Issuu on Google+





Selasa, 22 Mei 2012

BELAWAN- Seorang anak baru gede alias ABG, sebut saja Pelangi (18), disekap selama dua malam. Perempuan tamatan SMP ini, juga nyaris dipekerjakan sebagai pekerja seks komersial (PSK).

MEDAN- Warga Negara Indonesia (WNI), khususnya yang berusia maksimal 21 tahun (pelamar umum) dan 24 tahun (PNS) per 1 September 2012, terbuka peluang untuk menjadi Praja Institut Pemerintahan Dalam Negeri (IPDN) untuk tahun ajaran 2012/ 2013, tanpa terkecuali masyarakat Sumatera Utara (Sumut). Untuk pendaftarannya mulai dibuka sejak Senin (21/5) sampai Rabu (30/5), berlokasi di masing-masing kantor bupati/walikota di Sumut. „) Baca Pendaftaran ..Hal 2

Ribut-ribut Petral dan Prinsip C&C KADANG timbul. Kadang tenggelam. Kadang timbul-tenggelam. Begitulah isu korupsi di Pertamina. Siklus timbul-tenggelam seperti itu sudah berlangsung puluhan tahun. Belum ada yang mengamati: tiap musim apa mulai timbul dan mengapa (ada apa) tiba-tiba tenggelam begitu saja. Sejak sekitar tiga bulan lalu isu itu timbul lagi. Belum tahu kapan akan tenggelam dan ke mana tenggelamnya. Sebenarnya mena„) Baca Ribut-ribut ..Hal 7


Edisi 42 „ Tahun X

Disekap Dua Malam ABG Dijadikan PSK Pendaftaran Praja IPDN Dibuka


Keterangan yang dihimpun POSMETRO MEDAN (grup Metro) menyebutkan, selama enam bulan terakhir, Pelangi, warga Pangkalan Susu, Kabupaten Langkat bekerja sebagai pembersih barak di kawasan Canang, Belawan. Dan, beberapa waktu lalu temannya dari Malaysia bernama Wulan menghubunginya via handphone (Hp). Wulan menawarkan Pelangi ikut kerja ke

Malaysia. Tergiur dengan pekerjaan sebagai karyawati salon dengan gaji yang lumayan, Pelangi menerima tawaran yang diberikan Wulan. Nah, Wulan yang juga menjadi korban trafficking ini pun menawarkan Pelangi untuk berangkat melalui jasa seorang pria bernama Emi yang menetap di Canang, Belawan. Pertemuan pun terjadi antara mereka sekitar seminggu lalu, Emi langsung menawarkan Pelangi berangkat tanpa biaya dan persyaratan idenditas diri. Sekitar dua minggu kemudian (dari pertemuan itu),

SIANTAR- Wakil Ketua Partai Demokrat Kota Siantar Rocky Marbun mengatakan, SK Pengurus DPC Partai Demokrat Kota Siantar bernomor 21.26/SK/DPP.PD/DPC/V/ 2012 tertanggal 15 Mei 2012 diduga palsu. Rocky akan melaporkan ini ke DPP Partai Demokrat di Jakarta Rabu nanti.

“SK kepengurusan Partai Demokrat Kota Siantar tertanggal 15 Mei 2012 diduga palsu. SK itu keliru, karena tidak jelas siapa yang tanda tangan, masak tanda tangan Ketua DPP dan Sekjen dirobek. Tidak bisa seperti itu SK kepengurusan Partai „) Baca SK Demokrat ..Hal 2



„ Petani jeruk di Merek Raya memasang kelambu di ladang jeruk.

MASIH TRAUMA MENIKAH MANTAN istri Ahmad Dani, Maia Estianty mengaku masih trauma untuk kembali berumah tangga. „) Baca

Masih ..Hal 7

„) Baca Disekap ..Hal 2

„ Korban Trafficking


Maia Estianty

Petani Kelambui Ladang Jeruk

100 Ha Tanah Sihaporas STATUS STANPAS SIMALUNGUN- Sebanyak 100 hektare (ha) tanah di Nagori Sihaporas, Kecamatan Pematang Sidamanik, Simalungun berstatus stanpas. Tanah tersebut dalam kasus silang sengketa, antara masyarakat dan Pangulu Sihaporas. Sebab pangulu Sihaporas mengeluarkan surat di atas lahan masyarakat atas namanya sendiri sejak memimpin. „) Baca 100 Ha ..Hal 2


„ Warga Sihaporas mendatangi DPRD Simalungun, Senin (21/5).

Chondri: Banyak Pria Dikenal Yani

RAYA- Warga Huta Limag Nagori Merek Raya melakukan pemagaran ladang jeruknya dengan menggunakan kelambu. Alasannya guna pencegahan serangan lalat buah yang menyerang tanaman jeruk mereka sejak 6 bulan terakhir. Amatan METRO di Huta Limag Senin (21/5), hampir seluruh kebun jeruk warga menggunakan kelambu sebagai pagar ladang jeruk mereka. Kelambu

SIANTAR- Anggota DPRD Kota Siantar Chondri Silitonga menjelaskan, bukan dia saja lelaki yang dikenal Yani selama ini. Banyak lelaki lain yang dikenal wanita yang sempat menghebohkan sidang paripurna DPRD, Rabu (16/5) lalu. Chondri mengaku sudah lama mengenal Yuni, namun dia lupa waktu perjumpaan itu.

„) Baca Petani ..Hal 2

„) Baca Chondri..Hal 2


22 Mei 2012

Pasang BK 1 W di Mobil Pribadi Walikota Dipolisikan Sambungan Halaman 1 SIANTAR- Wallikota Siantar dilaporkan ke Polresta Siantar, , Senin (21/5) sekira pukul 11.00 WIB karena memakai plat merah BK 1 W pada mobil pribadinya, Jeep Cherooke, Senin (21/5) sekira pukul 11.00 WIB. Pemasangan plat mobil itu dilaporkan karena menyalahi Undang-Undang Nomor 22 tahun 2009 tentang lalu-lintas dan angkutan jalan. Ketua Bidang Hukum DPC Koswari SiantarSimalungun Mara Salim Harahap, Senin (21/5) menyebutkan, alasan utama pemasangan BK 1 W diadukan ke polisi karena Walikota Siantar Hulman Sitorus, tidak memberikan contoh baik kepada masyarakat di Kota Siantar. ”Walikota Siantar Hulman Sitorus sebagai publik figur, seharusnya menjadi contoh bagi masyarakat dalam menegakkan disiplin berlalu lintas, bukan malah sewenang-wenang,” tegas Harahap. Dengan adanya pengaduan ini, dia berharap agar pihakkepolisiansegeramengambillangkahpersuasif agar kepercayaan masyarakat terhadap kinerja kepolisiandapatterjaga.Diaberharap,agarpengaduan Koswari ditindaklanjuti pihak Polres Siantar. ”Pengaduan ini juga besok akan segera kita tembuskan ke Kapolri dan Mendagri. Harapan kami dari Koswari, agar masyarakat Kota Siantar tetap disiplin dalam mematuhi undang-undang berlalu lintas,” jelasnya. Pengaduan Koswari diterima oleh Staf Tata Usaha Polres Siantar dengan nomor:01/LP/BH/ KOS/SS/V/2012. Koswari berharap kepada Kapolresta Siantar AKBP Alberd Sianipar, segera menindak lanjuti pengaduan ini demi pencitraan kinerja dari aparat kepolisian di Kota Siantar. Dekan Hukum Universitas Simalungun Januarison Saragih menyebutkan, perbuatan walikota mengganti plat mobilnya telah melanggar Undang-Undang Nomor 22 tahun 2009 tentang Lalu Lintas dan Angkutan Jalan. Selain melakukan penipuan, hal lain yang dilanggar Hulman, etika sebagai pemimpin di Kota Siantar. Harusnya sebagai walikota, Hulman memberikan contoh baik kepada warga. Tidak melakukan tindakan suka-suka dengan mengganti plat mobil pribadinya dengan plat merah. (ral)

Disekap Dua Malam ABG Dijadikan PSK Sambungan Halaman 1 paspor pelancong menjadi dasar untuk masuk ke Malaysia diterima Pelangi. Dengan modal paspor pelancong, perempuan berkulit hitam ini diberangkatkan ke Malaysia dengan angkutan laut lewat Tanjung Balai pada tanggal 10 Mei 2012. Tiba di negara tetangga, Pelangi terkejut karena langsung dititip dengan seorang pria India dan diajak ke sebuah barak tempat perkumpulan para pekerja seks komersil (PSK). “Begitu sampai di sana rupanya aku lihat kerjaannya tak betul. Bukan di salon malah disekap di barak. Aku tak boleh keluar tanpa didampingi majikan,” kata Pelangi didampingi

orangtuanya, Abdul Muis (40) dan Icah (35), di Mapolres Pelabuhan Belawan, Senin (21/5). Merasa ditipu, korban berusaha menelepon keluarga dengan handphone (Hp) milik wanita yang juga ada di barak tersebut. Selanjutnya, korban menjelaskan kepada keluarganya kalau ia telah dijebak untuk dijadikan PSK di Malaysia. Mendengar penjelasan itu, keluarga langsung berusaha menolong Pelangi agar bisa kembali ke Indonesia. Kemudian paman korban bernama Taufik yang juga pengurus Putra Bangsa Republik Indonesia (PBRI) Langkat ini, menelepon PBRI di Malaysia dan meminta pertolongan. Dan, setelah dua malam disekap, pada malam ketiga Pelangi dikeluarkan dari barak untuk dibawa ke

“Tahun ini, pemerintah kembali membuka lowongan Calon Praja IPDN TA 2012/2013. Warga masyarakat di kabupaten dan kota yang berminat, bisa mendaftar di kantor bupati/walikota masingmasing,” ucap Sekretaris Daerah Provinsi Sumatera Utara (Sekdaprovsu), Nurdin Lubis dalam pertemuan dengan seluruh Kepala Badan Kepegawaian Daerah (BKD) pemkab/pemko se-Sumut, di Ruang Kenanga, Lantai VIII, Kantor Gubernur Sumut di Medan, Senin (21/5). Dijelaskannya, persyaratan pendaftaran antara lain, tinggi badan untuk pria minimal 160 cm dan wanita minimal 160 cm. Kemudian, berijazah SMA semua jurusan atau Madrasah Aliyah (MA) lulus tahun 2010, 2011

Sambungan Halaman 1 Demokrat,” ungkap Rocki, Senin (21/5). Lebih lanjut dikatakan Rocky, indikasi palsu juga terlihat pada formatur pengurus yang telah ditetapkan. Di mana pada SK tersebut, formatur kepengurusan hanya melibatkan DPC Partai Demokrat Kota Siantar saja. “Sesuai ketentuan AD/ART Partai Demokrat, harusnya formatur terdiri dari unsur DPP, DPD, DPC dan DPAC. Tim formatur inilah yang menentukan kepengurusan Partai Demokrat Kota Siantar,” jelasnya. Indikasi palsu lainnya, mulai berlaku SK. Pada konsederan kelima dari ketetapan, disebutkan, SK itu berlaku sejak tanggal ditetapkan yaitu 10 Desember 2011. Pengakuan Rocky, pada 10 Desember 2011 lalu, dia bersama beberapa pengurus Partai Demokrat Kota Siantar masih mengadakan pertemuan dengan Komisi Pengawas DPP Partai Demokrat di Jakarta terkait kisruh Muscab DPC Partai Demokrat Kota Siantar. “Anehnya lagi, di konsederan SK itu ditetapkan 10 Desember 2011, namun tanda tangan dari yang mengeluarkan SK itu tertanggal 15 Mei 2012 dan tidak jelas siapa yang tanda tangan,” ujarnya lagi. Menyikapi segala permasalahan ini, Rocky telah menghubungi Sukri, Pengurus DPP Partai Demokrat, serta Josep, anggota Dewan Kehormatan Partai Demokrat. Keduanya mengatakan,

tidak ada DPP mengeluarkan SK DPC Partai Demokrat Kota Siantar. “Tidak ada dikeluarkan SK DPC Partai Demokrat Kota Siantar, karena permasalahan DPC Partai Demokrat masih digodok di Dewan Kehormatan,” ujar Rocki menirukan jawaban dari Josep. “Hari Rabu, kami dari DPC bersama pengurus DPAC berencana ke Jakarta untuk bertemu dengan Dewan Kehormatan dan Komisi Pengawas untuk mempertanyakan SK itu. Saya melihat SK ini dikeluarkan lingkaran mafia dan oknum-oknum tertentu yang tidak bertanggung jawab,” jelasnya lagi. Tanpa Sepengetahuan DPD Sekitar pukul 22.00 WIB Minggu (20/5) malam, Rocky Marbun menelpon Ketua DPD Partai Demokrat Sumut HT Milwan. Percakapan keduanya sengaja direkam METRO. Dalam pembicaraan itu, HT Milwan mengatakan, tidak mengetahui keluarnya SK kepengurusan itu. “Iya, ya, belum tahu,” jelas HT Milwan melalui seberang telepon. Selain SK yang belum diketahuinya, pada pembicaraan itu, HT Milwan juga menyatakan setuju jika Rocki Marbun menggelar konferensi pers untuk menyatakan SK itu palsu.” Iya, ya, silahkan,” kata Milwan lagi. Kader PD Diminta Bersatu Pasca keluarnya SK DPP Partai Demokrat (PD) Nomor 21.26/SK/DPP.PD/DPC/V/2012 tertanggal 15 Mei 2012 tentang Susunan Kepengurus

dan 2012 (pelamar umum) dengan nilai minimal 7,00 yang dibuktikan dengan fotocopy ijazah/STTB yang dilegalisir kepala sekolah. “Syarat lainnya, tidak bertato atau bekas tato atau ditindik dan bekas ditindik telinganya atau anggota badan lainnya bagi pelamar pria, kecuali karena ketentuan adat/agama. Berikutnya, tidak menggunakan kacamata/lensa kontak sesuai dengan unsur pemeriksaan kesehatan serta belum menikah/ kawin/hamil/melahirkan dan sanggup tidak menikah selama dalam mengikuti pendidikan yang diketahui orangtua/wali yang disahkan oleh kepala desa/lurah setempat,” beber Nurdin. Syarat lainnya, calon bersedia diberhentikan tanpa menuntut di muka pengadilan melalui PTUN jika melakukan tindakan kriminal,

mengonsumsi maupun menjual belikan narkoba, melakukan perkelahian, pemukulan dan pengeroyokan, serta melakukan tindakan asusila yang berdampak hukum atau tidak yang dinyatakan secara tertulis di atas kertas bermaterai Rp6000. Menyangkut tahapan seleksi di provinsi, Nurdin merincikan, seleksi adminstrasi/verifikasi Kamis (31/5) sampai Senin (4/6). Kemudian tes psikologi 13-16 Juni, kesehatan dan kesemaptaan 9-14 Juli, tes akademik 4 Agustus, serta penentuan akhir oleh Kampus IPDN Jatinangor, Jawa Barat 19-21 September 2012. Sementara itu, Kepala BKD Provsu Suherman, menambahkan pihaknya berharap kabupaten dan kota segera mengirim data warganya, yang akan mendaftar Calon Praja secepatnya .(ari)

KELUHAN ASAM URAT REDA BERKAT MINUM SUSU KAMBING MILKUMA Tanpa kita s a d a r i , semakin tingginya usia seseorang, imunitas tubuh pun menjadi berkurang, apalagi jika memiliki kebiasaan yang kurang sehat, seperti kurang menjaga pola makan, kemungkinan terserang penyakit menjadi besar. Oleh karenanya, mulailah dengan menerapkan kebiasaan-kebiasaan baik, salah satunya adalah minum susu Milkuma 2 gelas sehari. Saat ini, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu kambing milkuma. Berbeda dengan susu sapi, sesungguhnya susu kambing milkuma memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Susu kambing milkuma mengandung Riboflavin, vitamin B yang penting untuk produksi energi. Riboflavin (vitamin B2) memainkan sedikitnya dua peran penting dalam produksi energi tubuh. Kini, hadir Milkuma, minuman serbuk susu kambing yang diproses

secara alami, tanpa pemanis buatan dan bahan pengawet. Bahan dasarnya adalah susu kambing peranakan ettawa segar dan Gula Aren. Jonta Simamora, S.Pd, warga Kel. Sumber Jaya, Kec. Siantar, Martoba, Pematang Siantar, Sumatera Utara kini mengatasi asam urat yang selalu mengganggu aktifitasnya dengan Milkuma, "Sejak tahun 2000 saya menderita asam urat. Kaki kanan jadi bengkak dan jalan terpincang-pincang." Ujar pria berusia 49 tahun tersebut. Lama berobat ke dokter, akhirnya ia tertarik mencoba Milkuma. Ternyata baru 3 bulan minum, kini kondisinya sudah sehat dan dapat menjalani aktifitasnya dengan nyaman, "Milkuma memang pilihan yang tepat. Selain rasanya enak, juga bermanfaat untuk mengatasi asam urat, sekarang kondisi saya sudah membaik." Terang guru tersebut. Memang di wilayah Sumatera Utara sangat rentan dengan cuaca karena perbedaan panas ke hujan datang secara tiba-tiba sehingga suhu udara menjadi pengaruh bagi mereka yang menderita asam urat. Ia pun kini mengajak orang lain untuk merasakan manfaat susu kambing milkuma ini, "Mari kita sehat bersama Milkuma." Ajak ayah 4 orang anak tersebut.

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

dipulangkan ke Indonesia. Disinggung apakah sempat bekerja sebagai PSK, Pelangi mengaku sejak tiba di Malaysia, ia disekap di sebuah kamar. Selama penyekapan, ia diberi makan dan tidak mengalami kekerasan. Hanya saja pada malam selanjutnya itu, korban diminta untuk melayani pria hidung belang. “Kalau tak kabur aku malam itu, ntah sudah jadi apa aku,” kata korban saat membuat pengaduan ke Polres Pelabuhan Belawan. Kasat Reskrim Mapolres Pelabuhan Belawan AKP Hamam, yang dikonfirmasi membenarkan laporan tersebut telah diterima oleh mereka. “Kita sudah terima laporannya, kasusnya akan segera kita lidik,” katanya. (ril)


Milkuma bermanfaat untuk menyembuhkan asam urat, menjaga daya tahan tubuh dan meningkatkan vitalitas. Fluorine yang terdapat dalam susu kambing milkuma bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan tidak menimbulkan dampak diare pada orang yang mengkonsumsinya. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Ditambah dengan kandungan Gula Aren bermutu tinggi sebagai pemanisnya, menjadikan Milkuma sebagai pilihan bijak untuk kesehatan. Untuk memperoleh hasil yang maksimal, terapkan pola hidup sehat seperti disiplin dalam pola makan, dan berolahraga, serta mengkonsumsi air putih paling sedikit 8 gelas/ hari. Dapatkan informasi lengkap tentang Milkuma di Saat ini, Milkuma sudah tersedia di apotek2 juga toko obat terdekat dikota anda, atau hubungi, Sumut : 085314072195 / 06191128785. Kota Pematang Siantar : 085360106966. Depkes dengan no PIRT. 6.09.3328.01.395.

DPS PD kota Siantar, diharapkan kepada seluruh pengurus dan kader untuk bersatu menjalankan visi dan misi partai. Keluarnya SK tersebut merupakan hasil dari proses pelaksanaan musyawarah cabang (Muscab) PD beberapa bulan lalu. Saat itu, seluruh proses muscab telah berjalan sebagai mestinya dan hasilnya adalah resmi, yang dirindaklanjut DPP PD dengan mengeluarkan sebuah SK. “Berarti dengan keluarnya SK ini, segala sesuatu yang telah dan akan dilakukan sudah murni, dan tidak ada lagi tindakan-tinakan yang bisa merobah hasilnya,” kata Koordinator Devisi Advokasi dan Bantuan Hukum Cabang PD Kota Pematangsiantar, Viktor Siallagan SH, Senin (21/ 5) di lobi Hotel Sapadia Jalan Diponegoro. Siallagan mengharapkan, ke depannya seluruh pengurus yang masih duduk dan sudah tidak duduk, dan kader PD di Kota Siantar harus bersatu dan bahu membahu untuk menjalankan visi dan misi partai, dengan tidak melakukan tindakan-tindakan atau kemonetar-komentar yang bisa menggangu kinerja partai. Pengurus dan kader kataya, adalah orang-orag terpilih yang sudah dibekali dengan visi dan misi partai, dan diharapkan menjadi perpanjangan tangan partai untuk mencari simpati rakyat untuk bergabung. Jadi, pengurus, mantan pengurus, kader harus peduli kepada partai, bukan malah memperburuk citra partai.

Soal adanya pihak-pihak yang mengatakan SK Nomor 21.26/SK/DPP.PD/DPC/V/2012 adalah palsu, diharap Viktor, agar pengurus dan kade PD tidak perlu menanggapinya, apalagi mengeluarkan komentar bukan di forum resmi dan alasan mengatakan palsu tidak dibuktikan dengan SK yang asli. “Saya yakin, pengurus DPC PD Siantar tidak akan terpengaruh dengan menanggapi isu-isu yang berusaha merusak citra PD Siantar. Tapi, jika ada bukti dari pernyataanya, mari sama-sama duduk dan dibicaraklan dalam forum yag resmi. Tetapi, kalau sudah meresahkan tatanan partai, hukum bisa berjalan,” tegas Viktor Siallagan. Sementara Wakil Ketua II DPC PD Siantar, Ferry SP Sinamo SH menambahkan apa yang dikatakan Viktor. “Saya imbau kepada pengurus, mantan pengurus di DPC, DPAC, DPran, dan kader PD agar tidak berbuat dan bertindak yag bisa merugikan partai,” ajaknya. Ferry menegaskan, SK Nomor 21.26/SK/ DPP.PD/DPC/V/2012 adalah asli yang ditandatangani Ketum dan Sekjend DPP PD, Anas Urbaningrum dan Edhie Baskoro Yudhoyono MSc yang dibuat di atas kertas berkop, berstempel DPP PD. “Jika ada pengurus, mantan pengurus di DPC, DPAC, DPran, dan kader PD yang mengatakan SK tersebut tidak asli, berarti dia bukan pengurus, mantan pengurus, dan kader PD,” tegas Ferry SP Sinamo SH. (mer/ral)


Pendaftaran Praja IPDN Dibuka Sambungan Halaman 1

sebuah diskotik menjumpai pria hidung belang yang akan dilayaninya. Nah, pada malam itu korban difasilitasi Hp oleh majikannya untuk menelepon tamu yang berada di diskotik. Tak mau terjebak, Pelangi langsung menelepon keluarganya di Pangkalan Susu. Dari komunikasi itu, Taufik langsung menyambungkan hubungan komunikasi Pelangi dengan PBRI di Malaysia dan konsultan yang ada di Malaysia. Malam itu juga Pelangi diperintahkan ke luar dari diskotik dan kabur dengan taksi. Caranya, korban memberikan Hp di tangannya kepada sopir taksi untuk berbicara dengan konsultan. Lalu, sopir taksi itu mengantarkan Pelangi ke tempat yang diminta konsultan. Setelah bertemu konsultan, malam itu juga korban

Sambungan Halaman 1 dipasang dengan penyangga bambu setinggi 5 meter. Petani jeruk yang menggunakan kelambu untuk mengatasi lalat buah Linsah Saragih, mengatakan sejak serangan serangga lalat buah setahun terakhir dirinya sudah berupaya untuk melakukan pecegahan. Upaya yang sudah dilakukan, yakni dengan penyemprotan dan pemasangan perangkap. Nyatanya, kata Linsah, serangga lalat buah masih saja menyerang tanaman jeruknya. “Tidak terhitung lagi biaya yang sudah kami keluarkan untuk mencegah dan memusnahkan serangga lalat buah ini. Terakhir ada yang mengatakan, dengan pemasangan kelambu agar serangga tersebut tidak bisa masuk,” ungkapnya.

Sementara petani lainnya Parulian Purba mengatakan, sejak pemasangan kelambu serangan lalat buah sudah bisa diminimalisir. Bahkan gagal panen yang selama ini menghantui mereka sudah bisa teratasi. “Sejak serangan hama ini puluhan ton jeruk tidak bisa dipanen karena busuk, bahkan hampir 6 bulan seluruh petani tidak ada yang panen, apalagi harga jeruk saat ini cukup berpihak pada petani,” kata Parulian didampingi rekannya Kerman Saragih. Beda dengan Waris Purba. Petani jeruk yang satu ini tidak mengikuti jejak rekannya untuk memasang kelambu. Menurutnya dengan pemasangan kelambu yang biayanya cukup mahal, tidak maksimal mengatasi lalat buah. Dikatakan Waris dengan pemasangan kelambu setinggi 5 meter, lalat buah tetap masih bisa

masuk. Selain itu katanya, dengan serangga lain seperti kupu-kupu maupun lebah yang membantu penyerbukan bunga tanaman jeruk jadi sulit masuk. “Penyerbukan bunga tanaman jeruk selain dibantu angin juga dominan dibantu oleh serangga yang ingin menghisap madu tanaman, dengan menggunakan kelambu ini lebah jadi sulit masuk,” katanya. Menurut Waris, selama ini dia hanya menggunakanlarutangulabatu,petrogenol,lannetmerah dan gincu kuning untuk menjerat lalat buah. Larutan tersebut katanya dioleskan pada plastik bekas kemudian diletakkan dibawah pokok jeruk miliknya. Lalat buah kemudian akan datang dan menempel dan kemudian mati pada plastik tersebut. “Selain murah dan praktis cara seperti ini cukup bermafaat, saat ini tidak ada lagi jeruk yang terkena serangan hama ini,” katanya. (hot)

CHONDRI: BANYAK PRIA DIKENAL YANI Sambungan Halaman 1 Ditemui di pelataran DPRD, Senin (21/5), Chondri Silitonga menyebutkan, sudah lama cerai dengan istrinya. Namun dia enggan merinci alasan perceraian itu. Sementara awal mula perkenalannya dengan Yani, Chondri juga enggan memberitahukan. “Sudah lama kami kenal, bukan aku saja lelaki yang kenal sama dia. Banyak laki-laki lain yang dia kenal,” kata Chondri sambil berjalan. Disinggung awal mula perkenalannya dengan Yuni, politisi muda Partai Pemuda Indo-

nesia (PPI) ini mengaku lupa. Terkait perkataan Yuni yang mengatakan, mereka kenal sejak tahun 2000 lalu, Chondri membantahnya. “Tidak mungkin lah itu kalau tahun 2000. Aku aja saat itu masih kecil. Kalau masalah nama, banyak nama dia itu, bukan Yuni saja, banyak nama lain, “ jelas Chondri seraya masuk ke dalam mobilnya. Dia juga menyebutkan, kedatangan Yani ke DPRD saat sidang paripurna, ada kaitannya dengan unsur politik. Kata Chondri, Yuni kemungkinan disuruh oleh orang lain. Yuni dihubungi melalui telepon selulernya tidak mau memberikan komentar banyak. Yuni

mengatakan akan membuka semuanya suatu saat. “Kalau dia bilang seperti itu, tidak apa-apa. Belum saatnya saya bicara, nanti saya akan bicara, akan saya buka semuanya,” jelasnya melalui telepon seluler. Sementara salah satu kakak ipar korban yang meminta namanya tidak dituliskan menyebutkan, Chondri dan istrinya cerai sekitar November 2011 lalu. Hal itu dikuatkan dengan keputusan Pengadilan Negeri Simalungun. Penyebab perceraian itu, dia sendiri tidak tahu. Terkait status hubungan antara Chondri dengan Yani, sejauh ini dia tidak tahu. (ral)

100 HA TANAH SIHAPORAS STATUS STANPAS Sambungan Halaman 1 Hal itu terungkap saat ratusan warga Nagori Sihaporas mendatangi kantor DPRD Simalungun Pematang Raya, Senin (21/5). Turut hadir saat itu dari legislatif, Suhadi sekretaris komisi I DPRD Simalungun beserta anggotanya, Bernhad Damanik dan Rajisten Sitorus. Sedangkan dari eksekutif, Camat Pematang Sidamanik R Tambun dan Asisten I Oberlin Hutagaol, sedangkan Pangulu Sihaporas, Manotar Ambarita datang terlambat saat pertemuan mau ditutup. Anggota DPRD, Bernhad Damanik mengatakan, supaya lahan yang diduga dirampas pangulu supaya diberhentikan pengerjaannya. Di mana lahan tersebut masih status silang sengketa. Kemudian menurut masyarakat, kalau pangulu juga telah menebangi pohonpohon di atas lahan tersebut. “Penebangan pohon pun perlu dicek izinnya. Kalau menurut camat bilang tidak ada izin penebangannya, supaya dipanggil juga Dinas Kehutanan untuk rapat. Rapat selanjutnya dalam waktu dekat akan dilaksanakan, tetap membahas tentang laporan pengaduan masyarakat Sihaporas.

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta) Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: Syafruddin Yusuf, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus),Aristo Linghten Panjaitan (Tobasa), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina)

Camat Pematang Sidamanik, R Tambun mengatakan, permasalahan masyarakat Sihaporas sudah pernah dibahas di tatanan kecamatan di kantor Camat Sidamanik. Bahwa menurut masyarakat, tanah di sana adalah tanah keturunan (Oppung). Karena sudah menyangkut tanah ulayat. Sambung Tambun, masyarakat diminta supaya membuat silsilah asal usul tanah. Maujana Sihaporas, Jabottor Sijabat mengatakan, selama 20 tahun dia tinggal di Sihaporas, setahunya Manotar Ambarita tidak pernah punya tanah di Sihaporas. Manotar, menurutnya tidak pernah sekali pun mengelola (bertani) di tanah Sihaporas. Judin Ambarita tokoh masyarakat mengaku, dirinya adalah generasi ke 11 keturunan yang tinggal di Sihaporas, dan belum pernah mengetahui Manotar Ambarita memiliki tanah di Sihaporas. Namun saat Manotar jadi pangulu, Manotar banyak mengklaim tanah yang sudah bertahun-tahun dikelola masyarakat jadi miliknya. Bahkan sudah ada tanah masyarakat yang di PIR-kan Manotar ke Toba Pulb Lestari (TPL). “Manotar menyerobot tanah masyarakat secara paksa. Setelah itu dibuatnya Perkebunan

METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Eva Wahyuni, Hermanto Sipayung, Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak,

Inti Rakyat (PIR) ke TPL. Itu dilakukan Manotar tanpa sepengetahuan masyarakat, karena tibatiba saja pihak TPL menanami di lahan masyarakat,” tegasnya. Tokoh adat, Karman Ambarita mengatakan, jangan sampai terjadi pertumpahan darah, namun diambil dulu solusi. Ia dengan tegas mengatakan,Manotartelahmemanipulasisuratsurat tanah masyarakat atas nama dirinya sendiri. Salahsatukorbanlahannyadirampas,Angarali Ambarita mengatakan, Manotar merampas paksa lahannya untuk dibuat kerjasama PIR dengan TPL. Lahan seluas 1 hektare itu sudah ditanami pohon ekaliptus oleh TPL. Rajisten Sitorus anggota DPRD Simalungun mengatakan, sebelum dibuat penyelesaian hukum, masyarakat Sihaporas supaya membuatkan surat tentang historis tanah tersebut. Agar nantinya, DPRD Simalungun bisa mengambil langkah penyelesaiannya, khususnya menyangkut PIR yang dibuat pangulu di atas lahan masyarakat. Terkait keterlibatan oknum polisi bermarga Matondang, Kabag Polres Simalungun AKP H Panggabean mengatakan, polisi tidak pernah membekingi penebangan kayu. (Osi)

Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab PematangsiantarAC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



22 Mei 2012

Siapa Penyuluh Pertanian di Maligas Tongah? KADIS Pertanian Simalungun terhormat, tolong disosialisasikan siapa para petugas penyuluh pertanian di Nagori Maligas Tongah. Petani tidak tau mau sama siapa tukar pikiran tentang pertanian di Nagori Maligas Tongah. 085358620xxx

Gerbang 12 Tertutup Tumpukan Sampah Kadis Kebersihan Siantar terhormat, sampah yang bertumpuk di depan gerbang 12 Pasar Dwikora telah menutup pintu tersebut. Hal itu karena sampah disana jarang diangkut. 085361477xxx

Tertibkan Sarang Walet di Perdagangan

Bupati Simalungun terhormat, tolong ditertibkan Sarang Walet di pusat kota Perdagangan, Kecamatan Bandar, karena suaranya bising dan bisa menimbulkan sarang penyakit. 081276863xxx

Tangkap Bandar Togel Berinisial Aw Kapolres Simalungun, kami masyarakat Serbelawan sudah merasa resah karena peredaran judi togel yang semakin marak dan terbuka lebar. Mulai kalangan remaja sampai orangtua sudah ikut terlibat di dalamnya. Tolong pak supaya ditangkap Bandar judi togel tersebut berinisial Aw berdarah tionghoa, karena Aw yang menjadi toke besar disana. 087868861xxx

Tangkap Perambah Kayu di Raya Kapolres Simalungun terhormat, tolong ditangkap perambah kayu di Kecamatan Raya. Hampir semua kayu berukuran besar di Raya habis ditebangi. Kalau dibiarkan terus, bisa menimbulkan longsor dan banjir. 082368024xxx

SIANTAR-Taman Pasar Horas yang terletak di sekitar gedung II dan gedung III sudah disulap menjadi tempat sampah pedagang. Taman yang seyogianya ditumbuhi tanaman bunga dan pohon rindang, sebaliknya yang terjadi di Taman Pasar Horas yang sedikitpun tidak nampak lagi tanaman pohon rindang ataupun bunga. Sampah yang semakin mengunung itu mengeluarkan bau busuk, sehingga pedagang kios di sekitarnya merasa kebauhan. Hal itu sangat mempengaruhi konsumen dan tidak mau datang belanja ke kios diseputaran tumpukan tersebut. (Osi/Mua)

Perlu Penataan Ulang Taman Pasar Horas yang berada diantara gedung II dan gedung III sudah selayaknya dilakukan penataan ulang. Kalau taman itu ditata ulang, Pasar Horas bisa nampak lebih indah dan udara disekitarnya juga lebih segar.(Mua)

Perlu Kesadaran Masyarakat

Minim Bak Penampungan Sampah

Menjaga kebersihan lingkungan itu sangat dibutuhkan kesadaran masyarakat. Kalau masyarakat sadar kalau kebersihan itu penting, mari sama-sama menjaga kebersihan. (mag-4)


Rosmauli Purba, Wiraswasta


enurut penuturan H. M. Nurdin kedelai memang protein. Karena itu, setiap Nasution, saat ditemui tak jauh dari menyebut kedelai kita pasti ingat protein. Namun, rumahnya akhir Maret 2010 lalu, ususnya ada senyawa esensial yang tak banyak ditemukan agaknya mempunyai kelianan. Kenapa? Setiap pada tanaman lain, yaitu isoflavon. Salah satu habis minum susu, ia selalu mencret. fungsinya adalah untuk melancarkan Akibatnya, ia tak berani minum susu. metabolisme sehingga penyerapan gizi Ternyata, ini berdampak pada diseimbangkannya dengan kesehatannya. “Kemampuan fisik saya pengeluaran. Penyebab badan tidak fit menurun, dalam hal apa pun,” ujar antara lain adalah sistem imun yang pensiunan PNS yang terakhir manjadi rendah, tapi isoflavon berperan dalam pengawas sekolah di Kabupaten meningkatkannya. Kedelai juga Kisaran ini. Atas saran istrinya, mantan merupakan sumber vitamin B1, B6, H. M. Nurdin Nst, 66 thn dan E, mineral magnesium dan seng, kepala sekolah di sejumlah SD di seputar Kisaran ini pun lalu serta asam amino triptofan. Di dalam mengonsumsi MDL-525, kedelai bubuk instan buku Susu Kedelai, Susu Nabati yang Menyehatkan yang sekarang sudah berganti nama dengan New dikatakan, senyawa dan zat-zat itu mampu Mandala 525 itu, sejak tiga tahun silam. “Awalnya menambah tenaga, vitalitas, dan kualitas tidur. New saya tidak suka minum produk itu karena seratnya Mandala 525 laku karena manfaatnya yang nyata. kasar. Tapi, kemudian istri saya menyeduhnya Produk ini bukan obat melainkan minuman dengan pintar. Entah diapakan olehnya, setelah itu kesehatan. Untuk konsultasi, kunjungi atau telepon (021) 70288540 dan produk tersebut enak saja setiap saya minum,” Dist. Medan HP 085263329972, (061) 77063851, ungkap lelaki 66 tahun ini sambil tersenyum. Sub Dist. Deliserdang HP 0813 9690 0147, Sub “Setelah dua bulan meminumnya, badan saya Dist. Binjai HP. 08126387156, Sub Dist. Tebing menjadi segar, saya tidak pernah mencret lagi, dan Tinggi HP 085288142323, Sub Dist. Pematang berat badan saya naik,” ujar ayah tiga anak ini. Siantar HP 08127625076, Dist Kabanjahe HP.0813 “Dan tak lama setelah itu, stamina saya meningkat, 61157 347, Sub Dist. Sidikalang HP. dalam hal apa pun, sehingga saya merasa seperti 081362382639. berusia empat puluhan lagi,” lanjut penduduk Jalan Sisingamangaraja, Kelurahan Sindangsari, Kecamatan Kisaran Barat, Kabupaten Asahan, Provinsi Sumatera Utara, ini diiringi tawa bersama sang istri yang ikut mendampinginya saat wawancara ini berlangsung. Kandungan tertinggi DINKES: PIRT No. 815320503590

"SEKARANG TANGAN DAN KAKI SAYA SUDAH TIDAK CUCUK-CUCUK LAGI" sehat, ia pun dapat menjalani aktifitasnya sehari-hari sebagai PNS dengan nyaman dan tidak segan-segan membagi pengalaman sehatnya dengan orang lain. Asam urat bukanlah nama suatu penyakit, namun ia adalah suatu zat sisa metabolisme zat yang bernama purin yang berasal dari makanan yang kita konsumsi. Keadaan dimana tubuh mengalami kelebihan kadar asam urat disebut hyperuricemia. Pada kondisi normal, kelebihan purin ini akan dikeluarkan melalui urine dan feses. Namun jika purin yang masuk dalam tubuh terlalu banyak, maka ginjal akan kesulitan mengeluarkan zat tersebut sehingga terjadi penumpukan sisa metabolismenya (asam urat). Penumpukan sisa metabolisme zat purin di persendian dapat menyebabkan bengkak dan rasa nyeri. badan terasa linu, nyeri terutama di malam hari atau pagi hari saat b a n g u n t i d u r, s e n d i t e r l i h a t bengkak, kemerahan, panas dan nyeri luar biasa pada malam dan pagi, timbul benjolan-bejolan kecil dari mulai sebesar biji beras sampai kacang hijau di daun telinga bawah (tofus) adalah gejala-gejala asam urat. Habbatussauda yang dikandung dalam Gentong Mas bermanfaat untuk menormalkan metabolisme, termasuk metabolisme purin sebagai pembentuk asam

K Manurung, Pedagang

Bak penampungan sampah di Pasar Horas sangat minim, dan perlu dilakukan penambahan. Akibat sulitnya mendapatkan bak sampah di Pasar Horas, banyak pedagang yang membuang sampah dengan sembarangan termasuk membuang ke Taman Pasar Horas. (Mag-02)

Akibatnya, Ia Merasa Seperti Berusia Empat Puluhan Kembali

K e l u h a n karena asam urat kini sudah tidak l a g i dirasakan D u ng d u ng N u r w a t i A ri to na ng. P a d a h a l, s u d a h 1 tahun, wanita berusia 43 tahun tersebut mengeluhkan kesehatannya terganggu karena asam urat. Kira-kira apa rahasianya? Ketika ditemui di kediamannya di Desa Tanjung Gusta, Kec. Sunggal, Kab. Deli Serdang, Sumatera Utara, ia menjawabnya, "Sudah 1 tahun terakhir ini saya menderita asam urat dan telah lama berobat, namun sakitnya masih datang dan pergi. Ta p i s e t e l a h s a y a m i n u m Gentong Mas selama 6 bulan, sekarang kaki dan tangan saya sudah tidak cucuk-cucuk lagi," tuturnya menceritakan pengalaman baiknya tersebut. Gentong Mas adalah minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda) terbukti memiliki banyak manfaat untuk kesehatan. Dulu, ketika sakitnya kambuh, ibu 5 orang anak ini selalu merasakan tangan dan kakinya s a k i t . Ta p i k i n i , s e m u a n y a berubah. Dengan tubuh yang


„ Taman Pasar Horas tampak kumuh dan menjadi tempat sampah para pedagang.

urat yang dipercaya dapat meningkatkan pengeluaran asam urat dari darah melalui urine. Sementara, Gula Aren selain rasanya manis dan lezat juga bermanfaat untuk menurunkan penyerapan lemak dan perbaikan sistem saraf. Untuk hasil maksimal, control makanan yang dikonsumsi dan banyak minum air putih, sekitar 8 gelas sehari. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/ toko obat terdekat atau hubungi: Medan : 081384777787 Sidikalang: 081384777787 Dolok Sanggul : 081384777787 Gunung tua : 081384777787 Batubara : 081384777787 Tobasa : 0813 8477 7787 Nias : 0813 8477 7787 Tebing Tinggi : 0813 2209 9495 Siantar : 082167538848 Binjai : 0813 9866 6166 Lbk Pakam : 082164659699 Karo : 0821 6753 8828 Langkat : 0812 6321 7797 Kisaran : 0623 7014 362 Tj. Balai : 0812 6349 5563 Labura : 0813 7059 0972 Labuhan batu: 0813 8477 7787 P. Sidimpuan : 0821 6346 6597 Sibolga : 0852 9685 5211 Taput : 081263243034 Madina : 082163466597.

Sumber Penyakit Tumpukan sampah tersebut bisa menjadi sumber penyakit. Maka perlu diantisipasi sebelum ada korban. (Pra)

Johan R Lumbangaol, Warga Jalan Melanthon Siregar

Telepon Penting PMI (Palang Merah Indonesia) 118, 0622-433911 Alamat Jl Sutomo No. 248, Pematangsiantar Kantor Imigrasi Alamat: Jl. Raya Medan Km. 11,5 Pematang Siantar Telepon : (0622)465018, 465014 Samsat Dipendasu Jln Sangnawaluh No 37A

0622 7552345. RS dr Djasamen Saragih Jln Sutomo No 230. 0622 (23824) Hotel Sapadia Jl.Diponegoro No.21 A P.Siantar Telp:0622-435922 Nice Trans Siantar-Medan Medan. <061>4558844 Siantar (0622)7000200 085275144777


22 Mei 2012


Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter.

Reformasi di Indonesia yang sudah berjalan selama 14 tahun belum membuahkan hasil maksimal. Salah satunya yakni pemberantasan korupsi yang masih jalan di tempat serta masih tebang pilih. Selain itu, reformasi birokrasi juga dinilai masih stagnan.

Sikap Kami Menantikan Berkah Wisatawan PULAU Komodo sudah resmi menjadi salah satu New7 Wonders of Nature. Hal ini pantas menjadi kebanggaan seluruh bangsa, setelah sebelumnya terjadi silang sengkarut terkait kredibilitas lembaga New7 Wonder. Apa yang sudah diraih oleh Pulau Komodo tentu saja menjadi pekerjaan rumah tersendiri bagi stakeholder di bidang pariwisata. Kita semua berharap, limpahan berkah akan segera datang ke pulau tersebut, yang diharapkan akan berdampak sistemik ke perbaikan perekonomian masyarakat. Namun, sepertinya limpahan berkah ini tidak bisa begitu saja jatuh dari langit. Pemerintah pusat dan pemerintah daerah bersama stakeholder pariwisata nasional harus bekerja keras untuk mempersiapkan berbagai hal terkait infrastruktur seperti jalan raya, hotel/penginapan, maupun juga masyarakatnya. Tentu kita ingin mengejar ketertinggalan pariwisata di Tanah Air dengan negara tetangga seperti Thailand, Malaysia, maupun Singapura. Negeri-negeri tersebut sebenarnya kalah banyak obyek wisatanya dibandingkan dengan Indonesia, namun jumlah wisatawan yang datang, hampir dua kali lipat lebih banyak. Kenapa? karena memang infrastruktur pariwisata di negeri-negeri itu sudah sangat bagus. Tidak hanya itu, rupanya mereka mampu menawarkan sensasi dan imajinsasi tersendiri ketika berwisata ke negaranya. Wisatawan seperti dihipnotis dengan kesadaran semu bahwa belum keren jika belum melancong ke Thailand, Kuala Lumpur, atau Singapura. Di sinilah peran marketing sangat menentukan. Paketpaket wisata di Tanah Air harus bisa dijual ke wisatawan asing. Mereka harus dibuat tertarik mengunjungi Danau Toba, Bukit Tinggi, Pulau Komodo, Bandung, Yogyakarta, Wakatobi, Raja Ampat, Lombok, Bali, atau daerah lainnya. Paket wisata lintas daerah sepertinya menarik untuk ditawarkan. Sejauh ini aspek marketing dan promosi wisata di Tanah Air memang masih kalah jauh dibandingkan dengan negara tetangga. Bahkan di sejumlah kedutaan besar pun, tidak ada sama sekali sekadar brosur untuk menjual paket wisata di Jamrud Katulistiwa ini. Melihat kondisi riil dunia pariwisata di Tanah Air saat ini, sepertinya kerja keras dari semua komponen sangat diperlukan. Awarding yang sudah diberikan untuk sejumlah kawasan wisata di Tanah Air, seperti Pulau Komodo, tidak seketika menjadi berkah, jika tidak dilakukan langkah progresif dalam pembenahan di dunia pariwisata Tanah Air. Semoga, keindahan alam dan keindahan flora-fauna Indonesia, bisa mendatangkan berkah buat masyarakat kita. (n/*)

Kebangkitan Nasional dan Pendidikan Politik 20 Mei 1908 kita yakini sebagai tonggak sejarah bangsa ini dari keterpurukan yang substansial. Yaitu keterpurukan mental, di mana penjajahan dan penindasan oleh bangsa kita saat itu seolah menjadi takdir yang sudah selayaknya kita terima sebagai bagian dari eksistensi kelahiran setiap anakanak negeri ini. Budi Utomo adalah salah satu simbol dominan atas kesadaran dan semangat yang tiba-tiba bangkit dan mengingatkan khalayak bahwa hakikat dari keberadaan manusia adalah bebas dan merdeka.

Habibi BK Lebihdariseratustahunberlalu,dimanalembar demilembarsejarahpanjangkemerdekaantelahkita bukadankitatulisidengantintapemikiran,sikapdan gaya hidup kita sebagai sebuah bangsa. Naik turun parapenguasayangmenghiasiroda-rodaperjalanan pemerintahan Republik Indonesia, mungkin memberikitasedikithikmahsaatmembacaberbagai fenomena, bahwa kemerdekaan sebagai tujuan utamaatauspiritdarikebangkitannasionalternyata hanya sekedar awal yang masih banyak menuntut darahdankerjakitaanak-anakrevolusi. Telah seabad lebih kebangkitan bangsa ini kita peringati, namun saya rasa nilai-nilai yang terkandung di dalamnya masih tetap krusial untuk dijadikancermindanpemicusemangatperubahan serta kebangkitan kembali bangsa yang seolah terperosokkembalikeduniapenjajahanwajahbaru yaitu neomaterialisme, neokapitalisme dan neoatheisme.Mungkinbanyakdiantarakitayangtidak merasakannya selain hidup menjadi semakin tak terarah, ketidakpuasan akan materi yang tak kunjung usai serta agama yang hanya menjadi simbol tanpa panghayatan. Tidak pula kita menyadari,entahkapanpastinyaterjadi,tiba-tibagaya hidupanak-anakkitatelahbanyakberubahmenjadi samasekalitidakkitakenal,jauhdarinilai-nilaiyang tiap hari diajarkan (oleh mulut-mulut kita para orang tua, tapi mungkin belum oleh hati). Apa yang sebenarnya terjadi pada tahun 1908 sehingga kita menyebutnya sebagai hari kebangkitan nasional? Saya coba untuk membuka lembar demi lembar catatan sejarah, mempelajari dan mengambil pemahaman. Saya melihat bahwa pada saat itu terjadi sebuah titik balik peradaban yang sebenarnya dimulai dari dunia eropa sendiri sebagai penjajah. Kacamata peradaban yang seolah awalnya melihat manusia sebagai makhluk yang berbeda-beda karena ras, agama, dan negara tiba-tiba berubah, semua adalah manusia yang satu! Perubahan paradigma ini berhembus ke seluruh penjuru dunia, terutama melaluijalur-jalurpendidikandanintelektualisme. Di Indonesia hal itu terjadi dengan sangat jelas di Stovia yang menjadi pusat pendidikan calon dokter dan juga intelektual.

Politik dan Pendidikan Selamainikitakebanyakanmenganggapbahwa politik dan pendidikan adalah dua hal dengan kutub yang berbeda. Politik berorientasi kepentingan sedangkan pendidikan justru mengajarkan untuk merangkul semua kepentingan sehingga menjadi seperti tanpa kepentingan. Oleh karenanya kedua hal tersebut senantiasa dipisahkan.Mungkinsebagianbesardarikitamerasa takut jika politik dimasukkan dan â&#x20AC;?mengotoriâ&#x20AC;? dunia pendidikan. Atau bahkan politik menjadikan pendidikan sebagai kepanjangan tangannya untuk memperluas kekuasaan. Secara salah banyak diantara kita menafsirkan konsep Paulo Freiremengenaipendidikanyangmelanggengkan ketertindasan (pedagogy of the oppressed) akan terjadi pada dunia pendidikan yang dicampuradukkan dengan dunia politik. Pendidikan merupakan wadah dimana pembentukan kultur generasi baru terjadi. Pendidikan adalahrahimdarisetiapkarakteryangakandimiliki oleh anak-anak kita di masa depan. Dengan demikian secara sederhana kita dapat membangun sebuah asumsi bahwa perbaikan pada diri masyarakat secara ideal akan terjadi jika kita benar-benar memperhatikan pendidikan, termasuk dalam bidangpolitik. Niat baik untuk membersihkan dunia pendidikan dari â&#x20AC;&#x2122;kotornyaâ&#x20AC;&#x2122; politik menurut saya justru lebih memperbesar peluang untuk membuat pihak-pihak tertentu memanfaatkan pendidikan demi kepentingan politiknya. Kita ambil contoh sederhana, pada era orde baru Pancasila sebagai falsafah negara diajarkan melalui penafsiran tunggal dengan alasan menghilangkan bias-bias politik seperti halnya yang terjadi pada orde lama. Namun justru itulah yang menjadi bumerang, karena penafsiran tunggal yang diajarkan adalah penafsiran yang dibuat oleh penguasa. Pendidikan Politik Dalam bukunya yang sangat populer, Democracy and Education, John Dewey menuliskan: As formal teaching and training grow in extent, there is the danger of creating an undesirable split between the experience gained in more direct asso-

ciations and what is acquired in school. Dalam statemen tersebut Dewey menjelaskan bahwa salah satu kesalahan dari pengajaran yang terjadidisekolahadalahketikamaterisekolahtidak mengarahkanparasiswauntukhidupdidunianyata. Dan saya rasa memang demikian, keberhasilan pendidikanadalahketikaparapesertadidikbenarbenarbelajaruntukhidupnyadanbahkanberpikir menyelesaikan permasalahan yang ada di sekelilingnya. Itulah mengapa kebangkitan nasional diawali dari dunia pendidikan yang memang memilikipotensikekuatanpengubahmasyarakatyang sangat besar. Pendidikan politik bukan berarti mengarahkananak-anakpadakepentingan-kepentingan politik tertentu. Pendidikan ini justru mengenalkan anak pada nilai-nilai penting politik dimulaidarikehidupansekolah. Alber Bandura menyatakan bahwa pendidikan utamanya terjadi melalui komunikasi dan keteladanan (modelling). Denikian pula dengan pendidikan politik, bagi saya hal tersebut dapat diajarkan tanpa harus membuat mata pelajaran baru melainkan dengan dua langkah awal yaitu: 1. Membangun atmosfer komunikatif di sekolah. Demokrasi pada dasarnya adalah karakter yang mendasari setiap relasi dalam kelompok sosial dan intinya adalah komunikasi yang seimbang. Kebebasan berpendapat dalam undangundang yang menjadi jantung dari kehidupan berdemokrasi kita seharusnya dibentuk pada diri setiap insan di republik ini sejak dini di sekolah. 2. Keteladanan dalam kehidupan berorganisasi. Sekolah merupakan sistem organisasi yang meliputi hubungan antara kepala sekolah, pegawai, guru hingga para siswa. Meskipun berbagai teori mengenai kehidupan berorganisasi dan bermasyarakat telah disampaikan oleh para guru, namun tanpa contoh langsung walaupun dalam sekup kecil, maka teori-teori akan menguap dan hanya sekedar membekas di catatan raport para siswa. Bagaimana seharusnya pemimpin bersikap, bagaimana kecintaan terhadap negara diwujudkan, semua itu harus juga dicontohkan. Kesadaran politik dari suatu sistem termasuk negara diawali dari kesadaran setiap individu di dalamnya.Olehkarenaituperubahansebagaihasil dari proses belajar seharusnya terjadi pada setiap individu yang pada akhirnya akan menggerakkan perubahan sosial yang jauh lebih besar. Bangkitnyakesadaranpadasegelintirorangadalahawal dari kebangkitan nasional. Itulah makna dari 20 Mei bagi saya.(n/*) Penulis adalah Dosen FKIP Universitas Wiraraja Sumenep

Ketua Umum PBNU KH Said Aqil Siroj, Senin (21/5)

Setiap inspektur jenderal (irjen) kementerian dan lembaga (K/L) harus berperan aktif mengawasi penyelewenganpenyelewengan yang dilakukan PNS. Pengawasan tersebut tidak hanya meliputi penyelewengan biaya perjalan dinas tetapi semua pos yang rawan penyelewengan.

Menteri Keuangan Agus Martowardojo, Senin (21/5)

KPK merupakan satusatunya hasil reformasi yang berhasil menunjukkan kinerja sungguh-sungguh. Sementara lembaga lain yang dibentuk setelah reformasi tidak menunjukkan prestasi sebagus KPK.

Ketua Komisi III DPR Benny K Harman, Senin (21/5)


22 Mei 2012


IstanaBantahDahlanIskanMundur JAKARTA- Beredar kabar di situs jejaring sosial soal rencana mundurnya Menteri BUMN Dahlan Iskan. Sontak saja kabar ini dibantah. Dahlan tetap bertugas seperti biasa hingga saat ini.

Ikut Demo, Anwar Ibrahim Akan Diadili KUALA LUMPUR — Pemimpin oposisi Malaysia, Anwar Ibrahim, dan seorang rekannya dipanggil pengadilan untuk menghadapi tuntutan atas partisipasinya dalam unjuk rasa ilegal, kata partainya, Senin (21/52). Anwar dan orang kedua di Partai Keadilan Rakyat, Azmin Ali, menerima panggilan untuk hadir di pengadilan pada Selasa (22/5) dengan tuduhan melanggar Undang-Undang Perkumpulan Damai. Anwar dan Azmin bergabung dengan puluhan ribu demonstran di Kuala Lumpur beberapa waktu lalu. Para pengunjuk rasa itu menuntut transparansi lebih pada pemilu yang kemungkinan bakal digelar beberapa bulan lagi. Surat panggilan pengadilan itu mengindikasikan, mereka akan didakwa atas kejahatan dengan ancaman hukuman denda maksimal sebesar 10.000 ringgit. Jika terbukti bersalah, keduanya bisa kehilangan kursi di parlemen. Belum jelas apakah mereka juga melanggar pasal yang membuat mereka terancam dihukum penjara. Demonstrasi besar itu digelar pada bulan lalu. Mereka menuntut pemerintahan koalisi Perdana Menteri Najib Razak memeriksa dugaan kebijakan pemilu yang bias hingga memungkinkan koalisi berkuasa terus berkuasa sejak 1957. (kmc/int)

Krisis Pangan Kian Parah

Puluhan Warga Korut Tewas PYONGYANG- Krisis pangan di Korea Utara (Korut) dianggap kian memburuk karena telah menelan korban jiwa. Puluhan warga di wilayah barat daya Korut yang menjadi wilayah produksi beras, dilaporkan tewas mengenaskan akibat kelaparan. ”Karena kekurangan pangan yang semakin memburuk tahun ini, ada laporan bahwa sejumlah orang tewas karena kelaparan di Provinsi Hwanghae Utara dan Selatan,” demikian seperti diberitakan oleh surat kabar Korea Selatan (Korsel), Daily NK, dan dilansir oleh AFP, Senin (21/5). Menurut surat kabar tersebut, sedikitnya 6 orang, beberapa di antaranya anak-anak, tewas akibat kelaparan di sebuah desa di wilayah Shingye, baru-baru ini. Insiden ini terjadi setelah otoritas setempat membuat kebijakan untuk hanya mensuplai 1-2 kg jagung bagi setiap keluarga. Sedangkan menurut sumber lain yang dikutip Daily NK, dilaporkan sedikitnya 10 orang tewas akibat kelaparan di wilayah pesisir pantai Haeju pada April lalu. Insiden tersebut merupakan dampak dari kekurangan pangan di musim dingin yang terjadi di Korut. Organisasi kemanusiaan yang bermarkas di Seoul, Korsel, Good Friends, menyatakan, kelaparan terus memakan korban di wilayah Hwanghae Selatan. Kondisi paling parah terjadi di Pabrik Besi Hwanghae. Para pekerjanya tewas akibat suplai makanan dihentikan. Menurut Daily NK, produksi beras di wilayah Hwanghae Utara dan Selatan mengalami penurunan drastis pada tahun lalu akibat banjir. Kondisiinisemakinparahkarenaproduksiberaspada musim gugur sengaja didistribusikan kepada militerKorutdanwargaPyongyangsaja.(dtc/int)

„ Juru bicara Presiden Julian Aldrin Pasha memberikan keterangan pers terkait isu mundurnya Dahlan Iskan.

”Pak Dahlan Iskan selaku Menteri BUMN, menjalankan tugas beliau. Ya tentu dalam kementerian BUMN dengan sangat baik sampai sekarang. Saya pastikan itu rumor yang tidak ada dasarnya,” tegas Juru Bicara Kepresidenan Julian Aldrin Pasha, di Bina Graha, Kompleks Istana Kepresidenan, Jakarta, Senin (21/5). Menurut Julian, isu yang beredar di twitter itu sebaiknya tidak perlu ditanggapi berlebihan. Bila ada pemanggilan seorang menteri oleh presiden adalah hal biasa, bukan melulu harus dikaitkan dengan isu reshuffle. ”Soal menteri dipanggil presiden, itu hal yang biasa. Kapan pun, hari libur, di Cikeas, di Istana,” tegasnya. Saat ditanya soal komentar Presidenn terkait pergantian direksi di lingkungan Pertamina, Julian memastikan itu memang kewenangan Dahlan. Karena itu, dia meminta agar masalah ini tak perlu lagi dipersoalkan. Isu ini sebelumnya dicuatkan oleh akun twitter anonim : @ratu_adil yang menggelontorkan isu perseteruan Dahlan Iskan dengan koleganya Jero Wacik, kasusnya berpusar pada soal Petral. Mundurnya Dahlan Iskan menurut twitter anonim itu berlangsung pada selasa malam (16/5/12) Dahlan Iskan ke Istana menghadap SBY bersama Jero Wacik mempermasalahkan persoalan pengangkatan jajaran Direksi Pertamina yang dinilai melangkahi kewenangan Dahlan Iskan sebagai Menteri BUMN, di mana untuk BUMN sebesar Pertamina mustinya Presiden ikut ‘cawecawe’. (kmc/int)

Pemeriksaan Cucu Soeharto Ditunda Hingga 23 Mei JAKARTA- Pemeriksaan terhadap Ari Haryo Wibowo Hardjojudanto alias Ari Sigit kembali tertunda lantaran cucu mantan presiden Soeharto itu mangkir dari pemeriksaan penyidik Polda Metro Jaya. Pemeriksaan baru akan dilakukan pada Rabu 23 Mei 2012. Kepala Bidang Humas Polda Metro Jaya, Kombes Rikwanto, mengatakan pemeriksaan Ari Sigit seharusnya dilakukan pada hari ini pukul 10.00 WIB. Namun, hingga sore tadi Ari Sigit tidak hadir. ”Lawyernya kirim surat ke penyidik untuk (pemeriksaan) ditunda pada Rabu,” kata Rikwanto kepada wartawan di Mapolda Metro Jaya,

Jakarta, Senin (21/5). Rikwanto mengatakan jadwal pemeriksaan Ari Sigit pada Rabu nanti merupakan bagian dari pemanggilan kedua. Penyidik akan kembali memanggil Ari Sigit untuk diperiksa pada Rabu seperti yang dijanjikan pengacaranya. ”Kalau tidak datang lagi, akan dijemput sebagai tersangka,” katanya. Lebih jauh Rikwanto mengatakan pengacara Ari Sigit tidak memaparkan secara jelas perkara ketidakhadiran kliennya itu. ”Sudah ada (konfirmasi ketidak hadiran), tapi alasannya tidak jelas,” ujarnya. Sebelumnya diberitakan, Ari Sigit dilaporkan oleh rekan bisnisnya Su-

trisno yang merupakan direksi di PT Rido Adi Sentosa atas dugaan penipuan dan penggelapan dana Rp 2,5 miliar dalam kerjasama dengan PT Dinamika Daya Andalan. Uang tersebut merupakan dana proyek pengerjaan pengerukan tanah milik PT Krakatau Wajatama di Cilegon, Banten. Ari Sigit merupakan komisaris di PT Dinamika Daya Andalan. Sedangkan PT Rido Adi Sentosa merupakan sub kontraktor PT Krakatau Wajatama. Ari Sigit yang sudah diperiksa pada Januari 2012 lalu membantah tuduhan penggelapan dan penipuan dana Rp 2,5 miliar itu. Menurutnya, Direktur Utama PT Dinamika Daya Andalan yang bertanggung jawab dalam kasus itu. (dtc/int)

Pemerintah Haramkan Biaya Kuliah PTAIN Naik JAKARTA - Direktur Jenderal Pendidikan Islam Kementerian Agama, Nur Syam telah memberikan wantiwanti bagi rektor Perguruan Tinggan Agama Islam Negeri (PTAIN) se Indonesia. Agar tidak menaikan biaya kuliah bagi mahasiswa pada tahun ajaran baru. Nur Syam menegaskan kenaikan biaya kuliah itu memiliki landasan hukumnya. Tidak bisa hanya keputusan rektor semata. Karena biaya kuliah di perguruan tinggi negeri berpegang pada sejumlah peraturan. “Saya ingatkan tidak boleh ada biaya SPP kuliah yang naik. Tidak dibenarkan kalau ada kenaikan biaya SPP,” tutur Nur Syam disela kesibukannya di Jakarta, Senin (21/5). Dia mengakui dalam aturannya biaya SPP kuliah disetiap perguruang tinggi bisa berbeda-beda. Tetapi tetap dalam koridor peraturan yang berlaku. Terutama pada biaya SPP untuk beberapa fakultas tertentu. Disebutkan Nur Syam tarif SPP saat ini bervariasi, mulai dari Rp. 600 ribu sampai Rp. 1,2 juta per semester. Perbedaan tersebut memang masih dibenarkan, sesuai dengan surat edaran Presiden.

„ Nur Syam “Itulah kenapa SPP tak boleh naik, karena ada surat edaran Presiden. Jadi tidak boleh rektor PTAIN menaikan SPP,” tuturnya. Menurutnya pengaturan kenaikan itu hanya membahas soal SPP saja. Artinya rektor bisa mencari celah untuk mendapatkan sumber pendanaan lainnya. Melalui pungutan yang tidak melwan aturan.

Dia menambahkan sampai saat ini belum ada laporan SPP PTAIN yang naik. Tetapi bisa saja rektor melakukan tindakna yang tak terpuji itu. “Ya..kalau ada bakal diperingatkan. Kan memang tidak boleh naik,” jelasnya. Ditanya soal jumlah calon mahasiswa baru yang berminat masuk PTAIN, Nur Syam memastikan masih cukup tinggi. Tak dipungkiri PTAIN itu menjadi tujuan melanjutkan study bagi sejumlah pelajar. Grafik peminatnya pun terus melonjak. Dia berharap terus bertambhnya minat calon mahasiswa baru itu dapat memberikan pengaruh besar bagi PTAIN. Setidaknya seluruh PTAIN berusaha meningkatkan kualitas pengajaran dan pendidikannya. Agar lulusan PTAIN dapat memiliki peran besar bagi masyarakat setelah lulus. Nur Syam mengatakan, saat ini jumlah PTAIN seluruh Indonesia mencapai 52 unit. Tahun ini ada penambahan satu lagi yaitu STAIN Gajah Putih Takengon, di Kabupaten Aceh Tengah. Dari seluruh kampus tadi, kuota mahasiswa baru tahun ini sekitar 12 ribuan. (rko/jpnn)

„ Priyo Budi Santoso

Priyo: Pelarangan Lady Gaga Jadi Kampanye Buruk JAKARTA- Wakil Ketua Dewan Perwakilan Rakyat, Priyo Budi Santoso, menilai sikap Polda Metro Jaya yang melarang konser Lady Gaga dapat menjadi kampanye buruk, khususnya di mata internasional. Menurut Priyo, hal itu bertolak belakang dengan citra Indonesia sebagai negara demokrasi terbesar ketiga di dunia dengan toleransi yang tinggi. “Saya agak terperanjat ketika masalah rencana konser Lady Gaga ini mendapatkan pemberitaan yang luas dari media hingga luar negeri. Ini kampanye yang tidak baik terhadap keberadaan toleransi yang selama ini kita andalkan. Ini akan jadi kampanye yang buruk,” kata Priyo ketika menerima pengaduan dari promotor yang mendatangkan Lady Gaga, Big Daddy Entertainment, di ruang kerjanya di kompleks Gedung MPR/ DPR Senayan, Jakarta, Senin (21/5/2012) malam. Priyo mengaku sulit menerima alasan pelarangan konser Lady Gaga. Menurut dia, tidak ada alasan bagi kepolisian untuk melarang konser itu. Apalagi, kata dia, pihak promotor telah memastikan bahwa Lady Gaga akan tampil dengan mematuhi norma, budaya, dan aturan yang berlaku di Indonesia. Polda Metro Jaya tak memberi rekomendasi konser tersebut dengan alasan banyak pihak yang memberikan masukan untuk melarang konser itu karena penampilan Lady Gaga dinilai tidak sesuai dengan budaya dan moral bangsa Indonesia. Polisi menyebut penampilan Lady Gaga dalam konser-konser sebelumnya memperlihatkan aurat dan gerakan-gerakan erotis yang cenderung menampilkan pornoaksi. Hal itu bertentangan dengan moral dan budaya bangsa Indonesia. “Jika konser itu masih pertahankan adat ketimuran, norma, agama, saya kira tidak ada yang perlu dikhawatirkan, kecuali Anda (promotor) undang Lady Gaga untuk telanjang bulat. Saya kira itu tidak mungkin. Jadi tidak ada alasan yang sahih bagi polisi untuk menolak itu,” kata Priyo. Meski demikian, politikus Partai Golkar itu meminta pihak promotor menerima kritik dari berbagai pihak yang menentang konser tersebut. Di antara kritikan itu, lanjutnya, pasti ada sisi positif untuk perbaikan. “Karena itu, menurut hemat saya, Kapolri kita persilakan berindak arif. Jangan terkesan bisa menimbulkan pertanyaan besar. Itu tidak baik bagi institusi Polri, tidak baik juga bagi kemajemukan,” ujar Priyo. (kmc/int)


22 Mei 2012

Honda PCX 150 Segera Meluncur

„ Honda PCX 150 PELAN tapi pasti, PT Astra Honda Motor terus memperkuat segmen skutiknya dengan produk baru. Kali ini adalah “flagship” skutik, PCX 150 yang akan diluncurkan pada awal semester dua tahun ini. Dengan PCX 150, kami akan memberikan produk dengan nilai semakin baik kepada konsumen,” ujar sumber AHM, Senin (21/5). Persiapan peluncuran PCX 150 tercium dari pendaftaran skutik tersebut ke Kementerian Perindustrian. Saat ini kode HONDA WW150D(IN) A/T masih dalam proses atau tengah diuji coba produknya. Dari kode ini terlihat bahwa Honda motor tetap mengimpor secara utuh (CBU) skutik kasta tertingginya ini dari Thailand. Untuk penampilan, PCX 150 hampir tak berrbeda dengan PCX 125 yang ada dipasar saat ini. Perbedaan utama hanya pada mesin SOHC 152,9 cc dengan teknologi Enhanced Smart Power (eSP). Teknologi tersebut sebenarnya sudah digunakan pada Vario Techno 125 PGM-FI yang mengoptimalkan pendinginan komponen dan mengurangi gesekan agar tenaga bertambah namun maksimal namun tetap irit. Untuk pemindah tenaga, CVT V-Matic, kinerjanya terus ditingkatkan. Fitur lainnya adalah Anti-Theft Alarm System, combi brake system hidrolik, ACG starter dan idling stop system (ISS). Sayang, untuk bandrol, sumber Honda masih tutup mulut. “Kalau harga masih belum jelas. Nanti saja kalau sudah pasti,” tutup sumber itu. (int/mer)

“iPad Mini” Rp2 Jutaan Segera Diproduksi? PERANGKAT tablet Apple dengan ukuran layar yang lebih kecil atau sering disebut dengan “iPad Mini” cukup ramai digosipkan dalam beberapa bulan terakhir. Baru-baru ini terdengar kabar bahwa komponenkomponen yang diperlukan untuk membuat tablet yang menurut informasi akan memiliki ukuran layar 7,85 inci ini sedang dipersiapkan. Situs teknologi Ubergizmo melaporkan bahwa beberapa pemasok komponen sudah memasuki persiapan tahap awal produksi. LG dan AU Electronics telah menerima sertifikasi untuk membuat layar yang akan digunakan pada “iPad Mini”. Kabar lain menyebutkan bahwa TPK Holding akan membuat 4 juta modul “backlight” untuk perangkat ini. Dua juta modul “backlight” lainnya akan dibuat oleh Chemi Innolux, sementara layar sentuh dengan teknologi thin-film akan dibuat oleh

Nissha Printing. Berdasarkan rumorrumor yang beredar sebelumnya, “iPad Mini” adalah versi lebih kecil dari perangkat iPad yang sudah diproduksi Apple sebanyak tiga generasi. Rancang betuknya dikabarkan tidak akan mengalami perubahan. Spesifikasi final dari perangkat ini masih simpang siur. Beberapa sumber menyebutkan bahwa “iPad Mini” akan dilengkapi dengan layar Retina Display, seperti pada iPhone 4/4S dan iPad generasi ketiga. Spesifikasi lain termasuk memori internal sebesar 8 GB. (int/mer)

Mitsubishi i-MiEV Evolution untuk Hill Climb DIVISI motorsport Mitsubishi kini punya mainan baru yang disiapkan bertarung di Pike’s Peak International Hill Climb, Colorado, Amerika Serikat, Juli mendatang, yaitu mobil listrik yang diberi nama i-MiEV Evolution. Sebelumnya Nissan melakukan hal yang sama pada mobil listriknya, Leaf pada tahun lalu. Evolution menggunakan motor listrik dan baterai yang sama untuk i-MiEV yang diproduksi secara massal. Hanya tenaga mesin yang dihasilkan berbeda. Jika i-MiEV standar menggunakan motor listrik tunggal 66 PS,

Evolution dilengkapi tiga motor (1 di depan, 2 di belakang) - masing-masing 107 PS - dengan total tenaga 321 PS. Sedangkan kapasitas baterai dua kali lipat standar, dari16 menjadi 35 kWh. Sistem gerak juga berubah. Bila sebelumnya hanya 2 roda belakang,

kini semua roda (all-wheel drive). Sistem yang digunakan dicontek dari Lancer yang terbukti kehandalannya. Dengan demikian, diharapkan bisa membantu Hiroshi Masuoka (juara Rally Dakar 2002-2003) sebagai joki untuk menaklukan medan reli tersebut.

Sedangkan ban, dipilihkan profil 245/40 R18 (i-MiEV : 145/65 R15). Desain juga berubah untuk memperoleh aerodinamika dan sosoknya yang lebih besar/. Mobil listrik untuk reli ini menggunakan rangka dan sasis pipa bulat dengan panjang 4.341 mm, lebar 1.900 mm dan lebar 1.339 mm. Untuk mewujudkan niatnya ini, Mitsubishi menggandeng 20 vendor untuk membangun proyek ini. Beberapa di antaranya yang sudah terkenal adalah GS Yuasa, HKS, Enkei dan Dunlop. (int/ mer)

„ Mitsubishi i-MiEV Evolution


22 Mei 2012

ABG Adukan Janda Sambungan Halaman 8 dikenalnya belum lama ini, Selasa (15/5). Waktu itu mereka berdua berada di depan Studio Miles, Jalan Jendral Sudirman Kota Siantar. “Tiba-tiba dia (Putri) datang dan mengamuk. Pipi kananku ini dicakarnya,”katakorbandikantorpolisi. Atas peristiwa itu, Vira langsung menujuRSUDdrDjasamenSaragih guna membuat Visum. Bahkan sebenarnya Vira sudah menunjukkan niatnya yang mau berdamai.

Syaratnya,PutriharusmembayarbiayaperobatanRp2juta.Tetapisetelah ditunggu selama satu minggu, putri seolah tak merasa bersalah dan akhirnyadiadukankekantorpolisi. Diduga kejadian berawal dari rasa cemburu Putri terhadap Vira yang dekat dengan Akbar. Sementara selama ini diketahui bahwa Akbar tinggal satu rumah dengan Putri di kawasan Jalan Surya. Pantauan METRO, Laporan pengaduan Vita akhirnya diterima personel SPKT Polres Pematangsiantar. (mag-4/hez)

Mobil Toke Getah Terguling

Warga Simpang Koperasi..

Sambungan Halaman 8 juga bekerja sebagai supir mopen SKB mendatangi Polresta Pematangsiantar, Senin (21/5) sekira pukul 15.00 WIB. Informasi dihimpun, saat itu korban yang mengendarai mopennya, melaju dari arah Jalan Medan menujuKotaSiantar.Saatyangbersamaan, tepatnya di depan Markas Brimob, mopen Sinar Siantar yang dikemudikan tersangka menyalip kendaraanrodaempatnya. Begitu posisi mobil berdekatan, tersangka yang identitasnya masih diselidiki ini, turun dan mendekati Ihsan. Tanpa basa basi, ia memukuli wajah korban. Karena tak mau menjadi bulanbulannan,akhirnyaIhsanmemilih melanjutkan laju mobilnya. Akan tetapi, tersangka tetap mengejar dari belakang dan kembali memberhentikan Ihsan di dekat SPBU yang berada di Jalan Ahmad Yani.

Di sana Ihsan kembali dipukuli. Warga setempat yang melihat keributan, mendekati keduanya. Beberapa warga dan pengendara yang sedang melintas, melerai aksi tersebut. Tepat saat korban melaju di Taman Bunga Jalan Merdeka, Ihsan kembali didatangi tersangka. Namun saat itu pria itu bukan berniat memukul. Sebaliknya ia datang meminta maaf. “Ada empat kali kepalaku dipukulnya bang, padahal aku tidak kenal sama dia. Hanya saja nomor pintu mopennya 024,” ucap Ihsan didampingi tiga temannya. Bahkandikatakannya,motifdari kejadian hingga kini tidak ia ketahui. Namun yang pasti, perbuatan itu tak bisa dimaafkan begitu saja. “Aku tidak senang, mandornya pun seolah-olah tidak mau bertanggung jawab. Makanya kuadukan ke sini,” tambah korban di ruang SPKT. (pra/hez)

Aksi Copet Merajalela Sambungan Halaman 8 uang Rp10 ribu milik korban ditemukan, namun kejadian sempat membuat pengunjung lainnya resah. Korban adalah Ruminjan br Sianturi(60)yangsedangberbelanja bersama temannya br Saragih Garingging. Sore kemarin, korban sudahselesaibelanja.Namunsebelum pulang, keduanya berjalan melintasidaerahpadatpengunjung. Tanpa disadari, langkah wanita tua initernyatasudahdikuntitpencopet. Taklamaberjalan,tasyangdisandang korban di samping, dirogoh. Saat itulahsebuahdompetberhasildiambilpencopet. Namun aksi pencopet yang diperkirakan masih berusia muda itu terlihat seorang pedagang kain. Tak membiarkan aksi kejahatan di sekitarnya,iaberteriak.Teriakanitulangsung membuat pencopet berlari kencang. Tanpa disadarinya juga, dompet hasil copet terjatuh tak jauh dari lokasi. Karena panik, korban langsungberjalanmenujulokasidan menemukankembalidompetnya. Warga dan pedagang yang mengejar tersangka tadi hampir kehilangan jejak. Namun di keramaian, mereka melihat pemuda mengenakan jaket yang mirip dengan pencopet tadi berlari. Pemuda yang terakhir diketahui berinisial MS itu akhirnya diamankan. Saat diinte-

rogasi, ia mengaku sebagai pelajar kelas 3 di STM Melati. Karena kecurigaan warga yang kuat, MS akhirnya diamankan dan diboyong kePosPolisiPasarHoras. “UangdidompetkuitucumaRp10 ribu.Itupununtukongkospulangke Serapuh,”katakorbanlemas. SementarabrSaragihmenerangkan, kedatangan mereka ke Pasar Horas adalah untuk berbelanja keperluan anaknya yang akan berangkatkeBatam. “Besok(hariini)anakkuberangkat keBatam.Diamaubekerjadiperusahaan swasta di sana. Tapi entah kenapa kawanku ini kecopetan,” katanya. Sedangkan MS yang sempat diinterogasipolisi,membantahsebagai pelaku copet. Bahkan pemuda ini mengaku sangat jarang mengunjungiPasarHoras. Denganwajahlebam,MSmengaku sempat menjadi korban pemukulan warga. “Ngapain pula aku mencopetbang.Memangakupakai jaket, tapi bukan berarti aku pencopetnya,”ucapnyapriayangmengaku wargaPerdaganganini. Taklamakemudian,beberapapersonelPolrestaPematangsiantardatang danmembawanyabersamakorban. KapolsekSiantarBaratAKPIndra Sakti menjelaskan, Hingga kini MS masih menjalani pemeriksaan di kantornya.(pra/hez)

Sambungan Halaman 8 Menurut teman korban Ahmad Nasir, sebelum peristiwa terjadi, Awi yang menetap di Huta Kedai Kopi Kelurahan Serbelawan, Simalungun ini, baru saja pulang dari Studio Karaoke Miles di Jalan Jendral Sudirman. “Tadi kami di Miles bersama dengan dia (Awi) dan temannya Gonggom. Karena sudah malam, Awi permisi duluan karena mau pulang ke Serbelawan,” sebutnya. Saat ditanyakan apakah korban sempat minum alkohol, warga Jalan Medan kilometer 4,5 ini mengaku bahwa Awi tidak

mengkonsumsialkohol.Awihanya ikut-ikutan nongkrong bersama mereka. Ditambahkan pemilik bengkel Zul tersebut, kerusakan mobil korbansudahmencapai90persen. Saatinimobilnyadiamankanpolisi ke Mapolsek Siantar Marihat. Sebagai teman, mereka berharap asuransi akan mengganti kerusakan mobil, atau memberikan uang maupun mobil baru. Usai kejadian, Awi yang diamankankemobilToyotaKijang BK1960QUolehteman-temannya, tampak trauma. Namun begitu ia dan temannya mengaku tidak mengalami luka-luka.

“Tadi aku menggelakkan kreta tanpa lampu yang datang berlawanan arah. Akibatnya mobil menghantam trotoar dan manabrak pohon di pinggir jalan sebelum akhirnya terguling. Tapi aku tak tahu berapa kali mobil terguling,” katanya kepada temantemannya di lokasi kejadian. Menurut seorang warga yang ditemui di lokasi, awalnya korban membawa mobil dengan kecepatan tinggi dari arah Jalan Hos Cokroaminoto menuju makam pahlawan. Sementara di lokasi, diramaikan pengendara sepdamotor yang melintas. “Tadi mobil ini mengelakkan sepedamotor dan akhirnya menabrak trotoar. Setelah itu langsung terbalik,” kata pria muda yang tak menyebutkan namanya ini. Bahkanditambahkannya,suara benturan dan gesekan mobil, terdengar sampai ke Jalan Ahmad Yani Kota Siantar. Pantauan METRO, Kondisi mobil terlihat sangat parah. Mulai bagian depan mobil hingga belakang, semuanya mengalami ringsek berat. Mobil akhirnya dievakuasi dari Jalan Merdeka, depan SMPN I Siantar, menggunakan derek sekira 45 menit usai kejadian. (mua/mag4/hez)

SDN 124386 Dibobol Maling Sambungan Halaman 8 diperiksa, satu unit DVD merk Kawachi yang sebelumnya di simpan di lokasi, sudah hilang. Kejadian itu langsung diberitahukankepadaKepalaSekolah Ruben Siagian. Walau sudah dicari kemana-mana DVD tetap tidak ditemukan. Bahkan setelah mereka memeriksa sekeliling, diketahui bahwajendelakelassudahrusak.

WAJAH MAHASISWA ROBEK Sambungan Halaman 8 ngendarai Honda Mega Pro BK 6562 TAK. Saat melaju di Jalan Kertas, sepedamotor yang ditumpangi keduanya laga kambing dengan sepedamotor KTM BK 6874 NU yang dikendarai Wira Hadi Husna (21), warga Jalan Kertas Kelurahan Siopat Suhu. Menurut keterangan Kurniawan yang ditemui di rumah sakit, sebelum kejadian, ia dimintai tolong untuk mengantarkannya ke komplek Megaland. Maksudnya adalah untuk memesan spanduk. Rencananya setelah itu, keduanya hendak pulang ke Kerasaan. Namun saat sepedamotor hendak menyeberang dari komplek Megaland menuju Jalan Asahan, mendadak Wira yang mengaku sebagai mahasiswa ini

rik kalau bisa dirunut, mengapa (ada apa) isu itu kembali muncul tiga bulan lalu. Ada kejadian apa dan siapa yang kali pertama memunculkannya. Dari sini sebenarnya akan bisa diduga kapan isu tersebut bakal tenggelam dan bagaimana cara tenggelamnya. Kadang isu yang muncul di sekitar sewa tanker. Kadang di sekitar ekspansi Pertamina di luar negeri. Kadang pula, seperti sekarang ini, soal anak perusahaan Pertamina yang bernama Petral. Petral adalah anak perusahaan yang 100 persen dimiliki Pertamina. Tugasnya melakukan trading. Jual-beli minyak. Lebih tepatnya membeli minyak dari mana saja untuk dijual ke Pertamina. Semua aktivitas itu dilakukan di Singapura. Petral memang didesain untuk didirikan di Singapura. Sebagai perusahaan Singapura, Petral tunduk kepada hukum Singapura. Isu pertama: Mengapa dibentuk anak perusahaan? Kedua: Mengapa di Singapura? Dulu segala macam pembelian itu dilakukan oleh induk perusahaan Pertamina di Jakarta. Apakah ketika itu tidak ada isu korupsi? Sama saja. Isunya juga luar biasa. Tapi, mengapa dipindah ke Singapura? Dan dilakukan anak perusahaan? Alasan pembenarnya adalah: supaya segala macam pembelian dilakukan oleh sebuah perusahaan trading. Direksi Pertamina jangan diganggu oleh pekerjaan trading. Alasan tidak formalnya: Kalau transaksi itu dilakukan di Singapura dan tunduk kepada hukum Singapura, intervensi dari mana-mana bisa berkurang. Bagi orang korporasi seperti saya, sangat gampang menerima logika mengapa dibentuk anak perusahaan

datang menuju pusat Kota Siantar. Akibatnya, kedua sepedamotor itu laga kambing. Sedangkan penumpang dua kreta itu terkapar di bahu jalan. Warga yang mengetahui kejadian, langsung datang menyemut guna menyaksikan kejadian. Tak lama kemudian, personel Satlantas Polres Pematangsiantar yang dipimpin Kanit Iptu Sugeng, datang dan melakukan olah TKP. Kedua korban kemudian dibawa ke RS Vita Insani Kota Siantar untuk mendapatkan perawatan atas luka yang dideritanya. Akibat kejadian, Kurniawan mengalami luka robek di bagian pelipis kiri dan mendapat enam jahitan. Sementara Wira mengalami luka robek di atas bibir dan mulutnya mengeluarkan darah. (mag-4/hez)

Korban Panggil Terdakwa via SMS Pedagang Ambal Ditangkap..

Sambungan Halaman 8

Sebelumnya Jaksa Penuntut Umum (JPU) Heri Santoso bersama R Nainggolan membacakan kronologi kejadian di hadapan hakim PN Siantar Usaha Ginting beranggotakan Ulina Marbun dan Janner Purba. Menurutnya, peristiwa terjadi pada Minggu, 19 Juni 2011 sekira pukul 14.30 WIB. Saat itu terdakwa bertemu dengan Suhendara alias Hendra (DPO) yang tinggal di Jalan Farel Pasaribu. Keduanya pergi ke Pondok VIII Kecamatan Tanah Jawa mengendarai Suzuki Spin tanpa plat. “Di kedai tuak itu, terdakwa dan Hendra minum beberapa gelas. Tak lama kemudian, korban mengirim SMS dan menanyakan keberadaannya. Saat itu juga terdakwa membalas SMS dan mengaku sedang minum tuak di Tanah Jawa,” terang Jaksa. Di hadapan terdakwa dan pengunjung sidang yang ramai, Heri Santoso melanjutkan bahwa korban kembali mengirimkan SMS yang isinya meminta agar terdakwa datang ke Penginapan Binalling. “Tengok nantilah, soalnya saya lagi minum jauh,” balas terdakwa waktu itu. Melihat terdakwa sibuk membalas SMS, Hendra bertanya dengan siapa terdakwa mengirim pesan. Lalu dijawabnya sedang SMS-

an dengan teman warga Jalan Kartini yang baik dan sering memberi uang sebesar Rp150 ribu. Bahkan saat itu terdakwa mengaku sering makan di luar bersama dan pernah melakukan hubungan sex dengan korban. Tak lama, korban kembali mengirim SMS dan menanyakan teman kencan kepada terdakwa. Kemudian terdakwa bertanya kepada Hendra apakah mau berkencan dengan korban. Saat itu Hendra mengaku mau, sebab ia sedang tidak memiliki uang. Sekitar pukul 18.30 WIB, keduanya kembali ke Siantar. Saat berada di Jalan Farel Pasaribu, Hendra meminta terdakwa untuk turun dulu. Sebab menurutnya ia hendak pergi ke rumah uwak (kakak ibu). Namun ternyata, di sana Hendra mengambil sebilah pisau. “Setelah itu Hendra kembali menjemput terdakwa dan berangkat menuju penginapan. Hendra sempat mengatakan bahwa ia yang akan melakukannya kepada terdakwa. Lalu dijawab Irvan terserah. Akhirnya keduanya sampai di Binaling dan memarkirkan kreta di depan kamar yang sudah dipesan korban,” ungkapnya. Menurutnya, terdakwa dan Hendra yang saat itu membawa tas hitam langsung masuk kamar. Di sana, mereka

melihat korban sudah berbaring di tempat tidur dan hanya memakai celana dalam. Waktu itu korban sempat bertanya kepada terdakwa apa yang dibawa. Lalu dijawab Irvan minuman tuak dan diletakkan di kosen jendela sembari duduk di ujung tempat tidur. Ditambahkan JPU, Saat itu Hendra duduk di samping kaki korban. Tak berapa lama, terdakwa membuka baju berhubung suhu di kamar panas. Melihat itu Hendra juga melakukan hal yang sama. Ketika terdakwa meminum tuak dan merokok, Hendra langsung menusuk korban. Penikaman dilakukan hingga korban tidak berdaya dan banyak mengeluarkan darah. “Korban sempat meminta tolong dan berteriak, namun Hendra kembali menusukkan pisau ke tubuh korban. Bahkan ketika kedua pria ini hendak keluar kamar, korban sempat berteriak dan berkata ‘saya dibunuh’. Perbuatan terdakwa melanggar pasal 340 KUHPidana jo pasal 55 ayat 1 ke 1 KUHP dan pasal 338 KUHPidana jo pasal 55 ayat 1 ke 1 KUHP,” ungkapnya. Usai mendengarkan dakwaan, majelis hakim menyebutkan dalam kasus tersebut ada 11 orang saksi yang dihadirkan. Untuk sidang pemeriksaan saksi dilanjutkan Senin (28/5). (mua/hez)

Sambungan Halaman 8 (19/5) sekira pukul 02.00 WIB. Saat itu korban yang berada di rumah, mendadak mendengar teriakan maling dari arah belakang kediamannya. Setelah dicek, orang yang berteriak itu adalah tetangganyua bermarga Hutasoit. “Awalnya si Hutasoit yang berteriak maling. Setelah kudatangi, katanya ada yang masuk ke belakang rumahku untuk mencuri ayam,” katanya. Setelah kedua jiran ini melakukan pencarian, tak satupun pelaku ditemukan. Namun tak lama kemudian, dari arah berlainan datang warga lain yang mengaku sudah menangkap pelakunya. Benar saja, Timbul terlihat sudah dipegangi warga agar tidak melarikan diri. Takut menjadi bulan-bulanan massa, korban dan warga sekitar langsung menyerahkannya ke Polsek Siantar Marihat. Hal itu tak dibantah tersangka. Kepada METRO ia menuturkan, sebelum mencuri, ia terlebih dulu diajak seorang teman bermarga Pangaribuan, masih warga sekitar. Ditambahkan pria yang sudah punya dua orang anak ini, awalnya ia dan teman-temannya habis minum tuak. Karena sudah mabuk berat, Pangaribuan punya ide untuk mengambil seekor ayam. Rencananya jika berhasil, ayam itu akan dipanggang.

Ide tersebutpun di iyakan Sinaga dan kemudian mereka masuk ke belakang rumah korban. Namun aksi mereka diketahui warga dan akhirnya menangkap Timbul. Saat disergap itu, Pangaribuan berhasil kabur. “Aku menyesal sekali bang, tidak pernah terpikirkan bisa seperti ini. Padahal aku hanya sekali itu saja iku,” ucapnya dengan raut wajah sedih. Pasca kejadian, Keluarga tersangka langsung berupaya menemui pemilik ayam. Bahkan dan informasi yang dihimpun, ada perjanjian damai di antara kedua pihak. “Tadi orangtuaku sudah datang, mudah-mudahan besok bisa selesai perdamainnya,” tambahnya. Diungkapkannya, saat peristiwa terjadi, ia sedang dalam kondisi mabuk, sehingga tidak begitu mengetahui apa yang terjadi.”istrinya jualan dirumahnya, makanya aku malu sekali. Aku sudah menyesal dan minta maaf ma pemilik ayamnya. Ini lah karena mabuk jadinya tidak sadar lagi apa yang mau dilakukan” sesal tersangka. “Kapolsek Siantar Marihat AKP Efendi Tarigan membenarkan bahwa tersangka telah ditahan karena telah melanggar pasal 363 KUHPidana dengan melakukan pencurian se ekor ayam. (Pra/Hez)

Sambungan Halaman Satu

Ribut-ribut Petral dan Prinsip C&C Sambungan Halaman 1

DitemudidiPolsekSiantarMarihat, Ruben mengatakan bahwa dua bulan lalu, kejadian serupa pernah terjadi. “Haritu, DVD juga yang hilang. Tapi ruangan tempat penyimpanannya berbeda,” ucapnya. Kapolsek Siantar Marihat AKP Efendi Tarigan mengaku masih melakukan penyelidikan terkait pengaduan. (pra/hez)

dan mengapa di Singapura. Tapi, bagi publik, bisa saja dianggap mencurigakan. Bagi publik, munculnya pertanyaan (mengapa dibentuk anak perusahaan dan mengapa di Singapura) itu saja sudah sekaligus mengandung kecurigaan. Pertamina memang bisa membuktikan praktik di Petral sudah sangat clean dengan tender internasional yang fair. Tim-tim pemeriksa yang dikirim ke sana tidak menemukan praktik yang menyimpang. Kalau begitu, apa yang masih diperlukan? Di sini kelihatannya bukan hanya clean yang perlu dipertunjukkan. Tapi, juga clear. Perusahaan BUMN memang tidak cukup dengan clean, tapi juga harus C&C. Harus clean and clear. Clean berurusan dengan GCG (good corporate governance), hukum, dan penjara. Clear berhubungan dengan public trust alias kepercayaan publik. Perusahaan yang tidak clear tidaklah melanggar hukum. Semua bisa dipertanggungjawabkan. Tapi, perusahaan yang tidak clear tidak akan mendapatkan kepercayaan publik. Karena BUMN adalah perusahaan milik publik, praktik C&C menjadi sangat penting. Di manakah letak belum clear-nya praktik trading Petral di Singapura? Begini: Pertamina adalah perusahaan yang sangat besar. Bahkan terbesar di Indonesia. Sebagai perusahaan terbesar, posisi tawar Pertamina tidak akan ada bandingannya. Boleh dikata, dalam bisnis Pertamina memiliki hak mendikte: mendikte apa saja, termasuk mendikte pemasok dan bahkan mendikte pembayaran. Inilah yang belum clear: Sebagai perusahaan terbesar, mengapa Pertamina belum bisa mendikte? Mengapa masih berhubungan dengan begitu banyak trader? Mengapa tidak

sepenuhnya melakukan pembelian langsung dari pemilik asal barang: membeli BBM langsung dari perusahaan kilang dan membeli crude (minyak mentah) langsung dari perusahaan penambang minyak? Dalam satu bulan terakhir tiga kali Presiden SBY mengajak mendiskusikan soal itu dengan beberapa menteri. Termasuksaya.ArahanPresidenSBYjelas dan tegas bagi saya: benahi Pertamina. Kalau ada yang mengaku-ngaku dapat bekingdaripresidenatau dariCikeasatau dariistana,abaikansaja.Bisasajaadayang mengaku-ngaku mendapat beking dari Presiden SBY. Tapi, sebenarnya tidak demikian. Jangankan Presiden SBY, saya pun, di bidang lain, juga mendengar ada orang yang mengatakan mendapat beking dari menteri BUMN! Presiden SBY juga menegaskan itu sekali lagi minggu lalu. Dalam pertemuan menjelang tengah malam itu diundang juga Dirut Pertamina Karen Agustiawan. Karen melaporkan sudah siap melakukan pembelian langsung, tanpa perantara lagi. Tentu diperlukan persiapan-persiapan yang matang. Tidak bisa, misalnya seperti yang diinginkan beberapa pihak, besok pagi Petral langsung dibubarkan. Pasokan BBM bisa terganggu. Dan bisa kacau-balau. Memang kelihatannya banyak motif yang berada di belakang isu Petral itu. Setidaknya ada tiga motif: 1) Ada yang dengan sungguh-sungguh dan ikhlas menginginkan Pertamina benar-benar C&C dan bisa menjadi kebanggaan nasional. 2) Dengan adanya Petral, mereka tidak bisa lagi ‘ngobjek’ dengan cara menekan-nekan Pertamina seperti yang terjadi di masa sebelum Petral. 3) Ada yang berharap kalau Petral dibubarkan, jual-beli minyak kembali dilakukan di Jakarta dan mungkin bisa

menjadi objekan baru. Tentu, seperti juga bensin oplos, ada juga campuran lain: politik! Ada politik anti pemerintah Presiden SBY. Tapi, yang keempat itu baiknya diabaikan karena politik adalah satu keniscayaan. Misalnya, ketika ada yang menyeru: Bubarkan Petral sekarang juga! Saya pikir, yang dimaksud sekarang itu ya pasti ada tahapannya. Ternyata tidak. Ternyata benar-benar ada yang menginginkan Petral bubar saat ini juga. Mereka tidak berpikir panjang, kalau Petral bubar sekarang, siapa yang akan menggantikan fungsi Petral. Siapa yang akan mendatangkan bensin untuk keperluan bulan depan dan beberapa bulan berikutnya. Mungkin memang ada maksud terselubung: Bubarkan Petral sekarang juga biar terjadi kelangkaan BBM dan terjadilah gejolak sosial. Itu mirip-mirip dengan logika: Jangan naikkan harga BBM dan pemakaiannya juga jangan melebihi 40 juta kiloliter setahun! Logika Joko Sembung yang tidak nyambung. Tentu saya tidak akan terpancing pemikiran pendek seperti itu. Yang harus dilakukan Pertamina adalah langkah yang lebih mendasar: Sebagai perusahaan raksasa, Pertamina, seperti ditegaskan Presiden SBY setegastegasnya, tidak boleh lagi membeli minyak dari perantara. Langkah seperti itu sebenarnya sudah mulai dilakukan oleh Pertamina. Tapi, belum semua. Jadinya tenggelam oleh pembelian yang masih dilakukan lewat Petral. Apakah kelak setelah Pertamina tidak lagi membeli minyak dari perantara, otomatis tidak akan ada yang dipersoalkan” Tidak dijamin. Akan terus ada yang mempersoalkan. Misalnya: Mengapa membeli langsung kalau pedagang bisa memberikan harga lebih

murah? (Dalam dunia bisnis, tidak dijamin pemilik barang menjual lebih murah daripada pedagang. Bisa saja pedagang kuat membeli barang dalam jumlah besar dengan diskon yang tinggi. Lalu, menjual kepada konsumen dengan harga lebih murah.) Pertamina (atau siapa pun) dapat komisi dari pemilik barang. Mengapa membeli langsung kepada pemilik barang” Mengapa tidak pakai tender terbuka saja? Dan banyak lagi yang masih akan dipersoalkan. Sebab, pada dasarnya memang banyak orang yang hobinya mempersoalkan apa saja. Tapi, ribut-ribut seperti itu tidak akan lama. Syaratnya, manajemen Pertamina terus secara konsisten menjaga integritas. Tidak mudah memang. Dan memerlukan waktu yang panjang untuk membuktikan konsistensi itu. Tapi, dalam menjaga integritas itu Pertamina tidak akan sendirian. Perkebunan sawit BUMN juga harus melakukan hal sama. Misalnya dalam pembelian pupuk. Sebagai perusahaan perkebunan terbesar di Indonesia, tentu aneh kalau PTPN masih membeli pupuk dari perantara. Perkebunan gula idem ditto. PLN juga harus membeli batu bara langsung dari pemilik tambang. Dan itu sudah dilakukan sejak dua tahun lalu: Semua pemasok adalah pemilik tambang. Tidak ada lagi perantara batu bara di PLN dalam dua tahun terakhir. Awalnya memang ributribut terus, tapi sekarang sudah kempis. Inilah prinsip yang harus dipegang: Dengan clean, kita memang tidak akan masuk penjara secara fisik. Tapi, dengan clear, kita tidak akan masuk penjara secara rohani. Hukum cukup menghendaki clean. Publik menghendaki clean and clear. (*)

MASIH TRAUMA MENIKAH Sambungan Halaman 1 Padahal, ibu Al, El, dan Dul itu dikabarkan pernah dekat dengan pria bule bernama Matteo. Pascabercerai dari Ahmad Dhani, 2008 silam, sampai saat ini Maia masih betah menjanda. Entah apa penyebabnya, apa karena Maia sulit mencari pengganti Dhani atau trauma berumah tangga lantaran pernah mengalami KDRT (kekerasan dalam rumah tangga)? Pasalnya, pertikaian dengan Dhani sempat mencuatkan isu KDRT. “Kalau dibilang trauma, ada trauma. Tapi aku yakin kalau nanti sudah ditemukan jodohnya, dan ada ruhnya, aku yakin jodohnya pasti itu akan hilang,” kata Maia. Dengan kondisi tersebut, mantan teman duet Mulan Jameela itu pun mengaku tak ngoyo mencari calon pendamping hidup. “Saya tidak akan mencari, biar Tuhan yang mencarikan untukku. Karena kalau saya yang mencari salah lagi kayak dulu. Tapi ya kenyataannya kayak itu, dan saya lagi enjoy ekspansi ke mana-mana, sehingga nanti next kalau saya sudah siap menikah lagi dia mau larang apa wong kerjanya sudah banyak,” tandasnya. (int)


SELASA 22 MEI 2012

Pedagang Ambal Ditangkap Curi Ayam

Mobil Toke Getah Terguling Pulang dari Studio Karaoke

Ngaku Menyesal, Mencuri karena Mabuk

SIANTAR- Timbul Sinaga (29), menetap di Jalan Farel Pasaribu, Siantar Marihat, nyaris jadi bulan-bulanan warga sekampungnya. Hal itu setelah ia dipergoki dan disergap warga saat mencuri ayam betina di kediaman Arlis Siregar (50). Peristiwa terjadi pada Sabtu

„) Baca Pedagang ...Hal 7

„ Timbul Sinaga, tersangka pencurian ayam.

SIANTAR- Mobil Mitsubishi Pajero Sport BK 168 JP milik Hendi alias Awi terguling. Peristiwa terjadi saat mobil berwarna hitam yang dikemudikan toke getah ini bermaksud mengelakkan sepedamotor yang melaju melawan arah tanpa menyalakan lampu, Selasa (22/5) sekira pukul 01.00 WIB. Akibatnya, mobil terseret 100 meter dan terguling di Jalan Medeka Kota Siantar. „) Baca Mobil ...Hal 7

TERGULING- Warga menyaksikan mobil Mitsubishi Pajero Sport yang terguling di Jalan Merdeka Kota Siantar. Peristiwa terjadi akibat pengemudi mengelakkan pengendara sepedamotor yang melaju melawan arah, Selasa (22/ 5). (Kanan) Kondisi mobil yang ringsek berat, namun dua penumpangnya tidak mengalami luka-luka.

Foto Eko/Fahmi

Warga mengamankan Honda Mega Pro yang dihantam KTM di Jalan Sangnaualauh Damanik., Senin (21/ 5).


MS, diamankan di Pos Polisi Pasar Horas. Itu setelah pemuda ini dicurigai warga mencopet di Pasar Horas, Senin (21/5).

Mega Pro Dihantam KTM

WAJAH MAHASISWA ROBEK SIANTAR- Akibat sepedamotor laga kambing di Jalan Sangnaualuh Damanik Kelurahan Siopat Suhu, Siantar Timur, dua pengendara mengalami luka serius pada wajah, Senin (21/5) sekira

pukul 17.30 WIB. Adalah M Kurniawan (26) warga Simpang Pelita Kerasaan yang sedang berboncengan dengan Sukardi me-

„) Baca Wajah ...Hal 7

SDN 124386 DIBOBOL MALING SIANTAR- Untuk kedua kalinya, SD Negeri 124386 di Jalan Pisang Kelurahan Pardamean, Siantar Marihat, dibobol maling. Bahkan pihak sekolah mengaku kehilangan satu unit DVD, barang yang sama saat sekolahnya dibongkar beberapa bulan lalu.

Aksi pencurian ini diketahui saat para guru baru saja melaksanakan upacara bendera. Waktu itu guru bernama Dame Sihotang, masuk ke ruang kelas I dan melihat gembok serta engsel lemari rusak. Saat

„) Baca SDN ...Hal 7

Aksi Copet Merajalela

Gagal Berdamai

ABG ADUKAN JANDA Korban Panggil Terdakwa via SMS

SIANTAR- Gagal berdamai, ABG bernama Puspita Purnama Sari alias Vira (14) mendatangi Polres Pematangsiantar, Senin (21/5) sekira pukul 08.30 WIB. Kedatangan korban adalah untuk mengadukan Putri, disebut-sebut janda beranak satu yang telah menganiayanya. Menurut keterangan Vira di Polres Pematangsiantar, sebelum penganiayaan itu terjadi, ia sedang bersama Akbar, duda beranak dua yang sudah „) Baca ABG ...Hal 7

Tak Senang Dipukuli

Warga Simpang Koperasi Adukan Supir Mopen

seorang warga Serapuh, Simalungun, kembali menjadi korban, Senin (21/5) sekira pukul 16.00 WIB. Meski akhirnya

„) Baca Aksi Copet ...Hal 7

SIANTAR- Irvan Lubis (31) warga Pintu Bosi Kelurahan Tomuan, Siantar Timur, yang didakwa membunuh Bambang Hemanto di Penginapan Binalling di Jalan Cornel Simanjuntak, mengaku dipanggil „ Irvan Lubis korban melalui SMS sesaat sebelum terjadi pembunuhan.

„) Baca Korban ...Hal 7

Warga Serapuh Jadi Korban SIANTAR- Meski sudah banyak memakan korban, aksi pelaku copet di Pasar Horas tak kunjung berhenti. Malah sebaliknya, geliat para pencopet itu seolah kian merajalela. Buktinya,

Sidang Pembunuhan di Binalling

SIANTAR- Tak terima dipukuli seorang supir Mopen Sinar Siantar, Ihsan (23) warga Jalan Medan Simpang Koperasi, Siantar Martoba, yang „ Puspita Purnama Sari

„) Baca Warga ...Hal 7


22 Mei 2012


WARGA: Kestiono, Sukadi, Tumpal Pardede serta beberapa warga Tanjung Pinggir dan Tambun Nabolon, Senin (21/5).

Sikat Mafia Tanah di Tanjung Pinggir! SIANTAR- Warga Tanjung Pinggir dan Tambun Nabolon, Kecamatan Siantar Martoba, meminta kepada Pemko Siantar dan pemerintah pusat untuk menyikat mafia tanah yang

menyebut-nyebut berhak atas tanah seluas sekitar 800 hektare di Tanjun Pinggir, eks hak guna usaha (HGU) PTPN III Unit

Baca Sikat ...Hal 10

Senin Depan, Ribuan Guru Turun ke Jalan Tuntut Pencairan Sertifikasi dan Insentif SIANTAR- Sekitar 5.500 guru di Kota Siantar akan turun ke jalan menuntut pencairan tunjangan sertifikasi Desember 2010 dan Desember 2011 serta insentif 2011 yang belum dicairkan Pemko Siantar. Direncanakan, aksi turun ke jalan dilaksanakan Senin (28/5). Kesiapan itu disampaikan Koordinator Forum Guru Sekolah (FGS) Kota Siantar Hendri Tampubolon, Senin (21/5) saat menggelar konferensi pers. Dia mengatakan, guru-guru di Kota Siantar akan

mengadakan aksi turun ke jalan Senin (28/5) depan terkait belum dicairkannya tunjangan sertifikasi Desember 2010 dan Desember 2011

Baca Senin ...Hal 10

Kolam Sirkulasi Jebol Limbah Dibuang ke Sungai

155 Pejabat Eselon III dan IV Dilantik RAYA- Bertempat di gedung SMA Plus Partuha Maujana Simalungun (PMS) Pamatang Raya, Bupati Simalungun diwakili Plt Sekda Gidion Purba melantik 155 pejabat eselon III dan IV, serta kepala sekolah SD, SMP, SMA/SMK, Senin (21/5). Para PNS yang dilantik tersebut sesuai Surat Keputusan (SK) Bupati Simalungun Nomor:821/2166/ BKD/2012 dan Nomor:821/2167/ BKD/2012, masing-masing tertang-


TUNTUT- Konferensi pers oleh Forum Komunikasi Guru yang menyatakan akan turun ke jalan menuntut pencairan dana sertifikasi dan insentif dari Gubsu, Senin (21/5).

gal 16 Mei 2012. Sebagai saksi dalam pelantikan itu Staf Ahli Bupati Simalungun Bidang Ekonomi dan Pembangunan Jonni Saragih SIP dan Kadis Kebudayaan dan Pariwisata Jarinsen Saragih SPd, serta para rohaniwan Islam, Kristen Protestan dan Katolik. Rincian 155 pejabat yang dilantik, antara lain 1 lurah yaitu Manaon

BANDAR- Pabrik kelapa sawit milik PT.Prima Sauhur Lestari sengaja mengalirkan limbah ke sungai karena jebolnya kolam sirkulasi limbah miliknya. Atas kondisi ini, pihak perusahaan yang berada di kawasan padat penduduk berjanji akan segera memperbaiki kolam sirkulasi limbah yang rusak.

Baca 155 Pejabat ...Hal 10

Hal ini disampaikan Manajer Pelaksana PKS PT Prima Sauhur Lestari, Syafii, ketika menerima kunjungan rombongan Badan Lingkungan Hidup (BLH) Kabupaten Simalungun dan anggota DPRD Simalungun, yang

Baca Kolam ...Hal 10

Peringatan Harkitnas

Menuju Bangsa Berdaulat dan Punya Jati Diri SIANTAR- Jika dihitung dari titik awal kebangkitan nasional tahun 1908, sudah lebih 100 tahun Bangsa Indonesia berproses dalam kesadaran, maupun kehidupan untuk menjadi bangsa yang berdaulat, memiliki identitas dan jati diri dalam kehidupan berbagsa dan bernegara.

Demikian disampaikan Menteri Komunikasi dan Informatika (Menkoinfo) Ir Tifatul Sembiring dalam sambutan tertulisnya yang dibacakan Walikota Pematangsiantar Hulman Sitorus pada Upacara memperingati Hari Kebangkitan Nasional

Baca Menuju ...Hal 10


MACET- Suasana kemacetan di pusat pasar Tanah Jawa yang terjadi pada pekan Senin dan Kamis. (FOTO: LAZUARDY FAHMI)

DRAINASE BURUK- Air meluap ke badan jalan di persimpangan Jalan WR Supratman karena drainase yang buruk. Kondisi ini selalu berlangsung jika hujan turun, Minggu (20/5)

Atasi Macet di Tanah Jawa Manfaatkan Jalan Keliling TANAH JAWA- Kemacetan yang selalu terjadi di jalan utama pusat kota pekan Tanah Jawa bisa teratasi jika jalan alternatif/ jalan keliling di belakang pusat pasar dimanfaatkan. Namun kenyataannya, para supir truk dan kenderaan bak besar enggan melintasi jalan ini. Mereka lebih memilih lintas dari pusat kota. Akibatnya, kemacetan terus terejadi, khususnya pada hari pekan Senin dan Kamis. Padahal kondisi jalan lingkar cukup lebar dan mulus. Mesmuliadi (45) tokoh masyarakat di Balimbingan, Tanah Jawa, Senin (21/5) mengatakan, kemacetan sudah menjadi

Baca Atasi ...Hal 10


22 Mei 2012

155 Pejabat Eselon III dan IV Dilantik Sambungan Halaman 9

Siregar SPdI sebagai Lurah Ujung Padang Kecamatan Ujung Padang, 38 kepala SD, 7 kepala SMP, 2 kepala SMK dan 2 kepala SMA dan selebihnya menduduki jabatan eselon III dan IV di berbagai instansi. Dalam arahannya, Plt Sekda mengatakan pelantikan merupakan hal yang biasa dilakukan di suatu organisasi pemerintahan. Hal ini bertujuan memberikan semangat bagi PNS melaksanakan tugas sebagai abdi negara dan abdi masyarakat dan untuk meningkatkan karier bagi PNS itu sendiri. Oleh karena itu diharapkan kepada PNS yang baru dilantik untuk lebih meningkatkan kinerjanya. “Tingkatkan kinerja dan kuasai tugas pokok dan fungsi (tupoksi). Jabatan yang diberikan kepada saudara merupakan rencana terbaik yang diberikan Tuhan. Untuk itu, syukuri pemberian Tuhan ini dan tunjukkan bahwa saudara mampu untuk melaksanakannya,” nasihat Gidion. Selanjutnya Gidion juga mengharapkan kepada para PNS yang baru dilantik senantiasa meningkatkan ilmu pengetahuan dan wawasan sehingga dalam melaksanakan tugas dapat berjalan dengan baik. “Ilmu pengetahuan dan wawasan harus terus kita gali untuk mendukung semua tugastugas kita dalam memeberikan pelayanan kepada masyarakat. Di samping itu, pelajari karakter pimpinan kita dan bekerjalah sesuai peraturan dan ketentuan yang berlaku,” tandasnya. Tampak hadir dalam kesempatan tersebut anggota DPRD Simalungun, para pimpainan Satuan Kerja Peranagkat Daerah (SKPD), para PNS dan sanak keluarga para pejabat yang dilantik. (rel/osi/ara)

Menuju Bangsa Berdaulat dan Punya Jati Diri Sambungan Halaman 9 (Harkitnas) ke-104, Senin (21/5) di Lapangan H Adam Malik Pematangsiantar. Dalam sambutan yang dibacakan Hulman Sitorus, disampaikan bahwa wajah dan corak Indonesia saat ini juga telah mengalami perubahan dan perkembangan sejalan dengan perjalanan waktu. Demikian halnya nilai-nilai kebangsaan selama 104 tahun, telah mengalami pasang surut seiring dengan perubahan jaman dan tuntutan masyarakat itu sendiri. Menurutnya, perubahan tersebut mau tidak mau, suka atau tidak suka, pasti akan berada dan menyatu dalam proses perjalanan sejarah Bangsa Indonesia. Bahkan itu semua telah dirasakan dan dialami bersama-sama, bahwa perjalanan Bangsa Indonesia berkali-kali mendapatkan gangguan, tantangan, dan hambatan serta ancaman baik dari dalam maupun dari luar. ”Oleh karena itulah dalam rangka tetap menjaga konsistensi dan kesinambungan nilai-nilai kebangsaan yang telah dirintis oleh para pendahulu kita. Pemuda sebagai generasi penerus perjuangan bangsa tidak boleh lengah dan lupa akan makna hakiki nilai-nilai kebangsaan tersebut,” ujarnya. ”Menyikapi itulah lahir Budi Utomo yang dalam proses perjalanannya mampu memicu munculnya organisasi-organisasi pergerakan kaum muda, baik yang bersifat kedaerahan, politik, serikat kerja, keagamaan dan kewanitaan serta kepemudaan,” katanya. Munculnya berbagai organisasi tersebut mewarnai bangkitnya nilai-nilai nasionalisme dan berlanjut pada tahun 1928 dengan bersatunya berbagai kelompok organisasi, khususnya organisasi kepemudaan dalam mewujudkan gerakan nasional sejati melalui Sumpah Pemuda, yang berikrar satu tanah air, satu bangsa dan satu bahasa. Upacara tersebut juga dihadiri unsur pimpinan daerah, Ketua DPRD Marulitua Hutapea, para veteran, jajaran SKPD, ormas, serta pelajar tingkat SMP, SMA, dan SMEA. (rel/ara)

Senin Depan, Ribuan Guru Turun ke Jalan Sambungan Halaman 9 serta dana insentif 2011. Dia mengatakan, besaran tunjangan sertifikasi yang belum cair pada Desember 2010 sekitar Rp1,7 miliar dan Desember 2011 sekitar Rp2,7 miliar. Kemudian insentif dari gubernur Sumatera Utara (Gubsu) sebesar Rp60 ribu per bulan per guru selama 2011 sekitar Rp1,8 miliar dan triwulan I 2012 sekitar Rp2,1 miliar, juga belum mereka terima. “Uang ini sama sekali belum dicairkan kepada guru-guru di Kota Siantar. Selain itu, guru di Kota Siantar juga sering dikutip uang

saat pengurusan berkas sertifikasi oleh oknum-oknum di Disdik Kota Siantar,” jelas guru SMKN 3 ini. Katanya, jumlah guru yang akan turun ke jalan sebanyak 5.500 guru, mulai dari guru SD hingga SMA baik swasta maupun negeri. Dia berharap, guru-guru akan tetap sepaham mengenai rencana ini hingga Senin depan. “Berkaitan dengan aksi turun ke jalan, kami sudah membentuk FGS. Forum ini berdiri sejak Sabtu 11 Mei lalu dan akan terus berjuang menuntut hak kami,” jelasnya. Ipson Tamba, anggota FGS yang hadir pada pertemuan menyebutkan, tiga kali

pertemuan di DPRD, mereka dipermainkan dan tidak ada kejelasan. Sebelum aksi turun ke jalan, Senin depan mereka berharap ada koordinasi dari Pemko Siantar terhadap permasalahan ini. Ketua Dewan Pendidikan Kota Siantar Nasir Armaya Siregar mengatakan, perwakilan guru-guru, Dewan Pendidikan dan Komisi II DPRD Kota Siantar akan berangkat ke Medan menemui Biro Keuangan Pemprovsu terkait dana ini. “Besok (hari ini, red) kita akan mempertanyakan langsung ke Biro Keuangan Pemprovsu apakah sudah dicairkan atau belum. Itu hak guru-guru, tidak boleh dia-

lihkan kepada kegiatan lain di Pemko Siantar,” jelasnya. Jamansen Purba, Penasehat Hukum FGS mengatakan, 23 April lalu dia sudah ke Biro Keuangan Pemprovsu. Berdasarkan keterangan dari salah satu staf, dana insentif Gubsu Rp1,8 miliar pada semester I dan Rp2,1 miliar pada semester II tahun 2011 telah dikirimkan Desember 2011 ke kas daerah Pemko Siantar. “Namun pada pertemuan di DPRD, Sekretaris Dispenda Kota Siantar, yaitu saudari Masni malah mengatakan uang itu belum ditransfer Biro Keuangan Provinsi,” jelasnya.(ral/ara)

Kolam Sirkulasi Jebol, Limbah Dibuang ke Sungai Sambungan Halaman 9 meninjau pengolahan limbah perusahaan tersebut, Senin (21/5). Katanya, jebolnya kolam sirkulasi limbah ini karenatingginyavolumelimbahyangdikeluarkan pabrik, sementara kapasitas kolam penampungan tidak mampu menampungnya. Akibatnya dinding kolam limbah jebol dan air limbahindustritersebutmengalirderaskeSungai Bahbolon melalui parit pembuangan limbah. Syafii juga mengklaim, selama ini dirinya melakukan pengawasan penuh terhadap

instalasi pembungan air limbah pabrik tersebut. ”Memang kamarin sempat terjadi kesalahan teknis di instalasi pembungan air dan limbah pabrik ini karena dinding kolamnya jebol. Saat ini kami masih mengupayapakan agar kolam limbah tersebut segera diperbaiki,” jelasnya. Sementara buntut dari kelalaian manajemen pabrik kelapa sawit ini, warga Nagori Pematang Kerasaan, Kecamatan Bandar, yang tinggal berdekatan dengan kawasan pabrik tersebut merasadirugikankarenaairsungaiyangdigunakan wargauntukmandidanmencucipakaiantercemar limbahpabrik.

SelanjutnyaRajaSianiparyangditemuiMETRO mengatakan, setelah dilakukan pemeriksaan pada instalasi pembungan air dan limbah milik pabrik ini, pihaknya menyimpulkan bahwa pengoperasian limbah sempat terjadi kelalaian karenajebolnyadindingkolaminstalasi.”Setelah kamilakukanpemeriksaan,ternyatamengalirnya limbah ke sungai tersebut disebabkan karena dinding kolam instalasi limbah yang berada di kolam nomor enam ini sempat jebol, makanya limbah mengalir ke sungai. Namun begitu kita sudah tegaskan agar mereka segera memperbaikinya dalam waktu cepat,” jelasnya.

Sikat Mafia Tanah di Tanjung Pinggir! Sambungan Halaman 9 Kebun Bangun. Sengketa tanah yang berkepanjangan telah menyebabkan kerugian besar bagi masyarakat di sekitar lokasi konflik, terutama yang ingin membuat sertifikat tanah karena dipersulit.Bahkanberkastidakditerimakarena diduga dianggap lahan sengketa. Kepada METRO, Senin (21/5), perwakilan masyarakat, Kestiono (70) warga Tambun Nabolon, Sukadi (45) warga Tanjung Pinggir, Tumpal Pardede serta beberapa warga yang ikut mendampingi menjelaskan, beberapa pihak yang mengklaim sebagai pemilik sah tanah merupakan eks Kebun Bangun sebenarnyapadaawalnyatidakmemilikiketerkaitan dengan tanah yang disengketakan sebelum hakgunausahaPTPNIIIhabis.Bahkansetelah HGU PTPN III habis, pada tahun 1997-1998 ketika Persatuan Petani Siantar-Simalungun (PPSS) melakukan penggarapan tanah seluas 243,5 hektare, lembaga-lembaga yang akhirakhir ini mengku-ngaku telah mengantongi surat dari Pengadilan, Kejagung bahkan Menteri BUMN, tidak muncul. “PPSS sebenarnya yang melakukan penggarapan tanah eks PTPN III Unit Kebun Bangun ketika HGU berakhir. Saat itu kebun tidak terurus sehingga semak belukar berisi pohon coklat yang masih kecil-kecil,” kata Kestiono. Kestiono menjelaskan, setelah dimulai tahun 1997 sampai tahun 1998, tanah seluas 243,5 hektare telah ditanami oleh masyarakat yang tergabung dalam PPSS. Kelompok PPSS merupakan keturunan pekerja kontrak yang bekerja di kebun teh milik Inggris dan Belanda di areal Kecamatan Siantar Martoba pada tahun1942.PerkebunantehmilikmilikBelanda tersebut beralih fungsi ketika Belanda

meninggalkan Indonesia ketika Jepang datang. Ketika Jepang datang, pihak Jepang memintakepadakaryawanperkebunantehmilik Belanda untuk membongkar sendiri kebun tehtersebutdanditanamidenganpadi,jagung serta makanan yang dapat dijadikan Jepang sebagai bahan makanan. Hasil tanaman tersebut diserahkan untuk akomodasi Jepang selama perang. Ketika Jepang usai, Belanda kembali datang, tetapi tanah eks perkebunan teh tersebut tidak diminta kembali. “Tanah seluas 243, 5 hektare yang sempat kami kuasai pada tahun 1998 merupakan tanah kami yang diminta oleh pihak perkebunan Simbolon (perkebunan karet sebelum PTP) pada tahun 1968. Masyarakat pada saat itu menyerahkan tanah karena di bawah ancaman serta isu terlibat G 30S PKI, karena pihak perkebunan membonceng polisi dan TNI pada masa itu,” terang Kestino. Ditambahkannya, tanah yang sebagian diserahkan masyarakat kepada pihak Perkebunan Simbolon telah memilih LR 68, yakni semacam surat kewenangan untuk menguasai tanah yang dikeluarkan pihak Agraria pada tahun 1968. Tetapi tidak seluruh masyarakat menyerahkan tanahnya, hanya sekitar243hektare.Sementarasebagianwarga yang rata-rata eks karyawan kontrak perkebunantehmasihmenyimpansuratLR68yang saat ini menjadi perkampungan Tambun Nabolon, Tanjung Pingggir sekitarnya. Sementara Sukadi menambahkan, setelah mengusai tanah seluas 243 hektare, kelompok PPSS menanami tanah dengan berbagai jenis tanaman. Oleh pihak perkebunan sempat dilarang, sebelum ada kesepakatan untuk melakukan tumpang sari. Pihak perkebunan tetap memiliki coklat, sementara petani menanami tanaman palawija. Tetapi pada tahun 2000, terjadi konflik dengan pihak

perkebunan. Walikota Siantar saat itu, Marim Purba, sempat melakukan mediasi antara kedua pihak. Tetapi sejak saat itu muncul beberapa kelompok yang melakukan penggarapan di Tanjung Pinggir, yang akhirnya tanah yang dikuasai kelompok PPSS dikuasai oleh kelompok lain. “Mewakili PPSS, kami telah sampai Mahkamah Agung, Komisi Yudisial, Badan Pertanahan Nasional serta pihak PTPN III untuk memperjuangkan tanah yang seharusnya kembali kepada kami. Tanah yang kami perjuangkan dan sempat kami kuasai antara 1998 sampai tahun 2000 adalah blok 28, blok 29, blok 30, blok 31, blok 37, blok 43, blok 44, blok 45, blok 46 dan blok 47” kata Sukadi. Dijelaskannya, aksi serta pernyataan beberapa kelompok yang sering dimuat di media membuat pihaknya merasa kurang nyaman, sebab kelompok-kelompok tersebut datang setelah mereka. “Kamihanyainginpemerintahtegas,jangan setengah hati. Jika ini tetap berlaru-larut, maka tanah tersebut akan menjadi lahan empuk untuk mafia-mafia yang pandai administrasi, tanah akan dikuasi oleh pihak yang tidak berhak,” katanya. Dijelaskannya, jika memang Pemko Siantar bercita-cita membuat kota baru di lokasi tanah sengketa tersebut, akan lebih baik karena tujuannya untuk masyarakat banyak. Beda jika tanah tersebut dikuasai oleh oknum-oknum yang memperkaya diri sendiri, mengambil yang seharusnya bukan bagiannya. SementaraTumpalPardede,yangmengaku telah bertani di Tanjung Pinggir sejak tahun 1982 ketika kebun karet milik PTPN III masih berproduksi, mengaku mengetahui secara detail pihak-pihak yang memiliki tanah pada awalnya. (esa/ara)

Sementara anggota Komisi II DPRD Simalungun Dodi H Lukman dan Abu Sopian Siregar sempat melakukan pengecekan langsung di kawasanInstalasiPengolahanAirLimbah(IPAL) pabrik dan mereka meminta agar pihak perusahaan mengedepankan sterilisasi lingkungan hidup. ”Kami hanya meminta supaya manajer atau pengawas lainnya jangan hanya melihat proses dan hasil peroduksi saja, tetapi lebih mengedepankan pelestarian lingkungan hidup, termasuk penanganan yang tepat untuk limbah pabriknya,” jelasnya. (mag02/ara)

Atasi Macet di Tanah Jawa... Sambungan Halaman 9 langganan. “Ini sudah berlangsung lama dan sepertinya sulit diatasi. Andainya di hari-hari pekan Senin dan Kamis ditempatkan pertugas khusus di jalan segitiga memasuki pusat pasar, pasti kemacetan dapat berkurang. Truk dilarang melintasi pusat pasar dan dipaksa harus lewat pasar keliling,” ujarnya. Namun, katanya, supir angkutan sepertinya masih rendah tingkat kesadarannya yang seenaknya parkir menunggu penumpang di badan jalan. “Hingar bingar suara klakson mobil yang saling bersahutan saat macet menambah semrawutnya pekan Tanah Jawa,” ujarnya. Mesmuliadi menambahkan, ada baiknya Muspika Tanah Jawa melakukan pertemuan dengan mandor atau direksi bus angkutan untuk mencari solusi. Terminal bus di depan ruko bisa dijadikan tempat mangkal seluruh mini bus angkutan umum jurusan Siantar. Kemudian para pedagang kaki lima ditertibkan dan dipaksa masuk ke dalam pajak. Sementara Tirto Atmojo, mantan Pangulu Balimbingan menambahkan, wajah pusat pasar Tanah Jawa perlu dipoles dan lebih berseri. Menurutnya, sudah saatnya pos polisi pembantu ditempatkan di pusat pasar. “Di samping menambah kenyamanan orang yang berbelanja juga bisa sekaligus mengarahkan para supir angutan umum agar tidak parkir sembarangan, khususnya di pusat kota,” ujarnya. Senada disampaikan Sutarno, warga Simpang Tangsi Balimbingan. Menurutnya, Tanah Jawa sebagai kecamatan yang besar yang dulunya disebut keresidenan harus mampu mempersolek diri menuju ibukota pemekaran Simalungun. “Para pengunjung tidak lagi dikeluhkan soal kemacetan. Mari bersatu menjadikan Tanah Jawa berseri dan nyaman bagi pengunjung,” ujarnya. (iwa/ara)


22 Mei 2012

„ Ilistrasi

Akuarium Terbesar di Dunia

Terlibat Cinta Segitiga

Pria Beristri Bunuh Diri Cinta segitiga antara seorang pria dengan dua wanita bersaudara di Australia berakhir tragis. Kisah cinta tersebut berujung dengan insiden penusukan. Sang pria bunuh diri setelah menusuk adik perempuan istrinya yang menjadi selingkuhannya. Seperti dilansir oleh, Senin (21/5), seorang pria berusia 45 tahun ditemukan tak bernyawa di rumahnya di Bossley Park, Sydney, Australia pada Sabtu (19/5) sekitar pukul 20.00 waktu setempat. Terdapat luka tusukan di bagian tubuh pria tersebut. Sedangkan seorang wanita berusia 37 tahun dilarikan ke Rumah Sakit Liverpool karena menderita sejumlah luka parah. Kondisinya kritis. Menurut tetangga, pria tersebut terlibat hubungan asmara dengan adik istrinya sendiri. Beberapa tetangga menyebutkan, istri pria tersebut pergi dari rumah sejak 3 minggu lalu, setelah mengetahui hubungan gelap suaminya tersebut.

Entah apa penyebab terjadinya insiden mengenaskan pada Sabtu kemarin. Sang pria menusuk adik perempuan istrinya tersebut dan kemudian menusuk dirinya sendiri dengan pisau. Penusukan ini terjadi ketika keduanya t e r l i b a t pertengkaran. Salah seorang tetangga mendengar teriakan si wanita yang meminta tolong di halaman depan rumah. Akhirnya tetangga tersebut menelepon polisi. “Dia (wanita itu) bersandar di mobil dan ada darah dimana-mana,” tutur salah seorang tetangga yang enggan disebut namanya. Kepolisian setempat masih menyelidiki lebih lanjut insiden maut ini. Namun polisi enggan menjelaskan secara detail kejadian tersebut. Polisi hanya menyatakan, wanita yang menjadi korban penusukan tidak akan dikenai pidana. Sedangkan pihak keluarga menolak untuk memberikan komentar atas insiden ini. (dtc/int)

AMERIKA SERIKAT- Jika Anda ingin mengunjungi akuarium terbesar di dunia, meluncurlah ke Atlanta, Amerika Serikat, untuk mengunjungi Aquarium Georgia. Lebih dari 8,5 juta galon air laut dan air tawar, rumah bagi 120.000 hewan dari 500 spesies yang berbeda. Atraksi utama adalah empat aquarium hiu paus muda dari Taiwan, empat paus beluga dan empat manta ray. Bernie Marcus dan istrinya, Billi, memutuskan untuk membangun akuarium terbesar di dunia ini sebagai kenang-kenangan yang indah untuk Bernie saat mengunjungi Monterey Bay Aquarium tahun 1990. Setelah meneliti struktur bangunan dan desain akuarium (dan setelah mengunjungi 56 akuarium di 13 negara), Bernie menyumbangkan $ 250 juta untuk pembangunan Georgia Aquarium. Dibantu

KESEMPATAN BERKARIR: Perusahaan CV SENTOSA ABADI yang bergerak di bidang General trading yang sedang berkembang pesat membutuhkan para propesional muda yang potensial,memiliki komitmen kuat,integritas dan ambisi untuk maju dalam mengisi posisi ADM, MARKETING,STAF GUDANG, QC, & SPV. Usia maksimal 28 tahun,pendidikan SMU/SMK sederajat.D1,D3 DAN S1(emua jurusan)Bawa langsung lamaran anda ke JL Gereja No.91 depan simpang sidamanik samping warkop P.Siantar NB: bagi yang di luar daerah di sediakan mess.

KESEMPATAN KERJA: Anda ingin berpendapatan min. Rp 2 jt/bln solusinya PRSH baru buka di Pematangsiantar, income harian min. Rp 100 rb/hari dan bulanan min. Rp 1 jt/bln, bukan sales, bukan asuransi/ASSsegera datang, anda pria/wanita 25-49 tahun. hub. Jafar SSi HP 0852 1618 2659 (Tidak SMS)

BARU SUZUKI ERTIGA Suzuki Ertiga, 7 Penumpang (3 baris) 1400cc DP 10% atau bunga 3,220% mulai Rp. 150Jt-an Ready Stock : carry Pick Up Dp. Rp. 13Jt Angs Rp. 2Jt-an APV Pick up Dp. Rp. 18Jt Angs Rp. 2Jt-an APV Arena Dp. Rp. 17Jt Angs Rp. 3Jt-an Hub: PT. Trans Sumatera Agung, Ricky HP 0812 6570 683 Ikuti Test Drive Berhadiah Suzuki Ertiga

Tran Airways, AT & T, Georgia-Pasifik, Time Warner,

Remaja Dibekuk WILMER- Seorang remaja di Kota Wilmer, Negara Bagian Texas, Amerika Serikat (AS) terpaksa ditangkap polisi karena mencoba untuk melakukan perampokan terhadap kantor polisi. Remaja itu mengatakan, ancaman yang dilontarkannya adalah lelucon.

„ Ilustrasi

• All New Xenia Ready stok • Terios Ready stok • Luxio Dp 15% (hadiah menarik) • Sirion Dp 15 % • Pick up Dp 15 % • Mini Bus Dp 15 % hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Proses cepat data dijemput. Menyediakan TEST DRIVE!!


· All New Avanza ..Ready Stock ! Bonus Lengkap ! · All New Avanza VELOZ ... Bonus Lengkap !! · YARIS...Ready Stok,Diskon besar, Buruan !! · New Rush ..... Ready Stok !! · Grand New Innova .... Ready Stock !! · Grand New Fortuner ... Ready Stock !! · Hilux S-Cab/D-Cab .... Bensin/Diesel !! HUB. HUB. RICKY. M - 0853 7199 9499- 0812 6505 3191 SALES EXECUTIVE TOYOTA SIANTAR. Data dijemput, Cash/Credit PROSES CEPAT..!!

SUZUKI BARU Carry Pick Up Dp. 15Jt angs 2Jtan Ertiga Dp. 30Jt angs 4Jtan APV Arena Dp. 26Jt angs 4Jtan Hub: Rio Sirait, 0812 6315 9559

TOYOTA BARU 2012: Dapatkan New Toyota dengan Bunga Kredit 3,85%. Proses cepat & bisa tukar tambah & dapatkan hadiah khusus di bulan ini. Hub: PREDY SIMATUPANG, 0813 6165 1801 - 0853 6207 2000 HONDA IDK2 PERWAKILAN SIANT AR SIANTAR

• Ready honda all new CR-V • Ready honda all new, honda jazz • Ready new honda freed • Promo freed bunga 0 % atau Dp 29 jt-an + hadiah •Honda new brio bisa inden. Ayo buruan, data dijemput, terima tukar tambah segala jenis merk mobil hub. 0853 5867 8803; SMS 0852 6131 5977 (Regar)


Company, Turner Broadcastings, Home Depot, UPS, Air-

Rampok Kantor Polisi,

CAPELLA PEMATANGSIANTAR YAYASAN MAHAGA SEJAHTERA: membutuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515 1742 DIBUTUHKAN SEGERA: Tenaga kerja wanita usia 17-40 Tahun dengan posisi sbb:Baby Sister,Perawat jompo/Pribadi, PRT, syarat fc.ijazah, KTP, KK, gaji bersih 700rb s.d 1.500rb/ bulan + bonus + THR, makan, asrama, dijemput loket, gratis. hub YYS Marel Mandiri. Jl.Cengkeh Raya No 18.C Medan HP 0813 6199 9211: 0878 6968 7879. DIBUTUHKAN TUKANG LAS: Usia 25-45 tahun, berpengalaman, 2 thn dibidang mengelas. Bagi yang memenuhi syarat langsung, Datang wawancara ke Jl. Hok Salamudin Siantar Estate No 32 A Pematangsiantar.

oleh sumbangan dari sponsor utama (termasuk Coca-Cola

SunTrust dan Southern Company), akuarium akhirnya dibuka pada tanggal 21 November 2005, dengan tanpa hutang, berkat tambahan $ 40 juta dalam pendanaannya. Ada sekitar 100,000200,000 ikan dan makhluk laut lainnya (lebih dari 500 spesies) di akuarium. Ikan diangkut dari Taiwan ke Georgia dengan 42 tangki UPS menyumbang untuk biaya pengiriman, yang diperkirakan lebih dari US $ 200.000. Makhluk-makhluk laut itu dipamerkan di sepanjang enam ruang galeri yang berbeda, semuanya memungkinkan pengunjung akuarium untuk mengamati makhluk-makhluk luar biasa itu dengan sedikit atau tidak ada penghalang visual sama sekali berkat terowongan akuarium yang full kaca, dari lantai ke dinding kaca dan juga langit-langitnya. (dtc/int)

• All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya

MITSUBISHI BARU: Ready Stock • Pajero Sport • Triton • Colt Diesel • L300, T120SS • Suku Bunga 0% Dp. Ringan Hub: F. Gultom, SE. 0813 6169 4479

# ISUZU 100% BARU # BUNGA 0% (Proses cepat, data dijemput) • Panther LM Dp. 20% • Panther LV Dp. 20% • Panther LS Dp. 20% • Panther Touring Dp. 20% Hub: PT. Astra Isuzu Siantar SUPRAPTO, HP 0813 7507 0088

DAIHATSU PAKET MURAH 100% DP Angsuran • Xenia 12.750.000 3.125.000 • Terios 15.000.000 4.090.000 • Luxio 19.100.000 3.961.000 • Pick up 9.000.000 2.432.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0878 9228 2993. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio

DIJUAL: Yamaha Jupiter Z 2012, kondisi masih baru, plat belum keluar, baru 2 bulan dipakai. BU, hub. HP 0813 10961048 CASH & CREDIT: Menyediakan rumah dan tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Rp 100 jt, DP 20 jt, angsuran selama 10 thn + Rp 1 jt per bulan, selama 15 thn + 800 rb per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Rp 175 jt, DP 40 jt, angsuran selama 10 thn + Rp 2 jt per bulan, selama 15 thn + 1,6 jt per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 150 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan. Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

Keithan Manuel pergi menuju kantor polisi di Wilmer dengan tangan yang terbalut handuk putih. Polisi setempat mengatakan, Manuel memecahkan kaca, menodongkan tangannya yang terbalut handuk ke polisi perem-

CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Rp 200 jt, DP 50 jt, angsuran selama 10 thn + Rp 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan, Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: 10 x 21,8 m Rp 76 jt, 20 x 22 m Rp 154 jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 tahun + Rp 16 jt per bulan selama 15 tahun + Rp 1,3 jt per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 1.908 M2 Rp 300 jt, cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Rp 95 jt, Dp 20 jt, angsuran selama 10 tahun + Rp 950 rb per bulan, selama 15 tahun + Rp 752 rb per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Rp 150 jt, DP 30 Jt, angsuran selama 10 thn + 1,7 juta per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Rp 200 jt, Dp Rp 50 jt, angsuran selama 10 thn + 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan. Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

puan, dan merampok kantor polisi. Polisi itu juga mengatakan, Manuel mengklaim dirinya membawa pistol ketika melakukan perampokan. Kepala polisi Victor Kemp melapor aparat kepolisian lain-

nya dan menangkap remaja berusia 18 tahun itu di tempat kejadian perkara. “Pemuda ini tentu saja, tidak menggunakan otaknya. Kalian pasti sering mendengar ‘Pelaku Kriminal Terbodoh di Dunia’ namun kalian tidak pernah sadar, pelaku kriminal itu ada di kota kita,” ujar Kemp, seperti dikutip Orange, Senin (21/5). Manuel menampik tuduhan kepemilikan senjata api. Manuel menegaskan, tindakan yang dilakukan hanyalah lelucon. (ok/int)

PIJAT DAN LULURAN “IBU SUM” Jika anda capek, pegal linu, lesuh, lelah kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran hub kami di Jl. flores No. 07 P. Siantar HP 0812 CASH & CREDIT: Rumah type 36/78 genteng 6526 0864; 0813 754 74647

CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar.

roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: 5 x 20 m Rp 17 jt, 10 x 20 m Rp 34 jt, 15 x 20 m Rp 51 jt, 20 x 20 m Rp 68 jt. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT TANAH: 5 x 25 m Rp 25 jt, 5 x 20 m Rp 20 jt, cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

MENYEDIAKAN ANEKA HEWAN PELIHARAAN: Burung hias/ konsumsi, pheasant, bebek hias, reptile, kura-kura (import & lokal), hamster, landak mini, merpati, ayam, perkutut, anjing, kodok hias, kelinci, cicak, jangkrik, ulat Hongkong/ Jerman, kroto, aksesories, pakan, kandang dll. hub. 0878 6849 0858 Medan HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat HukumPengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” HARI INI INVESTASI: Mulai besok dapat profit 7% Rp. 6.300.000 setiap harinya non stop selama 200 hari (Tanpa Rekrut) Minat???? SMS "Petunjuk" ke HP 0877 8847 7900

PIJAT DAN LULURAN “IBU Restu” jika anda capek, pegal linu, lesuh, lelah kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran. Jl. Simpang Viyata Yudha Komp. kelapa-2 dekat sekolah RK Katolik Asisi P. Siantar HP 0821 6681 TERCECER: BPKB Mobil Mitsubishi No. Polisi 7943; 0813 9635 4127 PIJAT DAN LULURAN “MBAK SARI”: Jika Anda Capek, Pegal, Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan Badan, Urut Bayi, Terkilir serta Luluran. Hub: kami di Jl. Usgara No. 1 (Masuk dari Jl. Bali samp. SMK Negeri) P. Siantar HP. 0812 635 5430 PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852.7600 0031; 0813.9688 9800. PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar Hp. 0813 7658 8917

BK 9589 TA, An. Ibrahim Cokromulio/CV Bintang Terang pada Minggu 6 Mei 2012 di sekitar Jl. Sutomo - Jl. Merdeka P. Siantar. Bagi yang menemukan hub: HP. 0853.6204.9905, Tidak akan dituntut dan akan diberi imbalan yang sepantasnya. DIBUTUHKAN: Tukang Las Usia 25-45 tahun, Pengalaman 2 thn dibidang mengelas. 2 Orang Supir Coltdiesel Usia 25-45 Tahun, berpengalaman 2 tahun. Bagi yang memenuhi syarat langsung datang wawancara ke Jl. HOK Salamudin Siantar Estate No 32 A Pematangsiantar

SELASA 22 Mei 2012





1 (satu) berkas sertifikat rumah An. Hasoloan Hutagalung, luas tanah 7 x 10 M di Jl. Ricardo Siahaan No. 42. Hilang pada tahun 2009 di sekitar Jl. Ricardo Siahaan. Bagi yang menemukan hub. HP 0813 9607 1741 Tidak dituntut tapi diberikan imbalan yang sepantasnya.


22 Mei 2012

Awal Mei lalu kabar tak mengenakkan menerpa hubungan Krisdayanti dan Raul Lemos. Pasangan ini dikabarkan telah pisah ranjang, namun kala itu adik Yuni Shara ini sudah membantahnya. Ditemui saat menghadiri resepsi pernikahan Anang dan Ashanty di Shangri-La Hotel, Jakarta Pusat, Minggu (20/5) semalam, Raul malah menegaskan jika berita pisah ranjang hanya gosip semata. “Aku mau klarifikasi sama mediamedia infotainment yang suka bohong, yang katanya saya sudah pisah ranjang sama istri saya, saya mau klarifikasi ya, saya punya kerjaan di Dili, istri saya warga negara Indonesia, saya warga negara Timor Leste, jadi jelas kami punya dua

HOROSKOP HARI INI TAURUS (21 April - 20 Mei) Hati akan menemukan kedamaian saat kita mampu memaafkan. Jadilah pribadi yang anggun di atas ketulusan. Jangan habiskan waktu Anda untuk memikirkan apa yang telah hilang di masa lalu. Hidup ini melangkah ke depan, bukan ke belakang.


(20 Januari - 18 Februari)

Tulislah segala keinginan dan harapanmu dan berikanlah kepada Tuhan. Jadikan Tuhan sebagai satu-satunya tempat berharap. Sifat orang yang berilmu tinggi adalah merendahkan diri kepada manusia dan takut kepada Tuhan.


(23 September - 22 Oktober)

Manusia paling baik adalah orang dermawan yang bersyukur dalam kelapangan yang mendahulukan orang lain dan bersabar dalam kesulitan. Lihatlah, dalam kehidupan ini banyak orang yang tahu apa yang seharusnya dikerjakan. Tetapi, sedikit sekali yang mengerjakan apa yang dia tahu.


(23 Oktober - 22 November)

Hidup adalah suatu perjalanan. Perjalanan itu akan berarti jika hidup kita mempunyai makna untuk sesama. Kegagalan adalah sesuatu yang bisa kita hindari dengan tidak mengatakan apa-apa, tidak melakukan apa-apa dan tidak menjadi apa-apa. Namun, apakah kita hanya akan berdiam diri sementara waktu hidup semakin singkat.


(23 Agustus-22 September)

Bila ilmu dan manfaat telah kita miliki, selanjutnya usaha kita untuk selalu mencari alamat (arah, tujuan, kesempatan).


(21 Desember -19 Januari)

ikap orang lain terhadap kita merupakan gema dari sikap yang keluar dari dalam diri kita. Pancarkan yang baik dan kebaikan itu akan engkau terima. Tidak ada salahnya selalu membawa diri tetap ikhlas dan selalu memperbaiki dengan kebaikan dan kejujuran.


( 23 November - 20 Desember)

Dengan mensyukuri nikmat yang telah diterima, kita telah mendapatkan surga dunia. Hidup menjadi terasa ringan, sedikit beban sampai akhir hayat kita.


19 Februari - 20 Maret

Doa memberikan kekuatan pada orang yang lemah, membuat orang tidak percaya menjadi percaya, dan memberikan keberanian pada orang yang semula dirundung takut. Apapun yang harus dijalani akan jauh lebih baik dan dapat dipercaya jika dimulai dari kejujuran dan keikhlasan.


(21 Mei - 20 Juni)

Keberhasilan adalah kemampuan untuk melewati dan mengatasi dari satu kegagalan ke kegagalan berikutnya tanpa kehilangan semangat. Tak ada rahasia untuk menggapai sukses. Sukses itu dapat terjadi karena persiapan, kerja keras mau belajar dari kegagalan.


(21 Juni- 20 Juli)

Mengambil langkah terbaik tidaklah mudah. Namun kalau hanya menunggu, justru akan membuat langkah tersebut semakin kacau. Bersyukurlah pada apa yang Anda miliki, maka Anda akan mendapatkan lebih banyak. Jika Anda memfokuskan pada apa yang tidak Anda miliki, maka Anda tidak akan pernah merasa cukup.


(21 Juli-21 Agustus)

Dua hal yang membangkitkan ketakjuban Anda adalah langit yang bertebaran bintang. Anda akan menemukan hikmah di dalamnya. Sebab, langit yang bercahaya bagaikan hidup yang penuh dengan ilmu dan kebijaksanaan.


19 Februari - 20 Maret

Air mata adalah satu-satunya cara bagaimana mata berbicara ketika bibir tak mampu menjelaskan apa yang telah membuat perasaanmu terluka. Ambil pelajaran dari masa lalu. Jangan biarkan belenggu kesedihan menutupi jalanmu menuju masa depan.

BUSANA kebaya yang dikenakan Ashanty saat acara resepsi pernikahan memang spesial. Selain menonjolkan teknik pengerjaan tangan, busananya bertabur ribuan kristal swarovski. “Saya berusaha menerjemahkan keinginan Mas Anang dan Ashanty dalam bentuk busana yang glamor dan elegan. Busana tersebut memadukan unsur tradisional dan modern,” tutur Ferry Sunarto, desain busana kedua pengantin itu, Senin (21/5). Kesan glamor yang terpancar

tempat tinggal, di Dili dan di Indonesia,” jelas Raul. Tak cuma menegaskan kalau hubungannya dengan Krisdayanti baik-baik saja, Raul malah membagi kabar kalau sang istri sudah berbadan dua lagi. “Kalau pisah ranjang memang sering terjadi yang artinya kalau istri saya lagi datang ke Jakarta ya kita pisah ranjang, tapi kalau kita lagi ketemu, ranjangnya dua meter yang kepakai cuma satu meter. Alhamdulillah, anak kami Amora, sebentar lagi akan punya adik.” Sementara Krisdayanti sendiri hanya menimpali, “Betapa bahagianya, sekarang usia kehamilannya sudah dua bulan.” (kpl/int)

Olla Ramlan

Ogah Warisi Bisnis Ayahnya Olla Ramlan ternyata lahir dari keluarga pengusaha kaya raya. Meski demikian, presenter Dahsyat tersebut enggan menjadi pewaris bisnis papanya dan lebih menikmati hidup sebagai ibu rumah tangga. ”Ah nggak, papa itu punya banyak anak. Terus terang saya sebenarnya menikmati menjadi ibu rumah tangga, aku pengennya ikut suami dan anak,” kata Olla di Studio RCTI Kebun Jeruk, Senin (21/5). Kalaupun saat ini Olla bekerja sebagai entertainer, tapi hal tersebut dilakukan karena masih berstatus janda. Olla juga tidak ingin kembali memberatkan orang tua. ”Saya bekerja seperti ini karena saya belum ada suami. Saya harus kerja sendiri walaupun ayah saya tetap akan menerima. Tapi saya tetap nggak enak memberatkan orang tua lagi,” jelasnya. Untuk bisa lebih mandiri, Olla bekerja matimatian. Bangun pagi menjadi presenter terus kemudian syuting sinetron. “Alhamdulillah bisa diberikan berkah terus,” ungkap Olla. Untuk melanjutkan bisnis ayahnya, Olla menyatakan lebih cocok dikerjakan oleh anak laki-laki. “Kalau pekerjaan bisa nyambung ke Aufar (kekasih Olla Ramlan) ya Alhamdulillah, jadi saya bisa menikmati dan membantu aja,” jelasnya. Olla menjelaskan, orang tuanya sudah lama berbisnis batu bara di Kalimantan. Selain itu, sang ayah juga sedang membangun arena bermain keluarga. ”Bapak saya lagi membangun arena permainan kayak Dufan, belum sempurna. Bapak saya pekerjaannya banyak jadi nggak bisa fokus. Insya Allah mungkin Aufar bisa bantu. Mereka kan sudah meeting, berdoa aja, saya nggak mau ikut campur,” kata Olla. (jpnn)

Ahmad Dhani-Mulan Jameela

Tampil Mesra Ahmad Dhani dan Mulan Jameela semakin menunjukkan hubungan istimewa mereka. Keduanya turun dari mobil yang sama milik Dhani, Alphard hitam B 1 RCR bersama dua anak Dhani, El dan Dul saat menghadiri pesta resepsi pernikahan Anang dan Ashanty di Shangri-La Hotel, Jalan Jend Sudiman Kav 1, Jakarta Pusat, Minggu (20/5) malam. Tak cuma itu, Dhani juga menggandeng mesra wanita yang diisukan menjadi istri sirinya itu. Saat kepergok media, Mulan terlihat menghindar dan agak menjaga jarak dengan pentolan band Dewa 19 itu. Dhani datang dengan pakaian serba hitam, sementara Mulan tampil seksi mengenakan sackdress pendek berwarna senada dengan

motif ukiran berwarna emas. Dhani dan Mulan menyumbangkan suara emas mereka dalam resepsi pernikahan Anang dan Ashanty. Tak canggung, mereka sempat berfoto bersama pengantin di atas pelaminan dan lantas mencuri perhatian. Setelah memberikan ucapan selamat kepada Anang dan Ashanty, Dhani langsung dihujani pertanyaan apakah ia nantinya akan menggelar resepsi senada dengan Anang. Seperti ciri khas Dhani, ia hanya menjawab sekenanya. “Kita lagi cari venue-nya,” kata Dhani senyum-senyum. Setelah hampir 3,5 jam

terlibat dalam acara resepsi sahabat

karibnya, Dhani langsung meluncur ke mobilnya. Ahmad Dhani, Mulan Jameela, El, dan Dul berada dalam satu mobil layaknya sebuah keluarga. Mulan pun menghindar saat kehadirannya di mobil Dhani diketahui media. (nov/int)

dari busana Anang-Ashanty terpancar dari pemilihan material bahan yang eksklusif dan penempatan detail yang pas, seperti kristal swarovski. “Kristal swarovski yang dipakai banyak, lebih dari 1.000. Selain itu, saya juga mengaplikasikan bordir, sulaman, dan lain-lain,” jelas desainer asal Kota Bandung ini. Untuk mewujudkan busana istimewa tersebut, desainer yang bergabung dengan Asosiasi Perancang Pengusaha Mode Indonesia (APPMI) ini membutuhkan waktu enam bulan. “Kami beberapa kali harus bertemu dan merumuskan konsep busana resepsi. Hasilnya, busana mereka terlihat glamor dan elegan,” tutupnya. (oz/int)

Tya Ariestya:

Nggak Dapet B a t a k , Palembang Juga Oke Harapan semua orang tua terhadap anaknya adalah mendapatkan pasangan hidup yang terbaik. Bagi orang tua dari artis Tya Ariestya, keinginan mereka adalah agar anaknya mendapatkan jodoh dari kalangan orang Batak juga. Namun hal itu sepertinya tak bisa terwujud, karena Tya disinyalir mengikuti jejak sang bunda yang menikah dengan pria yang bukan dari kalangan Batak. “Yah mama aku harapannya nikah jangan jauh-jauh, sama Batak juga. Cuman aku dapatnya bukan cowok Batak, tapi masih Sumatera juga, Palembang. Padahal orang Sumatera terkenal hatinya keras, padahal lembut,” ujarnya di sela-sela acara rapat besar persiapan pesta Bolon Simbolon 2012 di anjungan Sumatra Utara, TMII, Jakarat Timur. Presenter yang juga atlet taekwondo ini belum bisa memutuskan apakah akan memakai adat Batak atau Palembang di pernikahannya kelak. “Entar lihat dulu, dirapatin sama keluarga dulu. Kalau anak muda

SELASA 22 Mei 2012 KOMUNITAS FB XPRESI METRO SIANTAR Jika aku menjadi istrimu nanti... Jangan pernah berhenti mencintaiku, hingga ujung waktu... Hmmm, sepenggal lirik lagu Sheila On 7 cukup menghangatkan hari ini... Nah, untuk teman-teman, kalau ditanya; Jika aku menjadi (?) Apakah yang akan kalian pilih? Dan, apa alasannya plus harapan kamu? Silvia D’chieLy Pakpahan Jika aku menjadi Orang sukses. Aku ingin membahagiakan keluarga dan orang sekitarku F O TO : FEDRIK TARIGAN/ JAW A POS

Menteri BUMN Dahlan Iskan meluncurkan Novel Sepatu Dahlan saat Car Free Day di Jl. Raya Darmo, Surabaya, belum lama ini. Kartiny VanZaitan Aq pengen jd yg trbaik,mjd penolong baik suka dan duka

Asda Silalahi Yg terbaiK,karna aq ingin bhagiain ortu aq,hrapan’a mdah2han aq bsa mnjadi yg terbaik, biar aq bsa nynangin ortu aq.

Camerlan Purba Jika aku menjadi orang sukses aku membahgia kan orang tua ku dan keluarga ku dan masyarat indonesia yg miskin.

Devi Heaven Angel Jk aq mnjd seorg Missioner,aq akn mbritakn Injil ke daerah2 yg blm dijamah oleh Injil.

DoNy C’maNik ZZa Ingin mnjadi orang yg berguna,sukses di sekala bidang. mncintai keluarga qhu yg skrang n’ kluargaku nnti’a.. !!mka akan hidup bahagia.

Adech Ended Mnjdi org yg sdrhana,.

Elyas SanSiro Jika aku menjadi anggota satlantas.. damai itu indah bukan minimal 20 ribuuuuuu....!!!!

Belajar Lawan Kemiskinan dari Novel Sepatu Dahlan SEP ATU di kaki Dahlan Iskan SEPA adalah kisah nan panjang panjang.. Dia tidak sekadar sepasang alas kaki, tetapi juga citacita yang cita-cita mengiringi tapak demi tapak perjalanan hidupnya. TTermasuk ermasuk mimpi dan kesulitan hidup di masa lalunya. Kisah itulah yang diurai oleh Khrisna Pabichara dalam novel karyanya berjudul Sepatu Dahlan yang di-launching di selasela acara Car Free Day (CFD) di ruas jalan Darmo Surabaya. Novel setebal 369 halaman tersebut bercerita tentang impian seorang anak desa yang tegar menghadapi takdir dan kemiskinan dengan cara kerja keras serta ketekunan. ”Ini merupakan novel yang terinspirasi dari sukses Dahlan Iskan. Seorang bocah ndeso yang hidup kekurangan namun kemudian berhasil membalik keadaan menjadi pengusaha dan menteri yang top,” kata Khrisna. Judul Sepatu Dahlan dipilih, ujar Khrisna, tidak lepas dari mimpi masa kecil Dahlan yang sangat ingin memiliki sepatu, tetapi tidak kesampaian.

Sebab, apa daya, ketidakmampuan secara ekonomi dua orang tuanya membuat kakinya tidak mampu merasakan bersepatu hingga memasuki masa-masa akhir studi di SMA. Turut hadir dalam acara peluncuran novel kemarin sang tokoh utama, yaitu menteri BUMN kelahiran 17 Agustus 1951, Dahlan Iskan. Seolah mengiyakan cerita Khrisna, Dahlan mengatakan bahwa saking miskinnya, saat bersekolah dulu dirinya tidak pernah menggunakan sepatu. Tetapi nyeker alias telanjang kaki ke mana-mana. ”Saya baru dapat sepatu pada pertengahan kelas tiga SMA. Itu pun sepatu bekas yang sudah bolong bagian depan dan belakangnya. Cuma saya sudah sangat senang dan bersyukur sekali saat itu,” kata Dahlan. Entah karena rasa sayang terhadap sepatu itu, tidak jarang ketika berangkat sekolah, Dahlan menenteng sepatu dan memilih untuk tetap nyeker. ”Itu dilakukan biar sepatunya tidak cepat rusak,” kata Dahlan yang kemarin hadir ditemani dua orang cucunya, Ayrton Senninha Ananda dan Khalisha Salwa Dinata. Dalam launching yang disiarkan live

di JTV itu, Dahlan juga sempat mengajak masyarakat untuk tidak sekadar mengeluh terhadap keadaan. Terutama kemiskinan. “Kemiskinan bukan untuk dikeluhkan. Tetapi dilawan. Bagaimana caranya? Kerja keras sembari terus berdoa adalah jalan keluar terbaik,” ujar Dahlan yang langsung disambut aplaus dari ratusan masyarakat yang berkumpul di sana.Setelah novel Sepatu Dahlan yang sekarang sudah beredar di banyak toko buku, rencananya Khrisna dan penerbit Noura Books akan menjadikannya trilogi. Edisi kedua dan ketiga adalah Surat Dahlan dan Kursi Dahlan. ”Ini fasenya berbeda. Kalau Surat Dahlan banyak akan menceritakan bagaimana Pak Dahlan membangun kerajaan media dan sukses dalam berbisnis. Sedangkan buku ketiga akan berbicara mengenai Pak Dahlan yang juga sukses memimpin PLN serta sekarang menjabat sebagai menteri BUMN,” kata Khrisna. Sesudah tampil live, Dahlan yang kemarin menggunakan baju lengan panjang kuning berlapis kaus pendek berwarna biru muda serta dipadu dengan celana

training dan sepatu kets melayani permintaan tanda tangan di atas buku dari ratusan orang yang secara langsung membeli buku tersebut. ”Antre ya. Sabar. Semuanya insya Allah dapat,” ujar Dahlan. Kesempatan itu juga tidak disia-siakan oleh masyarakat untuk berfoto langsung dengan ayah dua anak tersebut. Bahkan, Rila Umila, salah seorang pesenam yang datang ke area CarFfree Day, cukup beruntung. Sebab, permintaannya untuk mendapatkan kaus berwarna biru muda yang dikenakan oleh Dahlan terkabul. ”Wah makasih banyak ya Pak Menteri,” kata Rila. Lantas, mau diapakan kaus tersebut? ”Nanti ini ndak saya cuci. Mau saya pajang di ruang tamu, Pak,” ujarnya sambil tertawa. Sebelum tampil live dalam acara launching novel Sepatu Dahlan, dengan semangat pria yang akun Twitter-nya @iskan_dahlan tersebut berbaur dengan masyarakat untuk mengikuti senam bersama yang dipimpin oleh instruktur dari hotel Mercure Grand Mirama Surabaya. (nji/c1/lk)

Perry Baringbing Aku ingin menjadi orang , yg tetap membuat orang terseyum hahahaha

Helena Angel Aku pgn jadi donatur besar di Indonesia n mnjdi wanita pling berpengaruh. Supaya bisa membantu sluruh anak2 Indonesia,rakyat Indonesia,apapun itu! N mengurangi tikus2 di INDONESIA!(Koruptor yg gak ada otak)

Jepri X-friends Manroe Jika aku menjadi seorang KORUPTOR maka aku akan membagi-bagi hasil korupsi ku kepada rakyat yang kurang mampu khususnya rakyat siantar

Nota Gea Jika aku menjadi cinta, aku akan menyentuh hati semua org agar saling mengasihi dan tidak ada kejahatan.

Kamp De Tissa Sinaga Jika aq menjd Presiden.. Kekayaan alam dan khas negara dibagi rata oleh rakyat... Tapi jika aku adlah insan yang slalu ada d hatinya... Aku tak akan membiarkan stetespun air matanya mengalir...

Ando Connect Juntak Ingin jd org sukses. Yr bsa mengangkat derajat kluargaqu.

Wulan Manik Duh,, pada mengkhayal smua y.. aq doain deh mudah2an t’kabul,, heheee.. hrs pake doa n usaha y,,

The Oracle Rebounds by Allison van Diepen Michaela “Kayla” Cruickshank bukan gadis SMA biasa. Umurnya baru 16 tahun tapi ia telah meretas jalan bisnis dengan membangun sebuah website yang menjajakan layanan konsultasi beragam persoalan seputar kehidupan percintaan remaja (dating) dengan nama samaran the Oracle. Pada tahun keduanya ini, Kayla harus menelan pil pahit ketika Jared, cowoknya dari setahun kemarin, justru meminta putus dengan alasan yang membuat Kayla gondok setengah mati. Maka dimulailah petualangan Kayla untuk membuktikan teori yang pernah ditulisnya tentang rumus memulai hubungan baru setelah putus dari hubungan yang lama. Nah, berdasarkan hitungan dari rumus yang dibuatnya itu, kayla membutuhkan waktu 62 hari sebelum ia bisa menjalin hubungan dengan cowok lain. Pada masa-masa itu, satu demi satu cowok masuk dalam kehidupannya. Tapi, nyatanya mencari cowok rebound nggak segampang yang ia kira. Belum lagi, secara tak terduga, website yang dikelolanya justru terjebak dalam kontroversi yang berpotensi menghancurkan reputasi yang sudah dibangunnya dari nol itu. Hmm, membaca teenlit karya Allison van Diepen ini memang manis-manis renyah. Yah, tak beda jauh sama kebanyakan teenlit lainnya, sih. Namun, karena background psikologi populer yang diemban si tokoh utama, tak jarang banyak selipan quotes yang cukup nendang buat para remaja sekalian yang sedang tersaput nuansa merah muda alias dalam masa-masa indah menjalin gita cinta dari SMA. Silakan disimak nasihat-nasihat love-

relationship by Kayla di buku ini. Yang kurang dari novel ini adalah dangkalnya penggalian konflik dan karakter yang ada. Masih hanya di permukaan saja. Bahkan, ending yang happy seolah menggampangkan semuanya. Cowok yang datang dan pergi selama masa ‘kepergian’ Jared di kehidupan Kayla terkadang serasa hanya tempelan belaka. Saya kurang bisa terisap ke dalam nuansa warna kehidupan remaja yang sejatinya penuh dengan goncangan jiwa itu...xixixi. Yang membuat saya bertahan untuk merampungkan novel ini adalah gaya menulis Allison yang lancar. Ceritanya ngalir, meskipun terkadang perpindahan satu adegan ke adegan yang lain berjalan kurang mulus. Contohnya pas bagian kedatangan seorang cowok exchange student ke rumah Kayla yang suddenly menggelenyarkan kisah asmara singkat di antara keduanya. Buat saya, bagian ini cepat dan kurang membawa arti bagi Kayla. Entahlah, sepertinya cara Allison menyajikan cowok-cowok rebound bagi Kayla kurang smooth dan terasa hanya untuk mengulur waktu untuk akhirnya mempersembahkan cinta sejati bagi Kayla. Sangat mudah tertebak. Sayang sekali. Bahkan, kehadiran teman-teman Kayla juga seolah hanya serupa pemandu sorak yang menggoyang pompom untuk memberikan dukungan pada Kayla tanpa memberikan makna yang cukup dalam bagi kehidupan Kayla. But, nyatanya saya malah penasaran untuk membaca buku sebelumnya, The Oracle of Dating, hahaha. Saya memang suka gaya menulisnya sih. Baiklah, selamat membaca, teman! (int)


22 Mei 2012


Maestro Siantar Permalukan PS Mayang 4-0

„ Tim Maestro Siantar yang siap meraih juara pada Sugiarto Cup 2012


„ Kegembiraan anak-anak Montpellier usai memastikan diri menjadi juara Liga1 Perancis1

MONTPELLIER meraih gelar juara Liga Prancis (Ligue 1) pertama kali dalam sejarah, setelah menang 2-1 atas Paris Saint-Germain di Auxerre pada pertandingan final yang berlangsung rusuh, Minggu. Situasi tak terkendali membut wasit menghentikan laga dua kali karena protes penonton. Tim urutan kedua Paris Saint-Germain mengeluarkan segenap kekuatan mereka memenangi pertandingan 21 di Lorient. Penundaan pertandingan di Auxerre membuat tim asuhan Rene Girard harus tahan nafas karena kesuksesan mereka musim ini masih belum pasti. Akhirnya Montpellier menyelesaikan musim ini dengan keunggulan tiga poin di atas PSG pada klansemen akhir, sehingga klub dari kawasan selatan itu —urutan ke-

14 pada kompetisi Ligue 1 musim lalu— meraih gelar besar pertama sejak Piala Prancis pada 1990. “Saya kira kami pantas mendapatkan gelar itu,” kata pelatih Montpellier Girard dalam wawancara di tepi lapangan setelah wasit meniup pluit panjang pada akhir permainan. “Ini benar-benar pertarungan keras dari awal hingga akhir. Jika melihat raihan poin, tiga klub teratas (Montpellier, PSG dan Lille) melakoni musim luar biasa,”

gemar melontarkan seloroh serta kutipan unik kepada media. Selain itu, Montpellier memiliki anggaran terkecil ke-13 dari seluruh peserta klub Ligue 1. Sementara, sejak digelar tahun 1893, kompetisi ini telah dimenangkan puluhan klub. Peraih terbanyak diduduki AS Saint-Étienne dan Olympique de Marseille dengan 10 gelar juara, Nantes 8, AS Monaco 7, Olympique Lyonnais 7, Stade de Reims 6, Girondins de Bordeaux 6, Standard Athletic Club 5, Roubaix 5, OGC Nice 4, Helvétique Marseille 3, Lille OSC 3, Le Havre 2, RCF Paris 2, FC Sochaux-Montbéliard 2, Sète 2, Paris Saint-Germain 2, Olympique Lillois 2, Club Français, Gallia Club Paris, Tourcoing, Saint-Raphaël, CA Paris, Stade Français, Rouen, Roubaix-Tourcoing, RC Strasbourg, AJ Auxerre, dan RC Lens masing-masing 1 gelar juara. (int)

„ Kegembiraan anak-anak Montpellier usai memastikan diri menjadi juara Liga1 Perancis

Spurs ke Final Wilayah Barat

„ Simon Santoso

Piala Thomas

Tujuh Pemain Disiapkan Lawan Inggris Simon Santoso akan menjadi tunggal pertama untuk menghadapi Inggris pada laga pertama Piala Thomas di Wuhan Sport Center Gymnasium, Senin (21/5/ 2012) malam ini. Indonesia harus menang untuk memastikan lolos ke perempat final. Di bagian ganda, Markis Kido/ Hendra Setiawan akan menjadi ganda pertama karena Muhammad Ahsan akan dimainkan ber-

katanya. Pertandingan cukup menegangkan, terlebih ketika Auxerre memecah jalan buntu lewat gol menit ke-20 di Stade Abbe Deschamps, ketika Olivier Kapo menggetarkan jalan gawang Montpellier dari arah pojok pertahanan lawan. Gol itu membuat Montpellier tidak akan berhasil meraih gelar musim ini. Tapi mereka berhasil menyamakan kedudukan pada menit ke-32 ketika John Utaka berhasil memanfaatkan umpan panjang dari rusuk kanan yang dilayangkan Suleymane Camara. Pendukung Auxerre melancarkan protes atas terdegradasinya tim mereka dengan melemparkan bola te-

nis dan benda lainnya ke lapangan pada awal babaka kedua, sehingga para pemain hasus kembali ke ruang ganti pakaian mereka. Ketika pertandingan dimulai lagi, Montpellier terlambat 19 menit dari laga LorientPSG dan dengan kemenangan PSG, berarti tim puncak Montpellier semakin grogi meneruskan permainan mereka. Lahir Juara Baru Riwayat Ligue 1 Prancis sebagai kompetisi yang banyak melahirkan juara baru kembali terjadi musim ini seiring kesuksesan Montpellier. Bisa dibilang Montpellier merupakan kejutan terbesar Ligue 1 musim ini, atau bahkan di Eropa. Tim asuhan Rene Girard terancam degradasi musim lalu dan menempati peringkat ke-14 klasemen akhir. Montpellier juga memiliki pemilik sekaligus presiden Louis Nicollin yang

sama Alvent Yulianto, bukan dengan Bona Septano. (int) SUSUNAN PEMAIN Tunggal: 1. Simon Santoso 2. Taufik Hidayat 3. Dionysius Hayom Rumbaka Ganda: 1. Markis Kido/Hendra Setiawan 2. Alvent Yulianto/Muhammad Ahsan

Keperkasaan San Antonio Spurs tidak terbendung. Spurs kembali membantai musuhnya dengan skor 4-0. Kali ini, Los Angeles Clippers yang menjadi korban. Spurs pun lolos ke partai final play-off NBA Wilayah Barat. Tim Duncan dan Tony Parker menjadi bintang Spurs dalam pertandingan di Staples Center, Senin (21/5) siang WIB. Duncan mengemas 21 angka, sedangkan Parker menambah lewat 17 poin. Spurs terus merajalela. Kemenangan ini, membuat Duncan dkk meraih total 18 kemenangan beruntun. Sementara untuk di babak play-off NBA musim ini, Spurs sudah mencatat rekor sempurna 8-0. Dari kubu Clippers, point guard Chris Paul mengemas angka tertitinggi dengan torehan 23 poin dan 11 assist, lalu ada Blake Griffin dengan 21 points, dan Eric Bledsoe menambah 17 poin di pertandingan ini. Clippers sempat memimpin lima menit sebelum pertandingan usai. Bledsoe menyumbang 11 poin beruntun untuk

TANAH JAWA- Penampilan brilian kapten kesebelasan Budi Siagian membawa tim Maestro Siantar mengalahkan PS Mayang Hutabayuraja dengan skor 4-0, Senin (21/5) di Stadion Balimbingan dalam lanjutan turnamen Sugiarto SE Cup. Meski sudah termakan usia, Budi Siagian masih mampu mencetak 3 gol di babak pertama. Gol keempat Maestro juga diciptakan Budi Siagian. Begitu babak pertama mulai, Budi Siagian yang mengemban ban kapten langsung menebar bencana ke daerah pertahanan PS Mayang. Dede, stopper Mayang jatuh bangun menahan gempuran lawan. Trio amunisi Maestro yang ditempati Tony, Acun dan Sapril tampil beringas memporakporandakan pertahanan lawan. Pemain tim Mayang yang sudah kalah mental pun dengan mudah dapat dilumpuhkan. Lapangan tengah praktis dikuasai pemain Maestro. Gol pertama Maestro tercipta di menit ke-3 oleh Budi Siagian lewat aksi individu yang mengundang decak kagum penonton. Budi mampu melewati lima pemain bawah lawan dan sekaligus menaklukkan kiper Mayang. Gol spektakuler ini disambut hangat ratusan penonton yang membanjiri lapangan. Kembali Budi Siagian mende-

monstrasikan keahliannya dengan mencetak dua gol tambahan. Budi yang mampu melucuti pemain bawah lawan langsung melarikan bola ke kotak pinalti Mayang. Melihat kiper Mayang yang salah posisi, Budi melesakkan bola ke sudit kiri gawang lawan. Hingga babak pertama usai dengan kemenangan Maestro 3-0. Di babak kedua, Mayang mulai menebar ancaman melalui penyerangnya Alim dan Rudy. Namun tetap tak mampu menaklukkan Wanda, kiper Maestro. Malah Budi Siagian yang berhasil lepas dari tekanan lawan dan berhasil melepaskan tendangan ke gawang Dony, kiper Mayang dan mengubah kedudukan menjadi 4-0 yang merupakan gol penutup. Seusai pertandingan, Anggota DPRD Simalungun Sugiarto SE mengatakan, hingga memasuki hari ke-7, pertandingan berjalan lancar. Emosi pemain dapat terkontrol dan penonton juga cukup kondusif. “Diharapkan situasi seperti ini terus berlanjut demi kesinambungan turnamen,” sebut Sugairto SE. Sementara, komisi pertandingan Lindung Pasaribu menerangkan, jadwal pertandingan berikutnya, antara lain Rabu (23/ 5) PS SMK Teladan vs PS Margasono, Gasta Tanah Jawa vs Marihat Utama. (iwa/ara)

„ Para pemain Pescara merayakan promosi ke Serie A

Pascara dan TorinoPromosi Zdenek Zeman sukses mengantarkan tim besutannya, Pescara promosi ke kompetisi Serie A untuk musim depan setelah menundukkan tuan rumah Sampdoria 3-1, Senin (21/5) dini hari WIB. Pescara menyusul Torino yang beberapa jam sebelumnya juga memastikan meninggalkan Serie B untuk bermain di Serie A. Sepanjang musim Pescara tampil konsisten sehingga hadiah promosi dinilai layak untuk mereka. Gianluca Caprari membuka gol kemenangan Pescara pada menit ke-18 usai menyelesaikan umpan Marco Verratti lewat serangan balik. Ciro Immobile mencetak gol kedua bagi Pescara pada menit ke-29. Caprari kembali memperbesar keunggulan Pescara setelah merobek gawang La Samp pada menit ke-61. Sampdoria baru bisa memperkecil kedudukan menjadi 3-1 tujuh menit sebelum laga usai melalui Juan Antonio. Pescara termasuk klub yang berkembang secara pesat dalam dua tahun terakhir. Pescara sempat bangkrut pada 2009 dan harus memulai lagi dari Lega Pro, tetapi terakhir kali mereka mencicipi kompetisi Seri A musim 1992-93. West Ham Promosi Sementara, di English Premier League, West Ham meraih tiket terakhir untuk promosi ke kasta tertinggi di Inggris, setelah mengalahkan Blackpool di partai

final play-off. West Ham menang 2-1. Setelah Reading dan Southampton memastikan promosi ke Liga Primer berkat finis satu dan dua secara berurutan di papan klasemen divisi Championship, satu tiket promosi yang tersisa pun diperebutkan oleh empat tim lain. West Ham, Birmingham City, Blackpool, dan Cardiff City menjadi empat tim yang berebut tiket sisa tersebut di fase play-off; di semifinal West Ham menghadapi Cardiff dan Birmingham bertemu Blackpool. Di partai semifinal itu West Ham menang telak 5-0 atas Cardiff sedangkan Blackpool menang 3-2 atas Birmingham. Di final, West Ham pun dihadapkan dengan Blackpool. Dalam pertandingan final playoff yang dihelat di Stadion Wembley, Sabtu (19/5/2012) waktu setempat, West Ham berhasil menang 2-1 berkat gol Carlton Cole (352 ) dan Ricardo Vaz Te (872 ), sedangkan Blackpool hanya bisa membalas lewat Thomas Ince (482 ). Dengan hasil tersebut maka West Ham akan kembali berkompetisi di Liga Primer musim depan, kasta teratas sepakbola di Inggris. Ini membuat The Hammers hanya menghabiskan satu musim di divisi Championship, setelah terdegradasi dari Liga Primer musim 2010-2011 usai jadi juru kunci klasemen. (int)

Sharapova Juara Italia Terbuka „ Para pemain San Antonio Spurs berhasil meloloskan timnya ke babak final wilayah barat membawa Clippers memimpin 90-85. Tapi, Spurs perlahan bangkit mengejar ketinggalan. Tembakan Duncan membawa Spurs memimpin dengan skor 96-94. Kemudian tidak lama kemudian, giliran Parker yang mencetak angka untuk memperlebar keunggulan menjadi 100-97, saat pertandingan tersisa 1 menit 47 detik lagi. Paul sempat membuat Clippers tertinggal hanya satu angka saja 100-99. Tapi, Danny Green dan Parker memastikan keme-

nangan Spurs lewat tembakan bebas. Kini, Duncan dkk menanti pemenang antara Oklahoma City Thunder melawan Los Angeles Lakers. Saat ini, Thunder memimpin 3-1. Di pertandingan lainnya, Miami Heat mampu menyamakan skor menjadi 2-2. LeBron James dkk mengalahkan Indiana Pacers 101-93. LeBron James menjadi penampil terbaik Heat dengan menorehkan 40 poin, 18 rebound dan sembilan assist. (oz/int)

MariaSharapovaberhasilmempertahankan gelar juara turnamen Italia Terbuka. Ia harus melewati pertarungan tiga set saat melawan Li Na di babak final. Dalam partai puncak yang dimainkan di kompleks olahraga Foro Italico, Minggu (20/5) malam WIB, Sharapova sempat berada dalam tekanan setelah kalah 4-6 di set pertama. Memasuki set kedua, petenis cantik asal Rusia ini bahkan tertinggal hingga 0-4. Tapi Sharapova mampu bangkit dan merebut set kedua dengan skor 6-4. Sharapova sempat unggul 4-1 di set ketiga sebelum berbalik tertinggal 4-5. Saat skor sama kuat 6-

6, hujan deras mengguyur arena dan memaksa pertandingan untuk dihentikan sementara waktu. Setelah 2,5 jam hujan, laga kemudian dilanjutkan ke tiebreak. Sharapova akhirnya memenangi set terakhir dengan skor 7-6. KemenanganinimembuatSharapova meraih gelar juara Italia Terbuka untuk kali kedua berturut-turut.Tahunlaluiajugamenjadi pemenang di turnamen yang sama. Gelar juara ini menjadi gelar kedua yang diraih Sharapova di tahun 2012 ini. Sebelumny, Sharapova sudah menjadi kampiun di Porsche Tennis Grand Prix bulan April lalu. (int)


22 Mei 2012


Setelah puasa gelar sejak 1990 dan terpuruk hingga ke Serie C karena bangkrut yang menerpa, akhirnya Napoli seperti terlahir kembali dengan kesuksesan meraih juara Copa Italy 2012. Bekas klub Diego Armando Maradona ini keluar sebagai juara setelah melumat Juventus dengan skor 2-0 di stadion Olimpico, Roma, Minggu (20/5). â&#x20AC;&#x153;Gelar juara ini bukan trofi pertama saya, tetapi ini adalah yang pertama sejak Napoli terlahir kembali,â&#x20AC;? ujar Presiden Napoli, Aurelio De Laurentiis, setelah timnya mengalahkan Juventus 2-0. Aurellio De Laurentiis telah membeli klub tersebut dan memulai lagi semuanya dari Serie C ketika Napoli dalam keadaan bangkrut. Partenopei tidak memenangkan trofi apapun sejak Piala Super Italia pada tahun 1990, sedangkan Coppa Italia terakhir yang diraih adalah pada 1987. â&#x20AC;&#x153;Klub ini terlahir kembali pada 2004 dan dalam beberapa tahun kemudian kami berhasil meraih kesuksesan di mana hal ini memberitahu dunia bahwa Napoli masih ada dan akan menjadi juara di dunia olahraga,â&#x20AC;? katanya. Sukses Napoli ini berkat dua gol dari Edinson Cavani serta Marek Hamsik di babak kedua. Bermain menekan sejak babak pertama, Napoli kerap menyulitkan Juventus. Setelah itu Juventus berulang kali mengancam gawang Napoli namun mereka tak bisa membobol gawang I Partenopei lantaran kecemerlangan De Sanctis. Begitu pula dengan Napoli yang juga gagal memaksimalkan sejumlah peluang, hingga pada akhirnya babak pertama ditutup dengan skor 0-0. Usa jeda, Napoli kembali mengambil inisiatif serangan dan berkali-kali mengancam gawang Juventus kawalan Marco Storari. Namun, lantaran penyelesaian akhir yang buruk, peluang pasukan Walter Mazzarri itu gagal dikonversi menjadi gol. Memasuki menit 63, wasit memberikan hadiah penalti kepada Napoli setelah Storari menjatuhkan Lavezzi di kotak terlarang. Cavani yang maju sebagai eksekutor dengan dingin menaklukkan Storari sekaligus memberikan keunggulan bagi Napoli. Tertinggal satu gol, Juventus terus menggempur pertahanan Napoli demi mencetak gol penyeimbang. Asik menyerang, Juventus malah kecolongan. Melalui sebuah serangan balik, Goran Pandev yang mencuri bola dari pemain Juventus, sukses memberikan umpan kepada Marek Hamsik dan berhasil dikonversi menjadi gol oleh gelandang asal Slovakia itu. Derita Juve makin bertambah setelah mereka harus bermain dengan 10 pemain setelah Fabio Quagliarella dikartu merah oleh wasit lantaran menyikut wajah Aronica. AS Roma-Juventus Terbanyak Peraih gelar juara Cpoa italy hingga saat ini masih didominasi tim ibukota Roma dan juventus. Keduanya telah meraih 9 gelar juara, disusul Inter Milan 7 kali, Fiorentina 6 kali, Torino 5 kali, AC Milan 5 kali, Lazio 5 kali, Sampdoria 4 kali, Napoli 4 kali, Parma 3 kali, Bologna 2 kali, Atalanta, Genoa, Venezia, Vado, dan Vicenza masing-masing 1 kali. Perpisahan Del Piero Akhir kurang memuaskan ini merupakan laga perpisahan Alessandro Del Piero, yang telah tampil bersama Juventus pada September 1993 silam. Hampir 19 tahun berseragam hitam putih, penyerang berusia 37 tahun tersebut telah tampil sebanyak 705 pertandingan internasional, memenangkan 19 piala termasuk Piala Dunia bersama tim nasional Italia tahun 2006. Selama membela Juventus, Del Piero mencetak 289 gol dan gol pertamanya dicetak dalam pertandingan kedua sebelum mengantongi hattrick pertama saat turun menjadi tim utama pada tahun 1993 silam. Dia juga langganan tim nasional Italia sejak tahun 1995, dengan 91 kali penampilan dan mencetak 27 gol. Kesetiaanya bersama Juventus juga teruji saat tetap bermain ketika Juventus dihukum turun kasta ke Serie B karena terlibat dalam skandal pengaturanskoryangmenyebabkankehilangangelarSerieAtahun2005 dan 2006. Setelah Juventus menyatakan tidak akan memperpanjang kontraknya, beragam spekulasi kini mengitari penyerang kelahiran Conegliano tersebut. Sejumlah klub Inggris seperti Arsenal, Tottenham dan Queens Park Rangers disebut-sebut tertarik dengan penyerang veteran tersebut termasuk klub AS LA Galaxy yang dilaporkan juga mengincarnya. (int)

Edisi 289 „ Tahun VIII

SELASA, 22 MEI 2012

Disekap 2 Malam ABG Dijadikan PSK BELAWAN- Seorang anak baru gede alias ABG, sebut saja Pelangi, disekap selama dua malam di salah satu barak. Perempuan tamatan SMP ini, juga dipaksa melayani tamu di diskotik. ‹ ‹ Baca

Disekap..Hal 2

Tabrak Tiang Listrik, Truk Lalu Masuk Parit SIBOLGA- Truk colt diesel pengangkut semen BK 8686 FY menabrak tiang listrik di pinggir Jalan Tarutung, Kampung Nias, Kelurahan Hutabarangan, Sibolga, Senin (21/5) sekira pukul 17.00 WIB hingga

tumbang. Sesaat kemudian truk tersebut masuk ke dalam parit. Pantauan METRO di lokasi, roda belakang kiri truk amblas masuk parit sedalam sekitar 30 ‹ ‹ Baca

Tabrak..Hal 2 „ Pelangi


„ M Reza Fahlevi dirujuk ke RSU Colombia Medan, Senin (21/5). Bocah malang ini tertembak di bagian kepalanya hingga tembus dari pistol milik ayahnya.


„ Truk colt diesel yang masuk parit.

Pendaftaran Praja IPDN Dibuka MEDAN- Warga Negara Indonesia (WNI), khususnya yang berusia maksimal 21 tahun (pelamar umum) dan 24 tahun (PNS) per 1 September 2012, terbuka peluang untuk menjadi Praja Institut Pemerintahan Dalam Negeri (IPDN) untuk

MANTAN istri Ahmad Dani, Maia Estianty mengaku masih trauma untuk kembali berumah tangga. Padahal, ibu Al, El, dan Dul itu dikabarkan pernah dekat dengan pria bule bernama Matteo. Pascabercerai dari A h m a d ‹ ‹ Baca

Masih.. Hal 7

tahun ajaran 2012/2013, tanpa terkecuali masyarakat Sumut. Untuk pendaftarannya mulai dibuka sejak Senin (21/5) sampai Rabu (30/5), berlokasi di masing-masing kantor bupati/ ‹ ‹ Baca

Oknum Polisi Teledor, Letak Pistol di Atas Meja

KEPALA BALITA DITEMBUS PELURU ACEH- Akibat keteledoran ayah, seorang anak mendapat celaka. Pasalnya, oknum polisi itu meletakkan senjata api di atas meja. Tanpa diduga pistol tersebut bisa diraih korban, serta menyalak. Dor...!

Sebutir peluru pun menembus batok kepala M Reza Fahlevi (4). Sang bocah kontan menggelepar, dengan kondisi darah segar membanjir di tubuhnya. Kejadian naas ini berlangsung di

Desa Blang Peuria Kecamatan Samudera, Aceh Utara, Senin (21/ 5) sekira pukul 10.30 WIB. Menurut keterangan dihimpun ‹ ‹ Baca

Kepala..Hal 2

Pengangguran Gantung Diri di Hari Ultah MEDAN- Diduga mengalami stres akibat ribut dengan istri, M Ambari (31) nekat mengakhiri hidupnya dengan gantung diri di dalam kamar dengan menggunakan seutas tali nilon, Minggu (20/5) sekira

Pendaftaran..Hal 2

pukul 22.30 WIB. Ironisnya, bapak dua anak ini gantung diri tepat di hari ulangtahunnya. Menurut informasi yang dihimpun Sumut Pos (grup Metro) di kepolisian menyebutkan, warga Jalan Sei Kera, Gang Pinang, Medan itu tewas dengan

leher terlilit dengan tali nilon yang diikat pada kusen pintu di joglo belakang rumah milik orangtuanya. Kali pertama, korban ditemukan Surya (35) abang ipar korban. Saat itu, ‹ ‹ Baca

Pengangguran..Hal 2

Reisa Kartikasari, Mantan Putri Indonesia Lingkungan yang Juga Anggota Tim DVI Polri

Bangga Tekuni Forensik, Tak Canggung Utak-atik Potongan Tubuh

Ribut-ribut Petral dan Prinsip C&C Kadang timbul. Kadang tenggelam. Kadang timbultenggelam. Begitulah isu korupsi di Pertamina. Siklus timbul-tenggelam seperti itu sudah berlangsung puluhan tahun. Belum ada yang mengamati: tiap musim apa mulai timbul dan mengapa (ada apa) tiba-

tiba tenggelam begitu saja. Sejak sekitar tiga bulan lalu isu itu timbul lagi. Belum tahu kapan akan tenggelam dan ke mana tenggelamnya. Sebenarnya menarik kalau bisa dirunut, mengapa (ada apa) isu itu kem‹ ‹ Baca

Ribut..Hal 2

Di antara puluhan anggota tim Disaster Victim Identification (DVI) RS Polri Kramat Jati yang tengah mengidentifikasi jasad korban Sukhoi Superjet 100, terdapat gadis cantik yang wajahnya sudah familier. Dia adalah Reisa Kartikasari, Putri Indonesia Lingkungan 2010. Mengapa dia di sana? SEKARING RATRI A, Jakarta


„ Reisa Kartikasari (kiri) bersama tim DVI Sukhoi Mabes Polri. Anton Castilani (baju polisi) direktur eksekutif DVI.

Keberadaan Reisa Kartikasari di tengah-tengah tim DVI Polri yang mengidentifikasi jasad korban Sukhoi cukup mencolok. Dengan wajah ayu serta tinggi badan 173 cm, Reisa menarik perhatian setiap orang yang ada di sana. Padahal, dia hanya mengenakan kaus biru gombrong dengan logo DVI. Bawahannya tak kalah simpel, hanya celana kain panjang berwarna senada. Wajahnya pun polos tanpa riasan. Reisa adalah salah satu anggota tim DVI Polri yang sudah lebih dari 10 hari ‹ ‹ Baca

Bangga..Hal 7


22 Mei 2012

Disekap 2 Malam, ABG Dijadikan PSK Sambungan Halaman 1 Keterangan yang dihimpun POSMETRO MEDAN (grup Metro) menyebutkan, selama enam bulan terakhir, Pelangi (18), warga PangkalanSusu,KabupatenLangkat bekerja sebagai pembersih barak di kawasan Canang, Belawan.Dan,beberapawaktulalu temannya dari Malaysia bernama Wulanmenghubunginyaviahand-

phone (Hp). Wulan menawarkan Pelangi ikut kerja ke Malaysia. Tergiur dengan pekerjaan sebagai karyawati salon dengan gaji yang lumayan, Pelangi menerima tawaran yang diberikan Wulan. Nah, Wulan yang juga menjadi korban trafficking ini pun menawarkan Pelangi untuk berangkat melalui jasa seorang pria bernama Emi yang menetap di Canang, Belawan. Pertemuan pun terjadi

antara mereka sekitar seminggu lalu, Emi langsung menawarkan Pelangi berangkat tanpa biaya dan persyaratan idenditas diri. Sekitar dua minggu kemudian (dari pertemuan itu), paspor pelancong menjadi dasar untuk masuk ke Malaysia diterima Pelangi. Dengan modal paspor pelancong, perempuan berkulit hitaminidiberangkatkankeMalaysia dengan angkutan laut lewat

Kepala Balita Ditembus Peluru Sambungan Halaman 1 Metro Aceh (grup METRO), ayah korban bernama Julyadi. Ia terdaftar sebagai anggota intel di Polres Lhokseumawe, serta berpangkat Brigadir. Kronologis awalnya saat Julyadi sedang sibuk, mengetik laporan dengan komputer di meja kerja rumahnya. Sementara pistol tergeletak di atas meja, tak jauh dari posisi duduknya. Tiba-tiba saja, Reza datang mendekat dan mengambil senpi tersebut. Karena mengira cuma mainan biasa, bocah malang ini tanpa sengaja menarik pelatuk, hingga pistol langsung menyalak. Suara letusan senjata di dalam rumah, sontak membuat Julyadi terkejut. Ia terperangah ketika

melihat anak kesayangannya sudah tergeletak di lantai dengan kondisi bersimbah darah. Dalam situasi panik, oknum polisi ini berteriak memanggil istrinya. Termasuk tetangga dan warga sekitar segera berhamburan ke dalam rumah. Mereka menyaksikan dan buru-buru mengevakuasi korban ke rumah sakit. Petugas medis di Instalasi Gawat Darurat (IGD) RSU Cut Meutia, Lhokseumawe cukup dibuat sibuk. Pasalnya, luka di bagian batok kepala Reza sangat parah. Darah pun tak berhenti mengucur, ditambah cairan otak yang sempat keluar. Oleh tim medis menyatakan belum sanggup untuk menangani, serta disarankan untuk dirujuk ke Medan. Dalam amatan Metro Aceh,

kondisi Reza terlihat sangat lemah. Ia sekarat dengan balutan perban di bagian kepala. Sementara ibu dan ayahnya menemani di sisi, selama mendapat perawatan medis. Di tengah kesedihan keluarga, Kasat Reskrim Lhokseumawe AKP Galih Indra Giri singgah ke rumah sakit. Pihaknya menyatakan turut berduka atas kejadian yang dialami anak anggotanya. Meski demikian, Kapolres Lhokseumawe AKBP Kukuh Santoso dan Kasat Reskrim AKP Galih Indra Giri, belum mau berkomentar ketika dihubungi Metro Aceh terkait peristiwa tersebut. Sedangkan bocah malang tersebut, dirujuk dari RSU Cut Meutia Lhokseumawe ke RSU Colombia, Medan. (jpnn)

Tabrak Tiang Listrik, Truk Lalu Masuk Parit Sambungan Halaman 1 cm. Sedangkan roda depan sebelah kiri tidak masuk parit. Posisi truk pengangkut semen 150 sak (8 ton) tersebut oleng. Tidak ada korban jiwa dalam peristiwa itu. DemakHutagalung(35)pemilik kedai di sekitar lokasi kejadian menyebutkan, peristiwa itu terjadi tiba-tiba. “Saya sendiri terkejut

mendengar suara tabrakan tiang listrik yang mengenai atap kedai. Ternyata truk colt diesel keluar dari jalur, hampir menabrak kedai saya yang berjarak kurang lebih tiga meter. Kalau bannya tidak nyangkut di parit, pasti mengenai kedai saya ini,” ungkapnya. Diutarakan Demak, saat kejadian itu truk melintas dari arah arahTarutungmaukearahSibolga.

Tiba-tiba laju truk oleng. Dan sesuai keterangan sopir truk kepada pemilik kedai, bahwa rem truk blong. “Makanya sopir banting setirnya ke sebelah kiri. Kebetulan tiang listrik ada di sana, dan menahan lajunya mobil,” ujarnya. Sopir truk sendiri saat hendak di temui METRO tidak lagi berada di lokasi kejadian. (saut)

Pengangguran Gantung Diri di Hari Ultah Sambungan Halaman 1 Surya bersama kakak korban dan ibu korban hendak masuk ke rumah. Namun, tiba di depan gerbang, terlihat pintu gerbang itu terkunci dengan gembok. Dari sana, Surya dan kakak korban pun memanggil-manggil korban guna membuka pintu. Setengah jam dipanggil, korban tak kunjung keluar membukakan pintu pagar besi berwarna hitam tersebut. Curiga dengan itu, Surya pun melompati gerbang coba mencari tahu apa sebenarnya

yang terjadi. Berhasilmelompatipagar,Surya pun coba membuka pintu utama rumah. Ketika dibuka pintu dalam keadaan tak terkunci, sedangkan korban sendiri tak didapati berada di dalam begitupun di dalam kamarnya. Penasaran, Surya pun melihat ke belakang rumah. Terkejut bukan main, Surya mendapati korban sudah tak bernyawa dengan kondisi tubuh tergantung. Menurut Dewi, korban sempat memberikan pesan singkat melalui SMS meminta kalau Ambaria sudah tiada, jasadnya

dikebumikan di pemakaman muslim di Jalan Jamin Ginting Medan. “Dirinya juga sempat memberikan pesan singkat dari SMS,” ujarnya. Masih Dewi, adiknya, baru ulang tahun ke-31. “Hariini(kemarin)diaulangtahun lah,” sebutnya. Kapolsekta Medan Timur KompolPatarSilalahimelaluiKanit Reskrim Polsekta Medan Timur AKP Ridwan membenarkan kejadian itu. “Iya, korban tewas dengan gantung diri, tanpa ada ditemukan kekerasan terhadap jasadkorban,ungkapRidwan.(gus)

KELUHAN ASAM URAT REDA BERKAT MINUM SUSU KAMBING MILKUMA Tanpa kita Milkuma bermanfaat untuk dan bahan pengawet. Bahan s a d a r i , semakin tingginya u s i a seseorang, imunitas tubuh pun menjadi berkurang, apalagi jika memiliki kebiasaan yang kurang sehat, seperti kurang menjaga pola makan, kemungkinan terserang penyakit menjadi besar. Oleh karenanya, mulailah dengan menerapkan kebiasaan-kebiasaan baik, salah satunya adalah minum susu Milkuma 2 gelas sehari. Saat ini, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu kambing milkuma. Berbeda dengan susu sapi, sesungguhnya susu kambing milkuma memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Susu kambing milkuma mengandung Riboflavin, vitamin B yang penting untuk produksi energi. Riboflavin (vitamin B2) memainkan sedikitnya dua peran penting dalam produksi energi tubuh. Kini, hadir Milkuma, minuman serbuk susu kambing yang diproses secara alami, tanpa pemanis buatan

dasarnya adalah susu kambing peranakan ettawa segar dan Gula Aren. Jonta Simamora, S.Pd, warga Kel. Sumber Jaya, Kec. Siantar, Martoba, Pematang Siantar, Sumatera Utara kini mengatasi asam urat yang selalu mengganggu aktifitasnya dengan Milkuma, "Sejak tahun 2000 saya menderita asam urat. Kaki kanan jadi bengkak dan jalan terpincangpincang." Ujar pria berusia 49 tahun tersebut. Lama berobat ke dokter, akhirnya ia tertarik mencoba Milkuma. Ternyata baru 3 bulan minum, kini kondisinya sudah sehat dan dapat menjalani aktifitasnya dengan nyaman, "Milkuma memang pilihan yang tepat. Selain rasanya enak, juga bermanfaat untuk mengatasi asam urat, sekarang kondisi saya sudah membaik." Terang guru tersebut. Memang di wilayah Sumatera Utara sangat rentan dengan cuaca karena perbedaan panas ke hujan datang secara tiba-tiba sehingga suhu udara menjadi pengaruh bagi mereka yang menderita asam urat. Ia pun kini mengajak orang lain untuk merasakan manfaat susu kambing milkuma ini, "Mari kita sehat bersama Milkuma." Ajak ayah 4 orang anak tersebut.

Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Tapanuli, Metro Siantar, Metro Asahan, Metro Tabagsel) Chairman : Rida K Liamsi Komisaris Utama : Makmur Kasim Komisaris : Kadafi Direktur Utama : Marganas Nainggolan Direktur : Goldian Purba Pengasuh Pemimpin Umum/Penjab/GM : Marganas Nainggolan Wa PU/Pimpinan Perusahaan :Maranatha Tobing Pj Pimred Metro Tapanuli : Pandapotan MT Siallagan Pimred Metro Siantar : Pandapotan MT Siallagan Pimred Metro Tabagsel : Muhiddin Hasibuan Pimred Metro Asahan : Eva Wahyuni Wapimred Metro Tapanuli : Daniel Simanjuntak Tim Ombudsman : Vincent Wijaya

menyembuhkan asam urat, menjaga daya tahan tubuh dan meningkatkan vitalitas. Fluorine yang terdapat dalam susu kambing milkuma bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan tidak menimbulkan dampak diare pada orang yang mengkonsumsinya. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Ditambah dengan kandungan Gula Aren bermutu tinggi sebagai pemanisnya, menjadikan Milkuma sebagai pilihan bijak untuk kesehatan. Untuk memperoleh hasil yang maksimal, terapkan pola hidup sehat seperti disiplin dalam pola makan, dan berolahraga, serta mengkonsumsi air putih paling sedikit 8 gelas/ hari. Dapatkan informasi lengkap tentang Milkuma di Milkuma sudah tersedia di apotek2 juga toko2 obat terdekat dikota anda, atau hubungi, Sumut : 085314072195 / 061-91128785. Depkes RI NO. PIRT.6.09.3328.01.395.

Tanjung Balai pada tanggal 10 Mei 2012. Tiba di negara tetangga, Pelangi terkejut karena langsung dititip dengan seorang pria India dan diajak ke sebuah barak tempat perkumpulan para pekerja seks komersil (PSK). “Begitu sampai di sana rupanya aku lihat kerjaannya tak betul. Bukan di salon malah disekap di barak. Aku tak boleh keluar tanpa didampingi majikan,” kata Pelangi didampingi orangtuanya, Abdul Muis (40) dan Icah (35), di Mapolres Pelabuhan Belawan, Senin (21/5). Merasa ditipu, korban berusaha menelepon keluarga dengan handphone (Hp) milik wanita yang juga ada di barak ter-

sebut. Selanjutnya, korban menjelaskan kepada keluarganya kalau ia telah dijebak untuk dijadikan PSK di Malaysia. Mendengar penjelasan itu, keluarga langsung berusaha menolong Pelangi agar bisa kembali ke Indonesia. Kemudian paman korban bernama Taufik yang juga pengurus Putra Bangsa Republik Indonesia (PBRI) Langkat ini, menelepon PBRI di Malaysia dan meminta pertolongan. Dan, setelah dua malam disekap, pada malam ketiga Pelangi dikeluarkan dari barak untuk dibawa ke sebuah diskotik menjumpai pria hidung belang yang akan dilayaninya. Nah, pada malam itu korban

difasilitasi Hp oleh majikannya untuk menelepon tamu yang beradadidiskotik.Takmauterjebak, Pelangi langsung menelepon keluarganya di Pangkalan Susu. Darikomunikasiitu,Taufiklangsung menyambungkan hubungan komunikasi Pelangi dengan PBRI di Malaysia dan konsultan yang ada di Malaysia. Malam itu juga Pelangi diperintahkan ke luar dari diskotik dan kabur dengan taksi. Caranya, korban memberikan Hp di tangannya kepada sopir taksi untuk berbicara dengan konsultan. Lalu, sopir taksi itu mengantarkan Pelangi ke tempat yang diminta konsultan. Setelah bertemu konsultan, malam itu juga korban

dipulangkan ke Indonesia. Disinggung apakah sempat bekerja sebagai PSK, Pelangi mengaku sejak tiba di Malaysia, ia disekap di sebuah kamar. Selama penyekapan, ia diberi makan dan tidakmengalamikekerasan.Hanya saja pada malam selanjutnya itu, korban diminta untuk melayani pria hidung belang. “Kalau tak kabur aku malam itu, ntah sudah jadi apa aku,” kata korban saat membuat pengaduan ke Polres Pelabuhan Belawan. Kasat Reskrim Mapolres Pelabuhan Belawan AKP Hamam, yang dikonfirmasi membenarkan laporan tersebut telah diterima oleh mereka. “Kita sudah terima laporannya, kasusnya akan segera kita lidik,” katanya. (ril)

Pendaftaran Praja IPDN Dibuka Sambungan Halaman 1 wali kota di Sumut. “Tahun ini, pemerintah kembali membuka lowongan Calon Praja IPDN TA 2012/2013. Warga masyarakat di kabupaten dan kota yang berminat, bisa mendaftar di kantor bupati/wali kota masing-masing,” ucap Sekretaris Daerah Provinsi Sumut Nurdin Lubis dalam pertemuan dengan seluruh Kepala Badan Kepegawaian Daerah (BKD) pemkab/pemko se-Sumut, di ruang Kenanga, Lantai VIII, Kantor Gubernur Sumut di Medan, Senin (21/5). Dijelaskannya, persyaratan pendaftaran antara lain, tinggi badan untuk pria minimal 160

cm dan wanita minimal 160 cm. Kemudian, berijazah SMA semua jurusan atau Madrasah Aliyah (MA) lulus tahun 2010, 2011 dan2012(pelamarumum)dengan nilai minimal 7,00 yang dibuktikan denganfotokopiijazah/STTByang dilegalisir kepala sekolah. “Syarat lainnya, tidak bertato atau bekas tato atau ditindik dan bekas ditindik telinganya atau anggota badan lainnya bagi pelamar pria, kecuali karena ketentuan adat/agama. Berikutnya, tidak menggunakan kacamata/lensa kontak sesuai unsur pemeriksaan kesehatan serta belum menikah/kawin/ hamil/melahirkan dan sanggup tidak menikah selama dalam mengikuti pendidikan yang

diketahui orangtua/wali yang disahkan oleh kepala desa/lurah setempat,” beber Nurdin. Syarat lainnya, calon bersedia diberhentikan tanpa menuntut di muka pengadilan melalui PTUN jika melakukan tindakan kriminal, mengonsumsi maupun menjual belikan narkoba, melakukan perkelahian, pemukulan dan pengeroyokan, serta melakukan tindakan asusila yang berdampak hukum atau tidak yang dinyatakan secara tertulis di atas kertas bermaterai Rp6000. Menyangkut tahapan seleksi di tingkat provinsi, Nurdin merincikan, untuk seleksi adminstrasi/ verifikasi tanggal Kamis (31/5) sampai Senin (4/6). Kemudian tes psikologi 13-16

Juni, tes kesehatan dan kesemaptaan 9-14 Juli, tes akademik 4 Agustus, serta penentuan akhir (pantukhir) oleh Kampus IPDN Jatinangor, Jawa Barat pada 1921 September 2012. Sementara itu, Kepala BKD Provsu Suherman menambahkan pihaknya berharap kabupaten dan kota segera mengirim data warga daerahnya, yang akan mendaftar calon praja secepat mungkin. Hal ini untuk kemudahan kompilasi data editing yang akan dikirim ke Jakarta. “Selain itu kita sangat berharap daerah bisa mematuhi ketentuan dan syarat yang berlaku. Bila tidak akan dibatalkan oleh pemerintah pusat,” jelasnya. (ari)

Ribut-ribut Petral dan Prinsip C&C Sambungan Halaman 1 bali muncul tiga bulan lalu. Ada kejadian apa dan siapa yang kali pertama memunculkannya. Dari sini sebenarnya akan bisa diduga kapan isu tersebut bakal tenggelam dan bagaimana cara tenggelamnya. Kadang isu yang muncul di sekitar sewa tanker. Kadang di sekitar ekspansi Pertamina di luar negeri. Kadang pula, seperti sekarangini,soalanakperusahaan Pertamina yang bernama Petral. Petral adalah anak perusahaan yang 100 persen dimiliki Pertamina. Tugasnya melakukan trading. Jual-beli minyak. Lebih tepatnya membeli minyak dari mana saja untuk dijual ke Pertamina.Semuaaktivitasitudilakukan di Singapura. Petral memang didesain untuk didirikan di Singapura. Sebagai perusahaan Singapura, Petral tunduk kepada hukum Singapura. Isupertama:Mengapadibentuk anak perusahaan? Kedua: Mengapa di Singapura? Dulu segala macam pembelian itu dilakukan oleh induk perusahaan Pertamina di Jakarta. Apakah ketika itu tidak ada isu korupsi? Sama saja. Isunya juga luar biasa. Tapi, mengapa dipindah ke Singapura? Dan dilakukan anak perusahaan? Alasan pembenarnya adalah: supaya segala macam pembelian dilakukan oleh sebuah perusahaan trading. Direksi Pertamina jangan diganggu oleh pekerjaan trading. Alasan tidak formalnya: Kalau transaksi itu dilakukan di Singapura dan tunduk kepada hukum Singapura, intervensi dari mana-mana bisa berkurang. Bagi orang korporasi seperti saya, sangat gampang menerima logika mengapa dibentuk anak perusahaan dan mengapa di Singapura. Tapi, bagi publik, bisa saja dianggap mencurigakan. Bagi publik, munculnya pertanyaan (mengapa dibentuk anak perusahaan dan mengapa di Singapura) itu saja sudah sekaligus mengandung kecurigaan. Pertamina memang bisa membuktikan praktikdiPetralsudahsangat clean dengan tender internasional yang fair. Tim-tim pemeriksa yang dikirim ke sana tidak menemukan praktik yang menyimpang. Kalau begitu, apa yang masih

DIVISI PRODUKSI Departemen Redaksi Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Eva Wahyuni, Muhidin Hasibuan, Daniel Simanjuntak, Leonardus Sihotang, Syafruddin Yusuf, Nurjannah, Hermanto Sipayung. Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Masril Rambe (koresponden Barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput). Sekretaris Redaksi: Yanti Nurhapni METRO SIANTAR Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta) Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). METRO TABAGSEL Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina).

diperlukan? Di sini kelihatannya bukan hanya clean yang perlu dipertunjukkan. Tapi, juga clear. PerusahaanBUMNmemangtidak cukup dengan clean, tapi juga harus C&C. Harus clean and clear. Clean berurusan dengan GCG (good corporate governance), hukum, dan penjara. Clear berhubungan dengan public trust alias kepercayaan publik. Perusahaan yang tidak clear tidaklahmelanggarhukum.Semua bisa dipertanggungjawabkan. Tapi, perusahaan yang tidak clear tidak akan mendapatkan kepercayaan publik. Karena BUMN adalah perusahaan milik publik, praktik C&C menjadi sangat penting. Di manakah letak belum clearnya praktik trading Petral di Singapura? Begini: Pertamina adalah perusahaan yang sangat besar. Bahkan terbesar di Indonesia. Sebagai perusahaan terbesar, posisi tawar Pertamina tidak akan ada bandingannya. Boleh dikata, dalam bisnis Pertamina memiliki hak mendikte: mendikte apa saja, termasuk mendikte pemasok dan bahkan mendikte pembayaran. Inilah yang belum clear:Sebagai perusahaan terbesar, mengapa Pertamina belum bisa mendikte? Mengapa masih berhubungan dengan begitu banyak trader? Mengapa tidak sepenuhnya melakukan pembelian langsung dari pemilik asal barang: membeli BBM langsung dari perusahaan kilangdanmembelicrude(minyak mentah) langsung dari perusahaan penambang minyak? Dalam satu bulan terakhir tiga kali Presiden SBY mengajak mendiskusikan soal itu dengan beberapa menteri. Termasuk saya. ArahanPresidenSBYjelasdantegas bagi saya: benahi Pertamina. Kalau ada yang mengaku-ngaku dapat beking dari presiden atau dari Cikeas atau dari istana, abaikan saja. Bisa saja ada yang mengaku-ngaku mendapat beking dari Presiden SBY. Tapi, sebenarnya tidak demikian. Jangankan Presiden SBY, saya pun, dibidanglain,jugamendengarada orang yang mengatakan mendapat beking dari menteri BUMN! Presiden SBY juga menegaskan itu sekali lagi minggu lalu. Dalam pertemuan menjelang tengah

malam itu diundang juga Dirut Pertamina Karen Agustiawan. Karen melaporkan sudah siap melakukan pembelian langsung, tanpa perantara lagi. Tentu diperlukan persiapan-persiapan yang matang. Tidak bisa, misalnya seperti yang diinginkan beberapa pihak, besok pagi Petral langsung dibubarkan. Pasokan BBM bisa terganggu. Dan bisa kacau-balau. Memang kelihatannya banyak motif yang berada di belakang isu Petral itu. Setidaknya ada tiga motif: 1) Ada yang dengan sungguhsungguhdanikhlasmenginginkan Pertamina benar-benar C&C dan bisa menjadi kebanggaan nasional. 2) Dengan adanya Petral, mereka tidak bisa lagi ‘ngobjek’ dengan cara menekan-nekan Pertamina seperti yang terjadi di masa sebelum Petral. 3) Ada yang berharap kalau Petral dibubarkan, jual-beli minyak kembali dilakukan di Jakarta dan mungkin bisa menjadi objekan baru. Tentu, seperti juga bensin oplos, ada juga campuran lain: politik! Ada politik anti pemerintah Presiden SBY. Tapi, yang keempat itu baiknya diabaikan karena politik adalah satu keniscayaan. Misalnya, ketika ada yang menyeru: Bubarkan Petral sekarang juga! Saya pikir, yang dimaksud sekarang itu ya pasti ada tahapannya. Ternyata tidak. Ternyata benar-benar ada yang menginginkan Petral bubar saat ini juga. Mereka tidak berpikir panjang, kalau Petral bubar sekarang, siapa yang akan menggantikan fungsi Petral. Siapa yang akan mendatangkan bensin untuk keperluan bulan depan dan beberapa bulan berikutnya. Mungkin memang ada maksud terselubung: Bubarkan Petral sekarangjugabiarterjadikelangkaan BBM dan terjadilah gejolak sosial. Itu mirip-mirip dengan logika: Jangan naikkan harga BBM dan pemakaiannya juga jangan melebihi 40 juta kiloliter setahun! Logika Joko Sembung yang tidak nyambung. Tentu saya tidak akan terpancing pemikiran pendek seperti itu. Yang harus dilakukan Pertamina adalah langkah yang lebih mendasar: Sebagai perusahaan raksasa, Pertamina, seperti ditegaskan Presiden SBY setegastegasnya, tidak boleh lagi membeli minyak dari perantara. Langkah

METRO ASAHAN Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang). Departemen, Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS. Kordinator Teknisi, Maintenance IT: Irwan Nainggolan. Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria. Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika. Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman. Staf Pengembangan: Simson Winata, Roy Amarta, Ismail, Efendi Tambunan. Kordinator Ekspedisi: Jhon Tua Purba. Staf Ekspedisi: Nico, Ardi, Erik. Departemen Iklan Manager Iklan: Jamot S. Kord Iklan: Bambang Satria, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf

sepertiitusebenarnyasudahmulai dilakukan oleh Pertamina. Tapi, belum semua. Jadinya tenggelam oleh pembelian yang masih dilakukan lewat Petral. Apakah kelak setelah Pertamina tidak lagi membeli minyak dari perantara, otomatis tidak akan ada yang dipersoalkan? Tidak dijamin. Akan terus ada yang mempersoalkan. Misalnya: 1. Mengapa membeli langsung kalau pedagang bisa memberikan harga lebih murah? (Dalam dunia bisnis, tidak dijamin pemilik barang menjual lebih murah daripada pedagang. Bisa saja pedagang kuat membeli barang dalam jumlah besar dengan diskon yang tinggi. Lalu, menjual kepada konsumen dengan harga lebih murah.) 2. Pertamina (atau siapa pun) dapat komisi dari pemilik barang. 3. Mengapa membeli langsung kepada pemilik barang? Mengapa tidak pakai tender terbuka saja? Dan banyak lagi yang masih akan dipersoalkan. Sebab, pada dasarnya memang banyak orang yang hobinya mempersoalkan apa saja. Tapi, ribut-ribut seperti itu tidak akanlama.Syaratnya,manajemen Pertamina terus secara konsisten menjaga integritas. Tidak mudah memang.Danmemerlukanwaktu yang panjang untuk membuktikan konsistensi itu. Tapi, dalam menjaga integritas ituPertaminatidakakansendirian. Perkebunan sawit BUMN juga harus melakukan hal sama. Misalnya dalam pembelian pupuk. Sebagai perusahaan perkebunan terbesar di Indonesia, tentu aneh kalauPTPNmasihmembelipupuk dari perantara. Perkebunan gula idem ditto. PLN juga harus membeli batu bara langsung dari pemilik tambang. Dan itu sudah dilakukan sejak dua tahun lalu: Semua pemasokadalahpemiliktambang. Tidak ada lagi perantara batu bara di PLN dalam dua tahun terakhir. Awalnya memang ribut-ribut terus, tapi sekarang sudah kempis. Inilah prinsip yang harus dipegang: Dengan clean, kita memang tidak akan masuk penjara secara fisik. Tapi, dengan clear, kita tidak akanmasukpenjarasecararohani. Hukum cukup menghendaki clean. Publik menghendaki clean and clear. (*)

Desaign:Reliston Purba Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi. Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat. Perwakilan Metro Asahan Ka Perwakilan/Ka Biro Usaha: Darwin Purba. Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa. Kuasa Hukum: Binaris Situmorang SH Tarif Iklan: Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan: Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp: (0622) 7553511, Fax (0622) 7553501 Siantar. e-mail: Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak: PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733.



22 Mei 2012

Kapoldasu Kunjungi PT PAS dan PT Mujur Timber SARUDIK –Di sela-sela kunjungannya ke Sibolga dan Tapteng, Kepala Kepolisian Daerah Sumatera Utara (Kapoldasu), Irjen Pol Drs Wisjnu Amat Sastro, beserta rombongan menyempatkan diri mengunjungi PT Putra Ali Sentosa (PAS) dan PT Mujur Timber Tapteng, Senin (21/5) sekira pikul 14.30 WIB. Di PT PAS selaku perusahaan yang bergerak di bidang perikanan danproduksiikaneksportini,rombongan Kapoldasu yang didampingiBupatiTaptengRajaBonaran Situmeang SH MHum, Kapolres Tapteng AKBP Dicky Patrianegara, dan Kapolres Sibolga Kota AKBP

Joas Feriko Panjaitan, disambut langsung pimpinan PT PAS, Adely Lis dan abang kandungnya Arsyad Lis. Dalam kunjungan itu Kapoldasu meninjau dermaga, kemudian ke tempat produksi ikan eksport, Loins (Pengolahan ikan menjaditinggaldaging),kemudian

ke packing dan cholroom tempat pembekuan ikan. Dari pantauan METRO, Kapoldasu dan rombongan terlihat serius mengamati dan berbincang dengan pimpinan PT PAS Adely Lis. Mulai dari cara proses hingga hasil akhir produk daging ikan. Dalam kesempatan itu, Adely Lis menunjukkan beberapa hasil produkyangsiapdikirimkeluarnegeri, seperti sotong, kakap merah, ikan layur serta lobster mutiara yang sudah di packing dan rencananya akan segera diekspor ke Cina. Sebelum meninggalkan kawasan PT PAS Tapteng, Kapoldasu

bersilaturahmi ke rumah pimpinan PT PAS yang disambut nyonya Adely Lis, Kurniati Sri Dewi. Setelah kunjungan ini, peninjauandilanjutkankePTMujurTimber yang berada di Jalan SibolgaBarus, Desa Mela, Kecamatan TapianNauli,Tapteng.Sekirapukul 16.30 WIB, rombongan tiba dan disambut manejer produksi PT MujurTimber,IrBigardanlangsung diarahkan ke tempat pengolahan kayu menjadi triplek eksport. Setelah 50 menit berada di PT Mujur Timber, rombongan Kapoldasu dan Bupati Tapteng pun menyudahi kunjungannya .(fred)

Seminar Paskah Katolik Dekanat Tapanuli (FOTO : FREDDY)

„ Adely Lis didampingi abangnya Arsyad Lis saat menunjukkan hasil produksi siap eksport kepada Kapoldasu Irjen Pol Drs H Wisjnu Amat Sastro bersama Bupati Tapteng dan rombongan lainnya.

Tingkatkan Peran Awam di Politik & Pemerintahan


SEMINAR- (dari kiri) Uskup Mgr Ludovicus Simanullang, Dr Cosmas Batubara, dan Oloan Simbolon ST tampil sebagai pembicara di Seminar & Dialog Interaktif Paskah Umat Katolik Dekanat Tapanuli Keuskupan Sibolga, Sabtu (19/5). PANDAN- Peran awam umat Katolik di bidang politik dan pemerintahan diakui telah menurun. Karena itu, Sinode telah memutuskan untuk menggalakkan pastoral politik, agar lahir para awam yang berani terjun ke dunia politik dan mengusahakan kesejahteraan umum. “Memajukan kesejahteraan umum adalah tugas setiap orang Kristiani. Mengabdikan diri

"SEKARANGTANGAN DAN KAKI SAYASUDAH TIDAK CUCUK-CUCUK LAGI" K e l u h a n karena asam urat kin i sudah tidak l a g i dirasakan D u ng d u ng N u r w a t iA ri to na ng. P a d a h a l, s u d a h 1 tahun, wanita berusia 43 tahun tersebut mengeluhkan kesehatannya terganggu karena asam urat. Kira-kira apa rahasianya? Ketika ditemui di kediamannya di Desa Tanjung Gusta, Kec. Sunggal, Kab. Deli Serdang, Sumatera Utara, ia menjawabnya, "Sudah 1 tahun terakhir ini saya menderita asam urat dan telah lama berobat, namun sakitnya masih datang dan pergi. Tapi setelah saya minum Gentong Mas selama 6 bulan, sekarang kaki dan tangan saya sudah tidak cucuk-cucuk lagi," tuturnya menceritakan pengalaman baiknya tersebut. Gentong Mas adalah minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda) terbukti memiliki banyak manfaat untuk kesehatan. Dulu, ketika sakitnya kambuh, ibu 5 orang anak ini selalu merasakan tangan dan kakinya s a k i t . Ta p i k i n i , s e m u a n y a

berubah. Dengan tubuh yang sehat, ia pun dapat menjalani aktifitasnya sehari-hari sebagai PNS dengan nyaman dan tidak segan-segan membagi pengalaman sehatnya dengan orang lain. Asam urat bukanlah nama suatu penyakit, namun ia adalah suatu zat sisa metabolisme zat yang bernama purin yang berasal dari makanan yang kita konsumsi. Keadaan dimana tubuh mengalami kelebihan kadar asam urat disebut hyperuricemia. Pada kondisi normal, kelebihan purin ini akan dikeluarkan melalui urine dan feses. Namun jika purin yang masuk dalam tubuh terlalu banyak, maka ginjal akan kesulitan mengeluarkan zat tersebut sehingga terjadi penumpukan sisa metabolismenya (asam urat). Penumpukan sisa metabolisme zat purin di persendian dapat menyebabkan bengkak dan rasa nyeri. badan terasa linu, nyeri terutama di malam hari atau pagi hari saat bangun tidur, sendi terlihat bengkak, kemerahan, panas dan nyeri luar biasa pada malam dan pagi, timbul benjolan-bejolan kecil dari mulai sebesar biji beras sampai kacang hijau di daun telinga bawah (tofus) adalah gejalagejala asam urat. Habbatussauda yang dikandung

dalam Gentong Mas bermanfaat untuk menormalkan metabolisme, termasuk metabolisme purin sebagai pembentuk asam urat yang dipercaya dapat meningkatkan pengeluaran asam urat dari darah melalui urine. Sementara, Gula Aren selain rasanya manis dan lezat juga bermanfaat untuk menurunkan penyerapan lemak dan perbaikan sistem saraf. Untuk hasil maksimal, control makanan yang dikonsumsi dan banyak minum air putih, sekitar 8 gelas sehari. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/ toko obat terdekat atau hubungi: Medan : 081384777787 Sidikalang: 081384777787 Dolok Sanggul : 081384777787 Gunung tua : 081384777787 Batubara : 081384777787 Tobasa : 0813 8477 7787 Nias : 0813 8477 7 7 8 7 Te b i n g Ti n g g i : 0 8 1 3 2209 9495 Siantar : 0 8 2 1 6 7 5 3 8 8 4 8 B i n j ai : 0 8 1 3 9866 6166 Lbk Pakam : 082164659699 Karo : 0821 6753 8828 Langkat : 0812 6321 7797 Kisaran : 0623 7014 362 Tj. Balai : 0812

kepada kesejahteraan umum dengan tindakan nyata. Mereka yang cakap dan berbakat hendaknya menyiapkan diri untuk mencapai keahlian politik, yang sukar selaigus amat luhur, tanpa memperhitungkan kepentingan pribadi atau keuntungan materiil, melainkan unutk kesejahteraan umum,” papar Uskup Keuskupan Sibolga, Mgr Ludovicus Simanullang OFM Cap dalam paparannya di Seminar &

Dialog Interaktif dalam rangka Perayaan Paskah Bersama Umat Katolik Dekanat Tapanuli Keuskupan Sibolga Tahun 2012, di Gedung Serbaguna, Jalan Dr FL Tobing Pandan, Tapteng , Sabtu (19/5). Seminar bertema “Sosial Kemasyarakatan dan Politik Umat Katolik” itu juga menghadirkan pembicara di antaranya mantan menteri RI Dr Cosmas Batubara, Ketua Pemuda Katolik Komda Sumut Oloan Simbolon ST, Pengajar hukum dan HAM, advokat, dan pekerja politik hukum Nikolas Simanjuntak SH MH, serta Hakim Pengadilan Tinggi Khusus Surabaya yang juga mantan Ketua PN Sibolga Antonius Simbolon SH MH. Dr Cosmas Batubara dalam makalahnya berjudul “Peningkatan Peran Awam Katolik pada Millenium Kini dan Masa Mendatang dalam Membangun Bangsa dan Negara”, memaparkan soal kelebihan sekaligus persoalan bangsa secara umum. Juga soal peta, sistim dan aturan perpolitikan di Indonesia sekarang. Yang dikaitkan dengan bagaimana peluang dan peranan awam Katolik di

bidang poltik dan pemerintahan. Sementara Oloan Simbolon ST, yang kini juga sebagai anggota DPRD Sumut, lebih pemaparan tentang peluang dan keberanian kaum muda Katolik untuk terjun ke dunia politik, baik sebagai anggota legislative maupun untuk menjadi kepala daerah. Di mana supaya Katolik juga menempati posisi sebagai pembuat dan penentu kebijakan pemerintah. Sementara itu Nikolas Simanjuntak SH MH dalam makalahnya yang berjudul Politik & Konstitusi Dalam Peran Partai & Uang, memaparkan soal bagaimana poltik uang dan etika sosial. Kemudian soal posisi etika dalam partai politik normative, kekuasaan dalam sistim hukum, soal sisitim politik Indonesia, dan tentang politik hukum dalam praktis sistim kenegaraan. Seminar diikuti oleh para pelajar, pemuda Katolik, umat katolik di Sibolga dan Tapteng, para suster, pastor, serta utusan dari gereja Katolik se-Dekanat Tapanuli Keuskupan Sibolga. (mor/nasa)


22 Mei 2012

APA KATA MEREKA Reformasi di Indonesia yang sudah berjalan selama 14 tahun belum membuahkan hasil maksimal. Salah satunya yakni pemberantasan korupsi yang masih jalan di tempat serta masih tebang pilih. Selain itu, reformasi birokrasi juga dinilai masih stagnan.

Setiap inspektur jenderal (irjen) kementerian dan lembaga (K/L) harus berperan aktif mengawasi penyelewengan-penyelewengan yang dilakukan PNS. Pengawasan tersebut tidak hanya meliputi penyelewengan biaya perjalan dinas tetapi semua pos yang rawan penyelewengan.

KPK merupakan satusatunya hasil reformasi yang berhasil menunjukkan kinerja sungguh-sungguh. Sementara lembaga lain yang dibentuk setelah reformasi tidak menunjukkan prestasi sebagus KPK.

Ketua Umum PBNU KH Said Aqil Siroj, Senin (21/5)

Menteri Keuangan Agus Martowardojo, Senin (21/5)

Ketua Komisi III DPR Benny K Harman, Senin (21/5)

Kirim Opini Anda ke email: metrotapanuli Maksimal tulisan 5.000 karakter.

Sikap Kami Menantikan Berkah Wisatawan PULAU Komodo sudah resmi menjadi salah satu New7 Wonders of Nature. Hal ini pantas menjadi kebanggaan seluruh bangsa, setelah sebelumnya terjadi silang sengkarut terkait kredibilitas lembaga New7 Wonder. Apa yang sudah diraih oleh Pulau Komodo tentu saja menjadi pekerjaan rumah tersendiri bagi stakeholder di bidang pariwisata. Kita semua berharap, limpahan berkah akan segera datang ke pulau tersebut, yang diharapkan akan berdampak sistemik ke perbaikan perekonomian masyarakat. Namun, sepertinya limpahan berkah ini tidak bisa begitu saja jatuh dari langit. Pemerintah pusat dan pemerintah daerah bersama stakeholder pariwisata nasional harus bekerja keras untuk mempersiapkan berbagai hal terkait infrastruktur seperti jalan raya, hotel/penginapan, maupun juga masyarakatnya. Tentu kita ingin mengejar ketertinggalan pariwisata di Tanah Air dengan negara tetangga seperti Thailand, Malaysia, maupun Singapura. Negeri-negeri tersebut sebenarnya kalah banyak obyek wisatanya dibandingkan dengan Indonesia, namun jumlah wisatawan yang datang, hampir dua kali lipat lebih banyak. Kenapa? karena memang infrastruktur pariwisata di negeri-negeri itu sudah sangat bagus. Tidak hanya itu, rupanya mereka mampu menawarkan sensasi dan imajinsasi tersendiri ketika berwisata ke negaranya. Wisatawan seperti dihipnotis dengan kesadaran semu bahwa belum keren jika belum melancong ke Thailand, Kuala Lumpur, atau Singapura. Di sinilah peran marketing sangat menentukan. Paket-paket wisata di Tanah Air harus bisa dijual ke wisatawan asing. Mereka harus dibuat tertarik mengunjungi Danau Toba, Bukit Tinggi, Pulau Komodo, Bandung, Yogyakarta, Wakatobi, Raja Ampat, Lombok, Bali, atau daerah lainnya. Paket wisata lintas daerah sepertinya menarik untuk ditawarkan. Sejauh ini aspek marketing dan promosi wisata di Tanah Air memang masih kalah jauh dibandingkan dengan negara tetangga. Bahkan di sejumlah kedutaan besar pun, tidak ada sama sekali sekadar brosur untuk menjual paket wisata di Jamrud Katulistiwa ini. Melihat kondisi riil dunia pariwisata di Tanah Air saat ini, sepertinya kerja keras dari semua komponen sangat diperlukan. Awarding yang sudah diberikan untuk sejumlah kawasan wisata di Tanah Air, seperti Pulau Komodo, tidak seketika menjadi berkah, jika tidak dilakukan langkah progresif dalam pembenahan di dunia pariwisata Tanah Air. Semoga, keindahan alam dan keindahan flora-fauna Indonesia, bisa mendatangkan berkah buat masyarakat kita. (n/*)

Kebangkitan Nasional dan Pendidikan Politik 20 Mei 1908 kita yakini sebagai tonggak sejarah bangsa ini dari keterpurukan yang substansial. Yaitu keterpurukan mental, di mana penjajahan dan penindasan oleh bangsa kita saat itu seolah menjadi takdir yang sudah selayaknya kita terima sebagai bagian dari eksistensi kelahiran setiap anak-anak negeri ini. Budi Utomo adalah salah satu simbol dominan atas kesadaran dan semangat yang tiba-tiba bangkit dan mengingatkan khalayak bahwa hakikat dari keberadaan manusia adalah bebas dan merdeka.

Habibi BK Lebihdariseratustahunberlalu,dimanalembar demi lembar sejarah panjang kemerdekaan telah kita buka dan kita tulisi dengan tinta pemikiran, sikap dan gaya hidup kita sebagai sebuah bangsa. Naik turun para penguasa yang menghiasi rodaroda perjalanan pemerintahan Republik Indonesia, mungkin memberi kita sedikit hikmah saat membaca berbagai fenomena, bahwa kemerdekaan sebagai tujuan utama atau spirit dari kebangkitan nasional ternyata hanya sekedar awal yang masih banyak menuntut darah dan kerja kita anak-anak revolusi. Telah seabad lebih kebangkitan bangsa ini kita peringati, namun saya rasa nilai-nilai yang terkandung di dalamnya masih tetap krusial untuk dijadikan cermin dan pemicu semangat perubahan serta kebangkitan kembali bangsa yang seolah terperosok kembali ke dunia penjajahan wajahbaruyaituneomaterialisme,neokapitalisme dan neoatheisme. Mungkin banyak diantara kita yang tidak merasakannya selain hidup menjadi semakin tak terarah, ketidakpuasan akan materi yang tak kunjung usai serta agama yang hanya menjadi simbol tanpa panghayatan. Tidak pula kita menyadari, entah kapan pastinya terjadi, tibatiba gaya hidup anak-anak kita telah banyak berubah menjadi sama sekali tidak kita kenal, jauh dari nilai-nilai yang tiap hari diajarkan (oleh mulutmulutkitaparaorangtua,tapimungkinbelumoleh hati). Apa yang sebenarnya terjadi pada tahun 1908 sehingga kita menyebutnya sebagai hari kebangkitan nasional? Saya coba untuk membuka lembar demi lembar catatan sejarah, mempelajari

danmengambilpemahaman.Sayamelihatbahwa pada saat itu terjadi sebuah titik balik peradaban yang sebenarnya dimulai dari dunia eropa sendiri sebagai penjajah. Kacamata peradaban yang seolah awalnya melihat manusia sebagai makhluk yang berbeda-beda karena ras, agama, dan negara tiba-tiba berubah, semua adalah manusia yang satu! Perubahan paradigma ini berhembus ke seluruhpenjurudunia,terutamamelaluijalur-jalur pendidikan dan intelektualisme. Di Indonesia hal itu terjadi dengan sangat jelas di Stovia yang menjadi pusat pendidikan calon dokter dan juga intelektual. Hikmah kedua yang dapat saya petik dari bacaan mengenai peristiwa kebangkitan nasional tahun 1908 adalah mengenai pendidikan dan politik. Stovia sebagai lembaga pendidikan profesional Belanda yang juga menjadi tempat sekolah priyayi Indonesia saat itu ternyata telah menjadi rahim dari kesadaran sekelompok pemuda melebihi entitas kesukuan, keagamaan dan bahwa keprofesian mereka sendiri sebagai calon dokter. Kesadaran yang membuat tugas sebagai seorang intelektual tidak hanya dalam bidang ilmu pengetahuan dan profesi dokter saja melainkan manusia secara luas. Kesadaran dasar itulah yang membawa mereka pada sikap revolusioner. Hikmah yang kedua ini menyadarkan saya bahwa pembentukan kesadaran politik tidak dapat dilepaskan dari dunia pendidikan. Politik dan Pendidikan Selamainikitakebanyakanmenganggapbahwa politik dan pendidikan adalah dua hal dengan kutub yang berbeda. Politik berorientasi ke-

pentingan sedangkan pendidikan justru mengajarkan untuk merangkul semua kepentingan sehingga menjadi seperti tanpa kepentingan. Oleh karenanya kedua hal tersebut senantiasa dipisahkan. Mungkin sebagian besar dari kita merasa takut jika politik dimasukkan dan â&#x20AC;?mengotoriâ&#x20AC;? dunia pendidikan. Atau bahkan politik menjadikan pendidikan sebagai kepanjangan tangannya untuk memperluas kekuasaan. Secara salah banyak diantara kita menafsirkan konsep Paulo Freiremengenaipendidikanyangmelanggengkan ketertindasan (pedagogy of the oppressed) akan terjadi pada dunia pendidikan yang dicampuradukkan dengan dunia politik. Pendidikan merupakan wadah dimana pembentukan kultur generasi baru terjadi. Pendidikan adalahrahimdarisetiapkarakteryangakandimiliki oleh anak-anak kita di masa depan. Dengan demikiansecarasederhanakitadapatmembangun sebuah asumsi bahwa perbaikan pada diri masyarakat secara ideal akan terjadi jika kita benar-benar memperhatikan pendidikan, termasuk dalam bidang politik. Ini sebenarnya selaras dengan prinsip kontekstual dan bermakna dalam kurikulum kita, yaitu menghadirkan kenyataan dunia kepada peserta didik. Niat baik untuk membersihkan dunia pendidikan dari â&#x20AC;&#x2122;kotornyaâ&#x20AC;&#x2122; politik menurut saya justru lebih memperbesar peluang untuk membuat pihak-pihak tertentu memanfaatkan pendidikan demi kepentingan politiknya. Kita ambil contoh sederhana, pada era orde baru Pancasila sebagai falsafah negara diajarkan melalui penafsiran tunggal dengan alasan menghilangkan bias-bias politik seperti halnya yang terjadi pada orde lama. Namun justru itulah yang menjadi bumerang, karena penafsiran tunggal yang diajarkan adalah penafsiran yang dibuat oleh penguasa. Perubahan sistem politik yang begitu terbuka dan desentralistik secara tiba-tiba membuat negeri ini seperti mengalami shock. Jika istilah pengasa dan penindas zaman orde baru adalah mereka para pemimpin di level ibukota maka saat ini penindas dan polikus kotor telah menyebar demikian rata di seluruh pelosok tanah air. Upaya pemberantasan KKN juga seolah menjadi lebih sulit. Bahkan bisa jadi karakter korup yang me-

rajalela saat ini lebih parah daripada saat zaman penjajahan. Sistem pemerintahan yang sehat dan bersih harus dimulai dari sistem politik yang juga bersih. Untuk mewujudkan ini dibutuhkan reformasi sistem politik dan hukum yang menyeluruh. Tapi apa mungkin? Dapatkan reformasi politik dilakukan oleh orang-orang yang telah terbiasa dan tercemar oleh sistem itu sendiri? Seandainya kita bisa mengharapkan perubahan terjadi pada generasi baru, maka seperti halnya reformasi yang dilakukan oleh Budi Utomo, itu seharusnya terjadi dalam dunia pendidikan, yaitu pendidikan yang jugamemperhatikanpendidikanpolitikbagianakanaknya. Saya yakin tugas ini sangat berat dan butuh waktu. Namun dengan perbaikan di ranah politik, hukum dan pendidikan sekaligus kita masih memiliki harapan untuk munculnya kebangkitan nasional kembali. Perlu dicatat, kebangkitannasionaltahun1908mengalamipuncak perjuangan 37 tahun berikutnya yaitu saat kemerdekaan RI 1945. Itu bukan waktu yang singkat dan perjuangan yang ringan. Pendidikan Politik Dalam bukunya yang sangat populer, Democracy and Education, John Dewey menuliskan: As formal teaching and training grow in extent, there is the danger of creating an undesirable split between the experience gained in more direct associations and what is acquired in school. Dalam statemen tersebut Dewey menjelaskan bahwa salah satu kesalahan dari pengajaran yang terjadidisekolahadalahketikamaterisekolahtidak mengarahkan para siswa untuk hidup di dunia nyata. Dan saya rasa memang demikian, keberhasilanpendidikanadalahketikaparapesertadidik benar-benar belajar untuk hidupnya dan bahkan berpikir menyelesaikan permasalahan yang ada di sekelilingnya. Itulah mengapa kebangkitan nasional diawali dari dunia pendidikan yang memang memiliki potensi kekuatan pengubah masyarakat yang sangat besar. Pendidikan politik bukan berarti mengarahkan anak-anak pada kepentingan-kepentingan politik tertentu. Pendidikan ini justru mengenalkan anak pada nilai-nilai penting politik dimulai dari kehidupan sekolah. Mereka diajarkan bagaimana

sebenarnya kebebasan berpendapat dan tanggung jawab sebagai warga negara melalui contoh nyata yang dilakukan oleh para pengajar maupun dalam sistem sekolah itu sendiri. AlberBanduramenyatakanbahwapendidikan utamanya terjadi melalui komunikasi dan keteladanan (modelling). Denikian pula dengan pendidikan politik, bagi saya hal tersebut dapat diajarkan tanpa harus membuat mata pelajaran baru melainkan dengan dua langkah awal yaitu: 1. Membangun atmosfer komunikatif di sekolah. Demokrasi pada dasarnya adalah karakter yang mendasari setiap relasi dalam kelompok sosial dan intinya adalah komunikasi yang seimbang.Kebebasanberpendapatdalamundangundang yang menjadi jantung dari kehidupan berdemokrasi kita seharusnya dibentuk pada diri setiap insan di republik ini sejak dini di sekolah. Semakin tinggi tingkat sekolah, maka komunikasi yang dibangun dapat lebih bersifat riil mengenai berbagai permasalahan di masyarakat dan bagaimana seharusnya mereka bersikap. 2. Keteladanan dalam kehidupan berorganisasi. Sekolah merupakan sistem organisasi yang meliputi hubungan antara kepala sekolah, pegawai, guru hingga para siswa. Meskipun berbagai teori mengenai kehidupan berorganisasi dan bermasyarakat telah disampaikan oleh para guru, namun tanpa contoh langsung walaupun dalam sekup kecil, maka teori-teori akan menguap dan hanya sekedar membekas di catatan raport para siswa. Bagaimana seharusnya pemimpin bersikap, bagaimana kecintaan terhadap negara diwujudkan, semua itu harus juga dicontohkan. Kesadaran politik dari suatu sistem termasuk negara diawali dari kesadaran setiap individu di dalamnya. Oleh karena itu perubahan sebagai hasil dari proses belajar seharusnya terjadi pada setiap individu yang pada akhirnya akan menggerakkan perubahan sosial yang jauh lebih besar. Bangkitnya kesadaran pada segelintir orang adalah awal dari kebangkitan nasional. Itulah makna dari 20 Mei bagi saya.(n/*) Penulis adalah Dosen FKIP Universitas Wiraraja Sumenep


22 Mei 2012

Akuarium Terbesar di Dunia

„ Ilistrasi

Terlibat Cinta Segitiga

AMERIKA SERIKAT- Jika Anda ingin mengunjungi akuarium terbesar di dunia, meluncurlah ke Atlanta, Amerika Serikat, untuk mengunjungi Aquarium Georgia. Lebih dari 8,5 juta galon air laut dan air tawar, rumah bagi 120.000 hewan dari 500 spesies yang berbeda. Atraksi utama adalah empat aquarium hiu paus muda

dari Taiwan, empat paus beluga dan empat manta ray. Bernie Marcus dan istrinya, Billi, memutuskan untuk membangun akuarium terbesar di dunia ini sebagai kenangkenangan yang indah untuk Bernie saat mengunjungi Monterey Bay Aquarium tahun 1990. Setelah meneliti struktur bangunan dan desain akuarium (dan setelah mengunjungi 56

akuarium di 13 negara), Bernie menyumbangkan $ 250 juta untuk pembangunan Georgia Aquarium. Dibantu oleh sumbangan dari sponsor utama (termasuk Coca-Cola Company, Turner Broadcastings, Home Depot, UPS, AirTran Airways, AT & T, Georgia-Pasifik, Time Warner, SunTrust dan Southern Company), akuarium akhirnya dibuka

pada tanggal 21 November 2005, dengan tanpa hutang, berkat tambahan $ 40 juta dalam pendanaannya. Ada sekitar 100,000200,000 ikan dan makhluk laut lainnya (lebih dari 500 spesies) di akuarium. Ikan diangkut dari Taiwan ke Georgia dengan 42 tangki UPS menyumbang untuk biaya pengiriman, yang diperkirakan lebih dari US $ 200.000. Makhluk-makhluk

laut itu dipamerkan di sepanjang enam ruang galeri yang berbeda, semuanya memungkinkan pengunjung akuarium untuk mengamati makhlukmakhluk luar biasa itu dengan sedikit atau tidak ada penghalang visual sama sekali berkat terowongan akuarium yang full kaca, dari lantai ke dinding kaca dan juga langit-langitnya. (dtc/int)

Pria Beristri Bunuh Diri Cinta segitiga antara seorang pria dengan dua wanita bersaudara di Australia berakhir tragis. Kisah cinta tersebut berujung dengan insiden penusukan. Sang pria bunuh diri setelah menusuk adik perempuan istrinya yang menjadi selingkuhannya. Seperti dilansir oleh, Senin (21/5), seorang pria berusia 45 tahun ditemukan tak bernyawa di rumahnya di Bossley Park, Sydney, Australia pada Sabtu (19/5) sekitar pukul 20.00 waktu setempat. Terdapat luka tusukan di bagian tubuh pria tersebut. Sedangkan seorang wanita berusia 37 tahun dilarikan ke Rumah Sakit Liverpool karena menderita sejumlah luka parah. Kondisinya kritis. Menurut tetangga, pria tersebut terlibat hubungan asmara dengan adik istrinya sendiri. Beberapa tetangga menyebutkan, istri pria tersebut pergi dari rumah sejak 3 minggu lalu, setelah mengetahui hubungan gelap suaminya tersebut.

Entah apa penyebab terjadinya insiden mengenaskan pada Sabtu kemarin. Sang pria menusuk adik perempuan istrinya tersebut dan kemudian menusuk dirinya sendiri dengan pisau. Penusukan ini terjadi ketika keduanya terlibat pertengkaran. Salah seorang tetangga mendengar teriakan si wanita yang meminta tolong di halaman depan rumah. Akhirnya tetangga tersebut menelepon polisi. “Dia (wanita itu) bersandar di mobil dan ada darah dimana-mana,” tutur salah seorang tetangga yang enggan disebut namanya. Kepolisian setempat masih menyelidiki lebih lanjut insiden maut ini. Namun polisi enggan menjelaskan secara detail kejadian tersebut. Polisi hanya menyatakan, wanita yang menjadi korban penusukan tidak akan dikenai pidana. Sedangkan pihak keluarga menolak untuk memberikan komentar atas insiden ini. (dtc/int)

Rampok Kantor Polisi,

Remaja Dibekuk WILMER- Seorang remaja di Kota Wilmer, Negara Bagian Texas, Amerika Serikat (AS) terpaksa ditangkap polisi karena mencoba untuk melakukan perampokan terhadap kantor polisi. Remaja itu mengatakan, ancaman yang dilontarkannya adalah lelucon.

Gerhana Matahari Pertama

dalam 173 Tahun

di Tokyo JEPANG- Fenomena gerhana matahari cincin disambut banyak orang di beberapa bagian wilayah Indonesia, China, Taiwan, Jepang hingga ke Amerika Serikat. Di Jepang, fenomena ini bisa disaksikan warga Tokyo, Nagoya dan Osaka pada Senin (21/5) pagi waktu setempat. Gerhana matahari cincin atau juga dinamakan gerhana ‘cincin api’ ini bisa dilihat di pantai Pasifik di bagian barat daya hingga ke timur laut Jepang. Gerhana tersebut berlangsung selama sekitar empat hingga lima menit. Demikian seperti diberitakan kantor berita AFP, Senin (21/5). Gerhana sebagian dimulai sekitar pukul 6 pagi waktu setempat di Prefektur Kagoshima di sebelah barat daya Jepang. Kemudian gerhana matahari cincin terjadi sekitar pukul 07.20 dan sekitar pukul 07.32 waktu setempat di daerah perkotaan Tokyo. Bagi warga Tokyo, fenomena ini sangat spektakuler. Sebab, ini merupakan fenomena gerhana matahari pertama di Tokyo dalam 173 tahun terakhir. Seorang warga Jepang,

„ Gerhana

Sadanobu Takahashi (60) bersama istrinya yang berasal dari Prefektur Akita, Jepang utara, sengaja ikut serta dalam tur khusus selama 2 hari di Tokyo untuk menyaksikan gerhana tersebut dari puncak gedung berlantai 54 di distrik Roppongi, Tokyo. “Lihat! Sekarang cincinnya sempurna. Mengagumkan!” teriak Takahashi saat menyaksikan fenomena istimewa tersebut. Di jalan-jalan Tokyo, para pengusaha hingga anakanak sekolah berhenti sejenak untuk menyaksikan gerhana tersebut. Mereka pun bersorak-sorai ketika melihat kemunculan gerhana matahari cincin tersebut. Fenomena gerhana matahari ini merupakan yang pertama di tahun 2012. Gerhana ini terjadi ketika bulan menutupi matahari karena bulan berada di posisi terjauh. Ukuran bulan lebih kecil daripada matahari, ketika piringan bulan menutupi matahari maka akan terbentuk cahaya seperti cincin, di mana bagian tengah gelap tapi tepinya cemerlang. (dtc/int)

Keithan Manuel pergi menuju kantor polisi di Wilmer dengan tangan yang terbalut handuk putih. Polisi setempat mengatakan, Manuel memecahkan kaca, menodongkan tangannya yang terbalut handuk ke polisi perempuan, dan merampok kantor polisi.

„ Ilustrasi

Polisi itu juga mengatakan, Manuel mengklaim dirinya membawa pistol ketika melakukan perampokan. Kepala polisi Victor Kemp melapor aparat kepolisian lainnya dan menangkap remaja berusia 18 tahun itu di tempat kejadian perkara. “Pemuda ini tentu saja,

tidak menggunakan otaknya. Kalian pasti sering mendengar ‘Pelaku Kriminal Terbodoh di Dunia’ namun kalian tidak pernah sadar, pelaku kriminal itu ada di kota kita,” ujar Kemp, seperti dikutip Orange, Senin (21/5). Manuel menampik tuduhan kepemilikan senjata api. Manuel menegaskan, tindakan yang dilakukan hanyalah lelucon. Saat ini, Manuel pun mendekam di penjara karena dihadapi berbagai dakwaan, termasuk percobaan perampokan. (ok/int)

Israel Bangun Negara Baru di Siprus Yunani Israel dikabarkan tengah mempersiapkan jajahan terbaru mereka di Siprus Yunani. Hal ini berdasarkan rencana pengiriman terminal gas di negara yang masih memiliki kedekatan dengan Yunani dan Siprus tersebut. Perdana Menteri Israel Benjamin Netanyahu dikabarkan tengah meminta izin pengerahan 20 ribu pasukan komando ke Siprus Yunani. Sebagai gantinya, pasukan itu akan membangun terminal gas di negara pulau itu. Laporan ini sepertinya membuat panas pihak Turki, karena pada dasarnya pulau itu dibagi kekuasaannya antara Siprus dengan Turki. Kantor Berita Turki Anatolia melaporkan, Netanyahu melakukan pertemuan dengan pemimpin Siprus Yunani Dimitris Christofias pada 16 Februari lalu. Diyakini pertemuan keduanya terkait dengan permintaan Siprus Yunani kepada Israel, yakni untuk membuat terminal gas. Sebagai ganti, Siprus Yunani harus mengizinkan Israel membangun pangkalan udara dan laut di negara tersebut. “Berikan kami pangkalan

udara dan laut dan kami akan cepat melarang investasi di wilayah pulau yang dikuasai Turki. Hal ini tentunya akan didukung oleh keputusan dari Parlemen Israel,” ujar Netanyahu, seperti dikutip Anatolia, Senin (21/5). Siprus Yunani, yang saat ini menghadapi kesulitan akibat krisis ekonomi global, tidak mampu mengeluarkan dana USD10 miliar atau sekira Rp93,6 triliun (Rp9.365 per USD), untuk membangun terminal gas. Israel pun menawarkan diri, tetapi meminta pekerja konstruksi berasal dari Israel dan dengan jumlah 10 ribu

„ Bendera Israel

jiwa. Ini berarti, sekira 30 ribu warga Israel akan tinggal di pulau tersebut bila rencana ini berhasil dilakukan. Sekira 20 ribu dari warga Israel itu adalah pasukan Komando Israel yang akan melindungi warga dan terminal gas yang baru dibangun. Tetapi Anataloia menambahkan, Israel bermaksud untuk membangun ‘little Israel’ atau Israel Kecil di negara itu. “Israel tidak akan meninggalkan negara itu setelah pekerjaannya selesai. Mereka berniat untuk tinggal selamanya,” tutup kantor berita Anatolia. (ok/int)

„ ilustrasi

Nenek Tewas Tertabrak Mobil Dikemudikan Cucunya KUALA LUMPUR- Insiden mengenaskan terjadi di Malaysia. Seorang nenek tewas akibat terhimpit di antara pagar besi rumahnya. Kejadian nahas ini terjadi setelah mobil yang dikemudikan cucu laki-lakinya menabrak wanita itu hingga terhimpit pagar besi tersebut. Seperti dilansir oleh AsiaOne, Senin (21/5), insiden ini terjadi di wilayah Taman Ria, Sekinchan, Malaysia pada Minggu (20/5) pagi waktu setempat. Wanita berusia 80 tahun tersebut langsung dilarikan ke rumah sakit terdekat untuk mendapatkan pertolongan pertama. Namun sayang, nenek ini akhirnya meninggal dunia saat menjalani perawatan di Rumah Sakit Tanjung Karang. Nenek ini meninggal akibat cedera parah di bagian kepala dan badannya. Sang cucu menuturkan, insiden ini berawal ketika dirinya hendak memundurkan mobil yang ada di halaman rumah. Namun, dia tidak menyadari bahwa ada neneknya yang sedang berdiri di belakang mobil tersebut. Tragis, sang nenek pun tertabrak bagian belakang mobil dan terhimpit di antara pagar besi. Kepolisian Sabak Bernam menyebutkan, kasus ini masih dalam penyelidikan polisi. Sang cucu terancam dikenai pasal pidana tentang kelalaian yang menyebabkan kematian. (dtc/int)


22 Mei 2012


Pedagang Ambal Ditangkap Curi Ayam Ngaku Menyesal, Mencuri karena Mabuk

„ Timbul Sinaga SIANTAR- Timbul Sinaga (29), menetap di Jalan Farel Pasaribu Kelurahan Pardamean, Siantar Marihat, nyaris jadi bulan-bulanan warga sekampungnya. Hal itu setelah ia dipergoki dan disergap warga saat mencuri ayam betina milik Arlis Siregar (50). Peristiwa terjadi pada Sabtu (19/5) sekira pukul 02.00 WIB. Saat itu korban yang berada di rumah, mendadak mendengar teriakan maling dari arah belakang kediamannya. Setelah dicek, orang yang berteriak itu adalah tetangganyua bermarga Hutasoit. “Awalnya si Hutasoit yang berteriak maling. Setelah kudatangi, katanya ada yang masuk ke belakang rumahku untuk mencuri ayam,” katanya. Setelah kedua jiran ini melakukan pencarian, tak satupun pelaku ditemukan. Namun tak lama kemudian, dari arah berlainan datang warga lain yang mengaku sudah menangkap pelakunya. Benar saja, Timbul terlihat sudah dipegangi warga agar tidak melarikan diri. Takut menjadi bulanbulanan massa, korban dan warga sekitar langsung menyerahkannya ke Polsek Siantar Marihat. Hal itu tak dibantah tersangka. Kepada METRO ia

menuturkan, sebelum mencuri, ia terlebih dulu diajak seorang teman bermarga Pangaribuan, masih warga sekitar. Ditambahkan pria yang sudah punya dua orang anak ini, awalnya ia dan teman-temannya habis minum tuak. Karena sudah mabuk berat, Pangaribuan punya ide untuk mengambil seekor ayam. Rencananya jika berhasil, ayam itu akan dipanggang. Ide tersebutpun di iyakan Sinaga dan kemudian mereka masuk ke belakang rumah korban. Namun aksi mereka diketahui warga dan akhirnya menangkap Timbul. Saat disergap itu, Pangaribuan berhasil kabur. “Aku menyesal sekali bang, tidak pernah terpikirkan bisa seperti ini. Padahal aku hanya sekali itu saja iku,” ucapnya dengan raut wajah sedih. Pasca kejadian, Keluarga tersangka langsung berupaya menemui pemilik ayam. Bahkan dan informasi yang dihimpun, ada perjanjian damai di antara kedua pihak. “Tadi orangtuaku sudah datang, mudah-mudahan besok bisa selesai perdamainnya,” tambahnya. Diungkapkannya, saat peristiwa terjadi, ia sedang dalam kondisi mabuk, sehingga tidak begitu mengetahui apa yang terjadi.”istrinya jualan dirumahnya, makanya aku malu sekali. Aku sudah menyesal dan minta maaf ma pemilik ayamnya. Ini lah karena mabuk jadinya tidak sadar lagi apa yang mau dilakukan” sesal tersangka. “Kapolsek Siantar Marihat AKP Efendi Tarigan membenarkan bahwa tersangka telah ditahan karena telah melanggar pasal 363 KUHPidana dengan melakukan pencurian se ekor ayam. (Pra/Hez)

Honorer Ketahanan Pangan Tanam Ganja TEBING TINGGI- Pegawai Honor di Dinas Ketahanan Pangan Pemko Tebing Tinggi, ditangkap personel Satnarkoba, Minggu (20/5) sekira pukul 21.00 WIB. Tersangka adalah Herman (26) warga Jalan Gunung Martimbang, Kecamatan Rambutan. Dari tangannya didapati dua puntungan rokok berisi ganja serta satu tunas ganja, ditanam di bekas gelas minuman mineral. Dalam keterangannya di Mapolres Tebing Tinggi, Senin (21/5), Herman mengaku hanyalah iseng-iseng menanam ganja tersebut. Itu diakuinya setelah ada keinginan mengetahui bagaimana hasil dari observasi yang ia lakukan seminggu sebelum tertangkap. “Saya hanya ingin tahu saja bagaimana hasil biji-biji ganja yang saya taburkan itu. Ternyata selama seminggu saya tunggu, biji itu tumbuh dan kini tingginya baru 5 centimeter,” ujar honorer yang baru tiga tahun bekerja di Dinas Ketahanan Pangan ini. Menurut Herman, bibit ganja itu sengaja dibeli dari seorang teman di Kampung Mandailing. “Ketika itu, saya membeli ganja 5 amp seharga Rp50 ribu. Rupanya ganja yang saya beli itu banyak campuran bijinya. Kemudian biji itu saya tabor saja dan saya letakkan di belakang rumah,” ungkapnya. Bagi tersangka, mengkonsumsi ganja bukanlah hal yang baru baginya. Pria yang berstatus lajang itu sering mengkonsumsi ganja lantaran sudah kecanduan. Untuk memenuhi ketergantungannya, ia selalu membeli dari uang gaji. Kebiasaannya itu ternyata tidak diketahui kedua orangtuanya, termasuk menanam bibit ganja di rumah. “Mana ada yang tahu pak, orangtua saya sekalipun tidak pernah tahu kalau saya sudah ketergantungan barang itu. Dari

ganja yang saya beli, bisa saja saya jual lagi. Itupun kalau ada teman yang mau membelinya,” ujar anak semata wayang ini. Usai menjual kembali ganja yang dimiliki itulah, keberadaannya terendus polisi. Akhirnya tersangka ditangkap. Peristiwa berawal saat tersangka Yudi Setiawan alias Yudi (30) warga Jalan KL Yos Sudarso, sudah lebih dulu ditangkap. Informasi yang diterima polisi menyebutkan bahwa di kawasan Jalan KL. Yos Sudarso sering terjadi transaksi narkoba. Informasi ini langsung ditindaklanjuti dengan melakukan penyelidikan ke lokasi. Saat itu Yudi sedang menjaga kios rokoknya. Tak membuang waktu, polisi menggerebek kios dan menemukan 4 bungkus kertas koran berisi daun, biji dan ranting ganja. Barang haram itu di simpan di kotak rokok Club Mild dengan berat 3,5 gram. Saat diinterogasi, Yudi yang belum berumah tangga itu mengaku ganja dibeli dari Herman. Dalam waktu yang singkat, malam itu juga Herman ditangkap di kediaman orangtuanya. “Ganja itu saya beli Rp40 ribu. Rencananya, mau kami pakai bersama teman-teman di kampong. Tapi akhirnya tidak jadi karena keburu tertangkap,” beber Yudi yang mengaku sudah mengenal Herman sejak keduanya duduk di bangku SD. Kasubbag Humas Polres Tebing Tinggi AKP Ngemat Surbakti, membenarkan penangkapan dua tersangka tersebut. “Atas perbuatannya, kedua tersangka dijerat pasal 114 (1) subs pasal 111 ayat (1) UU RI No 35 Tahun 2009. Ancamannya paling sedikit 4 sampai 5 tahun penjara,” terang Surbakti.(Awi/ pmg)

BELAWAN- Dedek Sari Harfianti (15) warga Jalan Titi Pahlawan, Medan Labuhan, mengaku disekap oleh bibinya Fauzah (30) selama dua hari. Peristiwa terjadi sejak 5 Mei lalu di rumah sang bibi, yang bersebelahan dengan kediaman korban. Orangtua korban yang tak tahu keberadaan siswi kelas III SMP ini sempat kelimpungan.

„ Dedek Sari Harfianti, siswi SMP yang mengaku disekap bibinya selama 2 hari di kamar.

Gelapkan Jeruk Penumpang

Supir Rental Dihukum 8 Bulan Penjara SIANTAR- Faisal Hutabarat (27) warga Tanah Garapan Lahan PTPN II Pasar V Amplas, Medan Denai, hanya bisa tertunduk saat hakim menghukumnya delapan bulan penjara. Terdakwa terbukti bersalah melakukan penggelapan jeruk milik Muhammad yang merupakan penumpang mobil yang dikendarainya. Akibat kejadian, korban merugi Rp15 juta. Dalam amar putusannya, majelis hakim Janner Purba menerangkan, terdakwa secara sah dan meyakinkan terbukti melakukan tindak pidana melanggar pasal 372 KUHPidana. “dari fakta-fakta persidangan dan keterangan saksi serta korban, terdakwa bersama Iwan (DPO) mencarter mobil Xenia BK 1678 TY. Mobil itu mereka dicarter seharga Rp250 ribu, kemudian digunakan menghantar penumpang. Salah satu penumpangnya adalah Muhammad,” sebutnya. Lebih lanjut hakim membacakan, saat itu saksi korban membawa 10 kotak asam jungga dan tiga kotak jeruk purut yang hendak diantar ke Tiga Balata. Ongkos untuk mengantar barang tersebut Rp300 ribu. Setelah kesepakatan terjalin, terdakwa bersama Iwan membawa Muhammad menuju Tiga Balata. “Setibanya di sana, terdakwa singgah

di rumah makan Minang. Namun saat berada di rumah makan, ia mendengar ada perbincangan bahwa Muhammad ingin diantar ke Porsea. Padahal janji awal hanya sampai Tiga Balata. Selanjutnya mereka meminta ongkos tambahan Rp300 ribu kembali,” ungkapnya. Sambungnya, mendengar itu korban menolak sembari melanjutkan minumnya di rumah makan. Sedangkan terdakwa sudah berada di mobil. Mereka kemudian menunggu korban hingga 20 menit, namun korban tidak kunjung naik ke mobil. Karena berlama-lama, terdakwa memutuskan kembali ke Medan dan membawa kotak jeruk korban. Katanya, kotak jeruk itu dikembalikan ke loket tempat ia semula datang. Mengingat barang korban telah dilarikan, Muhammad memilih melaporkan kasus tersebut ke Polres Simalungun akibat mengalami kerugian Rp15 juta. “Berdasarkan pertimbangan dan musyawarah, majelis memutuskan menghukum terdakwa delapan bulan penjara,” tegas Janner. Hukuman itu sudah lebih ringan dari tuntutan Jaksa Penuntut Umum (JPU) Hari Darmawan yakni satu tahun penjara. (mua/hez)

Menurut ayah korban Haris (68) didampingi istri Nuri (43) saat membuat pengaduan di Mapolres Pelabuhan Belawan, mereka tak mengerti apa maksud dan tujuan Fauzah mengurung anak mereka bersama seorang pria bernama Hari, di kamar. Namun selama ini Fauzah yang tak lain adik kandung Nuri, sudah berselisih paham dengan keluarga mereka. Sebab Fauzah kerap merasa iri dengan keluarga mereka.Bahkan Fauzah diduga ingin menguasai harta peninggalan orangtua mereka. Nah, untuk membuat keluarga Haris tak tenang, Fauzah mencoba mempengaruhi Dedek agar membenci keluarganya sendiri. Begitu juga sebaliknya, agar keluarga membenci Dedek. Untuk menghancurkan hubungan keluarga mereka, maka ia menyekap dan mengurung Dedek. Selama disekap, Dedek diancam untuk tidak pulang karena akan dipukuli dan diusir orangtuanya. “Karena takut, anak saya menurut dengan omongan si Fauzah. Dia kemudian dikurung di kamar dengan laki-laki,” kata Haris di kantor polisi. Sejak penyekapan itu, keluarga sempat mencari Dedek. Namun keberadaannya tidak diketahui.

Setelah dua hari kemudian, Fauzah membebaskan Dedek sembari melarangnya pulang ke rumah. Sebab dikatakan Fauzah, Dedek akan dipukuli orangtuanya jika berkeras pulang ke rumah. Karena merasa ketakutan, ia memilih menginap di rumah temannya di Marelan. Sedangkan keluarga yang waswas dengan keberadaan Dedek, masih terus melakukan pencarian. Dua minggu setelah kepergiannya, Dedek akhirnya ditemukan di rumah teman sekolahnya. Saat diinterogasi, Dedek, mengaku dikurung di rumah bibinya selama 2 hari dan 10 hari menginap di rumah temannya. “Dua hari saja anak saya disekap, sepuluh harinya di rumah temanya. Katanya ia takut pulang. Selama disekap, anak saya memang tidak diapa-apakan. Tapi saya tak terima dengan perlakuan bibinya,” kata bapak anak tiga ini. Disinggung persoalan penyekapan, Haris mengatakan selama ini Fauzah memang sudah mencari gara-gara dengan keluarga mereka. Dengan kerap membuat onar, diduga Fauzah menginginkan mereka pindah dari rumah peninggalan orangtuanya. “Dari dulu memang sudah cari gara-gara dia. Kami selalu dibuat tak tenang agar pindah dari lokasi. Bahkan sewaktu kami mencari Dedek ke kediamannya, istri saya sempat dicakar fauzah. Saat itu Fauzah mengaku tak senang dituduh menyembunyikan anak kami,” tukas Haris di Mapolres Pelabuhan Belawan. (ril/pmg)

2,5 Kg Sabu-sabu Gagal Beredar

„ Kombes Pol Andjar Dewanto MEDAN-Direktorat Reserse Narkoba Polda Sumatera Utara mengamankan 2,5 kilogram sabu-sabu asal Malaysia yang hendak diedarkan di Medan. Selain mengamankan barang haram tersebut, polisi juga menangkap tersangka Asnawi (54), yang mengaku sebagai kurir. “Barang haram tersebut diduga berasal dari Malaysia, kemudian dikirim ke Aceh dan akan diedarkan di Medan,” kata Direktur Reserse Narkoba Polda Sumut Kombes Pol Andjar Dewanto kepada wartawan,

Senin (21/5). Menurut dia, tersangka Asnawi, ditangkap oleh tim khusus Polda Sumut di kediamannya Perumahan Payasari Desa Payageli, Sunggal, Deli Serdang. Penangkapan dilakukan setelah petugas, kemarin malam, mendapatkan informasi adanya pengiriman sabu dari Aceh menuju Medan menggunakan mobil Kijang berwarna biru. Berdasarkan informasi tersebut, polisi kemudian melakukan pengembangan dengan mengikuti mobil tersangka Asnawi dari Jalan Gatot Subroto, Medan. Saat tiba di depan rumahnya, polisi langsung menyergapnya. Dari mobil, ditemukan 2,5 kilogram sabu yang dikemas dalam sebuah bungkusan. “Petugas masih memburu keberadaan pria berinisial D, penduduk Aceh, yang diduga kuat sebagai pemilik sabu tersebut. Tersangka yang mengaku menjadi kurir, untuk membayar hutangnya senilai Rp25 juta,” tutup Andjar. (pk/int)

Sana Surat, Sini Aurat ITA (19), layak marah. Dia berulang kali digauli kekasihnya Andika (27), hingga hamil. Tapi boro-boro dinikahi, si doi malah menikahi gadis lain. Ita pun segera melapor ke Polsek Pancur Batu (Deli Serdang). Inikan namanya: sini kena auratnya, sana yang dapat suratnya. Kasus tabrak lari memang tak hanya di jalan raya. Di jalan ranjang yang empuk bin mendut-mendut, bisa juga terjadi ”tabrak lari”. Saat demen-demennya, enak saja sang kekasih digauli berulangkali. Tapi giliran terjadi sebuah kehamilan, ditinggalkannya. Paling menyakitkan, banyak juga pelaku tabrak lari yang “menabrak” lagi di tempat lain, dan menikahlah di sana. Ini kan menyakitkan korban “tabrakan” yang pertama. Anak muda tukang tabrak lari ini salah satunya Andika, warga Pancur Batu, Deli Serdang. Sudah beberapa saat

lamanya dia punya pacar, Ita, warga tetangga desa. Namanya orang pacaran, Andika sering apel ke rumah Ita. Tapi selama ini ya hanya begitu-begitu saja. Hanya ngobrol-ngobrol hingga pukul 21.00 malam, setelah itu pamitan pulang. Cara-cara ini sangat menyenangkan bagi keluarga Ita, tapi sangat bikin dongkol setan. Masak pacaran di era gombalisasi masih ala tahun 1950an, modelnya lagu Ismail Marzuki. Jaman itu, bisa mencium mesra ujung jari tadi malam (lagu Aryati, Red) saja senangnya bukan main. Sekarang kan era liberalisme asmara. “Dulu ujung jari, sekarang ya ujung apalah namanya. Payah kamu…..” omel setan pada Andika yang bebal ini. Gara-gara diomeli setan tersebut, Andika menjadi lebih berani. Beberapa waktu lalu, Ita diajaknya ke kebun kelapa untuk cari kelapa muda. Ternyata sicowok memang jago

manjat juga. Habis makan degan, tiba-tiba Andika merayu untuk hubungan layaknya suami istri. Begitu mautnya rayuan di bawah pohon kelapa, akhirnya Ita pasrah. Diambilnya daun pisang buat alas. Dan inilah yang terjadi, Andika yang barusan manjat pohon kelapa, sekarang gantian “manjat” Ita. Ternyata sama-sama ketagihan. Siang itu Andika sempat nambah. Lain hari, di rumah Ita, di kala orangtua tak di rumah, keduanya kembali main suami istrian. Dan itu dilakukan berulang kali sampai nggak terhitung. Dan seperti yang telah diduga, akibat daripada pergaulan terlalu bebas dan mendalam itulah, Ita kemudian hamil. Tentu saja Ita segera mencari si doi untuk tanggungjawab. Dalam pada itu, Andika setelah kenyang menikmati tubuh mulus Ita, belakangan jarang muncul. Bahkan ketika

ada kabar gadis itu mencaricari untuk bertanggungjawab atas kehamilan, Andika malah main kucing-kucingan. Dia menghilang bak ditelan bumi. Dicari di rumahnya tak pernah ketemu. Padahal usia kandungan Ita secara otomatis terus membesar, dan perut pun dari hari ke hari maju sekian centimeter, hingga pusernya lari dari garis ekuator. Bak disambar petir disiang bolong, ada kabar Andika su-

dah menikah dengan gadis lain. Wah, tentu saja Ita jadi mencak-mencak. Enak saja, di sini sudah bukak-bukakan aurat, kok malah gadis sana yang memperoleh surat (nikah). Serta merta Ita melaporkan doinya ke Polsek Pancur Batu. “Saya tak terima Pak, memangnya saya cewek apaan, habis manis sepah dibuang,” Kata Ita berapi-api. Memangnya ini giling tebu di pabrik gula, apa? (pk/int)


22 Mei 2012

Ibu Anak Diseruduk Angkot Sambungan Halaman 8 Kota Sibolga. Saat itu ibu dan anak ini baru selesai berjualan roti, minuman, rokok dan buah di pelabuhan tersebut. “Kemudian kami lewat Jalan Gambolo menuju rumah kami di Jalan Rasat, Kelurahan Pancuran Dewa, Kecamatan Sibolga Sambas. Sebelum sampai di Simpang 5, aku melihat angkot datang dari Jalan Horas menuju Jalan Gambolo. Awalnya kami sama-sama berhenti dengan angkot tersebut,” terang Rantonus sembari mengaku tidak mengalami luka akibat kejadian itu. Lima menit kemudian, Rantonus mengaku sepedamotornya dan angkot tersebut sama-sama melaju menuju Simpang 5. Sesampainya di simpang tersebut, angkot tersebut tiba-tiba menyeruduk bagian belakang sepedamotor mereka. “Setelah ditabrak dari belakang, aku dan mamakku langsung terjatuh. Saat itu mamakku langsung menangis akibat kaki kanannya berdarahdarah. Terus aku dan sopir angkot tersebut langsung melarikan mamakku ke RSU FL Tobing Sibolga,” tuturnya lagi. Sementara Ronal, sopir angkot yang menabrak ibu dan anak tersebut, mengaku grogi karena jarak angkotnya dan sepedamotor korban terlalu dekat. “Ketika tiba di Simpang 5 aku grogi tak bisa mengelak lagi. Langsung angkotku seruduk sepedamotor mereka,” aku Ronal. Semetara petugas kepolisian Pos Lantas Simpang 5 yang melihat kejadian itu langsung terjun dan mengamankan lokasi. Sebagai barang bukti, angkot dan sepedamotor tersebut diamankan ke Mapolantas Polres Sibolga Kota. (dungo/nasa)

Pilihan Boleh BedaTapi Hindari Konflik Sambungan Halaman 8 damai tanpa masalah. Karena Kota Psp adalah daerah yang masih melekat dan kental dengan budaya Dalihan Na Tolunya. Kita semua tidak menginginkan adanya konflik pada masyarakat dikarenakan pemiliukada, karena yang rugi nanti kita juga masyarakat. Oleh karena itu, marilah kita junjung tinggi nilai-nilai kemasyarakatan dan mematuhi perundang-undangan yang berlaku. Dan hal inilah yang melatarbelakangi kita dari LSM Perkara bekerjasama dengan Kemendagri untuk melakukan sosialisasi ini,” katanya. Sementara itu, Bachrum Alamsyah Siregar SH menuturkan, bahwa begitu pentingnya wawasan kebangsaan dan cinta tanah air untuk tetap menjaga persatuan dan kesatuan bangsa dan menjadikan perbedaan (pluralisme) sebagai potensi kekuatan untuk makin memperkokoh rasa kecintaan kepada tanah air. “Perlu kita sadari bersama 4 pilar kebangsaan menjadi momentum persatuan dan kesatuan bangsa, pertama Pancasila, kedua UUD 1945, NKRI dan Bhinneka Tunggal Ika,” terangnya kepada ratusan peserta seminar yang terdiri dari berbagai elemen dan profesi masyarakat. Seminar ini dihadiri Walikota Psp yang diwakili Camat Psp Tenggara, Ahmad Bestari Lubis, Lurah dan Kepala Desa dari Kecamatan Psp Tenggara, dengan narasumber diantaranya Kasi Wawasan Kebangsaan, Kualo Pardosi dan lainnya, dengan ratusan peserta seminar yang berasal dari sejumlah elemen masyarakat dengan moderator M Ali Siregar. (phn)

Tak Punya SIM Bisa Denda Rp1 Juta Sambungan Halaman 8 punya pengetahuan berlalu lintas,” kata Kapolres Sibolga Kota, AKBP Joas Feriko Panjaitan SiK melalui Kasat Lantas AKP Mulkan D, Senin (21/5) kemarin di Mapolres Sibolga Kota. Menurut Mulkan, sejumlah pasal lain yang mengatur ketentuan berlalu lintas memberikan denda yang tidak sedikit, dimana dalam UU tersebut, sanksi denda minimal Rp250 ribu dikenakan kepada setiap pelanggar. “Pasal 287 ayat 1, setiap pengendara yang melanggar rambu lalu lintas dipidana dengan pidana kurungan paling lama 2 bulan atau denda paling banyak Rp500 ribu. Kemudian Pasal 287 ayat 5, setiap pengendara yang melanggar aturan batas kecepatan paling tinggi atau paling rendah dipidana dengan pidana kurungan paling lama 2 bulan atau denda paling banyak Rp500 ribu,” beber Mulkan. Pada Pasal 288, sambung Mul-

kan, setiap pengendara kendaraan bermotor yang tidak dipasangi Tanda Nomor Kendaraan dipidana dengan pidana kurungan paling lama 2 bulan atau denda paling banyak Rp500 ribu. “Sedangkan pada ayat 2 pasal ini menyebutkan, setiap pengendara kendaraan bermotor yang memiliki SIM namun tidak dapat menunjukkannya saat razia dipidana dengan pidana kurungan paling lama 1 bulan atau denda paling banyak Rp250 ribu,” tukas Mulkan. Pasal 285 ayat 2, lanjutnya, setiap pengendara mobil yang tak dilengkapi kelayakan kendaraan seperti spion, klakson, lampu utama, lampu mundur, lampu rem, kaca depan, bumper, penghapus kaca dipidana dengan pidana kurungan paling lama 2 bulan atau denda paling banyak Rp500 ribu. “Pasal 288 ayat 1, setiap pengendara yang tidak memiliki Surat Tanda Nomor Kendaraan

atau STNK dipidana dengan pidana kurungan paling lama 2 bulan atau denda paling banyak Rp500 ribu,” tukasnya. Menurut Mulkan, ada juga denda sebesar Rp250.000 per pelanggaran yang dilakukan diantaranya, tidak membawa SIM, tidak memakai sabuk keselamatan, tidak menggunakan helm, tidak menyalakan lampu utama siang hari, mengganggu fungsi rambu, marka, alat pengamanan pengguna jalan, tidak mematuhi petugas untuk berhenti, melanggar tata cara penggandengan kendaraan, pindah lajur tanpa isyarat, membelok atau berbalik arah tanpa isyarat, tidak memberi prioritas pada kendaraan tertentu, termasuk yang dikawal petugas Polri. “Untuk itu, kami berharap, seluruh pengguna jalan mematuhi aturan-aturan yang ada dan kami akan berupaya menjalankan UU itu dan kepada pelanggar akan ditindak sesuai pasal yang berlaku,” tandas Mulkan. (tob/nasa)

nya,” kata Marudut. Kapolda Sumut, Irjen Pol Drs H Wisjnu Amat Sastro SH dalam arahannya menyambut baik atas diterimanya kendaraan operasional tersebut, bahkan menyampaikan terima kasih kepada Pemko Sibolga yang sudah mendukung eksistensi Polres Sibolga Kota hingga kedepannya. “Termasuk juga saya sampaikan terima kasih kepada Bank Indonesia Sibolga dan PT SGSR yang sudah memberikan bantuan untuk kendaraan operasional kepada Polres Sibolga,” tukas Wisjnu. Menurut Wisjnu, dengan penambahan armada tersebut ke depan dapat mendukung kinerja Polres Sibolga Kota untuk melindungi dan mengayomi serta melayani masyarakat, sehingga ketika operasi tidak ada kendala lagi. “Dengan adanya mobil bantuan tersebut tentunya jajaran kepolisian baik di Polsek maupun Polres, bisa bergerak lebih cepat dalam mengantisipasi setiap ada kejadian yang membutuhkan penanganan cepat,” katanya. Kapolres Sibolga Kota, AKBP Joas Feriko Panjaitan SiK mengatakan, penyerahan yang dilakukan kendaraan operasional dari Pemko Sibolga, Bank Indonesia Kota Sibolga dan PT SGSR merupakan wujud kerja sama yang

baik dari kedua lembaga dalam rangka menegakan hukum di Kota Sibolga. Untuk itu, kata Joas, Polres Sibolga Kota akan berupaya semaksimal mungkin menciptakan suasana yang harmonis serta meningkatkan kerjasama dengan pemerintah setempat dalam rangka pencapaian harapan yang diinginkan, serta melahirkan kebijakan yang professional untuk pembangunan Kota Sibolga. “Dengan adanya bantuan kendaraan operasional ini, kita akan pergunakan sebaik mungkin untuk kegiatan operasional Polres Sibolga dalam rangka menciptakan keamanan dan ketertiban masyarakat di daerah ini,” tandas Joas. Adapun kendaraan yang diserahkan itu yakni, 1 unit Toyota Kijang Innova dari Pemko Sibolga, 1 unit Toyota Kijang Kapsul dari Bank Indonesia dan 2 unit sepeda motor KTM 150 R dari PT SGSR Manduamas. Hadir dalam penyerahan kendaraan operasional itu, Wakapolda Sumut, Brigjen Cornelis Hutagaol, Kabid Humas Poldasu AKBP Drs Raden Heru Prakoso, Wadir Lantas Poldasu, AKBP Johannes Didiek Dwi Priantono, Kapolres Tapteng, AKBP Dicky Patrianegara SH MSi dan sejumlah pejabat Poldasu lainnya. (tob/nasa)

Peringatan Harkitnas di SMAN 1 Andam Dewi Sambungan Halaman 8 itu upacara juga dihadiri oleh seluruh anggota SKPD se Kecamatan Andam Dewi dan unsur muspika kecamatan. Bertindak selaku inspektur upacara, Camat Andam Dewi, Rudolf Sihotang. Dalam sambutan Bupati Tapteng yang disampaikan oleh Camat Andam Dewi, disebutkan bahwa peringatan Hari Kebangkitan Nasional dilaksanakan sebagai bentuk peringatan lahirnya pergerakan dan organisasi Budi Utomo sebagai organisasi pertama di Indonesia yang berskop nasional. “Peringatan Hari Kebangkitan Nasional tahun 2012 ini merupakan peringatan yang ke 104 kali sejak berdirinya organisasi Budi Utomo pada tahun 1908 silam. Budi Utomo berdiri sebagai pergerakan pemuda yang berupaya memperjuangkan nasib bangsa Indonesia dari cengkraman pen-

jajahan. Budi Utomo menggalang para pemuda untuk bangkit dan bergerak melawan para penjajah agar bangsa Indonesia bisa mengecap kemerdekaan dan terbebas dari belenggu penjajahan,” ungkap Rudolf dalam pidatonya. Konsep peringatan Hari Kebangkitan Nasional kabupaten Tapanuli Tengah diharapkan mampu membangkitkan semangat kesatuan dan persatuan seluruh bangsa Indonesia dari ancaman disintegrasi. “Pada akhirnya dengan peringatan Harkitnas ini bangsa Indonesia bisa bangkit dan bersatu untuk mempertahankan bangsa Indonesia. Kita sekarang sedang berada dalam ancaman disintegrasi maka bagaimana kita bangkit dan bersatu dan melepaskan diri dari disintegrasi tersebut.” pungkas camat Andamdewi mengakhiri. (rina/nasa)

Sekda Diganti, Kinerja Polres Sibolga Dapat 4 Kendaraan Operasional PNS Diyakini Akan Rusak Sambungan Halaman 8

Sambungan Halaman 8 mewakili pimpinan PT SGSR. Wakil Wali Kota Sibolga, Marudut Situmorang AP MSP dalam sambutannya mengatakan, pemberian bantuan berupa 1 unit mobil itu untuk semakin mempererat jalinan hubungan silaturahmi dan menjalin kerjasama yang baik, antara Pemko Sibolga dengan Polres Sibolga Kota seperti yang sudah terjalin selama ini “Bantuan operasional yang diserahkan kepada Polres Sibolga Kota ini merupakan wujud partisipasi dan dukungan atas eksistensi Polres Sibolga Kota demi menjaga ciptya kondusif. Mudah-mudahan kendaraan operasional ini dapat membantu personil Polres Sibolga dalam menjalankan tugas serta pelayanan kepada masyarakat,” pungkas Marudut. Sebelumnya, sambung Marudut, Pemko Sibolga sudah pernah memberikan bantuan yang sifatnya pinjam pakai kepada Polres Sibolga yakni 1 unit mobil ambulance serta penyediaan lahan untuk pertapakan Polsek Sibolga Selatan. “Dan selanjutnya kita juga akan menyediakan lahan pertapakan untuk Mapolsek Sibolga Utara dalam waktu dekat ini. Kita berharap, kerjasama ini dapat berjalan dengan baik kedepan-

maka akan merusak tatanan kinerja PNS secara keseluruhan,” ucap keduanya. Dikatakan mereka, sejak seminggu lalu pihaknya sudah mendengar isu pergantian Sekda. Isu yang berkembang, pergantian ini karena adanya perbedaan pilihan dan dukungan antara Walikota dan Sekda dalam pilkada Psp ini. “Seharusnya perbedaan ini jangan sampai membuat atau berpengaruh pada kinerja pelayanan kepada publik. Kepala daerah harusnya memberikan pengarahan kepada pembantunya yakni Sekda, khususnya sebagai pemimpin PNS agar menyampaikan kepada PNS untuk tidak terlibat dalam politik praktis. Akhirnya jika sampai Walikota mengganti Sekda, maka pelayanan publik bisa terganggu,” jelas keduanya. Apalagi kata keduanya, jika sudah terjadi saat menjelang pilkada, kepala daerah sering seenaknya saja mencopot kabinetnya bahkan Sekda sekalipun. “Setahu kita, dulu Sarmadan Hasibuan diangkat menjadi Sekda saat menjelang pemilukada. Saat itu PNS terkotak-kotak dan menyebabkan pelayanan kepada masyarakat terganggu. Jadi kita minta Walikota benar-benar memikirkannya dengan matang, agar jangan sampai kejadian

yang lalu terulang lagi sekarang,” tutur keduanya. Hal yang sama dikatakan mantan pengurus HMI Sumut, Halomoan Harahap. Katanya, jika sekda diganti menjelang pemilukada, benar-benar bisa mengganggu kinerja PNS secara keseluruhan. Karena Sekda adalah pimpinan PNS, maka jika diganti akan menganggu kinerja pemerintahan secara keseluruhan dan Sekda adalah panutan dari PNS. “Kalaupun benar isu itu karena perbedaan pilihan dalam usungan dipilkada, kita tidak ingin hal seperti itu terjadi. Kita mengharapkan Walikota Psp, Drs Zulkarnaen Nasution MM untuk tidak mengganti Sekda pada situasi sekarang ini,” katanya. Dikatakannya jika nantinya pergantian Sekda ini benar terjadi jika memang karena kepentingan politis, maka bisa menyebabkan ketidakkondusifan dijajaran PNS, sehingga menyebabkan kinerja menjadi menurun dan PNS yang akan menjadi korbannya. “Sekali lagi kami minta kepada Walikota untuk tidak mengganti Sekda pada saat sekarang, karena banyak akibat negatifnya ketimbang hal positifnya,” ucapnya. Dukungan yang sama agar Sekda Psp tidak diganti sekarang menjelang pemilukada sebelumnya juga sudah disampaikan Ketua FPD DPRD Psp, Khoiruddin Nasution. (phn/mer)

Bangga Tekuni Forensik, Tak Canggung Utak-atik Potongan Tubuh Sambungan Halaman 1 ini disibukkan dengan proses identifikasi jenazah korban pesawat Sukhoi Superjet 100 yang menabrak Gunung Salak, Bogor Rabu (9/5) lalu. Seperti anggota lain tim itu, Reisa yang tak lain adalah Putri Indonesia Lingkungan 2010 tersebut harus berkutat dengan potongan-potongan tubuh (body part) korban yang sebagian besar sudah tidak berbentuk. Bersama anggota tim, dia bekerja keras mengungkap identitas para korban satu per satu. Tidak jarang, Reisa harus begadang semalaman untuk menyelesaikan pekerjaannya di bagian DVI RS Polri Kramat Jati. Namun, hal itu sama sekali tidak membebani dara cantik tersebut. Biasanya, Reisa bertugas membikin laporan DVI, termasuk mencocokkan data antemortem dan postmortem sejumlah jenazah. Namun, tidak jarang pula dia harus ikut mengutak-atik jenazah saat otopsi. Lewat salah satu foto yang ditunjukkan kepada Jawa Pos (grup METRO), tampak Reisa dengan santainya melakukan pemeriksaan atas potongan tubuh korban bersama anggota tim yang lain. Dia tidak shocked atau mual saat menyaksikan potongan tubuh korban yang kondisinya mengenaskan. “Mungkin karena sudah biasa, ya. Dan ini adalah kasus besar saya yang kesekian. Jadi, tidak ada beban sama sekali,” ujar Reisa saat ditemui di RS Polri. Kamar mayat dan isinya memang bukan hal baru bagi Reisa. Alumnus Fakultas Kedokteran Universitas Pelita Harapan tersebut menuturkan bersinggungan dengan jenazah sejak kali pertama menjalani program co-assistant di RS Polri pada 2007. Saat itu dia

dan kawan-kawannya sesama mahasiswa fakultas kedokteran diminta melakukan suatu hal yang ekstrem. “Kami dikerjain dokternya, hari pertama langsung ikut otopsi mayat. Eh, ternyata kami sudah langsung disuruh gergaji kepala orang. Ya pasti shock therapy karena gimanapun juga,” ujarnya, lantas terbahak. Setelah menjalani program itu, Reisa makin tertarik dengan dunia kedokteran forensik. Tak lama setelah lulus, dara 26 tahun tersebut memutuskan untuk bergabung dengan bagian forensik RS Polri pada 2009. Menurut dia, bagian forensik sangat menarik. Apalagi, dia gemar menonton serial thriller dari Amerika Serikat, CSI: Crime Scene Investigation. “Saya senang banget nonton CSI. Terus, waktu masih co-assistant di bagian forensik, seru saja rasanya, bisa solving causes dari jenazah. Dokter-dokternya juga baik dan banyak kasus menarik yang dipecahkan lewat identifikasi jenazah,” ujarnya. Saking gemarnya dengan bidang itu, dara kelahiran Malang, Jatim, tersebut pernah berniat melanjutkan pendidikan di jurusan ilmu kedokteran forensik. Sayang, orang tuanya tidak setuju dengan pilihan itu. “Mereka ngeri waktu tahu kesukaanku sama dunia forensik. Padahal, forensik itu luas, nggak cuma tentang jenazah,” ujarnya. Namun, lama-kelamaan orang tuanya tidak lagi protes dengan pilihan Reisa. Bungsu di antara dua bersaudara itu pun makin giat bekerja. Apalagi, sejak menjadi staf forensik RS Polri, dia langsung menangani kasus-kasus besar. Selain kasus pesawat SSJ 100, dia pernah terlibat dalam proses identifikasi jenazah korban bom JW Marriott pada 2009. Bukan hanya itu, serangkaian

kasus yang melibatkan teroris pernah dia urus. Ketika ditanya jumlah kasus yang pernah ditangani, Reisa mengatakan sudah tidak ingat jumlahnya. Yang jelas, sudah ratusan kasus. Namun, di antara sekian banyak kasus tersebut, adik kandung pengacara tenar Dea Tunggaesti itu mengaku paling terkesan saat menangani identifikasi jenazah korban tenggelamnya KM Levina 1 yang menewaskan 51 orang. Insiden tersebut terjadi saat dia masih magang sebagai dokter muda di RS Polri. “Peristiwa itu yang paling terngiangngiang sampai sekarang. Sebab, waktu itu korbannya banyak. Itu kali pertama saya menangani kasus besar. Karena korbannya meninggal dalam keadaan tenggelam, jadi baunya juga lebih anyir daripada korban tewas terbakar atau tabrakan,” jelas Reisa. Namun, dara bertubuh tinggi semampai itu mengakui, meski sudah bertahun-tahun menangani mayat, dirinya juga terkadang ngeri begitu menyaksikan jasad yang kondisinya remuk. Dia mengungkapkan pernah mengotopsi jenazah seorang kuli bangunan yang tewas karena tergencet benda berat di tempat kerja. “Kasihan banget sekaligus ngeri karena tubuhnya remuk,” papar dia. Di dunia forensik, Reisa mengaku senang jika bisa memecahkan kasus dari hasil otopsi jenazah. Dia mencontohkan, saat sesosok jenazah datang, di mana dirinya beserta tim sama sekali tidak mengetahui identitas maupun penyebab tewasnya orang tersebut, kondisi itu justru menjadi tantangan tersendiri. “Untuk memperkirakan waktu kematiannya, bisa dilihat dari ukuran belatungnya. Kalau makin besar, berarti

sudah lama meninggalnya. Kami senang banget kalau akhirnya bisa menemukan identitasnya dan mengungkap penyebab kematiannya. Yang paling sulit saat tidak berhasil mengidentifikasi,” terang dia. Meski begitu, Reisa menekankan bahwa bagian forensik tidak hanya berkutat dengan kasus-kasus orang yang sudah meninggal. Dia juga berurusan dengan kasus-kasus kekerasan atau pembunuhan yang membutuhkan visum pasien hidup. Dia mengatakan, banyak anak di bawah umur korban pemerkosaan dan korban kekerasan dalam rumah tangga (KDRT) yang ditanganinya. Dalam sehari dia bisa menangani 10 proses visum. “Di RS Polri ada dua tempat pelaporan pembuatan visum hidup dan mati. Jadi, yang ditangani banyak,” ucap dia. Namun, di balik kegiatan mengurusi mayat itu, tidak ada yang mengira bahwa Reisa juga menekuni dunia kecantikan, yang jelas bertolak belakang dengan bidang forensik. Di klinik kecantikan JMB runner-up pertama Putri Indonesia 2010 itu menjadi salah seorang dokter yang berpraktik sejak 2009. Dia memang pernah mengenyam pendidikan singkat di sebuah sekolah kecantikan. Karena itu, penampilan Reisa saat berpraktik sebagai dokter kecantikan jauh berbeda jika dibandingkan dengan saat dirinya bertugas sebagai tim DVI Polri. Saat menjadi dokter kecantikan, bisa dibilang penampilan Reisa full make-up meski tidak terlalu tebal. Begitu juga busana yang dia kenakan. Di balik jubah putih dia mengenakan dress cantik selutut. “Itu bedanya. Kalau di sini, harus

dandan kayak gini. Nggak bisa polosan seperti pas di rumah sakit Polri,” ujarnya ketika ditemui di klinik kecantikan JMB, kawasan Prapanca Raya, kemarin. Pasien yang dia tangani pun jauh berbeda. Pada umumnya, pasien Reisa adalah kaum hawa yang ingin mempercantik wajah dan tubuh. Bukan hanya si pasien, Reisa juga harus pandai menjaga kecantikan diri. Karena jadwal pekerjaan yang padat, Reisa selalu menyempatkan diri melakukan perawatan rambut, wajah, dan tubuh saat mandi. Kadang, saat pasien di klinik sepi, dia menyempatkan diri menjalani perawatan laser wajah. Meski harus menjalani dua bidang yang sangat kontras, Reisa tidak kerepotan. Asal pandai mengatur jadwal, dia justru menikmati bisa terlibat di dua bidang tersebut. Sebab, Reisa mengaku bahwa dirinya adalah tipe perempuan yang aktif dan tidak betah berdiam diri terlalu lama. “Pasti ada saja yang pengin saya kerjakan. Jadi, kalau sibuk malah senang,” ujar perempuan yang jarang berlibur saat weekend itu. Soal keterlibatannya dalam ajang

Putri Indonesia 2010, Reisa mengaku hanya iseng. Sebab, yang ngotot agar dirinya ikut justru sang ibu dan temantemannya. Tepat saat berusia 24 tahun, Reisa mendaftarkan diri. Dia mengumpulkan formulir pendaftaran dalam perjalanan ke rumah sakit. “Jadi, ya pakai baju kerja gitu,” terang dia. Karena itu, ketika terpilih, bahkan berhasil menjadi runner-up pertama Putri Indonesia 2010, Reisa mengaku tidak percaya bisa sampai sejauh itu. Otomatis, sejak menjadi Putri Indonesia Lingkungan 2010, pekerjaannya di klinik dan RS terhenti sementara. Dia harus terfokus pada segala kegiatan keputrian. Meski begitu, dia mengaku bersyukur bisa menjadi Putri Indonesia. Reisa belajar banyak hal, termasuk cara berdandan dan berpakaian yang baik, dari pengalamannya di ajang itu. Namun, sejak menyandang gelar Putri Indonesia Lingkungan 2010, Reisa kerap digoda rekan-rekannya di bagian forensik RS Polri. Mereka menyebut dia putri forensik. “Ada juga yang nyebut putriku lah,” ucap dia. Bukan hanya rekan-rekannya, atasannya juga kerap menggodanya. Sebagai staf forensik RS Polri, dia sering mendapat panggilan tugas jika ada kasus-kasus besar, aku yakinkasus jodohnya itu akan termasuk Sukhoipasti itu. “Waktu itu hilang,” kata ditelepon, iniMaia. ada kasus lagi. Eh, pas saya Dengan kondisi tersebut, mantan tebilang oke, dia malah bilang kirain man Mulan Jameelasudah itu pun sudahduet nggak mau (karena jadi mengaku tak ngoyo ujarnya mencarisambil calon Putri Indonesia),” pendamping hidup. tersenyum. (c11/nw) “Saya tidak akan mencari, biar Tuhan yang mencarikan untukku. Karena kalau saya yang mencari salah lagi kayak dulu. Tapi ya kenyataannya kayak itu, dan saya lagi enjoy ekspansi ke mana-mana, sehinggananti next kalausayasudahsiap menikah lagi dia mau larang apa wong kerjanyasudahbanyak,”tandasnya.(int)

Masih Trauma Menikah Sambungan Halaman 1 Dhani, 2008 silam, sampai saat ini Maia masih betah menjanda. Entah apa penyebabnya, apa karena Maia sulit mencari pengganti Dhani atau trauma berumah tangga lantaran pernah mengalami KDRT (kekerasan dalam rumah tangga)? Pasalnya, pertikaian dengan Dhani sempat mencuatkan isu KDRT. “Kalau dibilang trauma, ada trauma. Tapi aku yakin kalau nanti sudah ditemukan jodohnya, dan ada ruhnya,


22 Mei 2012

Tak Punya SIM Bisa Denda Rp1 Juta SIBOLGA-Peringatan keras bagi pengendara kendaraan bermotor. Jika tidak memiliki Surat Izin Mengemudi (SIM), pengemudi bisa didenda hingga Rp1 juta. Penetapan denda itu berdasarkan UU No 22 Tahun 2009 tentang Lalu lintas dan Angkutan Umum Pasal 281 yang menyebutkan setiap pengendara kendaraan bermotor yang tidak memiliki SIM dipidana dengan pidana kurungan paling lama 4 (empat) bulan atau denda paling banyak Rp1 juta. „ Yati Gea didampingi anaknya saat mendapat perawatan di RSU FL Tobing Sibolga.

Ibu Anak Diseruduk Angkot SIBOLGA- Yati Gea (39) yang dibonceng anaknya, Rantonus Bete (16) dengan sepedamotor diseruduk angkot 125 yang dikemudikan Ronal Siregar (25). Peristiwa yang terjadi Senin (21/5) di Simpang 5 Sibolga ini, membuat sang ibu mengalami luka di bagian kaki kanannya. Oleh anaknya dan sopir angkot yang menabrak mereka, Yati Gea kemudian dilarikan ke RSUD FL Tobing Sibolga untuk diberikan perawatan. Saat ini Yati Gea terpaksa di rawat inap di ruang Melur rumah sakit berplat merah tersebut. Menurut anak korban, Rantonus, kecelakaan lalu-lintas itu bermula saat mereka yang berboncengan sepedamotor melaju dari arah Pelabuhan

‹ Baca Ibu ...Hal ‹


“Sebenarnya itu denda maksimal dan ketentuan berapa pelanggar harus membayar denda itu kan nanti

Sebab SIM diberikan kepada pengendara bukan hanya sebagai sertifikat dia bisa mengemudi, namun juga dibuat agar pengendara

‹ Baca Tak Punya ...Hal ‹

sesuai dengan sidangnya. Namun sebagai warga negara yang sadar hukum, sudah seharusnya mematuhi hukum.


„ AKP Mulkan D


Pilihan Boleh BedaTapi Hindari Konflik


PERIKSA KENDARAAN, Kapolda Sumut, Irjen Pol Drs H Wisjnu Amat Sastro SH saat melakukan pemeriksaan terhadap mobil dinas yang diserahkan Pemko Sibolga, Senin (21/5) kemarin.

Polres Sibolga Dapat 4 Kendaraan Operasional SIBOLGA- Kepolisan Resort (Polres) Sibolga Kota memeroleh 4 unit kendaraan bermotor dari Pemerintah Kota (Pemko) Sibolga, Bank Indonesia, dan PT Sinar Gunung Sawit Raya (SGSR) Manduamas, Tapteng. Penyerahan kendaraan operasional itu

dilangsungkan Senin (21/5), di halaman Mapolres Sibolga Kota, dan diserahkan langsung oleh Wakil Wali Kota Sibolga, Marudut Situmorang AP MSP, Pemimpin Bank Indonesia (PBI) Sibolga, M Nur dan

‹ Baca Polres ...Hal ‹


Peringatan Harkitnas di SMAN 1 Andam Dewi ANDAM DEWI- Seluruh intansi pemerintah di Kecamatan Andam Dewi menggelar upacara peringatan Hari Kebangkitan Nasional yang jatuh pada tanggal 21 Mei. Acara yang digelar di halaman SMA Negeri 1 Andam Dewi tersebut berlangsung dengan khidmat dan meriah. Seluruh rangkaian kegiatan dipersiapkan oleh SMA Negeri 1 Andam Dewi selaku tuan rumah perayaan. Pasukan pengibar bendera yang berasal dari siswa-siswi SMA

‹ Baca Pilihan ...Hal ‹

Negeri 1 Sirandorung dengan mantap memasuki lapangan dan mengibarkan bendera. Upacara menjadi semakin khidmat dengan diiringi lagu-lagu nasional yang dinyanyikan oleh paduan suara SMA Negeri 1 Sirandorung. Hadir dalam upacara itu seluruh kepala sekolah se Kecamatan Andam Dewi. Mulai dari kepala sekolah dasar, menengah pertama dan menengah atas, baik negeri maupun swasta. Selain

‹ Baca Peringatan ...Hal ‹

SIDIMPUAN-Melalui momen pemilukada di Kota Padangsidimpuan (Psp) tahun ini diminta kepada seluruh masyarakat untuk meningkatkan nilai-nilai kemasyarakatan. Demikian disampaikan Ketua Lembaga Swadaya Masyarakat Pemerhati Khusus Aparatur dan Rakyat (LSM Perkara) Tabagsel, Khoirul Anwar Pulungan dalam acara seminar wawasan kebangsaan, bertempat di aula Kantor Camat Psp Tenggara, Senin (21/5). Di seminar yang di hadiri Kabid Program di Direktorat Jenderal Kesatuan Bangsa dan Politik (Dirjen Kesbangpol) Kementerian Dalam Negeri, Bahrum Alamsyah Siregar SH tersebut diharapkan pemilukada yang sudah dekat dan kesempatan ini telah memberikan ruang dan gerak pada masyarakat luas untuk menyalurkan aspirasi politiknya dengan memilih seorang pemimpin yang profesional, aspiratif, jujur dan adil, sudah merupakan dambaan semua masyarakat. “Dan untuk mewujudkan hal ini, semua berpulang kepada kita. Pilihan boleh berbeda akan tetapi kita tetap mengutamakan pemilukada yang



Sekda Diganti, Kinerja PNS Diyakini Akan Rusak SIDIMPUAN-Jika benar isu bahwa Walikota Padangsidimpuan (Psp) akan mengganti Sekretaris Daerah (Sekda) Kota Psp, Sarmadan Hasibuan, akan merusak tatanan kerja pegawai negeri sipil (PNS). Karenanya, walikota diminta untuk tidak melakukannya, karena akan lebih banyak akibat negatifnya daripada positifnya. Imbauan dan permintaan ini disampaikan kalangan mahasiswa yang ada di Kota Psp khususnya dan di Sumut pada umumnya. Mereka meminta Walikota Psp, Drs Zulkarnaen Nasution MM tidak mengganti Sekda saat sekarang ini. Ketua Badan Eksekutif Mahasiswa (BEM) Universitas Muhammadiyah Tapanuli Selatan (UMTS), Rony Rahmat Pohan didampingi Ketua Departemen Litbang, Horizon Saputra kepada METRO, Senin (21/5) meminta Walikota Psp agar benar-benar mempertimbangkan untuk mengganti Sekda saat situasi sekarang ini. “Sangat tidak efisien jika memang benar Walikota akan mengganti Sekda disituasi sekarang ini. Jika benar terjadi,

‹ Baca Sekda ...Hal ‹



22 Mei 2012

PKL Sebabkan Lalulintas Macet TAPUT- Kemacetan arus lalulintas di kawasan Pasar Siborongborong setiap hari pekan (Selasa, red) menjadi momok bagi masyarakat. Keberadaan Pedagang Kali Lima (PKL) di pasar itu pun dinilai penyebab terjadinya kemacetan. Tak ingin berlarut-larut

dengan kondisi seperti itu, Satpol PP Tapanuli Utara bertindak dengan menggelar razia setiap hari pekan. Penertiban itu bekerja sama dengan Polsek dan Koramil. Bagi pedagang yang membandel, akan dikenakan sanksi dengan mengangkut seluruh dagangan. “Minggu lalu kita sudah memberi toleransi. Jika pedagang masih ada yang

Aliansi Masyarakat Adat Pollung Demo Kantor Bupati

TPL Diminta Stop Beroperasi HUMBAHAS- Sekitar 500 lebih warga yang mengatasnamakan Aliansi Masyarakat Adat Kecamatan Pollung, melakukan aksi demo ke kantor Bupati Humbahas, Bukit Inspirasi, Doloksanggul, Senin (21/5). Kedatangan mereka menuntut agar PT Toba Pulp Lestari stop beroperasi di lahan masyarakat adat Pollung. „) Baca TPL Diminta .Hal 10

„) Baca PKL ...Hal 10

Foto Bernad L Gaol

IRIGASI: Irigasai di Dusun Lumban Soit, Desa Hutauruk Hasundutan, Kecamatan Sipoholon, Taput, yang belum difungsikan sejak dibangun tahun 2009.


DEMO: Sekitar 500 lebih warga dari 11 desa di Kecamatan Pollung saat melakukan aksi demo ke Kantor Bupati Humbahas, Bukit Inspirasi, Doloksanggul.

Irigasi Senilai Seputar Perampok Bersenpi Beraksi di Angkot Ratusan Juta Telantar Pelaku Diduga Sembunyi di Hutan TARUTUNG- Irigasi di Dusun Lumban Soit, Desa Hutauruk Hasundutan, Kecamatan Sipoholon, Taput, sejak selesai dikerjakan tiga tahun lalu belum juga difungsikan. Pembangunan irigasi yang menelan dana senilai Rp299 juta itu dinilai mubajir karena tidak dimanfaatkan sesuai kepentingan masyarakat. Tidak berfungsinya irigasi

itu membuat persawahan di daerah itu kering. Oleh petani kecewa dan mengalihkan lahan mereka dengan menanam tanaman palawija. Seperti, jagung dan umbi-umbian. “Sejak 2008 kami kesulitan mendapat air untuk mengairi persawahan. Sejak itu pula, produksi padi terus merosot.

„) Baca Irigasi ...Hal 10


FOTO Bernad L Gaol

BAHAS PERAMPOKAN: Kapolres Humbahas AKBP Verdy Kalele (tengah) didampingi Asisten Pemerintahan Drs Tonny Sihombing MAP dan Kakan Kesbang Tibum, Mangupar Simanullang membahas aksi perampokan yang terjadi di Jalan Doloksanggul-Parlilitan.

LOKET: Puluhan masyarakat antre di loket pembaran rekening listrik di Jalan Balige Pardangguran, Desa Simamora, Kecamatan Tarutung, Senin (21/5).

Petugas Loket PLN Kutip Denda Belum Jatuh Tempo TARUTUNG- Puluhan pelanggan PLN mengaku kecewa atas kebijakan yang dilakukan petugas loket tempat pembayaran rekening listrik di Jalan Balige Pardangguran, Desa Simamora, Kecamatan Tarutung. Pelanggan dikutip denda Rp3.000 meski pembayaran dilakukan sebelum jatuh tempo. Kepala Desa Pancur Napitu,

Tongam Sibarani yang juga pelanggan PLN kepada METRO Senin (21/5) mengaku kecewa terhadap tindakan petugas loket pembayaran rekening listrik tersebut. Pasalnya, dia dikutip denda Rp3.000 meski pembayaran sudah dilakukan di bawah tanggal 20 sebagai batas akhir pembayaran

„) Baca Petugas ...Hal 10

DOLOKSANGGUL- Tiga orang perampok bersenjata api (senpi) yang beraksi di dalam Angkutan Kota (angkot) jurusan Doloksanggul-Parlilitan, Sabtu (19/5) tepatnya di Desa Sampean, Kecamatan Doloksanggul, Humbahas, yang melarikan diri ke hutan, hingga Senin (21/5) belum ditemukan Polisi. Pelaku diduga masih berada dan sembunyi di hutan. “Setelah mendapat laporan dari penumpang itu, kita langsung turunkan anggota untuk melakukan pengejaran ke hutan tempat pelarian pelaku. Namun, sampai saat ini belum kita temukan,” ujar Kapolres Humbahas, AKBP Verdy Kalele, kepada METRO, Senin (21/5) saat memimpin pengamanan aksi demo Aliansi Masyarakat Adat Kecamatan Pollung ke Kantor Bupati Humbahas, Bukit Inspirasi, Doloksanggul.

„) Baca Pelaku ...Hal 10

Air Mancur Balige Tidak Lambangkan Identitas Budaya BALIGE- Hiasan air mancur di pusat Kota Balige, Kabupaten Toba Samosir, dinilai tidak mencerminkan budaya Batak Toba karena sama sekali tidak berfungsi sebagai simbol atau lambang identitas masyarakat setempat. “Bingkai hiasan air mancur itu bahkan menghalangi monumen Pahlawan Nasional DI Panjaitan serta rumah tradisional Batak Toba di sebelahnya, karena tampilannya melebihi bangunan sekitarnya,” ujar Ketua Forum Peduli Pembangunan Toba Samosir, Sahala Simanjuntak di Balige, Senin (21/5). Menurut dia, ikon kota memang perlu dibangun sebagai simbol suatu daerah, tapi hiasan air mancur di bundaran ibu kota kabupaten itu dinilai tidak menggambarkan nilai budaya Batak. Pada saat orang melintasi kota, kata dia, pendangan akan terfokus pada suasana daerah yang melekat bersama budaya dan adatnya, yang secara otomatis akan

„) Baca Air Mancur ...Hal 10


Ponsel Depo Tapanuli Peroleh TV LCD 22 Inch Mistery Shopper adalah program yang dicanangkan XL & dealer yang bertujuan untuk menggairahkan Frontliner Ponsel dalam menjual produk XL sebanyak-banyaknya dan melakukan action dengan mendahulukan menawarkan XL. Depo Tapanuli dengan Authorized Dealernya CV Rotua Excelcom Cellular, jadi pemenang dan berhasil memeroleh TV 22 inch. Dari Mistery Shopper tersebut dua SPG ponsel dapat hadiah televise LCD flat 22 inch

merek LG. Di antaranya, SPG Maranatha Ponsel Tarutung dengan SPG nya Sari Hutagalung. Sari selalu menawarkan XL lebih dahulu dan memberikan keterangan bahwa XL adalah kartu yang paling murah jika dipakai untuk telpon, SMS dan internet. Hanya kirim 1 kali (Rp150) dapat gratis SMS ke semua operator sebanyak 1.000 kali. Kemudian bayar Rp1.250 per menit dapat gratis satu jam. “Mau internetan juga oke. Jaringan luas dan terjangkau.

Jaringan XL kuat di Tarutung,” ucap sari promosi. Peraih hadiah TV LCD lainnya adalah Ira Nuraini dari Ponsel NECIS PONSEL di Balige. Selain menjelaskan tarif, Ira mengajak masyarakat menggunakan XL. “Mau internetan, ya XL. Jaringannya berkualitas. Tidak rugilah pakai XL,” sebutnya. Penyerahan hadiah diserahkan langsung oleh GM Sales Northern West, Swandi Tjia.

„) Baca Ponsel ...Hal 10

Foto Ist

„ Maranatha Ponsel Tarutung menerima satu unit TV LCD dari petugas XL.


22 Mei 2012

Petugas Loket PLN Kutip Denda Belum Jatuh Tempo Sambungan Halaman 9 rekening listrik setiap bulannya. Begini ceritanya, Sabtu (19/5) Tongam hendak membayar rekening listring via ATM (Automated Teller Machine) karena tanggal 20 jatuh pada hari minggu. Oleh monitor ATM menolak pembayaran karena rekening listrik miliknya sudah dibayar tanggal 5 Mei. “Saya sempat bingung. Kok sudah dibayar. Padahal sepegetahuan saya, rekening listrik kami belum saya bayar. Kemudian saya mendatangiloketresmipembayaran rekening listrik di Siatas Barita. Benartelahdibayar.Tapisiapayang bayarsayatidaktahu.Olehpetugas loket mengarahkan saya agar menemui petugas loket bernama Tandap L Tobing,” paparnya. Selanjutnya, sambung Tongam, Senin (21/5) dia menemui Tandap diloketyangterletakdiJalanBalige. “Saya tanya ke Tandap, ternyata benarkwitansitandabuktipembayaran sudah ada sama dia. Anehnya, ketika hendak membayar, dia malah meminta denda dengan alasan batas pembayaran sudah lewat. Saya berontak. Karena tanggal pembayaran ke bank sesuai yang tertera di slip tanda bukti pembayaranitutercatatpadatanggal 5 Mei. Saya merasa dibodohi dan tidak mau bayar. Sebenarnya, bukan persoalan denda itu. Tapi sejak awal kami tidak ada kesepakatan kalau dia yang membayar rekeninglistriksaya.Diamembayar suka rela, karena tidak ada kesepakatan sebelumnya. Mengapa tibatiba dia meminta denda? Kalau bukaninginmembodohimasyarakat, lalu apa maksudnya,” beber pria itu. Meski jadi korban akal-akalan, dia enggan melaporkan hal itu ke pihak berwajib. Karena menurut mereka pengaduan ke pihak berwajibbukantujuanutama,melainkan meluruskan serta mengingatkan petugas loket agar tidak mengulangi perbuatannya. Senada dikeluhkan Renti br Hutabarat, seorang pelanggan dari Desa Sitompul. “Selama ini kalau tanggal 20 jatuh pada hari libur, pembayaran bisa dilanjutkan ke tanggal21dantidakadadenda.Nah, kemarin, tanggal 20 jatuh pada hari Minggu.Makanyabaruhariinisaya bayar. Tapi, kami langsung dikenakan denda. Kebijakan apa itu? karena tidak ada pemberitahuan sebelumnya,” kesal wanita itu. Anehnnya,katadia,Senin(21/5) pukul 11.00 Wib, dia masih sempat membayar rekening listrik di PT Palapa di Jalan Balige, dan masih diladeni dan tidak dikutip denda. Namun, beberapa menit kemudian, ketika dia hendak membayar rekening tetangganya di loket dan alamatyangsama,tiba-tibadikutip denda Rp3.000. “Saya juga bingung. Ketika saya tanya,katanyaadaperaturanbaru,” jelasnya. Tidak hanya Renti yang merasa

kecewa, melainkan ratusan pelanggan PLN keberatan dengan kebijakan itu. Misalnya, Senin (21/ 5) ratusan pelanggan bersungutsungut karena petugas mengutip denda.Sepengetahuanpelanggan, selama ini, apabila tanggal 20 jatuh pada hari Minggu, pembayaran bisa dilanjutkan tanggal 21 tanpa dikutip denda. Berbeda bulan ini. Pelanggan yang membayar lewat tanggal 20 tetap didenda meski tanggal tersebut jatuh pada hari Minggu. Merekamengatakan,petugastelah bertindaksemena-menatanpaada pemberitahuan dan sosialisasi bahwa pengambilan slip rekening diatastanggal20meskitagihannya dibayar di bawah tanggal 20 juga didenda. Keluhan yang sama juga dilontarkan dari pelanggan loket Sipoholon, Tarutung, Siatasbarita. Ironisnya pembayaran di kantor Pos Tarutung, pada pagi hari (21/ 11) masih sempat dibuka pembayaran rekening listrik. Namun tiba-tiba puluhanh pelanggan terkejut karena petugas menstop pembayaran dan mengalihkanloketpembayaranke loket yang berada di bagunan PT Palapa,JalanBalige,Pardangguran. Ketika hal ini ditanya ke Tandap L Tobing, petugas loket pembayaranrekeninglistrikdiJalan Balige membayarkan pelanggan yang membayar di atas tanggal 20 akan dikenakan denda. “Kami hanya menjalankan tugas,” tandasnya. Namun, ketika ditanya apa dasarnya mendahulukan pembayaran rekening pelanggan dan mendenda yang terlambat mengambil slip pembayaran, dia tidak banyak komentar. “Tujuan kita hanya untuk mepermudah saja,” singkatnya. Sementara Supervisor PLN Ranting Tarutung, M Simbolon membenarkan, setiap pembayaranlewattanggal20akandikenakan denda.“Bataspembayarantanggal 20. Yang pasti lewat tanggal 20 akan didenda. Meski tanggal tersebut jatuh pada hari Minggu atau hari libur. Ketentuan itu telah diterapkan pada saat diberlakukanya On line oleh PLN sejak Juni 2011 lalu,” terangnya. Saat ditanya kebijakan petugas loket tentang pembayaran dimuka olehpetugastanpasepengetahuan pelanggan, dia enggan mengomentari. Namun ia berjanji akan menyelidikinya. “Jika ada kesepakatan antara pelanggan dengan petugas tidak menjadi masalah. Apabila hal itu benar, akan kita beri sanksi. Apa sanksinya, kemungkinan loket tersebut akan kita tutup,” tegasnya. Serupa disampaikan Kepala Ranting PLN Cabang Tarutung. “Batas pembayaran tanggal 20. apabilaterlambatdieknakansanksi biaya keterlambatan atau pemutusan sementara,” singkatnya. (cr-01)

TPL Diminta Stop Beroperasi Sambungan Halaman 9 Warga tersebut berasal dari 11 desa yang ada di Kecamatan Pollung, yakni Desa Huta Paung Induk, Desa Huta Paung Utara, Desa Hutajulu, Desa Pansur Batu, Desa Parsingguran I, Desa Parsingguran II, Desa Aek Nauli I, Desa Aek Nauli II, Desa Sipitu Huta, Desa Pandumaan dan Desa Sibatubatu. Mereka menuntut agar pemkab menandatangani peta usulan revisi tata batas konsesi PT Toba Pulp Lestari (TPL) dengan masyarakat adat di Humbahas khususnya di Kecamatan Pollung. Demonstran juga menuntut, agar pemkab melindungi dan mengakui tanah adat di Humbahas, menghentikan operasi PT TPL di lahan masyarakat adat Pollung yang disengketakan sebelum semua kawasan hutan kehidupan masyarakat adat hancur. Kemudian mendesak pemkab segera membuat Peraturan Daerah (perda) tentang perlindungan dan pengakuan hak-hak masyarakat adat. Saat demo berlangsung, perwakilan warga menuturkan, sengketa lahan antara masyarakat di 11 desa itu dengan PT TPL sudah berlangsung selama hampir empat tahun. Dimana area konsesi yang dimiliki TPL atas izin yang dikeluarkan oleh Menteri Kehutanan, masuk pada lahan warga yang di klaim warga sebagai

tanah adat mereka. Atas desakan warga itu, Wakil Bupati Humbahas Drs Marganti Manullang didampingi Sekretaris Daerah Martuaman S Silalahi SH dan sejumlah pejabat yang menerima demonstran di Halaman Kantor Bupati Humbahas, langsung meminta perwakilan setiap desa agar duduk bersama membicarakan tuntutan warga. Saat melakukan negosiasi di ruang rapat mini Kantor Bupati Humbahas, kesimpulan disepakati, agar revisi tata batas dijalankan sesuai aturan yang berlaku. Warga juga diminta agar tata batas wilayah kawasan yang di klaim sebagai tanah adat ditinjau lebih teliti untuk selanjutnya secara bersama dengan pemkab mengusulkan revisi tata batas area konsesi TPL kepada Menteri Kehutanan. “Kita harus mengikuti tata cara sesuai dengan aturan yang jelas untuk revisi tata batas itu. Jangan kami nanti terjebak menyalahi aturan yang berlaku karena dipaksa menandatangani revisi tata batas itu,” tegas Marganti. Sedangkan Kadis Kehutanan Humbahas, Ir Marco TP Panggabean saat pertemuan itu menjelaskan, pihaknya tidak mau terjebak menyalahi aturan sesuai dengan Peraturan Menteri Kehutanan Nomor 50 Tahun 2011 tentang pengukuhan kawasan hutan. Dijelaskan dia, tahapan pengukuhan tata batas kawasan hutan ha-

PKL Sebabkan Lalulintas Macet Sambungan Halaman 9 tidak taat peraturan, akan kita beri sanksi. Pedagang dilarang berjualan di luar Pasar Siborongborong. Jika ada yang membandal, dagangannya akan kita amankan,” tegas Kepala Satpol PP Taput, Rudi Sitorus SSos barubaru ini. Menurutnya, PKL di luar Pasar

Siborongborong dinilai penyebab utama arus lalulintas macet. Sebab pedagang menggelar dagangan hingga ke badan jalan. Padahal di dalam pasar tersebut masih ada yang kosong. Sebelumnya, Satpol PP dibantu Polsek dan Koramil Siborongborong telah melakukan penertiban terhadap pedagang di luar Pasar Siborongborong.

Sambungan Halaman 9 mencerminkan suasana hidup dan kehidupan di daerah tersebut. “Ketika kita memasuki wilayah pusat kota pandangan tertutup oleh bangunan air mancur, sehingga patung D.I. Panjaitan terkesan seperti ‘maningkirningkir’ (mengintip) dari bingkai empat persegi yang letaknya persis di tengah bundaran tersebut,” ujarnya. Tampilan patung menjadi terkungkung dalam pigura air mancur. “Jika diamati, air mancur sama sekali tidak mempunyai makna yang terkait dengan nilai kepahlawanan D.I. Panjaitan,” katanya. Seharusnya, menurut Sahala,

rancangan bangunan air mancur mengarah pada dua sifat tampilan yakni vertical patung dan horizontal rumah Batak, agar nilai budaya yang terkandung di dalamnya tidak terganggu. Ia menilai perlu kembali dirancangbentukbangunanairmancur yang lebih sesuai dengan lingkungan bundaran, sementara instansi terkait harus membuka pintu lebar-lebar dengan melibatkan masyarakat agar berkontribusi melalui sumbangan ide dan pemikiran. “Akan sangat tepat jika nilai budaya etnis Batak dimunculkan melalui cerminan filosofi berupa

PROMO MITSUBISHI: Pick Up L300 & T120ss. Colt Diesel Chassis & Dumptruck. Fuso, Triton, Pajero Sport. BB/BK >oke..! Kuning/Hitam>oke!! Diskon spesial Hubungi: VINA NAULI SIREGAR 0812 6036 0000 DIJUAL: Mobil Minibus Suzuki carry Futura 1.3 thun 1991, body mulus, harga nego tanpa perantara hub. D. Simanjuntak HP 0813 7554 0521


HARI INI INVESTASI: Mulai besok dapat profit 7% Rp. 6.300.000 setiap harinya non stop selama 200 hari (Tanpa Rekrut) Minat???? SMS "Petunjuk" ke HP 0877 8847 7900


GRAN MAX PU DP 15 Jutaan GRAN MAX MB DP 23 Jutaan XENIA DP 30 Jutaan TERIOS DP 40 Jutaan Hub. PT CAPELLA PADANG SIDEMPUAN HP 0852 7570 5030

Carry Pick Up Dp. 20Jt angs 2Jtan APV Pick Up Dp. 25Jt angs 2Jtan APV Arena GL Dp. 26Jt angs 4Jtan Hub: Chandra Pasaribu SE 0852 1514 0852

MITSUBISHI BARU: Ready Stock • Pajero Sport • Triton • Colt Diesel • L300, T120SS • Suku Bunga 0% Dp. Ringan Hub: F. Gultom, SE. 0813 6169 4479

TOYOTA BARU 2012: Dapatkan New Toyota dengan Bunga Kredit 3,85%. Proses cepat & bisa tukar tambah & dapatkan hadiah khusus di bulan ini. Hub: PREDY SIMATUPANG, 0813 6165 1801 - 0853 6207 2000

mottoatauimbauandalambahasa daerah, seperti ‘tampakna do rantosna, rim ni tahi do gogona’ yang bermakna kebersaman mencerminkan kekuatan,” ujarnya. Selain itu, juga patut diingat bahwa bundaran air mancur itu berfungsi sebagai marka jalan dan merupakan sirkulasi pemutaran ruas jalan utama serta jalur lintas Sumatera. “Untuk kenyamanan pengendara perlu suatu usaha memperkecil sudut tikungan, karena secara total tampilan air mancur itu tidak melambangkan Balige sebagai ibu kota Kabupaten Toba Samosir,” katanya. (ant/int)

Ponsel Depo Tapanuli Peroleh TV 22 Inch Turut hadir pada kesempatan itu, Regional Sales Operation Manager Sumut Handry HP, Jhonny Sinaga selaku Direktur CV Rotua Excelcom CellularbesertaistriRany Silaen dan Branch Manager CV Rotua Excelcom Cellular Siswandi. Area Manager Sales Ops Tapanuli, Jeffry Tampubolon mengatakan, program ini sengaja digulirkankepadamitraretailoutlet Depo Tapanuli (Sibolga, Tapanuli Tengah, Nias, Tapanuli Utara, Toba Samosir dan Humbang Hasundutan). Karena mitra outlet sudah maumemperjelasprogramdantarif murah XL kepada pelanggan. “Katakanlah inilah ungkapan terima kasih XL kepada kepada mitra outlet yang sudah melayani pelanggan di Depo Tapanuli,”

TOYOTA BARU ASTRA: Ready Avanza, innova, fortuner Hub. Purba 0813 9789 4633; 0813 9736 0333

Namun, sekitar ratusan pedagang masih ada yang bertahan. Adapun jalan yang dipakai pedagang sebagai tempat berjualan di antaranya, Jalan Baktiar, Jalan Damai, Jalan Horas dan Jalan Sisingamangaraja, Kecamatan Siborongborong. Kebanyakan dari mereka adalah pedagang sembako dan musiman. (cr-02)

Air Mancur Balige Tidak Lambangkan..

Sambungan Halaman 9

ZIDANE: Water Treatment Solution Menjual peralatan depot air isi ulang, Menerima pemasangan baru R.O & Mineral. Harga mulai Rp. 15 Jtan dan seterusnya. Hub: 0852 7541 7775 Jl. Sultan Sugenggu Paruman No. 22 (Pandan Sibolga)

rus sesuai Permenhut Nomor 50 Tahun 2011. ”Setelah kita petakan, kita ikuti pembuatan trayek batas, pemancangan batas sementara, dan selanjutnya menunggu pengumuman dari BPKH,” jelas Marco. Sementara pihak PT Toba Pulp Lestari, baru-baru ini, kepada METRO melalui salah satu direktur perusahaan, Ir Juanda Panjaitan mengatakan, pihaknya hanya mengusahai lahan di Kecamatan Pollung sesuai dengan izin Hak Pengusahaan Hutan Tanaman Industri (HPHTI) yang dikeluarkan Menteri Kehutanan. Meski demikian, pasca klaim warga Kecamatan Pollung atas tanah mereka, pihaknya siap untuk melakukan negosiasi. Saat aksi demo itu, Kapolres Humbahas AKBP Verdy Kalele langsung turun tangan untuk mengamankan jalannya demo. Tak kurang dari 100 orang aparat Polres Humbahas, turun mengamankan jalannya demo. Selain melakukan demo ke Kantor Bupati, rombongan juga melanjutkan aksinya ke Kantor DPRD. Namun, tak satu pun anggota Dewan yang ada di kantor saat rombongan tiba. Rombongan pun menghubungi salah satu anggota Dewan yakni Ramses Lumban Gaol melalui telepon seluler, agar menerima kedatangan warga dan selanjutnya berangkat ke lokasi lahan konlik di Kecamatan Pollung. (hsl)

jelasnya. XL dan Dealer di Depo Tapanuli dengan dua Branch Officenya di Sibolga dan Balige akan tetap memanjakan mitra Retail Outlet di Depo Tapanuli dengan programprogramnya. Di antaranya, program yang saat ini sedang berjalan seperti,HOTXL,KAS,XL,XLAgent danProgramKomunitasBiruyang cukup banyak hadiahnya. Antara lain, mobil, umroh, liburan ke Australia, uang tunai, dompul dan banyak lagi hadiah lainnya. “Tunggu kehadiran Mistery Shopper XL-ROTUA dengan hadiah TV nya di outlet Anda. Dengan cukup menyediakan Perdana XL yang banyak, tersedia update material promo dan selalu tawarkan produk XL dengan keunggulannya. Pake Dompul Pasti Untung,” tandasnya. (rel)

Irigasi Senilai Ratusan Juta Telantar Sambungan Halaman 9 Olehsebagianpetanimengalihkan sawah mereka dengan bertanam palawija,” kata Netti L Hutauruk (43), seorang petani di Lumban Soit, Senin (21/50) sembari menghunjuk irigasi yang tidak difungsikan itu. Awalnya, kata dia, irigasi itu dibangun untuk mempermudah pasokan air ke persawahan milik warga. Bahkan, bangunan itu kini sudah ditumbuhi ilalang. Senada disampaikan Hertokel Simanullang (47) petani di daerah itu. Menurutnya, tidak berfungsinya irigasi tersebut disebabkan sebagian saluran irigasi sudah rusak. “Selain sebagian saluran irigasi banyak yang rusak, air dari Aek Sigeaon sebagai pemasok air tidak lagi mengalir. Hal itu disebabkan Aek Sigeaon mengalami pendangkalan. Sehingga tidak mampu mengairi areal persawahan,” jelasnya. Diajugamembenarkan,saatini, sebagian petani telah mengubah fungsi persawahan dengan menanam tanaman palawija seperti jagung,umbi-umbiandansayuran. “Kitaberharapmasalahinisegera diatasi. Jangan diam. Kasihan petani. Jika kondisi ini tetap dibiarkansepertiini,kemungkinanbesar, petanisulitcarimakan.Bagaimana tidak. Harga beras melambung tinggi.Sementaramasyarakatyang ingin menanam padi terkendala karena air tidak ada,” jelasnya.

Kepala Bidang Jalan Jembatan PUK Taput, P Pangaribuan selaku Pejabat Pembuat Komitmen proyek tersebut membenarkan kalau pengerjaanya sudah selesai sejak Desember 2009 lalu. Saat ditanya berapa besar dana yang diperuntuk dalam pembangunan itu, dia tidak banyak komentar. “Kalau dananya saya tidakingatpersisberapa,tapisekitar Rp200 juta lebih dari dana fiscal 2009,” sebutnya. Disebutkannya, tidak mengalirnya air ke irigasi itu disebabkan adanya penurunan dasar Aek Sigeaon. “Irigasi tidak dialiri air bukan semata-mata karenaproyeknyayangdisalahkan. Melainkan karena ulah dari sekelompokpengusahakayupinus dan penambang pasir di hulu Sungai Sigeaon dan Aek Sirongit. Sehingga mengakibatkan sirkulasi air tidak dapat terjamin,” ucapnya. Disisilain,katanya,wargadisana jugaengganmelakukanperawatan terhadap saluran irigasi sehingga tidak bertahan lama. Amatan METRO di lokasi irigasi terlihat kurangnya perhatian pihak terkait dalam melakukan perawatan terhadap fasilitas teknis tersebut. Pada saluran induk ditumbuhi tanaman rawa-rawa sehingga air tidak bisa mengalir. Demikian juga pintu intake irigasi itutidakdialiriairkarenatertimbun lumpur. Sehingga air yang dipasok dari Aek Godang Sigeaon tidak naik. (cr-01)

Pelaku Diduga Sembunyi di Hutan Sambungan Halaman 9 Verdy menjelaskan, pihaknya telah menutup kemungkinan akses jalan keluar dari kawasan hutan tempat pelarian para pelaku. ”Selain melakukan penyisiran ke hutan oleh sejumlah anggota, kita juga sampai saat ini telah menutup akses kemungkinan jalan keluar dari dalam hutan tersebut,” tandasnya. Ditanya terkait proyektil peluru yang sempat satu kali diletuskan salah satu pelaku saat melakukan usaha aksi perampokan itu, Verdy menyebut, pihaknya juga belum menemukan bukti proyektil peluru di kawasan hutan atau dekat lokasi kejadian. ”Kita belum temukan proyektil pelurunya. Kita akan terus memburu pelakunya,” pungkasnya. Tiga orang perampok bersenjata api (senpi) beraksi di dalam Angkutan Kota (angkot) jurusan Doloksanggul-Parlilitan, Sabtu (19/5) sekitar pukul 17.30 WIB tepatnya di Desa Sampean, Kecamatan Doloksanggul, Kabupaten Humbang Hasundutan. M Harahap (5) dan M Nasir Simanungkalit (50) dua pedagang emas yang menjadi korban incaran tiga perampok bersenpi tersebut kepada METRO, Minggu (20/5) di Jalan Melanthon Siregar atau toko milik M Harahap mengatakan, ketiga perampok diduga telah mengikuti mereka sepulang berjualan dari Pasar Pusuk, Kecamatan Parlilitan hingga masuk ke dalam angkot jenis Colt Diesel L300 BK 7740 DJ yang dikemudikan Maruba Manullang (31) . M Nasir Simanungkalit menuturkan kronologis kejadian sekitar pukul 17.00 WIB, mobil angkutan yang mereka tumpangi berisi 11 penumpang. Nasir sendiri bersama M Harahap yang sama-sama pedagang emas, duduk di bangku depan dekat supir. Sementara ketiga pelaku, satu orang duduk di belakang supir, satu orang di bangku tengah dan seorang lagi duduk di bangku paling belakang. Saat di perjalanan, sebutnya, ketiga pelaku tidak banyak bicara. Namun, tepat di Hutan Sigaranggarang, Desa Sampan, Kecamatan Doloksanggul, seorang pelaku meminta supir untuk berhenti karena mengaku sudah lewat tujuan yang akan mereka singgahi. “Saat itu, supirnya pun menghentikan mobil di pinggir jalan. Namun, salah satu pelaku yang turun langsung menodong saya dengan senjata api lewat pintu sebelah kiri mobil. Sedangkan pelaku yang duduk persis di belakang supir turun, menodong supirnya dengan senjata tajam dari pintu kanan depan mobil dan mengambil handphone supir itu. Dan, pelaku yang di tengah juga mengancam salah satu penumpang bermarga Purba dan menyita handphone miliknya,” ujar Nasir Simanung-

kalit. Saat dirinya diancam dengan senjata api, sambung Nasir, kepadanya diminta untuk menyerahkan uang dan perhiasan miliknya. Namun, dirinya melakukan perlawanan. Sedangkan penumpang lainnya hanya diam karena ketakutan. ”Saat itu, aku lawan dia (pelaku-red) adu mulut. Sehingga pelaku emosi dan meletuskan senjata api yang dipegangnya ke arah leher saya. Saya sangat kaget waktu itu. Tapi setelah saya pegang leher saya tidak berdarah. Saya pun langsung mengambil besi bulat pembesar dan pengecil cincin yang ada di dalam tas sambil keluar dari dalam angkot. Tapi pelaku langsung lari ke arah belakang mobil. Saat saya kejar ke belakang, pelaku langsung lari ke arah hutan. Saat itu, pelaku yang di dalam angkot juga bergegas keluar dan lari ke hutan,” beber Nasir. Ia menyebut, pelaku yang meletuskan senjata api terhadap dirinya itu diduga mengambil senjata api dari dalam tas milik perampok sehingga berusaha lari. ”Kalau besi bulat dan berwarna hitam pembesar dan pengecil cincin itu kan pendek, mungkin saat saya hendak mengambil sesuatu ke dalam tas, pelaku pikir saya mengambil senjata api juga, makanya mereka lari,” kisahnya. Sementara itu, M Harahap, yang duduk berdampingan dengan Nasir saat kejadian mengatakan, dirinya mengaku sangat ketakutan dan memilih untuk diam saja. ”Melihat pistol yang ditodongkan kepada pak Simanungkalit itu saja saya sudah ketakutan. Saat itu saya tidak berani ikut melawan. Karena posisi saya pas duduk di tengah bangku depan. Pak Simanungkalit serta supir angkot yang duduk di samping kanan dan kiri saya posisinya sama-sama diancam,” ungkap Harahap. Ia mengaku baru bisa merasa lega, setelah mobil yang ditumpanginya sudah sampai di Doloksanggul. ”Saya baru bisa lega setelah mobil yang kami tumpangi sampai di Doloksanggul. Kalau selama di perjalanan pulang setelah kejadian itu saya masih tetap khawatir dan ketakutan. Padahal, saat ketiga pelaku sudah kabur, kami sudah menghubungi salah seorang polisi melalui handphone. Tapi saya tetap ketakutan,” akunya. M Harahap sendiri mengaku usai pulang berjualan dari Pasar Pusuk, Kecamatan Parlilitan membawa pulang perhiasan senilai Rp100 juta lebih dan uang puluhan juta. Demikian juga dengan M Nasir Simanungkalit. ”Saat itu, perhiasan dagangan yang kami bawa sama-sama bernilai sekitar Rp100 juta lebih dan uang puluhan juta rupiah. Beruntung, kami tidak apa-apa dan perhiasan serta uang kami tidak ada yang dirampok,” tutur M Harahap. (jona/hsl)




22 Mei 2012

Honda PCX 150 Segera Meluncur

„ Honda PCX 150 PELAN tapi pasti, PT Astra Honda Motor terus memperkuat segmen skutiknya dengan produk baru. Kali ini adalah “flagship” skutik, PCX 150 yang akan diluncurkan pada awal semester dua tahun ini. Dengan PCX 150, kami akan memberikan produk dengan nilai semakin baik kepada konsumen,” ujar sumber AHM, Senin (21/5). Persiapan peluncuran PCX 150 tercium dari pendaftaran skutik tersebut ke Kementerian Perindustrian. Saat ini kode HONDA WW150D(IN) A/T masih dalam proses atau tengah diuji coba produknya. Dari kode ini terlihat bahwa Honda motor tetap mengimpor secara utuh (CBU) skutik kasta tertingginya ini dari Thailand. Untuk penampilan, PCX 150 hampir tak berrbeda dengan PCX 125 yang ada dipasar saat ini. Perbedaan utama hanya pada mesin SOHC 152,9 cc dengan teknologi Enhanced Smart Power (eSP). Teknologi tersebut sebenarnya sudah digunakan pada Vario Techno 125 PGM-FI yang mengoptimalkan pendinginan komponen dan mengurangi gesekan agar tenaga bertambah namun maksimal namun tetap irit. Untuk pemindah tenaga, CVT V-Matic, kinerjanya terus ditingkatkan. Fitur lainnya adalah Anti-Theft Alarm System, combi brake system hidrolik, ACG starter dan idling stop system (ISS). Sayang, untuk bandrol, sumber Honda masih tutup mulut. “Kalau harga masih belum jelas. Nanti saja kalau sudah pasti,” tutup sumber itu. (int/mer)

Amazon Siap Rilis Kindle eBook Reader Baru

“iPad Mini” Rp2 Jutaan Segera Diproduksi? PERANGKAT tablet Apple dengan ukuran layar yang lebih kecil atau sering disebut dengan “iPad Mini” cukup ramai digosipkan dalam beberapa bulan terakhir. Baru-baru ini terdengar kabar bahwa komponenkomponen yang diperlukan untuk membuat tablet yang menurut informasi akan memiliki ukuran layar 7,85 inci ini sedang dipersiapkan. Situs teknologi Ubergizmo melaporkan bahwa beberapa pemasok komponen sudah memasuki persiapan tahap awal produksi. LG dan AU Electronics telah menerima sertifikasi untuk membuat layar yang akan digunakan pada “iPad Mini”. Kabar lain menyebutkan bahwa TPK Holding akan membuat 4 juta modul “backlight” untuk perangkat ini. Dua juta modul “backlight” lainnya akan dibuat oleh Chemi Innolux, sementara layar sentuh dengan teknologi thin-film akan dibuat oleh Nissha Printing. Layar “thin-film” konon memungkinkan “iPad Mini” dbuat dengan bentuk lebih tipis dari saudara-saudaranya sesama tablet Apple. Satu sumber bahkan mengatakan bahwa pabrik rekanan Apple di China, Foxconn dan Pegatron, sudah mulai memproduksi “iPad Mini”. Berdasarkan rumor-rumor yang beredar sebelumnya, “iPad Mini” adalah versi lebih kecil dari perangkat iPad yang sudah diproduksi Apple sebanyak tiga generasi. Rancang betuknya dikabarkan tidak akan mengalami perubahan. Spesifikasi final dari perangkat ini masih simpang siur. Beberapa sumber menyebutkan bahwa “iPad Mini” akan dilengkapi dengan layar Retina Display, seperti pada iPhone 4/4S dan iPad generasi ketiga. Spesifikasi lain termasuk memori internal sebesar 8 GB. Berita bagusnya, “iPad Mini’ disebutkan bakal dibanderol dengan harga sekitar 200 - 250 dollar AS atau Rp1,8 juta - Rp2,3 juta rupiah sehingga bisa bersaing dengan perangkat-perangkat sejenis yang memiliki harga lebih murah dari iPad 9,7 inci. Tanggal peluncuran masih belum pasti, tetapi disebutkan pada kuartal ketiga tahun ini. (int/mer)

Kindle eBook Reader

RAKSASA retail online Amazon dikabarkan sedang bersiapsiap merilis perangkat pembaca elektronik (eReader) baru. Perangkat ini dikatakan akan hadir lebih ringan dan lebih cerah saat digunakan membaca. Diwartakan, Sabtu (19/5), spekulasi yang banyak beredar mengatakan perangkat baru tersebut akan mendukung tampilan berwarna. Tapi tampaknya perangkat baru ini masih akan tampil monokrom (satu warna) dengan tambahan pencahayaan depan. Fitur tambahan ini kemungkinan akan disambut oleh konsumen. Pasalnya, banyak pengguna telah lama mengeluh karena harus memasang cahaya eksternal saat ingin membaca dalam gelap. Kindle eReader ini akan diperbarui dengan touchscreen yang menggunakan layar e-ink dan akan didukung koneksi 3G atau WiFi. Menurut sumber yang tak ingin diungkap namanya, harga perangkat ini cenderung tetap sama atau meningkat dengan margin kecil. Menurut IT Pro Portal, ini bisa dikatakan langkah mundur bagi Amazon dan sebuah pergerakan ke arah eReader monokrom yang lebih tradisional. Terutama setelah langkah terakhirnya ke pasar tablet Android dengan perilisan Kindle Fire. (int/mer)

Mitsubishi i-MiEV Evolution

untuk Hill Climb

DIVISI motorsport Mitsubishi kini punya mainan baru yang disiapkan bertarung di Pike’s Peak International Hill Climb, Colorado, Amerika Serikat, Juli mendatang, yaitu mobil listrik yang diberi nama i-MiEV Evolution. Sebelumnya Nissan melakukan hal yang sama pada mobil listriknya, Leaf pada tahun lalu. Evolution menggunakan motor listrik dan baterai yang sama untuk i-MiEV yang diproduksi secara massal. Hanya tenaga mesin yang dihasilkan berbeda. Jika i-MiEV standar menggunakan motor listrik tunggal 66 PS, Evolution dilengkapi tiga motor (1 di depan, 2 di belakang) - masing-masing 107 PS - dengan total tenaga 321 PS. Sedangkan kapasitas baterai dua kali lipat standar, dari16 menjadi 35 kWh. Sistem gerak juga berubah. Bila sebelumnya hanya 2 roda belakang, kini semua roda (all-wheel drive). Sistem yang digunakan dicontek dari Lancer yang terbukti kehandalannya. Dengan demikian,

diharapkan bisa membantu Hiroshi Masuoka (juara Rally Dakar 2002-2003) sebagai joki untuk menaklukan medan reli tersebut. Sedangkan ban, dipilihkan profil 245/40 R18 (i-MiEV : 145/65 R15). Desain juga berubah untuk memperoleh aerodinamika dan sosoknya yang lebih besar/. Mobil listrik untuk reli ini menggunakan rangka dan sasis pipa bulat dengan panjang 4.341 mm, lebar 1.900 mm dan lebar 1.339 mm. Untuk mewujudkan niatnya ini, Mitsubishi menggandeng 20 vendor untuk membangun proyek ini. Beberapa di antaranya yang sudah terkenal adalah GS Yuasa, HKS, Enkei dan Dunlop. (int/mer)

„ Ilustrasi

Sony dan Panasonic Gandengan Bikin TV OEL SONY dan Panasonic bekerja sama untuk memroduksi TV generasi mutakhir mereka. Langkah ini dilakukan demi mengambil alih pasar TV yang kini dikuasai rival dari Korea Selatan. Kedua perusahaan raksasa tersebut bermaksud mempercepat pengembangan TV dengan layar organic electroluminescence (OEL) berukuran besar. TV jenis ini diklaim akan mengkonsumsi daya lebih rendah ketimbang TV layar datar konvensional. OEL sendiri banyak diharapkan menjadi teknologi dominan pada TV generasi mutakhir. Demikian diwartakan, Senin (21/5). Baik Sony maupun Panasonic ingin mengkomersilkan TV OEL pada tahun fiskal 2015. Menurut Nikkei Daily, kerjasama yang dilakukan keduanya bisa saja berujung pada produksi bersama. Namun, kedua perusahaan tersebut tidak berkomentar pada laporan Nikkei. Panasonic hanya mengeluarkan pernyataan, “Perusahaan kami akan melanjutkan riset mengenai teknologi OEL berdasarkan apa yang telah dikembangkan. Belum ada keputusan terkait menerapkan riset ini pada bisnis.” Selain Sony dan Panasonic, perusahaan asal Korea Selatan Samsung Electronics dan LG Electronics juga berencana merilis TV OEL berukuran 55 inci pada tahun ini. (int/mer)

„ Mitsubishi i-MiEV Evolution

6 14


22 Mei 2012

Awal Mei lalu kabar tak mengenakkan menerpa hubungan Krisdayanti dan Raul Lemos. Pasangan ini dikabarkan telah pisah ranjang, namun kala itu adik Yuni Shara ini sudah membantahnya. Ditemui saat menghadiri resepsi pernikahan Anang dan Ashanty di Shangri-La Hotel, Jakarta Pusat, Minggu (20/5) semalam, Raul malah menegaskan jika berita pisah ranjang hanya gosip semata. “Aku mau klarifikasi sama mediamedia infotainment yang suka bohong, yang katanya saya sudah pisah ranjang sama istri saya, saya mau klarifikasi ya, saya punya kerjaan di Dili, istri saya warga negara Indonesia, saya warga negara Timor Leste, jadi jelas kami punya dua

HOROSKOP HARI INI TAURUS (21 April - 20 Mei) Hati akan menemukan kedamaian saat kita mampu memaafkan. Jadilah pribadi yang anggun di atas ketulusan. Jangan habiskan waktu Anda untuk memikirkan apa yang telah hilang di masa lalu. Hidup ini melangkah ke depan, bukan ke belakang.


(20 Januari - 18 Februari)

Tulislah segala keinginan dan harapanmu dan berikanlah kepada Tuhan. Jadikan Tuhan sebagai satu-satunya tempat berharap. Sifat orang yang berilmu tinggi adalah merendahkan diri kepada manusia dan takut kepada Tuhan.


(23 September - 22 Oktober)

Manusia paling baik adalah orang dermawan yang bersyukur dalam kelapangan yang mendahulukan orang lain dan bersabar dalam kesulitan. Lihatlah, dalam kehidupan ini banyak orang yang tahu apa yang seharusnya dikerjakan. Tetapi, sedikit sekali yang mengerjakan apa yang dia tahu.


(23 Oktober - 22 November)

Hidup adalah suatu perjalanan. Perjalanan itu akan berarti jika hidup kita mempunyai makna untuk sesama. Kegagalan adalah sesuatu yang bisa kita hindari dengan tidak mengatakan apa-apa, tidak melakukan apa-apa dan tidak menjadi apa-apa. Namun, apakah kita hanya akan berdiam diri sementara waktu hidup semakin singkat.


(23 Agustus-22 September)

Bila ilmu dan manfaat telah kita miliki, selanjutnya usaha kita untuk selalu mencari alamat (arah, tujuan, kesempatan).


(21 Desember -19 Januari)

ikap orang lain terhadap kita merupakan gema dari sikap yang keluar dari dalam diri kita. Pancarkan yang baik dan kebaikan itu akan engkau terima. Tidak ada salahnya selalu membawa diri tetap ikhlas dan selalu memperbaiki dengan kebaikan dan kejujuran.


( 23 November - 20 Desember)

Dengan mensyukuri nikmat yang telah diterima, kita telah mendapatkan surga dunia. Hidup menjadi terasa ringan, sedikit beban sampai akhir hayat kita.


19 Februari - 20 Maret

Doa memberikan kekuatan pada orang yang lemah, membuat orang tidak percaya menjadi percaya, dan memberikan keberanian pada orang yang semula dirundung takut. Apapun yang harus dijalani akan jauh lebih baik dan dapat dipercaya jika dimulai dari kejujuran dan keikhlasan.


(21 Mei - 20 Juni)

Keberhasilan adalah kemampuan untuk melewati dan mengatasi dari satu kegagalan ke kegagalan berikutnya tanpa kehilangan semangat. Tak ada rahasia untuk menggapai sukses. Sukses itu dapat terjadi karena persiapan, kerja keras mau belajar dari kegagalan.


(21 Juni- 20 Juli)

Mengambil langkah terbaik tidaklah mudah. Namun kalau hanya menunggu, justru akan membuat langkah tersebut semakin kacau. Bersyukurlah pada apa yang Anda miliki, maka Anda akan mendapatkan lebih banyak. Jika Anda memfokuskan pada apa yang tidak Anda miliki, maka Anda tidak akan pernah merasa cukup.


(21 Juli-21 Agustus)

Dua hal yang membangkitkan ketakjuban Anda adalah langit yang bertebaran bintang. Anda akan menemukan hikmah di dalamnya. Sebab, langit yang bercahaya bagaikan hidup yang penuh dengan ilmu dan kebijaksanaan.


19 Februari - 20 Maret

Air mata adalah satu-satunya cara bagaimana mata berbicara ketika bibir tak mampu menjelaskan apa yang telah membuat perasaanmu terluka. Ambil pelajaran dari masa lalu. Jangan biarkan belenggu kesedihan menutupi jalanmu menuju masa depan.

BUSANA kebaya yang dikenakan Ashanty saat acara resepsi pernikahan memang spesial. Selain menonjolkan teknik pengerjaan tangan, busananya bertabur ribuan kristal swarovski. “Saya berusaha menerjemahkan keinginan Mas Anang dan Ashanty dalam bentuk busana yang glamor dan elegan. Busana tersebut memadukan unsur tradisional dan modern,” tutur Ferry Sunarto, desain busana kedua pengantin itu, Senin (21/5). Kesan glamor yang terpancar

tempat tinggal, di Dili dan di Indonesia,” jelas Raul. Tak cuma menegaskan kalau hubungannya dengan Krisdayanti baik-baik saja, Raul malah membagi kabar kalau sang istri sudah berbadan dua lagi. “Kalau pisah ranjang memang sering terjadi yang artinya kalau istri saya lagi datang ke Jakarta ya kita pisah ranjang, tapi kalau kita lagi ketemu, ranjangnya dua meter yang kepakai cuma satu meter. Alhamdulillah, anak kami Amora, sebentar lagi akan punya adik.” Sementara Krisdayanti sendiri hanya menimpali, “Betapa bahagianya, sekarang usia kehamilannya sudah dua bulan.” (kpl/int)

Olla Ramlan

Ogah Warisi Bisnis Ayahnya Olla Ramlan ternyata lahir dari keluarga pengusaha kaya raya. Meski demikian, presenter Dahsyat tersebut enggan menjadi pewaris bisnis papanya dan lebih menikmati hidup sebagai ibu rumah tangga. ”Ah nggak, papa itu punya banyak anak. Terus terang saya sebenarnya menikmati menjadi ibu rumah tangga, aku pengennya ikut suami dan anak,” kata Olla di Studio RCTI Kebun Jeruk, Senin (21/5). Kalaupun saat ini Olla bekerja sebagai entertainer, tapi hal tersebut dilakukan karena masih berstatus janda. Olla juga tidak ingin kembali memberatkan orang tua. ”Saya bekerja seperti ini karena saya belum ada suami. Saya harus kerja sendiri walaupun ayah saya tetap akan menerima. Tapi saya tetap nggak enak memberatkan orang tua lagi,” jelasnya. Untuk bisa lebih mandiri, Olla bekerja matimatian. Bangun pagi menjadi presenter terus kemudian syuting sinetron. “Alhamdulillah bisa diberikan berkah terus,” ungkap Olla. Untuk melanjutkan bisnis ayahnya, Olla menyatakan lebih cocok dikerjakan oleh anak laki-laki. “Kalau pekerjaan bisa nyambung ke Aufar (kekasih Olla Ramlan) ya Alhamdulillah, jadi saya bisa menikmati dan membantu aja,” jelasnya. Olla menjelaskan, orang tuanya sudah lama berbisnis batu bara di Kalimantan. Selain itu, sang ayah juga sedang membangun arena bermain keluarga. ”Bapak saya lagi membangun arena permainan kayak Dufan, belum sempurna. Bapak saya pekerjaannya banyak jadi nggak bisa fokus. Insya Allah mungkin Aufar bisa bantu. Mereka kan sudah meeting, berdoa aja, saya nggak mau ikut campur,” kata Olla. (jpnn)

Ahmad Dhani-Mulan Jameela

Tampil Mesra Ahmad Dhani dan Mulan Jameela semakin menunjukkan hubungan istimewa mereka. Keduanya turun dari mobil yang sama milik Dhani, Alphard hitam B 1 RCR bersama dua anak Dhani, El dan Dul saat menghadiri pesta resepsi pernikahan Anang dan Ashanty di Shangri-La Hotel, Jalan Jend Sudiman Kav 1, Jakarta Pusat, Minggu (20/5) malam. Tak cuma itu, Dhani juga menggandeng mesra wanita yang diisukan menjadi istri sirinya itu. Saat kepergok media, Mulan terlihat menghindar dan agak menjaga jarak dengan pentolan band Dewa 19 itu. Dhani datang dengan pakaian serba hitam, sementara Mulan tampil seksi mengenakan sackdress pendek berwarna senada dengan

motif ukiran berwarna emas. Dhani dan Mulan menyumbangkan suara emas mereka dalam resepsi pernikahan Anang dan Ashanty. Tak canggung, mereka sempat berfoto bersama pengantin di atas pelaminan dan lantas mencuri perhatian. Setelah memberikan ucapan selamat kepada Anang dan Ashanty, Dhani langsung dihujani pertanyaan apakah ia nantinya akan menggelar resepsi senada dengan Anang. Seperti ciri khas Dhani, ia hanya menjawab sekenanya. “Kita lagi cari venue-nya,” kata Dhani senyum-senyum. Setelah hampir 3,5 jam

terlibat dalam acara resepsi sahabat

karibnya, Dhani langsung meluncur ke mobilnya. Ahmad Dhani, Mulan Jameela, El, dan Dul berada dalam satu mobil layaknya sebuah keluarga. Mulan pun menghindar saat kehadirannya di mobil Dhani diketahui media. (nov/int)

dari busana Anang-Ashanty terpancar dari pemilihan material bahan yang eksklusif dan penempatan detail yang pas, seperti kristal swarovski. “Kristal swarovski yang dipakai banyak, lebih dari 1.000. Selain itu, saya juga mengaplikasikan bordir, sulaman, dan lain-lain,” jelas desainer asal Kota Bandung ini. Untuk mewujudkan busana istimewa tersebut, desainer yang bergabung dengan Asosiasi Perancang Pengusaha Mode Indonesia (APPMI) ini membutuhkan waktu enam bulan. “Kami beberapa kali harus bertemu dan merumuskan konsep busana resepsi. Hasilnya, busana mereka terlihat glamor dan elegan,” tutupnya. (oz/int)

Tya Ariestya:

Nggak Dapet B a t a k , Palembang Juga Oke Harapan semua orang tua terhadap anaknya adalah mendapatkan pasangan hidup yang terbaik. Bagi orang tua dari artis Tya Ariestya, keinginan mereka adalah agar anaknya mendapatkan jodoh dari kalangan orang Batak juga. Namun hal itu sepertinya tak bisa terwujud, karena Tya disinyalir mengikuti jejak sang bunda yang menikah dengan pria yang bukan dari kalangan Batak. “Yah mama aku harapannya nikah jangan jauh-jauh, sama Batak juga. Cuman aku dapatnya bukan cowok Batak, tapi masih Sumatera juga, Palembang. Padahal orang Sumatera terkenal hatinya keras, padahal lembut,” ujarnya di sela-sela acara rapat besar persiapan pesta Bolon Simbolon 2012 di anjungan Sumatra Utara, TMII, Jakarat Timur. Presenter yang juga atlet taekwondo ini belum bisa memutuskan apakah akan memakai adat Batak atau Palembang di pernikahannya kelak. “Entar lihat dulu, dirapatin sama keluarga dulu. Kalau anak muda

SELASA, 22 MEI 2012

Aturan para Istri Tahun 50-an Ini Ternyata Masih Relevan Flash back ke era setelah perang dunia ke-2, yaitu tahun 1950an atau dalam istilah fashion sering disebut retro, terbayang para wanita yang terikat oleh banyak peraturan. Urusan seks dan cinta? Jangan ditanya.. Di zaman itu banyak hal masih ditabukan dan seorang wanita yang memberontak akan dianggap liar dan tidak sopan.

untuk suami Saat pacaran, tampil cantik di depan pasangan adalah wajib; namun setelah menikah, banyak wanita yang justru berdandan asal-asalan karena merasa ‘sudah ada yang punya’. Wanita di era 50an sangat menjaga penampilan sekalipun di depan suami sendiri. Mereka menjahit celemek yang cantik dan menghiasi baju tidur mereka dengan renda agar tampil cantik walaupun di rumah saja. Makan bersama di meja makan

Sekarang ini, wanita sudah jauh lebih bebas dan komunikasi lebih terbuka. Sikap tidak terus terang yang banyak menimbulkan masalah dalam hubungan di era nenek kita, telah jauh terkikis dengan pembicaraan dan sikap yang lebih frontal dan berani. Namun ada beberapa aturan para istri di tahun 1950an yang sepertinya tidak penting tapi ternyata bisa menyelamatkan kehidupan cinta Anda di saat ini. Berikut ini beberapa aturan yang bisa Anda coba dalam hubungan dengan pasangan. Beretika Etika sangat dijunjung tinggi di zaman itu, seorang wanita harus punya etika yang baik. Anda boleh punya bad habits , perilaku yang sedikit nakal dan liar, namun pada saat dibutuhkan dan pada pasangan, Anda harus tetap menjunjung tinggi etika dan sopan santun. Berdandan

Makan berdua di satu meja sepertinya hanya milik mereka yang sedang berkencan. Banyak pasangan yang karena kesibukan atau karena kebiasaan, lebih suka makan sendiri-sendiri, makan sambil nonton televisi atau makan sambil bekerja. Dengan makan berdua di meja makan, Anda punya waktu intim berdua untuk saling menatap dan bertukar cerita. Sesuatu yang ‘mahal’ untuk kehidupan rumah tangga zaman sekarang. Mendukung karir suami Di tahun 50an, wanita bekerja masih jarang. Kebanyakan dari mereka di rumah saja, atau mengerjakan pekerjaan sampingan yang tidak seberapa,

sambil memastikan rumah dan kebutuhan suami terawat dengan baik. Pria butuh lingkungan rumah yang hangat, nyaman dan kondusif agar mereka bisa berkarya dengan produktif, di sinilah tugas istri. Menyerahkannya pada pembantu bukanlah hal yang baik, jika Anda bisa melakukannya sendiri, suami akan lebih menyayangi dan menghormati Anda. Pakai lagi gaun tidur Siapa yang suka tidur dengan baju seadanya atau malah kaos belel dan celana pendek yang sudah longgar? Di tahun 1950an, para wanita menjaga penampilan mereka sekalipun saat tidur. Setiap wanita memiliki baju tidur berupa dress tipis longgar yang halus dan nyaman, walaupun sederhana. Ini bisa Anda terapkan juga saat ini. Menjaga penampilan adalah salah satu usaha menghargai suami Anda, sekalipun saat pergi tidur. (kl/int)

Minyak Goreng Hilangkan Getah Nangka Nangka, salah satu buah tropis yang mudah kita jumpai di Indonesia, apalagi jika musimnya datang. Dengan warna kuning menggoda dan aroma nangka yang khas, Anda pasti ingin menikmati kelezatannya. Makan nangka memang nikmat, manis, harum dan memiliki kandungan gizi yang menyehatkan. Tetapi getahnya... sering membuat jengkel. Getah nangka yang tertinggal di tangan,

pisau untuk mengupas, bahkan wadah untuk meletakkan buah nangka seringkali sulit dihilangkan. Sekalipun sudah dicuci dengan sabun, tetapi getah itu tetap bandel dan melekat kuat pada peralatan makan dan juga tangan Anda. Untuk menghilangkannya, ada cara mudah yang bisa Anda gunakan. 1. Ambil minyak goreng yang belum terpakai pada piring kecil secukupnya. 2. Oleskan minyak goreng tersebut

Pancake Strawberry KAYU MANIS Bahan: 100 gram tepung terigu 1 sdt baking powder 1 sdt gula halus 1 butir telur 1 sdt vanili bubuk 100 ml susu 1/2 sdm mentega tanpa garam 400 gram strawberry, cuci potong 1/2 sdt kayu manis bubuk Cara Membuat: 1. Campur tepung terigu, baking powder dan gula dalam mangkuk hingga rata. 2. Buat lubang di bagian tengah adonan, lalu tambahkan telur dan vanila bubuk, aduk hingga rata.

3. Tuang susu cair sedikit demi sedikit sambil diaduk, pastikan tidak ada gumpalan dan adonan cukup kental hingga bisa dicetak. Jika susu belum habis tetapi kekentalan adonan sudah cukup, tidak perlu menambah susu cair. 4. Masak adonan pancake di wajan bulat datar, tunggu hingga kedua bagian matang. 5. Lakukan hal yang sama hingga adonan habis. 6. Susun strawberry di atas pancake sesuai selera, taburi dengan gula pasir dan bubuk kayu manis sesuai selera Anda. 7. Sajikan selagi hangat. (kl/int)

pada tangan, pisau, atau wadah yang mengandung getah nangka. Gosok perlahan saja pada bagian yang terkena getah. Getah dengan sendirinya akan luntur bersama minyak. 3. Setelah seluruh getah hilang, cuci dengan sabun pencuci piring seperti biasa. 4. Jika getah masih terasa, ulangi lagi

proses menggosok dengan minyak goreng. Mudah bukan? Selamat mencoba! (kl/ int)

Info Penting soal Miss V SEMAKIN banyak kita mengetahui dan mengenal setiap jengkal tubuh kita, semakin kita bisa menghargai dan bersyukur karenanya. Selain itu, kita juga bisa tahu bagaimana memberikan perawatan yang terbaik, terutama untuk Miss V. Mari kita simak info penting berikut. Pentingnya klitoris Klitoris adalah bagian yang berbentuk segitiga pada Miss V dan memegang peranan yang sangat penting saat seorang wanita mengalami orgasme. Bagian ini juga sangat sensitif pada sentuhan pada saat foreplay , dan sentuhan kecil akan memaksimalkan orgasme. Cintailah sayuran Saat ibu kita meminta kita memperbanyak menu sayuran, bukan tanpa alasan lho. Terutama sayuran yang membantu Miss V menjaga keharumannya, seperti kemangi, daun peppermint, seledri, dan lain sebagainya. Tak harus selalu menggunakan sabun khusus Miss V untuk menjaganya agar tetap wangi. Miss V bergigi, hanyalah mitos Pernah mendengar mitos bahwa ada Miss V yang memiliki gigi? Ok, percayalah bahwa itu hanya sebatas mitos. Tak ada gigi yang tumbuh pada Miss V manapun, yang ada hanyalah kekuatan otot yang dapat mencengkeram Mr P dengan cukup kuat, lubang Miss V terasa sangat kecil dan sempit, sehingga Mr P seakan mengalami kesulitan sekaligus rasa nyaman setelah masuk jauh ke dalam. Hal ini bisa didapat dengan latihan kegel dan terapi dengan air daun sirih. Ejakulasi dapat dipelajari Tentu saja ini bukan mitos, karena Anda bisa meminta pasangan mencari G-spot dan menstimulasinya dengan berbagai gerakan, sampai akhirnya Anda dapat mencapai ejakulasi. Warna rambut Miss V tak selalu sama dengan rambut di kepala Ada beberapa orang yang berpikir bahwa semua rambut di seluruh bagian tubuhnya berwarna sama. Ternyata tidak. Mereka yang memiliki rambut kepala pirang, tak selalu memiliki rambut Miss V yang pirang juga. Rata-rata bulu atau rambut yang tumbuh di bagian tubuh berwarna hitam atau cokelat. Sunat tak hanya untuk pria Ada beberapa budaya yang melakukan penyunatan terhadap bayi perempuan yang baru lahir. Namun, dewasa ini hal tersebut tidak dilakukan dan bahkan ditentang keras karena tidak ditemukan manfaat positif pada penyunatan tersebut. Otot-otot Miss V dapat dilatih Tak hanya otot tubuh bagian atas atau kaki saja yang dilatih, tetapi otot Miss V juga bisa dilatih melalui latihan senam kegel. Manfaatnya adalah menjaga agar tetap kencang dan memberikan kenikmatan yang lebih saat melakukan hubungan intim dengan pasangan. Ukuran klitoris Ukuran rata-rata klitoris pada umumnya, lebar 0,13 inci dan panjang 0.21 inci. Ada beberapa wanita yang terlahir dengan klitoris berukuran lebih kecil, namun ada pula yang terlahir dengan ukuran yang lebih besar. Semuanya normal, hanya berbeda dalam ukuran saja. (kl/int)

Awetkah Kosmetik Disimpan di Kulkas? PERNAHKAH Anda mendengar bahwa produk kosmetik yang disimpan di kulkas akan jauh lebih awet? Tak hanya mendengar, tetapi beberapa cream kecantikan dari dokter memang disarankan untuk disimpan di kulkas. Katanya sih memang akan jauh lebih awet, benar nggak sih? Sebagian dari berita itu memang benar, tetapi ada beberapa hal yang perlu dicermati. Produkkosmetikamemangakancenderungjauh lebih awet apabila disimpan di suhu yang rendah. Hal ini disebabkan, reaksi kimia akan terjadi lebih cepat di suhu yang tinggi. Khususnya makeup dan pelembab, yang mudah sekali teroksidasi bila terkontaminasi udara. Tak heran bila beberapa kosmetik kemudian mudah mengeluarkan minyak dan ada yang baunya kurang sedap. Menyimpannya di kulkas akan memperlambat proses tersebut. Tetapi, tidak menambah masa kadaluarsa sebuah produk kosmetik. Apabila lipstik bisa bertahan sekitar 2-4 tahun, sekalipun disimpan di kulkas, usia

pakainya tak bisa melebihi masa tersebut. Lebih baik, tidak memakai lipstik yang telah disimpan lebih dari 5 tahun agar tidak timbul reaksi yang tak diinginkan pada bibir. “ Pernahkah Anda mendengar bahwa produk kosmetik yang disimpan di kulkas akan jauh lebih awet?” Kelebihannya, aroma wewangian yang terdapat pada produk kosmetika akan cenderung lebih awet. Parfum, misalnya, wewangiannya akan jauh lebih awet bila disimpan di dalam kulkas. Seperti yang telah dijelaskan di atas, reaksi kimia yang terjadi karena kontaminasi udara akan diperlambat, sehingga aroma wewangiannya akan cenderung lebih awet. Nah, yang perlu dicermati saat menyimpan produk kosmetik ini, adalah:

1. Pastikan Anda membersihkan terlebih dahulu produk yang telah dipakai dari keringat 2. Letakkan di dalam sebuah box yang khusus untuk menyimpan kosmetika sehingga tidak terkontaminasi makanan dan tidak mengontaminasimakanan.Khususnyaparfum yang aromanya mudah diserap oleh makanan 3. Pastikan tutupnya selalu rapat setelah Anda memakainya agar tidak tumpah di dalam kulkas 4. Letakkan di bagian paling bawah saja, jangan di dekat freezer agar produk kosmetika tidak membeku karena produk akan rusak apabila membeku 5. Hal terakhir, jauhkan dari jangkauan anakanak :) (kl/int)




Maestro Siantar Permalukan PS Mayang 4-0

„ Tim Maestro Siantar yang siap meraih juara pada Sugiarto Cup 2012


„ Kegembiraan anak-anak Montpellier usai memastikan diri menjadi juara Liga1 Perancis1

MONTPELLIER meraih gelar juara Liga Prancis (Ligue 1) pertama kali dalam sejarah, setelah menang 2-1 atas Paris Saint-Germain di Auxerre pada pertandingan final yang berlangsung rusuh, Minggu. Situasi tak terkendali membut wasit menghentikan laga dua kali karena protes penonton. Tim urutan kedua Paris Saint-Germain mengeluarkan segenap kekuatan mereka memenangi pertandingan 21 di Lorient. Penundaan pertandingan di Auxerre membuat tim asuhan Rene Girard harus tahan nafas karena kesuksesan mereka musim ini masih belum pasti. Akhirnya Montpellier menyelesaikan musim ini dengan keunggulan tiga poin di atas PSG pada klansemen akhir, sehingga klub dari kawasan selatan itu —urutan ke-

14 pada kompetisi Ligue 1 musim lalu— meraih gelar besar pertama sejak Piala Prancis pada 1990. “Saya kira kami pantas mendapatkan gelar itu,” kata pelatih Montpellier Girard dalam wawancara di tepi lapangan setelah wasit meniup pluit panjang pada akhir permainan. “Ini benar-benar pertarungan keras dari awal hingga akhir. Jika melihat raihan poin, tiga klub teratas (Montpellier, PSG dan Lille) melakoni musim luar biasa,”

gemar melontarkan seloroh serta kutipan unik kepada media. Selain itu, Montpellier memiliki anggaran terkecil ke-13 dari seluruh peserta klub Ligue 1. Sementara, sejak digelar tahun 1893, kompetisi ini telah dimenangkan puluhan klub. Peraih terbanyak diduduki AS Saint-Étienne dan Olympique de Marseille dengan 10 gelar juara, Nantes 8, AS Monaco 7, Olympique Lyonnais 7, Stade de Reims 6, Girondins de Bordeaux 6, Standard Athletic Club 5, Roubaix 5, OGC Nice 4, Helvétique Marseille 3, Lille OSC 3, Le Havre 2, RCF Paris 2, FC Sochaux-Montbéliard 2, Sète 2, Paris Saint-Germain 2, Olympique Lillois 2, Club Français, Gallia Club Paris, Tourcoing, Saint-Raphaël, CA Paris, Stade Français, Rouen, Roubaix-Tourcoing, RC Strasbourg, AJ Auxerre, dan RC Lens masing-masing 1 gelar juara. (int)

„ Kegembiraan anak-anak Montpellier usai memastikan diri menjadi juara Liga1 Perancis

Spurs ke Final Wilayah Barat

„ Simon Santoso

Piala Thomas

Tujuh Pemain Disiapkan Lawan Inggris Simon Santoso akan menjadi tunggal pertama untuk menghadapi Inggris pada laga pertama Piala Thomas di Wuhan Sport Center Gymnasium, Senin (21/5/ 2012) malam ini. Indonesia harus menang untuk memastikan lolos ke perempat final. Di bagian ganda, Markis Kido/ Hendra Setiawan akan menjadi ganda pertama karena Muhammad Ahsan akan dimainkan ber-

katanya. Pertandingan cukup menegangkan, terlebih ketika Auxerre memecah jalan buntu lewat gol menit ke-20 di Stade Abbe Deschamps, ketika Olivier Kapo menggetarkan jalan gawang Montpellier dari arah pojok pertahanan lawan. Gol itu membuat Montpellier tidak akan berhasil meraih gelar musim ini. Tapi mereka berhasil menyamakan kedudukan pada menit ke-32 ketika John Utaka berhasil memanfaatkan umpan panjang dari rusuk kanan yang dilayangkan Suleymane Camara. Pendukung Auxerre melancarkan protes atas terdegradasinya tim mereka dengan melemparkan bola te-

nis dan benda lainnya ke lapangan pada awal babaka kedua, sehingga para pemain hasus kembali ke ruang ganti pakaian mereka. Ketika pertandingan dimulai lagi, Montpellier terlambat 19 menit dari laga LorientPSG dan dengan kemenangan PSG, berarti tim puncak Montpellier semakin grogi meneruskan permainan mereka. Lahir Juara Baru Riwayat Ligue 1 Prancis sebagai kompetisi yang banyak melahirkan juara baru kembali terjadi musim ini seiring kesuksesan Montpellier. Bisa dibilang Montpellier merupakan kejutan terbesar Ligue 1 musim ini, atau bahkan di Eropa. Tim asuhan Rene Girard terancam degradasi musim lalu dan menempati peringkat ke-14 klasemen akhir. Montpellier juga memiliki pemilik sekaligus presiden Louis Nicollin yang

sama Alvent Yulianto, bukan dengan Bona Septano. (int) SUSUNAN PEMAIN Tunggal: 1. Simon Santoso 2. Taufik Hidayat 3. Dionysius Hayom Rumbaka Ganda: 1. Markis Kido/Hendra Setiawan 2. Alvent Yulianto/Muhammad Ahsan

Keperkasaan San Antonio Spurs tidak terbendung. Spurs kembali membantai musuhnya dengan skor 4-0. Kali ini, Los Angeles Clippers yang menjadi korban. Spurs pun lolos ke partai final play-off NBA Wilayah Barat. Tim Duncan dan Tony Parker menjadi bintang Spurs dalam pertandingan di Staples Center, Senin (21/5) siang WIB. Duncan mengemas 21 angka, sedangkan Parker menambah lewat 17 poin. Spurs terus merajalela. Kemenangan ini, membuat Duncan dkk meraih total 18 kemenangan beruntun. Sementara untuk di babak play-off NBA musim ini, Spurs sudah mencatat rekor sempurna 8-0. Dari kubu Clippers, point guard Chris Paul mengemas angka tertitinggi dengan torehan 23 poin dan 11 assist, lalu ada Blake Griffin dengan 21 points, dan Eric Bledsoe menambah 17 poin di pertandingan ini. Clippers sempat memimpin lima menit sebelum pertandingan usai. Bledsoe menyumbang 11 poin beruntun untuk

TANAH JAWA- Penampilan brilian kapten kesebelasan Budi Siagian membawa tim Maestro Siantar mengalahkan PS Mayang Hutabayuraja dengan skor 4-0, Senin (21/5) di Stadion Balimbingan dalam lanjutan turnamen Sugiarto SE Cup. Meski sudah termakan usia, Budi Siagian masih mampu mencetak 3 gol di babak pertama. Gol keempat Maestro juga diciptakan Budi Siagian. Begitu babak pertama mulai, Budi Siagian yang mengemban ban kapten langsung menebar bencana ke daerah pertahanan PS Mayang. Dede, stopper Mayang jatuh bangun menahan gempuran lawan. Trio amunisi Maestro yang ditempati Tony, Acun dan Sapril tampil beringas memporakporandakan pertahanan lawan. Pemain tim Mayang yang sudah kalah mental pun dengan mudah dapat dilumpuhkan. Lapangan tengah praktis dikuasai pemain Maestro. Gol pertama Maestro tercipta di menit ke-3 oleh Budi Siagian lewat aksi individu yang mengundang decak kagum penonton. Budi mampu melewati lima pemain bawah lawan dan sekaligus menaklukkan kiper Mayang. Gol spektakuler ini disambut hangat ratusan penonton yang membanjiri lapangan. Kembali Budi Siagian mende-

monstrasikan keahliannya dengan mencetak dua gol tambahan. Budi yang mampu melucuti pemain bawah lawan langsung melarikan bola ke kotak pinalti Mayang. Melihat kiper Mayang yang salah posisi, Budi melesakkan bola ke sudit kiri gawang lawan. Hingga babak pertama usai dengan kemenangan Maestro 3-0. Di babak kedua, Mayang mulai menebar ancaman melalui penyerangnya Alim dan Rudy. Namun tetap tak mampu menaklukkan Wanda, kiper Maestro. Malah Budi Siagian yang berhasil lepas dari tekanan lawan dan berhasil melepaskan tendangan ke gawang Dony, kiper Mayang dan mengubah kedudukan menjadi 4-0 yang merupakan gol penutup. Seusai pertandingan, Anggota DPRD Simalungun Sugiarto SE mengatakan, hingga memasuki hari ke-7, pertandingan berjalan lancar. Emosi pemain dapat terkontrol dan penonton juga cukup kondusif. “Diharapkan situasi seperti ini terus berlanjut demi kesinambungan turnamen,” sebut Sugairto SE. Sementara, komisi pertandingan Lindung Pasaribu menerangkan, jadwal pertandingan berikutnya, antara lain Rabu (23/ 5) PS SMK Teladan vs PS Margasono, Gasta Tanah Jawa vs Marihat Utama. (iwa/ara)

„ Para pemain Pescara merayakan promosi ke Serie A

Pascara dan TorinoPromosi Zdenek Zeman sukses mengantarkan tim besutannya, Pescara promosi ke kompetisi Serie A untuk musim depan setelah menundukkan tuan rumah Sampdoria 3-1, Senin (21/5) dini hari WIB. Pescara menyusul Torino yang beberapa jam sebelumnya juga memastikan meninggalkan Serie B untuk bermain di Serie A. Sepanjang musim Pescara tampil konsisten sehingga hadiah promosi dinilai layak untuk mereka. Gianluca Caprari membuka gol kemenangan Pescara pada menit ke-18 usai menyelesaikan umpan Marco Verratti lewat serangan balik. Ciro Immobile mencetak gol kedua bagi Pescara pada menit ke-29. Caprari kembali memperbesar keunggulan Pescara setelah merobek gawang La Samp pada menit ke-61. Sampdoria baru bisa memperkecil kedudukan menjadi 3-1 tujuh menit sebelum laga usai melalui Juan Antonio. Pescara termasuk klub yang berkembang secara pesat dalam dua tahun terakhir. Pescara sempat bangkrut pada 2009 dan harus memulai lagi dari Lega Pro, tetapi terakhir kali mereka mencicipi kompetisi Seri A musim 1992-93. West Ham Promosi Sementara, di English Premier League, West Ham meraih tiket terakhir untuk promosi ke kasta tertinggi di Inggris, setelah mengalahkan Blackpool di partai

final play-off. West Ham menang 2-1. Setelah Reading dan Southampton memastikan promosi ke Liga Primer berkat finis satu dan dua secara berurutan di papan klasemen divisi Championship, satu tiket promosi yang tersisa pun diperebutkan oleh empat tim lain. West Ham, Birmingham City, Blackpool, dan Cardiff City menjadi empat tim yang berebut tiket sisa tersebut di fase play-off; di semifinal West Ham menghadapi Cardiff dan Birmingham bertemu Blackpool. Di partai semifinal itu West Ham menang telak 5-0 atas Cardiff sedangkan Blackpool menang 3-2 atas Birmingham. Di final, West Ham pun dihadapkan dengan Blackpool. Dalam pertandingan final playoff yang dihelat di Stadion Wembley, Sabtu (19/5/2012) waktu setempat, West Ham berhasil menang 2-1 berkat gol Carlton Cole (352 ) dan Ricardo Vaz Te (872 ), sedangkan Blackpool hanya bisa membalas lewat Thomas Ince (482 ). Dengan hasil tersebut maka West Ham akan kembali berkompetisi di Liga Primer musim depan, kasta teratas sepakbola di Inggris. Ini membuat The Hammers hanya menghabiskan satu musim di divisi Championship, setelah terdegradasi dari Liga Primer musim 2010-2011 usai jadi juru kunci klasemen. (int)

Sharapova Juara Italia Terbuka „ Para pemain San Antonio Spurs berhasil meloloskan timnya ke babak final wilayah barat membawa Clippers memimpin 90-85. Tapi, Spurs perlahan bangkit mengejar ketinggalan. Tembakan Duncan membawa Spurs memimpin dengan skor 96-94. Kemudian tidak lama kemudian, giliran Parker yang mencetak angka untuk memperlebar keunggulan menjadi 100-97, saat pertandingan tersisa 1 menit 47 detik lagi. Paul sempat membuat Clippers tertinggal hanya satu angka saja 100-99. Tapi, Danny Green dan Parker memastikan keme-

nangan Spurs lewat tembakan bebas. Kini, Duncan dkk menanti pemenang antara Oklahoma City Thunder melawan Los Angeles Lakers. Saat ini, Thunder memimpin 3-1. Di pertandingan lainnya, Miami Heat mampu menyamakan skor menjadi 2-2. LeBron James dkk mengalahkan Indiana Pacers 101-93. LeBron James menjadi penampil terbaik Heat dengan menorehkan 40 poin, 18 rebound dan sembilan assist. (oz/int)

MariaSharapovaberhasilmempertahankan gelar juara turnamen Italia Terbuka. Ia harus melewati pertarungan tiga set saat melawan Li Na di babak final. Dalam partai puncak yang dimainkan di kompleks olahraga Foro Italico, Minggu (20/5) malam WIB, Sharapova sempat berada dalam tekanan setelah kalah 4-6 di set pertama. Memasuki set kedua, petenis cantik asal Rusia ini bahkan tertinggal hingga 0-4. Tapi Sharapova mampu bangkit dan merebut set kedua dengan skor 6-4. Sharapova sempat unggul 4-1 di set ketiga sebelum berbalik tertinggal 4-5. Saat skor sama kuat 6-

6, hujan deras mengguyur arena dan memaksa pertandingan untuk dihentikan sementara waktu. Setelah 2,5 jam hujan, laga kemudian dilanjutkan ke tiebreak. Sharapova akhirnya memenangi set terakhir dengan skor 7-6. KemenanganinimembuatSharapova meraih gelar juara Italia Terbuka untuk kali kedua berturut-turut.Tahunlaluiajugamenjadi pemenang di turnamen yang sama. Gelar juara ini menjadi gelar kedua yang diraih Sharapova di tahun 2012 ini. Sebelumny, Sharapova sudah menjadi kampiun di Porsche Tennis Grand Prix bulan April lalu. (int)


22 Mei 2012


Setelah puasa gelar sejak 1990 dan terpuruk hingga ke Serie C karena bangkrut yang menerpa, akhirnya Napoli seperti terlahir kembali dengan kesuksesan meraih juara Copa Italy 2012. Bekas klub Diego Armando Maradona ini keluar sebagai juara setelah melumat Juventus dengan skor 2-0 di stadion Olimpico, Roma, Minggu (20/5). â&#x20AC;&#x153;Gelar juara ini bukan trofi pertama saya, tetapi ini adalah yang pertama sejak Napoli terlahir kembali,â&#x20AC;? ujar Presiden Napoli, Aurelio De Laurentiis, setelah timnya mengalahkan Juventus 2-0. Aurellio De Laurentiis telah membeli klub tersebut dan memulai lagi semuanya dari Serie C ketika Napoli dalam keadaan bangkrut. Partenopei tidak memenangkan trofi apapun sejak Piala Super Italia pada tahun 1990, sedangkan Coppa Italia terakhir yang diraih adalah pada 1987. â&#x20AC;&#x153;Klub ini terlahir kembali pada 2004 dan dalam beberapa tahun kemudian kami berhasil meraih kesuksesan di mana hal ini memberitahu dunia bahwa Napoli masih ada dan akan menjadi juara di dunia olahraga,â&#x20AC;? katanya. Sukses Napoli ini berkat dua gol dari Edinson Cavani serta Marek Hamsik di babak kedua. Bermain menekan sejak babak pertama, Napoli kerap menyulitkan Juventus. Setelah itu Juventus berulang kali mengancam gawang Napoli namun mereka tak bisa membobol gawang I Partenopei lantaran kecemerlangan De Sanctis. Begitu pula dengan Napoli yang juga gagal memaksimalkan sejumlah peluang, hingga pada akhirnya babak pertama ditutup dengan skor 0-0. Usa jeda, Napoli kembali mengambil inisiatif serangan dan berkalikali mengancam gawang Juventus kawalan Marco Storari. Namun, lantaran penyelesaian akhir yang buruk, peluang pasukan Walter Mazzarri itu gagal dikonversi menjadi gol. Memasuki menit 63, wasit memberikan hadiah penalti kepada Napoli setelah Storari menjatuhkan Lavezzi di kotak terlarang. Cavani yang maju sebagai eksekutor dengan dingin menaklukkan Storari sekaligus memberikan keunggulan bagi Napoli. Tertinggal satu gol, Juventus terus menggempur pertahanan Napoli demi mencetak gol penyeimbang. Asik menyerang, Juventus malah kecolongan. Melalui sebuah serangan balik, Goran Pandev yang mencuri bola dari pemain Juventus, sukses memberikan umpan kepada Marek Hamsik dan berhasil dikonversi menjadi

gol oleh gelandang asal Slovakia itu. Derita Juve makin bertambah setelah mereka harus bermain dengan 10 pemain setelah Fabio Quagliarella dikartu merah oleh wasit lantaran menyikut wajah Aronica. AS Roma-Juventus Terbanyak Peraih gelar juara Cpoa italy hingga saat ini masih didominasi tim ibukota Roma dan juventus. Keduanya telah meraih 9 gelar juara, disusul Inter Milan 7 kali, Fiorentina 6 kali, Torino 5 kali, AC Milan 5 kali, Lazio 5 kali, Sampdoria 4 kali, Napoli 4 kali, Parma 3 kali, Bologna 2 kali, Atalanta, Genoa, Venezia, Vado, dan Vicenza masing-masing 1 kali. Perpisahan Del Piero Akhir kurang memuaskan ini merupakan laga perpisahan Alessandro Del Piero, yang telah tampil bersama Juventus pada September 1993 silam. Hampir 19 tahun berseragam hitam putih, penyerang berusia 37 tahun tersebut telah tampil sebanyak 705 pertandingan internasional, memenangkan 19 piala termasuk Piala Dunia bersama tim nasional Italia tahun 2006. Selama membela Juventus, Del Piero mencetak 289 gol dan gol pertamanya dicetak dalam pertandingan kedua sebelum mengantongi hattrick pertama saat turun menjadi tim utama pada tahun 1993 silam. Dia juga langganan tim nasional Italia sejak tahun 1995, dengan 91 kali penampilan dan mencetak 27 gol. Kesetiaanya bersama Juventus juga teruji saat tetap bermain ketika Juventus dihukum turun kasta ke Serie B karena terlibat dalam skandal pengaturan skor yang menyebabkan kehilangan gelar Serie A tahun 2005 dan 2006. Setelah Juventus menyatakan tidak akan memperpanjang kontraknya, beragam spekulasi kini mengitari penyerang kelahiran Conegliano tersebut. Sejumlah klub Inggris seperti Arsenal, Tottenham dan Queens Park Rangers disebut-sebut tertarik dengan penyerang veteran tersebut termasuk klub AS LA Galaxy yang dilaporkan juga mengincarnya. (int)