis dan mudah didapatkan, kata Villafuerte: "Karena hal itu bukanlah nasihat terbaik yang bisa Anda dapatkan." Informasi bisnis yang berkualitas lebih sulit didapatkan. Ia teringat pada teman-temannya yang ingin berbisnis laundry dan meminta nasihatnya. "Aku mengatakan kepadanya mengenai seminar operasi toko laundry di Nagoskwela: 'Kenapa kamu tidak hadir disana? Kamu akan mendapatkan nasihat dari orang-orang yang mengetahui bisnis itu.'" Temannya itu tidak menanggapi ide tersebut. "Untungnya bisnisnya tidak hancur, namun memerlukan tiga tahun sebelum bisnis itu stabil." Dibandingkan dengan temannya yang lain yang menghadiri seminar laundry itu. "Ia menghadiri seminar toko laundry itu -- tokonya baru dibuka baru tiga bulan, namun sudah stabil," kenang Villafuerte. "Dari situ Anda dapat melihat perbedaannya: meminta nasihat mengenai uang, bisnis, atau investasi, dari orang yang cuma Anda kenal, dibandingkan mendapatkannya dari orang yang memang ahli di bidang itu."(int)


PRIA dibalik sifat cekatan, kelelakian dan maskulinitas ternyata menyimpan kebiasankebiasan yang sangat buruk bagi kesehatan. Pria secara umum dikenal cuek dan tak menaruh perhatian terhadap hal-hal yang mengancam kesehatan mereka di masa depan. Berikut ini 10 daftar kebiasan buruk pria bagi kesehatan 1. Minum Minuman Keras. Meskipun haram dalam beberapa agama, namun masih banyak yang melakukan. Bahkan pada tahap tertentu seseorang akan sangat tergantung pada minuman keras. Di negaranegara yang membolehkan minuman keras beredar, kebiasan mabuk seolah menjadi tradisi dan sering melupakan dampak jangka panjang terhadap kesehatan. Alkohol berhubungan dekat dengan kematian dalam banyak kasus selain bisa menyebabkan obesitas dalam waktu cepat. 2. Menghindari Dokter Penelitian Charity Men’s Health Forum menunjukkan pria 20 persen lebih sedikit daripada wanita dalam hal mengunjungi dokter jika mereka sakit. Mengunjungi dokter bagi para pria adalah pengalaman yang tidak menyenangkan. 3. Malas melakukan Check Up Sama seperti mengunjungi dokter, melakukan check up terhadap gejala penyakit adalah hal yang menyebalkan. Para Pria takut, tak mau mengetahui penyakit dan bingung apa yang harus dilakukan jika melakukan cek medis. 4. Menyimpan masalah Secara umum, pria sangat jarang berbicara tentang perasaan mereka dibanding para wanita. Mereka sulit mengekspresikan emosi atau sekedar meminta dukungan dalam sebuah masalah. Karena faktor ini para pria lebih rentah terserang depresi dibanding wanita, dan sekitar 77 persen dari yang depresi ingin mengakhiri hidupnya. Memendam kemarahan sama dengan merugikan kesehatan pria itu sendiri 5. Stres dalam bekerja Sama sama memiliki tekanan dalam bekerja, namun menurut survei oleh Medicash terhadap 3.000 pekerja, Pria empat kali lebih banyak izin sakit karena stress dibanding pekerja perempuan. Stres dalam pekerjaan bisa berakibat buruk ke jantung dan stroke. Sangat penting untuk mencari cara mengurangi stres para pria dalam pekerjaan 6. Mandi Air Panas Banyak pria ingin bersantai dengan sering berendam air panas. Peneliti dari University of California

menemukan bahwa air panas dapat dengan signifikan menurunkan kesuburan pada pria. Sperma berkembang baik di lingkungan yang dingin, sehingga harus dihindari panas di daerah ini termasuk mandi air panas di jacuzzi atau menggunakan laptop di atas paha. 7. Tidak pernah memakai tabir surya. Kanker kulit adalah jenis kanker yang sering ditemui di Inggris dan pria dalam studi adalah pasien terbanyak. Dalam penelitian 52 persen wanita rajin menggunakan tabir surya dibandingkan pria yang hanya 37 persen. padahal pria melakukan aktivitas luar lebih banyak dibandingkan para wanita 8. Kamar mandi yang tidak higienis Apakah para pria mencuci tangan setelah dari kamar mandi? menurut sebuah studi dari assosiasi sabun dan deterjen di Amerika, satu dari tiga pria tidak melakukannya. Lebih jauh, sebuah study di Inggris menyebutkan hanya satu dari tiga pria yang mencuci tangan menggunakan sabun. Tidak mencuci tangan adalah permulaan dari infeksi, jamur dan penyakit lainnya. 9.Tidak gosok gigi! Dalam sebuah studi oleh asosiasi dokter gigi Amerika, hanya 66 persen dari para pria yang sikat gigi dua kali atau lebih dalam sehari. Bandingkan dengan wanita yang mencapi 86 persen. Selain itu dalam penelitian yang sama, wanita dua kali lebih rajin rutin memeriksakan giginya dibanding para pria.

10. Sering makan 'fast food' Fast food menjadi budaya di beberapa negara. banyak diantara kita yang bertambah berat badan secara drastis akibat konsumsi fast food berlebihan, sebagian besarnya adalah pria. Dalam survei oleh Pew Research Center, 47 persen pria setidaknya makan fast food sepekan sekali sedang wanita hanya 35 persen diantaranya.(int)

Nugget Tahu Sayur

BAHAN : gr 200 putih • Tahu • Daging sapi cincang 150 gr • Jagung manis pipil 100 gr • Kacang polong 50 gr • Roti tawar tanpa kulit 3 lbr • Susu cair 100 ml • Bawang putih 3 siung, cincang • Telur ayam 1 btr • Garam 1 sdt • Merica bubuk 1 sdt • Gula pasir 1 sdt BAHAN PELAPIS NUGGET TAHU SAYUR: • Putih telur 2 btr, kocok rata • Tepung roti 200 gr • Minyak goreng 500 ml CARA MEMBUAT NUGGET TAHU SAYUR: • Campur tahu, daging, bawang putih, roti tawar, 50 gr jagung, telur, dan susu cair. Masukkan dalam blender, proses hingga lembut. Sisihkan. • Tambahkan kacang polong, 50 gr jagung, garam, merica, dan gula pasir. Aduk hingga rata. • Tuang adonan dalam loyang yang diolesi minyak goreng dan di alasi plastik. Ratakan. • Kukus adonan nugget selama 30 menit. Angkat, dinginkan. Potong kotak, sisihkan. (Bentuk sesuaikan dengan keinginan) • Celupkan nugget dalam putih telur kocok, lalu balut dengan tepung roti. Lakukan 2x. • Goreng nugget hingga kecokelatan. Angkat dan sajikan.(int)


4 September 2012

Angelina Jolie

Kesal Putrinya Suka Madonna

ANGELINA Jolie marah begitu tahu ketiga putrinya, Zahara, Shiloh, dan Vivienne kecanduan lagu Madonna. Cewek jagoan Lara Croft di film Tomb Raider ini, mengaku kesal bagaimana lagu Madonna bisa digemari anak-anaknya padahal dia benci. ”Bukan rahasia lagi kalau Jolie bukanlah fans Madonna. Kata dia (Jolie) musiknya benar-benar mengerikan,” kata sumber yang dirilis tabloid terbitan Amerika Serikat, National Enquirer. Jadi tak heran jika pasangan hidup Brad Pitt ini sama sekali tak suka lagu ataupun musik Madonna. Siapa sangka kini Jolie harus tahan mendengarnya di rumah setiap saat sebab ketiga putrinya fans berat Madonna. (pra/jpnn)

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober)

Di hari ini hampir tidak ada gangguan yang berarti yang akan membikin kacau. Karena suasana dan situasi cukup mendukung bisnis Anda, maka jangan ragu untuk melakukan manuver-manuver yang berbahaya sekalipun.


(21 Desember -19 Januari)

Tak perlu ragu untuk mencoba memulai hal baru, walaupun semua itu memang berat untuk di awalnya, akan tetapi yang terpenting jalani dulu semua itu. Resiko dan hambatan di kemudian hari sebaiknya dipikir sambil jalan.


(20 Januari - 18 Februari)

Teruslah berupaya meraih hasil yang terbaik. Tidak perlu menyerah dengan keadaan karena ibarat orang berjalan pasti tidak akan selalu mulus jalannya, maka dari itu tetaplah optimis dan yakin.


19 Februari - 20 Maret

Waspadalah, omongan yang berhembus itu anggaplah angin lalu. Tak perlu ditanggapi toh nantinya akan hilang dengan sendirinya ditiup angin. Cobalah lebih konsentrasi pada apa yang sedang Anda hadapi. Tak perlu memikirkan yang bukan-bukan.


(21 April - 20 Mei)

Tak ada gunanya mengobral janji kalau akhirnya hanya akan membuat beban Anda saja di kemudian hari. Bicaralah terus terang dan tak perlu menutup-tutupi kesulitan yang lagi Anda hadapi saat ini.


(21 Mei - 20 Juni)

Peruntungan cukup mujur sehingga sangat baik untuk digunakan menyelesaikan masalah yang terkatungkatung itu. Hanya saja jangan mudah percaya dengan orang lain sebelum Anda melihat sendiri buktinya.


(21 Juni- 20 Juli)

Optimis memang perlu tetapi untuk saat ini sebaiknya jangan terlalu berambisi karena situasi di sekitar Anda sulit untuk Anda prediksi. Lebih baik Anda melangkah dengan sabar tetapi sangat terencana agar kesuksesan tetap dapat Anda raih.


(21 Juli-21 Agustus)

Apapun resiko yang akan muncul sebaiknya keyakinan tetap tidak boleh bergeser, untuk itu hindari membicarakan persoalan pada orang lain agar pikiran dan visi Anda tidak sampai terganggu.


(23 Oktober - 22 November)

Jangan biarkan kecerobohan mengganggu kinerja dan kelangsungan bisnis Anda, apalagi kompetitor tampak selalu memperhatikan setiap gerak-gerik Anda.


matahari yang hangat, telah mendorong para penonton yang terdiri berbagai lapisan masyarakat maupun warga Belanda dan asing lainya tetap bertahan di arena pertunjukan dan bejoget mengikuti irama lagu. Pesta Rakyat tahun 2012 yang dipandu oleh pembawa acara Feba dan Juniarti tersebut, dibuka secara resmi Dubes RI, Retno L.P. Marsudi yang dalam sambutannya menegaskan kembali bahwa kebahagiaan menyambut Hari Kemerdekaan. Lebih dari 32 stand makanan menyajikan beragam masakan Indonesia. Rujak cingur, sate ayam, makanan padang, gudeg, soto, empek-empek, aneka kue tradisional, makanan

Aming meninggal karena sakit. Masalah pencernaan dan faktor usia juga menjadi penyebab kepergian ibunda Aming. ”Udah udzur juga dan karena pencernaan juga,” jelasnya. Dijelaskan Iyus, saat

kepergian sang ibunda, bintang film ‘Madame X’ itu sedang berada di Jakarta. Kini Aming pun sudah berada di Bandung untuk menemani sang bunda ke peristirahatan terkahir. (dtc/int)

MODEL majalah Playboy, Tiara Lestari terus berjuang untuk meminta pembatalan putusan soal hak asuh putri semata wayangnya, Rania Kancana Tadya Dalima Sjarief dari mantan suaminya, Andi Sjarief. Dia ingin anaknya tidak lagi hidup berpindah dari rumahnya ke rumah mantan suaminya. Segala upaya dilakukan oleh Tiara, salah satunya membawa saksi ahli, Seto Mulyadi atau Kak Seto untuk didengar kesaksiannya. “Kenapa kita menghadirkan Kak Seto karena akan sangat diperlukan sekali pendapat Kak Seto. Anak berumur 5 tahun dan harus berpindah itu kan sangat melelahkan. Dampaknya untuk anak itu akan didengar dari Kak Seto,” ujar pengacara Tiara, Kartika Yosodiningrat, saat ditemui di Pengadilan Agama, Jakarta Selatan, Senin (3/9). Keterangan Kak Seto tidak langsung bisa didengarkan dalam persidangan, masih harus dijadwalkan. Sementara pihak Andi juga tidak keberatan dengan adanya saksi ahli seperti Seto Mulyadi. “Sah-sah saja mereka membawa Kak Seto. Tapi kan nanti ada agendanya sendiri. Saat ini masih pembuktianpembuktian secara surat-surata saja,” ujar pengacara Andi, Indra Prasetya. Sidangnya sendiri akan kembali dilanjutkan, Senin (10/9) dengan agenda pembuktian. (kpl/int)

manado, bakso, nasi campur, batagor, sejak pagi tidak henti-hentinya melayani masyarakat Indonesia untuk menikmati hidangan khas Indonesia. Baik yang langsung dinikmati di tempat maupun dibawa pulang. (kl/int)

Meskipun hubungannya dengan Gaston Castano kembali lengket, namun status Julia Perez masih sendiri. Setelah ditinggal sang ustad pilihan ibunda, Jupe belum mau menjalani hubungan spesial dengan lelaki mana pun. Artis yang kerap berbusana seksi itu pun mengaku sedang happy menjalani statusnya sebagai janda. Pelantun ‘Goyang 69’ itu mengaku banyak dilirik lelaki karena statusnya itu. ”Saya lagi senang jadi janda, saya banyak dilirik orang, Brad Pitt saja nengok ke saya,” selorohnya saat ditemui di studio RCTI, Jakarta Barat, Senin (3/9). Jupe menjelaskan, terkadang image janda mengundang cibiran ke arahnya. Namun, Jupe mengaku tak ambil pusing. ”Lebih baik janda daripada perawan tua, saya pernah rasain jatuh-bangunnya. Kawin atau nggak urusan saya,” tuturnya. “Tapi saya harus kawin karena harus punya keturunan the next Jupe,” tambahnya mengoreksi. Kini di usianya yang sudah tak muda lagi, bintang film ‘Arwah Goyang Karawang’ itu ingin lebih berhati-hati dalam memutuskan menikah lagi. (dtc/int)

(23 Agustus-22 September)

.Tetaplah melangkah maju karena sudah kepalang tanggung untuk melangkah mundur. Lebih baik yang ada dijalani dengan kesungguhan dan kemantapan hati.


PENYANYI dangdut Ikke Nurjanah bersama artis ibukota, Hudson tampil menghibur ribuan penonton dalam Pesta Rakyat Indonesia di Wassenaar, Belanda. Pesta Rakyat yang diselenggarakan Sabtu (1/ 9) oleh KBRI Den Haag, Belanda itu mejadi acara tahunan yang meriah dalam rangka menyambut Hari Kemerdekaan Indonesia, demikian keteerangan pers KBRI Denhaag, Minggu (03/09) Artis Hudson dengan busana kebaya yang menonjolkan peran sebagai Jessica dan sekaligus dirinya sendiri mengalunkan lagu-lagu Indonesia dan barat, di antaranya Keong Racun, Cinta Semalam, Getuk dan Terajana. Sementara itu Ikke Nurjanah dengan busana yang menonjolkan pakaian tradisi Indonesia yang sangat anggun melantunkan lagu Terlena, Kegagalan Cinta dan Biduan. Di samping Hudson dan Ikke Nurjanah, juga ikut tampil meramaikan adalah Tim Kesenian Sekolah Indonesia, Biroe Band, Persatuan Pelajar Utrecht, Tim Kesenian Samosir, Night Breaker band, Ray Jeffryn, dan Marabunta Band. Cuaca yang sangat cerah, dengan sinar

”Aming seperti yang lainnya ya, shock ketika denger kabar tersebut. Maklumlah ibunya kan motivator dia juga, jadi benarbenar spesial” kata Iyus saat dihubungi. Iyus menuturkan, ibunda

(21 Maret - 20 April)

Peluang yang tinggi sebaiknya bisa diimbangi juga dengan kerja keras jangan sampai loyo ataupun tidak ada peningkatan dalam prestasi kerjanya. Di hari ini peruntungan cukup mujur sehingga selalu ada saja jalan setiap menemui suatu permasalahan.



bunda komedian Aming, Emin Rumiah meninggal dunia di usia 82 tahun pada Senin (3/9) pagi. Menurut sang manajer, Iyus Aming shock pertama kali mendengar kabar duka itu.

( 23 November - 20 Desember)

Jangan hanya diam saja melihat sikap orang lain meremehkan kemampuan diri Anda. Segera lakukan gebrakan karena bagaimanapun juga mereka ternyata tidak bisa dihadapi dengan halus.

Personel Mahadewi, Puri telah resmi dilamar oleh kekasihnya yang berprofesi sebagai dokter berinisial ‘H’ usai Lebaran lalu. Acara pertunangan yang digelar pada 26 Agustus itu pun dihadiri keluarga besar Puri dan calon suami. Segala sesuatunya pun telah dipersiapkan Puri untuk langkah selanjutnya. Pelantun ‘Dokter Cinta’ itu akan segera menggelar akad nikah. Kapan? ”Akad nikahnya 1 November,” ungkap rekan Puri di Mahadewi, Gwen, Senin (3/9).

Sebagai sahabat, Gwen pun senang Puri akan melepas lajang. “Senenglah, pas deh dia kan udah 27 tahun juga ya udah waktunya, support-lah ini kan baik ya.” katanya. Gwen yang menggantikan Tata Janeta, personel Mahadewi yang sebelumnya hengkang pun mengaku siap mempersembahkan lagu jika diminta sahabatnya bernyanyi di hari bahagia itu. ”Siap aja kalau di-request yang punya hajat sih siap,” tuturnya ramah. (dc/int)



4 September 2012

Nyaris Timpa Alonso, Grosjean Minta Maaf PEMBALAP Lotus, Romain Grosjean, minta maaf atas manuvernya yang mengakibatkan kecelakaan di F1 GP Belgia, Minggu 2 September 2012. Grosjean merasa terpukul dengan sanksi larangan tampildiGPItalia.Atastindakannya di GP Belgia, Grosjean menerima sanksi satu larangan tampil dan denda €50 ribu (setara Rp599 juta). Dengan demikian pembalap asal Prancis itu harus absen di GP Italia, akhir pekan ini. Sebuah manuver berbahaya Grosjean di awal balapan GP Belgia mengakibatkan kecelakaan yang melibatkan sejumlah mobil. Usai menyenggol ban kiri depan pembalap McLaren, Lewis Hamilton, mobil Grosjean kemudian melayang dan nyaris menimpa pembalap Ferrari Fernando Alonso. Pembalap Sauber, Sergio Perez dan Kamui Kobayashi, juga terlibat


dalam kecelakaan tersebut. Namun,namaterakhirmampumelanjutkan balapan dan finish di posisi 13. “Saya tidak bermaksud membuat pembalap lain tertekan ke tembok. Saya tidak berusaha menghentikan balapan di tikungan pertama. Saya minta maaf, dan lega tidak ada yang terluka,” ujar Grosjean seperti dilansir Autosport. “Saya melakukan kesalahan dan salah menghitung jarak dengan Hamilton. Saya yakin telah melewati dia. Jadi, kesalahan kecil yang mengakibatkan kecelakaan besar,” lanjutnya. Grosjean menilai sanksi larangan tampil di GP Italia membuatnya sangat terpukul. “Ketika Anda cinta balapan, hukumaninisangatberat.Tapi,saya menerima kesalahan. Saya marah dengan diri sendiri,” tuntasnya. Lega Fernando Alonso menyesal tidak

berhasil mendapatkan poin di Grand Prix Belgia. Namun, Alonso mengaku beruntung tidak mengalamicederaparahakibatinsidenitu. Seperti diketahui, mobil Romain Grosjean yang kehilangan kendali menabrak mobil pemuncak klasemen pembalap itu dan juga Lewis Hamilton. Insiden itu memaksa Alonso finis dari lomba lebih awal. Sementara itu, Sebastian Vettel mampu finis di peringkat kedua pada balapan kemarin. Dengan hasil ini, pembalap Red Bull itu mampu memangkas ketinggalan poin menjadi 24 angka dari pemuncak klasemen Alonso. “Saya sangat kecewa karena kehilangan poin. Namun, saya merasa sangat beruntung karena bisa mengemudikan mobil dalam waktu lima hari mendatang di Monza,” jelas Alonso, dilaporkan Autosport, Senin (3/9). (int)

Paralimpik di London

Panitia Sediakan Bus Gratis

Untuk Warga ke Venue PON XVIII PANITIA Besar PON Riau menyediakan 45 unit bus untuk masyarakat secara gratis. Bus ini akan khusus membawa warga menuju berbagai tempat pertandingan. Demikian disampaikan Humas PB PON Riau, Chairul Riski, Senin (3/9) di Pekanbaru. Riski menjelaskan, penyediaan bus ini guna mempermudah masyarakat untuk menonton langsung pertandingan yang ada di Pekanbaru. Bus angkutan khusus ke venue PON ini akan mulai beroperas pada 9 September. “Masyarakat dapat memanfaatkan bus tersebut secara gratis menuju lokasi pertandingan. Ini guna merangsang warga untuk menyaksikan jalannya pertandingan olahraga,” kata Riski. Masih menurut Riski, 45 bus gratis itu akan ditandai stiker berlambang PON. Bus ini akan melayani rayon Kecamatan Tampan, tepatnya di sekitar kampus Universitas Riau (Unri). Selanjutnya Rayon Marpoyan di sekitar kampus Universitas Islam Riau (UIR). Dan bus juga akan melayani mewuju sport center di Kecamatan Rumbai. “Bus ini selama dua pekan akan terus beroperasi guna memberikan kemudahan kepada masyarakat yang akan menyaksikan pertandingan olahraga PON. Masyarakat tentunya akan sangat terbantu dengan adanya shuttle bus seperti ini,” kata Riski. Disebutkannya, pelayanan jasa transportasi memang menjadi perhatian serius dari PB PON, tidak hanya untuk para atlet, ofisial dan tamu PON lainnya. Masyarakat yang ingin menyaksikan pertandingan-pertandingan olahraga pun harus difasilitasi. “Kita memberikan sarana transportasi gratis ini akan tetap beroperasi sejak pagi hingga pertandingan usai. Kiranya masyarakat dapat memanfaatkan fasilitas ini,” kata Riski. (int)


Tantang Bartoli di Perempatfinal PETENIS unggulan ketiga, Maria Sharapova, akhirnya berhasil melenggang ke babak perempatfinal US Open 2012 dengan mengalahkan petenis dari Rusia, Nadia Petrova, Senin (3/9). Sharapova terlibat pertandingan yang cukup sengit saat berhadapan dengan Petrova. Ia membutuhkan tiga set untuk mengkandaskan Pertova dengan skor 6-1, 4-6 dan 6-4. Dengan kemenangan ini, Sharapova akan berhadapan dengan petenis dari Prancis, Marion Bartoli, untuk merebutkan tiket ke semifinal US Open. Sebelumnya, Bartoli berhasil mengalahkan Petra Kvitova di babak keempat dengan skor akhir 1-6, 6-2, 6-0. Hasil Lengkap Babak Keempat US Open Putri: Samantha Stosur - Laura Robson 6-4, 6-4. Victoria Azarenka - Anna Tathishvili 6-2, 6-2 Maria Sharapova - Nadia Petrova Marion Bartoli - Petra Kvitova 1-6, 6-2, 6-0

Indonesia meraih medali pertama di ajang Paralimpik London, lewat petenis meja Dian David Michael Jacobs (32). David Jacobs berhasil meraih medali perunggu setelah menundukkan lawannya dari Spanyol José Manuel Ruiz Reyes dalam pertandingan semifinal di gedung Excel, London, Minggu malam. Atlet kelahiran Makassar 21 Juni 1977 ini mulai berkenalan dengan tenis meja sejak umur 10 tahun berhasil menundukkan pemain terbaik Eropa dengan 3-1. Dalam pertandingan yang cukup menegangkan, David yang awalnya menempati peringkat 40 dunia kelas 10, mendapat dukungan dari sang ayah Jan Jacobs yang berusia 71 tahun dan istrinya Jeanny Palar serta kakak lelaki yang khusus datang dari Kenya. Keberhasilan David mempersembahkan medali perunggu merupakan sejarah tersendiri bagi Indonesia, mengingat untuk pertama kalinya Indonesia berhasil meraih medali diajang pesta olahraga difabel (penyandang cacat) paling bergengsi dunia itu. Ketua Umum Komite Paralympic Indonesia Senny Marbun mengatakan bahwa suatu kebanggaan akhirnya David berhasil mempersembahkan medali bagi Indonesia.

“Pertama kami berterima kasih kepada Tuhan yang telah mengizinkan David mendapatkan medali yang merupakan medali pertama Indonesia dalam Paralimpik,” ujar Senny usai acara pengibaran bendera. Pertarungan tenis meja di kelas 10 ini pertandingan David sendiri cukup menegangkan, set pertama dimenangkannya 11-9, dibabak kedua Ruiz Reyes bangkit dan menang 11-7. Namun dengan ketenangan David babak ketiga dan empat diraih dengan mudah 11-5 dan 11-6. Usai pertandingan, David tampak tidak dapat menahan haru dan bahkan sempat berlutut dan airmatanya pun menetes sambil melambaikan tangannya ke arah suporter Indonesia, yang mengibarkan bendera Merah Putih. Sang pelatih Pribadi mengakui meskipun baru pertama kali mengikuti kejuaraan Paralimpic, David langsung memberikan yang terbaik buat bangsanya. “Paralimpik di London merupakan ajang pertama bagi David dan kita bersyukur akhirnya bisa

mempersembahkan medali,” ujar Pribadi. Sementara itu Ketua Kontingen Indonesia James Tangkudung menyampaikan terimah kasih kepada masyarakat Indonesia yang bermukim di London dan masyarakat Indonesia pada umumnya atas doa dan dukungannya. “ Ini prestasi terbaik tim paralimpic Indonesia,” ujar mantan Deputi Menteri Bidang Pembudayaan Olahraga Kementerian Pemuda dan Olahraga. Walaupun pertandingan telah berakhir, suporter Indonesia tak satu pun beranjak meninggalkan tempat duduknya menantikan upacara penyerahan medali dan pengibaran bendera merah putih yang merupakan saat saat bersejarah bagi bangsa Indonesia khususnya penghormatan bagi para penyandang cacat di Indonesia. (int)

Dian David Michael Jacobs, peraih medali pertama Paralimpik di London dari cabang tenis meja.

Button Rayakan Kemenangan DENGAN JESSICA PEMBALAP McLaren Mercedes Jenson Button sukses meraih kemenangan di GP Belgia. Ini merupakan kemenangan kedua Button di musim ini setelah balapan pembuka musim 2012 di GP Australia. Button tampil menawan dengan terus memimpin jalannya balapan dari pole-position. Performa Button yang sempat diperkirakan akan melemah di tengah musim justru tidak terlihat di Spa Francorchamps. Mantan pembalap Williams ini pun menutup GP Belgia dengan gembira. Usai penyerahan piala dan wawancara dengan media, Button langsung merayakannya dengan seluruh kru McLaren. Tak hanya itu, kekasih Button, Jessica Michibata juga tampak hadir. Model 27 tahun itu bahkan mengenakan seragam tim McLaren yang berwarna oranye dan terlihat akrab dengan kru McLaren lainnya bahkan dengan rekan setim Button, Lewis Hamilton. Jessica dan Jenson sudah berpacaran selama dua tahun dan Jessica cukup dikenal di paddock F1 karena sering menemani B u t t o n balapan di beberapa Grand Prix. (int)

SELASA 4 September 2012

Van Persie Tentang Kegagalan Penaltinya

„ Robin van Persie tampil memukau saat membuat trigol untuk memenangkan Manchester United atas Southampton

SOUTHAMPTON-RobinvanPersie tampil memukau saat membuat trigol untuk memenangkan Manchester United atas Southampton. Tapi,kenapadiasampaigagaldalam eksekusipenaltialaPanenkaitu? Di menit 69, saat MU tertinggal 1-2 di St Mary’s Stadium, Minggu (2/9/2012),VanPersiemajusebagai algojo penalti setelah dirinya dijatuhkan seorang pemain lawan di kotak 16 meter. Sebagaimana orang selalu tak menyangka jika penendang penalti melakukannya dengan mencungkil bola — diciptakan oleh Antonin Panenka dari Cekoslowakia di final Piala Dunia 1976, terakhir dilakukan oleh Andrea Pirlo di Piala Eropa 2012 -–, begitu pula yang dilakukan Van Persie. Sial buat dia, cungkilannya buruk dan bisa dihalau oleh kiper Kelvin Davis. Untungnya bagi dia, eks bintang Arsenal bisa mencetak gol lagi di menit 86 dan injury time, sehinggaMUmenang3-2,danVan Persie tetap jadi pahlawan. “Aku tidak tahu apa yang aku pikirkan

Napoli Atasi Fiorentina Lazio Hantam Palermo NAPLES - Napoli tak kehilangan angka saat menjadi tuan rumah untuk Fiorentina di pekan kedua Seri A. Lazio juga meraih kemenangan cukup telak atas tamunya Palermo. Menjamu La Viola di San Paolo, Minggu (2/ 9) malam, Napoli menang tipis 2-1. Di Olimpico, Lazio mengungguli Rosanero dengan skor 3-0.

membuatnyadimenit39dan82. Satu gol lain dari Biancoceleste diukir gelandang Antonio Candreva di menit 56. Sama seperti Juve dan Napoli, Lazio juga telah memiliki enam angka dari dua pertandingan. Mereka duduk di tempat ketiga hanyakarenataklebihbaikselisih golnya dari kedua rivalnya itu.

„ Marek Hamsik

Susunan Pemain


emenangan Napoli dibuka oleh Marek Hamsik di menit ke-10 babak kedua. Dari tendangan bebas yang dilepaskan Juan Zuniga, Hamsik menyundul bola, yang kemudian sempat mengenai Borja Valero dan bersarang di gawang Emiliano Viviano. Gol ini dicatat sebagai bunuh diri Valero. Di menit 75 Il Patenopei menggandakan keunggulannya. Blerim Dzemaili meluncurkan tembakan setengah voli dari

depan kotak penalti dan mengubah kedudukan menjadi 20. Fiorentina tidak menyerah dan mencoba menekan Napoli di sisa pertandingan. Atas upayanya itu mereka menghasilkan satu gol dari tendangan lengkung nan menawan dari Stevan

Jovetic di menit 87. Tapi itu tak cukup untuk menghindarkan skuat Vincenzo Montella dari kekalahan. Kemenangan kedua dari dua pertandingannya itu membuat Napoli berada di urutan kedua klasemen sementara. Mereka hanya kalah selisih gol dari Ju-

ventus, yang juga telah mengutip enam angka dari dua laga. Fiorentina, yang di pekan pertama menang 2-1 atas Udinese, turun ke peringkat 11. Sementara itu Miroslav Klose mencetakduadaritigagolkemenangan Lazio atas Palermo. Bomber veteran Jerman itu

Napoli: De Sanctis; Campagnaro, Cannavaro, Britos; Maggio, Behrami (Inler 52), Dzemaili, Hamsik (Donadel 89), Zuniga; Insigne (Vargas 81); Cavani Fiorentina: Viviano; Roncaglia, Gonzalo Rodriguez, Tomovic; Cuadrado, Romulo (Seferovic 85), Pizarro, Borja Valero, Pasqual (Fernandez 78); El Hamdaoui (Ljajic 69), Jovetic Lazio: Marchetti; Konko, Biava, Dias, Lulic; Ledesma; Mauri (Onazi 80), Gonzalez, Hernanes (Scaloni 86), Candreva; Klose (Kozak 89) Palermo: Ujkani; Pisano, Cetto, Von Bergen, Garcia; Giorgi (Arevalo Rios 51), Kurtic (Hernandez 58), Barreto, Bertolo; Ilicic, Miccoli (Dybala 58)

Persib Umumkan Skuad Sementara

„ Wenger

Wenger Tetap Percaya Giroud LONDON-Setelahmenjalanitiga lagabersamaArsenal,OlivierGiroud belumjugamamputampilimpresif. Kendati demikian, manajer Arsene WengerpercayabahwaGiroudbisa suksesdiPremierLeague. Pemain Prancis ini jadi satusatunya pemain rekrutan utama The Gunners yang ditunggu golnya. Soalnya Lukas Podolski dan Santi Cazorla sudah mencatatkan nama mereka di papan skor dalam kemenangan 2-0 atas Liverpool di Anfield, kemarin malam. Statistiknya pun tidak terlalu bagus; total tujuh tembakan, tanpa assist, sehingga tak ayal top skorer Ligue 1 di musim lalu ini pun mulai diragukan, apakah dia mampu

memenuhi ekspektasi. Wenger menganggap penilaian negatif yang dialamatkan terhadap Giroud masih terlalu dini. Laga ketat melawan The Reds diyakini akan jadi proses pembelajaran untuk pemainnya itu. “Saya percaya dengan dia,” ucap Wenger seperti diwartakan Mirror. “Giroud sedang dalam masa adaptasi. Dia sudah menunjukkan bahwa dia siap dalam sebuah pertarungan dan saya yakin dia akan beradaptasi dengan intensitas striker Inggris.” “Melawan (Martin) Skrtel dia telah menemukan bagaimana sebenarnya Premier League itu,” pungkas The Professor. (int/int)

BANDUNG–SkuadPersibBandung yang akan berkompetisi di Indonesia Super League (ISL) 2012-2013 belum sepenuhnya hadir dalam pertemuan yang digelar PT Persib Bandung Bermartabat (PT PBB), Senin (3/9). Hal itu diketahui setelah pengurus Persib dan ofisial tim melakukanpertemuandikantorPTPBB. Didampingi pelatih Jajang Nurjaman,sebanyak10pemainmusim lalu melakukan pembicaraan mengenai persiapan menghadapi kompetisi musim depan. Jajang mengumumkan22namapemain yang akan menjadi skuad Persib musim depan. Dari komposisi itu, 50% adalah pemain lama. Dari pemain musim lalu, sebanyak11namapemaindipertahankan yaitu Cecep Supriatna, Rizky Bagja, Maman Abdurahman, AbandaHerman,JajangSukmara, Tony Sucipto, M Agung Pribadi, Atep, Hariono, Sigit Hermawan dan Airlangga Sucipto. Hanya saja Abanda Herman yang termasuk sebagai pemain yang dipertahankan Persib berhalangan hadir di Graha Persib tersebut. “Hari ini konsolidasi pertama dengan para pemain yang dipertahankan. Hari initidakjadilatihan,hanyakumpul saja. Pemain lama yang dipertahankan sudah datang, tinggal menunggu yang baru,” ungkap Jajang kepada wartawan. Semula, Jajang berencana melakukan tes medis pada Senin (3/ 9). Namun dijadwal ulang pada

Selasa (4/9). Mantan asisten pelatihPeliaJayainipunmenegaskan para pemain yang hadir sudah dipastikan akan berkostum Persib meski secara resmi akan melakukan penandatangan kontrak 10 September mendatang. “Saya pastikan mereka tetap bersama Persib. Saya juga sudah meminta komitmen mereka untuk tetap bersama Persib musim depan,” jelas Jajang. Terhadap skuad lama yang tidak dipertahankan, Jajang mengaku sudah menyampaikan secara baik-baik. Ada empat pemain penting musim lalu yang tidak dipertahankan yakni Zulkifli Syukur, Muhammad Ilham, Muhammad Nasuha, dan Aliyudin. Menurutnya, keputusan diambilberdasarpertimbangandan pengamatannya selama ini terhadap kebutuhan komposisi Persib di mana kontribusi keempat pemainitudinilaikurangmaksimal terhadap tim. Salah satunya M Nasuha yang sering diistirahatkan karena mendapatkan cedera. Manajer tim Persib yang juga menjabat sebagai Komisaris PT PBB Umuh Muchtar mengaku sangat berat dengan melepas para pemain tersebut. Menurutnya, keputusan melepas beberapa pemain sudah sesuai pertimbangan tim pelatih. “Saya sudah beri tahu mereka secara baik-baik. Saya hanya menjalankan perekrutan dan melakukan negoisasi sesuai dengan keinginan pelatih dan berdasarkan keputusan ber-

sama-sama,” terangnya. Sementara, soal perekrutan pemain baru Umuh mengatakan, tidak ada lagi masalah. “Rasanya tidakakanadamasalahkarenakita sudah mengikuti aturan yang benar.Kitabicaralangsungdengan pemain dan sudah deal. Bahkan, sebagian sudah diberikan DP,” jelasnya. Para pemain baru akan menandatangani kontrak pada 10 September mendatang.(int) PEMAIN LAMA Cecep Supriatna Rizky Bagja Maman Abdurahman Abanda Herman Jajang Sukmara Tony Sucipto M Agung Pribadi Atep Hariono Sigit Hermawan Airlangga Sucipto PEMAIN BARU IMadeWirawan(Persiba/Penjagagawang) Shahar Ginanjar (Pelita Jaya/ Penjaga gawang) Jamie Coyne (Sriwijaya FC/Bek) Supardi (SFC/Bek) Aang Suparman (Persibo-Bek) Asri Akbar (Persiba/Gelandang) Firman Utina (Sriwijaya FC/ Gelandang) M Ridwan (Sriwijaya FC/Gelandang) Mbida Messi (Kamerun/Gelandang) Kenji Adachihara (Persiba/Striker) Dzumafo Epandi (Arema/Striker)

dengan penalti itu. Tadinya aku ingin menendang keras, sebagaimana selalu aku lakukan. Tapi di detik terakhir aku berubah pikiran,” ungkap pria 29 tahun itu kepada MUTV. “Tak cukup baik, makanya aku sedikit down. Jujur saja, aku kecewa. Aku memasang standar tertentu untuk permainanku, dan ketika hal seperti itu terjadi, apalagi saat tim Anda tertinggal 2-1, mestinya Anda tak boleh mengambil penalti seperti itu.” Van Persie menambahkan, dia siap disalahkan jika efek kegagalan penaltinya itu buruk buat tim. Dia pun berjanji akan belajar dari pengalaman ini, serta sangat lega karena akhirnya MU menang. “Saya kaget dia melakukannya dengan cara begitu,” komentar pelatih Sir Alex Ferguson. “Biasanya dia melesakkannya ke gawang. Setiap kali saya melihat menembak keras ke kiri dan kanan. Mungkin dia terlalu percaya diri. Tapi dia telah membayarnya dengan dua gol berikutnya.” (int)

Rodgers: Sahin Akan Semakin Bagus LIVERPOOL- Manajer Liverpool Brendan Rodgers mengaku puas dengan penampilan Nuri Sahin di laga melawan Arsenal, Minggu (2/9) malam WIB. Sahin diyakini cocok dengan gaya Liverpool dan tampil kian bagus. PertandingandiAnfieldtersebut menandai debut Sahin bersama Liverpool setelah resmi dipinjamkan oleh Real Madrid. Pesepakbola berdarah Turki itu diplot sebagai starter dan digantikan Jonjo Shelvey di menit 67. Sayangnya, debut Sahin tidak berakhir manis. The Reds dibungkam dua gol tanpa balas oleh Arsenal lewat Lukas Podolski dan Santi Cazorla. Meski tak menuntaskan laga, Sahin telah memberikan kesan positif buat Rodgers. Eks bintang Borussia Dortmund ini dipercaya akan berperan penting untuk Liverpool di musim ini. “Dia tidak punya waktu bermain yang banyak, Nuri, jadi mendapatkan 65 menit bagus untuk dia,” ucap Rodgers yang dikutip dari situs resmi klub. “Dia menunjukkan bahwa dia

„ Nuri Sahin adalah seorang pesepakbola yang hebat dan dia akan cocok dengan gaya permainan kami. Dia seorangpemudayangbaikdandiakini semakin bugar dan kuat dia akan tampil semakin bagus,” yakin eks manajer Swansea itu. Walau gagal bersama Madrid, Sahinpunyastatistikokesaatmasih bersama Dortmund. Di musim 2010-11 ia berperan besar dalam sukses Dortmund menjadi kampiun sekaligus menyabet pemain terbaik Bundesliga. (int)

„ Andik Virmansyah

Bakal Berlatih di AS Andik Ngaku Terkendala Bahasa SURABAYA-AndikVirmansyah mengaku senang kala mendapatkan undangan berlatih dari salahsatu klub Amerika Serikat. Namun, ada satu yang jadi masalah: bahasa. Meski ada rumor yang beredar bahwaklubyangmengundangnya adalah DC United, Andik belum mau membenarkannya. Namun, menurut pengakuannya, klub tersebut berasal dari MLS. Menurut Andik, undangan tersebut adalah mimpi yang jadi kenyataan—meski hanya undangan latihan bersama. Namun. pemain bernomor punggung 10 di Persebaya ini membantah jika dirinya akan dikontrak permanen oleh klub itu. “Ini bukan seleksi, tapi ikut latihan di klub yang berlaga di MLS,” katanya disela-sela latihan fisik di Lapangan Persebaya, Jalan Karanggayam Surabaya, Senin (3/ 9). Akan tetapi pemuda kelahiran 23 November 1991 ini berharap, dengan adanya undangan latihan bersama ini dia bisa mewujudkan mimpinya untuk bermain di luar negeri. “Mohon doa restunya. Siapa tahu cuma ikut latihan terus bisa dikontrak permanen,” harapnya. Andik juga mengungkapkan, jika klub yang mengundang dirinya untuk berlatih bersama meng-

inginkan agar dirinya segera bergabung usai menerima undangan yang diterimanya saat bulan puasa. “Karena saat itu saya masih dalam proses penyembuhan cedera dan kondisi fisik saya drop karena puasa, maka saya meminta pengunduran keberangkatan dan alhamdulillahmerekamemaklumi kondisi saya,” ungkap Andik. Meski mengaku sudah siap dan bersyukur bisa berlatih di luar negeri, anak pasangan Saman dan Jumiah ini mengaku ada beberapa hal yang membuat dirinya minder, yakni masalah bahasa untuk berkomunikasi. Hal lainnya, ia mengaku sama sekali buta soal cuaca di Negeri Paman Sam itu. “Kalau masalah skill, fisik, saya siap bersaing. Tapi untuk masalah komunikasi ini yang saya takutkan. Bisanyabisatapikanlittle-littlealias pasif,” ujarnya. “Kalau makanan sudah terbiasa, kalau cuaca saya kurang tahu. Selain itu lama di sana sehingga pasti bisa adaptasi. Sedangkan nama klubnya, mohon maaf saya tidak bisa sebut,” kata Andik. Dengan diterimanya undangan latihan bersama tersebut, Andik juga dipastikan tidak bisa memperkuat timnas U-22, yang akan melakoni laga persahabatan dengan Vietnam di Surabaya, 9 September 2012. (int)

SELASA 4 September 2012

ENGLISH PREMIER LEAGUE No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Team Chelsea Swansea City West Brom Man City Man United Everton West Ham Arsenal Wigan Newcastle Fulham Stoke City Sunderland Tottenham Norwich City Reading Aston Villa Liverpool QPR Southampton

M 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 2 3 3 3 3

M 3 2 2 2 2 2 2 1 1 1 1 0 0 0 0 0 0 0 0 0

S 0 1 1 1 0 0 0 2 1 1 0 3 2 2 2 1 1 1 1 0

K 0 0 0 0 1 1 1 0 1 1 2 0 0 1 1 1 2 2 2 3

SG 8-2 10-2 6-1 8-5 6-5 4-3 4-3 2-0 4-4 3-4 7-6 3-3 2-2 3-4 2-7 3-5 2-5 2-7 2-9 4-8

Nilai 9 7 7 7 6 6 6 5 4 4 3 3 2 2 2 1 1 1 1 0

TOP SCORER Gol 4 4 3

Nama Klub Michu Swansea City R. van Persie Manchester United C. Tévez Manchester City

SPANISH LA LIGA No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Team M Barcelona 3 Mallorca 3 Málaga 3 Rayo Vallecano 3 Real Valladolid 3 Deportivo 3 Sevilla 3 Getafe 3 Atlético Madrid 2 Levante 3 Real Madrid 3 Real Betis 2 Real Sociedad 3 Real Zaragoza 3 Celta de Vigo 3 Athletic Club 3 Valencia 3 Granada 3 Espanyol 3 Osasuna 3

M 3 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0

S 0 1 1 1 0 2 2 1 1 1 1 0 0 0 0 0 2 1 0 0

BARCELONA K 0 0 0 0 1 0 0 1 0 1 1 1 2 2 2 2 1 2 3 3

SG 8-2 4-2 3-1 3-1 3-2 6-4 3-2 4-4 5-1 4-5 5-3 6-5 3-7 2-3 3-3 5-9 4-5 1-5 4-7 1-6

Nilai 9 7 7 7 6 5 5 4 4 4 4 3 3 3 3 3 2 1 0 0

TOP SCORER Gol 4 3 3

Nama L. Messi R. Falcao T. Hemed

BARCELONA- Gol tunggal Adriano membuat laga Barcelona versus Valencia di Camp Nou dimenangi tuan rumah. Los Cules pun tetap memuncaki klasemen sementara Liga Spanyol. Dari 14 tembakan yang dilakukan Barca, lima di antaranya mengarah ke gawang, tapi yang

menembus gawang Diego Alves adalah yang dihasilkan Adriano di menit 23, menjadikan pertandingan ini berakhir 1-0. Pemain berpaspor Brasil membuat gol tersebut setelah mendapatkan bola dari sepak pojok pendek, lalu dari sudut kotak penalti melepaskan tembakan ke bagian atas tiang jauh gawang Valencia. Gol itu membuat permainan lebih terbuka. Berselang lima



menit Barca mendapatkan peluang lagi dari kerja sama Pedro dan Cesc Fabregas, tapi penyelesaian akhirnya tidak membuahkan gol. Tim tamu mencoba lebih berani menyerang di babak kedua. Namun mereka kesulitan menandangi penguasaan bola yang sudah jadi trade mark Barca. Statistik mencatat, ball possession tuan rumah 67% sedangkan El Che 33%.

Klub Barcelona Atlético Madrid Mallorca

Juventus Napoli Lazio Sampdoria Roma Catania Torino Genoa Internazionale Milan Fiorentina Chievo Parma Cagliari Udinese Bologna Palermo Pescara Atalanta Siena

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

2 2 2 2 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0

0 0 0 0 1 1 1 0 0 0 0 0 0 1 0 0 0 0 1 1

TOP SCORER Gol 3 3 2

Nama S. Jovetiæ G. Pazzini G. Bergessio

Klub Fiorentina Milan Catania

0 0 0 0 0 0 0 1 1 1 1 1 1 1 2 2 2 2 1 1

6-1 5-1 4-0 3-1 5-3 5-4 3-0 4-3 4-3 3-2 3-3 2-2 2-2 1-3 2-6 1-5 0-6 0-6 1-2 1-2

Kesempatan terbaik Barca di babak kedua terjadi ketika Alexis Sanchez berhasil membuka pertahanan lawan, tapi tembakan lanjutan dari Fabregas melambung. Valencia sempat menggetarkan gawang Victor Valdes melalui tendangan Victor Ruiz, tapi gol tersebut dianulir wasit karena terjadi offside. Sampai pertandingan selesai

skor tidak berubah, tetap 1-0. Susunan pemain: Barcelona: Valdes; Alves (Alba 46), Pique, Mascherano, Adriano; Fabregas (Iniesta 64), Xavi, Song; Alexis (Busquets 87), Messi, Pedro Valencia: Diego Alves; Pereira, Rami, V. Ruiz, Cissokho; Feghouli (Valdez 81), T.Costa, Abelda (Gago 77), Guardado (Viera 77); Jonas, Soldado

Rumor-Rumor di Belakang Wajah Sedih CR7

ITALIAN SERIE A 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20


6 6 6 5 4 4 3 3 3 3 3 3 3 1 0 0 0 0 -1 -5

Roma Teu k k Inter 3-1 di Meazza MILAN-ASRomamemetikkemenangan pertamanya di musim ini. Bertandang ke Giuseppe Meazza, Roma menang 3-1 atas Inter Milan. Di laga yang dimainkan di Giuseppe Meazza, Senin (3/9) dinihari WIB, Roma unggul lebih dulu saat laga berjalan 15 menit. Umpan Francesco Totti dari sisi kiri disundul oleh Alessandro Florenzi yang berdiri bebas di dalam kotak penalti Inter. Tertinggal satu gol, Inter mengambil inisiatif menyerang. Tapi peluang Inter lewat Diego Milito di menit ke17 masih mampu digagalkan oleh Maarten Stekelenburg. Inter kembali mendapat peluang, kali ini lewat tendangan bebas Wesley Sneijder. Namun bola eksekusi Sneijder bisa diamankan oleh Stekelenburg. Di ujung babak pertama, Inter menyamakan kedudukan lewat sepakanAntonioCassano.Tembakannya mengenai Nicolas Burdisso dan

mengecoh Stekelenburg. Hingga turun minum, skor imbang 1-1 tetap bertahan. Roma mendapat peluang emas di awal babak kedua. Berawal dari umpan Panagiotis Tacthsidis, Pablo Osvaldo yang berdiri bebas kemudianmelepaskantembakan.Tapisial bagi Osvaldo, upayanya masih belum menemui sasaran. Osvaldo membawa Roma unggul di menit ke-67. Meneruskan umpan Totti, Osvaldo mencungkil bola melewati Luca Castelazzi dan mengubah skor menjadi 2-1. Marquihno menambah keung-

gulan Roma di menit ke-79. Menerima umpan dari Osvaldo, Marquinho yang bergerak dari sisi kiri kemudian melepaskan tembakan dari sudut sempit ke pojok gawang Castelazzi. Di masa injury time, Roma harus bermain dengan 10 orang. Osvaldo menerima kartu kuning kedua setelah melakukan handball. Hingga peluit panjang berbunyi, skor 3-1 untuk keunggulan Roma tetap tidak berubah. Dengan kemenangan ini, Roma merangkak ke peringkat lima dengan empat poin. Sementara Inter tertahan di posisi delapan dengan tiga poin.

Susunan Pemain: Inter: Castellazzi; Zanetti, Silvestre, Ranocchia, Nagatomo; Guarin, Gargano (Coutinho 76), Pereira (Cambiasso 66); Sneijder; Cassano (Palacio 50), Milito

Roma: Stekelenburg; Piris, Burdisso, Castan, Balzaretti (Taddei 56); Florenzi, Tachtsidis, De Rossi (Marquinho 32); Destro (Lamela 69), Osvaldo, Totti

MADRID-Belumdiketahuisecara pasti apa yang menyebabkan Cristiano Ronaldo bersedih hati. Spekulasi menyebut, si pemain ingin meninggalkan Real Madrid karena beberapa persoalan tertentu. Wajah sendu pemain Portugal itu jelasterlihatsetelahmencetakduagol dari tiga gol Madrid ke gawang Granada pada Senin (3/9) dinihari tadi. Jangankan melakukan selebrasi, ia bahkan tidak tersenyum. Seusai pertandingan, Ronaldo mengungkapkankepadamediabahwa dia sedang tidak bahagia dan klub mengetahui situasi tersebut. Namun demikian,pemainterbaikdunia2008 initidakmenjelaskanlebihlanjutsoal permasalahan ini. Dugaan bahwa Ronaldo marah dengan kemenangan Andres Iniesta dalam pemilihan pemain terbaik UEFA 2011/12 bukanlah alasannya. “Tidak ada hubungannya dengan itu. Iniesta pantas mendapatkannya,” ujar Ronaldo. Lantas apa? Dilansir Football Espana, radio terkemuka Spanyol Cadena SER mengklaim Ronaldo

telah mengungkapkan ketidaknyamannya di Madrid kepada Presiden Florentino Perez dan direktur umum Jose Angel Sanchez dalam pertemuan pada Sabtu (1/9). Ditambahkan pula ada isu bahwa Ronaldotidakakurdenganbeberapa rekan satu timnya. Mantan pemain Manchester United itu kabarnya tak senang dengan Marcelo yang barubaru ini berkomentar bahwa kiper Iker Casillas lebih pantas memperoleh Balon d’Or ketimbang dirinya, yang mana itu diyakini akan merugikan Ronaldo. Sedangkan dari kabar yang didapat Telegraph, penyebab Ronaldo gusar adalah perlakuan klub terhadap Kaka. Pemain Brasil tersebut kini tidak jelas masa depannya karena tak ada klub yang bersedia menggaetnya lantaran gajinya yang tinggi, namun juga tak masuk dalam rencana Jose Mourinho. Ronaldo sudah bermukim di Madrid selama tiga tahun dan selama itu pula ia menjadi pemain terbaik mereka dengan andil besarnya dalam suksesmeraihCopadelReydanjuara La Liga. Musim lalu, Ronaldo mengatakan akan senang untuk menghabiskan kariernya bersama Los Merengues. Tampaknya itu menjadi indikasi bahwa dia menginginkan sebuah kontrak baru, namun sampai saat ini klub belum menunjukkan tanda-tandaakanmenawari kesepakatan baru. Well, apa yang sebenarnya terjadi dengan Ronaldo? (int)






SELASA, 4 September 2012 Edisi 237


Mayat pria berkain sarung diperiksa petugas kesehatan di ruang jenazah RSUD Psp.

Basyrah Lubis Belum Pulangkan Mobil Dinas PALAS – Mantan Bupati Padang Lawas (Palas) Basyrah Lubis hingga saat ini belum memulangkan mobil dinas milik pemkab. Selain Basyrah, mantan Sekda Palas Gusnar Hasibuan dan lima mantan pejabat lainnya juga melakukan hal serupa. Kabag Umum Pemkab Basyrah Palas Bustami Harahap menerangkan, masih ada tujuh unit kendaraan roda empat yang belum tertarik, termasuk kenBaca

Pria Berkain Sarung TEWAS KELAPARAN SIDIMPUAN- Pria tanpa identitas dan hanya mengenakan kain sarung ditemukan meninggal di trotoar pinggiran jembatan Siborang, perbatasan Kelurahan Kantin dan Wek V, Kecamatan Padangsidimpuan (Psp) Selatan, Senin (3/9).

Menurut Kapolres Psp AKBP Andi S Taufik melalui Kabag Humas AKP Indra F Dalimunte, mayat ini ditemukan warga sekira pukul 18.00 WIB dengan posisi telentang atau seperti tertidur dengan penyangganya badan jembatan. Selanjutnya, warga melaporkan penemuan Baca

Pria ...Hal 6

10 Peserta Asal Tabagsel Lulus Seleksi Akademis Calon Praja IPDN MEDAN- Sebanyak 102 peserta dari 518 orang yang mengikuti tes dinyatakan lulus seleksi akademis pada penerimaan calon praja Institut Pemerintahan Dalam Negeri (IPDN) tahun ajaran 2012/2013. Sepuluh di antaranya berasal dari lima daerah di wilayah Tapanuli Bagian Selatan

Basyrah Lubis ...Hal 6


10 Peserta ...Hal 6


Calon Wali Kota Psp Dedi Jaminsyah Putra membeli cabai pedagang kaki lima di Pasar Sangkumpal Bonang, kemarin

Sapa Warga di Pasar Sangkumpal Bonang

DEDI-AFFAN BELANJA CABAI SIDIMPUAN- Pasangan Calon Walikota dan Wakil Walikota Padangsidimpuan (Psp) Nomor Urut 4, Dedi Jaminsyah Putra Harahap SSTP MSP-H Affan Siregar SE bersama tim menyapa banyak pedagang dan pembeli di Pasar Sangkumpal Bonang, Plaza ATC dan sejumlah pedagang kaki lima, Senin (3/9). Momen itu juga, selain di-

Ketika Para Pesepak Bola Indonesia Bergaya di Catwalk

Ponaryo Menahan Senyum, Jajang Sempat Gemetar Sejumlah pemain sepak bola menjadi model dadakan atas permintaan mantan punggawa timnas yang kini menyambi desainer, Isnan Ali. Hanya berlatih sekali, ada yang santai, ada pula yang sampai berkeringat dingin. M Ali Mahrus, Jakarta

TATAPAN matanya lurus. Di bawah sorot lampu disko dan

Tahun III


Ponaryo saat bergaya di catwalk bertema UIFashionWeek.

iringan musik mengentak, bibirnya tampak menahan senyum. Dengan langkah mantap, dia bergaya bak model profesional memamerkan pakaian yang dikenakan. Padahal, catwalk sama sekali bukan panggungnya. ‘Tempat bermainnya’ sehari-hari justru di lapangan hijau. Ya, dia adalah Ponaryo Astaman, mantan kapBaca

Ponaryo ...Hal 7

Kami akan Jadi Raja yang Sayang Rakyatnya PASANGAN Calon Walikota dan Wakil Walikota Padangsidimpuan (Psp) Nomor Urut 4, Dedi Jaminsyah Putra Harahap SSTP MSP-H Affan Siregar SE mengutarakan, antusias masyarakat di acara Borhat-borhat Dedi-Affan (Menghantarkan De-

di-Affan di pemilukada Psp 18 Oktober), Minggu (2/9) lalu, karena keikhlasan. “Tidak mungkin kita hadir di sini kalau bukan karena kita bersaudara. Tidak mungkin kita Baca

Kami ...Hal 7


Dedi...Hal 7

Tidak Ada Bayi Tergencet, Akuarium pun Jadi Hari itu wartawan Oleh Dahlan Iskan foto berbondong ke Menteri BUMN Stasiun Pasar Senen, Jakarta. Semua wartawan (he he he, saya pun dulu begitu) sudah hafal ini: Stasiun Senen adalah objek berita yang paling menarik di setiap menjelang Lebaran. Tidak usah menunggu perintah redaksi, wartawan pun tahu. Ke Senen-lah cara terbaik Baca

Tidak ...Hal 6






4 September 2012

Kinerja Pansus PT Palmaris Tak Jelas Habiskan Dana Hampir Rp300 Juta MADINA-Walaupun sudah dua kali penamabahan waktu kerja dan sudah menghabiskan anggaran sekira Rp300 juta, kinerja panitia khusus (Pansus) PT Palmaris Raya di DPRD Mandailing Natal (Madina) belum jelas. Hingga saat ini rekeomendasi hasil kerjanya tak ada. Sejumlah elemen masyarakat meminta kepada Pansus PT Palmaris Raya DPRD Madina agar segera merekomendasikan hasil kerjanya yang sudah berjalan lebih dari 4 bulan terhitung mulai bulan April lalu. Mereka menilai, pansus ini sudah melukai hati masyarakat Kecamatan Batahan, yang belasan dianiaya perusahaan. Selama itu pula masyarakat menggantungkan harapan kepada Pansus PT Palmaris yang dibentuk paska aksi nginap di gedung dewan beberapa waktu lalu. Ketua Forum Komunikasi Indonesia Bersatu wilayah Pantai Barat, Toguan Lubis kepada METRO, Senin (3/9) menyampaikan, masyarakat di Kecamatan Batahan khususnya yang bermasalah lahan dengan pihak perusahaan, sudah terlalu lama menantikan keputusan yang dari persengketaan yang mereka hadapi saat ini. Pasalnya, warga merasa belasan tahun dizalimi perusahaan. Terakhir, puncak kekesalan warga terjadi pada tanggal 9 April lalu, dimana ratusan warga termasuk anak-anak berangkat dari Batahan menuju gedung DPRD untuk menyampaikan tuntutan hak milik mereka bahkan sempat melakukan aksi menginap di gedung dewan beberapa malam. Akhirnya ketika itu, Pemkab Madina mengeluarkan surat

KPU Bakal Verifikasi Ulang Seluruh Parpol RANTAU – Komisi Pemilihan Umum (KPU) Labuhanbatu bakal melakukan verifikasi ulang seluruh Partai Politik (Parpol) yang akan mengikuti pemilu 2014. Verifikasi ulang seluruh parpol tersebut rencananya dilaksanakan mulai pertengahan September. “Kami akan melakukan verifikasi ulang mulai bulan pertengahan September ini sesuai dengan keputusan MK,” kata Ketua Divisi Sosialisasi KPU Labuhanbatu M Sofyan MA. Dijelaskan Sofyan, sesuai dengan Pasal 8 Ayat (1) UU Nomor 8/2012 tentang pemilu yang yang dibatalkan MK itu berbunyi, ”Partai politik peserta pemilu pada pemilu terakhir yang memenuhi ambang batas perolehan suara dari jumlah suara sah secara nasional ditetapkan sebagai partai politik peserta pemilu pada pemilu berikutnya.” Sedang Pasal 208 yang dibatalkan adalah pem-

berlakuan ambang batas 3,5 persen secara nasional dan menyatakan ambang batas 3,5 persen hanya berlaku untuk DPR. Dengan pembatalan MK itu, katanya, berarti seluruh partai politik baik lama maupun baru, memiliki kursi di parlemen atau tidak, harus mengikuti verifikasi di KPU untuk jadi peserta Pemilu 2014. Walaupun agenda KPU Labuhanbatu padat dengan masuknya tahapan Pilgubsu 2013, pihaknya siap melakukan verifikasi parpol calon peserta Pemilu 2014. Sofyan menambahkan, bulan September ini akan diadakan sosialisasi verifikasi parpol menjadi peserta Pemilu 2014 dengan mengundang semua parpol, baik yang lama maupun yang baru. Bentuk verifikasi faktual parpol tingkat kabupaten/ kota, yaitu mengenai kepengurusan, keterwakilan perempuan, kantor parpol dan verifikasi keanggotaan parpol. (riz)

PTPN 3 Diminta Desak Polisi Tahan Pencuri Sawit di Afdeling II Mambang Muda

„ Ibu-ibu menangis mengadukan nasip yang mereka alami ke DPRD Madina. penghentian sementara atas lahan bermasalah dan DPRD membentuk Pansus. ”Ketika dibentuk pansus, warga ketika itu sangat bergembira mendengar adanya komitmen DPRD Madina yang akan menindaklanjuti persoalan yang mereka hadapi. Namun, lebih 4 bulan, hasil kinerja Pansus belum diketahui dan kami menduga ada permainan di dalamnya,” sebut Toguan. Kata Toguan, seharusnya pansus konsisten atas apa yang disampaikan di hadapan

Himmah Imbau BKD:

Jangan Asal Lolos Pindahkan PNS! PALAS-Gampangnya pegawai negeri sipil (PNS) dari Kabupaten Padang lawas (Palas) pindah (mutasi) ke daerah lain, akan berdampak buruk bagi daerah ini. Palas sebagai daerah pemekaran yang baru, nantinya akan kekurangan PNS sebagai pelayan masyarakat. Ketua Himpunan Mahasiswa Alwasliyah (Himmah) Cabang Kabupaten Palas, Irham Habibi Harahap didampingi Wakil Ketua, M Yakub Harahap melihat akibat buruk ini, meminta Pemkab Palas melalui Badan Kepegawaian Daerah (BKD) Palas agar tidak asal meloloskan perpindahan PNS dari Palas. “Dengan gampangnya seorang PNS Palas mengurus perpindahan tugas ke daerah lain, nantinya akan berakibat berkurangnya PNS. Pasalnya, Palas masih mengalami kekurangan PNS,” kata mereka. Dijelaskan kedua kativis mahasiswa Palas tersebut, selama ini ada dugaan telah terjadi mafia mutasi di lingkungan BKD Palas, sehingga terjadi tumpang tindih dalam jumlah PNS di lingkungan Pemkab Palas. Bahkan, ada lagi dugaan praktek pungutan liar dalam meloloskan perpindahan PNS dengan patok Rp10 juta per PNS yang mau pindah. Anehnya, kata mereka, ada PNS yang sudah memeroleh surat lolos pindah dari BKD ke daerah lain, padahal masa tugasnya masih 1 hingga 2 tahun lolos sebagau PNS di Palas. “Ini adalah praktek mafia mutasi yang menjadikan jabatannya sebagai mesin uang,” ucap Irham kesal, Senin (3/9). Kemudian kata Irham, Plt BKD Palas yang baru diminta mereformasi kebinet di BKD Palas. Pasalnya, ditemukan mafia jabatan dan mutasi yang bergentayangan di kantor BKD tersebut. “Kami melihat Plt Kaban BKD Palas, Syaiful Bahri Siregar sangat intens sekali memperbaiki birokrasi. Diharapkan, reformasi staf ini sebagai tugasnya yang pertama,” tegas keduanya. Sedangkan sumber di BKD Palas mengakui, kalau praktek mutasi PNS ke daerah lain sudah lama terendus. Namun katanya, sangat sulit dibuktikan karena permainannya cukup lihai. “Ada bandrol harganya yang di tarif kalau mau pindah ke luar Provinsi Sumatera Utara. Begitu juga dalam meluluskan lolos butuhnya PNS dari provinsi lain. Ini sudah modus lama di BKD dan sangat disayangkan bagi PNS yang baru bekerja tiba-tiba sudah pindah,” tukas sumber tersebut. (amr/mer)

masyarakat danb jangan hanya omong kosong belaka. Sebab, persoalan ini tidak seharusnya memakan waktu sampai 4 bulan untuk menghasilkan rekomendasi untuk diparipurnakan. ”Jika pansus serius menindaklanjuti persoalan inim, tidak sampai 4 bulan sudah selesai bekerja dan mengeluarkan,” ujarnya. Untuk itulah, sambungnya, Pansus PT Palmaris perlu dipertanyakan dan dievaluasi kinerja dan dievaluasi pertanggungjawaban penggunaan dana

yang sudah menelan ratusan juta rupiah. ”Jangan-jangan ada permainan di dalamnya, karena sampai sekarang belum ada paripurna hasil Pansus,” tambahnya. Sekretaris DPRD Madina, Zulkarnain Siregar membenarkan, masa kerja Pansus PT Palmaris kurang lebih 4 bulan dan sudah terjadi dua kali perpanjangan waktu. Kelambatan ini disebabkan ada sejumlah agenda yang belum terselesaikan. Ketika ditanyai masalah anggaran, Zulkarnain menyebut-

kan, total anggaran belum bisa diketahui secara final. Kalau totalnya belum direkafitulasi, tetapi di atas Rp200 juta, untuk biaya perjalanan kerja mereka seperti ke Jakarta dan turun ke lapangan. Ketua Pansus, Bahri Efendi yang dikonfirmasi lewat telepon selulernya tidak mau memberikan konfirmasi. Ketika dimintai keterangan lewat pesan singkat, juga tidak memberikan jawaban dan dicari ke gedung dewan juga tidak berhasil ditemui. (wan/mer)

Andi Ariono Pimpin PT PLN Panyabungan


PLN-Kiri-kanan: Manager PLN cabang Psp, Dwi Alfan Djunaidi, Kepala rayon Panyabungan dan asisten manajer cabang Psp, Kibar Barus. kerjasama yang baik dengan semua karyawan/ti karena untuk menjalankan beban dan tanggungjawab itu harus dengan tim yang solid. ”Saya sudah tahu kekuatan tim di PLN rayon Panyabungan dan saya cukup salut atas tim kerja yang dibangun oleh pimpinan sebelumnya. Saya sudah banyak cerita dengan Pak Arli bagaimana membuat terobosan yang baik. Kesuksesan beliau akan saya lanjutkan dengan segala kemampuan saya. Saya mengajak semua rekan-rekan kerja di rayon Panyabungan untuk tetap menjadi tim yang solid dan tangguh,” ujar Andi. Arli Wijaya berpesan kepada karyawan/ti agar terus mempertahankan kinerjanya dan bila perlu ditingkatkan bersama dengan pimpinan yang baru. ”Saya terharu atas pengalaman kerja selama 1 tahun 4 bulan di Panyabungan, sebab saya

mendapat dukungan dan semangat maksimal atas tim kerja yang kita bangun selama ini,” ungkap Arli seraya menyuarakan iyel-iyel yang biasa mereka gunakan yaitu “Panyabungan Bisa” Manager PLN Area Padangsidempuan, Dwi Alfan Djunaidi dalam sambutannya menyampaikan, tidak ada kata perpisahan, yang ada hanya pergeseran posisi karena masih dalam satu korps yaitu PT PLN. Katanya, segala kesuksesan dan tim yang solid serta kebersamaan yang telah dibangun itu harus bisa dipertahankan dan harus ditingkatkan. ”Untuk kepala rayon Panyabungan yang baru, anda sudah bertugas di pusat kabupaten. Artinya, kerjasama harus dibangun, selama ini mungkin hanya di tingkat Muspika kecamatan saja, tetapi sekarang harus dibangun di tingkat Muspida

kecemburuan sosial, karena dalam kasus serupa pencurian aset milik perusahaan PTPN 3 sudah banyak warga yang ditangkap lalu dijebloskan ke dalam penjara untuk menjalani hukuman,” kata Surya. Disebutkan Surya, jika pihak PTPN 3 beranggapan apa yang dilakukan mereka dalam menangani kasus pencurian di lakukan Sunarato sudah sesuai prosedur, mereka jangan tinggal diam dan hanya menunggu surat pemberitahuan perkembangan penyidikan (SP2HP) dari polisi, “Pihak perkebunan harus serius dan benar-benar mengamankan asetnya, dan bentuk keseriusan itu bisa ditunjukan dengan mempertanyakan alasan pelepasan itu,” katanya. Terpisah, Kapolsek Kualuh Hulu AKP Arifin Marpaung mengatakan, meskipun Sunarto tidak ditahan dalam kasus itu, namun prosesnya tetap dilanjutkan. “Tidak ditahanya Sunarto karena kurangnya bukti untuk dilakukan penahanan. Karena meskipun buah sawit yang dicuri ditemukan dari belakang rumahnya, namun Sunarto tidak mengakui perbuatannya,” kata apolsek. (put)

Tutup SPBU Ahmad Yani! Permintaan Demonstran pada Pemkab

K Sitompul di Rayon Kotanopan

MADINA-Dua pimpinan rayon PT (Persero) PLN di Cabang Padangsidempuan (Psp) di Kabupaten Mandailing Natal (Madina), yaitu rayon Panyabungan dan rayon Kotanopan berganti. Untuk rayon Panyabungan dipimpin oleh Andi Ariono, sedangkan di rayon Kotanopan dipimpin oleh Kloster Sitompul Secara resmi, pimpinan kedua rayon itu diabadikan pada acara temu pisah yang digelar di Cafe Assyifa jalan lingkar timur Panyabungan, Senin (3/9) dihadiri oleh Manager PLN Area Psp, Dwi Alfan Djunaidi, Asisten Manager, Kibar Barus, Camat Panyabungan, Kapolsek Panyabungan, Danramil 013 Panyabungan. Juga dihadiri seratusan karyawan/ti PLN Panyabungan dan Kotanopan. Untuk diketahui, kepala rayon Panyabungan sebelumnya, Arli Wijaya memeroleh promosi jabatan baru sebagai Kepala PLN rayon Medan Sunggal Kota Medan, lalu Andi Ariono sebelumnya menduduki jabatan sebagai Kepala PLN rayon Kotanopan yang digantikan oleh Supervisor pelayanan pelanggan PLN rayon Panyabungan. Kloster Sitompul naik menjadi kepala PLN rayon Kotanopan Kepala PLN rayon Panyabungan, Andi Ariono menyampaikan, jabatan adalah amanah yang penuh beban dan tanggungjawab besar, dalam mengejar target dan kinerja sangat dibutuhkan

AEKKANOPAN– Pihak perkebunan PTPN 3 di Kecamatan Kualuh Hulu Kabupaten Labura diminta mendesak polisi untuk menahan Sunarto (40) di Dusun Suka Rendah Kelurahan Aekkanopan Timur yang ditangkap mencuri Tandan Buah Segar (TBS) sawit milik PTPN 3. Pasalnya hingga, Minggu (2/ 9) tersangka belum dijeblosan ke penjara dengan alasan belum cukup bukti. Jika Sunarto tidak ditahan, hal ini akan membuat kecemburaan bagi warga yang tinggal di sekitar perusahaan tersebut. Permintaan ini disampaikan Surya Darma, selaku Ketua Lembaga Swadaya Masyarakat Potret Indonesia. Menurut Surya, terkait kasus pencurian TBS dari lokasi areal Afdeling II, perkebunan Membang Muda, tanggal 23 Juli lalu. Di mana petugas keamanan kebun sudah berhasil menemukan buah yang dicuri Sunarto dan disimpan di belakang rumah Sunarto. Namun persoalan itu hingga kini tetap menjadi gunjingan warga. Karena sesudah tersangka dibawa ke kantor polisi, Sunarto dilepas. “Kedaaan itu tentunya dapat berpotensi menimbulkan

kabupaten. Tingkatkan prestasi kerja dengan tim anda untuk bisa mengejar target dan program Pimpinan wilayah kita (general manager) yaitu “Perangi gangguan, perangi tunggakan” kata Dwi Pada kesempatan itu, sejumlah karyawan/ti terlihat menangis melepas pimpinan lama, seperti untaian kata perpisahan KTU PLN rayon Panyabungan, Emmy Robiah didampingi beberapa rekannya. “Terimakasih kepada pimpinan lama yang sudah banyak mengajarkan hal-hal baru kepada kami. Betapa pentingnya tim work, dan kesolidan dan tidak pernah membedakan karyawan/ti dari posisi kerjanya, mulai dari cleaning service, satpam dan seterusnya. Selamat datang kepada pimpinan baru, semoga kesuksesan berpihak kepada semua,” ungkap Emmy. (wan/mer)

RANTAU– Sejumlah aktivis yang menamakan dirinya Gerakan Muda Sumut Foundation (GMSF) melakukan aksi unjuk rasa di kantor Bupati Labuhanbatu, Senin (3/9). Mereka meminta agar Stasiun Pengisian Bahan Bakar Umum (SPBU) nomor 14.214.225 yang terletak di Jalan Ahmad Yani Rantauprapat ditutup. Permintaan aktivis tersebut karena SPBU yang baru terbakar beberapa waktu lalu itu tidak memiliki izin ganguan/Human Ordonancy (HO) sejak tahun 2011 lalu.KoordinatoraksidemoAzlansyah Hasibuan mengatakan, tidak seharusnya SPBU tersebut beroperasikembalidengantidakmengantongiizinganguan.PadahalSPBU tersebut juga menjual gas. Para aktivis tersebut membeberkan, pasca terbakarnya SPBU tersebut, Pemkab Labuhanbatu telah melayangkan surat untuk menutup SPBU tersebut. Namun kata mereka, fakta yang terjadi SPBU tersebut kembali beroperasi seperti biasa bahkan tetap menjualgastanpaizindaripemerintah setempat. “Kami melihat bahwa Pemkab Labuhanbatu tidak memiliki ketegasan dalam mengambil sikap dalam menjalankan peranan dan fungsinya dengan arti kata Labuhanbatu mandul,” kata Azlansyah. Sementara Imam Marpaung dalam orasinya menegaskan,

fungsi pengawasan DPRD Labuhanbatu yang mengawasi kinjerja pemkab hanya berjalan di tempat. Sehingga mereka menyebut lembagga dewan tersebut amburadul. Ada pun empat tuntutan para pengunjuk rasa yakni meminta agar Bupati Labuhanbatu dr Tigor Panusunan Siregar menutup SPBU 14.214.225. Setelah beberapa lama menyampaikan orasinya, sejumlah perwakilan aksi kemudian diterima oleh Asisten Pemerintahan Pemkab Labuhanbatu Sarbaini untuk membicarakan persoalan tersebut. Sarbaini mengakui memang SPBU tersebut beroperasi tanpa memenang izin HO yang telah habis massa berlakunya sejak tahun 2011. Namun katanya, pihak SPBU tersebut telah mengajukan perpanjangan HO dengan melengkapi persyaratan yang ada. Namun sampai saat ini belum ada pihak perusahan yang berniat untuk mengambil izin tersebut. Sementara itu disinggung dengan adanya masyarakat sekitar yang menentang perpanjangan izin HO tersebut, Sabraini membenarkanya. Hanya saja Sabrani menjelaskan jika SPBU tersebut ditutup maka otomatis akan mengurangi pasokan BBM di Rantauprapat dan menyulitkan masyarakat untuk mengisi BBM. (riz)


Para pengunjuk rasa berorasi di depan kantor Bupati Labuhanbatu, Senin (3/9). Para pengunjuk rasa meminta agar Pemkab Labuhanbatu menutup SPBU Ahmad Yani Rantauprapat.



4 September 2012


Ada Martil, Black Label, dan Civas Regal SIANTAR- Sebanyak 219 botol minuman keras (miras) berbagai merek dimusnahkan Polres Siantar di halaman Mapolres, Senin (3/9), sekira pukul 10.07 WIB. Minuman keras ini terdiri dari berbagai merek, red label, balleys, gordons, martini, jose cuervo, black label, winner, martil, civas regal, dan berbagai merek minuman keras lain dari dalam dan luar negeri. (FOTO:DEV BAKKARA)

BUAT LAPORAN- Harianto Sinaga (50) saat membuat laporan di Mapolres, Senin (3/9). Korban kehilangan Honda Vario BK 5763 TAM dari Gedung I Pasar Horas.

Satu Hari, Dua Kreta Matic Hilang DARI SEPUTARAN PASAR HORAS SIANTAR- Dua kreta matic hilang dari seputaran Pasar Horas, Sabtu (1/9). Satu unit Yamaha Mio hitam BK 6658 WZ hilang dari Jalan Cipto Gg Suzuki milik Husni (46) pukul 08.30 WIB. Sementara satu unit Honda Vario BK 5763 TAM milik Mariana br Silalahi (45) hilang dari Gedung I Lantai Dasar Pasar Horas pada pukul 17.00 WIB. Menurut suami Mariana br Silalahi, Harianto Sinaga (50) ditemui di Pasar Horas, Senin (3/9), pada Sabtu pagi pukul 08.00 WIB, seperti biasa istrinya berangkat kerja untuk berjualan kain di Lantai Dasar Pasar Horas. Kreta inipun lalu diparkirkan di tempat biasa di Gedung I Lantai Dasar Pasar Horas. Namun bukan dilokasi parkir biasa dipinggir Jalan Sutomo. Lokasi parkiran kreta ini agak kedalam dan hanya berjarak sekitar 50 meter dari toko milik mereka. Namun diakuinya, lokasi parkir kreta ini tidak bisa dilihat langsung karena terhalang terpal dan agak sedikit berbelok dari tempat usahanya. Sekitar pukul 16.00 WIB, salah satu anggota keluarganya melintas dari lokasi parkir itu, kreta tersebut masih ada. Namun sekira pukul 18.00 WIB, sewaktu hendak pulang ke rumah, kreta tersebut sudah tidak ada lagi. Istrinya pun sangat terkejut dan sempat pingsan karena kreta miliknya hilang. Selama ini kreta itu selalu digunakan setiap hari ke tempat usaha di Pasar Horas. “Setelah kreta itu tidak ada, istri saya langsung menelpon saya. Setibanya saya dilokasi, saya lihat istri saya sudah pingsan. Saya sempat cari keliling-keliling Pasar Horas hingga pukul delapan malam, tapi tetap tidak ada juga dapat kreta itu,” ujar warga Jalan

Meranti, Siantar Utara ini. Disebutkannya, mulai Sabtu hingga Senin, dia telah berusaha mencari lokasi kreta itu diberbagai lokasi di Kota Siantar. Namun usahanya ini belum berhasil, sehingga keluarganya memutuskan melaporkan masalah ini ke Polres Siantar. “Kata istriku, kreta itu memang tidak dikunci stangnya, makanya mudah dibawa lari. Memang salah istriku jugalah ini. Didalam jok kreta itu ada STNK dan surat-surat kredit kreta itu. Baru enam bulanlah kami pakai kreta itu,” ujarnya lagi. Sabtu Pagi, Yamaha Mio Hilang Sebelumnya, pada pagi hari sekitar pukul 08.30 WIB, satu unit Yamaha Mio hitam BK 6658 WZ milik Husni hilang dari Jalan Cipto Gg Suzuki. Padahal selama ini korban selalu memarkirkan kretanya dilokasi itu selama bertahun-tahun. “Memang naas saya ini, saya hanya minum sebentar di kedai kopi Koktung Massa, paling lama setengah jam. Saya datang kesitu jam delapan pagi, saya pulang setengah sembilan. Saya pun heran, stang kreta itu saya kunci juga. Selama ini saya selalu parkir kreta disitu,” jelasnya. Dikatakan warga Jalan Mojopahit Siantar Utara ini, usai kejadian, dia berusaha mencari kreta itu di sekitaran Jalan Cipto, namun tidak berhasil. Disebabkan ada urusan mendesak di Medan, dia baru sempat melaporkan peristiwa ini ke Polres pada Senin. Kasubag Humas Polres Siantar AKP Altur Pasaribu membenarkan laporan pengaduan kedua korban. Saat ini, pihaknya sedang melakukan penyelidikan identitas pelaku yang mengambil kreta di dua lokasi di seputaran Pasar Horas Sabtu lalu.(ral)


DIMUSNAHKAN- 219 botol miras senilai Rp70 juta, dimusnahkan di halaman Mapolres Pematangsiantar, Senin (3/9).



SIMALUNGUN– Sucipto alias Cipto (28) warga Huta IV Nagori Panambean Baru, Kecamatan Bandar Masilam dituntut 1,6 tahun penjara. Terdakwa terbukti secara sah dan meyakinkan melakukan tindak pidana penipuan dan penggelapan uang hasil penjualan sawit sebanyak 8,3 ton sebesar Rp11,620 juta. Hal itu disampaikan Jaksa Penuntut Umum, Sanggam Siagian di hadapan majelis hakim Ramses Pasaribu beranggotakan Monalisa dan Gabe Doris di PN Simalungun, Senin (3/9). Menurutnya, berdasarkan keterangan saksi dan terdakwa di persidangan terungkap perbuatan terdakwa melanggar pasal 372 KUHPidana. “Peristiwa itu berlangsung Senin (12/12) sekira pukul 12.30 WIB di Huta V Nagori Pematang Kerasaan. Saat itu terdakwa menghubungi saksi korban Susilo dan menawarkan agar terdakwa menjualkan sawit milik korban yang baru dipanen. Kemudian terdakwa menawarkan harga sawit yang akan dijual Rp1.400 per kg,” sebutnya. Dia menerangkan, terdakwa

juga berjanji akan membayarkan langsung uang penjualan itu usai di timbang di PKS Kerasaan. Mendengaritukorbanpuntertarik dan akhirnya anggota terdakwa datang kerumah korban dan mengangkat sawit milik korban berjumlah 8,3 ton. Selanjutnya, setelah sawit dibawa, korban pun langsung menanyakan soal pembayaran kepada terdakwa. Kemudian terdakwa menyuruh korban untuk bertemu di Perdagangan. Akan tetapi setelah korban datang ke Perdagangan terdakwa tidak berada di tempat yang dimaksud. “Kemudian korban pun menghubungi terdakwa dan saat itu terdakwa mengatakan agar pembayaran dilakukan di rumahnya di Huta IV Mandaroh Nagori Panambean Baru, KecamatanBandarMasilam.Akan tetapi karena korban masih punya pekerjaan lainnya, Susilo menyuruh adiknya Yono untuk mengambil uang hasil penjualan sawit sebanyak Rp11,620 juta,” ungkapnya. Sambung Sanggam, setelah adik korban datang ke rumah

terdakwa justru terdakwa memberikansatuunitmobilKijang Innova sebagai boroh penjualan sawit itu. Karena merasa curiga korban pun mendatangi keluarga terdakwa dan menanyakan siapa pemilikmobiltersebut. Kemudian keluarganya itu mengaku bahwa mobil itu dirental oleh terdakwa. “Korban pun langsung mendatangi terdakwa dan mengembalikan kunci mobil tersebut. Selanjutnyakorbanmemintauang hasil penjualan sawit miliknya. Akan tetapi terdakwa hanya memberikan panjar atas penjualan sawit miliknya sebesar Rp3 juta. Korban pun tidak menerima karena merasa ditipu oleh terdakwa,” jelasnya. Untuk hal memberatkan perbuatan terdakwa meresahkan masyarakat khususnya saksi korban. Sementara hal meringankan terdakwa bersikap sopan di persidangan, berterus terang, mengku salah dan berjanji tidak mengulanginyakembali.Untukitu jaksa memutuskan menuntut terdakwa 1,6 tahun penjara dikurangi selama masa tahanan.(mua)

Botol miras ini merupakan hasil operasi pekat selama bulan suci Ramadan tahun ini yang disita dari UDMakmurJayaJalanMHSitorus. Kegiatan pemusnahan dilaksanakandihalamanMapolresSiantar. Dihadiri jaksa fungsional Hari DarmawandanKasipidumRParulian dari Kejari Siantar. Sementara dari Polres Siantar diwakili Kasat Narkoba AKP Sofyan dan puluhan personelpolisidariberbagaisatuan. TuruthadirKetuaFrontPembelaIslam(FPI)KotaSiantarMuhammad SyahrilChan. Secarasimbolis,tigabotolminuman keras ini dilemparkan ke arah alat berat silinder oleh tiga orang yang mewakili kejari dan polisi. Secaraperlahanalatberatinimenggilas semua botol minuman keras yang sudah ditumpuk di aspal. Usai pemusnahan, mewakili KejariSiantar,JaksaHariDarmawan menyebutkan, nomor putusan pengadilanpemusnahan219miras ini yaitu Nomor:01 Pid C/2012/PN PMS, tertanggal 13 Agustus 2012.

Hari menambahkan, tertundanya pemusnahan ini dari jadwal yang ditentukan disebabkan Hari Raya Lebaran. Sehingga pemusnahan barudapatdilaksanakan,Senin(3/ 9). “Tidak ada unsur kesengejaan terkait penundaan pemusnahan ratusan botol miras ini. Data yang dimusnahkan hari ini sesuai dengan yang tertera di kepolisian dan kejaksaan, tidak ada beda sama sekali. Saya kira tidak ada masalah dengan itu,” ujarnya. Sementara Ketua FPI Kota Siantar Muhammad Syahril Chan mengucapkan terima kasih kepada aparat kepolisian atas pemusnahan yang dilakukan. Mereka menghargai kinerja polisi dan berharap agar terus ditingkatkan. “Peredaran miras sudah menyeluruh di Kota Siantar, kita berharap polisi meingkatkan kinerjanya dalam pemberantasan miras ini. Jika sudah baik saat ini, untuk terus ditingkatkan kedepan,” jelasnya. (ral/dro)


Tidur di Mapolsek Coba Bunuh Diri

MEDAN- Sungguh kasian nasib perempuan yang depresi satu ini, bagaimana tidak sudah dua hari cewek depresi ini menginap di Polsek Medan Sunggal, sejak Sabtu (1/9) dan merepotkan jajaran Polsek Sunggal. Sebut saja namanya Bunga (19), cewekberparasmanisinijikadisaksikan sekilas tidak tampak jika dirinya depresi atau stress. Namun jika terus-terusan diperhatikan maka akan tau jika cewek ini stres karena sering tertawa dengan sendirinyadanmenangissertamenyebut-nyebut lelaki dan sering berteriak tak menentu. Dugaan sementara, cewek strees berkulit bersih ini diperkosa. Hal ini terbukti dari ocehan si cewek strees ini. “Jangan sentuh aku, jangan buka celanaku, sakit anuku,” ujar Bunga. Bukan hanya itu, Bunga juga sering memandang ke atap dan dan berceloteh dengan logat Aceh. Polsek Medan Sunggal sendiri kerepotan dengan tigkah si

Bunga, apalagi Bunga tidak mau makandanminumhanyaterdiam dan tertawa sendiri. Dankejadianyangpalingmenghebohkan ketika Bunga berlari ke jalan depan Polsek Medan Sunggal dan mencoba bunuh diri denganberdiriditengahjalandanhampir di tabrak tronton. “Bingung kita untuk menanganinya, tadi hampir mati dia ditabrak truk,” ujar Kasi humas Polsek Medan Sunggal. Setelah ditenangkan akhirnya Bunga mau dibujuk. Kejadian ini membuat macet ruas jalan dan heboh warga yang berdatangan untuk menyaksikan pertunjukan percobaan bunuh diri. “Ngeri juga Polsek Sunggal ya melihara orang gila,”ujarwargayangmenyaksikan. RencananyaBungaakandikirim keDinasSosialolehPolsekSunggal dan Polsek Sunggal akan menyelidiki asal usul cewek depresi tersebut. “Kita cari dululah keluarganya dannantikitakirimkedinassocial,” ujar Kasi Humas Polsek Sunggal. (mri/pmg)

RIZKI PONSEL Jalan Merdeka, Kota Padangsidimpuan. Menerima HP bekas dengan harga tinggi. Blackberry, Nokia, Samsung, Sony Erikson, dll. Dengan syarat lengkap dan baik. Hubungi IRWANTO:

Hp 0813 6215 1119 SUZUKI PROMO LEBARAN

• Carry Pick Up • APV Mega Carry Pick Up • AVP • Ertiga • Swift • SX4 • Grand Vitara

Dp. 15,7Jt Dp. 23Jt Dp. 29Jt Dp. 35Jt Dp. 35Jt Dp. 40Jt Dp. 70Jt

angs angs angs angs angs angs angs

2Jt 2Jt 3Jt 3Jt 4Jt 4Jt 5Jt

Proses cepat, angsuran ringan dan data bisa dijemput. Hubungi:

Abdul : 0821 6188 5013 MENERIMA LOWONGAN KERJA: Wanita usia 17-45 thn, tamatan SD, SMP, SMU sederajat, dengan honor : 900 rb s/d 1.500.000/bulan bersih, utk merawat anak & orang tua Alamat Jl. Pasar 3 no. 45 A Krakatau, Hub : 0811 602 145, 0852 6114 3441


4 September 2012

Kapolri: Ada 1.629 Lokasi Potensi Konflik di Indonesia JAKARTA- Berkaca dari kasus Sampang, Polri memetakan lokasi-lokasi potensi konflik di Indonesia. Polri menginventarisir ada 1.629 lokasi berpotensi konflik. ”Polri pro aktif menginventarisir potensi konflik di seluruh Polda agar tidak berkembang, yaitu terdapat 1.629 lokasi potensi konflik,” ujar Kapolri Jenderal Timor Pradopo dalam rapat dengan pendapat bersama Komisi III DPR, di Gedung DPR, Senayan, Jakarta, Senin (3/9).

Menurutnya, lokasi-lokasi itu tersebar pada beberapa latar belakang kondisi masyarakat. Terbanyak, lokasi potensi konflik terdapat pada sektor perkebunan. ”Lokasi terbanyak adalah perkebunan, pertanahan, agama, ekonomi sosial dan budaya, serta pertambangan,” tuturnya. Ia menjelaskan Polri telah menempatkan petugasnya di setiap desa guna mengantisipasi potensi konflik, mengetahui masalah dan mencari solusi bersama dengan masyarakat. ”Polri juga senantiasa berkoordinasi dengan tokoh masyarakat untuk memediasi agar tidak muncul konflik.

Pesawat AS Serang Yaman

13 ORANG TEWAS SANAA- Pesawat tak berawak milik Amerika Serikat kembali melancarkan serangan-serangan udara di Yaman. Sedikitnya 13 warga sipil dilaporkan tewas dalam serangan terbaru tersebut. Seorang pejabat kepolisian Yaman mengatakan, serangan udara itu terjadi di daerah Radaa pada Minggu, 2 September sekitar pukul 16.00 waktu setempat. Radaa berlokasi sekitar 130 kilometer sebelah tenggara Sanaa, ibukota Yaman. Menurut pejabat Yaman yang tidak disebutkan namanya itu seperti diberitakan Press TV, Senin (3/9), serangan udara pesawat tanpa awak AS tersebut mengenai dua kendaraan. Dikatakannya, dua wanita termasuk di antara para korban tewas. Militer AS telah menggunakan pesawat-pesawat tanpa awak untuk melancarkan serangan-serangan udara di Pakistan, Afghanistan, Yaman dan Somalia. Washington mengklaim serangan-serangan itu untuk menargetkan para militan. Namun pada kenyataannya, banyak warga sipil yang menjadi korban serangan-serangan tersebut. Sejumlah media Barat bahkan memberitakan, badan intelijen AS alias CIA berupaya meningkatkan serangan-serangan pesawat tanpa awak di Yaman. (dtc/int)

Dalam hal ini, Polri memainkan peran sebagai mediator yang membawa pesan perdamaian bagi masyarakat,” ujarnya. Selain itu, upaya yang dilakukan Polri dalam menyikapi lokasi potensi konflik dilakukan dengan membangun kerukunan antar warga dan mengikuti perkembangannya secara terus menerus. ”Kami juga menambah kekuatan Polri sebanyak 10.000 anggota pada tahun 2012 ini juga melengkapi perlengkapan senjata dalam penanganan konflik,” kata Timor. (dtc/int)

600 WNI Selamat dari Bencana Badai Tropis di Lousiana „ Miranda memberikan penjelasan di hadapan Majelis Hakim di Pengadilan Tipikor Jakarta.

Masa Tahanan Miranda Segera Berakhir JAKARTA- Majelis hakim Pengadilan Tipikor memutuskan mempercepat rangkaian sidang perkara suap cek pelawat dengan terdakwa Miranda Swaray Gultom. Alasannya, masa penahanan Miranda hanya sebulan lagi. ”Setelah kami perhatikan masa penahanan terdakwa paling lambat tanggal 7 Oktober. Kami tidak putus tanggal 7 Oktober karena masa pikir-pikir selama 7 hari. Paling lambat 30 September untuk masuk masa pikir-pikir (atas putusan),” kata Ketua Majelis Hakim Gusrizal di awal persidangan Miranda di Pengadilan Tipikor Jakarta, Senin (3/9). Gusrizal kembali mengigatkan hal ini ketika hendak menutup persidangan. “Ini kesempatan terakhir bagi penuntut umum untuk hadirkan saksi. Apakah akan dikonfrontir, ini kesempatan terakhir,” ujarnya. Hakim juga meminta penasihat hukum menyiapkan pemanggilan terhadap ahli atau pun saksi meringankan untuk dihadirkan pada hari Senin (10/9) pekan depan. ”Tanggal 10 itu kita langsung pemeriksaan terdakwa karena tidak ada waktu lagi,” imbuh Gusrizal. Sidang Miranda akan dilanjutkan hari Kamis 6 September dengan menghadirkan saksi yang dijadwalkan penuntut umum. Rencananya, penuntut juga akan mengupayakan menghadirkan Hamka Yandhu, Endin Soefihara dan Paskah Suzetta untuk dikonfrontir terkait keterangan berbeda mengenai pertemuan di kediaman Nunun. (dtc/int)

JAKARTA- 600 WNI selamat dari bencana badai tropis ‘Isaac’ di Lousiana, AS. Mereka, saat badai itu mengamuk di kawasan itu pada pekan lalu, mengungsi ke tempat aman. Dipastikan tidak ada korban WNI akibat bencana badai tersebut. Seperti disampaikan Konjen RI di Houston, dalam siaran pers, Senin (3/9/ 2012), para WNI sebagian besar banyak mengungsi ke kota-kota yang aman seperti Baton Rouge, Lafayette, dan bahkan sampai ke Houston, Texas, 570 km dari New Orleans. Akibat badai itu, ribuan rumah penduduk tenggelam, pohon-pohon bertumbangan, listrik mati dan ribuan penduduk mengungsi. Saat ini seluruh masyarakat Indonesia telah kembali ke rumah masing-masing. Konsul Jenderal RI di Houston, Al

Busyra Basnur dan isteri Wenny Busyra Basnur pun menyempatkan mengunjungi masyarakat Indonesia yang menjadi korban. Pada pertemuan dalam bentuk makan siang bersama itu, Al Busyra menanyakan langsung kondisi masyarakat Indonesia dan pengalaman mereka selama badai berlangsung. Hadir sekitar 80 orang masyarakat Indonesia. Mengingat kawasan itu sering dilanda bencana alam, Al Busyra Basnur, juga menyampaikan imbauan kepada para WNI. Mereka diminta waspada, memperhatikan setiap peringatan, dan mengikuti petunjuk dari pemerintah setempat serta segera menghubungi KJRI Houston. Dua hari sebelum badai Isaac datang, Konjen Al Busyra juga telah melakukan komunikasi intensif dengan masyarakat Indonesia di kawasan bencana untuk

melakukan monitoring dan memberikan arahan kepada masyarakat. Bahkan KJRI Houston membentuk satuan tugas untuk membantu masyarakat Indonesia di sana. Dalam kesempatan itu, Ketua Indonesian American Community Association (IACA), Indah D. Kusuma, mengatakan bahwa sebelum dan pada saat badai masyarakat Indonesia di Louisiana selalu saling memberikan informasi satu sama lain untuk mengetahui kondisi masingmasing. Sementara itu, Bambang Arifatmi, seorang mahasiswa program doktor di New Orleans, mengatakan bahwa kondisi dan keberadaan masyarakat Indonesia pada saat badai, dapat diketahui dengan baik berkat adanya koordinasi yang erat setiap saat dengan pihak KJRI Houston. (dtc/int)

DAMASKUS- Para pejuang oposisi di Suriah mengklaim telah menguasai sebuah pangkalan udara militer Suriah di Provinsi Deir el-Zour, Suriah timur. Para pemberontak juga menyandera setidaknya 16 tentara dan menyita senjata-senjata dan amunisi mereka. Kekerasan berlanjut dengan insiden dua bom mobil yang meledak dekat kantor kepala staf gabungan militer Suriah di Damaskus pada Minggu, 2 September malam waktu setempat. Empat perwira terluka. Demikian seperti diberitakan stasiun televisi Suriah seperti dilansir kantor berita AFP, Senin (3/9). Sebelumnya pada Sabtu, 1 September, sebuah bom mobil lainnya meledak di dekat kamp pengungsi Palestina di Damaskus dan menewaskan 15 orang. Dalam sejumlah video yang beredar di internet terlihat situasi pasca serangan pemberontak di pangkalan pertahanan udara di al-Bukamal, dekat perbatasan Suriah dengan Irak. Di salah satu video terlihat para pemberontak berkumpul di depan sebuah gedung, dengan jasad dua tentara pemerintah tergeletak di tanah. Sementara itu, juru runding baru Suriah untuk PBB dan Liga Arab, Lakhdar Brahimi, akan pergi ke Damaskus dalam beberapa hari ini. Diplomat veteran Aljazair tersebut berniat untuk bermarkas di Damaskus guna menjalankan misinya. ”Damaskus merupakan tempat yang tepat,” kata Brahimi. “Apakah itu mungkin atau tidak, saya akan segera mengetahuinya,” tandasnya. (dtc/int)

Kepala Badan Luar Angkasa Rusia Dipecat

KPKJaminPenyidiknya Profesional Periksa Perwira Polri JAKARTA- Komisi Pemberantasan Korupsi menjamin penyidiknya akan profesional dalam memeriksa para perwira Polisi yang menjadi saksi kasus dugaan korupsi proyek simulator ujian surat izin mengemudi (SIM) Korps Lalu Lintas (Korlantas) Polri 2011. Hal tersebut disampaikan Juru Bicara KPK, Johan Budi, di Jakarta, Senin (3/9/2012). “Saya kira kita menghormati profesionalitas penyidik KPK. Ketika dia sudah bekerja di KPK, tentu dia akan melakukan tugas-tugas sebagai penyidik untuk kepentingan KPK,” katanya. Seperti diketahui, hampir semua penyidik yang bertugas di KPK berasal dari institusi Polri sementara sebagian lainnya dari institusi Kejaksaan Agung. Menurut Johan, untuk kasus simulator SIM ini, semua penyidik berasal dari Kepolisian. Rata-rata penyidik KPK yang menjadi ketua satuan tugas (satgas) penyidikan suatu kasus, berpangkat Ajun Komisaris Besar Polisi atau AKBP. “Ada juga yang kombes (komisaris besar) ketua satgasnya,” tambah Johan. Dia juga mengatakan, KPK tidak akan mengganti tim penyidiknya dengan yang berpangkat tinggi-tinggi saat memeriksa Inspektur Jenderal (Irjen) Polisi Djoko Susilo nantinya. “Jadi gini, setiap kasus itu ada timnya. Nah setiap tim itu dipimpin oleh seorang ketua yaitu kasatgas. Jadi siapa yang diperiksa, tentu tidak mengubah dari tim yang sudah ada,” tutur Johan. Sejauh ini, KPK belum memeriksa Djoko sebagai tersangka kasus dugaan korupsi proyek simulator SIM. Menurut Johan, Djoko akan diperiksa dalam satu hingga dua pekan ke depan. Hari ini KPK memeriksa tiga perwira Polisi sebagai saksi untuk Djoko. Mereka adalah Kepala Kepolisian Resort Temanggung, Jawa Tengah, AKBP Susilo Wardono, Kepala Subdit Pendidikan dan Rekayasa Direktorat Lalu Lintas Polda Jawa Tengah, AKBP Indra Darmawan, dan Kepala Polres Kebumen, Jawa Tengah, AKBP Heru Trisasono. Pada Jumat (31/8) lalu, KPK memeriksa empat perwira Polisi yang menjadi panitia pengadaan proyek simulator SIM 2011. Keempatnya adalah AKBP Wisnhu Buddhaya, AKBP Wandi Rustiwan, Komisaris Polisi (Kompol) Endah Purwaningsih, dan Kompol Ni Nyoman Suwartini. (kmc/int)

Pemberontak Kuasai Pangkalan Udara

„ Jenazah teroris Solo dibawa ke rumah sakit untuk diotopsi.

Teroris Solo Gunakan Senjata dari Filipina JAKARTA- Terduga teroris di Solo menggunakan senjata dari Filipina saat beraksi. Kepolisian Filipina dilibatkan guna menelusuri senjata tersebut. ”Soal senjata Filipina, itu sedang ditelusuri,” kata Menko Polhukam Djoko Suyanto di Istana Negara, Jakarta, Senin (3/9). Menurut dia, proses penelusuran bersama Filipina sudah dilakukan. Indonesia juga menjalin kerjasama antiteror dengan negara lainnya mengingat teroris memiliki jaringan yang luas. ”Itulah fungsi dan kegunaannya sehingga kita bisa menelusuri apa yang terjadi,” ujarnya. Namun demikian, Djoko menolak membeberkan kemajuan penyelidikan. “Itu adalah buah dari kerja keras mereka. Mereka kan sudah ada di lapangan sejak lama,” kata dia. Kapolri Jenderal Timur Pradopo sebelumnya menyebut terduga teroris di Solo menggunakan senjata dari Filipina. Mereka diduga melakukan penyelundupan berbagai jenis senjata api dan amunisi dari Filipina. Sejumlah barang bukti juga diamankan antara lain 1 pucuk pistol pietro baretta, 3 buah magazine, 43 peluru kaliber 9 mm merk Luger, dan 9 holopoint CBC, 1 unit HP, beberapa dokumen, dan STNK.

Motif untuk Balas Dendam Kepolisian RI memastikan bahwa rentetan penyerangan kelompok teroris di Solo, Jawa Tengah, selama Agustus 2012 bermotif balas dendam. Hal ini berdasarkan hasil pemeriksaan terhadap barang bukti dan pemeriksaan tersangka teroris yang ditangkap hidup oleh Densus 88 Anti Teror Polri Kepala Biro Penerangan Masyarakat Polri Brigadir Jenderal (Pol) Boy Rafli Amar mengatakan, selain magazen, di dalam tas pinggang yang dipakai Farhan (19), polisi menemukan banyak lembaran kertas. Dalam lembaran itu, kata Boy, terdapat surat yang ditulis tangan. “Ternyata di dalam surat itu cukup jelas untuk menyimpulkan motif. Secara ideologi memang mereka berjuang sebagaimana kelompok terdahulu seperti Jamaah Islamiyah yang ingin membentuk negara syariah Islam di Indonesia. Jadi kenapa mereka membalas, karena mereka merasa kecewa dengan penangkapan tokoh mereka selama ini sehingga mereka balas dendam,” kata Boy sebelum rapat kerja dengan Komisi III di Gedung Kompleks Parlemen Senayan, Jakarta, Senin ( 3/9/2012 ). Dalam raker itu, Komisi III ingin mendengar penjelasan Kepala Polri Jenderal (Pol) Timur Pradopo mengenai penanga-

nan Madura, dan Sigi, Sulawesi Tengah. Akan disinggung pula mengenai penanganan kasus terorisme di Solo. Boy menambahkan, dalam pemeriksaan terungkap pula sandi yang dipakai kelompok mereka, yakni “main bola”. Jika sandi “pengantin” untuk melakukan bom bunuh diri, sandi “main bola” dipakai untuk menyerang petugas kepolisian. “Itu terungkap dalam pemeriksaan ini. Kita melihat mereka sangat teliti, sampai menentukan hari (penyerangan) pun mereka sangat memikirkannya. Penentuan tanggal 17 Agustus dikaitkan bersamaan dengan hari proklamasi,” kata Boy. Seperti diberitakan, Jumat malam lalu, Detasemen Khusus (Densus) Antiteror menyergap tiga terduga pelaku teror yang menembak seorang polisi di Pos Polisi Singosaren, Ajun Inspektur Dua (anumerta) Dwi Data Subekti, hingga tewas. Dua di antaranya, yakni Farhan (19) dan Mukhsin (19), tewas dalam baku tembak di Jalan Veteran, Kelurahan Tipes, Kecamatan Serengan, Solo. Terduga lainnya, Bayu (24), warga Tipes, ditangkap di kediaman mertuanya, Wiji Siswo Suwito, di Desa Bulurejo, Kecamatan Gondangrejo, Kabupaten Karanganyar, Jateng. Kepolisian masih mengembangkan penyidikan untuk mencari tahu ada tidaknya keterlibatan pihak lain. (dtc/int)

MOSKOW- Presiden Rusia Vladimir Putin memecat Kepala Badan Luar Angkasa Khrunichev, Vladimir Nesterov dari jabatannya. Pemecatan ini dilakukan menyusul sejumlah kegagalan peluncuran program ke luar angkasa oleh Rusia. Menurut dekrit presiden yang dikeluarkan tanggal 31 Agustus, Nesterov telah resmi dilengserkan dari jabatannya. Dekrit tersebut dipublikasikan dalam situs resmi Kremlin pada hari ini dan dilansir AFP, Senin (3/9). Pria berusia 63 tahun ini telah menjabat sebagai Direktur Umum Produksi Pusat Ruang Angkasa dan Riset Nasional Khrunichev sejak tahun 2005. Biro Ruang Angkasa Khrunichev merupakan badan luar angkasa terbesar di Rusia yang bermarkas di Moskow, yang selama ini memproduksi dan melakukan peluncuran roket-roket Proton ke luar angkasa. Bulan lalu, muncul laporan bahwa Rusia kehilangan 10 satelit dalam jangka waktu 1,5 tahun terakhir. Terhadap laporan tersebut, Perdana Menteri Dmitry Medvedev memanggil sejumlah pejabat terkait isu ruang angkasa untuk memberikan penjelasan kepada pemerintah. Dalam pertemuan dengan para pejabat tersebut, PM Medvedev menyebut serangkaian kegagalan tersebut ‘telah melemahkan reputasi Rusia di mata internasional sebagai negara yang memimpin dalam misi luar angkasa.’ Nesterov yang juga hadir dalam pertemuan tanggal 14 Agustus tersebut, kemudian diminta untuk mengundurkan diri. Diketahui bahwa pada 6 Agustus lalu, 2 buah satelit milik Rusia hilang setelah upaya peluncuran menggunakan roket Proton-M gagal mencapai orbit. Satelit telekomunikasi, milik Rusia MD2 dan milik Indonesia Telkom3, tidak bisa melakukan kontak. Komisi penyelidikan pun dibentuk untuk menyelidiki kegagalan tersebut. Hasilnya menunjukkan adanya masalah pada Briz-M, bagian atas roket Proton-M. Otoritas Rusia pun langsung memerintahkan inspeksi terhadap seluruh hasil produksi Briz-M dan upaya peluncuran dalam beberapa waktu ke depan terpaksa ditunda. Selain itu, masalah pada program ruang angkasa Rusia juga diwarnai oleh adalah persoalan teknis yang berujung pada hilangnya belasan satelit dan penjelajah Rusia sejak tahun lalu, termasuk kendaraan luar angkasa pembawa Progress yang bertugas mengangkut sejumlah perlengkapan ke Stasiun Ruang Angkasa Internasional. (dtc/int)


2102 rebmetpeS 4

lesgabaT lasA atreseP 01 simedakA iskeleS suluL .ayngnalu ajaRP nolac aman ratfaD sulul nakataynid gnay NDPI etisbew id tahilid tapad iskeles utiay usvorpmep id uata di.og.vorptumus.www -es atoK/netapubaK DKB .aratU aretamuS NDPI ajarP nolaC adapeK adap aretret aynaman gnay irgadneM KS naripmal /ropalem kutnu duskamid nadaB id naharagnep usvorP hareaD naiawagepeK aretamuS runrebuG rotnaK 03.oN orogenopiD nalaJ aratU lukup )9/5( ubaR adap ,nadeM awabmem nagned BIW 00.90 .ilsA naijU romoN utraK ,ini nagned nagnubuheS usbuG )tlP( saguT anaskaleP nidruN ,usvorpadkeS iulalem arap itaruynem halet sibuL tumuS es atokilaw nad itapub )ES( naradE taruS iulalem 2102/III/DKB/40771/008.oN raga 2102 rebmetpeS 3 laggnaT adapek nakuhatirebmem aguj aynaman gnay NDPI ajarp nolac ek ropalem raga sulul nakatynid anamiagabes tumuS DKB )ira(.rutaid halet gnay lawdaj

1 namalaH nagnubmaS .)lesgabaT( naiawagepeK nadaB alapeK tumuS isnivorP )DKB( hareaD namrehuS ,)usvorP( adapek uti lah nakakumegnem id usbuG rotnaK id ,nawatraw .)9/3( nineS ,nadeM naksalejnem namrehuS naiju sulul gnay aman-aman gnay hal ini simedaka iskeles itukignem kutnu kahreb rihkA nautneneP aracnawaW tutitsnI supmaK id )rihkutnaP( ,iregeN malaD nahatniremeP iauses ,taraB awaJ ,rognanitaJ gnay ropalem lawdaj nagned .nakutnetid halet ,ayntujnal ,ini nasululeK nasutupeK taruS nakrasadreb nuhaT 585-1.298.oN irgadneM ,2102 ustsugA 03 laggnaT 2102 nolac nakpatenem halet gnay sulul nakataynid gnay ajarp iskeles adap simedaka iskeles NDPI ajaRP nolac naamirenep .3102/2102 narajA nuhaT tseT itukignem gnay atreseP“ gnay ,gnaro 815 kaynabes iskeles sulul nakataynid ”,gnaro 201 kaynabes simedaka

muleB sibuL harysaB saniD liboM nakgnaluP naubisaH ifanaH nadraM salaP kiranem upmam kadit aynsusuhk ,sanid naaradnek iakapid hisam gnay tapme ador .salaP bakmeP tabajep natnam ukagnem ifanaH nadraM mit ajrenik nagned awecek ripmah ,babeS .salaP bakmeP muleb ,ajrekeb mit nalub utas tarus nakhaB“ .lisah iaunem raul ek aggnih sanid nanalajrep nakraulekid hadus aguj haread ,numaN .salaP itapuB tlP helo nakhaB .ada kadit aynlisah salaP adkeS tlP ini taas aggnih naaradnek iakamem ajas hisam .nadraM pacu ”,idabirp -em tagnas nadraM ajrenik aynhamel nakgnayayn malad salaP itapuB tlP nahawab -ak ,admeP tesa naknamagnem idajret naka nakritawahkid aner tubesret tesa adap napaleggnep .aragen nakigurem naka gnay idajret naka ritawahk atiK“ bakmeP tesa adap napaleggnep iapmas igalapA .tubesret salaP kadit mit isasilaer ,ini taas )rma( .nadraM pacu ”,lisahreb

itapuB omeD awsisahaM ,eynapmaK ijnaJ higaT

1 namalaH nagnubmaS natnam iakapid gnay naarad nad ,adkes natnam ,itapub hadus ini taaS“ .aynnial tabajep amasreb mit ,uggnim agit kusam - n e k i r ac n e m l e s p aT s e r l o P pacu ”,tubesret sanid naarad .imatsuB ada ,imatsuB atak ,numaN -em gnay aladnek idajnem gnay hasus sanid libom nakbabeyn -ajep natnam ,aynlasiM .kiratid naaradnek iakamem gnay tab .hamur id kadit gnadakret sanid aynlibom icnuk gnay adA rikrap libom nakgnades awabid kadit gnay aguj adA .hamur id naadarebek anam id iuhatekid .uti tabajep natnam -aradnek rihkaret gnay naD“ -eb ,nakumetid kadit aguj aynna gnay gnaro aguj utig nakhaB .ini amales ayniakamem kadit nakireb atik gnay tarus iakamep adapek iapmas hanrep .aynpacu ”,sanid naaradnek sivitka ,ini lah ipagggnaneM )BRG( gnaujreB taykaR nakareG


.niramek ,anidaM itapuB rotnaK id asar kujnureb gnay awsisahaM

gnaynalawagnepnagnednuman,aynajrek PP loptaS nad serloP tarapa irad tatek utnip id nahatid asarkujnugnep ,anidaM iska idajret nad itapuB ajrek gnaur lawa ,aynrihkA .sagutep agned gnorod gnilas irid nakrabubmem awsisaham assam nalikawrep nup gnaroes ada kadit anerak .bakmep arabutaB tayadiH MH anidaM itapuB nopelet tawel ORTEM isamrifnokid gnay nopeletamirenemaidesrebkaditaynrelules tawel napaggnat iatnimid taaS .nawatraw nakirebmem kadit aguj ai ,takgnis nasep )naw( .nupapa nabawaj

iagabes itapuB atnimem aguj imaK” nakrikimem raga ini anidaM id autgnaro takaraysam pudih tajah nad nagnitnepek adnA tagnI .napalab itukignem adapirad takaraysam hurules autgnaro halada ini imak natutnut alibapa naD .anidaM awabmem naka imak akam nakhadniid -ijnaj tutnunem kutnu anidaM takaraysam atak ”,anidaM itapuB ukales kapab ijnaj .asarkujnugnep isakol naklaggninem mulebeS tapmes asarkujnugnep arap ,narotnakrep anidaM bakmeP tairaterkes ikusamem gnaur id itapub iracnem kadneh nakhab

nahatniremep ador naknalajnem raga ”,ulud eynapmak ijnaj-ijnaj nagned iauses pakis naataynrep malaD .awsisaham ures itapuB atnimem awsisaham ,akerem ador naknalajnem nemtimok raga anidaM isim-isiv nagned iauses nahatniremep nad sitarg natahesek ,sitarg nakididnep( muleb tahilem IMH .)urab ajrek nagnapal nakhab isasilaeret hadus gnay nuputas ada ayntakgninem utiay aynkilabes ada gnay kusamret urab naruggnagnep akgna .reronoh aganet nasakgnamep anacner ianegnem imak naumet kaynab naD“ hawab id anidaM bakmep nakorbobek imak ,arabutaB tayadiH nanipmimepek gnarohaladakifanumgnaroadnatnaktagni ulales nad ijnaj itapenem kadit gnay .assam kairet ”,gnohobreb itapuB atnimem aguj awsisaham ,ulaL sidaKtlPitnaggnemnadtopocnemanidaM halet gnay sibuL nagnualraP rI UP anidaM bakmeP kiab aman gnerocnem -paus aynkaukret nagned itkubret keyorp tekap heloremem kutnu pauynem arap uti akiteK .rednet nalatabmep nad sanid hamur ignatadnem tapmes nanaker nad nabawajgnuggnatrep atnimem itapuB hadus inI .nakilabmekid akerem gnau .nahatniremep tabatram nakhutajnem

irad awsisaham nahuluP -ANIDAM -aC )IMH( malsI awsisahaM nanupmiH asarkujnu)anidaM(lataNgniliadnaMgnab tayadiH anidaM itapuB tutnunem ijnaj-ijnaj nakisasilaerem arabutaB .)9/3( nineS ,ayneynapmak arabutaB tayadiH ialinem awsisahaM nakijnajid gnay apa irad gnecnelem hadus takaraysam ubir nasutar napadah id lah malad kusamret ,anidaM nad ispurok anadip kadnit nasatnarebmep .natabaj naanughalaynep malad kuluM ludbA iska rotanidrooK tayadiH kajes ,nakatagnem aynisaro kitnalid noitusaN nasaH nalhaD-arabutaB adap anidaM pubaW nad itapuB iagabes ada muleb ,ulal nuhat inuJ 82 laggnat .anidaM id ilakes amas nahaburep id ini taas anidaM ,IMH turuneM naigabes nad narucnahek gnabma -tayadiH ayacrep kadit anidaM takaraysam haraekanidaMawabmemupmamnalhaD turunem nakhab ,kiab hibel gnay hadus IMH aman sata akerem ,awsisaham raga anidaM itapuB naktagnignem hanrep hisamutkawesbabesNKKnakukalemkadit ulales ini nagnasap itapub nolac iagabes .NKK itna gnay nagnasap nakarauynem itapuBatnimemanidaMIMHiradimaK“

narapaleK saweT gnuraS niakreB airP irad naropal amirenem ada kadit nagnalihek asarem gnay takaraysam atik ayntujnaleS .aynagraulek atoggna nad nakidileynep nakada naka ek awabid naka tayam nad nakidiynep .kisnerof naigab ek ratnaisgnatameP hakapa ulud uggnut atik koseb iapmaS gnay takaraysam naropal ada .aynraju ”,agraulek atoggna nagnalihek iagabes tubesret X rM iric-iric nupadA 051 gnaruk hibel nadab iggnit ,tukireb katob naped naigab alapek ,retemitnec .laki tubmar nad nakanegnem nakumetid akitek X rM raul naigabid inkay sipal agit naiakap ,igolomineD keremreb urib anraw tekaj ,rekgnod urib anraw katok siril ajemek malad analec nad ,malad soak iakamem ,XA kerem gnaggnip taki ,urib anraw igig ,urib anraw ipot ,livrac kerem ladnas tapad kadit numan gnopmo aud naped tubesret igig audek hakapa nakitsapid mulebes aynnaadaek naikimed hadus .hunubid uabmignem ai ,uti natapmesek adaP nagnalihek ada akij takaraysam adapek raga sata id iric-iric nagned agraulek .aesroP DUSR ek tubesret tayam tahilem nagnalihek asarem gnay agraw igaB“ ,idat naktubes ayas gnay iric-iric itrepes ”,aesroP DUSR ignatadnem nakhalis )sed/marb/nhp( .aynuabmi

gnurak isi tahilem utigeb regeg agraw kutnU .aisunam kososes tubesret tayam ,tujnal hibel nakidileynep mumU tikaS hamuR ek awab id tubesret .aesroP )DUSR( hareaD gnay inarabiS ydderF rd turuneM irad tahilid ,aesroP DUSR id sagutreb gnaubid hadus ini tayam ,aynisidnok ini tayam aynitrepeS“ .nalubes ratikes ”,ulal nalubes ratikes gnaubid hadus askiremem taas inarabiS idderF rd atak .aesroP DUSR tayam gnaur id X rM tayam iduB PBKA risomaS aboT serlopaK id ORTEM iumetid gnay namrehuS aesroP DUSR tayam gnaur ratikes nabrok nakitsapid X rM ,nakatagnem hurules ,aynlasaP .nahunubmep .nabkalid nabrok hajaw naigab ipututid aynhajaw naigab huruleS” nad gninuk anraw nabkal iakap ,natarej tawak nakumetid aynrehelid iakap takiid aynikak audek naidumek nabrok ,nakitsapid akaM .aguj nabkal atak ”,nahunubmep nakapurem tasaK gnipmadid aguj gnay serlopaK ,gniribmeS treboR PKA mirkseR nosnaM PKA aesroP keslopaK .naloggniaN tayam ,nakatagnem serlopaK asaboT agraw nakub inikayid tubesret .asaboT raul irad namirik naknialem atik anerak naikimed nakatak atiK“

gnay uggnim aud ratikeS“ .)anidaM( .anidaM ,agaM irad aynukagn aid ,ulal id rudit ini uggnim aud hadus naD tahileM .uti natabmej riggnip tikas agudnem imak aynisidnok aud gnatad utkaw anerak ,irtnesid asib kadit nad tikas hadus ,ulal uggnim hanrep aguj imaK .nalajreb agraw raju ”,nakam aynirebmem .ratikes ,takiiD ikaK ,kusubmeM airP nabkaliD hajaW aguj airp gnaroes ,hasipret tapmet iD kusubmem nakumetid satitnedi apnat naposoS aseD id natabmej hawab id /3( nineS ,asaboT ,itnareM nahoP utniP naaguD .biW 03.51 lukup arikes )9 ,babeS .hunubid nabrok ,aratnemes tulum nad takiid aynikak audek .nabkalid ,ORTEM helorepid gnay isamrofnI naagirucek irad lawareb uti naumenep kusub uab amora muicnem gnay agraw haleteS .ulal sutsugA 13 laggnat kajes ,naidumek irah aparebeb irusuletid lasareb uti kusub uab amora rebmus matih anraw kitsalp gnurak haubes irad .natabmej gnolok id adareb gnay gnusgnal agraw ,ayntujnaleS ataynreT .aesroP kesloP ek nakropalem gnusgnal PKT id abit isilop utigeb ,raneb natnopS .duskamid gnurak akubmem

1 namalaH nagnubmaS gnusgnal ,naD .isilop adapek tubesret naidajek tapmet halo nakukalem hubut askiremem isiloP .)PKT( arakrep agudid nad ukak hadus gnay nabrok .maj 6 hawab id laggninem halet airp hubut awabmem isilop naidumeK psP DUSR tayam gnaur ek tubesret hubut adap hakapa nakitsamem kutnu adnat-adnat nakumetid nabrok .nasarekek nakumetid kadit nabrok hubut iraD“ niak nalatnub aynah ,nupapa satitnedi malad id katok isan nad naiakap isireb iggnit ikilimem ini airP .matih kitsalp 04 nakarikrepid aisu nad retem 16,1 .ardnI PKA gnaret ”,nanuhat aynkahip ,nakhabmanem ardnI PKA .amsiw anut tubesret airp agudnem narapalek anerak laggninem ai ,agudiD nakumetid ada kadiT“ .nanignidek nad hubut id naayainagnep adnat-adnat anerak laggninem agudiD .ini airp hisam atiK .nanignidek nad narapalek ”,ini airp satitnedi uhat iracnem .aynpacu agraw turunem ,uti aratnemeS ratikes isakol ek gnatad ini airp ,ratikes irad ukagnem nad ulal uggnim aud lataN gniliadnaM netapubaK ,agaM

idaJ nup muiraukA ,tecnegreT iyaB adA kadiT ilebmemasibgnarO.adarebnupanamidtekraminim gnarO.nupnapaknaiakamepkutnunupnapaktekit gnatnetgnisam-gnisamretupmokidtahilemasibnup gnayanamisruknadgnosokhisamgnayanamisruk akeremgnayaterektahilemasibagujgnarO.naknigniid utiatereknadanamnuisatsidadarebgnadesuggnut .igaltinemaparebabitnaka gnidraobnakanuggnemsurahagujipaaterekkiaN amanhakapaaskirepidnakagnapmuneppaiteS.ssap adapadagnayamannagnedamastekitidaretretgnay gnaroajasnakub,utiaracnagneD.gnapmunepisDI tekitnagnedgnay,aterekkusamasibkadittekitapnat sisreP .adebreb aynaman ualak kalotid naka nup .tawasepkiannagned nakirebmemkaditsitkarpgnamemtubesretaraC asaj ,ipaT .isareporeb kutnu olac igab gnaulep nakhab ,pudih patet ajas asib tekit nakilebmem .lagelnagnedgnabmekreb gnapmunephalmuj,utirihkaretnakarbegnagneD naadaekmalad,aynhena,ipaT.nurunemipaaterek ipaatereknalisahgnep,nurunemgnapmunephalmuj !nesrep011kian margorP.nakukalidsurahgnaykaynabhisamutneT gnapmunep nurut tapmet ,CA-reb imonoke aterek tacnolsurahaggnihes(norepraulidhisamgnadakgnay ,igal hisreb hibel aterek taubmem ,)hutajret nad nad,nuisatskitnacrepmem,nakasurekignarugnem naajrekephaladanuisatsratikesidnagnukgnilatanem .hadumkaditagujgnay teliot irad habuid kaynab naka aguj teliot-telioT gnayatinaw,iniamaleS.kududteliotidajnemkokgnoj nagnednatilusekimalagnemsnijanalecnakanegnem aterek gnapmunep pudih ayaG .kokgnoj teliot alolegnepaggniheshaburebkaynabhadusgnamem .iridnakiauseynemsurahagujaterek asarem gnay gnapmunep ilakes kaynab iniK aumesidaidesrethadusPHregrahC:AKidnamayn -ioT.igaladakaditnakamaterekidsagropmoK.isruk id nakhab( hisreb hibel hadus nuisats id teliot-tel idteliotadapiradhisrebhibelhadusnuisatsaparebeb .)aradnab iapacnem naka uti nemejanam nakiabreP ipa aterek adnag rulaj taas :igal nalub 81 aynkacnup nahagnetrepadaP.nugnabidiaselesayabaruS-atrakaJ adamulebgnamemayabaruS-atrakaJrulajid,uti4102 kiabhibelgnayaterekurabnaparahipat’,nesnaknihS‘ )*(!atamnapedidhadus

.agnilettigiggnemgnaytabahas tapad kadit gnapmunep ,adnag sicrak awitsireP isruk,firatsataidhuajgnaysicrakagrah,kududtapmet nanamaynkaditeknad,hunepgnalibidgnaygnosok halada ayngnuju-gnuju ,aynrasad adap ,nial .utiatiruggnemhadusgnaynagnirajnaniamrep .lagagulalesaynnakiaseleynemkutnuaraciagabreB nad ,”!olac pakgnat“ ,”!olac satnareb“ kudnapS naureS .aynitra ada kadit ilakes amas aynasgnabes :uhat nanoJ .gnosok gnomo halaynah uti itrepes gnayadasurahaguj,ipaT.aynrauleknalajhaligolonkeT aynnaknalajnemgnaynaD.igolonketnaknalajnem ,aisunam aynaman gnay naD .aisunam aguj surah ,lekgnej,kebmagn,haramigalgnayaisunamigalapa kadit igolonket taubmem ajas asib ,madned nad .isgnufreb .aynnawayrak ijag nakkianem hadus nanoJ ,ipaT .aynfatsnaarethajesekikiabrepmemhaduS gnay gnaro-gnaro ,NLP id itkubret aguj itrepeS aynranebes isasinagro haubes id uggnaggnem gnaY .nesrep 01 ratikes aynaH .kaynab halkadit gnaY.kiabaynranebesgnaygnaroajaspatetkaynabret naknignignem gnay halpatet kaltum satiroyam .kiabaynaragenuataaynnaahasurep .kiabgnaynipmimepnakulrememakerem,aynaH taubmem urtsuj gnay nipmimep nakuB gnaynipmimepagujnakuB.korbobaynnaahasurep nanoJ.kiabgnaygnaro-gnaronakrikgniynemurtsuj id ayniggnit nakududek naklaggninem hadus gnay ,habat gnay nipmimep idajnem asib uti gnisa knab .’kelbadn‘tikidesnad,huggnat satiroyaM :amas nup aisenodnI ipA atereK TP iD ipa aterek naknignignem aynranebes nawayrak hakgnal-hakgnal,aynitkuB.ujamnadkiabgnabmekreb aynrihka nemejanam nakkarbegid gnay nakiabrep ada awhaB .aynnarajaj hurules helo naknalajid asib halada uti ,inis-anas id natilusek nad natabmah gnay,rasebgnayisasinagrohaubesiradisneukesnok ,ipaT .habureb kutnu hacnil kadit gnamem gnadak gnaro000.02nawayraknagnedIAKrasebisasinagro .tapecfitalerhaburebasibataynret tamagnaynarajalephuggnusIAKTPidisamrofsnarT .aisenodnIidnemejanamhanazahkigabagrahreb harajesmaladtatacidsurahini2102nuhatnarabeL kaditanamidharajeshalinI.aisenodnIidnaolacrep ilebmemasibgnaroaumeS.ipaaterektekitolacigalada teltuonasutariradnadaynhamurirad:huajiradtekit

ilunapaT orteM nalikawreP ,mahuM aksirE :nagnaueK fatS ,gniribmeS naitsirK :ahasU oriB aK/nalikawreP aK dlonrA ,idnaifluZ :nagnabmegneP fatS ,iraS hafrA :nalkI/naroK gnatuiP fatS )tupaT haread nanabmegnep( nolobmiS lesgabaT orteM nalikawreP :nagnabmegneP rotanidrooK ,natiajnaP idE :ahasU oriB aK/nalikawreP aK tarabatuH anitsirK :nagnaueK/mdA ,sibuL imiahuS damhA nahasA orteM nalikawreP aniveR :nagnauek/mdA ,naigaiS oeL llahsraM :nagnabmegneP rotanidroK ,asinnA :naroK/nalkI gnatuiP fatS ,gnibmohiS HS gnaromutiS siraniB :mukuH asauK agrauleK nalkI ,molok mm/005.7 .pR yalpsiD/mumU )W/B( hituP/matiH : nalkI firaT mm/000.51 .pR )ruoloC lluF( anraW nalkI ,molok mm/005.3 .pR tamaleS napacU .)atok malad( 000.2pR narecE agraH .%01 NPP habmatid nalki agraH .molok -701:CA ratnaisgnatameP baC iridnaM knaB sreP aideM ratnaiS TP : n/a gninekeR .1381013000 ajaragnamagnisiS lJ nadeM aneP aharG : nadeM narasameP /nalkI/ iskadeR tamalA 3371887 )160( xaF )gnitnuH( 1661887 )160( pleT .salpmA-nadeM 431.oN 5,8 MK ratnaiS dnaL ageM pmoK 42.oN hulawangnaS lJ :narasameP /nalkI/ iskadeR tamalA : liam-e .r a t n a i S 1 0 5 3 5 5 7 ) 2 2 6 0 ( x a F , 11 5 3 5 5 7 ) 2 2 6 0 ( : p l eT 71amaL naroyabeK ayaR nlJ :atrakaJ nalikawreP .moc.oohay@ratnaisortem .22509435-)120( .xaF .5119435 ,6029435 ,5029435-)120( .pleT nataleS atrakaJ )160( pleT .nadeM 431.oN 5,8 MK ajaR MS lJ ,odniarG nadeM TP : katecneP 3371887 )160( xaF )gnitnuH( 1661887

kera halada nanoJ anerak uti utas gnay ayabaruS ipaaterekinignarakesedoirepmalad,ipaT.)oyoboruS ayaS .uti itrepes nadnamok nakulremem gnamem uludkok,lilajDnayfoSNMUBiretneMnagnedmugak .nanoJitrepeskinugnaronakumenemasib gnaro kosos salej araces nakrabmaggnem kutnU nadacabidkane”opmeT“halajamotom,utiutasgnay :tikides isakifidomid surah ipat ,pitukid asib ,ulrep .”ulrepnadtahilidnaklabeynem“ gnaygnaronakulrememgnamemipaaterek,ipaT naklabeynem aiD .nanoJ itrepes ”naklabeynem“ gnaralemininuhatlawakajesanerakkokorephurules gnayimonokesalekidnakhaB.ipaaterekidkokorem raseb apateb nakgnayaB !nupilakes CA-reb kadit aynahnanoJilakeseS.lubmitgnayisnatsisernadkalojeg ”?kadituatanaksuretidini,siDkaP“.ayasekSMSmirik !suuuuureT:ajaskednepaynasaibnupayasnabawaJ nakraulegnem nup aid ,naidumek amal kadiT ada helob kadiT :fitisnes tagnas gnay nakajibek ek kusam arac nagned nalaujreb gnay nagnosa ,ader iskaer igal muleB .ipa aterek gnobreg-gnobreg nalajnanak-irikraganediserPkapaBiskurtsnilucnum .tarebgnaynaajrekephuggnusutI.nakbitretidipaaterek nanoJ ,ipaT .nitab nad rihaL .naasarep nakam naD nakanaskalem asib ayntaik-taik nad arac nagned .kajibkaga,ehehnebmut,nagnedtubesretiskurtsni igalnakraulekaiD.nakatpicaidsuretlogimedloG tapadnem surah gnapmunep paiT :ini nakajibek .imonokesalekgnapmunepkusamreT.kududtapmet halmujnagnedamassurahsicraknalaujnepitrarebutI gnaygnapmunepadaigalhelobkadiT.kududtapmet .iridreb AK utnip id iridreb iboh ulud gnay gnaro kaynaB asibkaditgnay)ajamerasamidayasnaasaibekitrepes( sata sarek iskaeR .uti iboh naksurenem igal .asaibraulhuggnusutiaynnakajibek ?apagneM gnusgnal gnay italeb tarabi ini ilak aynnakajibeK halinis iD .iridnes malad gnaro itah ulu ianegnem iraduatarauliradigalkadiT.nanoJtarebretnagnatnat gnaro lageli nagniraj irad naknialem ,gnapmunep ,nurumet-nuruthadusgnaynagniraJ.iridnesmalad .tiagnem-tiaknad,kanipkanareb,atiruggnem aynmadnedipat,tahilidasibraulgnaroaynharaM asib:tumilesmaladhusumitrepesasibmaladgnaro gnires ayabaruS gnarO .kulemem libmas tibucnem :gnipuk kaic gnipoh nagned aynnakhalitsignem

,inuyhaW avE ,gniboT ahtanaraM ,)autek( naloggniaN sanagraM :iskadeR naweD ,fusuY niddurfayS :anaskaleP rutkadeR ,gnuyapiS otnamreH,fusuY niddurfayS niwdE : n a t u p i L r o t a n i d r o K , g n u y a p i S o t n a m r e H : a n a s k a l e P r u t k a d e R n e t s i s A k e A ( a r t u P , ) n a r a s i K ( y d a w o l i s u S , ) n a r a s i K ( n o i t u s a N n a v r I : r e t r o p e R ,gniggniraG ,)gnaniP atoK( paharaH arhaM ,)taparP R( anadrahW ikziR ,ebmaR okinnA,)naponaK )ialaB jT( sibuL kahsI kitsitrA & katecarP ,nahajawreP .peD omolaS:katecarP fatS ,niddurimA :gabaK ,risaY damhA :kitsitrA & katecarP pedaK ,gnallunaM irdnA ,artuP eerfeJ ,okodnaH yrdeH ,aganiS niddulamaJ ,ualaM neveS ideD ,gnatohiS leumaS :gnitnuoM fusuY ailuA ,okodnaH ,artuphayS adnah yduR nawrI :TI ecnanetniaM ,isinkeT rotanidroK ,SH ociN ,naloggniaN narmA ,kinamaD natiajnaP adnauJ ,ubiraS koloD dnaltoH :etisbeW enilnO ,naloggniaN AHASU ISIVID nagnaueK/mdA/mumU nemetrapeD gnadaP inoitseR :gnitnuoccA gabaK ,airamuD :mumU/ueK/mdA reganaM narasameP / isalukriS nemetrapeD ,gnanotirA ynradnI : narasameP mdA ,higaraS nosnilrebaJ :narasameP reganaM fatS ,namA irS :nahiganeP fatS ,motluG edA retsE :naroK gnatuiP rotanidroK ,ocnoP ,nanubmaT idnefE ,liamsI ,ataniW nosmiS :nagnabmegneP .atramA yoR ,idrA , ociN :isidepskE fatS ,abruP auT nohJ :isidepskE nalkI nemetrapeD :puorg nalkI .mdA droK , a i r t a S g n a b m a B :nalkI droK , S t o m a J :nalkI reganaM nedloH :nalkI ngiseD gabaK ,airaM oiT :puorG nalkI gnatuiP ,initraK inayiraH abruP notsileR:ngiaseD fatS ,katnujnamiS

aguj nak-liam-e ayas ajas patet ,aynacabmem .aynadapek ilabmek ”sapmoK“ ,naidumek irah aparebeB ilha ,nanoJ kosoS .uti sarek ajrek isaiserpagnem siraynnaklipmatid,uti,ASU,dravraHnasululnagnauek .namalahhagnetes agabmeL nasayaY auteK ,amas gnay irah iD lekitra silunem idabA suluT aisenodnI nemusnoK nakiabrepijumemaguj:naurabmeParauSidgnajnap .ininagnakalebIAKnanayal arakrepnakub,uhatayas,ipaaterekihanebmeM gnaruk“ aynranebes iridnes nanoJ .hadum gnay ,akiremAknabfitukeskeidajaidkaneapateB.”saraw .nakruiggnemgnaysatilisafnadCAgnaurnagned,itiC asaj NMUB nipmimem aid aynlawa ,NMUB iD sanap-sanaprebhilipaidiniK.anahaBTPnagnauek nadtakeD.aynnialnuisatseknuisatsutasiradAKkian ialuM.utasreputasihanebaiD.liceknadraseB.huaj .sinketarakrep-arakrepaggnih,nahisrebek,nanayal aynhusum uti ipa aterek ihanebmem ,lahadaP ,irik ,hawab ,sata ,malad ,raul :pakgnel nad kaynab iriknadraulnanak,nakhaB.gnakaleb,akum,nanak ,idajret ajas asiB .malad irik nad malad nanaK .raul nagnares ayntabeh anerak nakub lobej ayngnawag aterekgnakalebnasirabanerakipat,husumiradalob .iridneslognikibgnayaynipa naknignignem gnay ”retropus“ iaros-karos ,ipaT aynitneh-itnehkaditlogkatecnemasibsuretipaaterek ipaatereknapednasirabidgnareyneparaP.amegreb logtaubmeM.logtaubmemaynhalel-halelkaditnup ,ilakaudlogigaltaubmeM.ilakeslognalobobek,ilakes ,ayntukireblog-logkutnu,ipaT.ilakesigallognalobobek ek kusam gnay adapirad taubid gnay kaynab hibel .iridnesgnawag irebmemsuretipaaterekmitnetpakiagabesnanoJ .gnakalebeknadakumekirallibmasnapedeknapmu ayniral aggnihes suruk nad licek aynnadab ,gnutnU riggnimulrepkaditaggniheskiabaynizig,gnutnU.hacnil niamgnadaknetpakisiksem(gnutnU.munimkutnu tahilemkaditayntisaw,)rasakaynkairetadannaduyak .tahilemkaditarup-arupuata halitsap,logkaynabnikibasibkaditaynmitajasualaK -gnilkcatanerakkiab:haremutrakanekrethadusaid gnay aynnakairet-nakairet nupuam sarek gnay ayn .alobniamrebakiteraggnalemgnires nad,surul,sagetgnaygnaronanoJawhabuhatayaS asahabnakhamejrenemnakakaditayas(”orsok“kaga

iskadeR nemetrapeD RATNAIS ORTEM natopadnaP , gniboT ahtanaraM ,)autek( naloggniaN sanagraM :iskadeR naweD ,gnatohiS sudranoeL :anaskaleP rutkadeR ,gnatohiS sudranoeL ,nagallaiS TM ,kinamaD nohJ ,higaraS remlohP : r u t k a d e R ,abruP ordnahC :natupiL rotanidroK idE ,ytukgnaR ibzeH ,nabaliS DM alaP :rutkadeR netsisA ,hannajruN ,antawedilP ,oholaH isavE arP,abruP adlemI ,inarabiS oggnoT ,nimA rorkI :retropeR ,higaraS tohiraM ,)taparaP( tiariS orteJ ,)awaJhanaT(haysnawrI ,))atrakaJ( usmaS omoteoS .)kolodubiraS( abruP otraW idneS ,)naehaK ualiS( abruP onodraH ,)ayaR( aganiS inpahruN itnaY :iskadeR siraterkeS ILUNAPAT ORTEM TM natopadnaP ,gniboT ahtanaraM ,)autek( naloggniaN sanagraM :iskadeR naweD rotanidroK ,- :anaskaleP rutkadeR ,fusuY niddurfayS ,katnujnamiS leinaD ,nagallaiS ,aromamiS tohiraM ,ratuB ratuB nawdiR :retropeR ,adnalyamartuP asaN :natupiL ebmaR lirsaM ,gnaemutiS tuaS ,nairubiS ognuD ,gniboT ydderF ,asaraB sirA ihalaliS nedroH ,)surab nednopserok( nubraM itawaniR ,)suraB nednopserok( )tupaT( gniboT ikgneH ,)tupaT( loagnabmuL dranreB ,)sahabmuH( LESGABAT ORTEM niddihuM , gniboT ahtanaraM ,)autek( naloggniaN sanagraM :iskadeR naweD oenroB :natupiL rotanidroK ,hannajruN :anaskaleP rutkadeR tlP ,naubisaH nahoP narmA ,)lespaT/naupmidiS( nahoP nagnudnilraP :retropeR ,narognoD sibuL nawdiR M ,)salaP( ,rageriS lakiP narmA,)atulaP( paharaH gnohoT ,)lespaT( )anidaM( NAHASA ORTEM

1 namalaH nagnubmaS gnay otof :acab( kiabret otof tapadnem kutnu gnay iyab ,ralugnem gnay naertna :)nakhideynem anerak rudit gnay aut gnaro ,nagnodneg id tipejret nakkianid gnay licek kana ,teliot taked id nahalelek ,aterekutniptecnegekgnayatinaw,alednejtawelaterek .aynsinejesnad gnay kejbo-kejbo ,ini nuhat narabeL gnalejneM kabpaynelabit-abitutiotofnawatrawatamid’iskes‘ ,natipmi ,nakased igal ada kadiT .imub naletid kiranem gnay nial naatirednep sinej nad ,natecneg tahilretgnaykaynabnupnawatrawaraP.otofidkutnu gnay naD .mutnemom uggnunem aynah kudud .tahilretgnujnukkadituggnutid nuisatssagutepgnaroes,ayngnesinagned,akaM ajasurabaid,aynapuR.ayasPHekotofnakmirignem nawatrawgnaroeS:kiranemgnaynaidajektertomem kiranem kejbo naktapadnem kadit anerak gnay otoF.nuisatsidadagnaymuiraukatertomemhilimem kadiT:inigebsketirebaidnuputi”tertomemnawatraw“ !muiraukatertomemnupnawatraw,otofkejboada irahesgnay,gnalaMnasurujgnapmunepgnaroeS id IR naakedremeK TUH aracapu tuki aynmulebes pudihrumueS:ayasekSMSnakmirignem,aynrotnak ayas ini nuhat narabeL urab ,narabeL kidum !naakedremeknakasarem naijupSMStapadnemkayalkaditasaremayasutneT -rofayasaregesnuputiSMS.utiitrepestignaliggnites TP(aisenodnIipAatereKTPamatUrutkeriDekdraw narajajhurulesatres(hal-nanoJ.nanoJsuisangI)IAK kahreb hibel gnay )ipa aterek nawayrak nad iskerid .utinaijuptapadnem aumeS.amasgnayadannagnedSMSilakeskaynaB nup turiD kaP .nanoJ ek drawrof ayas id ipa aterek narajaj hurules ek aynnakrabeynem .aynhawab nuputaskadittahilretgnamem,aynirahnakoseeK id natewurek ianegnem amatu otof taumem narok nakhab ”sapmoK“ nairaH .ipa aterek nuisats :naped namalah id gnajnap nasilut naknurunem aterekajreniksataasaibraulgnaynaijupnakirebmem isrev nakmirignem acabmep kaynaB .ini nuhat ipa ritawahk,ayasliam-eekuti”sapmoK“idnasilutenilno .aynacabmemkaditayas ayasiksemnaD.aynacabmemhadusayasutneT alup hadus itsap nanoJ awhab uhat nup

LESGABAT ORTEM lesgabaT gnarO naaggnabeK naroK

7002/A/20/3002/834 :.oN SPS atoggnA sreP aideM ratnaiS .TP : tibreneP ) lesgabaT orteM ,nahasA orteM ,ilunapaT orteM ,ratnaiS orteM( ismaiL K adiR misaK rumkaM ifadahK naloggniaN sanagraM abruP naidloG naloggniaN sanagraM gniboT ahtanaraM abruP niwraD nagallaiS TM natopadnaP naubisaH niddihuM nagallaiS TM natopadnaP inuyhaW avE katnujnamiS leinaD ayajiW tnecniV

: namriahC : amatU sirasimoK : sirasimoK : amatU rutkeriD : rutkeriD : husagneP : MG/bajneP/mumU nipmimeP : naahasureP nanipmiP/UP likaW : naahasureP nanipmiP likaW : ratnaiS orteM dermiP : lesgabaT orteM dermiP : ilunapaT orteM dermiP .jP : nahasA orteM dermiP : ilunapaT orteM dermipaW : namsdubmO miT


4 September 2012

Truk Rombongan... Sambungan halaman 8 rangka bantuan pengamanan di sana. “Brimob Poldasu deta semen B Tebing Tinggi yang berangkat ke Batang Toru, Tapanuli Selatan dalam rangka pengamanan di sana,” ucapnya. Lebih lanjut Kapolres mengatakan, korban luka berat atas nama M Sitorus saat ini sudah dilarikan langsung ke Medan untuk dirujuk ke Rumah Sakit Elisabet. Sedangkan ketujuh lainnya, dirawat intensif di RSU Tarutung. “Sedangkanpersonelyangselamatterusmelanjutkan perjalanan ke Batang Toru,” ucapnya. Pantauan wartawan di RSU Tarutung, sejumlah korban hingga kini masih dirawat intensif oleh petugas medis rumah sakit. Sedangkan Kapolres, hingga berita ini diturunkan, masih tetap memantau di rumah sakit tersebut. Berdasarkan data yang dihimpun wartawan, kedelapan korban luka masing-masing, Aswar Anas Tanjung (supir), Marihot Sitorus, Dedi Asmono, Ahmad Fahri, Jaya Sitanggang, Ricky dan Yokia. Berdasarkan informasi dari warga sekitar, truk itu terbalik karena supir tidak bisa mengendalikan kemudi saat mau menikung di tikungan tajam kilometer 12 Desa Parsikkaman, Adian Koting, Tarutung. Sedangkan kondisi truk ringsek setelah jatuh berguling-guling ke jurang sedalam empat meter. (cr-01/des)

Air Laut Masuk... Sambungan halaman 8 karena air laut kerap membanjiri rumah penduduk di sekitar bibir Pantai Ujung, Sibolga. Peristiwa ini terjadi dalam beberapa hari belakangan, terutama pada malam hari deburan ombak terasa semakin besar. “Seperti semalam, disaat aku tidur di rumah jadi kaget sebab tiba-tiba air laut bisa menyiram wajah dan badanku. Kalaupun misalnya terjadi pasang gembung (gelombang pasang,red), belum pernah terjadi seperti ini,” kata Hendra, salah seorang warga yang rumahnya tak jauh dari bibir pantai, Senin (3/9) kemarin. Menurut Hendra, setiap tahunnya warga Pondok Reformasi memang menjadi langganan hantaman gelombang air laut, bahkan sudah ada beberapa rumah warga setempat yang rusak total akibat dihantam gelombang laut yang besar tersebut. “Kalupun setiap tahun seprti ini, namun untuk tahun ini cukup besar dan membuat kami warga resah. Apalagi kami kuatirkan, kuatnya hantaman gelombang pasang dan hantaman ombak khususnya membuat tembok penahan yang ada menjadi rusak,” tukasnya. Untuk itu, ia dan warga setempat lainnya berharap agar Pemko Sibolga memberikan perhatian misalnya dengan membangun tembok penahan yang kokoh guna menahan derasnya hantaman gelombang air laut yang sedang mengamuk. “Artinya sebagai warga kami berharap perhatian pemerintah untuk membangun tembok penahan yang kuat, bukan asal dibangun. Sebab gelombang laut atau ombak di pantai Ujung Sibolga ini lebih kuat dibanding beberapa pantai lainnya yang ada,” ujarnya. Senada itu, Infust Hutapea, salah seorang warga setempat lainnya membenarkan adanya kekuatiran warga akan gelombang laut yang cukup tinggi dalam beberapa hari ini, yang dikuatirkan bisa merusak rumah warga lainnya seperti yang sudah-sudah. “Jangankan rumah warga yang pondasinya tidak terlalu kuat. Bangunan menara pantai Ujung atau kami sebut menara kastel ini saja bisa roboh akibat kuatnya hantaman ombak,” tukasnya. Jika dilihat, sambungnya, memang gelombang pasang yang muncul beberapa hari ini cukup besar bahkan tingginya bisa mencapai 2 meter. “Ini memang setiap tahun terjadi, namun tak sebesar tahun ini. Wajarlah kalau warga setempat menjadi was-was atau kuatir dengan hal

Aparat Hukum Harus Tegas Sambungan halaman 8 Kapolda Sumut dengan menempatkan baliho atau spanduk bertuliskan berantas narkoba di Sumut di tempat umum atau di polsek-polsek di wilayah Sumut menandakan Kapolda berko-

mitmen memberantas narkoba di Sumut. “Apalagi Kapolda sebagai aparat keamanan putra Sumut, tentunya berkewajiban secara moral untuk menyikat habis pengguna narkoba. Saya kenal betul pribadi Kapoldasu karena sering komunikasi. Yang penting, semua elemen harus

mendukung program Kapoldasu untuk memberantas narkoba yang juga salah satu program dan atensi Kapolri,” tegas Malik Assalih Harahap. Malik menambahkan, penyalagunaan narkoba akan menghadapi banyak masalah terutama masalah sosial bagi penggunanya yang kebany-

akan kalangan pelajar. Mereka cenderung menjadi orang yang tidak berguna karena tidak mampu memikul tanggung jawab. Di samping itu, pengguna narkoba akan cenderung menjadi pelaku kejahatan untuk memenuhi kebutuhannya. (phn/mer)

STKIP St Maria Sibolga, Lepas 259 Mahasiswa/i PPLT Sambungan halaman 8 Marbun SCMM serta disaksikan oleh sejumlah pejabat Kota Sibolga beserta pengurus yayasan, dan seluruh Dosen. Dalam pengarahannya, Wali Kota Sibolga menyarankan kepada seluruh mahasiswa/i STKIP St Maria Berbelas Kasih yang akan dilepas untuk melaksanakan kegiatan PPLT secara sungguh-sungguh dan tidak menyianyiakan kesempatan tersebut. Karena menurutnya PPLT selain untuk melatih kemampuan mengajar, juga melatih kemam-

puan mahasiswa untuk bermasyarakat. “Diharapkan agar mahasiswa/i STKIP mampu mengajar dan bermasyarakat di lingkungannya,” tutur Syarfi memberikan arahan. Hal yang senada juga disampaikan oleh ketua Yayasan Santa maria Berbelas Sr Dionesia Marbun SCMM. Ia mengimbau agar seluruh mahasiswa yang melaksanakan PPLT memberikan yang terbaik. “Kepada mahasiswa-mahasiswi kami, kami harapkan agar jangan bermain-main dalam melaksanakan kegiatan PPLT ini.

Apalagi ini merupakan PPLT perdana bagi kampus kita. Kalianlah mahasiswa/i angkatan pertama yang akan mencerminkan wajah STKIP ke permukaan. Untuk itu berikanlah yang terbaik,” ujar Sr Dionesia. Sementara ketua panitia Drs L Sinaga dalam laporannya menyampaikan, bahwa mahasiswa/i yang akan melaksanakan PPLT di Sibolga Tapteng terdiri dari 44 orang Program Studi Pendidikan Matematika, 59 orang Program studi Pendidikan Bahasa Inggris dan 155 orang program studi Pendidikan Guru Sekolah Dasar (PGSD).

Akibat Jalan Rusak Petani Kewalahan Sambungan halaman 8 perti yang diungkapkan Ketua DPRD Taput, Asman justru berpendapat bahwa pemerintah daerah harus bekerja lebih maksimal lagi. Caranya, jangan hanya berpatok terhadap anggaran tersebut. Melainkan pemerintah harus mencari dana dengan melakukan loby ke pusat. “Dinas Pekerjaan Umum harus mengetahui seberapa banyak jalan yang butuh perbaikan dan berapa dana yang dibutuhkan. Apabila sudah diketahui berapa jumlah untuk itu, pemerintah harus mencari cara lain. Jadi jangan hanya mengharapkan dana alokasi umum yang bersumber dari APBD saja. Itu tugas pemerintahan untuk mencari dana lainnya. Seperti, Dana Alokasi Khusus (DAK) dari Pusat. Atau mungkin dana percepatan pembangunan daerah tertinggal. Kalau itu maksimal dilakukan, niscaya keterbatasan dana itu bisa diatasai,” bebernya. Selain itu, lanjut Asman yang juga mantan angggota DPRD Taput ini, DPRD selaku wakil rakyat juga harus proaktif melihat apa-apa saja yang dibutuhkan oleh masyarakat. “Dewan harus mengkaji lebih dalam kebijakan umum anggaran. Hal-hal yang tidak dibutuhkan, saya rasa seperti kegiatan seremonial


RUSAK: Satu unit bus melintas dari satu ruas jalan di Siatas Barita, Taput, yang rusak parah dan butuh perbaikan. seharusnya diminimalkan. Contohnya, acara HUT Pemkab Taput yang dilakukan 10 hari. Memang boleh saja itu dirayakan. Namun saya mau tanya apa rupanya keuntungan yang dihasilkan dengan dilakukannya acara seremonial itu. Jadi acara seremonial seperti itu harus dikurangi dan dana yang harusnya diperuntukkan untuk acara itu bisa dialihkan ke perbaikan jalan,” imbaunya. Selain itu, tambah Asman, kompetisi olahra-

ga di Tapanuli Utara dinilai tidak terlalu penting untuk digemborkan. Karena menurutnya, saat ini olahraga di daerah itu masih sebatas hiburan tanpa adanya prestasi. “Nah, hal-hal seperti itulah yang perlu Dewan pikirkan dan harus berani mengatakan agar hal itu ditunda dulu dan mencari solusi dengan mengarahkan ke yang lebih penting seperti pembangunan infrastruktur tadi misalnya,” pungkasnya. (cr-02/des)

“Mereka akan di kirim ke 39 SD, 11 SMP, dan 12 SMA di Sibolga Tapteng,” pungkasnya.(Cr-1/nasa)

TetapEksis... Sambungan halaman 8 nyumbangkan suaranya. Baim menambahkan, sesudah berdiri 5 tahun, Osibisa tetap eksis. Bahkan, keluarga besar Osibisa turut bersyukur karena ada beberapa anggotanya yang akan berangkat ke tanah suci untuk menunaikan ibadah haji. Ada juga keluarga Sufahmat yang baru kembali ke SIbolga yang merupakan kampung halaman. “Kami bersyukur, Osibisa tetap eksis dengan jumlah anggota sebanyak 50-an KK. Organisasi ini bukanlah organisasi politik. Tapi bersifat sosial kemasyarakatan. Ada pegawai negeri, pensiuanan, pengusaha swasta, dan dari berbagai latar belakang profesi lainnya,” timpal Baim. Selama perjalanannya, Osibisa aktif dalam kegiatan sosial kemasyrakatan. Seperti menggelar arisan rutin tiap bulan. Touring Komunitas Sepedamotor Osibisa pada hari libur ke ke luar daerah, seperti ke Padang Sumbar, Riau dan Pekan Baru, Berastagi, dan daerah lainnya, sambil mempromosikan objek-objek wisata yang ada di SibolgaTapteng. Osibisa juga telah menunjukkan kehadirannya ke tengah masyarakat dengan turut memberi bantuan kepada para korban bencana alam yang terjadi di Sibolga dan Tapteng. “Jadi Osibisa ini bukan organisasi untuk hoga-hoga,” pungkas Baim. Di kesempatan itu, Zufrianto Hutagalung SH yang mewakili anggota juga menyampaikan sambutan dan sepatah kata dalam momen Idul Fitri. (mor/nasa)

Sukran Bagikan Buku “Si Anak Singkong” Sambungan halaman 8 (CT) setengah abad. CT, demikian nama panggilannya, adalah pengusaha Indonesia yang sukses dalam wirausahanya dan memperluas usahanya. Dalam pengantar buku itu, dituliskan CT adalah anak muda yang sukses. Kesuksesannya dirintis, dikembangkan, dan diperoleh berkat kerja keras, bekerja tuntas, punya komitmen, dan sedikit banyak digerakkan ambisi. Biografi Chairul Tanjung diawali dengan kisah bagaimana di tengah keterbatasan kondisi ekonomi keluarga, CT mampu melanjutkan pendidikan ke perguruan tinggi. Kedua orangtua sangat tegas dalam mendidik anak-anaknya, termasuk CT. Orangtuanya mempunyai prinsip agar bisa keluar dari jerat kemiskinan, pendidikan merupakan langkah yang harus ditempuh dengan segala daya dan upaya. Apa pun akan mereka upayakan agar anak-anak mereka dapat melanjutkan pendidikan tinggi sebagai bekal utama kehidupan masa depan. Bab-bab berikutnya masih menceritakan

kehidupan masa muda CT. Saat menjadi mahasiswa sampai kisah awalnya menjadi wirausaha. Tahun 1987, CT menjadi kontraktor pembangunan pabrik sumpit di Citeureup, Bogor, seluas 800 meter persegi. Tapi yang jadi malah pabrik sandal. Buku ini juga mengisahkan kehidupan rumah tangga dan keluarga CT, ketika CT bertemu dengan perempuan Jawa, Anita Ratnasari, yang tegas dan tegar. Dalam buku ini, CT mengungkapkan bahwa baginya ibu adalah segalanya. CT percaya bahwa surga ada di telapak kaki ibu. Bila kita benarbenar berbakti kepada ibu sepenuh hati dan ikhlas, maka surga akan kita gapai di dunia. Itu yang saya alami sendiri, CT berpendapat. CT juga menyampaikan pandanganpandangannya tentang persoalan ekonomi dan menceritakan aktivitasnya sebagai pengusaha. CT mengembangkan Para Group, kemudian mengganti nama perusahaannya menjadi CT Corp. Secara umum CT Corp terdiri atas tiga perusahaan subholding yaitu Mega Corp, Trans Corp, dan CT Global Resources. Mega Corp adalah perusahaan induk untuk

jasa keuangan yang melayani masyarakat di sektor perbankan, asuransi, pembiayaan, dan pasar modal. Trans Corp adalah perusahaan induk yang bergerak di bisnis media, gaya hidup, dan hiburan. Dalam perusahaan ini, terdapat dua stasiun TV, yaitu Trans TV dan Trans 7, portal berita Detik, dan perusahaan ritel Careefour. Selain itu juga ada perusahaan yang bergerak di bidang makanan dan minuman, hotel, biro perjalanan, dan sejumlah department store yang menyediakan kebutuhan fashion merek terkenal dan high-end. Sedangkan CT Global Resources adalah perusahaan induk yang fokus pada bisnis perkebunan. Buku ini menarik dibaca dan bermanfaat bagi siapa saja yang ingin mengetahui bagaimana seorang CT berhasil menjadi pengusaha sukses dengan hasil kerja kerasnya dan hasil keringatnya sendiri, dan bukan warisan keluarga konglomerat. “Buku ini berisi kisah hidup Bang Chairul Tanjung. Dari anak desa yang suskses menjadi pengusaha dan konglomerat. Tapi beliau tetap

rendah hati hingga digelari “Si Anak Singkong”. Buku ini bisa memotivasi kita untuk meraih suskes dan sangat inspiratif. Buku ini saya bagikan gratis kepada masyarakat Tapteng dan Sibolga, ke perpustakaan, sekolah, dan lembaga sosial lainnya. Beliau sendiri berkeinganan datang ke Tapteng dalam waktu dekat ini,” pungkas Sukran. Hadir di acara itu, Bupati Tapteng, Raja Bonaran Situmeang SH MHum bersama Ketua TP PKK Ny Normaida Br Simatupang dan jajaran pimpinan SKPD, para camat dan lurah serta para PNS di lingkungan Pemkab Tapteng. Hadir juga Walikota Sibolga Drs HM Syarfi Hutauruk dan jajaran. Kapolres Tapteng AKBP Dicky Patrianegara SH SIK MSi beserta jajaran, Dansatradar 234 Sibolga, Dandenpom 1-2 Sibolga, Dandim 0211 TT. Hadir juga para pimpinan perbankan, tokoh agama dan masyarakat Tapteng dan Sibolga, pengurus dan anggota OKP, para pimpinan dan anggota DPRD Tapteng dan Sibolga, serta segenap elemen masyarakat lainnya. (mor/ nasa)

SAMBUNGAN METRO TABAGSEL Ponaryo Menahan Senyum, Jajang Sempat Gemetar Sambungan Halaman 1 ten timnas Indonesia, yang kemarin malam bergaya mengenakan kaus hitam dengan celana dilipat di bawah lutut berdampingandenganmodelwanitacantik. Ponaryo tak sendirian di fashion show bertemaUIFashionWeekdisalahsatumaldi kawasan Jakarta Selatan yang berlangsung Sabtumalamlalu(1/9)itu.Melenggangtepat dibelakangnya,JajangMulyana. StrikertinggibesarasalklubMitraKukaritu juga tampak percaya diri menjadi model. Wajahnya dingin dan langkahnya di catwalk meyakinkan.Diamengenakankemejakotakkotak berwarna merah dan memakai tutup kepala. Secara berurutan kemudian muncul penggawa Persela Lamongan yang dikabarkan baru saja putus dengan sang

kekasih,penyanyiPinkanMambo,Febrianto Wijaya. Disusul pemain Pelita Jaya Riyandi ‘Angky’RamadhanaPutra. Suasanamenjadilebihhebohketikasosok seorang ‘model’ bule muncul mengenakan kemejakotak-kotakmerahdenganjinshitam dansepatuputih.DialahSimonMcMenemy, eks pelatih Mitra Kukar dan timnas Filipina asal Inggris yang dua tahun silam pernah menjadi perbincangan saat foto-foto mesranya dengan Rahma Azhari beredar di internet. Para model dadakan dari lapangan hijau masing-masing muncul dua kali di catwalk dengan mengenakan dua busana berbeda. Sebetulnya gelandang timnas Firman Utina juga dijadwalkan tampil. Tapi, karena ada musibah yang menimpa salah seorang keluarganya,Firmanbatalmenjadimodel. Parapemaindanpelatihtersebutmenjadi

model DEIJE a.k.a denim is jeans yang salah satu owner dan desainernya adalah mantan penggawa timnas Merah Putih Isnan Ali. Setahun terakhir, bersama dua rekannya, Raka Zaipul dan Adri Naufal, pemain yang saat ini tercatat sebagai salah seorang penggawa Mitra Kukar itu serius mengembangkan bisnis di luar lapangan bola. “Gila. Ini lebih tegang daripada melakoni pertandinganpentingdilapanganhijau.Saya sangat gugup tadi sampai gemetar saat berjalan. Keringat mengucur deras,” ujar Jajang,lantastertawangakak. Pemain yang pernah menimba ilmu di Brasil itu mengatakan, dirinya dan pemain yang lain sama sekali tidak berlatih dahulu sebelum berlenggak-lenggok di catwalk. “Latihannya ya cuma gladi resik sebelum tampil.BarukemarinsayadihubungiIsnan,”

Dedi-Affan Belanja Cabai Sambungan Halaman 1 sempatkan Dedi-Affan untuk mengenalkan diri di tengah-tengah masyarakat,mendengaraspirasidanharapan, Dedi juga menyempatkan diri belanja sayursayuran,ikandanbuah-buahan.BahkanDedi membelikan cabai untuk seorang pembeli yang kebetulan saat itu sama-sama membeli dengan Dedi. Terlihat jelas, pasangan Dedi-Affan yang mulai berjalan kaki dari simpang eks Bioskop Rajawali menuju Pasar Sangkumpal Bonang sudah mengundang antusias masyarakat untuk menyalam dan menyapa pasangan calon pemimpin masa depan Psp ini. Masyarakat pun rela berdesak-desakan menemani Dedi-Affan menyapa para pedagang di Pasar Sangkumpal Bonang. Awalnya, Dedi berkeliling di sejumlah lorong di lantai 1 Pasar Sangkumpal Bonang. Lalu menemui sejumlah pedagang kaki lima, truskebasePasarSangkumpalBonang.Meski

dalam kondisi yang begitu panas membuat tubuh keringatan, masyarakat begitu senang dan gembira dijumpai Dedi-Affan. Di base Pasar Sangkumpal Bonang, DediAffan bersama tim yaitu Ketua dan Sekretaris Tim Parpol Pengusung, Taty Ariyani TambunanSHdanHErwinNasutionSHMM, Ketua dan Sekretaris Dedi-Affan Center, H Roppu Harahap dan Borkat SSos dan lainnya, menyempatkan diri minum dan makan di Warung Kembar, sekaligus bercerita dengan masyarakat.Selanjutnya,Dedi-Affankelilingke sejumlah blok di base Pasar Sangkumpal Bonang, lalu menuju Plaza ATC yang juga untuk menyapa pedagang di Plaza ATC. Memasuki shalat Ashar, Dedi-Affan dan rombongan singgah di Masjid Tuanku Lelo Pasar Sangkumpal Bonang. Usai shalat Ashar berjamaah, Dedi-Affan menyempatkan diri belanjasayur-sayuran,ikandanbuah-buahan. Sekitar 2 jam lamanya Dedi-Affan menyapa para pedagang dan pembeli, pasangan birokrat murni ini bersama sejumlah timnya

kembali ke Kantor Dedi-Affan Center di Jalan Bakti PU Ujung Padang menumpang becak bermotor (betor). Pasangan Dedi-Affan kepada METRO mengaku, sejumlah pedagang di Plaza ATC dan sejumlah pedagang kaki lima mengeluhkan Pasar Sangkumpal Bonang yang begitu semrawut, masalah kebersihan kurangdiperhatikandanpelayananpengelola kepadaparapedagang.Dilantaisatudanbase Pasar Sangkumpal Bonang terasa begitu panas, dinilai mereka karena kurangnya sirkulasi udara. Sejumlah keluhan lain yang merekaterimadarisejumlahpedagangadalah penataan pengelolaan Pasar Sangkumpal Bonangyangkurangbaik,jaminankeamanan dinilai kurang dan sebagainya. Sehingga, terang Dedi-Affan, jika mereka diamanahkan rakyat memimpin Psp lima tahun ke dpan, merekasiapmenataPasarSangkumpalBonang agar bisa lebih baik lagi, sehingga pembeli dan pedagang bisa sama-sama nyaman di pasar tersebut, baik dari segi manajemen, tata kekola, fasilitas dan lainnya. (neo)

sambungnya. Lain halnya dengan Febrianto Wijaya. Pemain yang sempat menjalani latihan di klub Vfb Stuttgart (Bundesliga Jerman) itu mengaku enjoy tampil di catwalk. Febrianto mengatakan sangat tertarik dengan fashion. “Sayarasafashionperlujugauntukpemain bola,” katanya. Febri bahkan menyatakan bersedia jika ada yang “mem-booking-nya” kembali menjadi model. Bagaimana kesan Ponaryo Astaman? “Ini benar-benar pengalaman yang berbeda yang tidak akan pernah saya lupakan. Bayangkan saja, saya biasa tampil di lapangan, tapi tiba-tiba saja menjadi model di catwalk,” ujar Ponaryo. Karena yang menjadi bintang di acara fashion show adalah para pemain bola, para penontonnya pun banyak yang selama ini berkecimpung di lapangan hijau. (jpnn)

Tak Menolak Dijodohin Ustad PENYANYI seksi Vicky Shu belum juga menambahkan tanda-tanda akan menikah. Meski sudah berusia 32 tahun, Vicky Shu tetap saja menjomblo. “Betah enggak betah sih. Betah karena aku biasa mandiri, kalo gak betahnya kangen juga masamasa punya cinta,” kata Vicky Shu di Studio RCTI Kebon Jeruk Jakarta Barat, Senin (3/9). Vicky mengaku pernah dijodoh-jodohkan oleh beberapa pria semasa kuliah. Tapi sekarang orang tua Vicky Shu sudah tak pernah lagi menyodorkan pria. “Zamanku dulu waktu kuliah malah sering, tapi begitu udah lulus kuliah udah kerja, enggak lagi. Kapok,” terang pemilik nama

lengkap Vicky Veranita Yudhasoka itu. Ia juga mengakui dirinya sulit membuka hati kepada pria. Hal itu dilakukan karena dirinya ingin mencari sosok yang pas. “Daripada gua gonta-ganti, karena tujuannya memang bukan pacaran tapi nikah. Sebetulnya tdk sepemilih itu cuman yang simpel aja,” jelasnya. Vicky Shu membantah kedekatan dirinya dengan seorang pengusaha dan penyanyi. “Pengusaha mana? Bukan, doain aja. Ama penyanyi? Enggak, udah lewat,” jelas Vicky. (abu/jpnn)

Kami akan Jadi Raja yang Sayang Rakyatnya Sambungan Halaman 1 hadir di sini kalau bukan karena keikhlasan,”ujarDedi-Affandidampingi nyonya dan Tim Terang DeFan di hadapansekitar3.000-anmasyarakat. Dedi mengaku terharu dengan sambutan dan dukungan masyarakat kepada mereka. “Untuk itu, kami akan berupaya menjadi pemimpin sebagai lambang keadilan. Kami akan menjadi pemimpin yang pro rakyat. Kami akan menjadi pemimpin yang toleransi kepada semua agama. Doakan kami, restuikami,”ucapDedi. Diungkapkan Dedi kalau mereka bukan apa-apa dan tidak akan bisa mencapaicita-citabersamamenujuPsp yang lebih baik ke depan tanpa bantuan semuanya. “Andaikan hari ini kami dinobatkan menjadi seorang raja, maka kami akan menjadi seorang raja yang sayangkepadarakyatnya,”pungkasDedi. Meski dalam suasana yang sesak dan


Dedi Jaminsyah Putra didampingi nyonya serta Affan Siregar dan nyonya, di acara borhat-borhat Dedi-Affan, Minggu (2/9). panas tapi masyarakat terang Dedi tetap antusiasmengikutitiaprangkaianacara. “Ini karena kebersamaan kita. Tidak ada yang sempit di hati yang lapang. Terima kasih, kami tidak akan berjanjijanji karena yang terpenting bagi kami adalah realisasinya. Kami memang

bukanyangterbaik,tapikamisiaptampil menjadi yang terbaik untuk Kota Psp. Di pemilukada ini ada kalah dan menang. Tapi Kami ikut pemilukada ini bukan untuk kalah tapi untuk menang,” tegas Dedi disambut tepuk tangan riuh masyarakatyanghadir.(neo)


4 September 2012

Aparat Hukum Harus Tegas Berantas Peredaran Narkoba FOTO BERSAMA: Malik Assalih Harahap bersama Kapoldasu, Irjen Pol Wisjnu Amat Sastro.

OSIBISA Gelar Halal Bihalal

Tetap Eksis di Usia 5 Tahun PANDAN-Organisasi Sosial Serba Bisa (Osibisa) SibolgaTapteng menggelar Halal Bihalal sekaligus silaturahmi Idul Fitri 1 Syawal 1433 H di Lapo Harambir Hotel Bumi Asih Pandan, kemarin malam. Hadir segenap pengurus dan anggota organisasi yang telah berusia 5 tahun itu. “Halal Bihalal ini merupakan momentum memupuk jalinan silaturahmi antar keluarga besar

Osibisa, yang bertepatan pula pada momen Hari Raya Idul Fitri,” tutur ketua Osibisa Sibolga-Tapteng, Baim Lubis dalam sambutannya. Halal Bihalal digelar secara sederhana, namun penuh nuansa kekeluargaan. Dikemas dengan acara makan bersama dengan selingan lagu-lagu yang dibawakan para anggota yang me-

Baca Tetap Hal 7

SIDIMPUAN-Memberantas penyalagunaan narkotika dan obat-obat terlarang (Narkoba, red) diperlukan tindakan tegas dari aparat penegak hukum. Tujuannya, ada efek jera terhadap pelaku atau pemakai serta bandar bahkan dapat juga mempersempit ruang gerak para pengedar atau bandar. Disamping tindakan tegas aparat penegak hukum, juga diharapkan peran serta orang tua, kepala lingkungan (Kepling), pendidik, ula-

ma, pendeta, LSM, tokoh politik, organisasi mahasiswa dan pemerintah untuk ikut bersama dalam memberantas penyalahgunaan

narkoba termasuk memberi informasi kepada polisi. “Peran serta seluruh elemen masyarakat akan sangat membantu pihak kepolisian untuk membekuk pelaku narkoba,” kata pemerhati kepolisian Malik Assalih Harahap ST, Senin (3/9). Malik Assalih Harahap mendukung komitmen Kapolda Sumut, Irjen Pol Wisjnu Amat Sastro beserta jajarannya untuk memberantas penyalagunaan narkoba di Sumut. Walaupun kadang di lapangan

sering terjadi penghadangan dari warga akibat markas mereka digrebek polisi, tapi itupun tidak membuat surut aparat kepolisian untuk tetap menyikat habis para bandar narkoba yang sengaja merusak moral terutama para generasi muda. Apa yang dilakukan para pelaku narkoba patut dihukum berat, karena mereka telah merusak moral bangsa ini. Apa yang dilakukan

Baca Aparat... Hal 7

Air Laut Masuk Rumah Warga Pondok Reformasi Resah SIBOLGA-Warga Pondok Reformasi, Kelurahan Kota Beringin, Kecamatan Sibolga Kota, resah

Baca Air Laut Hal 7


OMBAK- Warga Pondok Reformasi Kota Sibolga resah karena air laut kerap membanjiri rumah penduduk di sekitar bibir Pantai Ujung, Sibolga.

Akibat Jalan Rusak Petani Kewalahan TAPUT- Kondisi infrastruktur jalan di Tapanuli Utara saat ini memprihatinkan. Dimana-mana terdapat lubang, bahkan masih ada yang belum tersentuh aspal sama sekali. Sehingga membuat petani kesulitan mengangkut hasil pertanian mereka. “Ini harus menjadi perhatian khusus oleh pemerintah daerah. misalnya di Pangaribuan, infrastruktur jalan di sana masih mem-

prihatinkan. Hal ini saya temukan ketika melakukan reses ke daerah itu. Teman-teman Dewan yang lain juga menemukan hasil yang serupa. Mereka menilai perbaikan jalan di Taput harus lebih diperhatikan lagi,” kata Ketua DPRD Taput Fernando Simanjuntak ditemui di kantornya, Senin


EVAKUASI: Truk rombongan Brimob Poldasu yang terguling setelah dievakuasi.

Truk Rombongan Brimob Poldasu Masuk Jurang 8 Luka-luka TARUTUNG- Truk petugas yang membawa rombongan 22 personel Brimob Poldasu deta semen B Tebing Tingg No Polisi 15201 II Aans Tanjung, terbalik dan masuk ke jurang sedalam 4 meter di kawasan tikungan manis KM 12, Desa Parsingkaman, Kecamatan Adian Koting atau 45 kilometer dari Tarutung, Taput, Senin (3/9) sore. Peristiwa ini mengakibatkan satu orang personel mengalami luka berat, tujuh luka ringan, sedangkan sisanya hanya mengalami luka gores. Kapolres Taput AKBP Wijadmika SIK kepada wartawan usia membesuk

STKIP St Maria Sibolga

Lepas 259 Mahasiswa/i PPLT SIBOLGA-Sekolah Tinggi Keguruan dan Ilmu Pendidikan (STKIP) St Santa Maria Sibolga menggelar acara pelepasan 259 mahasiswa/i untuk melaksanakan Program Pengalaman Lapangan Terpadu (PPLT) ke sejumlah sekolah di Sibolga dan Tapteng, di Aula STKIP Santa Maria Jumat (31/ 8) sekira pukul 16.00 WIB. Pelepasan mahasiswa PPLT dilakukan langsung oleh Wali Kota Sibolga Drs HM Syarfi Hutauruk yang didampingi oleh Ketua Yayasan Santa Maria Berbelas Kasih Sr Dionesia

Baca Lepas 259 Hal 7

Sukran Bagikan Buku “Si Anak Singkong”

korban di RSU Swadana Tarutung membenarkan peristiwa itu. Ia mengatakan, berdasarkan informasi yang mereka peroleh, peristiwa ini terjadi diduga karena rem blong. “Diduga rem blong karena kecepatan bus hanya mencapai 40 KM per jam. Mungkin akibat rem blong supir banting setir sehingga akhirnya terbalik ke jurang. Ini murni laka tunggal,” terang Kapolres. Sebelumnya, kata Kapolres, rombongan Brimob ini berangkat dari Deta Semen B Tebing Tinggi tujuan Batang Toru, Tapanuli Selatan (Tapsel) dalam

PANDAN-Wabup Tapteng H Sukran Jamilan Tanjung SE membagikan buku “Chairul Tanjung Si Anak Singkong” kepada para tamu di acara Open House Idul Fitri di rumah Dinas Wabup Jalan R Junjungan Lubis, Pandan, Senin (3/9). Di mana sebelumnya, Chairul Tanjung sendiri yang menitipkan seribu eksemplar buku itu kepada Wabup untuk dibagikan gratis kepada warga Tapteng dan Sibolga. “Beberapa hari yang lalu Bang Chairul Tanjung yang langsung menyerahkan seribu eksemplar bukunya. Beliau titip salam kepada seluruh masyarakat Tapteng dan Sibolga yang merupakan kampung halamannya. Ayah beliau lahir di daerah kita ini,” tukas Wabup, mengawali sambutannya sebelum membagikan buku itu. Buku “Chairul Tanjung Si Anak Singkong” diluncurkan bertepatan usia Chairul Tanjung

Baca Truk Rombongan Hal 7

Baca Sukran Bagikan Hal 7

(3/9). Ia menilai, perbaikan infrastruktur jalan di daerah ini salah satu hal yang paling dibutuhkan melihat masih banyaknya jalan rusak yang mengakibatkan masyarakat kewalahan memasarkan dam mengerjakan lahan pertanian mereka.

Tetapi Fernando tidak memungkiri, perbaikan tersebut akibat keterbatasan dana APBD. Sehingga perbaikan jalan rusak tidak dapat sekaligus dilakukan. Ketua LSM Predikat Sumut Asman Sihombing kepada METRO membenarkan infrastruktur jalan di Taput kini sudah banyak rusak. Soal keterbatasan dana APBD se-

Baca Akibat Hal 7


4 September 2012

Nomor 3 Pilihanku SIDIMPUAN-Andar Amin Harahap SSTP MSi yang berpasangan dengan Muhammad Isnandar Nasution SSos (AMIN) merupakan calon kuat memimpin Kota Padangsidimpuan (Psp) periode 2013-2018 mendatang di pilkada Psp ini. Dari 6 calon kepala daerah sebagai kontestan di pilkada 18 Oktober 2012 nanti, Andar-Isnan disebutsebut memiliki basis massa terbesar, bahkan diprediksi bakal menang 1 putaran. Peluang menang Andar-Isnan pasangan yang populer disebut

3.400 Relawan Chaidir-Maragunung Siap Awasi Kecurangan Pemilukada SIDIMPUAN-Sebanyak 3.400 orang relawan pasangan Ir H Chaidir Ritonga MM dan Maragunung Harahap MM siap mengamankan pelaksanaan Pemilihan Umum Kepala Daerah (Pemilukada) Kota Padangsidimpuan pada 18 Oktober 2012.

‹ Baca Nomor 3...Hal 10

Pengamanan tersebut untuk menghindari terjadinya kecurangan-kecurangan atau yang bertentangan dengan peraturan, khususnya yang

Dedi Jalin Silaturahmi dengan Pimpinan dan Karyawan/ti ITC Finance Psp

Leasing Juga Agen-agen Pembangunan SIDIMPUAN-Calon Walikota Padangsidimpuan (Psp) Nomor Urut 4, Dedi Jaminsyah Putra Harahap SSTP MSP didampingi Ketua DPD PAN Kota Psp, H Erwin Nasution SH MM mengenalkan diri dan menjalin silaturahmi dengan pimpinan serta puluhan karyawan dan karyawati ITC Finance Psp beralamat di Jalan Imam Bonjol Kota Psp, Sabtu (1/9) lalu. Para karyawan dan karyawati ITC Finance Psp yang merupakan perusahaan leasing ujar Dedi Jaminsyah Putra Harahap juga merupakan

‹ Baca Leasing ...Hal 10

KPU Diminta Tak Asal Lakukan Verifikasi Parpol JAKARTA - Putusan Mahkamah Konstitusi (MK) atas uji materi UU Pemilu yang memerintahkan seluruh partai politik menjalani verifikasi dinilai tidak akan berpengaruh banyak terhadap partai-partai pemilik kursi di parlemen. Namun demikian diharapkan Komisi Pemilihan Umum (KPU) tak asalasalan dalam melakukan verifikasi. Mantan anggota KPU, Mulyana Wira Kusumah mengungkapkan, sebenarnya putusan MK itu tidak menjadi persoalan besar bagi partaipartai yang kini memiliki kursi di DPR. “Itu hanya akan memberikan beban administratif bagi partaipartai pemilik kursi parlemen. Tapi bukan persoalan besar,” kata

‹ Baca KPU ...Hal 10

‹ Baca 3.400...Hal 10 FOTO: IST

RELAWAN: Ir H Chaidir Ritonga MM saat melakukan sosialisasi visi dan misinya dihadapan ribuan simpatisan dan pendukungnya usai melantik dan mengambil sumpah 3.400 relawan.

KM Simatupang: Dedi-Affan Pantas Diperjuangkan SIDIMPUAN-Ketua Tim Terang DeFan, KM Simatupang mengatakan bahwa pasangan Calon Walikota dan Wakil Walikota Psp Nomor Urut 4, Dedi Jaminsyah Putra Harahap SSTP MSP-H Affan Siregar SE merupakan calon pemimpin masa depan Psp yang pantas diperjuangkan di pemilukada 18 Oktober mendatang. “Tim Terang DeFan mendoakan kiranya Dedi-Affan diberkati Tuhan dalam perjalanan di Pemilukada Psp 18 Oktober mendatang,” ujar KM Simatupang dalam sambutannya di acara Borhat-Borhat Dedi-Affan (Me-

nghantarkan Dedi-Affan di pemilukada Psp 18 Oktober) oleh Tim Terang De-Fan Psp, bertempat di gedung Sinar Pancar, Kampung Losung, Kecamatan Psp Selatan, Kota Psp, Minggu (2/9) lalu. Diungkapkan KM Simatupang bahwa mereka sadar kalau Dedi-Affan adalah calon pemimpin yang pantas diperjuangkan dan diangkat ke tempat yang lebih baik. “Untuk itu kami dari tim salut. Mudah-mudahan nantinya di kota ini „ KM Simatupang.

‹ Baca KM Simatupang: ...Hal 10

Pemimpin Psp Kedepan Harus Pro Rakyat SIDIMPUAN-Salah seorang pedagang di Pasar Sangkumpal Bonang Padangsidimpuan (Psp), Ashari (45) berharap nantinya di pemilukada Walikota dan Wakil Walikota Psp 18 Oktober mendatang mendapatkan figur pemimpin yang komit mengurus masalah rakyat, khususnya pedagang di Pasar Sangkumpal Bonang. Mengingat tempat mereka berjualan di Pasar Tradisional

‹ Baca Pemimpin ...Hal 10

„ Dedi-Affan bersama nyonya menari bersama masyarakat.

„ M Sukur Nasution

Rusydi-Riswan Solusi Atasi Persoalan Psp SIDIMPUAN-Calon Walikota dan Wakil Walikota dengan nomor urut 2, Ir Rusydi Nasution MM-Ir Riswan Daulay MM merupakan solusi paling cerdas dan tepat untuk mengatasi persoalan dan untuk kemajuan pembangunan di Kota Psp di masa-masa mendatang. Demikian dikatakan simpatisan dan tim pemenangan Rusydi-Riswan Center, M Sukur Nasution.mengatakan, selain mendapatkan dukungan dari perantau di pusat dan penerimaan dari masyarakat yang sangat luar biasa atas sosok Rusydi yang tidak berkaitan dengan pemerintahan selama

ini karena bekerja sebagai professional, maka nama Rusydi Nasution adalah orang yang paling cocok dan layak memimpin Kota Psp 5 tahun dan masa yang akan datang. Kemampuan managerial dan wawasan yang luas serta hubungan yang terjalin dengan baik tingkat pusat, kata Sukur menjadi potensi Rusydi untuk bisa membangun Kota Psp kearah yang lebih baik lagi dimasa mendatang. Ditambahkannya, dukungan dari para perantau menjadi salah satu modal yang besar,

‹ Baca Rusydi...Hal 10


4 September 2012

Asosiasi Pedangan Pasar Akui Beriklan Demi Jokowi JAKARTA - Asosiasi Pedagang Pasar Seluruh Indonesia (APPSI) secara terang-terangan mengakui dukungannya untuk pasangan calon gubernur DKI Jakarta, Jokowi-Ahok. Bahkan APPSI mengakui bahwa iklan televisi yang dibuatnya bertujuan untuk mengkampanyekan pasangan cagub peraih suara terbanyak pada putaran pertama Pilkada DKI 2012 itu. “Itu partisipasi kami pedagang pasar sebagai bagian masyarakat untuk dukung Jokowi. Tujuannya memang supaya teman-teman pedagang memilih Jokowi,” ujar Ketua Litbang DPP APPSI, Setyo Edi kepada wartawan di kantor Panwaslu DKI, Jalan Suryopranoto, Jakarta Pusat, Senin (3/9). Setyo mengungkapkan, Jokowi telah menjadi ikon bagi anggota APPSI. Pasalnya, Jokowi selaku Walikota Solo kerap mengambil kebijakan yang pro pedagang pasar. Oleh karenanya, APPSI merasa perlu untuk mengajak warga jakarta memilih Jokowi sebagai DKI 1. Setyo menolak jika iklan APPSI dianggap sebagai pesanan pihak Jokowi-Ahok. Ia mengklaim bahwa pembiayaan iklan tersebut merupakan sukarela para anggota APPSI. “Duitnya aja dari pedagang. Total untuk iklan sekitar seratusan juta,” ungkap Setyo. Soal tuduhan pelangggaran ketentuan kampanye, Setyo menilainya salah alamat. Alasannya, ujar Setyo, organisasinya bukanlah bagian dari tim kampanye Jokowi-Ahok. “Kami kan bukan tim kampanye. Kita kan hanya mengapresiasikan kecintaan padagang pasar kepada Jokowi, apa itu salah? Jadi nggak salah, karena kami masyarakat bukan tim kampanye,” pungkasnya. Setyo dan perwakilan APPSI mendatangi markas Panwaslu DKI didampingi Ketua DPP Gerindra DKI Jakarta, M.Taufik. Menurut Taufik, iklan yang dipasang APPSI bukanlah pelanggaran kampanye. Ia memastikan, APPSI bukan bagian dari tim kampanye Jokowi-Ahok. “Iya bagus jadi top APPSI nya menurut saya. Yang jelas bahwa, kalau saya menilai tidak ada unsur kampanye, tidak masuk dalam kriteria kampenya menurut saya. Karena APPSI itu di luar semua, di luar tim kampanye, di luar penyelenggara, di luar relawan,” ujar Taufik. Iklan APPSI yang ditayangkan 4 stasiun TV swasta pada tanggal 27 Agustus 2012 lalu diadukan oleh tim sukses pasangan calon Fauzi Bowo-Nachrowi Ramli ke Panwaslu DKI. Iklan tersebut dinilai mengandung unsur-unsur kampanye antara lain adanya ajakan memilih menjabarkan visi misi dan menampilkan pasangan calon. Saat ini Panwaslu tengah mendalami kasus ini untuk menentukan adanya pelanggaran atau tidak. Beberapa saksi telah dipanggil untuk dimintai keterangan, salah satunya Ketua APPSI sekaligus Ketua Dewan Pembina Partai Gerindra, Prabowo Subianto. Namun, Prabowo yang dua kali dipanggil Panwaslu DKI selalu mangkir. (dil/jpnn)

Nomor 3 Pilihanku Sambungan Halaman 9 AMIN cukup mendapat alasan. Pertama, potensi keluarga besar, kemudian, AMIN yang tinggal dan lahir dan menetap di Psp sudah sejak lama sampai saat ini cukup dikenal luas masyarakat. Popularitas AMIN dikenal luas sangat ramah, rendah diri, jiwa membangun, petarung sejati, menghargai antar sesama, sosialis, pergaulan luas dan familiar. Atas alasan itulah maka sejumlah warga siap mendukung, memilih dan memenangkan pasangan AMIN menjadi walikota dan wakil walikota 5 tahun mendatang. “Kami dan segenap keluarga jauh-jauh hari sudah menanamkan niat mendukung penuh agar pasangan bernomor urut 3, Andar-Isnan dapat mulus menduduki kursi salak 1,” ujar Meyer Simamora (50) warga Kelurahan Sitamiang, Kecamatan Psp Selatan. Sama halanya dengan apa yang dikatakan ibu rumah tangga Rosita Maya Siregar (40), warga Kelurahan Wek II, Kecamatan Psp Utara yang mengatakan siap memilih nomor 3 di pilkada Kota Psp yang hanya tinggal beberapa bulan lagi ini. Kesiapan lain, datang dari warga Kelurahan Losung Batu, Kecamatan Psp Utara, Deni (35). Ibu 4 orang anak ini juga siap memilih calon walikota dan wakil walikota AMIN bernomor urut 3. Mereka semua diakhir ungkapannya samasama berharap 5 tahun yang akan datang bumi dalihan na-3 Kota Psp lebih Maju, Sehat dan Sejahtera (SMS). “Apalagi, konsep diusung AMIN untuk membangun Psp holong mangalap holong dalam arti saling mendukung yang positif, niscaya perobahan kota salak ini dari yang sekarang akan terwujud,” ujar Maya sembari mengaku tidak akan berpaling ke calon lain terkecuali ke nomor 3. (phn)

Demokrat Tegaskan Foke Tak Butuh Popularitas Lagi JAKARTA - Ketua DPP Partai Demokrat, Nurhayati Ali Assegaf, menegaskan bahwa pasangan calon gubernur dan wakil gubernur DKI Jakarta yang diusung partainya, Fauzi Bowo-Nahrowi Ramli (Foke-Nara) bukanlah pencari popularitas. Demokrat menganggap dua figur yang dicalonkan itu merupakan sosok pekerja keras. “Bagaimana kubu Foke-Nara ini pada putaran pertama semua menjelek-jelekan, tapi alhamdulillah masyarakat cukup cermat, cukup cerdas, dan tahu bahwa Foke adalah sosok pekerja, bukan sosok yang mencari popularitas,” kata Nurhayati, kepada wartawan, Senin (3/9), di gedung parlemen, Jakarta. Dia menegaskan, Foke tidak pernah mencari popularitas dengan programprogramnya di DKI. “Padahal programprogramnya banyak yang spektakuler,” kata Nurhayati. Ketua Fraksi Demokrat di DPR itu mencontohkan program Foke yang sukses seperti jembatan layang di Casablanca. “Banyak sekali yang dia lakukan tapi dia tidak mencari popularitas. Jadi, dia bekerja

tidak untuk mencari popularitas, itu Foke,” katanya. Makanya, lanjut Nurhayati, ketika putaran pertama Foke yang dikeroyok tetap mampu meraih 33 persen lebih suara. “Itu adalah kecerdasan warga DKI dalam memilih gubernur, dan itu membanggakan,” tegasnya. Bagaimana dengan putaran kedua nanti saat Foke akan bersaing melawan JokowiBasuki yang menjadi jawara pada putaran pertama? Nurhayati yakin bahwa Foke tak akan dikeroyok lagi karena banyak partai pengusung pasangan calon gubernur lainnya yang telah memutuskan untuk bekerja bersama Demokrat. “Karena pada putaran pertama bahwa Foke dikeroyok ramai-ramai tetap menang, maka parpol lain yang dengan penuh kesadaran mendukung Foke (di putaran kedua),” katanya. “Karena kecerdasan rakyat, ini berjalan secara alami. Jadi, tidak ada lagi mengatakan keroyok mengeroyok. Istilah keroyok mengeroyok membuat saya jadi ketawa. Kok kayak preman keroyokkeroyokan?” timpalnya. (boy/jpnn)

Jangan Memimpin Jakarta Seperti CEO JAKARTA - Pengamat politik dari Universitas Indonesia (UI), Chusnul Mar”iyah, menyatakan bahwa calon gubernur DKI Jakarta harus berpikir bahwa memimpin ibu kota tidak seperti menjadi chief executive officer (CEO) di perusahaan. Menurutnya, gubernur sebagai pelayan masyarakat bukan seperti CEO perusahaan yang orientasinya hanya mencari keuntungan. “Gubernur sangat berbeda dengan CEO, karena Gubernur harus mampu menjadi pelayan publik. Dan itu merupakan suatu hal yang harus dilakukan,” kata Chusnul dalam diskusi publik bertema “Politik Perkotaan, Hubungan Pemerintah Pusat, Pemerintah Daerah, dan Swasta” di Universitas Paramadina, Jakarta, Senin (3/9). Mantan anggota KPU itu mengatakan, salah satu calon Gubernur DKI, Joko Widodo (Jokowi) pernah mengungkapkan bahwa jika nanti terpilih menjadi Gubernur DKI akan memimpin Jakarta menggunakan sistem CEO. Chusnul menegaskan bahwa tidak ada CEO perusahaan yang melayani masyarakat. “Sebenarnya mereka hanya

mengejar keuntungan,” ungkap Chusnul. Dia juga mengatakan, cagub DKI yang meninggalkan wilayah yang masih dipimpinnya merupakan bukti sebagai sosok yang tidak amanah. “Dulu waktu di Solo bicara apa untuk lima tahun ke depan? Bisa jadi nanti pada 2014 pindah lagi ke daerah lain. Ini juga menjadi satu persoalan, bagaimana kita amanah, atau istiqomah memegang amanah itu,” beber Chusnul. Sekjen Serikat Mahasiswa Universitas Paramadhina, Fellix Martha, menambahkan,untuk memilih calon pemimpin harus cerdas. Dia pun mengajak pemilih di DKI untuk memilih calon gubernur yang benar-benar memiliki pengalaman dan sudah terlihat hasil kerjanya. “Bila Foke nanti jadi, memang dipastikan Foke hanya melanjutkan programnya. Namun bila Jokowi yang jadi, kita tidak tahu pasti ke arah mana Jakarta akan dibawa serta bagaimana perubahannya, apakah postitif atau negatif,” kata Fellix yang juga jadi pembicara dalam diskusi itu. (boy/jpnn)

3.400 Relawan Chaidir-Maragunung Siap Awasi Kecurangan Pemilukada Sambungan Halaman 9 dilakukan penyelenggara Pemilukada dan pasangan calon. Relawan ini juga akan membantu masyarakat dalam mendapatkan hak pilihnya pada Pemilukada tersebut. Indikasi akan terjadinya kecurangan tersebut sudah mulai terlihat. Selain itu intervensi pihak birokrasi untuk memenangkan salah satu kandidat sudah bukan rahasia umum lagi. Melihat indikasi tersebut relawan Ir H Chaidir Ritonga MM dan Maragunung Harahap MM siap bekerja keras dalam melaksanakan Pemilukada Psp

yang jujur dan adil. Tim relawan ini dilantik Ir HChaidir Ritonga pada 17 Agustus 2012 di Auditorium STAIN Psp. Pada kesempatan tersebut, Chaidir juga Ketua Ikatan Alumni SMA Negeri 3 Psp menyosialisasikan visi dan misinya menciptakan 10 ribu lapangan kerja, pengobatan gratis yang menyentuh seluruh lapisan masyarakat dan pendidikan gratis berkualitas. Dengan metode yang cerdas, Chaidir yang juga Ketua Perhimpuan Alumni IPS di Sumut yakin Psp akan dapat terlaksana. Chaidir yang juga Wakil Ketua DPRDSU

pada Senin (3/9) usai menyerahkan bantuan kenderaan roda empat terhadap enam Pimpinan Kecamatan Partai Golkar Kota Pspn mengatakan, ada 3.400 relawan yang siap memenangkan pasangan nomor 6 dan mengamankan pelaksanaan Pemilukada Psp dari tindakan kecurangan dan manipulasi. “Mereka telah bersumpah dan berjanji untuk menyukseskan pilkada ini. Kondisi hari ini sudah ada indikasi politik uang dan intimidasi. Informasi ini kita dapatkan dari warga yang menginginkan Pemilukada jujur, adil, dan bersih,” ujarnya Ditegaskan Chaidir, relawan tersebut akan

Pemimpin Psp Kedepan Harus Pro Rakyat Sambungan Halaman 9 Sangkumpal Bonang saat ini kurang nyaman. Pernyataan ini disampaikan Ashari (45) pedagang ikan asin di pasar Sangkumpal Bonang beberapa waktu yang lalu. “Kami di sini punya perkumpulan yaitu Himpunan Pedagang Pasar Raya Sangkumpal Bonang (HPPRSB) sangat

menginginkan Walikota nantinya yang mau mengurus dan mengelola pasar ini dengan baik,” ujar Ashari selaku Sekretaris HPPRSB ini beberapa waktu lalu. Tidak jauh berbeda dengan Harapan Parada (60), seorang penjual bunga taman hias saat disambangi METRO di tempat usahanya di jalan Raja Inal Batunadua Jae, Kecamatan Psp Batunadua, dirinya berharap kalau seorang pemimpin Kota Psp 5 tahun

ke depan supaya dapat membangun jalan rusak seperti jalan tanggal dan jalan akses menuju desa pinggiran kota. Kerusakan jalan menurutnya sangat berpengaruh pada usahanya dan masyarakat, dikarenakan warga yang hendak melintas enggan lewat jalan rusak dan berdebu. Walaupun jalan rusak tersebut bukan tanggungjawab Pemko Psp, maunya Walikota nantinya harus dapat membangunnya. (tan/neo)

mengawasi politik uang yang sifatnya massif maupun sistematis. “Kita sudah menerima banyak laporan dari berbagai pihak bahwa berbagai intimidasi yang dilakukan sejumlah oknum aparat,” ungkapnya. Politisi Partai Golkar ini mengingatkan para pejabat untuk tidak melanggar UU Nomor 32 Tahun 2004 tentang Pemerintahan Daerah (Pemda) yang menyebutkan Pegawai Negeri Sipil (PNS) dan birokrasi harus bersikap netral. “Karena kalau tidak netral, bisa kita persoalkan, karena itu suatu tindak pidana pelanggaran Pemilukada,” tegasnya. (rel)

Rusydi-Riswan... Sambungan Halaman 9 tingkat loyalitas yang tinggi ada di bawah kepemimpinan Dedi-Affan yang akan kita berangkatkan di Pemilukada ini. Kepada saudara Dedi-Affan, inilah kami atas nama masyarakat umat Kristiani Tim Terang De-Fan yang siap bekerjasama ke hari depan, rasa berjuang di hari depan tanggal 18 Oktober, untuk memimpin Psp yang mampu mengayomi seluruh masyarakat tanpa membedakan suku, agama dan golongan. Kami sadar dengan persaudaraanlah Kota Psp maju di masa yang akan datang. Mudahmudahan atas nama kebersamaan dan persaudaraan yang tulus dapat menjadi pemimpin yang berhasil di Psp ini,” harapnya kepada Dedi-Affan. (neo)

Rusydi-Riswan Solusi Atasi Persoalan Psp Sambungan Halaman 9 karena keinginan para perantau saudarasaudaranya yang ada di Kota Psp menjadi lebih baik lagi dan terutama agar kampung halaman mereka dapat terus berkembang dari yang sudah ada saat ini. Ditambah lagi sosok Riswan yang merupakan birokrat tulen. Menurut Sukur, keduanya menjadi gabungan yang sangat

klop dan paling pas untuk mengatasi persoalan dalam membangun Kota Psp menjadi lebih baik dan maju lagi dari kondisi yang sudah ada sekarang ini. “Kemampuan Rusydi sebagai ekonom kita yakin mampu memanagerial system perekonomian dan keuangan di Kota Psp, kemudian ditambah sosok Riswan dari birokrat, sehingga keduanya saling melengkapi. Yakinkan hati berdasarkan hati

nurani. Kami yakin masyarakat Kota Psp adalah masyarakat yang cerdas dan tahu bagaimana calon pemimpin yang dibutuhkan memimpin daerahnya sendiri,” ungkapnya. Dituturkan Sukur, Rusydi Nasution baik sifat dan karakternya sangat cocok bagi warga Psp yang saat ini mencari alternatif dari kondisi yang sudah ada dan mereka juga menggantungkan harapan kepada Rusydi Nasution untuk membangun Kota Psp.

“Mari kita sambut calon pemimpin yang membawa harapan baru untuk perubahan Kota Psp kearah yang lebih baik, bersih, cerdas, dan santun. Marilah kita berjuang dan berdoa agar pilihan hati nurani masyarakat Kota Psp ini terpilih menjadi pemimpin Kota Psp dan nantinya bisa menjadikan Kota Psp Madani, Asri dan Sejahtera (MAS). Mari kita sambut calon pemimpin baru,” ajaknya. (phn)

KPU Diminta... Sambungan Halaman 9 Mulyana di Jakarta, Minggu (2/9). Staf pengajar di FISIP Universitas Indonesia yang kini memimpin lembaga kajian Seven Strategic Studies itu menambahkan, justru putusan MK itu membuka ruang agar Pemilu tidak hanya demokratis dari sisi prosedur tatepi juga substansi. “Harapannya ini akan jadi free and fair election yang tercermin dari proses verifikasi itu. Yang kemarin kan hanya mewakili partai politik di parlemen, jadi diskriminatif,” ulasnya. Hanya saja Mulyana juga wanti-wanti kepada KPU saat ini agar tidak sembarangan melakukan verifikasi. Sebab KPU tidak hanya bakal menjadi pusat perhatian dan diawasi banyak pihak, tetapi juga diancam dengan sanksi jika salah melangkah. “Sekarang agak susah kalau KPU asal-asalan verifikasi, karena mereka juga disorot oleh DPR, pemerintah dan juga Bawaslu. Bahkan masih ada Dewan Kehormatan yang punya otoritas memberikan sanksi,” pungkas mantan koordinator Komite Independen Pemantau Pemilu (KIPP) itu.(ara/jpnn)

„ Dedi Jaminsyah Putra Harahap didampingi H Erwin berfoto dengan pimpinan dan karyawan/karyawati ITC Finance usai acara silaturahmi, Sabtu (1/9) lalu.


Leasing Juga Agen-agen Pembangunan Sambungan Halaman 9 agen-agen pembangunan. Karena, orang yang sulit mendapatkan fasilitas kendaraan bisa terbantu dengan keberadaan leasing. Pihak leasing terang Dedi juga berkepentingan agar perekonomian masyarakat terus meningkat, dengan harapan tidak ada kendala dalam proses pembayaran kendaraan oleh masyarakat terutama pembayaran melalui kredit. “Kalau daya bayar masyarakat rendah tentu itu bisa mendatangkan masalah bagi pihak leasing,” ujar Dedi dihadapan puluhan karyawan dan karyawati ITC Finance. Sehingga Dedi menawarkan, jika rakyat mengamanahkan pasangan Dedi-Affan memimpin Psp atas ridho Allah SWT perio-

de 2013-2018 mendatang, pasangan DediAffan akan menyambung simpul-simpul yang ada di Kota Medan, untuk dikembangkan di Kota Psp ini sehingga Kota Psp bisa menjadi kota maju kedepan. Karena, posisi Kota Psp merupakan kota yang menjanjikan. “Dikatakan kota menjanjikan, karena Kota Psp berada di tengah-tengah baik bagi Kabupaten Madina, Tapsel, Paluta dan Palas, Sibolga serta Tapteng. Sehingga, Kota Psp merupakan kota jasa baik untuk jasa pendidikan, jasa leasing, jasa perdagangan dan lainnya Psp sangat memungkinan,” terang alumni STPDN ini. Sehingga tutur lulusan S2 Magister Studi Pembangunan (MSP) ini, kalau pasangan Dedi-Affan membutuhkan kerjasama semua pihak termasuk pihak leasing dalam memajukan Kota Salak kedepannya.

“Karena leasing juga agen-agen pembangunan, karena masyarakat membutuhkan transportasi. Mudah-mudahan kita semua tetap dalam lindungan Tuhan yang Maha Esa, karena apapun cita-cita kami tanpa bantuan semuanya kami tidak akan bisa berbuat apa-apa. Kami bersama Pak Affan tidak pernah memproklamirkan diri kami sebagai yang terbaik, tapi kalau Tuhan memberikan kami kesempatan, maka kami akan berupaya tampil menjadi yang terbaik untuk Kota Psp kedepan,” tutur Dedi. Digambarkannya sepintas bagaimana meningkatkan perekonomian masyarakat dari sektor pasar. Dimana, revitalisasi pasarpasar tradisional salah satu hal yang akan diprogramkan Dedi-Affan kedepan,

sehingga pasar tidak bertumpu di pusat kota yaitu di Pasar Sangkumpal Bonang. Tapi, pasar-pasar di kecamatan bisa tumbuh dan perekonomian masyarakat bisa meningkat. “Dengan begitu, daya beli masyarakat akan tinggi termasuk hasil-hasil pertanian masyarakat,” digambarkannya singkat. Kepercayaan yang diberikan rakyat Psp nantinya tegasnya, akan mereka pertanggungjawabkan dengan sebaik mungkin dengan kinerja dan realisasi program yang mereka laksanakan. “Selamat bekerja. Bantulah masyarakat yang membutuhkan untuk kehidupannya yang lebih layak, jangan apatis, berikan semangat baru bagi mereka. Kemudian, bantulah kami dengan ikhlas, bukan karena keterpaksaan,” pungkas Dedi mengakhiri. (neo)


4 September 2012

Kepala Korlantas Polri Irjen Pudji Hartanto.

“Sebanyak 66 persen dari 5,796 insiden kecelaksaan selama arus mudik-balik Lebaran 2012 disebabkan disebabkan unsur manusia. Seperti mengantuk, kelelahan, mabuk, sakit, mengunakan handhone, menerobos, melanggar batas, pindah jalur dan mendahului,”

“Intelijen negara terus memberi masukan kepada pemerintah untuk berupaya agar isu suku, agama, ras dan antargolongan (SARA) tidak Kepala Badan Intelijen Negara tumbuh subur,” (BIN) Marciano Norman.

Syahganda Nainggolan.

“Dahulu bangsa ini pernah mengalami junta militer dari Soekarno ke Soeharto. Namun setelah reformasi justru yang berkembang adalah desakan kapitalisme internasional, dengan kekuatan-kekuatan kapitalis di tanah air yang berusaha menguasai negeri dan kekuasaan politik secara nasional,”

Kirim Opini Anda ke email: metrotabagsel Maksimal tulisan 5.000 karakter

Sikap Kami Tabiat Buruk Penyerapan Anggaran KITA seperti nyaris kehilangan kata-kata ketika menyaksikan masih buruknya kinerja penyerapan anggaran oleh pemerintah. Penyakit tahunan itu amat sulit disembuhkan, bahkan ketika Presiden Susilo Bambang Yudhoyono sudah beberapa kali menyatakan kekecewaannya. Kondisi paling baru disampaikan Tim Evaluasi dan Pengawasan Penyerapan Anggaran (TEPPA) yang dibentuk Presiden. Tim itu terdiri dari Kepala Unit Kerja Presiden Bidang Pengawasan dan Pengendalian Pembangunan Kuntoro Mangkusubroto, Wakil Menteri Keuangan Anny Ratnawati, dan Kepala Badan Pengawasan Keuangan dan Pembangunan (BPKP) Mardiasmo. Berdasarkan laporan TEPPA, serapan khusus belanja modal 43 kementerian dan lembaga pada semester I 2012 masih rendah. Hingga saat ini baru 25 institusi yang kemampuan identifikasi paket pengadaannya di atas 60%. Sebanyak 37 institusi berkemampuan di bawah 60% dan 25 institusi tidak memiliki kejelasan pelaksanaan penyerapan. Amat mungkin mereka akan menumpuk penyerapan anggaran di akhir tahun. Masih banyak institusi yang belum memulai proses pengadaan lelang pada medio tahun ini. Padahal, hal itu menjadi indikator bagi tren realisasi penyerapan anggaran. Lebih parah lagi, TEPPA mencatat penyerapan anggaran belanja empat institusi hingga triwulan II 2012 masih 0%. Keempatnya ialah Kementerian Pemuda dan Olahraga, Badan Intelijen Negara, Badan Nasional Penanggulangan Terorisme, dan Dewan Kehutanan Nasional. Hingga kini, baru lima institusi yang mampu melelang paket kegiatan secara signifikan. Kelimanya ialah Badan Kepegawaian Negara dengan capaian lelang 100%, BP Batam 94%, BPKP 81,5%, Kementerian Pekerjaan Umum 79,6%, dan Kementerian Koperasi dan Usaha Kecil dan Menengah 67,3%. Fakta itu sungguh menjadi potret betapa respons aparatur kita terhadap percepatan ekonomi amat lamban. Padahal, di tengah perekonomian dunia yang murung akibat krisis, stimulus APBN amat penting untuk mempertahankan atau bahkan mendongkrak pertumbuhan. Lambatnya penyerapan anggaran jelas bisa menjadi inefisiensi bagi perekonomian kita. Ia juga sebagai penanda tidak beresnya perencanaan. Tiap tahun, belanja APBN terus meningkat. Di RAPBN 2013 pemerintah bahkan menargetkan belanja negara Rp1.657,9 triliun, naik Rp109,6 triliun (7,1%) ketimbang belanja APBNP 2012. Jika dibandingkan dengan belanja negara di 2007, kenaikan belanja RAPBN 2013 malah mencapai dua kali lipat. Sayangnya, kenaikan belanja itu belum berbanding lurus dengan upaya keras membereskan hambatan penyerapan anggaran. Dari target penyerapan 50% di semester I, yang tercapai baru sekitar 30%. Untuk membereskan itu, sanksi tegas berupa pengurangan anggaran bagi institusi yang buruk dalam penyerapan harus benar-benar ditegakkan. Sebaliknya, ganjaran harus diberikan kepada institusi yang signifikan dalam menyerap anggaran. Sekadar pidato kekecewaan jelas tidak akan pernah menyelesaikan persoalan. (**)

Peraturan Baru Izin Lingkungan Banyak penanam modal asing (PMA) menginvestasikan sahamnya untuk pendidikan industri di Indonesia. Hal ini secara langsung akan memberikan dampak kepada taraf ekonomi nasional dengan meningkatnya penyerapan tenaga kerja, produk domestik bruto, maupun pajak arus distribusi produk. Namun, salah satu pertimbangan kuat dari perusahaan PMA adalah keadaan geografis yang strategis untuk membuang limbah industri ke badan lingkungan. Kegiatan industri di kota Cilegon mencatat sebanyak 84 perusahaan PMA dan 48 perusahaan PMDN. : Gugi Yogaswara LIMBAH industri yang dihasilkan sangat bergantung dari jenis usaha yang diselenggarakan. Mayoritas industri yang bertempat di kawasan industri Cilegon adalah industri-industri petrokimia, logam, dan maupun manufaktur yang notabene menghasilkan limbah B3 yang dapat dikelola hanya setelah mendapatkan izin pengelolaan dari KLH. Aktifitas penanam modal tersebut sebenarnya sudah berlangsung dari tahun 90an. Hal ini menjadi kesempatan yang baik untuk industri-industri asing tersebut. Pasalnya, perizinan lingkungan perusahaan dirasa masih belum mengikat aktifitas industri yang memiliki dampak lingkungan untuk turut serta manjaga bumi indonesia dari aktifitas pembuangan limbah industri.

Pada tahun 1993, pemerintah membuat Peraturan nomor 51 tentang Analisis Mengenai Dampak Lingkungan (AMDAL) sebagai perbaikan dari PP No. 23 Tahun 1986. Istilah AMDAL kita kenal sebagai dokumen studi dampak dari aktifitas perusahaan terhadap lingkungan yang disusun pemrakarsa (pihak pemiliki industri) untuk disetorkan kepada pemerintah dalam rangka memperoleh izin mendirikan perusahaan. Kemudian, seiring perkembangan waktu, pemerintah memperbaiki PP No. 51 tahun 1993 menjadi PP No. 27 tahun 1999. Perbaikan ini dilakukan untuk menyeimbangkan aturan lingkungan dengan sistem kepemerintahan otonomi daerah, sehingga peraturan No. 27 tahun 1999 memberikan wewenang lebih bagi pemerintah daerah

untuk memutuskan pertimbangan dampak lingkungan bagi kegiatan atau usaha yang dibangun di daerah masing-masing. Pembangunan kegiatan industri semakin marak terjadi di seluruh penjuru Indonesia. Mayoritas industri membangun lapak pabrik di lokasi dengan badan lingkungan yang strategis seperti di pinggir laut, pinggir danau, pinggir sungai, maupun di daerah dataran rendah. Hal ini semata-mata untuk menunjang sumberdaya kegiatan industri dan mempermudah pembuangan limbah. Lokasi-lokasi tersebut adalah lokasi yang dapat menunjang penghematan perusahaan dalam mengolah limbah. Lokasi dekat badan air dapat menghemat biaya distribusi pembuangan limbah dengan hanya membuat saluran pendek pembuangan air limbah yang bermuara di laut atau badan air lainnya. Daerah dengan angin kencang dapat mempercepat dispersi pencemaran udara dari sumber emisi tak bergerak. Lalu, lokasi lapak pabrik yang dekat dengan pelabuhan dapat menghemat biaya pengangkutan limbah B3 pada pihak ketiga. Hal inilah yang terjadi pada daerah Cilegon dan sekitarnya yang menjadi pusat industri provinsi Banten. Aspek-aspek geografis tersebut diperebutkan oleh penanam modal untuk membangun lapak pabrik industri. Sementara, pihak badan lingkungan hidup daerah

(BLHD) yang memiliki andil dalam menerapkan kebijakan lingkungan di daerah sepertinya kewalahan dalam menangani aktifitas pengelolaan limbah industri yang semakin lama semakin marak. Bahkan, peraturan pemerintah No. 27 Tahun 1999 seolah tidak mengantisipasi kualitas SDM pelaksana kebijakan dengan diberikannya wewenang lebih pada pemerintah daerah untuk mengelola kebijakan lingkungan. Hal ini menyebabkan penilaian aktifitas pengelolaan dampak lingkungan perusahaan samar terlihat. Laporan pengelolaan lingkungan perusahaan dinilai baik hanya karena parameter pencemar berada di bawah baku mutu limbah (BML). Di samping itu, komisi penilai AMDAL cenderung mereduksi makna AMDAL sebagai kajian ilmiah. Ini mengakibatkan studi AMDAL maupun UKL & UPL dipandang sebagai formalitas belaka. Hal yang serupa terjadi pada aspek hukum studi AMDAL. Penerapan hukum atas pelanggaran tidak difasilitasi secara khusus, mengingat AMDAL dan UKL & UPL adalah bukan keputusan Tata Usaha Negara (TUN). Kekurangan-kekurangan tersebut melandasi pemerintah merevitalisasi Peraturan Pemerintah No 27 tahun 1999 tentang Analisis Mengenai Dampak Lingkungan menjadi PP No. 27 Tahun 2012 tentang Izin Lingkungan. Beberapa per-

ubahan mendasar yang terdapat dalam PP No. 27 tahun 2012 adalah reduksi jumlah dokumen AMDAL dari 5 dokumen menjadi 3 dokumen, reduksi waktu penilaian dokumen dari 180 hari menjadi selama 125 hari saja. Kemudian, PP baru ini juga mengembalikan makna AMDAL dan UKL & UPL sebagai kajian ilmiah yang harus dinilai secara ilmiah pula. Sehingga, penilaian dapat lebih jelas mengacu pada standar baku mutu yang sudah ditetapkan. Perubahan hukum juga terjadi pada skema izin lingkungan yang termasuk dalam keputusan Tata Usaha Negara. Hal ini menjadikan izin lingkungan memiliki sifat enforceable dan memiliki konsekuensi hukum atas pelanggaran yang terjadi. Lahirnya PP 27 Tahun 2012 ini diharapkan dapat menjadi landasar instrumen perlindungan dan pengelolaan lingkungan di indonesia. Aktifitas pengelolaan limbah industri telah banyak mencemari lingkungan, baik itu pencemaran air, tanah, maupun udara. Hal ini akan diperburuk jika penegakan hukum lingkungan tidak digalakkan dengan berintegritas di seluruh negeri. (**) Penulis adalah Mahasiswa Fakultas Teknologi Pertanian, Jurusan Teknik Sipil dan Lingkungan, alumnus SMAN 1 Kota Serang.


4 September 2012

Angelina Jolie

Kesal Putrinya Suka Madonna

ANGELINA Jolie marah begitu tahu ketiga putrinya, Zahara, Shiloh, dan Vivienne kecanduan lagu Madonna. Cewek jagoan Lara Croft di film Tomb Raider ini, mengaku kesal bagaimana lagu Madonna bisa digemari anak-anaknya padahal dia benci. ”Bukan rahasia lagi kalau Jolie bukanlah fans Madonna. Kata dia (Jolie) musiknya benar-benar mengerikan,” kata sumber yang dirilis tabloid terbitan Amerika Serikat, National Enquirer. Jadi tak heran jika pasangan hidup Brad Pitt ini sama sekali tak suka lagu ataupun musik Madonna. Siapa sangka kini Jolie harus tahan mendengarnya di rumah setiap saat sebab ketiga putrinya fans berat Madonna. (pra/jpnn)

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober)

Di hari ini hampir tidak ada gangguan yang berarti yang akan membikin kacau. Karena suasana dan situasi cukup mendukung bisnis Anda, maka jangan ragu untuk melakukan manuver-manuver yang berbahaya sekalipun.


(21 Desember -19 Januari)

Tak perlu ragu untuk mencoba memulai hal baru, walaupun semua itu memang berat untuk di awalnya, akan tetapi yang terpenting jalani dulu semua itu. Resiko dan hambatan di kemudian hari sebaiknya dipikir sambil jalan.


(20 Januari - 18 Februari)

Teruslah berupaya meraih hasil yang terbaik. Tidak perlu menyerah dengan keadaan karena ibarat orang berjalan pasti tidak akan selalu mulus jalannya, maka dari itu tetaplah optimis dan yakin.


19 Februari - 20 Maret

Waspadalah, omongan yang berhembus itu anggaplah angin lalu. Tak perlu ditanggapi toh nantinya akan hilang dengan sendirinya ditiup angin. Cobalah lebih konsentrasi pada apa yang sedang Anda hadapi. Tak perlu memikirkan yang bukan-bukan.


(21 April - 20 Mei)

Tak ada gunanya mengobral janji kalau akhirnya hanya akan membuat beban Anda saja di kemudian hari. Bicaralah terus terang dan tak perlu menutup-tutupi kesulitan yang lagi Anda hadapi saat ini.


(21 Mei - 20 Juni)

Peruntungan cukup mujur sehingga sangat baik untuk digunakan menyelesaikan masalah yang terkatungkatung itu. Hanya saja jangan mudah percaya dengan orang lain sebelum Anda melihat sendiri buktinya.


(21 Juni- 20 Juli)

Optimis memang perlu tetapi untuk saat ini sebaiknya jangan terlalu berambisi karena situasi di sekitar Anda sulit untuk Anda prediksi. Lebih baik Anda melangkah dengan sabar tetapi sangat terencana agar kesuksesan tetap dapat Anda raih.


(21 Juli-21 Agustus)

Apapun resiko yang akan muncul sebaiknya keyakinan tetap tidak boleh bergeser, untuk itu hindari membicarakan persoalan pada orang lain agar pikiran dan visi Anda tidak sampai terganggu.


(23 Oktober - 22 November)

Jangan biarkan kecerobohan mengganggu kinerja dan kelangsungan bisnis Anda, apalagi kompetitor tampak selalu memperhatikan setiap gerak-gerik Anda.


matahari yang hangat, telah mendorong para penonton yang terdiri berbagai lapisan masyarakat maupun warga Belanda dan asing lainya tetap bertahan di arena pertunjukan dan bejoget mengikuti irama lagu. Pesta Rakyat tahun 2012 yang dipandu oleh pembawa acara Feba dan Juniarti tersebut, dibuka secara resmi Dubes RI, Retno L.P. Marsudi yang dalam sambutannya menegaskan kembali bahwa kebahagiaan menyambut Hari Kemerdekaan. Lebih dari 32 stand makanan menyajikan beragam masakan Indonesia. Rujak cingur, sate ayam, makanan padang, gudeg, soto, empek-empek, aneka kue tradisional, makanan

Aming meninggal karena sakit. Masalah pencernaan dan faktor usia juga menjadi penyebab kepergian ibunda Aming. ”Udah udzur juga dan karena pencernaan juga,” jelasnya. Dijelaskan Iyus, saat

kepergian sang ibunda, bintang film ‘Madame X’ itu sedang berada di Jakarta. Kini Aming pun sudah berada di Bandung untuk menemani sang bunda ke peristirahatan terkahir. (dtc/int)

MODEL majalah Playboy, Tiara Lestari terus berjuang untuk meminta pembatalan putusan soal hak asuh putri semata wayangnya, Rania Kancana Tadya Dalima Sjarief dari mantan suaminya, Andi Sjarief. Dia ingin anaknya tidak lagi hidup berpindah dari rumahnya ke rumah mantan suaminya. Segala upaya dilakukan oleh Tiara, salah satunya membawa saksi ahli, Seto Mulyadi atau Kak Seto untuk didengar kesaksiannya. “Kenapa kita menghadirkan Kak Seto karena akan sangat diperlukan sekali pendapat Kak Seto. Anak berumur 5 tahun dan harus berpindah itu kan sangat melelahkan. Dampaknya untuk anak itu akan didengar dari Kak Seto,” ujar pengacara Tiara, Kartika Yosodiningrat, saat ditemui di Pengadilan Agama, Jakarta Selatan, Senin (3/9). Keterangan Kak Seto tidak langsung bisa didengarkan dalam persidangan, masih harus dijadwalkan. Sementara pihak Andi juga tidak keberatan dengan adanya saksi ahli seperti Seto Mulyadi. “Sah-sah saja mereka membawa Kak Seto. Tapi kan nanti ada agendanya sendiri. Saat ini masih pembuktianpembuktian secara surat-surata saja,” ujar pengacara Andi, Indra Prasetya. Sidangnya sendiri akan kembali dilanjutkan, Senin (10/9) dengan agenda pembuktian. (kpl/int)

manado, bakso, nasi campur, batagor, sejak pagi tidak henti-hentinya melayani masyarakat Indonesia untuk menikmati hidangan khas Indonesia. Baik yang langsung dinikmati di tempat maupun dibawa pulang. (kl/int)

Meskipun hubungannya dengan Gaston Castano kembali lengket, namun status Julia Perez masih sendiri. Setelah ditinggal sang ustad pilihan ibunda, Jupe belum mau menjalani hubungan spesial dengan lelaki mana pun. Artis yang kerap berbusana seksi itu pun mengaku sedang happy menjalani statusnya sebagai janda. Pelantun ‘Goyang 69’ itu mengaku banyak dilirik lelaki karena statusnya itu. ”Saya lagi senang jadi janda, saya banyak dilirik orang, Brad Pitt saja nengok ke saya,” selorohnya saat ditemui di studio RCTI, Jakarta Barat, Senin (3/9). Jupe menjelaskan, terkadang image janda mengundang cibiran ke arahnya. Namun, Jupe mengaku tak ambil pusing. ”Lebih baik janda daripada perawan tua, saya pernah rasain jatuh-bangunnya. Kawin atau nggak urusan saya,” tuturnya. “Tapi saya harus kawin karena harus punya keturunan the next Jupe,” tambahnya mengoreksi. Kini di usianya yang sudah tak muda lagi, bintang film ‘Arwah Goyang Karawang’ itu ingin lebih berhati-hati dalam memutuskan menikah lagi. (dtc/int)

(23 Agustus-22 September)

.Tetaplah melangkah maju karena sudah kepalang tanggung untuk melangkah mundur. Lebih baik yang ada dijalani dengan kesungguhan dan kemantapan hati.


PENYANYI dangdut Ikke Nurjanah bersama artis ibukota, Hudson tampil menghibur ribuan penonton dalam Pesta Rakyat Indonesia di Wassenaar, Belanda. Pesta Rakyat yang diselenggarakan Sabtu (1/ 9) oleh KBRI Den Haag, Belanda itu mejadi acara tahunan yang meriah dalam rangka menyambut Hari Kemerdekaan Indonesia, demikian keteerangan pers KBRI Denhaag, Minggu (03/09) Artis Hudson dengan busana kebaya yang menonjolkan peran sebagai Jessica dan sekaligus dirinya sendiri mengalunkan lagu-lagu Indonesia dan barat, di antaranya Keong Racun, Cinta Semalam, Getuk dan Terajana. Sementara itu Ikke Nurjanah dengan busana yang menonjolkan pakaian tradisi Indonesia yang sangat anggun melantunkan lagu Terlena, Kegagalan Cinta dan Biduan. Di samping Hudson dan Ikke Nurjanah, juga ikut tampil meramaikan adalah Tim Kesenian Sekolah Indonesia, Biroe Band, Persatuan Pelajar Utrecht, Tim Kesenian Samosir, Night Breaker band, Ray Jeffryn, dan Marabunta Band. Cuaca yang sangat cerah, dengan sinar

”Aming seperti yang lainnya ya, shock ketika denger kabar tersebut. Maklumlah ibunya kan motivator dia juga, jadi benarbenar spesial” kata Iyus saat dihubungi. Iyus menuturkan, ibunda

(21 Maret - 20 April)

Peluang yang tinggi sebaiknya bisa diimbangi juga dengan kerja keras jangan sampai loyo ataupun tidak ada peningkatan dalam prestasi kerjanya. Di hari ini peruntungan cukup mujur sehingga selalu ada saja jalan setiap menemui suatu permasalahan.



bunda komedian Aming, Emin Rumiah meninggal dunia di usia 82 tahun pada Senin (3/9) pagi. Menurut sang manajer, Iyus Aming shock pertama kali mendengar kabar duka itu.

( 23 November - 20 Desember)

Jangan hanya diam saja melihat sikap orang lain meremehkan kemampuan diri Anda. Segera lakukan gebrakan karena bagaimanapun juga mereka ternyata tidak bisa dihadapi dengan halus.

Personel Mahadewi, Puri telah resmi dilamar oleh kekasihnya yang berprofesi sebagai dokter berinisial ‘H’ usai Lebaran lalu. Acara pertunangan yang digelar pada 26 Agustus itu pun dihadiri keluarga besar Puri dan calon suami. Segala sesuatunya pun telah dipersiapkan Puri untuk langkah selanjutnya. Pelantun ‘Dokter Cinta’ itu akan segera menggelar akad nikah. Kapan? ”Akad nikahnya 1 November,” ungkap rekan Puri di Mahadewi, Gwen, Senin (3/9).

Sebagai sahabat, Gwen pun senang Puri akan melepas lajang. “Senenglah, pas deh dia kan udah 27 tahun juga ya udah waktunya, support-lah ini kan baik ya.” katanya. Gwen yang menggantikan Tata Janeta, personel Mahadewi yang sebelumnya hengkang pun mengaku siap mempersembahkan lagu jika diminta sahabatnya bernyanyi di hari bahagia itu. ”Siap aja kalau di-request yang punya hajat sih siap,” tuturnya ramah. (dc/int)


4 September 2012

Berusia 1 Tahun Aditya Berkumis

Bayi Kembar Beda Ras Pamela Frazer sudah tahu akan memiliki anak kembar sejak masa kehamilan. Tapi, sama sekali tak terbayang di benaknya bahwa dua buah hatinya itu terlahir dengan dua ras berbeda, empat pekan lalu. Candice Anne membawa sifat genetik: kulit hitam, rambut hitam, dan mata hitam. Sedangkan Aleisha Lilly menuruni sifat genetik: kulit putih, rambut pirang, dan mata cokelat. “Setidaknya aku tidak akan bisa salah memanggi anak-anakku,” ujarnya sambil bercanda, seperti dilansir The Sun. Meski langka, kasus itu masih bisa mendapat penjelasan secara medis. Ini mengingat Pamela dan suaminya, Oswald memiliki garis keturunan dari ras campuran. Pamela terlahir dari ibu keturunan Jamaika, Afrika, Irlandia, dan ayah keturunan Yahudi berkulit putih. Sedangkan Oswald terlahir dari ibu keturunan Jamaika, irlandia, dan ayah keturunan Jamaika. “Dokter mengatakan bahwa kasus semacam ini biasanya

maklum terjadi pada kakak dan adik yang tidak kembar. Namun, untuk kasus kembar sangat sangat jarang terjadi, kemungkinannya bisa jadi hanya satu dari setiap satu juta kelahiran,” ujar Pamela. Berdasar penjelasan dokter, dua sel telur Pamela kemungkinan besar mengalami pembuahan dari dua sperma berbeda. Ini artinya, masing-masing benih memiliki sifat genetik berbeda yang akan menentukan karakter fisiknya. Terlepas perbedaan karakter ras putri kembarnya, Pamela dan Oswald bersyukur

memiliki keturunan yang sehat. “Kami sangat mencintai mereka dan tak akan pernah membedabedakan,” Oswald menambahkan. Bukan Kasus Pertama Kasus serupa juga menimpa Shirley Wales yang melahirkan bayi kembar dengan ras berbeda. Yang lakilaki menuruni gennya yang seorang Grenadian: kulit gelap, mata coklat, dan rambut ikal coklat. Sedang bayi perempuannya menuruni gen mantan suaminya: kulit putih, mata biru, dan rambut pirang. Lewat operasi caecar di

Dewsbury District Hospital, West Yorkshire, dua bayi itu lahir sehat dan selamat pada 2009. “Saya tahu akan punya anak kembar dampit, tapi saya syok ketika perawat memberi tahu mereka punya warna kulit berbeda,” ujar Wales. Kelahiran bayi kembar itu sempat menyita perhatian media dan orang-orang di sekitarnya. Tak kurang 100 orang datang berkunjung di dua hari awal pascapersalinan. “Kalau saya cuma menggendong Hope, orang pasti akan mengira itu keponakan saya,” katanya sambil terbahak. (int)

BIHAR- Seorang balita di Distrik Bihar, India, Aditya Kumar menderita penyakit Sindrom Cushing dan penyakit membuatnya terlihat semakin tua. Balita berusia 18 bulan itu berbadan besar layaknya seorang bocah berusia enam tahun dan memiliki kumis. Sindrom Cushing merupakan penyakit yang memiliki sangkut paut dengan hormon. Aditya lahir dalam kondisi normal dan sehat. Namun pada saat ulang tahunnya yang ke-satu, Aditya tumbuh besar secara cepat. Tubuh balita itu membesar, tangannya pun berbulu dan kumis pun muncul di wajahnya. Bobot badan Aditya langsung meroket dan wajah balita itu terlihat semakin tua. Orangtua Aditya langsung panik dan membawa putranya ke dokter. Dokter yang ditemuinya tidak dapat menolong bocah malang itu. Dokter itu memutuskan untuk mengirim

Aditya ke rumah sakit dan pada saat itulah Aditya menjalani pemeriksaan kesehatan. Menurut Dr Krishna, Aditya harus menjalani proses operasi atau terapi radiasi untuk menyebuhkan Sindrom Cushing. Krishna mengatakan bahwa penyakit itu muncul akibat gangguan hormonal. “Saya sudah melihat laporan dari tes ultrasonografi bocah ini. Ada tumor di dalam kelenjar adrenalin yang terletak di atas ginjal Aditya. Hal ini menjadi pemicu sekresi dari hormon itu,” ujar Krishna, seperti dikutip Daily Mail, Senin (3/9). Kondisi finansial orangtua Aditya juga kurang baik. Pada awalnya, mereka ingin putranya dirawat di Patna, namun Krishna menyarankannya agar pergi ke All India Institute of Medical Sciences (AIIMS) di New Delhi. Bocah itupun siap menjalani sejumlah tes untuk menyelidiki penyakitnya. (ok/int)

Pria Inggris Habisi Nyawa 2 Anaknya LONDON- Seorang ayah tega menghabisi nyawa kedua putranya yang masih berusia 11 tahun dan 3 tahun gara-gara perpisahannya dengan sang istri. Setelah melakukan perbuatan keji terhadap kedua buah hatinya, pria berusia 36 tahun ini pun nekat gantung diri. Jasad Graham Anderson dan kedua buah hatinya ini baru ditemukan oleh sang pemilik apartemen yang dihuni oleh Graham di wilayah Tidworth, Wiltshire, Inggris, pada Sabtu (1/9) waktu setempat. Saat itu sang pemilik apartemen tengah menunjukkan sejumlah apartemen lainnya kepada calon penyewa baru. Semenjak kedua orangtuanya berpisah, kedua bocah tersebut tinggal bersama ibu mereka di

Andover, Hampshire. Namun kemudian keduanya secara rutin datang mengunjungi Graham di kediamannya. Sang ibu, Victoria Jones (30) telah melihat jasad korban dan memastikan bahwa 2 anak yang telah tak bernyawa tersebut merupakan buah hatinya, yakni Jack (11) dan Bryn (3). Tidak dijelaskan lebih lanjut bagaimana kondisi jasad ketiganya saat ditemukan. Tidak diketahui juga bagaimana cara

„ Lokasi kejadian Graham menghabisi nyawa kedua buah hatinya. Demikian

seperti dilansir Daily Mail, Senin (3/9).

Marah Diselingkuhi, Wanita Peru Potong

Alat Kelamin Kekasih LIMA- Seorang wanita marah besar karena mengetahui kekasihnya telah berselingkuh. Saking marahnya, dia memotong alat kelamin kekasihnya itu dengan pisau dapur! Peristiwa ini terjadi di Peru seperti diberitakan kantor berita AFP, Senin (3/9). Julia Munoz Huaman, wanita Peru berumur 41 tahun tersebut, mengaku telah memotong alat kelamin pasangannya, Ramon Arias (46) karena dibakar api

cemburu. Media lokal memberitakan, Huaman memotong alat kelamin Arias ketika pria itu sedang terlelap tidur. Potongan ‘burung’ tersebut kemudian dibuang Huaman ke toilet. Insiden mengerikan itu terjadi di sebuah penginapan di kawasan Brena, Lima. Warga setempat pun dibuat gempar dengan kejadian itu. Para petugas keamanan menangkap Huaman dan membawanya ke kantor polisi. Sementara Aria yang mengerang

kesakitan, langsung dilarikan ke rumah sakit. Saat ini pria

tersebut masih dirawat secara intensif di ruang ICU. (dtc/int)

12 Menit, TTelan elan 191 Sayap Ayam

BUFFALO – Sebuah lomba makan sayap ayam digelar di Buggalo, Amerika Serikat (AS). Juaranya sanggup menelan 191

sayap alam dalam waktu 12 menit! Penyelenggara National Buffalo Wing Festival menyatakan, Joey Chestnut

sanggup menyantap 191 sayap ayam dalam waktu sesingkat itu. Chestnut mencetak rekor

lomba makan sayap ayam yang digelar setiap tahun di Buffalo, sebuah kota di Negara Bagian New York. Rekor sebelumnya, 183 sayap ayam yang dicetak oleh Sonya Thomas alias Black Widow, nama panggungnya. Awal tahun ini, Chestnut yang warga California memenangkan gelar keempat berturut-turut sebagai juara lomba makan hot dog.Ia menyantap 68 hot dog dalam waktu 10 menit. Akhir pekan ini, festival sayap ayam masih digelar di Buffalo. Termasuk di antaranya, penyajian 100 macam menu masakan sayap ayam. (int)

Kepolisian setempat masih menangani kasus ini. Meski

mengkategorikan kematian korban dalam kasus ini cukup mencurigakan, namun kepolisian setempat tidak mencurigai adanya pelaku lain dalam kasus ini. Motif Graham melakukan perbuatan ini diduga karena masih tidak bisa menerima perpisahannya dengan sang istri. Meski belum mengetahui secara pasti kronologi insiden ini, namun kepolisian mencurigai aksi keji Graham tersebut dilakukan pada Kamis (30/8) pagi waktu setempat. “Sang ibu sangat-sangat terkejut mengetahui hal ini. Kami menyampaikan duka mendalam bagi pihak keluarga dan kerabat korban,” ujar Kepala Detektif setempat, Inspektur Ian Saunders. (dtc/int)


Coofey Ditangkap 4 Kali WASHINGTON- Di New Hampshire, Amerika Serikat (AS) seorang perempuan paruh baya tersangkut sejumlah kasus hukum. Bahkan dalam 26 jam terakhir, perempuan yang bernama Joyce Coffey ini sudah empat kali ditangkap. Kasus hukum pertama terjadi ketika para tetangga mengeluhkan tindakan Coffey yang memutar musik rock terlalu keras. Tidak tahan dengan perilaku Coffey para tetangga pun melaporkan kejadian ini ke pihak berwenang. Tak lama petugas pun datang dan memberikan Coffey peringatan. Namun, polisi terpaksa harus kembali ke rumah Coffey setelah munculnya keluhan kedua. Coffey yang menolak menurunkan mengecilkan suara musik rocknya pun terpaksa digiring ke kantor polisi. Namun perempuan berusia 53 tahun dilepaskan setelah membayar denda sekira USD500 atau Rp4,7 juta (Rp9.535 per USD). Mendekam di penjara ternyata tidak kunjung menimbulkan efek jera pada diri Coffey sampai akhirnya ia kembali ditangkap kedua kalinya akibat perbuatan yang sama. Untuk kedua kalinya pula Coffey dapat bebas setelah membayar denda lebih besar USD1000 atau sekira Rp9,5 juta “Coffey berjanji bahwa ia tidak akan mengulangi perbuatannya serta menjaga kenyamanan lingkungan sekitar.” tulis petugas polisi Matt Blonigen, seperti dikutip Upi, Senin (3/9). Namun ketika Blonigen mengecek kondisi sekitar rumah Coffey keesokan harinya, musik rock masih terdengar. Tanpa butuh keluhan dari tetangga Coffey pun ditangkap untuk ketiga

kalinya. Kali ini dakwaan melanggar jaminan juga turut diarahkan pada Coffey. Untuk kali ketiganya Coffey berhasil bebas setelah membayar jaminan sekira Rp95 juta. Sejumlah aturan pun diberlakukan polisi diantaranya Coffey dilarang menyetel musik sebelum pukul 10 pagi dan setelah pukul 20.00 malam waktu setempat. Polisi mengira Coffey akan jera dan menyadari perbuatannya namun ternyata hal itu terjadi. Karena ternyata tidak lama kemudian muncul kembali pengaduan terkait ulah Coffey. Kali ini pengaduan tersebut langsung datang dari keponakan Coffey, Dan Letourneau.Menurut Letourneau, tibatiba saja Coffey marah dan melemparkan wajan ke arahnya ketika ia berusaha mengambil beberapa barang miliknya di rumah. Maka hal ini pun membuat Coffey kembali ditangkap untuk keempat kalinya. (ok/int)


nilah ebiasan uruk ria dalam esehatan

Tak semua orang bisa mengelola uang dengan baik. Banyak di antara kita yang tak punya tabungan, tak punya dana darurat, dan tenggelam dalam tumpukan utang. Kami bertanya pada pengusaha dan blogger finansial Fitz Villafuerte: apa kesalahan utama kita, dan apa yang harus dilakukan untuk memperbaikinya? 1. Kita memprioritaskan pengeluaran daripada simpanan sehingga tidak menyisakan apapun. "Setiap mereka mendapatkan gaji mereka, mereka biasanya membelanjakan terlebih dahulu, dan kalau ada sisanya, itulah yang akan mereka tabung," kata Fitz Villafuerte. "Pada umumnya, tidak ada yang tersisa pada akhir bulan." Solusi: Balik prosesnya. Pertama pisahkan sebagian dari gaji Anda untuk menabung, kemudian silakan habiskan sisanya. Villafuerte juga merekomendasikan untuk minta HRD perusahaan Anda untuk membantu: "Kamu bisa mendebet tabungan Anda secara otomatis. Minta HRD Anda untuk mengirimkan sebagian dari gaji Anda ke rekening lain di bank penggajian (payroll) kantor Anda." Metode proaktif ini membuat menabung tidak begitu menyusahkan. "Dengan begitu Anda tidak merasa kalau Anda menabung," kata Villafuerte. "Kamu tidak merasa bersalah jika menghabiskan apa yang tersisa. Menabung terasa lebih ringan dan menguntungkan." 2. Kita berinvestasi sebelum membuat dana darurat. Villafuerte mengamati kalau kesalahan kedua yang sering dilakukan orang ketika mereka mendapatkan uang ekstra adalah berinvestasi sebelum mereka menyisihkan sebagian untuk dana darurat. "Mereka tidak menggunakannya terlebih dahulu untuk menyiapkan dana darurat," katanya. Dana darurat adalah fondasi dasar dari portfolio setiap or-

ang, yang jumlahnya adalah: uang senilai enam kali biaya pengeluaran bulanan rumah tangga Anda, disimpan untuk kebutuhan darurat. So lusi: Villafuerte Merekomendasikan memiliki dana tersebut sebelum Anda menginvestasikan uang Anda. Bukannya dia tidak menganggap penting untuk membuat uang Anda bertambah, namun seperti masalah sebelumnya, masalah yang akan dihadapi ini adalah sesuatu yang merupakan prioritas. "Biaya rumah sakit, perbaikan mobil atau rumah yang mendadak tidak bisa Anda kesampingkan." Tanpa adanya dana darurat, kamu akan mencari utang atau mencairkan investasi Anda dengan segera. 3. Kita menghindari

bursa saham. Villafuerte menganggap bursa saham disalahartikan banyak orang. "Ketika Anda berbicara mengenai bursa saham, orang berpikir mengenai perdagangan saham, dan mereka jadi ketakutan, karena mereka pikir itu seperti berjudi," jelasnya. "Itu alasan mengapa hal itu kurang diberdayakan sebagai kendaraan investasi." Selalu ingat: Perdagangan saham hanya merupakan sebagian kecil dari bursa saham. "Terdapat juga investasi bursa saham, yang lebih berupa jangka panjang," papar Villafuerte. "Jika warga lebih terdidik mengenai investasi [mengenai membeli saham atau menahannya untuk lima sampai tujuh tahun] Anda akan melihat kalau Anda

irip erarti odoh

ANDA tentu sering mendengar pernyataan ini, kan: 'Pasangan yang mirip, berarti jodoh'? Well, sekarang sudah ada bukti yang solid. Para dokter di University of Michigan baru saja menyelesaikan sebuah riset mendalam tentang hubungan antara kemiripan wajah dengan kelanggengan sebuah hubungan. Hasilnya menunjukkan, wajah mirip menandakan bahwa pasangan tersebut juga memiliki beberapa karakteristik genetik yang sama. Maka rasa "familiar" ini membuat hubungan lebih solid. Nah, bagaimana dengan Anda dan pasangan?(int)

mendapatkan lebih banyak dibandingkan jika Anda hanya menaruh uang Anda di deposito berjangka." Namun Vilafuerte tidak mau memberikan nasihat mengenai bursa saham. Ia lebih memilih untuk mereferensikan brokernya: "Mereka menawarkan seminar gratis mengenai investasi bursa saham." Terdapat banyak masukan berkualitas di luar sana — namun Anda harus teliti mengenai hal itu. 4. Kita mendapatkan saran finansial dari orang yang salah. Villafuerte telah melihat ini terlalu sering — pengusaha baru yang bertanya kepada temannya untuk nasihat bisnis gratis dan kena batunya. "Kita suka mengambil jalan pintas," tambahnya. "Mereka tidak melihat segala hal dari segi bisnis; mereka tidak bertanya kepada seorang pengusaha, 'bagaimana Anda menjalankan bisnis Anda?' jadi hal itu meningkatkan resiko kegagalan mereka." Selalu ingat: Ada alasannya mengapa informasi tertentu gratis dan mudah didapatkan, kata Villafuerte: "Karena hal itu bukanlah nasihat terbaik yang bisa Anda dapatkan." Informasi bisnis yang berkualitas lebih sulit didapatkan. Ia teringat pada teman-temannya yang ingin berbisnis laundry dan meminta nasihatnya. "Aku mengatakan kepadanya mengenai seminar operasi toko laundry di Nagoskwela: 'Kenapa kamu tidak hadir disana? Kamu akan mendapatkan nasihat dari orang-orang yang mengetahui bisnis itu.'" Temannya itu tidak menanggapi ide tersebut. "Untungnya bisnisnya tidak hancur, namun memerlukan tiga tahun sebelum bisnis itu stabil." Dibandingkan dengan temannya yang lain yang menghadiri seminar laundry itu. "Ia menghadiri seminar toko laundry itu -- tokonya baru dibuka baru tiga bulan, namun sudah stabil," kenang Villafuerte. "Dari situ Anda dapat melihat perbedaannya: meminta nasihat mengenai uang, bisnis, atau investasi, dari orang yang cuma Anda kenal, dibandingkan mendapatkannya dari orang yang memang ahli di bidang itu."(int)


PRIA dibalik sifat cekatan, kelelakian dan maskulinitas ternyata menyimpan kebiasankebiasan yang sangat buruk bagi kesehatan. Pria secara umum dikenal cuek dan tak menaruh perhatian terhadap hal-hal yang mengancam kesehatan mereka di masa depan. Berikut ini 10 daftar kebiasan buruk pria bagi kesehatan 1. Minum Minuman Keras. Meskipun haram dalam beberapa agama, namun masih banyak yang melakukan. Bahkan pada tahap tertentu seseorang akan sangat tergantung pada minuman keras. Di negaranegara yang membolehkan minuman keras beredar, kebiasan mabuk seolah menjadi tradisi dan sering melupakan dampak jangka panjang terhadap kesehatan. Alkohol berhubungan dekat dengan kematian dalam banyak kasus selain bisa menyebabkan obesitas dalam waktu cepat. 2. Menghindari Dokter Penelitian Charity Men’s Health Forum menunjukkan pria 20 persen lebih sedikit daripada wanita dalam hal mengunjungi dokter jika mereka sakit. Mengunjungi dokter bagi para pria adalah pengalaman yang tidak menyenangkan. 3. Malas melakukan Check Up Sama seperti mengunjungi dokter, melakukan check up terhadap gejala penyakit adalah hal yang menyebalkan. Para Pria takut, tak mau mengetahui penyakit dan bingung apa yang harus dilakukan jika melakukan cek medis. 4. Menyimpan masalah Secara umum, pria sangat jarang berbicara tentang perasaan mereka dibanding para wanita. Mereka sulit mengekspresikan emosi atau sekedar meminta dukungan dalam sebuah masalah. Karena faktor ini para pria lebih rentah terserang depresi dibanding wanita, dan sekitar 77 persen dari yang depresi ingin mengakhiri hidupnya. Memendam kemarahan sama dengan merugikan kesehatan pria itu sendiri 5. Stres dalam bekerja Sama sama memiliki tekanan dalam bekerja, namun menurut survei oleh Medicash terhadap 3.000 pekerja, Pria empat kali lebih banyak izin sakit karena stress dibanding pekerja perempuan. Stres dalam pekerjaan bisa berakibat buruk ke jantung dan stroke. Sangat penting untuk mencari cara mengurangi stres para pria dalam pekerjaan 6. Mandi Air Panas Banyak pria ingin bersantai dengan sering berendam air panas. Peneliti dari University of California

menemukan bahwa air panas dapat dengan signifikan menurunkan kesuburan pada pria. Sperma berkembang baik di lingkungan yang dingin, sehingga harus dihindari panas di daerah ini termasuk mandi air panas di jacuzzi atau menggunakan laptop di atas paha. 7. Tidak pernah memakai tabir surya. Kanker kulit adalah jenis kanker yang sering ditemui di Inggris dan pria dalam studi adalah pasien terbanyak. Dalam penelitian 52 persen wanita rajin menggunakan tabir surya dibandingkan pria yang hanya 37 persen. padahal pria melakukan aktivitas luar lebih banyak dibandingkan para wanita 8. Kamar mandi yang tidak higienis Apakah para pria mencuci tangan setelah dari kamar mandi? menurut sebuah studi dari assosiasi sabun dan deterjen di Amerika, satu dari tiga pria tidak melakukannya. Lebih jauh, sebuah study di Inggris menyebutkan hanya satu dari tiga pria yang mencuci tangan menggunakan sabun. Tidak mencuci tangan adalah permulaan dari infeksi, jamur dan penyakit lainnya. 9.Tidak gosok gigi! Dalam sebuah studi oleh asosiasi dokter gigi Amerika, hanya 66 persen dari para pria yang sikat gigi dua kali atau lebih dalam sehari. Bandingkan dengan wanita yang mencapi 86 persen. Selain itu dalam penelitian yang sama, wanita dua kali lebih rajin rutin memeriksakan giginya dibanding para pria.

10. Sering makan 'fast food' Fast food menjadi budaya di beberapa negara. banyak diantara kita yang bertambah berat badan secara drastis akibat konsumsi fast food berlebihan, sebagian besarnya adalah pria. Dalam survei oleh Pew Research Center, 47 persen pria setidaknya makan fast food sepekan sekali sedang wanita hanya 35 persen diantaranya.(int)

Nugget Tahu Sayur

BAHAN : gr 200 • Tahu putih • Daging sapi cincang 150 gr • Jagung manis pipil 100 gr • Kacang polong 50 gr • Roti tawar tanpa kulit 3 lbr • Susu cair 100 ml • Bawang putih 3 siung, cincang • Telur ayam 1 btr • Garam 1 sdt • Merica bubuk 1 sdt • Gula pasir 1 sdt BAHAN PELAPIS NUGGET TAHU SAYUR: rata kocok btr, 2 telur • Putih • Tepung roti 200 gr • Minyak goreng 500 ml CARA MEMBUAT NUGGET TAHU SAYUR: • Campur tahu, daging, bawang putih, roti tawar, 50 gr jagung, telur, dan susu cair. Masukkan dalam blender, proses hingga lembut. Sisihkan. • Tambahkan kacang polong, 50 gr jagung, garam, merica, dan gula pasir. Aduk hingga rata. • Tuang adonan dalam loyang yang diolesi minyak goreng dan di alasi plastik. Ratakan. • Kukus adonan nugget selama 30 menit. Angkat, dinginkan. Potong kotak, sisihkan. (Bentuk sesuaikan dengan keinginan) • Celupkan nugget dalam putih telur kocok, lalu balut dengan tepung roti. Lakukan 2x. • Goreng nugget hingga kecokelatan. Angkat dan sajikan.(int)



4 September 2012

Nyaris Timpa Alonso, Grosjean Minta Maaf PEMBALAP Lotus, Romain Grosjean, minta maaf atas manuvernya yang mengakibatkan kecelakaan di F1 GP Belgia, Minggu 2 September 2012. Grosjean merasa terpukul dengan sanksi larangan tampildiGPItalia.Atastindakannya di GP Belgia, Grosjean menerima sanksi satu larangan tampil dan denda €50 ribu (setara Rp599 juta). Dengan demikian pembalap asal Prancis itu harus absen di GP Italia, akhir pekan ini. Sebuah manuver berbahaya Grosjean di awal balapan GP Belgia mengakibatkan kecelakaan yang melibatkan sejumlah mobil. Usai menyenggol ban kiri depan pembalap McLaren, Lewis Hamilton, mobil Grosjean kemudian melayang dan nyaris menimpa pembalap Ferrari Fernando Alonso. Pembalap Sauber, Sergio Perez dan Kamui Kobayashi, juga terlibat


dalam kecelakaan tersebut. Namun,namaterakhirmampumelanjutkan balapan dan finish di posisi 13. “Saya tidak bermaksud membuat pembalap lain tertekan ke tembok. Saya tidak berusaha menghentikan balapan di tikungan pertama. Saya minta maaf, dan lega tidak ada yang terluka,” ujar Grosjean seperti dilansir Autosport. “Saya melakukan kesalahan dan salah menghitung jarak dengan Hamilton. Saya yakin telah melewati dia. Jadi, kesalahan kecil yang mengakibatkan kecelakaan besar,” lanjutnya. Grosjean menilai sanksi larangan tampil di GP Italia membuatnya sangat terpukul. “Ketika Anda cinta balapan, hukumaninisangatberat.Tapi,saya menerima kesalahan. Saya marah dengan diri sendiri,” tuntasnya. Lega Fernando Alonso menyesal tidak

berhasil mendapatkan poin di Grand Prix Belgia. Namun, Alonso mengaku beruntung tidak mengalamicederaparahakibatinsidenitu. Seperti diketahui, mobil Romain Grosjean yang kehilangan kendali menabrak mobil pemuncak klasemen pembalap itu dan juga Lewis Hamilton. Insiden itu memaksa Alonso finis dari lomba lebih awal. Sementara itu, Sebastian Vettel mampu finis di peringkat kedua pada balapan kemarin. Dengan hasil ini, pembalap Red Bull itu mampu memangkas ketinggalan poin menjadi 24 angka dari pemuncak klasemen Alonso. “Saya sangat kecewa karena kehilangan poin. Namun, saya merasa sangat beruntung karena bisa mengemudikan mobil dalam waktu lima hari mendatang di Monza,” jelas Alonso, dilaporkan Autosport, Senin (3/9). (int)

Paralimpik di London

Panitia Sediakan Bus Gratis

Untuk Warga ke Venue PON XVIII PANITIA Besar PON Riau menyediakan 45 unit bus untuk masyarakat secara gratis. Bus ini akan khusus membawa warga menuju berbagai tempat pertandingan. Demikian disampaikan Humas PB PON Riau, Chairul Riski, Senin (3/9) di Pekanbaru. Riski menjelaskan, penyediaan bus ini guna mempermudah masyarakat untuk menonton langsung pertandingan yang ada di Pekanbaru. Bus angkutan khusus ke venue PON ini akan mulai beroperas pada 9 September. “Masyarakat dapat memanfaatkan bus tersebut secara gratis menuju lokasi pertandingan. Ini guna merangsang warga untuk menyaksikan jalannya pertandingan olahraga,” kata Riski. Masih menurut Riski, 45 bus gratis itu akan ditandai stiker berlambang PON. Bus ini akan melayani rayon Kecamatan Tampan, tepatnya di sekitar kampus Universitas Riau (Unri). Selanjutnya Rayon Marpoyan di sekitar kampus Universitas Islam Riau (UIR). Dan bus juga akan melayani mewuju sport center di Kecamatan Rumbai. “Bus ini selama dua pekan akan terus beroperasi guna memberikan kemudahan kepada masyarakat yang akan menyaksikan pertandingan olahraga PON. Masyarakat tentunya akan sangat terbantu dengan adanya shuttle bus seperti ini,” kata Riski. Disebutkannya, pelayanan jasa transportasi memang menjadi perhatian serius dari PB PON, tidak hanya untuk para atlet, ofisial dan tamu PON lainnya. Masyarakat yang ingin menyaksikan pertandingan-pertandingan olahraga pun harus difasilitasi. “Kita memberikan sarana transportasi gratis ini akan tetap beroperasi sejak pagi hingga pertandingan usai. Kiranya masyarakat dapat memanfaatkan fasilitas ini,” kata Riski. (int)


Tantang Bartoli di Perempatfinal PETENIS unggulan ketiga, Maria Sharapova, akhirnya berhasil melenggang ke babak perempatfinal US Open 2012 dengan mengalahkan petenis dari Rusia, Nadia Petrova, Senin (3/9). Sharapova terlibat pertandingan yang cukup sengit saat berhadapan dengan Petrova. Ia membutuhkan tiga set untuk mengkandaskan Pertova dengan skor 6-1, 4-6 dan 6-4. Dengan kemenangan ini, Sharapova akan berhadapan dengan petenis dari Prancis, Marion Bartoli, untuk merebutkan tiket ke semifinal US Open. Sebelumnya, Bartoli berhasil mengalahkan Petra Kvitova di babak keempat dengan skor akhir 1-6, 6-2, 6-0. Hasil Lengkap Babak Keempat US Open Putri: Samantha Stosur - Laura Robson 6-4, 6-4. Victoria Azarenka - Anna Tathishvili 6-2, 6-2 Maria Sharapova - Nadia Petrova Marion Bartoli - Petra Kvitova 1-6, 6-2, 6-0

Indonesia meraih medali pertama di ajang Paralimpik London, lewat petenis meja Dian David Michael Jacobs (32). David Jacobs berhasil meraih medali perunggu setelah menundukkan lawannya dari Spanyol José Manuel Ruiz Reyes dalam pertandingan semifinal di gedung Excel, London, Minggu malam. Atlet kelahiran Makassar 21 Juni 1977 ini mulai berkenalan dengan tenis meja sejak umur 10 tahun berhasil menundukkan pemain terbaik Eropa dengan 3-1. Dalam pertandingan yang cukup menegangkan, David yang awalnya menempati peringkat 40 dunia kelas 10, mendapat dukungan dari sang ayah Jan Jacobs yang berusia 71 tahun dan istrinya Jeanny Palar serta kakak lelaki yang khusus datang dari Kenya. Keberhasilan David mempersembahkan medali perunggu merupakan sejarah tersendiri bagi Indonesia, mengingat untuk pertama kalinya Indonesia berhasil meraih medali diajang pesta olahraga difabel (penyandang cacat) paling bergengsi dunia itu. Ketua Umum Komite Paralympic Indonesia Senny Marbun mengatakan bahwa suatu kebanggaan akhirnya David berhasil mempersembahkan medali bagi Indonesia.

“Pertama kami berterima kasih kepada Tuhan yang telah mengizinkan David mendapatkan medali yang merupakan medali pertama Indonesia dalam Paralimpik,” ujar Senny usai acara pengibaran bendera. Pertarungan tenis meja di kelas 10 ini pertandingan David sendiri cukup menegangkan, set pertama dimenangkannya 11-9, dibabak kedua Ruiz Reyes bangkit dan menang 11-7. Namun dengan ketenangan David babak ketiga dan empat diraih dengan mudah 11-5 dan 11-6. Usai pertandingan, David tampak tidak dapat menahan haru dan bahkan sempat berlutut dan airmatanya pun menetes sambil melambaikan tangannya ke arah suporter Indonesia, yang mengibarkan bendera Merah Putih. Sang pelatih Pribadi mengakui meskipun baru pertama kali mengikuti kejuaraan Paralimpic, David langsung memberikan yang terbaik buat bangsanya. “Paralimpik di London merupakan ajang pertama bagi David dan kita bersyukur akhirnya bisa

mempersembahkan medali,” ujar Pribadi. Sementara itu Ketua Kontingen Indonesia James Tangkudung menyampaikan terimah kasih kepada masyarakat Indonesia yang bermukim di London dan masyarakat Indonesia pada umumnya atas doa dan dukungannya. “ Ini prestasi terbaik tim paralimpic Indonesia,” ujar mantan Deputi Menteri Bidang Pembudayaan Olahraga Kementerian Pemuda dan Olahraga. Walaupun pertandingan telah berakhir, suporter Indonesia tak satu pun beranjak meninggalkan tempat duduknya menantikan upacara penyerahan medali dan pengibaran bendera merah putih yang merupakan saat saat bersejarah bagi bangsa Indonesia khususnya penghormatan bagi para penyandang cacat di Indonesia. (int)

Dian David Michael Jacobs, peraih medali pertama Paralimpik di London dari cabang tenis meja.

Button Rayakan Kemenangan DENGAN JESSICA PEMBALAP McLaren Mercedes Jenson Button sukses meraih kemenangan di GP Belgia. Ini merupakan kemenangan kedua Button di musim ini setelah balapan pembuka musim 2012 di GP Australia. Button tampil menawan dengan terus memimpin jalannya balapan dari pole-position. Performa Button yang sempat diperkirakan akan melemah di tengah musim justru tidak terlihat di Spa Francorchamps. Mantan pembalap Williams ini pun menutup GP Belgia dengan gembira. Usai penyerahan piala dan wawancara dengan media, Button langsung merayakannya dengan seluruh kru McLaren. Tak hanya itu, kekasih Button, Jessica Michibata juga tampak hadir. Model 27 tahun itu bahkan mengenakan seragam tim McLaren yang berwarna oranye dan terlihat akrab dengan kru McLaren lainnya bahkan dengan rekan setim Button, Lewis Hamilton. Jessica dan Jenson sudah berpacaran selama dua tahun dan Jessica cukup dikenal di paddock F1 karena sering menemani B u t t o n balapan di beberapa Grand Prix. (int)


SELASA 4 September 2012

ENGLISH PREMIER LEAGUE No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Team Chelsea Swansea City West Brom Man City Man United Everton West Ham Arsenal Wigan Newcastle Fulham Stoke City Sunderland Tottenham Norwich City Reading Aston Villa Liverpool QPR Southampton

M 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 2 3 3 3 3

M 3 2 2 2 2 2 2 1 1 1 1 0 0 0 0 0 0 0 0 0

S 0 1 1 1 0 0 0 2 1 1 0 3 2 2 2 1 1 1 1 0

K 0 0 0 0 1 1 1 0 1 1 2 0 0 1 1 1 2 2 2 3

SG 8-2 10-2 6-1 8-5 6-5 4-3 4-3 2-0 4-4 3-4 7-6 3-3 2-2 3-4 2-7 3-5 2-5 2-7 2-9 4-8

Nilai 9 7 7 7 6 6 6 5 4 4 3 3 2 2 2 1 1 1 1 0

TOP SCORER Gol 4 4 3

Nama Klub Michu Swansea City R. van Persie Manchester United C. Tévez Manchester City

SPANISH LA LIGA No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Team M Barcelona 3 Mallorca 3 Málaga 3 Rayo Vallecano 3 Real Valladolid 3 Deportivo 3 Sevilla 3 Getafe 3 Atlético Madrid 2 Levante 3 Real Madrid 3 Real Betis 2 Real Sociedad 3 Real Zaragoza 3 Celta de Vigo 3 Athletic Club 3 Valencia 3 Granada 3 Espanyol 3 Osasuna 3

M 3 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0

S 0 1 1 1 0 2 2 1 1 1 1 0 0 0 0 0 2 1 0 0

BARCELONA K 0 0 0 0 1 0 0 1 0 1 1 1 2 2 2 2 1 2 3 3

SG 8-2 4-2 3-1 3-1 3-2 6-4 3-2 4-4 5-1 4-5 5-3 6-5 3-7 2-3 3-3 5-9 4-5 1-5 4-7 1-6

Nilai 9 7 7 7 6 5 5 4 4 4 4 3 3 3 3 3 2 1 0 0

TOP SCORER Gol 4 3 3

Nama L. Messi R. Falcao T. Hemed

Klub Barcelona Atlético Madrid Mallorca

Juventus Napoli Lazio Sampdoria Roma Catania Torino Genoa Internazionale Milan Fiorentina Chievo Parma Cagliari Udinese Bologna Palermo Pescara Atalanta Siena

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

2 2 2 2 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0

0 0 0 0 1 1 1 0 0 0 0 0 0 1 0 0 0 0 1 1

TOP SCORER Gol 3 3 2

Nama S. Jovetiæ G. Pazzini G. Bergessio

Klub Fiorentina Milan Catania

0 0 0 0 0 0 0 1 1 1 1 1 1 1 2 2 2 2 1 1

6-1 5-1 4-0 3-1 5-3 5-4 3-0 4-3 4-3 3-2 3-3 2-2 2-2 1-3 2-6 1-5 0-6 0-6 1-2 1-2

Dari 14 tembakan yang dilakukan Barca, lima di antaranya mengarah ke gawang, tapi yang

menembus gawang Diego Alves adalah yang dihasilkan Adriano di menit 23, menjadikan pertandingan ini berakhir 1-0. Pemain berpaspor Brasil membuat gol tersebut setelah mendapatkan bola dari sepak pojok pendek, lalu dari sudut kotak penalti melepaskan tembakan ke bagian atas tiang jauh gawang Valencia. Gol itu membuat permainan lebih terbuka. Berselang lima


menit Barca mendapatkan peluang lagi dari kerja sama Pedro dan Cesc Fabregas, tapi penyelesaian akhirnya tidak membuahkan gol. Tim tamu mencoba lebih berani menyerang di babak kedua. Namun mereka kesulitan menandangi penguasaan bola yang sudah jadi trade mark Barca. Statistik mencatat, ball possession tuan rumah 67% sedangkan El Che 33%.

Roma Teu k k Inter 3-1 di Meazza

ITALIAN SERIE A 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

BARCELONA- Gol tunggal Adriano membuat laga Barcelona versus Valencia di Camp Nou dimenangi tuan rumah. Los Cules pun tetap memuncaki klasemen sementara Liga Spanyol.


6 6 6 5 4 4 3 3 3 3 3 3 3 1 0 0 0 0 -1 -5

MILAN-ASRomamemetikkemenangan pertamanya di musim ini. Bertandang ke Giuseppe Meazza, Roma menang 3-1 atas Inter Milan. Di laga yang dimainkan di Giuseppe Meazza, Senin (3/9) dinihari WIB, Roma unggul lebih dulu saat laga berjalan 15 menit. Umpan Francesco Totti dari sisi kiri disundul oleh Alessandro Florenzi yang berdiri bebas di dalam kotak penalti Inter. Tertinggal satu gol, Inter mengambil inisiatif menyerang. Tapi peluang Inter lewat Diego Milito di menit ke17 masih mampu digagalkan oleh Maarten Stekelenburg. Inter kembali mendapat peluang, kali ini lewat tendangan bebas Wesley Sneijder. Namun bola eksekusi Sneijder bisa diamankan oleh Stekelenburg. Di ujung babak pertama, Inter menyamakan kedudukan lewat sepakanAntonioCassano.Tembakannya mengenai Nicolas Burdisso dan mengecoh Stekelenburg. Hingga turun minum, skor imbang 1-1 tetap bertahan. Roma mendapat peluang emas di awal babak kedua. Berawal dari umpan Panagiotis Tacthsidis, Pablo Osvaldo yang berdiri bebas kemudianmelepaskantembakan.Tapisial bagi Osvaldo, upayanya masih belum menemui sasaran. Osvaldo membawa Roma unggul di menit ke-67. Meneruskan umpan Totti, Osvaldo mencungkil bola melewati Luca Castelazzi dan mengu-

bah skor menjadi 2-1. Marquihno menambah keunggulan Roma di menit ke-79. Menerima umpan dari Osvaldo, Marquinho yang bergerak dari sisi kiri kemudian melepaskan tembakan dari sudut sempit ke pojok gawang Castelazzi. Di masa injury time, Roma harus bermain dengan 10 orang.

Osvaldo menerima kartu kuning kedua setelah melakukan handball. Hingga peluit panjang berbunyi, skor 3-1 untuk keunggulan Roma tetap tidak berubah. Dengan kemenangan ini, Roma merangkak ke peringkat lima dengan empat poin. Sementara Inter tertahan di posisi delapan dengan tiga poin.

Susunan Pemain: Inter: Castellazzi; Zanetti, Silvestre, Ranocchia, Nagatomo; Guarin, Gargano (Coutinho 76), Pereira (Cambiasso 66); Sneijder; Cassano (Palacio 50), Milito

Roma: Stekelenburg; Piris, Burdisso, Castan, Balzaretti (Taddei 56); Florenzi, Tachtsidis, De Rossi (Marquinho 32); Destro (Lamela 69), Osvaldo, Totti


Kesempatan terbaik Barca di babak kedua terjadi ketika Alexis Sanchez berhasil membuka pertahanan lawan, tapi tembakan lanjutan dari Fabregas melambung. Valencia sempat menggetarkan gawang Victor Valdes melalui tendangan Victor Ruiz, tapi gol tersebut dianulir wasit karena terjadi offside. Sampai pertandingan selesai

skor tidak berubah, tetap 1-0. Susunan pemain: Barcelona: Valdes; Alves (Alba 46), Pique, Mascherano, Adriano; Fabregas (Iniesta 64), Xavi, Song; Alexis (Busquets 87), Messi, Pedro Valencia: Diego Alves; Pereira, Rami, V. Ruiz, Cissokho; Feghouli (Valdez 81), T.Costa, Abelda (Gago 77), Guardado (Viera 77); Jonas, Soldado

Rumor-Rumor di Belakang Wajah Sedih CR7 MADRID-Belumdiketahuisecara pasti apa yang menyebabkan Cristiano Ronaldo bersedih hati. Spekulasi menyebut, si pemain ingin meninggalkan Real Madrid karena beberapa persoalan tertentu. Wajah sendu pemain Portugal itu jelasterlihatsetelahmencetakduagol dari tiga gol Madrid ke gawang Granada pada Senin (3/9) dinihari tadi. Jangankan melakukan selebrasi, ia bahkan tidak tersenyum. Seusai pertandingan, Ronaldo mengungkapkankepadamediabahwa dia sedang tidak bahagia dan klub mengetahui situasi tersebut. Namun demikian,pemainterbaikdunia2008 initidakmenjelaskanlebihlanjutsoal permasalahan ini. Dugaan bahwa Ronaldo marah dengan kemenangan Andres Iniesta dalampemilihanpemainterbaik UEFA 2011/12 bukanlah alasannya. “Tidak ada hubungannya dengan itu. Iniesta pantas mendapatkannya,” ujar Ronaldo. Lantas apa? Dilansir Football Espana, radioterkemukaSpanyol Cadena SER mengklaim Ronaldo telah mengungkapkan ketidaknyamannya di Madrid kepada Presiden Florentino Perez dan direkturumumJoseAngel Sanchez dalam pertemuan pada Sabtu (1/9).

Ditambahkan pula ada isu bahwa Ronaldotidakakurdenganbeberapa rekan satu timnya. Mantan pemain Manchester United itu kabarnya tak senang dengan Marcelo yang barubaru ini berkomentar bahwa kiper Iker Casillas lebih pantas memperoleh Balon d’Or ketimbang dirinya, yang mana itu diyakini akan merugikan Ronaldo. Sedangkan dari kabar yang didapat Telegraph, penyebab Ronaldo gusar adalah perlakuan klub terhadap Kaka. Pemain Brasil tersebut kini tidak jelas masa depannya karena tak ada klub yang bersedia menggaetnya lantaran gajinya yang tinggi, namun juga tak masuk dalam rencana Jose Mourinho. Ronaldo sudah bermukim di Madrid selama tiga tahun dan selama itu pula ia menjadi pemain terbaik mereka dengan andil besarnya dalam sukses meraih Copa del Rey dan juara La Liga. Musimlalu,Ronaldomengatakan akan senang untuk menghabiskan kariernya bersama Los Merengues. Tampaknya itu menjadi indikasi bahwa dia menginginkan sebuah kontrak baru,namunsampai saat ini klub belum menunjukkan tanda-tanda akan menawari kesepakatan baru. Well, apa yang sebenarnya terjadi dengan Ronaldo? (int)


