Page 1

Sabtu, 28 April 2012

Edisi 18 „ Tahun X

SIMALUNGUN HATARAN Ditunda Hingga 2014 SIANTAR- Plt Gubernur Sumut, Gatot Pujo Nugroho menjelaskan, kendala pemekaran Kabupaten Simalungun sejak tahun 2007, karena komunikasi yang kurang dari panitia pemekaran dengan Kemendagri dan Komisi II DPR RI. Pemekaran Simalungun juga akan tertunda hingga tahun 2014 karena munculnya kebijakan Mendagri Gamawan Fauzi terkait pemilu legislatif 2014.

Karir dan Affair Berlabuh di Bui

Gatot Pujo Nugroho ditemui di halaman Masjid Raya Kota Siantar, Jumat (27/4) menyebutkan, Pemprovsu sudah pernah menyampaikan dan melengkapi berkas pemekaran Kabupaten Simalungun kepada pemerintah pusat pada 2007 lalu. Gubernur Sumut saat itu dijabat Rudolf Pardede. “Artinya, secara prosedur „) Baca Simalungun .Hal 7

JAKARTA-Kehidupan Angelina Sondakh sarat cerita. Sejak suaminya Adjie Massaid meninggal, awan gelap kehidupannya terus bergerak. Saat heboh dikaitkan dengan kasus korupsi wisma atlet, kisah cintanya mencuat ke publik. Putri Indonesia 2001 dikabarkan melakukan affair dengan polisi penyidik KPK.

FOTO: LAZUARDY FAHMI

„ Plt Gubernur Sumut Gatot Pujo Nugroho bersilaturahmi dengan pengurus Masjid Raya Siantar, Jumat (27/4).

Baca ..Hal 2

Bapak Batal Jemput Putri

Pembunuh Siti Belum Terungkap

Ibu-ibu Tetangga Korban DATANGI MAPOLRESTA SIANTAR– Sedikitnya 30 ibu-bu warga Jalan Aman, Kelurahan Siopat Suhu, Kecamatan Siantar Timur, datang ke Mapolresta Siantar, Jumat (27/ 4) pukul 15.30 WIB. Mereka mempertanyakan perkembangan kasus pembunuhan salah seorang ibu rumah tangga di sana, Siti Nurcahaya alias Ester br Siagian (38), yang tewas pada Rabu (18/4) lalu.

Setiba di Polres Siantar, warga langsung menuju ruang Reskrim, setelah sebelumnya menjelaskan maksud kedatangan mereka kepada petugas penjagaan. Selain warga, orangtua Siti Nurcahya turut hadir dan beramai-ramai menanyakan perkembangan kasus tersebut.

Tewas di Mobil Saat Berhenti di Lampu Merah FOTO: PRA EVASI HALOHO

„ Pohon beringin tempat anak-anak bertapa sebelum menerima ilmu kuda kepang, Jumat (27/4).

„) Baca Ibu-ibu ...Hal 7

PULUHAN ANAK KERASUKAN KUDA KEPANG

SIANTAR- Saimi Widodo (49) warga Jalan Singosari, Kelurahan Martoba, Siantar Utara, ditemukan tewas dalam mobilnya Suzuki Carry warna biru BK 1183 LI saat lampu

merah di Jalan Merdeka Tugu Wahana Graha sekira pukul 18.30 WIB, Jumat (27/4). Saimi berniat menjemput putrinya Yuli Mayasari (20) yang bekerja di Pengadilan

Bertapa di Pohon Beringin SIANTAR– Sejumlah anak yang kesurupan kuda kepang sudah disembuhkan. Mereka mengaku sebelum menerima ilmu dan sebelum membaca mantra, mereka terlebih dulu bertapa di pohon beringin dekat lapangan komplek Rindam. Sedikitnya 6 orang anak yang masih SD dan SMP saat ditemui METRO mengatakan, kemungkinan masih ada teman mereka yang lain memiliki ilmu kuda kepang. Mereka menyebutkan, ilmu yang mereka terima dulunya sudah

FOTO: PRA EVASI HALOHO

ngi Polresta Pematangsiantar „ Ibu-ibu warga Jalan Aman mendataSiti dituntaskan, Jumat (27/4). n untuk meminta kasus pembunuha

FOTO: LAZUARDY FAHMI

„) Baca Bertapa ...Hal 2

„ Juhri, anak korban histeris di instalasi jenazah RSU Dr Djasamen Saragih menyaksikan jasad ayahnya, Jumat (27/4).

Kunjungi Musem Simalungun Anda punya keluhan terhadap pelayanan publik di Siantar-Simalungun? kirim SMS ke nomor:

082164546471 Usut Tenaga Honor Fiktif di RS Djasamen Yang terhormat Bapak Walikota Siantar, tolong diusut data fiktif tenaga honor yang dari TKS RS Umum Djasamen Saragih Kota Siantar. Yang sebenarnya ada 44 orang, namun data nama yang dikirim ke BKD sebanyak 57 orang, jadi ada 13 data nama fiktif yang dikirim. Pengirim: 081361187xxx:

Istri Panglima Jenderal Malaysia Kagum SIANTAR– Istri Panglima Jendral dari Malaysia lakukan kunjungan ke Musem Simalungun di Jalan Sudirman, Kota Pematangsiantar, Jumat (26/ 4) sekitar pukul 10.00 WIB. Kunjungan Rashidah Abdul Rahuim istri dari Panglima Jenderal Datok Azizan yang didampingi empat orang perempuan selaku ajudannya, dikawal anggota TNI dari Kodim 02/07 Bukit

FOTO: LAZUARDY FAHMI

„ Rasida Abdul Rahim, istri Panglima Ketentaraan Diraja Malaysia saat mengunjungi Museum Simalungun, Jumat (27/4).

Barisan datang dengan menggunakan mobil TNI. Sementara Panglima Jendral Datok Azizan sudah terlebih dahulu pergi ke Parapat. Rashidah ketika melihat bendabenda bersejarah yang berusia ratusan tahun tampak kagum saat melihat beberapa penginggalan rakyat Simalungun. Bagian peninggalan yang sangat menarik perhatiannya adalah alat musik „) Baca Istri ...Hal 7

Agama Jalan Asahan. Penyebab kematian Saimi diduga serangan jantung. Informasi dihimpun, saat itu „) Baca Tewas ...Hal 2


SABTU

28 April 2012

Tewas di Mobil Saat Berhenti di Lampu Merah

Karir & Affair Berlabuh di Bui Sambungan Halaman 1 Akhir 2011 lalu, kisah asmara perempuan yang akrab disapa Angie ini dengan Kompol Raden Brotoseno terendus. Cinta bersemi di antara keduanya karena kerap berkomunikasi. Waktu itu, Angie adalah saksi dalam kasus proyek Wisma Atlet dengan terdakwa Nazaruddin. Kisah keduanya menjadi topik panas di internal KPK dan publik. Kepada pimpinan KPK, Brotoseno yang merupakan penyidik berpangkat perwira menengah ini mengakui hubungannya dengan Angie. Namun Angie sempat menutupnutupi hubungannya dengan Brotoseno. Namun Angie kini mulai terbuka soal hubungannya Broto. Terbukti Angie berani membawa Broto dalam acara kunjungannya ke Wonosobo, Jawa Tengah, Selasa (28/12) lalu. Waktu itu, Angie datang mengunjungi korban bencana banjir bandang dan longsor Wonosobo di pengungsian balai desa Tieng. Namun, Kompol Brotoseno enggan turun dan bertahan di dalam mobil usai melihat wartawan di halaman pengungsian yang merupakan balai desa setempat. Foto mesranya dengan Brotoseno sempat beredar. Namun Angie tak ambil pusing dengan foto-foto itu. “Itu kan foto yang tidak melanggar etika,” kata Angie seperti dituturkan sahabatnya, Kahfi Siregar, saat dikonfirmasi. Setelah menjadi buah bibir, Broto ditarik ke Mabes Polri dari KPK. Untuk diketahui, Brotoseno pernah ikut menangkap Mindo Rosalina Manulang, Manajer Marketing PT Duta Graha Indah, Mohammad El Idris, dan mantan Sekretaris Kemenpora, Wafid Muharram, pada 21 April 2011 di kantor Kemenpora. Angie juga diisukan mempunyai affair dengan pria berinisial ‘N’. Bahkan hubungan itu disebut-sebut sudah ada jauh sebelum dia berhubungan dengan Brotoseno dan masih menjadi istri Adjie Massaid. Namun soal ini pihak Angie membantahnya. Ketika menggelar konferensi pers di kediamannya di Taman Cilandak II, Jakarta Selatan pada Maret lalu, Angie banyak menanggapi pertanyaan dengan “meminta doa” atau “dukungan”. “Saya bersabar aja dengan fitnah-fitnah terhadap saya,” ujarnya. Angie mengaku kadang merasa kesepian dan sedih menghadapi semua persoalan itu seorang diri. Hal itu membuatnya terkenang kembali pada sosok almarhum suaminya. “Kadang saya sedih, saya harap ada Mas Adjie sama saya,” ujarnya. Kini Angie harus mendekam di balik tahanan KPK terkait kasus wisma atlet di Kemenpora dan proyek universitas di Kemdikbud. Dia sendiri menunggu kasusnya bergulir di pengadilan. Tanpa Keanu sang putra, dan tanpa Brotoseno sang kekasih di sampingnya. Angelina Sondakh menjadi tersangka pertama yang menghuni Rutan Komisi Pemberantasan Korupsi (KPK) Cabang Jakarta Timur. Seusai menjalani pemeriksaan kali pertama Jumat (27/4), anggota

Sambungan Halaman 1 mobil korban mengikuti jalur lampu merah atau traffic light. Setelah rambu hijau, mobil tersebut tidak berjalan. Beberapa pengendara yang di belakang korban menglakson dengan kuat, namun tak juga membuat mobil itu bergerak. Disebabkan itu, beberapa pengendara langsung turun menghampiri bagian depan mobil dan melihat supir, setelah dilihat ternyata korban saat itu sudah tergeletak dengan posisi tubuh jatuh ke sebelah kiri. Setelah diperiksa, korban sudah tidak bernyawa. Akibat peristiwa itu, kemacetan sempat terjadi di Jalan Merdeka. Disebabkan tak seorangpun warga yang berani mengemudikan mobil tersebut. Mobil pun beramai-ramai didorong ke pinggir jalan. Hujan gerimis saat itu tak menghalangi warga yang ingin melihat serta mengenali korban. Setiap pengendara berhenti melihat korban, namun tak satupun yang mengenali. Salah satu pengendara yang ada di lokasi menelpon pihak polisi yang segera tiba di lokasi. Selanjutnya salah seorang polisi menelpon anak korban bernama Fajar sesuai yang tertera di telepon seluler. Kemudian korban dibawa ke RSUD Djasamen Saragih untuk diotopsi. Fajar Prabowo (16) anak ketiga korban ditemui di Instalasi Jenazah sekira pukul 19.00 WIB menyebutkan, Desember 2011 lalu, korban sempat satu minggu diopname di RS Tiara karena mengalami penyakit jantung. Kemudian Maret 2012, korban juga diketahui memiliki penyakit lever. Namun Fajar meminta agar bapaknya tidak usah diotopsi karena menurut mereka, kematian korban murni serangan jantung. Jemput Putri Menurut Fajar, Jumat sore sekira pukul 16.00 WIB, korban sempat marah-marah karena ibunya, Kamauli (40) lama pulang dari perwiridan. ”Biasanya jam 16.00 WIB sudah pulang, ini kok belum pulang–pulang, apa wiridnya di luar negeri,” kata Fajar menirukan ucapan korban saat itu. Tidak lama kemudian, Yuli Mayasari, anak kedua korban yang bekerja di Kantor Pengadilan Agama Simalungun, minta dijemput. Mendapat telepon dari Yuli, korban yang saat itu masih marah, langsung pergi menjemput. Fajar mengatakan, ayahnya merupakan pedagang mi basah keliling dan ibunya pedagang pakaian keliling. Ayahnya berjualan mi pagi dan sorenya membantu ibunya berjualan pakaian. Keluarga Histeris Kamauli, istri korban saat tiba di Instalasi Jenazah RSU Djasamen Saragih langsung menangis histeris. Dia tidak menyangka suaminya ini pergi meninggalkan dia secepat itu. Kamauli datang bersama anaknya yang belakangan diketahui bernama Juhri. “Ayah kenapa tidak pesan. Ayah kenapa tidak meninggalkan pesan,“ ujar Kamauli terisak sembari meneteska air mata. Juhri putra bungsu korban langsung memeluk tubuh ayahnya dengan perasaan yang sangat sedih. Tangisan yang sangat kuat terdengar sampai keluar ruangan Instalasi Jenazah. “Ayah bangun, ayah bangun,” tangis Juhri berulang kali dengan raut wajah yang sangat sedih. Tidak lama kemudian, Yuli Mayasari, putri kedua korban, tiba dengan mobil dinas Kantor Agama. Dia langsung menghampiri tubuh ayahnya yang saat itu sudah berada di dalam mobil jenazah untuk dibawa ke rumah duka. ”Ayah kan mau jemput aku, ayah kan mau jemput aku,” ucap Yuli terlihat lemas dan hampir pingsan. (mag-4/ral)

Komisi X DPR itu langsung dijebloskan ke ruang tahanan berukuran 3x4 meter yang terletak di basement gedung KPK. Menurut Nasrullah, kuasa hukum Angie yang sempat mengantar hingga masuk sel, kliennya sempat menitikan air mata begitu masuk ke ruangan sempit itu. Kata Nasrullah, yang membuat Angie sangat sedih adalah dia harus berpisah dengan Keanu Jabbar Massaid, anaknya yang baru berumur dua tahun. “Kalau untuk masalah kasusnya, dia sudah pasrah. Yang membuat dia paling sedih adalah berpisah dengan anak-anaknya. Bayangkan dia sekarang menghidupi tiga anak yatim,” kata Nasrullah. Angie yang mengenakan pakaian putih dipadu celana hitam dengan rambut terurai datang ke markas komisi antikorupsi jalan Rasuna Said Jakarta sekitar pukul 09.20. Seperti biasa, janda Adjie Massaid itu didampingi Mudji Massaid, adik iparnya. Sang ayah Lucky Sondakh juga terlihat datang memberikan dukungan untuk Angie. Dia hanya melempar senyum kepada wartawan yang sudah menunggunya. Tanpa mengeluarkan sepatah kata pun Angie melenggang ke pintu masuk gedung KPK dengan pengawalan Mudji. “Ini memang kali pertama AS (Angelina Sondakh) kami panggil untuk dimintai keterangan sebagai tersangka,” kata juru bicara KPK Johan Budi kemarin. Angie memang tidak hanya ditetapkan sebagai tersangka dalam kasus suap wisma atlet. Tapi perempuan yang masih aktif di komisi X DPR itu belakangan juga ditetapkan sebagai tersangka dalam dugaan korupsi di Kemendikbud. Ternyata KPK tak kenal kompromi. Seusai menjalani pemeriksaan selama enam jam lebih, Angie langsung ditahan. Komisi antikorupsi ini pun memutuskan Angie ditahan di rutannya. Ketua KPK Abraham Samad saat dihubungi wartawan sore kemarin mengatakan dirinya memang menandatangani surat penahanan. “Yang bersangkutan kami tahan di rutan KPK agar tidak melakukan konsolidasi dengan pihak lain di luar,” kata Abraham kemarin. Namun meski ditahan di rutan yang letaknya satu gedung dengan ruang pemeriksaan, KPK memiliki protab tersendiri. Yakni Angie dibawa keluar melalui pintu utama lalu digiring masuk ke rutan melalui pintu samping KPK yang berjarak sekitar 200 meter. Jadi wartawan memiliki kesempatan untuk mewawancara atau merekam gambar Angie. Sekitar pukul 17.00, mobil tahanan KPK disiapkan diluar pintu utama. Rencananya, Angie dikeluarkan lalu diangkut dengan mobil tahanan untuk dibawa ke pintu samping. Itu rencana tersebut urung dilakukan. KPK memutuskan untuk menggiring Angie dengan berjalan kaki. Puluhan polisi dan satuan pengamanan KPK disiapkan. “Tak berselang lama Angie keluar dan langsung digiring menuju rutan KPK. Johan mengatakan penahanan ini akan dilakukan hingga 20 hari kedepan hingga masa penyidikan selesai. Sebab, sejak

sehat, tidur jadi nyenyak, berat badan pun sudah naik." Terang wanita berusia 52 tahun tersebut. Ia menceritakan, sudah 6 bulan ini minum Milkuma. Setelah merasakan manfaat susu kambing ini, ibu 3 orang anak ini pun mengajak orang lain untuk merasakan manfaatnya, "Mari kita sehat bersama Milkuma." Ajak warga Desa Pematang Raya, Kec. Raya, Kab. Simalungun, Sumatera Utara tersebut. Sebenarnya, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu kambing. Berbeda dengan susu sapi, sesungguhnya susu kambing memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Selain mengandung Riboflavin, vitamin B yang penting untuk produksi energi, susu kambing pun jarang menyebabkan alergi sehingga aman, dan bermanfaat untuk penderita asma. Satu gelas susu kambing memasok 20,0% dari nilai harian Riboflavin. Selain itu, mengkonsumsi Milkuma sebanyak 2 gelas sehari bermanfaat untuk menjaga daya tahan tubuh dan meningkatkan vitalitas. Fluorine yang terdapat

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Pandapotan MT Siallagan Alvin Nasution Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

dalam susu kambing bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan tidak menimbulkan dampak diare pada orang yang mengkonsumsinya. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Ditambah dengan kandungan Gula Aren bermutu tinggi sebagai pemanisnya, menjadikan Milkuma sebagai pilihan bijak untuk kesehatan. Untuk memperoleh hasil yang maksimal, terapkan pola hidup sehat seperti disiplin dalam pola makan, dan berolahraga, serta mengkonsumsi air putih paling sedikit 8 gelas/ hari. Dapatkan informasi lengkap tentang Milkuma di www.milkuma.com. Saat ini, Milkuma sudah tersedia di apotek2 juga toko obat terdekat dikota anda, atau hubungi, Sumut : 085314072195 / 06191128785. Kota Pematang Siantar : 085360106966, Apt Sehat, Apt. Dear farma, Tebing tinggi : Apt. Tangan mas, Apt. Bulian, Apt. Saudara Baru. Depkes dengan no PIRT. 6.09.3328.01.395.

digunakan sebagai pelicin. Salah satunya adalah untuk pelicin pembangunan proyek di Universitas Sumatera Utara (USU) dan Universitas Haluoleo di Sulawesi Tenggara. Saat digiring ke rutan, Angie mengaku pasrah dengan penahanan yang dilakukan kepadanya. “Saya lillahi ta ala aja,” kata Angie sambil terus tersenyum kepada wartawan. Saat dirubung wartawan, Angie hanya singkat menjawab, untuk urusan proses hukum semua sudah diserahkankan kepada pihak kuasa hukum. Nasrullah mengaku tidak kaget kliennya ditahan. Bahkan dia mengaku sejak siang kemarin telah mengirim surat permohonan penangguhan penahanan dengan alas an tertentu. Tapi semua dimentahkan KPK. Menurutnya, KPK terlalu tergesa-gesa menahan kliennya. Pasalnya, selama ini kliennya selalu koperatif dan sedang menghidupi tiga anak yang masih kecil. Menurutnya, KPK belum perlu menahan kliennya. Tak hanya itu, dia juga membongkar bahwa sebenarnya surat perintah dimulainya penyidikan (sprindik) untuk Angie ternyata baru dibuat pada 18 April lalu. Dengan begitu, kata Nasrullah, saat penetapan Angie sebagai tersangka pada awal Februari tidak berdasarkan sprindik. Padahal seharusnya, penyidikan harus didasari pada sprindik. “Bisa jadi ada tekanan tertentu yang membuat KPK tergesa-gesa menetapkan Angie sebagai tersangka. Tapi saya tidak tahu apakah itu tekanan politis atau tidak, yang jelas ada keuntungan politis yang didapat kalangan tertentu dengan ditetapkan Angie sebagai tersangka,” imbuhnya. “ Sementara itu, Lucky Sondakh, ayah kandung Angelina Sondakh, mengatakan kedatagannya ke KPK adalah bentuk support dan kasih sayang terhadap anaknya. Katanya, sebagai seorang ayah dirinya memiliki kewajiban untuk mendampingi anaknya yang tengah terjerat kasus korupsi. “Saya sedih (Angie ditahan) tapi harus tabah,” katanya sesaat setelah Angie ditahan. Untuk itu dia meminta agar Angie lebih mendekatkan diri kepada Tuhan dan memperbanyak ibadah dan doa. Meskiu begitu Lucky mengaku tidak tahu banyak soal kasus yang menjerat anaknya. Dia beralasan bukan seorang ahli hukum. Tapi dia mengaku kerap berdiskusi bersama Angie untuk membicarakan kasusnya. Sementara itu, kalangan di Partai Demokrat berharap agar Angie tetap kooperatif menjalani proses hukum seperti yang telah dilakukan, selama ini. “Sebagai partai, tentu kami akan mendorong kader untuk mematuhi proses hukum dengan baik. Saya yakin Angie tidak akan mempersulit proses pemeriksaan, sebab dia warga negara yang patuh dan menghormati hukum.” kata Ketua Departemen Pemberantasan Korupsi dan Mafia Hukum DPP Partai Demokrat Didi Irawadi Syamsuddin. (kuh/dyn/agm)

Bertapa di Pohon Beringin

NAFAS SESAK KARENA ASMA, HILANG BERKAT MINUM SUSU KAMBING Ketika asma menyerang, saluran nafas mengalami penyempitan k a r e n a hiperaktifitas terhadap rangsangan tertentu, yang menyebabkan peradangan. Pada penderita asma, penyempitan saluran pernafasan merupakan respon terhadap rangsangan yang pada paru-paru normal tidak akan mempengaruhi saluran pernafasan. Penyempitan ini dapat dipicu oleh berbagai rangsangan, seperti serbuk sari, debu, bulu binatang, asap, udara dingin dan olahraga. Sekian lama berobat, akhirnya Karsini, seorang guru tertarik mencoba Milkuma, minuman serbuk susu kambing yang diproses secara alami, tanpa pemanis buatan dan bahan pengawet. Bahan dasarnya adalah susu kambing peranakan ettawa segar dan Gula Aren. "Sejak tahun 1990, saya menderita asma. Kalau sudah kambuh, nafas jadi payah atau sesak dan bunyi, mau ngomong jadi susah. Untunglah kini saya minum Milkuma, sekarang saya sudah

awal rutan KPK memang digunakan hanya untuk tersangka yang menjalani proses penyidikan saja. Lebih lanjut Johan menerangkan, KPK memiliki pertimbangan tersendiri menahan Angie. Tapi semua pertimbangan tersebut ada di tangan penyidik. “Kami punya alasan tersendiri di mana harus menahan seseorang. Dan seorang tersangka tidak bisa memilih harus ditahan dimana. Lha kalau tersangka minta ditahan di rumah gimana,” katanya. Berarti Angie satu tahanan bersama Mindo Rosalina Manunang (mantan Direktur Marketing PT Anak Negeri), apakah tidak akan mengganggu proses penyidikan mengingat keduanya tersangkut kasus yang sama” Johan pun menjawab bahwa penahanan Rosa di rutan KPK adalah hasil koordinasi dengan LPSK. Sebab hingga kini Rosa dibawah perlindungan LPSK. Karenanya lanjut Johan, yang bisa menjelaskan bagaimana keberadaan Rosa di rutan KPK adalah LPSK. “Dan pihaknya sendiri akan berkoordinasi dengan lembaga yang dipimpin Abdul Haris Semendawai itu. Tapi bagaimanapun juga KPK akan terus meminimalisir hal-hal yang tidak diinginkan. “Ada penjaga 24 jam di luar dan di dalam rutan. Di sana juga ada cctv untuk membantu pengawasan,” imbuhnya. Pria yang pernah mencalonkan diri sebagai pimpinan KPK membenarkan bahwa pihaknya menemukan beberapa transaksi keuangan Angie yang diduga berkaitan dengan proyek di “Kemenpora dan Kemendikbud. Namun Johan “tidak menerangkan lebih rinci bentuk aliran ke Angie itu. “Nanti akan dibuka semua di pengadilan,” tambah Johan. Memang berdasarkan persidangan dalam kasus suap wisma atlet, Angie disebut-sebut menerima sejumlah dari Permai Grup, perusahaan yang dipimpin Muhammad Nazaruddin. Uang-uang itu diberikan melalui perantara Rosa yang sebelumnya sudah diperkenalkan Nazaruddin. Dalam persidangan dengan terdakwa Nazaruddin Rabu (25/1) lalu, Rosa yang dihadirkan menjadi saksi mengaku pada 2010 perusahaannya telah menggelontorkan dana Rp 10 miliar untuk meloloskan proyek Wisma Atlet SEA Games 2012 yang tenag dibahas Badan Anggaran DPR. Pilitisi DPR yang mendapat pelicin dari Nazaruddin itu adalah Wayan Koster dan Angie. Masingmasing mendapat Rp 5 miliar. Hal itu dibenarnya Yulianis, mantan Direktur Keuangan Permai Grup. Dia mengatakan memang pernah mencatat pengeluaran perusahaan yang diminta Rosa agar diberikan kepada Angie. Uang tersebut lantas diantar Lutfi Ardiansyah, sopir Yulianis ke ruang I Wayan Koster di DPR. Nah, setelah mengantar uang itu, Lutfi berpapasan dengan Angie yang hendak masuk ke ruang Koster. Selain itu, KPK juga menemukan banyak pembicaraan antara Angie dengan Rosa dengan menggunakan istilah apel Malang dan apel Washington untuk menyebut rupiah dan dollar yang

Sambungan Halaman 1 sekitar 2 bulan. Bahkan yang menerima ilmu kuda kepang tersebut sudah memiliki grupgrup. Salah seorang anak yang sudah sembuh, anak kelas 6 SD bermarga Gultom mengatakan, sebelum disembuhkan, ia dan temantemannya sering pergi ke lapangan kosong dekat komplek Rindam berjarak sekitar 200 meter dari perkampungan Aek Nauli. Kemudian METRO pun diajak anak-anak untuk menunjukkan lapangan tempat mereka kerasukan oleh ilmu tersebut. Tiba di lokasi, siswa SMP kelas 2 marga Simanjuntak ini mengatakan, di lapangan yang akrab disebut lapangan secaba sebagai tempat mereka memanggil ilmu yang mereka miliki. Sedikitnya dalam satu minggu mereka melakukan kesurupan lima kali dan selalu datang sore hari yang dipimpin Manantin. “Kami ada sekitar 15 orang dan kalau sudah sampai, kami kosentrasi dulu dan mengucapkan mantranya. Beberapa saat kemudian, tingkah anak tersebut langsung berubah. Bagi yang memiliki roh Endang monyet, maka tingkahnya seperti monyet. Demikian juga yang punya Endang Kingkong tingkahnya seperti kinkong. Namun selama kerasukan, mereka hanya berada di lapangan tersebut. “Kami saat itu tidak sadar kalau bertingkah seperti itu. Lalu sekitar satu jam kemudian kami selesai kerasukan dan kami sadar kembali,” kata Gultom. Menurut mereka, ilmu yang mereka dapatkan itu berasal dari satu orang lalu berantai ke

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta) Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Alvin Nasution, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: Syafruddin Yusuf, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus),Aristo Linghten Panjaitan (Tobasa), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina)

yang lain. “Di sinilah kami dulu bertapa dan kami waktu itu rame. Bahkan kadang sampai malam, itu kalau malam minggu. Selama bertapa, Manantin dan temannya yang lain membuat jeruk purut serta membakar kemenyan. Berselang beberapa saat setelah acara bertapa, mereka kembali ke lapangan dan selanjutnya dituntun untuk baca mantra. Kemudian langsung kerusurpan sesuai ilmu yang didapatnya dan bertingkah sesuai ilmunya. “Katanya ada tingkat-tingkatnya Bang, tapi dulu kami itu mau karena dibilang hanya hiburan saja dan tidak ada pengaruhnya,” ucap Napitupulu. Ia menambahkan, sejumlah masyarakat yang melihat aksi mereka yang aneh tidak menaruh curiga. Masyarakat menganggap bahwa selama ini anak-anak tersebut hanya bermain-main dan tidak ada hubungannnya dengan ilmu. Menurut Napitupulu, dia sudah pernah diajak Manantin ke kampungnya di Sidamanik untuk menonton kuda kepang. Saat di kampung, Manantin membawa temantemannyayangberjumlah4orangmenyaksikan pertunjukkan kuda kepang yang selanjutnya berbicarakepadamentorkudakepangtersebut. Amatan METRO, loakasi tempat mereka kesurupan berukuran sekitar 10 x 20 meter dan sudah tidak terawat karena tidak pernah dipergunakan. Sementara di pinggirnya terdapat beberapa kayu yang berbatasan dengan sungai Bah Bolon. Tempat itu jaraknya sekitar 1 km dari Simpang SKI menuju Rindam. Mereka sering menyebutnya lapangan secaba. Selama memiliki ilmu kuda kepang selama

METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Eva Wahyuni, Hermanto Sipayung, Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

2 bulan, Gultom mengaku badannya terasa berat. Akan tetapi, ilmu kuda kepang itu bisa datang apabila memang diminta untuk datang melalui dengan fokus dan membacakan mantra. Namun sejak dilepaskannya, dengan serentak mereka mengaku puas dan lega karena ilmunya sudah dilepaskan. Teman satu lagi, bermarga Simanjuntak Johan selaku paranormal warga Tojai baru selaku orang yang telah mengeluarkan ilmu kuda kepang, Kamis (26/4) di komplek SMA GKPI Jalan DI Panjaitan mengatakan, mereka selanjutnya diajak ke Tojai Baru setelah diobati. Di sana mereka dimandikan bunga mancan kera dan selanjutnya pakaian yang mereka dilepaskan oleh Johan dan dihanyutkan ke sungai Bah Bolon dengan mantra. Mereka mengatakan, Manantin yang kos di Aek Nauli adalah orang pertama yang memiliki ilmu tersebut yang diperolehnya dari kampungnya Sidamanik. Kemudian ia memberikan kepada rekannya. Rekannya tersebut kemudian memberikan kepada temannya yang lain, sehingga seperti berantai. Kemungkinan masih ada anak yang memiliki kuda kepang belum disembuhkan dan ilmu tersebut masih ada dalam dirinya. Seperti pada berita sebelumnya, sedikitnya dua puluh orang anak SD dan SMP warga Kelururahan Aek Nauli Siantar dikumpulkan dan diobati oleh Johan. Awalnya ketahuannya saat di antara anak-anak tersebut kerasukan dan menari seperti gaya kuda kepang yang diperhatikan masyarakat. (pra)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : metrosiantar@yahoo.com. Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733

DALAM PELIPUTAN, WARTAWAN METRO SIANTAR SELALU DIBEKALI IDENTITAS DIRI DAN TIDAK DIBENARKAN MEMINTA SERTA MENERIMA APAPUN DARI NARASUMBER BILA ADA YANG MERASA DIRUGIKAN OLEH WARTAWAN METRO SIANTAR, DIMINTA UNTUK MELAPOR KE PIHAK BERWAJIB ATAU HUBUNGI 0622-7553998


SABTU

28 April 2012

APA KATA MEREKA

Kirim Opini Anda ke email: metrosiantar @yahoo.com. Maksimal tulisan 5.000 karakter.

Kalau mentalnya pimpinan negara masih mental calo maka persoalan TKI takkan pernah usai. Yang penting fee nya aja, tapi waktu rakyatnya susah di luar negeri tidak diusut, perlindungannya tidak serius.

Sikap Kami Tragedi TKI tiada Bertepi DERITA yang menimpa tenaga kerja Indonesia (TKI) di luar negeri benar-benar tiada bertepi. Rantai kekerasan begitu kuat membelenggu mereka. Derita demi derita pun terus terulang. Tragedi teranyar menimpa tiga TKI asal Dusun Pancor Kopong, Pringgasela Selatan, Lombok Timur, Nusa Tenggara Barat (NTB), yaitu Herman, 34, Abdul Kadir Jaelani, 25, dan Mad Nur, 28. Mereka yang merantau ke negeri jiran untuk mengais uang justru pulang tanpa nyawa. Ketiga TKI itu tewas akibat laku bengis aparat Kepolisian Diraja Malaysia yang memberondong mereka dengan tembakan di area Pelabuhan Port Dickson, Negeri Sembilan, 25 Maret dini hari. Alasannya, korban merampok sehingga perlu dihadiahi peluru tajam berkali-kali. Mayat korban bahkan diperlakukan layaknya bukan jasad manusia. Saat diautopsi di RS Port Dickson sehari setelah kejadian, sejumlah organ tubuh ketiga TKI itu hilang atau sengaja dicuri untuk diperdagangkan. Kepolisian Malaysia tentu membantah keras tudingan itu. Namun, autopsi ulang oleh ahli forensik Rumah Sakit Bhayangkara Polda NTB, kemarin, menunjukkan sebaliknya. Jenazah korban yang diangkat dari liang kubur diperiksa dan hasilnya sungguh mengagetkan. Menurut keluarga korban yang menyaksikan autopsi, jasad Herman sarat keganjilan. Kedua matanya hilang, kepala terbelah, bahkan ditemukan plastik di kepala dan beberapa alat bedah tertinggal di tubuhnya. Apa pun penyebabnya, ketiga TKI tak layak dibunuh. Dipandang dari sudut mana pun, menghilangkan organ tubuh manusia adalah kejahatan luar biasa. Tragedi itu sekaligus menguatkan fakta bahwa TKI akrab dengan penistaan. BelumhilangdariingatanketikaKikimKomalasari, TKI asal Cianjur, Jawa Barat, disiksa lalu dibunuh sang majikan dan mayatnya dibuang ke tempat sampah di Arab Saudi, dua tahun silam. Atau, saat Sumiati, TKI asal Dompu, NTB, digunting mulutnya. Harus diakui, tragedi tiada henti yang melanda TKI tak lepas dari kegagalan negara dalam mengelola para pendulang devisa itu. Menteri tenaga kerja sudahberkali-kaliberganti,tapiprosesrekrutmendan pengiriman TKI tetap saja amburadul. Itulah yang menyebabkan TKI menjadi sasaran empuk kekejaman di negeri orang. Pemerintah selalu semringah ketika menyebut para TKI sebagai pahlawan devisa karena memang uangyangmerekakirimkeTanahAirmencapaiRp100 triliun. Tetapi, proteksi terhadap mereka terus saja minimal. Jika pemerintah tetap inferior, jika pembelaan negara hanya tampak ketika terjadi insiden, derita yang menimpa TKI tak akan berkesudahan. Kasus yang menimpa Herman, Abdul Kadir, Mad Nur, dan TKI lainnya tak hanya mencabik nilai kemanusiaan, tetapi juga melukai harkat dan martabat bangsa ini. Kita mendesak pemerintah bersikap tegas demi harga diri bangsa serta harkat dan martabat warga negara. Menuntut pertanggungjawaban pemerintah Malaysia adalah keharusan. Dengan segala risiko, penghentian pengiriman TKI patut dipertimbangkan karena faktanya negara gagal melindungi mereka. Sebagai pengganti, negara harus menyediakan lapangan kerja seluas-luasnya di dalam negeri. (***)

Ketua Komisi IX DPR Ribka Tjiptaning, Jumat (27/4)

Mendidik Anak Jadi Tugas Siapa? Banyak kita jumpai anak-anak zaman sekarang dalam pergaulannya sudah menodai norma-norma sosial yang ada. Masalah tersebut menimbulkan suatu pertanyaan. Siapa yang bertanggung jawab, orang tua, guru ataukah lingkungan sosial?

Candrawansah DALAM Undang-Undang Sistem Pendidikan Nasional No. 20/2003, pendidikan adalah usaha sadar dan terencana guna mewujudkan suasana belajar dan proses pembelajaran agar peserta didik secara aktif mengembangkan potensi dirinya untuk memiliki kekuatan spiritual keagamaan pengendalian diri, kepribadian, kecerdasan, akhlak mulia, serta keterampilan yang diperlukan dirinya, masyarakat, juga negara. Peran Orangtua Orang tua mempunyai tanggung jawab dari membesarkan dan mendidik anak hingga paham norma-norma yang ada. Sebenarnya seorang anak dibentuk beberapa faktor. Pertama, keluarga yang berperan utama dalam membentuk kepribadian anak. Bahkan, dalam Aquran hampir semua ayat yang berbicara tentang pendidikan anak; di antaranya yang artinya ’’Dan rendahkanlah dirimu terhadap kedua (orang tua) dengan penuh kasih sayang dan ucapkanlah, ’’Wahai Ragaimana mereka berdua telah mendidik aku sewaktu kecil’’. (QS Al-Isra: 17:24). Orang tua hendaknya memiliki pengetahuan dan visi yang sahih (benar) dan jelas akan arah pendidikan anak. Ayat di atas memberi bekal para orang tua agar mengarahkan pendidikan anak ke sikap bersyukur kepada Allah. Selain itu, juga perbuatanperbuatan kebajikan (amal saleh) yang diridai Allah. Visi ini harus melekat kepada orang tua di tengah berbagai tarikan-tarikan materialisme dalam tujuan kehidupan. Kedua, apa yang dibacanya (ilmu) termasuk di dalamnya adalah guru (dosen) sebagai tenaga pendidik. Ketiga, lingkungan. Kalau ini baik, anak bisa baik, juga sebaliknya. Begitu pula baik dan buruk kadar pendidikan kita.

Peran Pendidik Tenaga pendidik (guru/dosen) merupakan jabatan atau profesi yang memerlukan keahlian khusus. Pekerjaan ini tidak bisa dilakukan seseorang tanpa memiliki keahlian sebagai pendidik. Untuk menjadi seorang tenaga pendidik, diperlukan syarat-syarat khusus. Apalagi, seorang tenaga pendidik yang profesional harus menguasai seluk beluk pendidikan dan mengajar dengan berbagai ilmu pengetahuan lainnya. Di mana perlu dikembangkan melalui masa pendidikan tertentu. Tenaga pendidik merupakan unsur penting dalam keseluruhan sistem pendidikan yang akan membentuk karakteristik anak. Oleh karena itu, peranan dan kedudukan tenaga pendidik dalam meningkatkan mutu dan kualitas anak didik perlu diperhitungkan dengan sungguh-sungguh. Status tenaga pendidik bukan hanya sebatas pegawaiyanghanyasemata-matamelaksanakan tugas tanpa ada rasa tanggung jawab terhadap disiplinilmuyangdiembannya.Dalampendidikan itu,tenagapendidikmempunyaitigatugaspokok yang dapat dilaksanakan yang dapat berupa, pertama,tugas profesional.Yaitutugas yangberhubungan dengan profesinya. Tugas profesional ini meliputimendidik,mengajar,danmelatih. Mendidik berarti meneruskan dan mengembangkan nilai-nilai hidup. Mengajar yakni meneruskansertamengembangkanilmupengetahuan dan teknologi. Sedangkan melatih berarti mengembangkan keterampilan. Kedua, tugas manusiawi. Yaitu tugas sebagai manusia. Dalam hal ini tenaga pendidik bertugas mewujudkan keinginan anak untuk merealisasikan seluruh potensi yang dimilikinya. Ketiga, tugas kemasyarakatan. Yaitu tenaga pendidik sebagai anggota masyarakat dan warga negara seharusnya berfungsi sebagai pencipta masa depan dan penggerak kemampuan. Bahkan, keberadaan tenaga pendidik merupakan faktor penentu yang tidak mungkin dapat digantikan komponen mana pun dalam kehidupan bangsa sejak dulu. Peran Lingkungan Lingkungan adalah sesuatu yang berada di luar batasan-batasan kemampuan dan potensi genetik seseorang. Dan, ia berperan dalam menyiapkan fasilitas-fasilitas bahkan menghambat seseorang dari pertumbuhan. Lingkungan sosial manusia adalah faktor penting dalam pembentukan ciri khas kejiwaan dan norma manusia, bahasa dan adab,

serta kearifan lokal. Syahid Mutahhari berkata, meski tidak bisa memisahkan hubungannya dengan genetik, lingkunganalam,sosial,dansejarahzamansecara keseluruhan, manusia mampu melawannya. Sehingga bisa membebaskan dirinya dari ikatan faktor-faktor ini. Dari satu sisi, manusia dengan kekuatan akal dan ilmunya melalui kekuatan ikhtiar, mampu melakukan perubahan pada faktor-faktor ini. Faktor tersebut diubah sesuai kemauan, sehingga menjadi pemilik bagi nasibnya sendiri. Oleh karena itu, benar kalau kita katakan lingkungan memiliki peran mendasar dalampembentukankepribadianmanusia.Akan tetapi, bukan faktor penentu yang pasti. Sebab, manusiamemilikiikhtiar. Para pakar mengatakan demikian. Sebab, ada orang yang lahir buta tetap tersenyum saat ibu mendekatinya. Jadi, seorang bayi memiliki rasa pada saat mendengar azan, juga memiliki jiwa yang bisa berhubungan dengan sekelilingnya. Karena itu, azan menjadi kalimat pertama yang diucapkan kepadanya. Karena saat membacakan azan, seorang muazin berhubungan dengan Allah. Inilah yang memberikan dampak bagi perkembangan anak ke depan. Kedua, sampai umur tujuh hari, kelahiran anak perlu disyukuri (akikah). Kalau begitu, jangan sampai terbetik dalam pikiran ibu/bapak merasa tidak mau atau tidak membutuhkannya. Sebab, saat itu sang anak sudah punya perasaan dan harus disambut dengan penuh syukur (akikah). Misal, ada orang yang mengharapkan anak laki-laki, namun lahir perempuan. Akhirnya,iakecewadantidakmenerimasertamenyukurinya. Semestinya perlu disyukuri, baik lakilaki maupun perempuan. Ketiga, setelah akikah, sang anak baru diberi nama yang terbaik karena dalam hadis disebutkan, ’’Di hari kemudian nanti orang-orang itu akan dipanggil dengan namanya’’. Dalam hadis lain dijelaskan, ’’Nama itu adalah doa dan nama itu bisa membawa pada sifat anak kemudian’’. Jadi, pilihlah nama yang baik untuknya. Semua elemen sangat berpengaruh terhadap perkembangan anak, baik itu orang tua, tenaga pendidik, maupun lingkungan. (*) Penulis adalah Dosen Ilmu Komunikasi FISIP UM Lampung dan Mahasiswa Pascasarjana IAIN Raden IntanBandarlampung.

Pangan adalah hak asasi setiap warga negara sehingga dengan demikian semua rakyat tanpa kecuali harus terjamin haknya untuk memperoleh pangan. Untuk itu harus ada aturan terkait pangan yang berpihak kepada rakyat.

Ketua Dewan Pertimbangan HKTI Jafar Hafsah, Jumat (27/4)

Pemerintah berbicara demi kepentingan rakyat, tapi kenyataan rakyat bagai tikus yang nyaris mati di lumbung padi. Politisi dan penguasa sekarang ini mencari harta dan kekuasaan supaya mereka sepuasnya bisa menikmati korupsi.

Aktivis Anti Korupsi Teten Masduki, Jumat (27/4)


JUMAT

27 April 2012

Internasional Terlibat Kejahatan Perang

Mantan Presiden Liberia Divonis BELANDA- Pengadilan khusus internasional di Den Haag memutuskan mantan pemimpin Liberia, Charles Taylor, bersalah telah membantu dan bersekongkol dalam kejahatan perang di Sierra Leone. Dia didakwa mendukung kelompok pemberontak dalam perang Charles Taylor saudara di Sierra Leone yang berlangsung tahun 1991 hingga 2002 dan menewaskan puluhan ribu orang. Saat membacakan keputusan, Hakim Richard Lussick, mengatakan jaksa penuntut sudah membuktikan kelompok pemberontak bertanggung jawab atas pembunuhan, pemerkosaan, dan penjagalan orang selama perang di Sierra Leone tersebut. ”Tuan Taylor, majelis pengadilan menyatakan Anda bersalah atas 11 dakwaan, termasuk teror, pembunuhan, pemerkosaan, dan memaksa anak-anak menjadi tentara,” kata Lussick kepada Charles Taylor. Ketika mendengarkan vonis mantan pemimpin Liberia tersebut tampak tidak memperlihatkan emosi. (kmc/int)

AS Akan Tarik 9 Ribu Marinir dari Jepang TOKYO- Pemerintah Amerika Serikat (AS) telah membuat kesepakatan dengan Jepang untuk memindahkan 9 ribu Marinir AS dari Okinawa, Jepang. Mereka akan ditempatkan di Guam, Hawaii dan Australia. Dengan penarikan ini berarti akan mengurangi nyaris separuh jumlah personel AS yang masih berada di Jepang, yakni tinggal 10 ribu personel. Demikian hasil kesepakatan yang diumumkan dalam pernyataan bersama AS-Jepang seperti diberitakan kantor berita AFP, Jumat (27/4). ”Saya sangat senang karena setelah bertahun-tahun lamanya, kita telah mencapai kesepakatan dan rencana aksi penting ini,” kata Menteri Pertahanan AS Leon Panetta dalam sebuah statemen. ”Saya menghargai kerja keras dan upaya yang telah dilakukan untuk mewujudkan ini. Jepang bukan cuma sekutu dekat, namun juga teman dekat,” imbuh Panetta. Sesuai kesepakatan tersebut, 9 ribu Marinir AS di Jepang akan direlokasi. Sebanyak 5 ribu Marinir di antaranya akan ditempatkan di Guam. Sementara sisanya akan dikirimkan ke Hawaii dan Australia. Namun meski tercapainya kesepakatan ini, kedua negara belum sepakat tentang tuntutan penutupan pangkalan militer Futenma di Okinawa. Pemerintah AS menolak penutupan pangkalan tersebut karena Jepang dianggap belum bisa mencarikan lokasi alternatif jika pangkalan itu ditutup. Berbagai usulan yang ditawarkan pemerintah Jepang mendapat penolakan kelompok oposisi negeri Sakura tersebut. Selama ini keberadaan pasukan AS di Okinawa telah menjadi isu kontroversial. Warga Okinawa menginginkan pangkalan itu ditutup karena dianggap membahayakan dan sebagai penyebab utama kebisingan. (kmc/int)

KPK Pastikan Banding atas Putusan Nazaruddin JAKARTA- Vonis 4 tahun 10 bulan terhadap M Nazaruddin belum membuat tim jaksa KPK puas. Lembaga antikorupsi itu memastikan banding terhadap vonis pengadilan negeri Tipikor. ”Sudah dipastikan,” tutur Jubir KPK Johan Budi ketika dikonfirmasi, Jumat (27/4). Johan belum mengetahui secara pasti alasan jaksa KPK memutuskan untuk banding. Namun menurutnya, ada penerapan pasal yang masih dinilai kurang pas oleh KPK. ”Saya belum dapat penjelasan dari jaksa KPK tapi yang jelas karena vonis hakim belum sesuai dengan tuntutan jaksa KPK, baik dari

sisi penerapan pasal maupun hukuman yg dijatuhkan,” sambungnya. M Nazaruddin, divonis 4 tahun 10 bulan penjara, jauh lebih ringan dibanding tuntutan 7 tahun penjara. Dia dinilai terbukti bersalah dalam kasus suap wisma atlet lantaran menerima suap dari Manajer Marketing PT Duta Graha Indah (DGI), Mohammad El Idris. ”Menjatuhkan pidana oleh

karenanya pada terdakwa dengan pidana 4 tahun dan 10 bulan, menjatuhkan denda Rp 200 juta jika tidak dibayar diganti kurungan 4 bulan,” ujar ketua majelis hakim, Dharmawati Ningsih, di Pengadilan Tipikor, Jalan HR Rasuna Said, Jakarta, Jumat (20/4). Nazar menghadiri sidang dengan mengenakan kemeja batik lengan panjang warna biru. Selama sidang, dia menyimak dengan serius surat putusan yang dibacakan hakim. Nazar dinilai terbukti bersalah dalam pasal 11 UU 31/1999 sebagaimana diubah UU No 20/2001 tentang Pemberantasan Tipikor. (dtc/int)

Tersangka kasus suap wisma atlet Nazaruddin memberikan keterangan di persidangan.

Tembak TNI, 9 Anggota Brimob Gorontalo Tersangka JAKARTA- Mabes Polri menyebutkan pihaknya telah menetapkan sembilan anggota Brigade Mobil (Brimob) Polda Gorontalo sebagai tersangka dugaan penembakan terhadap anggota TNI AD di Gorontalo. Mereka diduga kuat sebagai pihak yang bertanggung jawab atas serentetan tembakan yang menewaskan seorang anggota TNI itu. “Sembilan anggota brimob yang melakukan penembakan sudah kita tetapkan (sebagai) tersangka dan tadi pagi sudah dilakukan gelar perkara yang dipimpin oleh Kadiv Propam Polri yang dihadiri juga oleh kepala Staf Kostrad,” ujar Karopenmas Div Humas Polri Brigjen (pol) M Taufik, di Jakarta, Jumat (27/ 4). Sembilan tersangka ini terdiri dari seorang perwira dan delapan lainnya berpangkat bintara. Kini anggota personil satuan tempur Polri itu sudah ditahan. Tidak hanya terancam pidana jika dalam persidangan nanti mereka terbukti bersalah ancaman pemberhentian dengan tidak hormat sudah menanti. “Dan proses selanjutnya kita upayakan percepatan pemberkasan dari perkara ini dan kita serahkan sesegera mungkin ke JPU,” imbuhnya. Seperti diketahui sejumlah prajurit Kostrad 221 Gorontalo diduga menjadi korban penembakan Sabtu (21/4) lalu di Taman Menara Kea-

gungan Limboto. Peristiwa tersebut kemudian membuat seorang anggota TNI bernama Prada Firman tewas setelah beberapa hari men-

jalani perawatan akibat luka. Untuk mencegah bentrok antar satuan, Mabes Polri dan TNI turun langsung menan-

gain kasus tersebut. Adapun adanya pelanggaran atau perbuatan pidana yang dilakukan oleh oknum atau person-

al yang dituduh tidak atas nama institusi, jadi hanya dilakukan beberapa orang,”pungkasnya.(zul/ jpnn)

Kapolri memberikan penjelasan pers terkait penetapan tersangka personel Brimob yang menembak TNI.

Ical: Tak Ada Capres Selain Saya Belanja Pegawai Rendah, JAKARTA- Posisi Ketua Umum DPP Partai Golkar Aburizal Bakrie untuk maju sebagai capres sepertinya sangat kuat. Pria yang akrab dipanggil Ical ini bahkan sudah berani sesumbar tidak ada calon lain dari partai berlambang pohon beringin itu. ”Jadi sayang sekali tidak ada sama sekali calon lain yang dibicarakan untuk menjadi capres selain saya,” tutur Ical dalam jumpa pers usai Rapat Pleno di DPP Partai Golkar, Jl Anggrek Neli Murni, Jakarta Barat, Jumat (27/4). Ical mendasarkan ucapannya itu pada keputusan Rapimnas II yang menurutnya sudah mengikat. Rapimnas II yang digelar tahun lalu itu sudah memutuskan Ical satusatunya capres dan menutup peluang calon lain. ”Untuk pencalonan presiden

Daerah Boleh Angkat CPNS

Aburizal Bakrie

yang dipakai adalah keputusan Rapimnas II untuk penetapan dan pengukuhan Aburizal Bakrie sebagai capres,” katanya. Tidak ada hal yang berbeda dengan keputusan Rapimnas II di Golkar. Jika DPP Golkar tidak melaksanakan amanat Rampim-

nas, maka hal itu merupakan pelanggaran aturan organisasi. ”Bisa dikenakan sanksi,” ungkapnya. Rapat pleno yang digelar di DPP Golkar dipimpin oleh Aburizal Bakrie. Tokoh Golkar yang hadir antara lain Idrus Marham, Theo Sambuaga, Leo Nababan, dan Nurul Arifin. (dtc/int)

JAKARTA - Meski persyaratannya lebih rumit, namun pemerintah pusat tetap memberikan peluang kepada pemda untuk mengadakan seleksi CPNS tahun ini, khusus formasi tenaga kesehatan, pendidik, dan kebutuhan mendesak. Itupun dibatasi hanya untuk daerah yang belanja pegawainya di bawah 50 persen dari APBD. “Kebijakan moratorium pengangkatan CPNS bertitik tolak pada upaya penataan PNS, khususnya bagi daerah yang memiliki PNS dalam jumlah besar sehingga menyedot anggaran APBD. Bagi daerah yang belanja pegawainya melebihi 50 persen, kemungkinan mengajukan pengangkatan CPNS sangatlah kecil,” terang Kepala Sub Bagian Publikasi

Badan Kepegawaian Negara (BKN) Petrus Sujendro dalam keterangan persnya, Jumat (27/4). KebijakanmoratoriumPNSdidasarkan pada keputusan bersama antara Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi, Menteri Dalam Negeri dan Menteri Keuangan yang pelaksanaannya berlaku hingga Desember 2012. Dijelaskannya, sesuai amanat moratorium PNS, pengajuan penambahan pegawai hanya bisa diberikan untuk daerah yang mempunyai anggaran belanja pegawai kurang dari 50 persen. Meski begitu, daerah yang mempunyai peluang tersebut tidak serta merta bisa langsung mengajukan kebutuhan pegawai baru. (esy/jpnn)


SABTU

28 April 2012

8 Mei, PS Vita Masuk Pasaran Indonesia Sony mengumumkan konsol game portabel PlayStation (PS) Vita akan mulai tersedia di Indonesia pada 8 Mei mendatang. Model yang masuk ke Indonesia terlebih dahulu adalah PS Vita versi Wi-Fi. Tak seperti PSP (PlayStation Portable), PS Vita dilengkapi dengan dua stik analog tepat di

bawah tombol navigasi bagian kanan dan kirinya. Untuk urusan layar, PS Vita memiliki layar sentuh berukuran 5 inci dengan rasio 16:9, dan beresolusi 960x544 piksel OLED. Layarnya yang multi touch bisa dioperasikan untuk tap, scroll, pinch, dan swipe. PS Vita dibekali dengan

prosesor quad core ARM CortexA9 core, tersedia pula kamera belakang dan kamera depan. Selain Wi-Fi, PS Vita juga menyediakan Bluetooth untuk koneksi nirkabel. Sony belum menginformasikan secara pasti kapan PS Vita versi Wi-Fi + 3G akan masuk ke Indonesia. Yang jelas, PS Vita versi Wi-Fi

dibanderol Rp 3.399.000. Sony akan membuka pemesanan awal untuk PS Vita value pack pada 1 sampai 6 Mei di toko-toko tertentu. Paket Value pack ini akan disertai dengan game Uncharted: Golden Abyss (versi Chinese & English), dan ModNation Racers: Road Trip (versi Asian English & Chinese). (int)

TV 3D Makin Sempurna V-Ixion Model Anyar Hadir JAKARTA-Kabar mengenai kehadiran wajah baru Yamaha V-ixion nampaknya menemukan titik terang. Yamaha memastikan kalau mereka sedang mempersiapkannya. General Manager Promotion and Communications PT Yamaha Indonesia Motor Manufacturing (YIMM), Eko Prabowo mengatakan semua sedang dirancang dan meminta konsumen untuk lebih sabar menanti. “V-Ixion insya Allah. Ditunggu saja,” katanya di Cilandak Town Square Jakarta, Jumat (27/4).

Kabar mengenai kelahiran V-ixion terbaru sendiri sudah bergerak cepat dalam beberapa bulan belakangan. Ada kabar mengatakan kalau di edisi barunya nanti V-ixion akan memiliki desain baru. Kaki bagian belakang motor bermesin 150 cc yang sudah mengusung sistem pengabutan injeksi ini pun dikatakan sudah memiliki rem cakram bukan lagi tromol seperti sekarang. “Sing sabar, orang sabar disayang Tuhan,” elak Eko ketika didesak mengenai motor anyarnya ini. (dtc)

Honda Punya Mini MPV dari Brio Pertengahan Maret lalu, Honda Indonesia menginformasikan bahwa mereka sudah menyiapkan produk baru mini MPV (multi purpose vehicle=MPV) 7penumpang untuk mengejar volume penjualan. Produk itu akan dikembangan menggunakan platform Brio, mobil kompak, sama seperti yang dilakukan Suzuki Ertiga diciptakan dari platform Swift. “Saat ini tim dari Honda Motor Company lagi di Indonesia untuk melakukan penelitian mendalam untuk produk ini. MPV ini diciptakan khusus untuk Indonesia,” komentar Jonfis Fandy, Direktur Pemasaran dan Layanan Purna Jual PT Honda Prospect Motor (HPM) di Jakarta, Kamis (26/4). Dijelaskan, saat ini Honda baru memanfaatkan 40 persen kandungan lokal dari industri komponen Indonesia. Untuk MPV baru ini, komposisinya akan ditingkatkan. “Bahkan untuk persetujuan pemilihan komponen nanti langsung di Indonesia, karena pihak

prinsipal menyiapkan perwakilannya di sini (Indonesia),” beber Jonfis. Seperti diketahui, Honda sudah memastikan komitmen investasi Rp3,1 triliun untuk membangun pabrik baru di Karawang, Jawa Barat, sehingga total produksi di Indonesia naik dari 60.000 unit menjadi 180.000 unit per tahun. Pabrik ditargetkan mulai beroperasi awal 2014 dan memproduksi dua model baru Brio dan MPV (dari Brio). “Dengan masuk ke segmen low (Brio dan MPV Biro), Honda berharap bisa mendongkrak volume penjualan,” tutup Jonfis. Besarnya ceruk pasar MPV low di Indonesia makin menarik prinsipal lain untuk ikut memeriahkan segmen ini. Setelah Suzuki resmi meluncurkan Ertiga pekan lalu, Honda menyiapkan Brio MPV dan Chevrolet juga sudah punya PM7. Semuanya berniat mematahkan dominasi duet maut AvanzaXenia yang masih tercatat sebagai produk terlaris di Indonesia.(int)

LG Electronics Indonesia (LGEIN) baru saja melepas generasi terbaru LG Cinema 3D Smart TV. Ada perubahan besar yang semakin menyempurnakan fitur yang terdapat pada generasi pertama TV 3D yang dipasarkan tahun lalu. Dengan tetap mengusung teknologi Film Patterned Retarder (FPR), penyempurnaan generasi baru ini dimulai dari desainnya. Bingkai layarnya (bezel) yang setipis 1 milimeter, membuatnya seolah nyaris tak berbingkai. Desain yang mereka sebut Cinema Screen ini tak cuma membuat 3D TV makin menarik. Tidak heran jika Cinema 3D Smart TV baru ini memegang rekor sebagai 3D TV dengan bingkai tertipis di dunia saat ini. Untuk memperkuat posisi terkuat pasar TV 3D di negeri ini, pihak LGIN juga siap menghadirkan TV berlayar OLED (Organic Light Emitting Diode) yang pertama di Indonesia dengan produk LG EM9600. Produk TV 3D OLED ini layarnya hanya setebal 4 milimeter atau setara dengan tebal tumpukan tiga kartu kredit yang merupakan 3D TV tertipis di dunia saat ini. “Menjadi yang terdepan berarti memikul tanggung jawab memberi yang terbaik bagi konsumen setianya. Inilah yang menjadi semangat LG dalam memperkenalkan berbagai produk inovatif kami,” ujar Kim Weon Dae, Presiden Direktur PT LG Electronics Indonesia.TV pintar LG sebelum ini sukses menguasai pasar 3D TV di Indonesia. PenyempurnaanSelain bingkai, perbaikan TV 3D baru adalah kualitas visualisasi efek 3D, yaitu dengan memberi

„ TV 3D opsi mengatur kedalaman efek 3D sesuai keinginan hingga 20 tingkat. Terdapat pula fitur konversi 2D ke 3D yang membuat pengguna bisa mengubah setiap tayangan 2D menjadi format bernuansa 3D. Sebagai 3D TV pintar, juga beragam konten telah disertakan. Pemilik dapat menikmati berita, video on demand atau bahkan berbelanja online lewat 3D TV

terbaru ini. Magic Remote Control sudah jauh lebih ramping dari sebelumnya, selain tak banyak tombol. Di dalamnya terdapat opsi magic gesture yang membuat akses menu pilihan cukup dengan gerak sapuan sederhana yang telah direkam remote control ini sebelumnya. Contohnya, pengguna dapat menyapukan bentuk “V” dan Magic Remote Control akan

menerjemahkannya sebagai perintah mengakses menu Video. LG Cinema 3D Smart TV baru hadir dalam tiga varian, yaitu LG LM8600, LG LM7600 dan LG LM6700 yang tersedia dengan dimensi layar 42" hingga 55" dan dilengkapi Wi-Fi built-in. Selain itu juga tersedia seri LG LM9500 dengan lebar layar 72 inci, merupakan TV 3D terbesar di dunia saat ini. (int)

HP Z1, Komputer Workstation “Beraroma” BMW Hewlett Packard (HP) merilis komputer desktop Workstation Z1. Komputer desktop besutan HP ini mengusung model All-in-One PC dengan “citarasa” sedan mewah BMW. Marketing Development Manager Workstation HP Indonesia, Erric Budiono menjelaskan HP menggandeng BMW Designwork Amerika Serikat untuk mendesain Workstation Z1 agar mirip dengan desain mobil BMW Z4. “Desktop tersebut didesain sedemikian rupa seperti mobil BMW. Misalnya performa dibuat powerful, tapi suhu tetap dingin dan tidak berisik,” kata Erric saat peluncuran HP Workstation Z1 di PT Tunas Mobilindo Parama, Authorized BMW Dealer, Jakarta, kemrin. Dari sisi performa, HP Z1 memiliki keunggulan dengan sifatnya yang “Hybrid”. Artinya kompuer ini bisa

memakai prosesor Intel Quad Core Xeon, namun juga bisa memakai Intel Core i3. Dengan fitur “Hybrid” tersebut, workstation bisa dikonfigurasi menjadi PC biasa atau sekaligus menjadi server PC.Di sisi grafis, workstation tersebut bisa memakai kartu grafis Intel HD 2000 atau Intel HD 3000. Bila memerlukan performa lebih tinggi, HP telah menyediakan kartu grafis NVIDIA Quadro.Di sisi layar, monitornya memakai ukuran diagonal 27 inci dan mendukung lebih dari 1 miliar warna display LED. Sehingga akan memberikan sudut pandang yang luas 178 derajat serta panel in plane switching (IPS). Audionya mengadopsi speaker front facing dual core dan SRS Premium Sound. Sehingga menawarkan kejernihan tata suara.Fitur lain adalah tool-less

„ HP Workstation Z1 chassis. Sehingga pengguna bisa dengan mudah menambahkan hard drive, kapasitas memori ataupun kartu grafis. Pengguna pun hanya langsung membuka chassis untuk mengeluarkan komponen yang

diinginkan.Kapasitas penyimpanan storage pun bisa dipilih antara hard disk drive (HDD) atau solid state drive (SSD). Perangkat ini juga disertakan slot optical drive untuk Blu-ray Writer. (int)


SABTU

28 April 2012

Ayah Pemerkosa Putrinya Ditangkap Sambungan Halaman 8 anya, membantah semua tuduhan yang dialamatkan kepadanya. Dia menuturkan, sama sekali tidak ada melakukan perbuatan senonoh itu terhadap putrinya. “Tidak ada kujadikan putriku jadi budak sex,” katanya singkat. Sekadar mengingatkan, perbuatan Egan menggagahi putri kandungnya, Melati (11), terkuak saat putrinya mengigau karena mengalami demam tinggi. Padahal, aksi Egan yang merupakan warga Kisaran itu, sudah terjadi selama setahun. Ibu kandung Melati yang juga istri Egan, Me (38) kepada METRO, Kamis (19/4) menerangkan, beberapa hari lalu Melati mengalami demam. Suhu tubuhnya cukup tinggi. Saat tidur, kata Me, Melati mengigau. “Jangan ayah, jangan ayah,” kata Melati berulang-ulang seperti ditirukan ibunya. Mengetahui kondisi putrinya, Me bingung dan merasa khawatir. Begitu Melati terbangun dan sadarkan diri, siswi kelas 6 SD itu langsung memeluk ibunya sambil menangis. Pelan-pelan, Me menanyakan kepada Melati apa yang telah terjadi. Sambil terus menangis, Melati mengaku telah menjadi budak nafsu ayahnya sendiri sejak setahun lalu.MendengarpengakuanMelati, Me menjerit dan menangis. “Saya menjerit seketika saat anak saya mengadukan hal itu.

Dari situlah mulai terbongkar kalau Melati selama ini menjadi budak nafsu ayah kandungnya,” kata Me, sambil terus menangis. Me sama sekali tidak menyangka suami tercintanya itu tega merusak masa depan putri sulungnya. Padahal, kata Me, dirinya selalu berusaha melayani suaminya dengan baik, jangan sampai mengecewakan. Masih menurut perempuan yang sehari-hari bekerja di kantor biro jasa itu, saat ini suaminya merantau ke luar daerah. Suaminya, sambungnya, belum tahu perbuatan bejadnya sudah terbongkar. Paman korban, Warkam mengaku keluarga besarnya tidak terima atas perbuatan Egan. Keluarga, kata dia, memberikan dukungan moril agar Me melaporkan suaminya ke polisi. “Kami dukung Me melaporkan suaminya ke polisi,” kata Warkam sembari meminta Melati jangan diwawancarakarenamasihtrauma. Me mendatangi Polres Asahan untuk melapor. Selanjutnya Melati didampingi ibunya menuju RSU Kisaran untuk menjalani visum. Kapolres Asahan AKBP Yustan Alpiani melalui Kasubbag Humas AKP R Berutu didampingi Kanit Pelayanan Perempuan dan Anak ( PPA) Aptu Erika Tumanggor, membenarkan pihaknya ada menerima pengaduan ibu rumah tangga yang anaknya telah digagahi suaminya. (sus/smg)

Usai UN, Anak Kembar Tertabrak Truk Sambungan Halaman 8 mendatangi korban untuk memberikan pertolongan. Selanjutnya korban dibawa masuk ke sebuah rumah gubuk di dalam gudang itu. Namun, kakak beradik ini selanjutnya ditinggalkan di gubuk itu karena Sitorus kembali melanjutkan pekerjaannya. Pada akhirnya, kedua korban pun mampu pulang ke rumah. Keluarga yang berada di rumah selanjutnya menghubungi Wito, ayah korban. Wito pun membawa kedua putrinya ini ke Rumah Sakit Mina Padi di Jalan

Siantar-Medan, Kelurahan Sinaksak, Kecamatan Tapian Dolok. Selanjutnya Wito mendatangi Mapolres Siantar untuk melaporkan kejadian yang menimpa putri kembarnya. Namun petugas sempat bingung saat menerima laporan Wito karena barang bukti berupa sepedamotor yang ditabrak sudah sempat dipebaiki di bengkel, walau belum tuntas. Untuk memastikan barang bukti itu benar terjadi kecelakaan, terpaksa Wito kembali mengembalikan keadaan sepedamotor tersebut seperti semula. (mag-4/ara)

Menjala, 2 Sekawan Hilang di Sungai Sambungan Halaman 8 Andi (28) yang diketahui warga Siantar pergi menjala ikan ke pinggiran Sungai Batang Toru. Keduanya, kata Kapolsek, menjala ikan tidak dari atas perahu. Diduga salah satu dari keduanya terpeleset dan jatuh ke sungai, kemudian hanyut terbawa arus. Melihat itu, temannya mencoba menolong dengan menarik jala. Naas, ia turut hanyut dibawa arus. Saat ini, sambung Kapolsek, jajarannya bersama muspika plus dan warga Muara Batang Toru masih melakukan pencarian dengan menyisir pinggiran dan seluruh Sungai Batang Toru. Namun keduanya masih belum ditemukan. “Kita masih melaku-

kan pencarian keduanya,” tutur Kapolsek. Kapolsek menambahkan, dari hasil penelusuran yang dilakukan Juned dan Andi bekerja sebagai buruh bangunan di perumahan perusahaan yang ada di Kecamatan Batang Toru. “Dari informasi yang kita peroleh, Juned dan Andi ini berteman. Keduanya sama-sama bekerja borongan pembangunan perumahan di perkebunan di Kecamatan Batang Toru. Andi, warga Siantar ini baru tiga bulan tinggal di Kecamatan Batang Toru, sedangkan Juned memang warga setempat. Kita perkirakan keduanya terpeleset saat menjala ikan dan jatuh ke sungai. Saat ini kita masih terus melakukan pencarian,” pungkas Kapolsek. (phn)

Usai Kunjungi Cucu Par tus.... Sambungan Halaman 8

dengan kecepatan tinggi, kecelakaan pun tak terhindarkan. Keduanya terhempas ke aspal. Warga yang melihat kejadian langsung berbondong-bondong menolong kedua korban. Halim dibawa ke klinik milik Evi Nuria Damanik, tak jauh lokasi kejadian. Dia mengalami luka

sepedamotor Karibun tampak redup, dan diduga inilah yang menyebabkan dia tak memperhatikan jalan hingga sampai mengambil jalur terlalu ke tengah. Karena keduanya pun melaju

cukup parah. Kaki sebelah kanan patah serta luka parah di hampir sekujur tubuhnya. Sementara Karibun dilarikan ke RSU Perdagangan karena mengalami luka yang sangat parah. Karibun mengalami luka di bagian kepala, dada sebelah kiri remuk, serta luka-luka di sekujur

Terlilit Utang, PNS jadi Kurir Ganja Sambungan Halaman 8 dari mobil dan mematikan mobilnya. Awalnya, polisi yang melakukan penggeledahan di dalam mobil tidak menemukan barang bukti. Namun saat polisi memeriksa dinding-dinding mobil, yang dimulai dari dinding pintu depan, akhirnnya petugas berhasil menemukan barang bukti yang dimaksud. Mendapatkan temuan tersebut, petugas pun mulai membuka kap penutup dinding-dinding mobil. Dan pencarian itu tidak sia-sia, ternyata di setiap dinding ditemukan daun ganja yang berjumlah 35 buah yang dibungkus dengan lakban warna hijau dan hitam. Petugas langsung menggiring tersangka beserta barang bukti dan dua orang wanita penumpang mobil. Hingga sampai saat ini petugas masih melakukan penyelidikan dan memintai keterangan dari tersangka pembawa daun ganja ini. Kapolsek Binjai Timur AKP Ismui didampingi Kanit Reskrim Ipda Rudi Lapian mengatakan,, penangkapan tersebut berawal dari informasi yang diterima dari seorang informan di lapangan. “Informasi ini sudah kita terima dua minggu yang lalu dan kita terus melakukan pemantauan

terhadap mobil yang akan melintas,” kata AKP Ismui. Selanjutnnya, setelah menunggu mobil yang dimaksud atas dasar informasi, petugas mengawasi setiap gerak-gerik kendaraan yang melintas di wilayah hukum mereka. Setelah beberapa hari menunggu, akhirnnya muncullah mobil yang dimaksud. “Kita pun melihat mobil tersebut melintas dan kita langsung menangkap dan kita temukan barang bukti sebanyak 35 amplop daun ganja kering yang ditaksir beratnya 35 kg,” tegasnnya sembari mengatakan pihaknnya masih melakukan pengembangan dan tersangka terjerat pasal 111 Undang-undang nomor 35 tahun 2009, dengan ancaman 15 tahun kurungan penjara. Terlilit Hutang Sementara, M Lepiah yang merupakan warga Dusun Bahagia, Desa Dalam, Kecamatan Karang Baru, Kabupaten Aceh Tamiang ini mengaku nekat menjual ganja untuk membayar utang sebesar Rp200 juta. Sebelum membawa barang tersebut dari Aceh menuju Medan, dia datang ke rumah Tengku Indris, seorang bandar ganja yang terletak di daerah Blang Kejren, Aceh Utara. Di rumah tersebut, ia disuruh masuk ke dalam rumah, sementara mobil di masukan

“Kami mau meminta kejelasan, sudah bagaimana penanganan kasus pembunuhan itu. Kami mau pelakunya segera ditangkap karena kami selalu dihantui ketakutan,” ujar warga kepada petugas. Menurut mereka, pasca pembunuhan itu, sejumlah warga terutama yang berdekatan dengan rumah korban selalu khawatir bila mana pelaku muncul dan mengancam keselamatan warga lainnya. Setelah mendengarkan keluhan warga, polisi menerangkan bahwa kasus tersebut masih dalam penyelidikan dan tetap berupaya menangkap pelaku. Polisi menjelaskan, pengungkapan kasus harus disertai bukti-bukti dan tidak bisa langsung menenetapkan seseorang menjadi tersangka. Hampir seluruh warga menyampaikan agar pelaku segera ditangkap, bahkan suara-suara sumbang terdengar bahwa warga

serta perlengkapan dapur seperti kuali, periuk serta tempat untuk menumbuk padi. Demikian juga alat alat musik dengan berbagai jenis. Dengan logat Malaysia, ia mengatakan soal alat musik seperti ada kemiripan dengan budaya yang ada di Malyasia. Sahmawin Purba dan Pengurus Museum Simalungun, Jomen Purba

Sambungan Halaman 8 Maria bingung setelah Arnold mulai menelantarkan John Edwards, yang diketahui adalah anak dari staf rumah tangganya yang bernama Mildred Baena dan telah bekerja untuk keluarga Arnold selama 20 tahun. Arnold sendiri sudah mengakui skandal itu kepada Maria. ”Setelah meninggalkan kantor gubernur, saya mengatakan kepada istri saya tentang peristiwa ini, yang terjadi lebih dari satu dekade lalu. Saya memahami kekecewaan dan kemarahan istri, teman-teman, serta keluarga besar saya. Tidak ada alasan bagi saya untuk lari dan saya ambil penuh tanggung jawab tersebut. Saya pun meminta maaf kepada Maria, anak-anak saya, juga keluarga besar saya. Saya benar-benar menyesal,” aku Arnold. Mendengar pengakuan itu, Maria masih dilanda kebingungan. Dia belum mengambil keputusan apakah akan tetap melanjutkan pernikahan dengan Arnold dan melegalkan pernikahannya di sisi hukum atau mengakhiri. Kini, Maria telah bekerja berkonsultasi dengan seorang penasihat keuangan yang akan membantunya bercerai dari mantan gubernur California itu. ”Ini adalah saat yang menyakitkan dan memilukan. Sebagai seorang ibu, kekhawatiran saya adalah anak-anak. Saya minta belas kasihan, menghormati privasi anak-anak saya dan saya mencoba untuk membangun kembali kehidupan kita,” tutur Maria. (int)

Rumah Partonun Dibakar Pagi-pagi Buta Sambungan Halaman 8 Kemudian Irmawati memanggil ibunya dan mencari HP untuk penerangan. Saat ia keluar dari kamar, ia sangat terkejut melihat api sudah menjilat pintu dan dinding rumahnya. Sontak dia berlari ke belakang rumah seraya berteriak ada kebakaran. Korban yang mendengar putrinya berteriak pun selanjutnya ikut berteriak minta tolong. Selain dua orang anak kos yang memadamkan api dari dalam, warga sekitar yang mendengar teriakan turut membantu memadamkan api dengan mengambil air dari bak mandi. Walau api sudah membakar pintu depan rumah serta bagian jendela samping, setelah pertolongan warga, beberapa menit kemudian apinya berhasil dipadamkan. “Tadi malam, kami semua tidur sekitar pukul 23.00 WIB dan mematikan lampu depan. Saat aku keluar kamar aku lihat api dari dalam dan asap sudah banyak. Bau bensin juga sangat menyengat,” ucap Irmawati. Ia menambahkan, setelah dipadamkan, ia dan warga

menemukan goni besar yang bau bensin dan sudah ada bekas terbakar. “Ini yang dipakai untuk membakar rumah ini,” ucap Irmawati. Menurut Nursahat, dia tidak mengetahui pelaku pembakaran itu. “Saya tak tahu pelakunya. Ada dua asal titik api, yakni di pintu rumah depan an di bagian jendela samping rumah,” ujarnya. Malik Saragih (30), pemilik warung di sebelah rumah korban juga mengatakan pintu warungnya juga sempat sedikit terkena api tapi tidak sempat besar karena langsung dipadamkan. Ia mengatakan, ketika mendengar teriakan korban, ia langsung keluar dan masih mendengar suara lari ke arah belakang menuju sungai. Selanjutnya Nursahat boru Sibuea dan Malik Saragih pergi ke Polres Siantar beserta warga yang lain membuat laporan pengaduan. Namun merka selanjutnya dianjurkan untuk membuat laporan ke Polsek Siantar Marihat karena tempat kejadian perkara (TKP) berada di wilayah Polsek Siantar Marihat. Kanit Reskrim Polsek Siantar

Marihat Aiptu Hendra Sihombing membenarkan adanya laporan pengaduan dari Nursahat boru Subuea dan Malik Saragih. Sementara barang bukti berupa goni sudah diamankan, namun pelakunya masih dalam penyelidikan. Diteror Lewat SMS Kepada METRO, sebelum kejadian Malik Saragih mengaku sering mendapat SMS teror dari orang yang tidak dikenal dengan menyebutkan agar hati-hati dan segera angkat kaki. Bahkan ada kata-kata ancaman akan membuat tindakan bila perintahnya tidak dilaksanakan. “Aku dapat SMS belakangan hari ini dengan bahasa ancaman. Tapi aku tidak kenal orangnya,” sebutnya. Disinggung apakah dia ada masalah, Malik mengakui pada bulan sebelumnya ia pernah berperkara dengan seseorang yang persoalannya adalah kasus tanah. Namun akhirnya kasus tersebut SP3 di Polres Pematangsiantar. Namun dia mengatakan tidak menuduh pelaku yang membakar rumah itu adalah orang berperkara dengan dia sebelumnya. (pra/ara)

„ Goni yang diduga digunakan untuk membakar.

Foto: Fahmi

Sambungan Halaman Satu

mencurigai pelakunya kemungkinan orang dekat korban. “Banyak juga warga mencurigai orang dekat korban. Tapi itulah, kami saja sudah ketakutan sekarang,” ujar beberapa ibu-ibu warga di sana kepada METRO. Mereka mengatakan, sejak kejadian, Jalan Aman berubah dari biasanya. Setiap malam, jika sudah pukul 19.00 WIB, komplek itu langsung sepi dan orang keluar malam, begitu juga anak-anak. “Nyuci di kamar mandi sendiri takut, membayangkan pelakunya datang dari belakang. Karena korban dibacok dari belakang,” kata warga lagi. Sedikitnya tiga warga termasuk orang tua korban masuk ke ruangan penyidik Reskrim dan menyampaikan keinginan mereka agar polisi secepatnya mengungkap kasus tersebut. Sekitar 30 menit kemudian, setelah warga menyampaikan harapannya, mereka pulang ke Jalan Aman. Sementara itu, rumah korban

masih belum ditempati suaminya Ponijo. Menurut Suhartati, saudara Ponijo, kalau malam Ponijo belum tidur di rumahnya. Namun kalau siang terkadang ditempati untuk bersih-bersih. “Untuk sementara ini, ia masih tidur di sini karena masih trauma,” ucap Suhartati. Terkait soal kerja Ponijo, ia mengatakan bahwa pihak Yayasan USI telah datang pada hari Selasa lalu untuk mengatakan bahwa Ponijo cuti selama satu bulan, namun gajinya tetap diberikan.“Katanya diberi cuti satu bulan, dan mudahmudahan kasusnya cepat terungkap. Karena dia masih trauma setelah istrinya meninggal. Ponijo dianggap masih trauma dan belum bisa bekerja” katanya. Suhartati yang biasanya berjualan gorengan mi di depan rumahnya, hingga saat ini belum memulai aktivitas jualan pasca kejadian. “Gimanalah, belum jualanlah” katanya. Sekedar mengingatkan, Siti Nurcayaha alias Ester Siagian (38)

yang sedang mengandung 6 bulan ditemukan tewas di ruang dapur rumahnya dengan 7 bacokan di leher belakang, perut dan tangannya, Rabu (18/4) lalu sekitar pukul 10.30 WIB. Korban meninggalkan lima orang anak. Sehari-hari, korban bekerja sebagai tukang cuci, sedangkan suaminya Ponijo bekerja sebagai supir di Yayasan Universitas Simalungun (USI). Hingga saat ini, identitas pelaku pembunuhan masih misterius. Sementara di lokasi kejadian tidak ada ditemukan barang bukti yang digunakan pelaku. Sedangkan Ponijo hanya menyebutkan seseorang inisial ES yang pernah datang ke rumahnya bertamu untuk tujuan mencari kos sekaligus menawarkan pekerjaan satpam kepada Ponijo. Namun Ponijo mengaku tidak mengetahui alamat ES. Hingga berita ini diturunkan, kasus pembunuhan tersebut masih dalam penyelidikan pihak Polresta Siantar. (mag-1)

Istri Panglima Jenderal Malaysia Kagum Sambungan Halaman 1

Kapos Lantas Polsek Perdagangan Aiptu W Aritonang yang dikonfirmasi METRO membenarkan telah terjadi kecelakaan di lokasi tersebut. Dia mengatakan, pihaknya sedang melakukan olah TKP dan saat ini telah diamankan dua sepedamotor sebagai barang bukti. (mag-02/ara)

Punya Anak dari Stafnya

ke dalam gang rumah tersebut. Setelah menunggu beberapa menit, ia pun disuruh membawa mobil Suzuki AVP BK 1013 KO, yang diakuinnya dirental. “Aku tahu akan membawa ganja, tapi aku gak tahu siapa yang akan aku temui di Medan. Yang pasti, saat berbincang melalui Hp, yang mau aku jumpai di Medan itu bernama Ahmad dan kami berjanji bertemu di lapangan Teladan Medan,” jelasnnya. Setelah barang semua dimasukan ke dalam mobil, ungkapnnya, ia kemudian pergi ke Medan untuk menemui Ahmad, orang yang sudah berbincang melalui Hp. Namun, ia tidak sendiri. Di dalam mobil ia ditemani anak tirinnya Desiana Putri (20) dan Dalika Darmida (21). “Karena aku pikir aman, aku pun membawa anak angkatku yang ingin jalan-jalan ke Medan. Anakku itu juga gak tahu kalau aku mengantar ganja ke Medan. Aku bilang sama mereka, aku pergi ke Medan mau menemui kawan,” jelasnnya. M Lepiah sendiri juga mengaku baru sekali mengantar ganja dan itu dilakukannya karena terlilit utang. Katanya, sekali mengantar barang haram itu ia mendapatkan upah sebesar Rp200 ribu per bungkusnnya. (mag-4/ara)

Ibu-ibu Tetangga Korban Datangi Mapolresta Sambungan Halaman 1

tubuhnya. Namun, tak sempat mendapatkan perobatan di RSU Perdagangan, kakek 4 cucu ini akhirnya tewas di perjalanan. Tak lama berselang, personel kepolisian dari Polsek Perdagangan tiba di lokasi kejadian untuk melakukan olah tempat kejadian perkara (TKP).

tampak memberikan keterangan kepada Rasidah soal fungsi-fungsi peninggalan sejarah tersbeut. Bahkan Sahmawin menjelaskan bahwa musem tersebut adalah musem pertama yang ada di Sumut. Sekitar 30 menit berada di museum, romongan Rashidah selanjutnya pergi melanjutkan perjalanan ke Parapat. Kepada METRO, Rashidah mengatakan, tujuan kedatangannya bersama suaminya adalah untuk berlibur

dan mengunjungi tempat-tempat bersejarah termasuk obyek wisata Danau Toba. Katanya, mereka di Indonesia hanya tiga hari. Dia menambahkan, setelah melihat Museum Simalungun, ia mengatakan bahwa peninggalan Simalungun sangat bagus dan perlu dijaga dengan baik. “Bagus, dan budaya Simalungun harus dijaga. Karena itu adalah jati diri yang harus dipertahankan,” ucapnya. Ia mengatakan, hendak melanjutkan per-

jalanan ke Parapat, sebab suaminya sudah terlebih dahulu berangkat. Jomen Purba pengurus Museum Simalungun mengatakan, kedatangan rombongan dari Malaysia sudah diberitahukan dua jam sebelumnya dari Kodim. “Katanya mereka mau berkunjung, dan kita menyambut baik atas kunjungannya. Selama di museum, dia terlihat kagum atas benda-benda peninggalan sejarah di Simalungun,” katanya. (pra)

Simalungun Hataran Ditunda Hingga 2014

Sambungan Halaman 1

dari pemerintah provinsi sudah clear (bersih) sejak tahun 2007. Pemerintah provinsi sudah merekomendasikan pemekaran sejak 2007 lalu, masa Pak Rudolf sebagai Gubernur,” tegasnya. Menurutnya, terkendalanya pemekaran Kabupaten Simalungun selama ini karena panitia pemekaran, dalam hal ini Badan Persiapan Pemekaran Kabupaten Simalungun BP2KS, tidak mengikuti prosedur pemekaran secara rinci dan detail. Akibatnya, kekurangan berkas sejak 2007 lalu, baru diketahui pada tahun 2012 ini. “Komunikasi panitia pemekaran yang kurang terhadap Komisi II DPR RI dan kepada pemerintah pusat dalam hal ini Kemendagri,” ujarnya lagi. Lebih lanjut Gatot mengatakan, terhitung sejak 2007, tidak ada lagi proses atau upaya pemekaran tambahan yang dilakukan Bupati Zulkarnain Damanik saat itu. Namun saat JR Saragih menjabat bupati, upaya pemekaran ini mulai dilakukan kembali. “Sudah datang surat Bupati JR Saragih Maret lalu kepada kita, kalau tidak salah sekitar tanggal 12 Maret. Kita pertanyakan lagi kepada Mendagri, namun muncul masalah baru, berkas administrasi kita lengkap, namun Mendagri membuat policy (kebijakan) terkait proses pembuatan data baku dan baik untuk persiapan pemilu legislatif 2014. Untuk sementara waktu pemekaran Simalungun harus menunggu hingga 2014,” ujarnya lagi. Disebutkannya, Kabupaten Simalungun tidak termasuk 19 kabupaten/kota yang sudah disetujui dimekarkan oleh Komisi II DPR RI. Meski begitu, menurut Gatot, berkas pemekaran dari Simalungun dan Provinsi Sumatera Utara, tidak harus berkas baru. “Tidak harus berkas baru, saya kira juga tidak perlu lagi kita paripurna lagi di DPRD Sumut. Cukup kita kirimkan berkas yang sudah ada itu,” jelasnya. Ketua Badan Persiapan Pemekaran Simalungun (BP2KS) Maknur Sinaga mengatakan, mereka memahami apa yang disampaikan Plt Gubernur tentang komunikasi yang kurang kepada Komisi II dan Kemendagri selama ini. Disinggung komunikasi yang kurang ini berkaitan dengan uang, Maknur terkesan mengiyakan. “Jangan bilang begitu, kalau masalah komunikasi itu kami juga tahu. Tidak usahlah dibuat tentang itu. Kami akan tetap berusaha supaya pemekaran ini cepat terealisasi. Keputusan pemekaran ini bukan di tangan Gubernur, tetapi di tangan pemerintah pusat. Kalau memang berkasnya dari provinsi sudah dilengkapi, kita dukung itu,” tegasnya. (ral)


METRO SIANTAR

SABTU 28 APRIL 2012

s u t r a p u c u c i g n u j Usai kun

„ Deva dan devi saat dirawat RS Mina Padi

Usai UNa,r

Anak Kemb

Tertabrak Truk SIANTAR- Apes bagi Deva Ayu Absari dan Depi Ayu Absari (15), keduanya siswa SMP MTsN Jalan Medan, Simpang Kapok km 6,5 Kelurahan Tanjung Tongah, Siantar Martoba. Anak kembar ini tertabrak truk pengangkut tanah di depan SMAN 5 Jalan Medan, Kamis (26/4) sekitar pukul 11.00 WIB saat hendak pulang usai mengikuti Ujian Nasional (UN). Saat itu mereka hendak pulang ke rumah di Jalan Anjangsana Gang Famili, Nagori Karang Sari, Kecamatan Gunung Maligas,

n a k a r b a t s a w e kakek t SIMALUNGUN- Karibun (72) warga Huta II, Nagori Lias Baru, Kecamatan Bandar Masilam, Simalungun, meregang nyawa akibat kecelakaan yang dialaminya saat hendak pulang setelah baru saja mengunjungi cucunya yang baru partus, tak jauh dari rumahnya, Jumat (27/4) sekira pukul 19.00 WIB.

Kecelakaan tersebut terjadi di Jalan Perdagangan-Bandar Tinggi km 12-13, Nagori Lias Baru saat dia mengendarai sepedamotor jenis Honda Astrea 800 BK 2099 MK. Informasi dihimpun METRO, saat itu Karibun mengendarai sepedamotornya ke arah Bandar Tinggi dengan kecepatan tinggi dan melaju terlalu ke tengah. Selanjutnya sebuah

sepedamotor jenis Honda Legenda BK 5564 EN yang dikemudikan Muhammad Halim (18) warga Nagori Bandar Silou, Kecamatan Bandar Masilam, datang dari arah berlawanan. Warga yang menyaksikan kejadian mengatakan, lampu

„) Baca Usai..Hal 7

Rumah Partonun

Simalungun. Namun naas, saat berada di depan SMAN 5, tiba-tiba dari dalam gudang tempat pengambilan tanah keluar truk nomor polisi B 9164 GJ. Terkejut atas kedatangan truk dan tak mampu mengelakkan truk tersebut, akhirnya korban yang mengendarai Mio Soul BK 3374 WY berwarna merah hitam tertabrak truk tersebut. Selanjutnya, A Sitorus (40) salah seorang warga yang berada di warung tak begitu jauh dari TKP langsung

DIBAKAR Pagi-pagi Buta Sebelumnya Dapat Teror SMS

„) Baca Usai..Hal 7

Ayah Pemerkosa Putrinya Ditangkap SIMALUNGUNPelarian Egan alias Sidabutar (40) kandas. Pemerkosa gadis di bawah umur, sebut saja Melati (11), yang juga putri kandungya ditangkap di Jorlang Hataran Simalungun, Kamis (26/4) sekitar pukul 24.00 WIB. Informasi dihimpun METRO, penangkapan Egan dilakukan petugas Polres Asahan Unit Pelayanan Perempuan dan Anak (PPA). Di mana, se-

Skandal

jak dilaporkan oleh istrinya karena memerkosa putrinya sejak umur 7 tahun, pelaku melarikan diri. Kasat Reskrim AKP Fahrizal mengaku pihaknya masih melakukan pemeriksaan terhadap pelaku pemerkosa putrinya. “Berdasarkan keterangan korban dan saksi-saksi serta hasil visum, besar dugaan tersangka melakukan perbuatan itu,” kata Fahrizal.Sementara Egan alias Sidabutar ketika dit-

„) Baca Ayah ..Hal 7

Arnold Schwarzenegger

Punya Anak dari Stafnya SATU per satu skandal Arnold Schwarzenegger terkuak. Bintang film Terminator itu ternyata memiliki anak dari staf rumah tangganya. Hal itu terkuak dari istri Arnold yang saat ini mengajukan gugatan cerai, Maria Shiver. Seperti dikutip TMZ, Maria mulai merampungkan proses perceraian dan berkonsultasi dengan penasihat keuangan. Lebih parahnya lagi,

„) Baca Punya ..Hal 7

Foto: Ist

„ Tersangka pembawa ganja dan barang bukti saat diinterogasi Kapolsek Binjai Timur.

Terlilit Utang, PNS jadi Kurir Ganja Barang Bukti 35 Kg BINJAI- Niat M Lepiah (51) mendapatkan uang untuk membayar utang dengan menjadi kurir ganja berhasil digagalkan petugas dari Polsek Binjai Timur. Pria yang juga PNS Dinas Pertanian di Aceh ini ditangkap membawa 35 kg ganja dengan mengendarai mobil Suzuki BK 1013 KO di Jalan Ringroad, Kelurahan Sumber Rejo, Kecamatan Binjai Timur, Jumat (27/4) sekira pukul 11.45 WIB. Aksi warga Dusun Bahagia, Desa

MENJALA, 2 Sekawan Hilang di Sungai TAPSEL- Dua sekawan, Juned (27) dan Andi (28) menghilang di Sungai Batang Toru, Kecamatan Batang Toru, Kabupaten Tapanuli Selatan (Tapsel), sejak Rabu (25/4) sekira pukul 17.18 WIB. Hingga kemarin, Jumat (27/4), keduanya

Dalam, Kecamatan Karang Baru, Kabupaten Aceh Tamiang ini sebelumnya telah diketahui polisi yang mendapatkan informasi. Tak ingin buruannya hilang, pasukan yang dipimpin Kanit Reskrim Ipda Rudi Lepian pun menghambat mobil tersebut saat melintas. Setelah memastikan jika benar ciriciri mobil yang dikabarkan oleh seorang informan membawa

ganja melintas di Jalan Ringroad, tepatnnya di sebelah rel perlintasan kreta api, Rudi Lapian langsung menyuruh anggotannya menyelip mobil tersangka dengan mobil patroli yang sudah berjaga-jaga. Bak film laga di tv, mobil yang diselip langsung berhenti. Petugas pun menyebar dan mengepung tersangka. Saat itu ada dua wanita di dalam mobil. Mereka kemudian menyuruh sopir dan penumpang turun

SIANTAR- Rumah Nursahat boru Sibuea (80) di Jalan Melanthon Siregar, Kelurahan Marihat Jaya, Siantar Marimbun, Jumat dini hari (27/4) sekitar pukul 03.15 WIB dibakar oleh orang tak dikenal. Beruntung api cepat dipadamkan oleh pemilik rumah yang bekerja sebagai penenun ulos ini. Peristiwa adanya api di pintu depan rumahnya diketahui pertama kali oleh putri korban bernama Irmawati (30). Saat itu orang yang tinggal di dalam rumah hanya 4 orang, yakni Nursahat, Irmawati (putrinya), Patimah dan Seri, yang keduanya adalah anak kos korban yang berkerja sebagai tukang tenun. Ketika itu, Irmawati seperti mendengar sesuatu yang jatuh di samping rumahnya. Namun ia tidak tahu asal suara tersebut. Dan beberapa saat kemudian, ia mendengar suara seperti membalikkan meteran listik dan seketika itu juga listrik di rumah dia padam yang mengakibatkan rumah tersebut gelap gulita.

„) Baca Rumah..Hal 7

„) Baca Terlilit ..Hal 7

belum juga ditemukan. Diduga, mereka terpeleset lalu hanyut saat menjala ikan. Informasi yang dihimpun METRO dari Kapolsek Batang Toru Gunawan Pane mewakili Kapolres Tapsel AKBP Subandriya, menyebutkan, dari keterangan sejumlah saksi, saat itu Juned (27), warga Karang Moncol, Desa Bandar Hapinis, Kecamatan Muara Batang Toru, Tapsel bersama temannya

„) Baca Menjala,..Hal 7

Foto: Fahmi

„ Nursahat boru Sibuea pemilik rumah yang nyaris di bakar otk.


SABTU

28 April 2012

Besok, Temu Kader Nasdem

Pematangan Restorasi Indonesia SIANTAR- Besok, Minggu (29/4) dilaksanakan temu kader Partai Nasdem Kota Pematangsiantar dalam rangka pematangan restorasi Indonesia. Ketua DPD Nasdem Siantar, Lingga Napitupulu, kemapad METRO< Jumat (27/4) kemarin mengatakan, pertamuan tersebut akan dilaksanakan di Balai Rahmat Shah, Minggu pukul 14.00 WIB. Lingga Dia menambahkan, temu kader Nasdem tersebut dihadiri Ketua Badan Hukum DPP Nasdem, Edi Syahputra SH MH, juga dihadiri DPW Sumut, Haji Ali Umri., DPD dan DPC se-

Jembatan Sipef Terancam Rubuh Total GUNUNG MALELA- Kondisi jembatan Sipef di Jalan Asahan km 20,5 Nagori Pematang Sahkuda, Kecamatan Gunung Maligas, Simalungun sudah semakin parah. Dasar dan tepi jembatan kini telah amblas dan dikhawatirkan akan rubuh total dalam waktu dekat. Puing-puing bangunan jembatan ini yang jatuh ke sungai pun membuat irigasi tersumbat. Karenanya, warga Huta II turun ke sungai untuk membersihkan puing-puing bangunan dasar jembatan yang terkikis karena tergerus air hujan. Firman Sipayung (38), warga Nagori Pematang Sahkuda, ketika ditemui METRO, Jumat (27/4) mengatakan, tepi jembatan Sipef ini amblas karena hujan yang terus-menerus

Baca Pematangan ...Hal 10

Baca Jembatan ...Hal 10

Bah Bolon Dibersihkan

(F:METRO/IST)

MTQ- Plt Gubsu H Gatot Pujo Nugroho bersama Walikota Hulman Sitorus SE memberangkatkan Kafilah MTQN Siantar ke MTQN ke-33 Tingkat Sumut.

MTQN Siantar Diberangkatkan Plt Gubsu

Perkokoh Ketahanan Mental SIANTAR- Kafilah MTQN Kota Pematangsiantar akan bertarung pada MTQN ke-33 tingkat Sumatera Utara (Sumut) 2012 yang dilaksanakan di Serdang Bedagei (Sergai) pada 27 April hingga 5 Mei. Para Kafilah ini langsung diberangkatkan oleh Plt Gubsu H Gatot Pujo Nugroho, Jumat (27/4) di ruang data balai kota.

layaknya kesehatan balita berusia 1-5 tahun. Dinkes juga mengimbau orangtua agar mendukung program utama Dinkes ini, yakni memberantas gizi

SIANTAR- Aksi bersih Bah Bolon dilaksanakan di Jalan Simbolon, Kelurahan Teladan, Siantar Barat, Jumat (27/4) sekira pukul 10.00 WIB. Aksi bersih memungut sampah di pinggir sungai, pengambilan sampel air dan penanaman pohon trembesi dipinggir Bah Bolon. Penanaman pohon trembesi di pinggir Bah Bolon oleh Walikota Siantar Hulman Sitorus diwakili Staf Ahli Pembangunan Adiaksa Purba. Selanjutnya mewakili generasi muda, salah satu pelajar SD di Kota Siantar dihunjuk menanam pohon. Kemudian para undangan dan peserta kegiatan yang berasal dari berbagai latar belakang profesi juga melakukan penanaman pohon. Kepala Badan Lingkungan Hidup (BLH) Kota Siantar Jekson Gultom menyebutkan, tujuan aksi bersih Bah Bolon ini untuk mengetahui kualitas air Bah Bolon saat ini, terutama tingkat pencemarannya. Aksi bersih Bah Bolon ini merupakan bagian dari program Kementerian Lingkungan Hidup dalam program kali bersih (Prokasih). â&#x20AC;&#x153;Sebenarnya, berdasarkan penelitian yang

Baca Pohon ...Hal 10

Baca Bah Bolon ...Hal 10

( FOTO : LAZUARDY FAHMI )

PAKIAN ADAT SIMALUNGUN : Plt Gubernur Sumatera Utara saat dipakaikan gotong pakaian adat Simalungun dalam acara Dies Natalies Himapsi ke-34 di Audotorium USI, Jumat (27/4).

Gatot Ajak Pemuda Berbenah Diri Perayaan Dies Natalis Himapsi ke-34 SIANTAR- Plt Gubernur Sumut H Gatot Pujo Nugroho mengharapkan Himpunan Mahasiswa dan Pemuda Sima-

lungun (Himapsi) menjadi agen perubahan. Karenanya, para pemuda dan mahasiswa diajak berbenah untuk mencapai jati diri masing-masing sebagai seorang pemuda dan mahasiswa. â&#x20AC;&#x153;Pemuda dan mahasiswa merupakan

sebuah semangat menuju masa depan. Pemuda dan mahasiswa harus mampu menjadi calon pemimpin. Kita sepakat bahwa mahasiswa dan pemuda adalah

Baca Gatot ...Hal 10

Baca Perkokoh ...Hal 10

Mari Bersama-sama Atasi Gizi Buruk SIMALUNGUN- Sebanyak 11 penderita gizi buruk di Kabupaten Simalungun berhasil diobati oleh Dinas Kesehatan Simalungun. Saat ini kondisi kesehatan para balita itu sudah normal kembali sebagaimana

(FOTO: EDI SARAGIH)

BONGKAR BIBIT-Heru Sitepu bersama beberapa pegawai BPBD Kota Siantar memuat bibit manggis sebelum dibagikan

Pohon Manggis Cocok Ditanam di DAS SIANTAR- Bibit pohon manggis sangat cocok ditanam di daerah aliran sungai (DAS) di Kota Pematangsiantar dan sekitarnya. Selain akarnya ber-

fungsi menahan tanah, buah pohon manggis dapat menjadi pemasukan

Baca Pohon ...Hal 10

(FOTO:IMELDA PURBA)

Regional Head, Jefri Butar-butar didampingi Sales area manager, Wandes Samosir memberikan pengarahan tentang produk Smartfren, Jumat (27/4)

Galeri Smartfren Diresmikan

Gratis Seumur Hidup SIANTAR- Sebagai penyedia layanan telekomunikasi berbasis teknologi canggih EVDO, Smartfren kini hadir di Kota Siantar. Peresmian galeri Smartfren yang dibuka Walikota Siantar Hulman Sitorus, Jumat (27/4) merupakan wujud komitmen untuk terus berinovasi dan memperluas jaringan dan memenuhi kebutuhan masyarakat. Regional Head Smartfren, Jefri Batubara didampingi Wandes Samosir mengatakan, Smartfren merupakan operator CDMA yang tidak mengganti nomor

Baca Gratis ...Hal 10


SABTU

28 April 2012

Pematangan Restorasi Indonesia

Gratis Seumur Hidup Sambungan Halaman 9 registrasi ketika ke luar kota. “Sesama pengguna Smartfren diberlakukan gratis nelpon seumur hidup tanpa biaya. Bahkan Smartfren berani hadir serta menjadi operator anti lambat atau sesuai slogannya, anti lelet,” ungkapnya. Lebih lanjut ia menerangkan, sesuai dengan logonya, yakni mata dan telinga, Smartfren digunakan dengan audio dan visual tanpa batas. Bahkan Smartfen terus menjawab kebutuhan masyarakat dengan menghadirkan produkproduk terbarunya di tengah masyarakat. Produk tersebut, antara lain HP XStream EVDO yang dapat digunakan untuk streaming YouTube. Kemudian USB Modem Smartfen CE 682 seharga Rp199 ribu, HP Enduro yang bisa standby Rp700 jam setta Blackberry 8330 seharga Rp600 ribuan. “Galeri Smartfren ini didirikan untuk memberikan yang terbaik pada masyarakat dalam hal pengetahuan di dunia teknologi. Bahkan untuk mempermudah layanan, serta pemahaman masyarakat bisa datang langsung ke galeri di Komplek Megaland Jalan Asahan,” paparnya. Menurutnya, untuk menyemarakkan peresmian galeri tersebut, mereka juga menggelar kegiatan di lapangan parkir pariwisata bertajuk ‘petualangan kwik’. Petulangan kwik ini dilangsungkan Sabtu, (28/4) yang diikuti pelajar, komunitas, serta masyarakat. Selaian menyediakan bazaar, mereka juga melaksanakan konvoi, dancer, musik dan UMKM serta kuliner. “Ini merupakan cara untuk melakukan pendekatan pasar melalui strategi edukasi, khusunya dalam membangun kesadaran tentang manfaat teknologi inovatif dari Smartfren. Kami akan tetap berusaha menghadirkan kualitas jaringan yang lebih luas dan lebih baik,” jelasnya. Sementara itu Walikota Siantar, Hulman Sitorus SE mengucapkan selamat kepada Smarfren yang memberikan perluasan. “Di dunia modern sekarang, telekomunikasi yang canggih sudah semakin dibutuhkan dan berharap Smartfren dapat menjawab semua itu lewat produknya,” kata walikota. (mua/ara)

Gatot Ajak Pemuda Berbenah Diri Sambungan Halaman 9 agen perubahan dan Himapsi merupakan wadahnya,” kata Gatot pada acara Dies Natalies ke-34 Himapsi, Jumat (27/4) di Auditorium Universitas Simalungun. Lebih lanjut Gatot mengatakan, mahasiswa dan pemuda harus memiliki kemampuan membangun jaringan. Melalui jaringan yang dibuat ini, diharapkan akan muncul sebuah perubahan. Untuk itu, pembenahan diri sangat dibutuhkan untuk mencapai jati diri masingmasing sebagai mahasiswa dan pemuda. “Pemuda harus mampu memotivasi dan mengajak masyarakat Simalungun untuk bangga akan jati diirnya sebagai warga berkebudayaan dan memiliki intelektual,” katanya. Politisi dari Partai Keadilan Sejahtera ini juga menjabarkan sejarah asal usul keragaman di Simalungun, di mana warga Simalungun sebahagian besar berasal dari Hindia Selatan dan suku-suku di sekitarnya. Hal ini membuktikan terjadinya kulturasi budaya. Sehingga peran pemuda untuk menyesuaikan diri tanpa hanyut dalam kulturasi sangat diperlukan. Pemuda dan mahasiswa harus berpengaruh, baik untuk Simalungun secara khusus maupun Sumatera Utara secara umum, dan bangsa tercinta ini. Menurut Gatot, Sumut merupakan contoh keberagaman yang terjaga baik di Indonesia bagian barat, terutama di Pulau Sumatera. Sehingga perlu mempertahankan kemandirian dan kekayaan budaya ini sebagai wujud kecintaan atas tanah leluhur ini. “Peran mahasiswa dan pemuda yang tergabung dalam Himapsi tidak mentok hanya sebatas organisasi formil. Namun harus mampu membaurkan diri kepada organisasi-organisasi lain,” jelasnya. Hadir dalam acara Dies Natalis itu Walikota Siantar Hulman Sitorus dan beberapa pejabat Pemko, Bupati Simalungun JR Saragih diwakili Kadis Perkebunan Amran Sinaga, Pendiri Himapsi Januarison Saragih, Ketua DPP Himapsi Sarmuliadin Sinaga, dan pengurus dan tokoh Himapsi lainnya. (ral/ara)

Sambungan Halaman 9

(FOTO: LAZUARDY FAHMI)

JALAN BERLUBANGPengendara sepedamotor sedang melintas di jalan berlubang yang berada di Jalan Rangkuta Sembiring, Jumat (27/4).

Sumatera Utara. “Selain itu Ketua DPD Nasdem Tebing Tinggi juga akan ikut dalam acara temu kader Nasdem tersebut,” kata Lingga Napitupulu. Dalam temu kader itu juga nantinya akan dihadiri kader-kader, masyarakat dan ormas Nasdem. Dia menjelaskan, dalam pertemuan tersebut akan dibahas makna sesungguhnya restorasi. “Selain itu juga dibicarakan persiapan menjelang verifikasi KPU untuk tahun 2014. kita harapkan semua undangan hadir pada acara tersebut,” kata Lingga mengakhiri. (ara)

Jembatan Sipef Terancam Rubuh Total Sambungan Halaman 9 turun. Katanya, jika tak diperbaiki segera, kemungkinan dalam waktu dekat jembatan akan rubuh total. Poniran (43), warga sekitar jembatan

mengatakan, amblasnya tepi dan dasar jembatan ini terjadi pada Jumat (27/4) sekira pukul 07.00 WIB. Hal diketahui warga ketika warga ini akan mengantarkan anaknya sekolah. ”Tadi pagi saya dengar ada suara

keras dari jembatan. Ternyata dasar dan tepi jembatan itu saja yang amblas,” katanya. Bahkan, longsoran ini telah mengakibatkan Misnan, warga sekitar, kehilangan tanahnya sekitar 15 m2.

Mari Bersama-sama Atasi Gizi Buruk Sambungan Halaman 9 buruk di Simalungun. Kepada METRO, Jumat (27/4) Kepala Dinas Kesehatan Simalungun dr Saberina Tarigan MARS mengatakan, ada 40 penderita gizi buruk di Kabupaten Simalungun dan penderitanya rata-rata berusia 1-5 tahun. Selama 2012 sebanyak 11 orang yang berhasil diobati atau sekitar 30 persen dari jumlah pengidap gizi buruk di Kabupaten Simalungun. “Sebelas pengidap gizi buruk sudah pulih menjadi gizi baik. Keberhasilan itu berkat kerja keras bidan-bidan desa yang rutin mengecek kesehatan si penderita dan pemberian makanan tambahan (PMT) berupa makanan 4 sehat 5 sempurna,” ujarnya. Saberina menyampaikan, penyebab utama gizi buruk adalah sikap orangtua yang sering meninggalkan anaknya dan tak memberikan perhatian. Katanya, di Kabupaten Simalungun rata-rata masyarakatnya bekerja sebagai petani. Ibu si anak pergi ke ladang, sedangkan anaknya ditinggal di rumah. Otom-

atis selama seharian si anak tidak mendapat perhatian dari orangtuanya, seperti air susu ibu, makanan selayaknya untuk balita, dan kasih sayang. “Biasanya di Kabupaten Simalungun ibunya pergi ke ladang dan anaknya ditinggal di rumah. Hal itu membuat si anak jarang mendapat perhatian dan tidak sempat lagi membawa anaknya ke posyandu,” ungkapnya. Agar anak tidak sempat mengidap penyakit gizi buruk, lanjut Saberina, anak harus rutin ditimbang selama masih balita antara 1-5 tahun. Dengan rutin menimbang anak ke posyandu, bisa diketahui perkembangan berat badan si anak. “Kalau terus-menerus ditimbang dan mengalami penurunan berat badan, itu membuktikan anak sudah mulai terkena gejala gizi buruk. Memang membuat anak sehat bukan pekerjaan ringan, namun harus dilakukan demi kesehatan anak,” tegasnya. Masih kata Saberina, pihaknya terus menggalakkan sosialisasi penanggulangan gizi buruk serta penanganan-

nya. Dinkes Simalungun saat ini mendapat bantuan berupa PMT untuk 18 orang penderita gizi buruk yang biayanya dialokasikan untuk 90 hari. “Mengobati penderita gizi buruk merupakan program utama Dinkes Simalungun. Diupayakan sampai tahun ini penderita gizi buruk bersih di Simalungun. Melalui bantuan dari Badan Ketahanan Pangan dan PKK Simalungun, secepatnya penderita gizi buruk sudah tidak ada lagi,” harapnya. Menurutnya, penanganan gizi buruk di Simalungun merupakan swadaya kepedulian karena tidak ada dianggarkan dari APBD Pemkab Simalungun. Meskipun tidak dianggarkan untuk penanggulangan gizi buruk itu, Saberina mengatakan tidak membuat Dinas Kesehatan tidak peduli dengan kesehatan masyarakat Kabupaten Simalungun. “Dengan swadaya kepedulian dan sadar diri masyarakat gizi buruk bisa tertanggulangi. Sudah dibuktikan, sebanyak 11 orang sudah kembali sehat dari gizi buruk,” tegasnya. (osi/ara)

Para warga juga mengaku kecewa atas sikap cuek Pemkab Simalungun dan pihak perkebunan Sipef atas kerusakan ini. “Padahal, katanya, truktrukbertonaseberatyangmengangkut sawitselalumelewatijembatanini,dan

truk-truk ini merupakan penyebab utama rusaknya jembatan. “Kalau jembatan ini runtuh, aktifitas dari Siantar-Perdagangan akan lumpuh total. Ini harus segera diperbaiki,” tuntut warga. (mag-02/ara)

Bah Bolon Dibersihkan Sambungan Halaman 9 kita lakukan, sumber pencemaran utama Bah Bolon di Kota Siantar berasal dari sampah rumah tangga. Bisa berupa tinja, plastik dan berbagai sampah buangan masyarakat lainnya. Dari limbah pabrik memang ada, tetapi lebih banyak dari limbah rumah tangga,” jelas Gultom. Karenanya, Jekson mengimbau kepada seluruh warga Siantar yang menetap dan bertempat tinggal di sekitar Bah Bolon agar tidak membuang sampah dan lainnya ke sungai. Selama ini hampir seluruh warga di pingggiran Bah Bolon membuang limbahnya ke sungai. “Khusus kepada perusahaan-perusahaan yang ada di sekitar Bah Bolon, supaya memproses limbahnya dulu sesuai IPAL sebelum dibuang ke Bah Bolon,” jelasnya. Untuk mengetahui kualitas air dan tingkat pencemaran air yang terjadi di

Bah Bolon, selain pengambilan sampel di Kelurahan Teladan Siantar Barat, sebagai kawasan tengah Bah Bolon, sampel air Bah Bolon juga akan diambil di hulu dan hilir. Pada hulu dan hilir Bah Bolon dimaksud berada pada perbatasan antara Kota Siantar dan Kabupaten Simalungun. Selain BLH, terlihat hadir pada acara ini beberapa LSM lingkungan seperti GOA dan beberapa lainnya. Selain itu, ikut dilibatkan komunitas guru pecinta lingkungan (green teacher), siswa dan beberapa pejabat dari Pemko Siantar, serta pelaku usaha yang membuang limbahnya ke Bah Bolon. “Aksi seperti ini akan terus kita lanjutkan dan kita laksanakan secara berkala. Mungkin ke depan akan kita pikirkan untuk bisa memanpaatkan Bah Bolon dalam hal lain seperti arung jeram atau lomba perahu,” jelasnya. (ral/ara)

Pohon Manggis Cocok Ditanam di DAS Sambungan Halaman 9 bagi yang menanamnya. Kepada Badan Penanggulangan Bencana Daerah (DPBD) Kota Siantar Ir Reinward Simajuntak melalu Heru Sitepu, kepada METRO, Kamis (26/4) di sela-sela pembagian bibit pohin manggis di Kelurahan Sumber Jaya Kecamatan Siantar Martoba mengatakan, dalam upaya menyelamatkan lingkungan, terutama untuk daerah lahan kritis, Pemko Siantar membagikan berbagai bibit pohon kepada masyarakat untuk ditanam di pekarangan rumah atau di lahan yang rentan terjadi longsor, terutama daerah aliran sungai.

“Di antara bibit yang dibagikan adalah bibit manggis, selain akan menyelamatkan lahan kristis dari bahaya longsor, dalam jangkapanjangpohonmanggisakanmenghasilkanbagimasyarakat,”kataHeruSitepu. Dia menjelaskan, ada sekitar 500 bibit manggisyangdibagikankepadamasyarakat diKelurahanSumberJaya.Bibitinidiharapkan ditanamsertadirawatolehpenerimakarena akanmenghasilkanpadawaktunya. “Banyak bibit pohon yang dibagikan tidak dirawat, bahkan mati sebelum besar. Alasannya, pohon yang ditanam tidak menghasilkan kepada masyarakat, hanya menghasilkan batang kayu, yang menurut masyarakat tidak menjadi miliknya jika besar kelak,” katanya. (esa/ara)

Perkokoh Ketahanan Mental Sambungan Halaman 9 Dalam sambutannya, GatotGatot mengatakan, MTQ yang akan diikuti peserta sangat positif dan berdaya guna juga sebagai salah satu upaya peningkatan keimanan, kecintaan kepada Allah SWT, serta untuk mengasah keterampilan, pemahaman dan implementasi kehidupan spiritual masyarakat dalam memperkokoh ketahanan mental saat kita dihadapkan pada tantangan krisis multidimensi. “Saya mengucapkan selamat kepada seluruh kafilah yang mendapatkan kepercayaan mewakili Kota Pematangsiantar ke tingkat Sumut. Saya berharap, semoga meraih sukses dan bisa menjadi juara,” harapnya.

Selanjutnya Walikota Pematangsiantar Hulman Sitorus SE juga menyampaikan, kafilah yang diberangkatkan merupakan qori-qoriah terbaik dari Kota Pematangsiantar dari hasil seleksi MTQ di tingkat kota beberapa waktu lalu. “Sebagai qori-qoriah yang terpilih, tentunya terpikul suatu tugas yang berat dalam rangka membawa nama baik Pematangsiantar di MTQN ke-33 tingkat Sumut di Sergai. Tunjukkan kemampuan semaksimal mungkin dengan terus menjaga kondisi, stamina, dan kesehatan selama mengikuti MTQN agar bisa menjadi yang terbaik,” harap Hulman. Sebelumnya, ketua panitia sekaligus ketua rombongan kaf-

ilah Asisten I Djumadi SH melaporkan, jumlah kontingen MTQ Kota Pematangsiantar yang akan berlaga di MTQN Sumut ke-33 sebanyak 40 peserta. Sebanyak 30 peserta mengikuti perlombaan dan 10 orang adalah official. “Mereka akan mengikuti 8 cabang, antara lain cabang Tilawah, Tahfiz, Fahmil Quran, Syahril Quran, Khattil Quran,Tartil Quran, dan karya ilmiah,” terang Djumadi. Sementara, Kabag Humas Drs Daniel Siregar menjelaskan, kafilah MTQ Kota Pematangsiantar sebelum bertanding telah mendapat pembinaan melalui technical meeting selama 3 hari di Pematangsiantar dan Kota Medan.

Bupati Harapkan Kekompakan Bupati Simalungun JR Saragih diwakili Ketua Umum Lembaga Penelitian Tilawatil Quran (LPTQ) Kabupaten Simalungun Ir H Djadiaman Purba juga memberangkatkan kontingen peserta MTQ dari Kabupaten Simalungun secara simbolis di eks rumah dinas bupati Jalan Perintis Kemerdekaan Pematangsiantar. Dalam bimibingan dan arahannya, bupati mengatakan kepada official dan semua peserta agar berupaya dan berjuang secara maksimal serta berdoa meraih juara dan menjaga nama baik Kabupaten Simalungun. Bupati juga berharap kepada official dan peserta agar selalu menjaga kekompakan, selalu

berkoordinasi dan memperhatikan disiplin serta menjaga kesehatan selama mengikuti MTQ. Kepala Kantor Kementerian Agama Kabupaten Simalungun Drs H Muslim Lubis MM yang turut memberangkatkan perserta tersebut berharap kepada seluruh peserta yang diutus agar dapat berprestasi untuk membawa nama baik Kabupaten Simalungun. Ketua kontingen MTQ dari Kabupaten Simalungun Drs H Nasril Jambak menerangkan, jumlah peserta yang diutus sebanyak 23 orang untuk mengikuti cabang Mujawad golongan dewasa, remaja dan anak-anak, Tahfiz Quran, Syarhil Quran, Fahmil Quran dan cabang Khattil Quran dan akan didampingi 6 orang official. (mer/rel/ara)


SABTU

28 April 2012

Perempuan Meksiko

Mengandung 9 Bayi

(int)

DUA VAGINA: Hazel Jones memiliki dua vagina yang ditawari bermain film porno.

GADIS DUA VAGINA

Ditawari Main Film Porno LONDON-Hazel Jones (27), perempuan yang didiagnosis medis memiliki dua vagina, dua rahim, dan dua cervix ini tiba-tiba saja menjadi sangat terkenal. Ketenaran Hazel Jones juga menyedot perhatian Steven Hirsch, pemilik Vivid Production, perusahaan film pornografi Amerika Serikat. Menurut TMZ.com, Hircsh sangat tertarik dengan perempuan berambut pirang yang berasal dari High Wycombe ini. Bahkan, Hircsh secara khusus mengirimkan surat yang berisi tawaran terhadap Hazel Jones sebesar 1 juta dollar AS. Hircsh berharap Jones bersedia membintangi salah satu film porno produksinya. “Anda (Hazel Jones) jelas seorang wanita luar biasa, dan saya ingin menawarkan peran yang menantang dalam salah satu film produksi Vivid. Kami akan membayar jasa Anda 1 juta dollar AS,” tulis Hircsh. Dalam surat tersebut, Hirsch juga berjanji akan menanggung seluruh biaya akomodasi dan semua fasilitas kelas satu seperti yang dinikmati para

selebriti di Los Angeles. “Kami akan menanggung seluruh biaya perjalanan dan akomodasi Anda selama berada di Los Angeles dengan fasilitas kelas utama,” tulis Hirsch. Steven Hirsch adalah pendiri Vivid Production, perusahaan yang memproduksi film-film dewasa yang menggunakan jasa selebriti papan atas. Beberapa selebriti yang menjadi bintang Vivid Production adalah Pamela Anderson, Tommy Lee, dan Kim Kardashian. Namun hingga saat ini, Hazel Jones belum menanggapi tawaran Steven Hirsch. Hazel Jones mengatakan kepada ITV, dia merasa nyaman dengan kondisinya. “Saya tidak perlu malu dengan kondisi saya. Akan saya perlihatkan kepada masyarakat—secara medis —tentang kelainan saya. Jika para wanita ingin mengetahui tentang kelainan yang saya derita, maka akan saya tunjukkan dan terangkan kepada mereka,” kata Jones kepada Holly Willoughby dan Phillip Schofield, pembawa acara ITV. (kps)

„ Ilustrasi (int)

BERFOTO: Margareta Winberg berfoto bersama para elite pengambil kebijakan lingkungan Swedia setelah ia secara keliru diundang ke perjamuan makan malam para elite itu.

WARGA TERKEJUT

Diundang Petinggi Swedia Tak Lewat Pos dan Alamat STOCKHOLM-Ketika Margareta Winberg mendapat undangan Pemerintah Swedia untuk menghadiri sebuah jamuan malam resmi, ia merasa tersanjung walau sedikit terkejut. Namun, karena ia menerima undangan itu melalui pos, dengan nama dan alamatnya tercantum di atasnya, dia tidak begitu khawatir tentang tujuan makan malam tersebut. Pensiunan berusia 67 tahun itu, yang berasal dari Sundbyberg di pinggiran kota Stockholm, tidak pernah bekerja untuk pemerintah. Namun, ia berpikir bahwa undangan itu mungkin ada hubungannya dengan

DAIHATSU PAKET MURAH 100% YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 / bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari YAYASAN MAHAGA SEJAHTERA: membutuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515 1742 DIBUTUHKAN SEGERA: Tenaga kerja wanita usia 17-40 Tahun dengan posisi sbb:Baby Sister,Perawat jompo/Pribadi,PRT,syarat fc.ijazah,ktp,KK,gaji bersih 700rb s.d 1.500rb/ bulan+bonus+THR,makan,asrama,dijemput loket,gratis.hub YYS Marel Mandiri.JL.Cengkeh Raya No 18.C Medan HP 0813 6199 9211: 0878 6968 7879.

BARU SUZUKI ERTIGA Suzuki Ertiga, 7 Penumpang (3 baris) 1400cc DP 10% atau bunga 3,220% mulai Rp. 150Jt-an Ready Stock : carry Pick Up Dp. Rp. 13Jt Angs Rp. 2Jt-an APV Pick up Dp. Rp. 18Jt Angs Rp. 2Jt-an APV Arena Dp. Rp. 17Jt Angs Rp. 3Jt-an Hub: PT. Trans Sumatera Agung, Ricky HP 0812 6570 683 Ikuti Test Drive Berhadiah Suzuki Ertiga

NEW NISSAN: Grand Livina, Nissan Juke, Nissan X-Trail, Navara, Murano. Ready Stock. Cash/Credit Hub. Wandi 0813 61400 0058, 061-7770 9408

TOYOTA SIANTAR

• All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya

DP Angsuran • Xenia 12.750.000 3.125.000 • Terios 15.000.000 4.090.000 • Luxio 19.100.000 3.961.000 • Pick up 9.000.000 2.432.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0878 9228 2993. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio

Suzuki 100 % BARU : APV Arena : Angsuran 135 ribu Carry pick up : Angsuran 83 ribu APV pick up : Angsuran 86 ribu Ertiga pic up : Angsuran 137 ribu Info dan pemesanan hub. RADOT (Sales Executive) HP 0852 6109 7775

GEBYAR MITSUBISHI BARU READY STOCK:

• T120SS • L300 • Colt Diesel • Pajero Sport/Dakar • Triton Strada Diskon kandas + Cash back, Dp. Ringan, Angsuran murah, Hub: 0813 6222 3889 ERIC SARAGI, sales Executive Medan

CAPELLA PEMATANGSIANTAR • All New Xenia Ready stok • Terios Ready stok • Luxio Dp 15% (hadiah menarik) • Sirion Dp 15 % • Pick up Dp 15 % • Mini Bus Dp 15 % hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Proses cepat data dijemput. Menyediakan TEST DRIVE!! ASTRA DAIHATSU PROMO: Ready : Xenia, Terios, Pick Up & GranMax Minibus. Proses cepat/bunga ringan!! Hub: Edy, 061-7772 3699 / 0819 851 688

READY STOCK! • Carry pick up New Hitam • Gran Max Pick Up New Hitam NB: Bisa kredit dan tukar tambah. Hubungi: 0622 - 7436198

PR OMO TOYOTA B AR U PROMO BAR ARU

· All New Avanza ..Ready Stock ! Bonus Lengkap ! · All New Avanza VELOZ ... Bonus Lengkap !! · YARIS...Ready Stok,Diskon besar, Buruan !! · New Rush ..... Ready Stok !! · Grand New Innova .... Ready Stock !! · Grand New Fortuner ... Ready Stock !! · Hilux S-Cab/D-Cab .... Bensin/Diesel !! HUB. HUB. RICKY. M - 0853 7199 9499- 0812 6505 3191 SALES EXECUTIVE TOYOTA SIANTAR. Data dijemput, Cash/Credit PROSES CEPAT..!!

pekerjaannya dulu sebagai asisten terapi okupasional.”Namun, saya tidak berpikir terlalu banyak tentang hal itu dan saya juga tidak tahu banyak tentang makan malam tersebut. Hanya saja, saya diundang dan bahwa itu ‘tentang lingkungan’,” katanya, Jumat (26/4). Jadi, saat tanggal makan malam itu—untuk menandai pembukaan sebuah konferensi lingkungan—tiba, Nyonya Winberg berdandan dan menampakkan dirinya di kompleks kantor Pemerintah Swedia di Rosenblad. Barulah ketika itu para pejabat menyadari kekeliruan karena

TOYOTA 100% BARU

• New Avanza....Ready, buruan !!! • Rush...Dp. Ringan • Innova....Ready!!! • Fortuner....Ready!!! • Yaris...Bonus paling lengkap!! • Truck Dyna, dll Hub: 0813 7597 9007 / 0821 6620 6007 Andre Toyota Medan - Sales Executive. Data dijemput, mau proses yg cepat disini tempatnya

undangan itu seharusnya ditujukan untuk mantan wakil perdana menteri, menteri pertanian, dan duta besar untuk Brasil— yang kebetulan memiliki nama yang sama.Yang muncul bukan mantan menteri dan diplomat Margareta Winberg. Yang berdiri di depan mereka justru mantan asisten terapi okupasional Margareta Winberg. Sadar telah melakukan kesalahan, tuan rumah acara itu, Menteri Lingkungan Lena Ek, berusaha mengendalikan keadaan. Nyonya Winberg diantar ke tempat duduk yang telah disiapkan untuk “dia” dan diperkenalkan kepada tamu-tamu lain—

CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Rp DIJAUL: 1 unit mobil Suzuki Escudo Nomade, 200 jt, DP 50 jt, angsuran selama 10 thn + warna hitam coklat, tahun 1997, harga 90 jt Rp 2,2 jt per bulan, selama 15 thn + 1,8 jt (nego) tanpa perantara, yang berminat hub. per bulan, Jl.Pdt Wismar Saragih Gg HP 0852 7563 8768 Y br Saragih Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; CASH & CREDIT: Rumah type 45/104 genteng 08126207631; (0622) 7070442.

roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 tahun + Rp 16 jt per bulan selama 15 tahun + Rp 1,3 jt per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442.

CASH & CREDIT: Rumah tipe 36/42/45. Atap Multi roof, atap rangka baja ringan, dinding batu bata, gibsun, relief keramik. RUKO LANTAI 1 : Pondasi untuk 2 lantai atap cor, dinding batubata, dilokasi sedang dibangun Martoba Water park. PERUMAHAN BERSATU MAJU : Lokasi jl. Pdt. Wismar Saragih P. Siantar.Telp. 081370261747-085296029651-081361161011081362303662. CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 150 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan. Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Menyediakan rumah dan tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 42 Luas tanah 9x12 m, atap baja ringan dinding batu-bata, gimsum, relief lantai keramik, PLN., PDAM SHM, IMB dan KPR. PERUMAHAN SETIA NEGARA BARU : lOKASI JL. Pengintai Komp. setia negara IV Telp. 081370261747- 08529602965, 081361161011- 081362303662.

dengan penjelasan tentang apa yang sudah terjadi.Erik Bratthall, juru bicara pers Lena Ek, mengatakan kepada harian Swedia, Aftonbladet, “Ketika Lena menyadari kesalahan itu, dia melakukan semua yang dia bisa sehingga perempuan itu tidak akan merasa tidak nyaman.” Nyonya Winberg yang lain, yang menjadi sasaran undangan, kemudian menerima permintaan maaf dan dilaporkan menyebut kekeliruan itu sebagai humor yang baik. “Saya berharap orang bernama sama dengan saya itu menikmati makan malam yang indah,” katanya kepada media Swedia. (kps)

MEKSIKO CITY - Ketika sebagian perempuan harus menanti selama bertahuntahun untuk memiliki banyak anak. Namun, tidak begitu halnya yang terjadi dengan seorang perempuan asal Meksiko ini. Bagaimana tidak, perempuan Meksiko yang diketahui bernama lengkap Karla Vanessa Perez, saat ini dikabarkan tengah mengandung sembilan bayi sekaligus. Enam dari bayi yang dikandung itu berjenis kelamin perempuan sementara tiga lainnya laki-laki. Meski sangat antusias menyambut kehadiran bayi-bayinya tersebut. Namun, Perez mengaku ia belum menyiapkan nama untuk mereka. ”Masih terlalu dini untuk memikirkan nama bagi mereka. Yang terpenting adalah semuanya berjalan dengan lancar,” ujar Karla Vanessa Perez, Jumat (27/4). Perez yang saat ini tengah dirawat di sebuah rumat sakit di ibu kota negara bagian Saltillo menjelaskan, dokter memperkirakan ia akan melahirkan pada 20 Mei mendatang. Terkait dengan kehamilannya yang tidak biasa itu Perez mengatakan, selama ini ia memang rutin melakukan perawatan kesuburan. ”Ternyata melakukan perawatan kesuburan secara rutin mengarah pada kehamilan ganda,” ujarnya. (oz)

CASH & CREDIT: 10 x 21,8 m Rp 76 jt, 20 x 22 m Rp 154 jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT TANAH: 5 x 25 m Rp 25 jt, 5 x 20 m Rp 20 jt, cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Rp 95 jt, Dp 20 jt, angsuran selama 10 tahun + Rp 950 rb per bulan, selama 15 tahun + Rp 752 rb per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

DIJUAL TANAH: Luas 320 M2, SHM, PLN, PAM, pagar besi keliling, sangat strategis, sudah ada kios jualan, lokasi di Jl. Nias No. 3 C Kel. Toba, harga 180 jt (nego) hub. HP 0813 6218 4015

CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar. CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Rp 200 jt, Dp Rp 50 jt, angsuran selama 10 thn + 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan. Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar& CREDIT: 1.908 M2 Rp 300 jt, cocok CASH

untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT : Rumah tipe 36, tipe 42, Atap Multi roof, dinding batu bata , gimsum, relief lantai keramik. RUKO TIPE 40: Pondasi untuk 2 lantai, atap cor, dinding batu -bata, relief pintu besi , PLN, PDAM, SHM, IMB, dan KPR. PERUMAHAN BATU PERMATA RAYA : Lokasi Jl. Batu permata raya ujungkelurahan bah kapu.Telp. 081370261747085296029651-081361161011-081362303662 CASH & CREDIT : Rumah tipe 36, 42. atap Multi roof, rangka atap baja ringan, dinding batubata, gimsum, relief lantai keramik. RUKO TIPE 40 : Pondasi untuk 2 lantai, atap cor, dinding batu-bata, relief pintu besi, PLN, PDAM, SHM, IMB, KPR. PERUMAHAN HERAWATI INDAH : Lokasi Jl. Viyata Yudha ujung,kelurahan Bah Kapul.(tojai baru) Telp. 081370261747085296029651-0813611611011-081362303662.

CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Rp 100 jt, DP 20 jt, angsuran selama 10 thn + Rp 1 jt per bulan, selama 15 thn + 800 rb per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 7070442 DIKONTRAKKAN: Rumah 1 pintu, permanen, uk 4,5 x 9 M, 1 kamar tidur, ruang tamu, dapur, kamar mandi WC di dalam air PAM listrik Jl. Dahlia 27 / Bel P. Siantar. hub. AFIF HP 0813 6235 CASH6727 & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Rp 175 jt, DP 40 jt, angsuran selama 10 thn + Rp 2 jt per bulan, selama 15 thn + 1,6 jt per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442

CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Rp 150 jt, DP 30 Jt, angsuran selama 10 thn + 1,7 juta per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 5 x 20 m Rp 17 jt, 10 x 20 m Rp 34 jt, 15 x 20 m Rp 51 jt, 20 x 20 m Rp 68 jt. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

DIJUAL TANAH: Tanah ukuran 8x23,m (SHM) dan Rumah/bangunan 7 x 15 M. Kamar Tidur 3,Kamar Mandi 2, Keramik,Gipsun. Harga 275 Juta /NegoLokasi Jl. Lau Cimba Ujung. Pematangsiantar. HP 0813 7043 4885 / 0813 7031 6990 (TP)

PIJAT DAN LULURAN “IBU SUM” Jika anda capek, pegal linu, lesuh, lelah kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran hub kami di Jl. flores No. 07 P. Siantar HP 0812 6526 0864; 0813 754 74647 PIJAT DAN LULURAN “IBU Restu” jika anda capek, pegal linu, lesuh, lelah kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran. Jl. Simpang Viyata Yudha Komp. kelapa-2 dekat sekolah RK Katolik Asisi P. Siantar HP 0821 6681 7943; 0813 9635 4127 PIJAT DAN LULURAN “MBAK SARI”: Jika Anda Capek, Pegal, Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan Badan, Urut Bayi, Terkilir serta Luluran. Hub: kami di Jl. Usgara No. 1 (Masuk dari Jl. Bali samp. SMK Negeri) P. Siantar HP. 0812 635 5430 PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852.7600 0031; 0813.9688 9800. PIJAT DAN LULURAN “PAK SETU”: Jika

Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar Hp. 0813 7658 8917 MENYEDIAKAN ANEKA HEWAN PELIHARAAN: Burung hias/konsumsi, pheasant, bebek hias, reptile, kura-kura (import & lokal), hamster, landak mini, merpati, ayam, perkutut, anjing, kodok hias, kelinci, cicak, jangkrik, ulat Hongkong/Jerman, kroto, aksesories, pakan, kandang dll. hub. 0878 6849 0858 Medan HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” BUTUH DANA CEPAT: • SERTIPIKAT • BPKB Hub: KAMI PT BPR EKA PRASETYA Jl. SM Raja no 202. P. Siantar (depan parluasan) Telp. 0622 - 430780; HP 0852 7657 8625 HARI INI INVESTASI: Mulai besok dapat profit 7% Rp. 6.300.000 setiap harinya non stop selama 200 hari (Tanpa Rekrut) Minat???? SMS "Petunjuk" ke HP 0877 8847 7900 STAR MASSAGE: Pijat dan lulur, tune up body, man porman, khusus panggilan ke rumah dan hotel. hub. Joni HP 0853 6287 3041 No. SMS

HOTLINE IKLAN

Telp. 0622 - 7553511


IKLAN INFO

SABTU 28 April 2012

12

METRO SIANTAR

TER CECER TERCECER Telah tercecer surat hibah atas tanah seluas 2.000 meter persegi, yang terletak di Lingkungan II Dolok Baringin, Kelurahan BP Nauli Kecamatan Siantar Marihat Kota Pematangsiantar, An. Josep Simangunsong, tertanggal 6 Juli 1998, kepada penerima hibah Hendri Robert Simangunsong(anak). Diperkirakan tercecer sejak tahun 1998 di Pematangsiantar. Bagi yang menemukan kami harap untuk mengembalikan. Tidak akan dituntut tapi akan diberi hadiah.Hub 081361384712.

INCOME TTAMBAHAN AMBAHAN 3 JT - 8 JT

Perusahaan America Yang Sedang Berkembang, Membutuhkan : Konsultan Indenpenden Yang Bergerak Di Bidang Kecantikan Dan Kesehatan. Untuk Jadwal Interview Seminar Hubungi:

HP. 0852 7500 2233 HP. 0813 7600 3715 HP. 0852 7600 5055

TER CECER TERCECER

35

Plastik hitam yang berisi 2 (dua) buah BPKB dengan nopol BK 6672 WZ An. Ida Sumarti dan STNK dengan nopol BK 6112 TAA An. Azhar Dalimunthe dan STNK, KTP An. Ida Sumarti, SIM An. Azhar Dalimunthe. Tercecer pada tanggal 23 April 2012, disekitar Jl. Asahan - Perumnas Bt. 6, pukul 10.30 WIB. Bagi yang menemukan hub: HP 0813 7653 5731. Tidak akan dituntut tapi diberikan imbalan yang sepantsnya.


SABTU

28 April 2012

Tampil Polos, RIHANNA Dinilai Lebih Cantik Beberapa waktu lalu penyanyi Rihanna mengunggah foto dirinya tanpa menggunakan make up di Twitter. Dari foto itu, banyak yang menilai Rihanna lebih keren jika tampilpolos. Sebelumnya memang hampir jarangpelantun‘CaliforniaKingBed’ itudinilaikeren.Namun,ketikatampil tanpamakeupRihannajustrudinilai memperlihatkan kecantikannya. Meski tatanan rambutnya terlihat kusut, ia memang menunjukkan kelebihannya. Dalam foto tersebut, Rihannatampakhanyamemfokuskankamerakepadawajahnya.Sedikit tersenyum,iajugamenggigitbagian bawahbibirnya.“Shelookedbeautiful,arguablymoresothanwhensheis madeupforaneventoravideo,”tulis DailyMail,Jumat(27/4). Sosok Rihanna memang kerap diberitakansebagaiperempuanyang bermasalah dan doyan tampil seronok saja. Penyanyi 24 tahun itu baru-baruinijugakedapatantengah menggunakan kokain di sebuah pesta.Waduh!(dtc/int)

Gosip panas kembali berhembus menerpa rumah tangga penyanyi Krisdayanti yang dibangun 20 Maret 2011 dengan Raul Lemos. Pasangan yang telah dikaruniai bayi cantik ini dikabarkan pisah ranjang. Pelantun Pilihlah Aku ini pun meradang mendengarnya. Ditemui di House of Lusense, Kebayoran Baru, Jakarta Selatan pada Kamis (26/4), Krisdayanti mementahkan gosip tersebut. “Itu berita aku baru denger kemarin jam 11 malem pas landing di Jakarta. Ini berita yang sangat tidak benar dan tidak bertanggungjawab,” tandas Krisdayanti, “Ini memang orang yang tidak suka sehingga mencoba menghembuskan berita itu. Apa kehabisan berita artis-artis yang suka cari sensasi dengan gosip?” Krisdayanti pun menyesalkan berita yang muncul tanpa konfirmasi itu, terutama karena kini ia telah memiliki kehidupan dan keluarga baru. “Masalahnya saya punya kehidupan dan privasi yang sekarang lebih tertata. Karena suami saya bukan dari dunia hiburan, saya harus menjaga perasaan saya dan perasaan suami saya,” sesal wanita 37 tahun itu. Krisdayanti mencoba bijak dengan menganggap gosip tersebut sebagai ujian rumah tangganya, “Saya kaget diberitakan telah pisah ranjang. Bukan su’udzon, mungkin yang menghembuskan

berita ini memang tidak suka kepada kami. Ini merupakan ujian. Ujian itu bisa hadiah, hadiah yang baik, hadiah yang ganggu perasaan, tapi jalani saja,” tuturnya. CemburupadaAshanty Ashanty sepertinya sudah mulai mendekatkan diri kepada anak-anak dari calon suaminya, Anang Hermansyah. Pendekatan yang dilakukan Ashnaty tergolong berhasil, kini kedua anak Anang kian akrab dengannya. Kedekatan Ashanty dan anak-anak Anang, ternyata mengundang kecemburuan dari ibunda kandung mereka, Krisdayanti. Bahkan dengan nada bercanda, KD sempat ‘menegur’ anak keduanya, Azriel karena sering bersama Ashanty. ”Saya baru bercandain sama Azriel. Saya bilang sama dia, kalau saya cemburu karena dia kan sering sama bundanya (Ashanty),” ujarnya saat ditemui di kawasan Jakarta Pusat, Kamis (26/4). Meski begitu KD mengaku bersyukur mantan suaminya sudah menemukan pendampingnya yang baru. Ia pun berjanji akan datang ke pernikahan Anang. ”Saya bersyukur Anang temukan wanita yang bisa jadi istri dan ibu untuk anakanak,” paparnya. (dtc/kpl/int)

Pesinetron Adly Fairuz kembali menyandang status jomblo setelah putus dari pacarnya akhir Desember lalu. Sejak itu, Adly mengaku banyak yang ingin menjodohkannya.

”Pelan-pelan saja tapi pasti. Udah zaman sekarang nggak usahlah dijodohin lagi,” ucapnya seraya tertawa saat ditemui di jalan Wijaya II, Jakarta Selatan, Kamis (26/4) malam. Bintang ‘Cinta Fitri’ itu

mengaku saat ini sudah mulai membuka hatinya. Tapi Adly belum mau berpacaran karena ingin fokus dalam pekerjaan. ”Belum ada yang cocok ajah,” tambahnya. Cowok berusia 25 April itu

mendambakan perempuan dengan kriteria fisik berambut panjang dengan kulit sawo matang. Adly berharap bisa menemukan pujaan hatinya, dan menikah saat usianya sudah 28 tahun. (dtc/int)


SABTU 28 April 2012

KOMUNITAS FB XPRESI METRO SIANTAR Hmm, teman-teman yang ingin mengucapkan selamat ulangtahun untuk siapa saja, ntah itu keluarga, teman, atau pacar, dipersilahkan dengan penuh cinta ? Binsar Parlindungan Tampubolon Yang lagi ultah, aku mencintaimu...

C’alay Yg CuEt Sitorus HAPPY BIRTHDAY FRIEND GOD ALWAYS BLESING YOU

Adi Susanto Lumban Tukkup ý:: Selamat ulang tahun buat semua teman-teman di facebook yang lagi ulang tahun ::

Bayu Setiawan Slamat ulang tahun. Buat syapa ja la

El Harris Purba yang pasti, individunya harus sadar.

Rändhie RezpeCtór ÀQuariusant Buat anak Siantar yg pengen gabung & menjadi anggota resmi Rezpector. siLahkan besok ikut Gath jam 15:00 di Parkiran Bus Pariwisata (PW).

Ferywilsoen Putra Sulung Roemahorboe Met ultah buat kota siantar, permintaan buat pemkot siantar pertahankan becak BSA siantar karena itu adalah barang antik dikota ini

Ulang tahun pertama kali dimulai di Eropa. Dimulai dengan ketakutan akan adanya roh jahat yang akan datang pada saat seseorang berulang tahun. Untuk menjaganya dari hal-hal yang jahat, temanteman dan keluarga diundang datang saat sesorang berulang tahun untuk memberikan doa serta pengharapan yang baik bagi yang berulang tahun. Memberikan kado juga dipercaya dapat memberikan rasa gembira bagi orang yang berulang tahun sehingga dapat mengusir roh-roh jahat tersebut.

Febry Dastan Maulana Evi.... aku sayang padamu... Walau sampai kapanpun... Aku akan menunggumu! I love you so much...

Rotua Naibaho Met ultah buat metro siantar.mga acra untk bsok.sukses..be the best for MS

M E N G ATASI KELUHAN AKIBAT MAAG TANPA EFEK SAMPING SepintasF i t r i aHarah apmemang tampak se h a t. Namun siapa y a n g menyangka wanita yang berprofesi sebagai guru ini sudah 10 tahun lamanya menderita maag, "Kalau sudah kambuh, perut saya sering terasa mual, penuh, dan seperti ada benjolan," terang wanita berusia 32 tahun tersebut. Bertahun-tahun mengatasi maag dengan mengkonsumsi obat kimia a k h i r n y a m e n i m b u l k a n kekhawatiran di diri ibu 2 orang anak ini akan efek samping yang ditimbulkannya. Karenanya, kini ia mengikuti anjuran suaminya untuk beralih pada pengobatan yang alami. Terbukti dalam jangka waktu 1 bulan, Fitria merasakan manfaatnya, "Setelah minum Gentong Mas secara teratur, Alhamdulillah kini sakit maag saya sudah tidak kambuh, badan selalu fit." Ungkap wanita yang tinggal di Kisaran Timur, Asahan, Sumatra Utara tersebut. Gastritis atau lebih dikenal sebagai maag berasal dari bahasa Yunani yaitu Gastro, yang berarti perut/ lambung dan Itis yang berarti inflamasi/peradangan dengan gejalagejala seperti perih atau sakit seperti

terbakar pada perut bagian atas yang dapat menjadi lebih baik atau lebih buruk ketika makan, mual, muntah, kehilangan selera, kembung, terasa penuh pada perut bagian atas setelah makan, kehilangan berat badan. Setelah merasakan manfaat mengkonsumsi Gentong Mas, kini ibu 2 orang anak ini ingin sekali membagi pengalaman baiknya dengan orang lain, "Semoga pengalaman saya ini dapat bermanfaat bagi orang lain." Harapnya. Gentong Mas adalah minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda) terbukti memiliki banyak manfaat untuk kesehatan. Habbatussauda bermanfaat untuk memelihara pembuluh darah, perbaikan sistem saraf, optimalisasi aktifitas hormon, meningkatkan proses penyembuhan dinding lambung, meningkatkan daya tahan tubuh dan bersifat anti bakteri. Selain itu juga, Habbatussauda dapat mengatasi gangguan tidur dan relaksasi. Cabe Jawa yang terdapat dalam Gentong Mas bermanfaat untuk mempercepat penyembuhan mukosa lambung. Sedangkan kandungan yang terdapat dalam Kayu Manis bersifat anti kembung dan mules. Kapulaga dalam Gentong Mas bermanfaat sebagai anti muntah serta

radang lambung. Dan Gula Aren bermanfaat untuk menurunkan penyerapan lemak dan perbaikan sistem saraf. Untuk hasil cepat dan maksimal dianjurkan untuk makan teratur, hindari alkohol, rokok, kendalikan stress, dan jika memungkinkan hindari obat penghilang nyeri Manfaat yang hebat bagi kesehatan dan rasa yang lezat membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi www.gentongmas.com. Untuk informasi lebih lanjut silahkan kunjungi w w w.gentongmas.com. Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/ toko obat terdekat atau hubungi: Medan : 081384777787 Sidikalang : 081384777787 Dolok Sanggul : 081384777787 Gunung tua : 081384777787 Batubara : 081384777787 Tobasa : 0813 8477 7787 Nias : 0813 8477 7787 Tebing Tinggi : 0813 2209 9495 Siantar : 082167538848 Binjai : 0813 9866 6166 Lbk Pakam : 082164659699 Karo : 0821 6753 8828 Langkat : 0812 6321 7797 Kisaran : 0623 7014 362 Tj. Balai : 0812 6349 5563 Labura : 0813 7059 0972 Labuhan batu: 0852 7707 1977 P. Sidimpuan : 0821 6346 6597 Sibolga : 0852 9685 5211 Taput : 081263243034 Madina : 082163466597.

Merayakan ulang tahun merupakan sejarah lama. Orang-orang jaman dahulu tidak mengetahui dengan pasti hari kelahiran mereka, karena waktu itu mereka menggunakan tanda waktu dari pergantian bulan dan musim. Sejalan dengan peradaban manusia, diciptakanlah k a l e n d e r. Kalender memudahk a n manusia untuk mengin g a t dan merayakan halhal penting setiap tahunnya, dan ulang tahun merupakan salah satunya. Banyak simbolsimbol yang diasosiasikan atau berhubungan dengan ulang tahun sejak ratusan tahun lalu. Ada sedikit penjelasan mengapa perayaan ulang tahun harus menggunakan kue. Artemis Diana Salah satu cerita mengatakan, karena waktu dulu bangsa Yunani menggunakan kue untuk persembahan ke kuil dewi bulan, Artemis. Mereka menggunakan kue berbentuk bulat yang merepresentasikan bulan purnama. Cerita lainnya tentang kue ulang tahun yang bermula di Jerman yang disebut sebagai “Geburtstagorten” adalah salah satu tipe kue ulang tahun yang

biasa digunakan saat ulang tahun. Kue ini adalah kue dengan beberapa layer yang rasanya lebih manis dari kue berbahan roti. Simbol lain yang selalu menyertai kue ulang tahun adalah penggunaan lilin ulang tahun di atas kue. Orang Yunani yang mem-

persembahkan kue mereka ke dewi Artemis juga meletakan lilin-lilin di atasnya karena membuat kue tersebut terlihat terang menyala sepeti bulan (gibbons, 1986). Orang Jerman terkenal sebagai orang yang ahli membuat lilin dan juga mulai membuat lilinlilin kecil untuk kue mereka. Beberapa orang mengatakan bahwa lilin diletakan dengan alasan keagamaan/religi. Beberapa orang jerman meletakan lilin besar di tengahtengah kue mereka untuk menandakan “Terangnya Kehidupan” (Corwin,1986). Yang lainnya percaya bahwa asap dari lilin tersebut akan

membawa pengharapan mereka ke surga. Saat ini banyak orang hanya mengucapkan pengharapan di dalam hati sambil meniup lilin. Mereka percaya bahwa meniup semua lilin yang ada dalam satu hembusan akan membawa nasib baik. Pesta ulang tahun biasanya diadakan supaya orang yang berulang tahun dapat meniup lilinnya. Ada juga mitos yang mengatakan bahwa ketika kita memakan kata-kata yang ada di atas kue, kata-kata tersebut akan menjadi kenyataan. Jadi dengan memakan “Happy Birthday” akan membawa kebahagiaan. Pada pesta ulang tahun pertama kalinya, pesta diadakan karena orang menduga akan adanya roh jahat yang mengganggu mereka. Jadi mereka mengundang teman dan kerabat untuk menghadiri pesta ulang tahun mereka sehingga roh-roh jahat tidak jadi mengganggu yang berulang tahun. Dalam pestapesta selanjutnya banyak dari keluarga dan teman yang membawa kado atau bunga untuk yang berulang tahun. Saat ini kebanyakan pesta ulang tahun diadakan untuk bersenang-senang. Jika orang yang diundang tidak bisa menghadiri pesta ulang tahun, biasanya mereka akan mengirimkan kartu ucapan selamat ulang tahun. Tradisi mengirimkan kartu ucapan dimulai di Inggris sekitar 100 tahun yang lalu (Motomora, 1989). Pada awal mulanya hanya raja saja yang dirayakan ulang tahunnya (mungkin disinilah awal mulanya tradisi topi ulang tahun bermula). Seiring waktu berlalu, anak-anak juga di ikutsertakan dalam pesta u l a n g tahun. Pesta ulang tahun untuk anaka n a k pertama kali terjadi di Jerman dan dinamakan “kinderfeste”. Tetapi saat ini, pesta ulang tahun bisa diadakan oleh siapa saja. (berbagai sumber)


SABTU

28 April 2012

Hayden: Rossi Pantang Menyerah Nicky Hayden benar-benar tidak percaya dengan rekanya di Ducati, Valentino Rossi yang akan memilih masuk pit saat balapan seri pertama MotoGP Qatar 2012. Hayden menilai bila Rossi adalan seorang pembalap yang memiliki daya tarung besar. Rossi memang mengawali musim ini dengan cukup tidak memuaskan. Dalam balapan yang berlangsung di sirkuit Losail tersebut, dirinya hanya menempati posisi ke-12 di babak kualifikasi. Saat sesi balapan pembalap asal Italia tersebut finis di posisi ke-10. Setelah balapan selesai The Doctor mengakui bila dirinya sempat ingin kembali ke pit dan tidak meneruskan balapan. “Saya berpikir untuk kembali ke pit, tapi dikarenakan menghormati tim dan juga untuk mengumpulkan

data-data, maka saya memilih untuk melanjutkan balapan,” katanya saat itu. Hayden yang saat di Qatar berhasil finis di tempat keenam, tidak percaya dengan hal tersebut. Ia menuturkan bila Rossi adalah orang yang tidak pantang menyerah dalam balapan. “Mingkin dia berpikir untuk menyerah, namunValentino adalah seorang petarung. Saya benarbenar sangat tidak yakin bila dirinyaakancepatmenyerah,”ujar Hayden seperti dilansir Autosport, Jumat (27/4). “Memang ia tidak meraih hasil yang cukup baik (di Qatar), tapi dirinya adalah pembalap yang mengkoleksi sembilan gelar juara dunia. Saya percaya ia akan menemukan kembali caranya untuk menjadi yang terdepan,” pungkasnya. (oz/int)

Chelsea Siapkan 35 Juta Pounds Gaet Higuain „ Hayden dan Rossi

5 Pemain ISL akan Bergabung ke Timnas Manajer tim nasional Indonesia, Ramadhan Pohan, mengatakan, lima pemain dari klub Indonesia Super League (ISL) telah menyatakan kesiapannya untuk bergabung dalam pemusatan latihan di Yogyakarta. Namun, Ramadhan masih merahasiakan nama-nama pemain tersebut.

P

emusatan latihan di Yogyakarta adalah bagian dari persiapan tim yang diasuh Nil Maizar untuk mengikuti turnamen Al-Nakbah di Palestina pada 13-23 Mei mendatang. Sebelumnya PSSI telah memanggil 15 pemain ISL untuk ikut bergabung dalam pelatnas. Namun, tidak ada satu pun pemain ISL datang ke pelatnas yang berlangsung sejak bergulir 19 April lalu. “Kisarannya sekitar lima pemain. Memang masih belum afdol karena pemain ISL belum bergabung. Baru 18 pemain yang

bergabung. Saya harapkan 15 pemain ISL bisa bergabung nanti,” kata Ramadhan kepada wartawan, Jumat (27/4). Pria yang menjabat Wakil Sekjen Partai Demokrat itu juga berjanji akan menempuh cara apa pun, termasuk bertemu dengan Aburizal Bakrie dan Nirwan Dermawan Bakrie, agar pemain ISL bergabung dengan timnas. “Seharusnya kalau sudah dipanggil untuk membela bangsa, tidak perlu ada negosiasi dan lobi. Tapi saya siap melakukan cara tersebut karena, dengan adanya pemain ISL, pelatih jadi

„ Ramadhan Pohan leluasa memilih pemain. Saya juga mengimbau untuk legowo untuk mengizinkan pemain bergabung dengan timnas karena

ini demi kepentingan bangsa,” kata Ramadhan. Setelah resmi menjabat posisi manajer timnas, Senin (23/4/

2012), Ramadhan langsung fokus memantau kegiatan timnas di Yogyakarta. Menurutnya, pelatnas timnas masih dengan sistem buka-tutup mengingat kompetisi belum berakhir. Pelatnas akan berjalan penuh pada bulan depan. “Timnas sudah komplet diurusi tim kepelatihan. Saya sebagai manajer memotivasi karena banyak pemain yang baru pertama kali membela timnas. Saya juga minta pemain jangan pernah merasakan rendah diri dan tidak berdaya,” ujarnya. Ramadhan berpesan kepada para pemain untuk tetap bersemangat meski prestasi sepak bola Indonesia sedang terpuruk. Ia meminta peristiwa kekalahan timnas dari Bahrain pada prakualifikasi Piala Dunia 2014 tidak menjadi beban. (kps/ int)

Chelsea dilaporkan tengah menyiapkan sebuah tawaran untuk merayu striker Real Madrid Gonzalo Higuain supaya bersedia merapat ke Stamford Bridge. Laporan yang dilansir dari kabar The Sun itu menyebut, The Blues sudah menganggarkan dana sekitar £35 juta untuk menghadapi bursa transfer musim panas mendatang. Kabarnya, kehadiran Higuain ini akan menggantikan tempat Didier Drogba yang santer terdengar bakal hengkang pada musim panas nanti. “Higuain sekarang ini menjadi daftar teratas dalam list belanja pemain,” kata seorang sumber di Chelsea. “Dia sudah menjadi seorang pencetak gol yang fenomenal buat Real Madrid dan juga Argentina. Namun demikian dia juga cukup banyak membantu pemain lain mencetak gol.” “Jadi kehadirannya bakal menjadi sempurna buat kami. Kami yakin dia akan menjadi pemain yang bisa berkembang di Liga Primer,” ujar sang sumber. (int)

„ Gonzalo Higuain

Rexy Pelatih Termahal Filipina

„ Greysia Polii-Meiliana Jauhari

India Open Superseries 2012

Srikandi Merah-Putih Bertumbangan Indonesia dipastikan harus puasa gelar pada nomor ganda putri di ajang India Open Superseries 2012. Pasalnya, tiga pasangan srikandi Merah- Putih yang turun di babak kedua harus tumbang oleh lawan-lawannya. Pertama adalah pasangan Vita/Nadya yang gagal mengulang sukses di Badminton Asia Championships 2012 pekan lalu di mana mereka kalahkan pasangan Jwala Gutta/Ashwini Ponnappa dari India. Namun, kali ini keduanya harus mengakui keunggulan Jwala/Ashwini, usai bertarung tiga game, 21-16, 1521, 17-21. Hal yang sama juga terjadi pada pasangan Anneke Feinya Agustin/Nitya Krishinda yang tunduk oleh ganda putri Jepang, Miyuki Maeda/Satoko Suetsuna. Meskipun mampu mencuri satu game dari pasangan unggulan ketiga ini. Anneke/Nitya harus rela kehi-

langan tiket perempat final saat Maeda/Suetsuna menyelesaikan pertandingan dengan kemenangan mereka, 21-15, 18-21, 21-14. Harapan terakhir Indonesia ada pada pasangan Greysia Polii/Meiliana Jauhari yang hanya membutuhkan dua poin lagi untuk maju ke perempat final saat unggul 19-16 di game kedua. Sayang, mereka juga harus tersingkir usai pasangan Bao Yixin/Zhong Qianxin mampu menekan balik pada poin-poin kritis dak akhinya menyamakan kedudukan menjadi 19-19. “Sebetulnya kuncinya ada di kedudukan 19-16, saya lihat Greysia/Meiliana tidak panik, namun lawannya semakin menekan terus dan membuat Greysia/Meiliana main bertahan terus dan tidak ada kesempatan menyerang” ujar pelatih ganda putri, Paulus Firman seperti dilansir PBSI. (oz/int)

Pelatih bulu tangkis asal Indonesia, Rexy Mainaky menargetkan membentuk tim Filipina untuk dapat lolos ke Olimpiade Rio de Janeiro 2016 mendatang. “Saya bukanlah seorang pesulap,” kata Rexy yang memilih menangani Filipina setelah mundur sebagai pelatih timnas Malaysia. “Saya hanya ingin melakukan yang terbaik. Saya harap dapat membentuk sebuah tim (Filipina) ke Olimpiade 2016. Ini rencana saya. Jika dalam dua tahun saya gagal, saya akan mundur.” Rexy dikabarkan menolak tawaran dari Inggris dan Rusia dan memilih Filipina. Untuk itu ia mendapat gaji sebesar 12 ribu dolar AS per bulan ditambah jaminan hidup buat keluarganya yang

„ Rexy Mainaky akan segera bergabung dengannya di Manila. Juara Olimpiade Atlanta 1996 ini memang pernah mengatakan tidak ingin terlalu jauh dari tanah air dan keluarga besarnya agar ia dapat setiap saat pulang.

Menurut Jojo Binay dari asosiasi bulu tangkis Filipina (PBA), pihaknya memang membutuhkan Rexy untuk kebangkitan bulu tangkis. “Kami memang sangat menginginkan dia, meski dia merupakan pelatih termahal. Ia akan membantu kami mewujudkan impian. Ia seorang yang sangat dispilin dan hal inilah yang kurang pada atletatlet kami.” Rexy akan berkeliling Filipina untuk melihat bakat para pemain berusia 12 hingga 17 tahun. “Kita tidak dapat meraih medali emas dalam waktu satu malam. Namun kami berharap dapat sejajar dengan tim-tim yang kuat. Kami akan memberi kebebasan penuh pada Rexy,” kata Albee Benitez dari PBA. (kps/int)

„ Kobe Bryant dan Pacman

Pacquiao Atlet Berpengaruh Legenda tinju Filipina, Manny Pacquiao masuk dalam daftar 10 besar atlet paling berpengaruh 2012 versi majalah Forbes. Pacquiao menjadi satu-satunya petinju yang masuk dalam daftar 10 besar tersebut. Pacquiao berada di bawah pebalap NASCAr, Jimmie Johnson dan dua pemain liga sepakbola Amerika (NFL), Tim Tebow dan Peyton Manning. Namun nama Pacquiao be-

rada di atas nama terkenal lainnya seperti Tom Brady (NFL/5) dan Jeremy Lin (NBA/10). Namanama ini terpilih dari polling yang dilakukan Nielsen Media Research dan E-Poll Market Research terhadap 1100 responden. Promotor Pacquiao, Bob Arum mengaku tidak kaget dengan populariats petinjunya tersebut. “Dia layak mendapatkannya. Saya tidak pernah memegang (atlet) sepopuler dia.” (kps/int)

Button: Uji Coba di Mugello Tak Ada Manfaat

„ Jenson Button

Pembalap asal McLaren, Jenson Button, menilai bila rencana uji coba dilakukan di Sirkuit Mugello pekan depan oleh McLaren tidak ada manfaat yang didapatkannya. Seperti diketahui, McLaren akan melakukan uji coba pembalapnya di Italia. Rencananya McLaren akan menguji para pembalapnya seperti, Gary Paffett dan Oliver Turvey, di sesi uji coba di Italia itu. Sebelumnya, Lewis Hamilton yang merupakan rekan satu timnya meminta pengaturan jadwal

ulang agar bisa menjalani istirahat usai tampil buruk di Bahrain. Sayang, tim tetap pada rencana awal, yang mana Paffett dan Turvey akan berbagi tempat di Mugello selama tiga hari. Soal uji coba ini, Button sendiri sejak awal tidak pernah berencan untuk ikut serta. Pasalnya, pembalap asal Inggris ini menilai tidak ada manfaat yang bisa didapati dari uji coba di Mugello. Terlebih, sirkuit itu sendiri belum pernah dipakai untuk uji coba sebelumnya. Alasan terakhir, adalah bila McLaren tidak

ada rencana untuk melakukan perubahan secara signifikan di Italia nanti. “Alasa kenapa kita tidak akan pergi kesana karena saya tak pernah ke Mugello sebelumnya. Saya merasa tidak akan pernah mendapatkan manfaat karena tidak perubahan besar di sana,” ujarnya Press Association, Jumat (27/4). “Untuk test Driver mendapatkan banyak jam terbang dan mencoba beberapa hal yang cukup ekstrim saya pikir bagus, Namun, kita sendiri tidak perlu ada di sana,” pungkasnya. (int)


SABTU

28 April 2012

PREMIERE LEAGUE KLASEMEN SEMENTARA 1 Man United

35

26

5

4

86-32

83

2 Man City

35

25

5

5

87-27

80

3 Arsenal

35

20

5

10

67-43

65

4 Newcastle U

34

18

8

8

53-42

62

5 Tottenham H

34

17

8

9

57-39

59

6 Chelsea

34

16

10

8

56-38

58

7 Everton

34

13

9

12

42-38

48

8 Liverpool

34

12

10

12

40-37

46

9 Fulham

34

12

10

12

45-44

46

10 WBA

35

13

6

16

41-47

45

11 Sunderland

35

11

11

13

42-41

44

12 Swansea City

35

11

10

14

39-45

43

13 Norwich City

35

11

10

14

47-60

43

14 Stoke City

34

11

9

14

32-48

42

15 Aston Villa

34

7

15

12

35-48

36

16 QPR

35

9

7

19

39-57

34

17 Wigan Ath

35

8

10

17

34-60

34

18 Blackburn R

35

8

7

20

47-73

31

19 Bolton W

33

9

3

21

37-66

30

20 Wolves

35

5

8

22

34-75

23

PENCETAK GOL

Euro 1996

Inggris Menangis Menjadi tuan rumah turnamen Akbar antarnegara Benua Biru yang digelar 8-30 Juni 1996 ini, Inggris kurang beruntung. Misinya, kandas di semi final dengan cara menyakitkan setelah kalah adu penalti dari Jerman. Shoutgate yang menjadi penendang terakhir Inggris gagal memperdaya Andreas Kopke. Sedangkan enam algojo Der Panzer, seluruhnya menaklukan David Seaman. Di fase grup, Inggris yang menghuni Grup A bersama Belanda, Skotlandia dan Swiss sebenarnya tampil garang. Dua kemenangan dan hasil sekali imbang dikantongi Union Jack. Asa tuan rumah sempat membara melihat The Three Lions sempat meruntuhkan Belanda dengan skor telak, 4-1, di partai pamungkas.

Tapi pada akhirnya Inggris gagal mewujudkan semua ambisinya seperti yang tertuang dalam motto yang diusungnya di turnamen itu “Football Comes Home”. Namun, setidaknya Inggris tidak terlalu kehilangan muka karena strikernya Alan Shearer menyabet Golden Boot. Digruplainsecaraumumtidakada kejutan berarti, hanya Italia yang tidak lolossetelahdipartaihidupmati,Italia hanya bermain imbang dengan Jerman. Hasil itu membuat Italia tersingkir karena kalah agregat gol dengan Rep Ceska yang menorehkan poin sama, 4 sedangkan Jerman kokoh di posisi puncak dengan poin 9. Kedua tim ini lah yang akhirnya bertempur di laga puncak. Rep Ceska yang di semi final mengandaskan

EURO- Keperkasaan Jerman di Euro 1996 usai menyingkirkan tuan rumah Inggris Prancis, ditundukan 2-1 dalam partai finalyangdigelardiWembleyStadium London itu. Dalam duel ini, mental baja Der Panzer sungguh teruji. Meski sempat tertinggal di menit 60, Jerman

Van Persie Wayne Rooney Sergio Aguero

hanya diikuti delapan tim, melainkan 16timyangterbagidalamempatgrup, menyusul bertambahnya negara di Eropa usai pecahnya Uni Soviet. Di Inggris ini untuk pertama kali nama ‘Euro’ dipakai. (int)

ARSENAL

STOKE CITY 27 26 22

membalikkan keadaan dengan gol Oliver Bierhoff di menit 73 dan mengunci gelar dengan golden goal di menit 95. Yang tak kalah penting dicatat dalam edisi kali ini, Euro tidak lagi

Arsenal Man United Man City

LIGA SPANYOL KLASEMEN SEMENTARA 1 Real Madrid

34 28

4

2

109-30

2 Barcelona

34 25

6

3

97-26

88 81

3 Valencia

34 15

10

9

54-42

55

4 Malaga

33 15

6

12

49-46

51

5 Levante

34 14

7

13

48-47

49

6 Ath Bilbao

34 12

12

10

49-44

48

7 Atl Madrid

34 13

9

12

47-42

48

8 Sevilla

34 12

10

12

41-39

46

9 Atl Osasuna

33

11

13

9

37-53

46

10 Espanyol

34 12

9

13

44-46

45

11 Getafe

34 12

9

13

38-45

45

12 Mallorca

34

11

10

13

36-41

43

13 Real Betis

34 12

6

16

40-49

42

14 Real Sociedad

34 10

10

14

41-50

40

15 R Vallecano

34 12

4

18

50-60

40

16 Granada

34

11

6

17

31-49

39

17 Villarreal

34

8

13

13

35-48

37

18 Sporting G

34

8

7

19

35-64

31

19 Real Zaragoza

34

8

7

19

29-60

31

20 R Santander

34

4

14

16

24-53

26

Kekalahan telak 0-3 di kandang Newcastle memang tidak berarti apa-apa bagi Stoke. Pasukan Tony Pulis kini duduk di peringkat ke-14 dengan raihan 42 poin. Stoke terkesan tampil setengah hati karena hanya memiliki target untuk bertahan di premier league. Pulis berharap anak asuhnya tetap dapat menunjukkan permainan yang menghibur para fans yang akan datang. Pulis juga me-

nginginkan balas dendam atas kekalahan 1-3 di Emirates pada putaran pertama. Bagi ARsenal, setelah kalah 1-2

BURSA TARUHAN

dari Wigan, mereka kembali gagal menang setelah ditahan imbang tanpa gol oleh Chelsea. Kini posisi Arsenal diancam oleh Newcastle. Kedua tim hanya berjarak tiga poin, namun Newcastle masih menyimpan 1 pertandingan sisa. Pelatih Arsene Wenger meminta anak asuhnya untuk bangkit dan memenangi semua pertandingan sisa. Hal senada juga diutarakan oleh kapten tim, Van Persie yang

METRO Stoke City Arsenal

1/2 0

HEAD TO HEAD: 23 Okt 2011 8 Mei 2011

Arsenal Stoke

vs vs

Stoke Arsenal

3-1 3-1

5 PERTANDINGAN TERAKHIR STOKE CITY

PENCETAK GOL

„ Crouch

21 Apr 2012 9 Apr 2012 7 Apr 2012 31 Mar 2012 24 Mar 2012

Newcastle Aston Villa Stoke Wigan Stoke

vs vs vs vs vs

Stoke Stoke Wolves Stoke Man City

3-0 1-1 2-1 2-0 1-1

5 PERTANDINGAN TERAKHIR ARSENAL 21 Apr 2012 16 Apr 2012 11 Apr 2012 8 Apr 2012 31 Mar 2012

Arsenal Arsenal Wolves Arsenal QPR

vs vs vs vs vs

Chelsea Wigan Arsenal Man City Arsenal

0-0 1-2 0-3 1-0 2-1

optimis timnya akan bangkit dan kembali ke jalur kemenangan. Biasanya tim papan atas Inggris urutan pertama, kedua dan ketiga langsung masuk ke babak penyisihan grup Liga Champions, dengan tim yang selesai keempat masuk ke pertandingan kualifikasi awal. Tetapi jika Chelsea, yang saat ini keenam, mengalahkan Bayern Munich di final 19 Mei, mereka akan mendapatkan jatah kualifikasi dengan mengorbankan klub urutan keempat di Liga Premier. Jenkinson ingin mengakhiri musim Liga Premier dengan tim asuhan Arsene Wenger berada dalam persaingan elit Eropa musim depan, daripada mengandalkan Bayern mengalahkan Chelsea. “Tentu saja Chelsea bisa menang, mereka tidak akan pergi sejauh ini jika mereka tidak memiliki keinginan untuk menang,” kata Jenkinson.nal baru menang sekali dalam empat kunjungan terakhir mereka ke kandang Stoke City Britannia Stadium, terakhir kalah pada sebuah kekalahan 3-1 Mei lalu. (int)

ENGLISH PREMIER LEAGUE Everton vs Fulham Sunderland vs Bolton Swansea vs Wolves West Brom vs Aston Villa Wigan vs Newcastle Norwich vs Liverpool

0 : 1/2 0 : 1/2 0:1 0 : 1/4 0:0 1/2 : 0

ITALIAN SERIE A Cagliari vs Chievo Palermo vs Catania Roma vs Napoli

0 : 1/4 0 : 1/4 0:0

SPANISH LA LIGA Espanyol vs S Gijon Getafe vs Mallorca Levante vs Granada R Sociedad vs Santander Villarreal vs Osasuna

0 0 0 0 0

: : : : :

1 1/2 1/2 1 3/4

„ Szczesny

LIVE Malam Ini Pukul 20:30 WIB

42 41 21

Ronaldo Lionel Messi Higuaín

Real Madrid Barcelona Real Madrid

SERIA A ITALIA KLASEMEN SEMENTARA 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Juventus Milan Lazio Udinese Napoli Roma Inter Catania Chievo Siena Palermo Bologna Parma Atalanta Fiorentina Cagliari Genoa Lecce Novara Cesena

33 33 33 33 33 33 33 33 33 33 33 33 33 33 33 33 33 33 33 33

19 20 16 14 13 15 14 11 11 11 11 10 10 11 9 9 9 8 5 4

14 8 7 10 12 5 7 13 10 9 8 11 11 13 11 11 9 11 10 10

0 5 10 9 8 13 12 9 12 13 14 12 12 9 13 13 15 14 18 19

57-18 63-27 49-41 44-32 58-41 52-46 47-45 44-43 30-40 41-35 46-51 34-39 44-50 37-36 32-38 33-42 44-62 38-49 27-56 21-50

71 68 55 52 51 50 49 46 43 42 41 41 41 40 38 38 36 35 25 22

PENCETAK GOL

24 20 20

Ibrahimovic Cavani Diego Milito

Milan Napoli Inter

Spanyol Digdaya

„ Athletic Bilbao dan Atletico Madrid berhasil menciptakan All Spanish Final UEFA 2012

Walau gagal di Liga Champion setelah Barcelona dan Real Madrid tersingkir, namun kedigdayaan klub Spanyol masih terasa di Liga UEFA. Athletic Bilbao dan Atletico Madrid sukses menciptakan final sesama klub Spanyol di Liga Europa musim ini. Itu menjadi “final Spanyol” keenam di Eropa, sebuah rekor tersendiri. Di partai leg II semifinal Liga Europa,Jumat(27/4)dinihariWIB,Bilbao dan Atletico sama-sama berhasil mengamankantiketkepartaipuncak. Di kandang Valencia, Atletico

berhasil menang 1-0 untuk menambah agregat menjadi 5-2 sementara Bilbao yang menjamu Sporting Lisbon menang 3-1 untuk menjadikan agregat 4-3. Keberadaan Bilbao dan Atletico di final Liga Europa itu menjadi kali keenam dua klub Spanyol bersaing dalam partai puncak kompetisi antarklub Eropa, seperti dicatat Infostrada Live. Torehan tersebut merupakan rekor tersendiri, melewati capaian lima partai final antara sesama klub asal Italia di kancah Eropa. (int)


Edisi 265 „ Tahun VIII

SABTU, 28 APRIL 2012

Barcelona Kehilangan Pep

Hujan Deras, Bukit Pemakaman Longsor

PELATIH Barcelona, Pep Guardiola, memutuskan untuk meninggalkan klub pada akhir musim. Hal ini disampaikan dalam keterangan pers yang digelar di Camp Nou, Jumat (27/4). ‹ ‹ Baca

Barcelona..Hal 7

„ Angelina bersama anak-anaknya.

Angelina Sondakh

Minta Anak-anak Kuat

SIBOLGA- Perbukitan yang menjadi areal pemakaman HKBP Sibolga Julu di Lingkungan Satu, Kel. Angin Nauli Aek Parira, Sibolga Utara diterjang longsor, menyebabkan tulang-belulang berserak. Hujan deras itu terjadi Kamis (25/4) sekira pukul 22.00 WIB. Sebelum kejadian Albiner Pasaribu, Anton Tobing dan beberapa orang lagi berbincang-bincang di teras kedai milik M Sihombing. Dan tiba-tiba dari arah pemakaman di perbukitan mereka mendengar suara keras seperti pohon besar patah. “Jarak perbukitan itu sekitar 100 meter dari kedai. Tapi karena hujan deras kami tidak menghiraukannya,” tutur Albiner Pasaribu. Barulah Jumat (26/4) sekitar pukul 06.30 WIB, Albiner ke luar dari rumah dan melihat banyak warga di lokasi pemakaman.

„ Pep Guardiola

Mou dengan Gaji Tertinggi 1. Jose Mourinho (Real Madrid) 2. Carlo Ancelotti (PSG) 3. Pep Guardiola (Barcelona) 4. Arsene Wenger (Arsenal) 5. Guus Hiddink (Anzhi) 6. Fabio Capello (Ex-Inggris) 7. Sir Alex Ferguson (Man Utd) 8. Dick Advocaat (Rusia) 9. Jose Camacho (China) 10.Roberto Mancini (Man City)

JAKARTA- Setelah menjalani berjam-jam pemeriksaan, Angelina Sondakh ditahan atas kasus Wisma Atlet yang dibawahi Kemenpora dan juga kasus Kemendikbud. Pesan terakhir Angie sebelum ditahan adalah mengenai anak-anaknya. Selama menghadapi masalah

14,8 juta euro 13,5 juta euro 9,5 juta euro 9 juta euro 8,6 juta euro 8,5 juta euro 8 juta euro 7 juta euro 6,1 juta euro 5,9 juta euro

‹ ‹ Baca

Minta ..Hal 2

„ Bhatoegana ketika berada di Madina menyatakan maju dalam pemilihan Gubernur Sumut 2012.

KISARAN- Pelarian Egan alias Sidabutar (40) kandas. Pemerkosa gadis di bawah umur, sebut saja Melati (11), yang juga putri kandungya ditangkap di Jorlang Hataran Simalungun, Kamis (26/4) sekitar pukul 24.00 WIB.

Bhatoegana, Pilih Gubsu Ketimbang Menteri (FOTO: DUNGO)

KUBURAN LONGSOR: Pemakaman HKBP Sibolga julu di perbukitan Kelurahan Angin Nauli Aek Parira, Sibolga diterjang longsor. Sedikitnya 50 makam mengalami kerusakan hingga mengakibatkan tulang-belulang terbongkar dari kuburan.

Ayah..Hal 2

Pasca Longsor di Kelurahan Hutabarangan, Sibolga

Dapat Rp500 Ribu plus Beras dan Mi Instan Walikota Sibolga Syarfi Hutauruk menyerahkan bantuan kepada 43 kepala keluarga korban kebakaran dan bencana longsor di Kelurahan Hutabarangan, Jumat (27/4). Per orang pun dapat bantuan Rp500 ribu dari Sarfi Hutauruk. “Tadi malam saya dan sejumlah SKPD, Camat, Lurah dan Kepling meninjau lokasi dan para korban dan longsor. Memang, ‘penyakit’ di Sibolga ini kalau hujan lebat alamat akan terjadi longsor, umumnya di kawasan perbukitan yang

‹ ‹ Baca

Warga..Hal 2

Ayah Pemerkosa Putri Kecilnya Ditangkap

‹ ‹ Baca

tersebut, Angie memang lebih mementingkan keluarga terutama ketiga anaknya. Ia pun berharap Zahwa, Aaliya dan Keanu kuat menghadapi masalah itu. Asisten Angie, Kahfi Siregar sempat berbincang sesaat se-

(FOTO:METRO/MARIHOT SIMAMORA)

BANTUAN– Walikota Sibolga Syarfi Hutauruk menyerahkan bantuan kepada 43 kepala keluarga korban kebakaran dan bencana longsor di Sibolga, Jumat (27/4).

struktur tanahnya lembek. Kalau sudah cuaca begitu, atau ada terjadi bencana alam, saya selalu stand by,” tutur Syarfi saat penyerahan bantuan. Syarfi pun mengajak warga untuk lebih sadar lingkungan. Seperti dalam hal membuang sampah pada tempatnya. Bukan di parit, sungai atau ke laut. Kemudian terkait sikap serba salah soal ketegasan aturan larangan membangun rumah di kemiringan 45 derajat. “Bencana alam bukan kehendak siapa-siapa. Tapi perlu diperhatikan agar tidak membuang sampah sembarangan ke parit. Karena kalau sudah tersumbat, hujan datang, maka banjirlah. Lalu soal ‹ ‹ Baca

Dapat..Hal 7

MADINA- Pengurus DPP Partai Demokrat Sutan Bhatoegana Siregar mengaku lebih memilih menjadi Gubernur Sumatera Utara (Gubsu) dibanding Menteri. Alasannya; ingin mengabdi untuk kampung halaman. Hal ini ditegaskannya di hadapan seratusan masyarakat

‹ ‹ Baca

Bhatoegana..Hal 7


SABTU

28 April 2012

Tiga TKI Tewas Diberondong Polisi Malaysia JAKARTA— Berdasarkan penelusuran Direktur Pengamanan Kedeputian Perlindungan Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia Brigadir Jenderal(Pol)BambangPurwantoselamadiMalaysia pada 24-25 April 2012¸ ditemukan keterangan yang mengarah pada fakta bahwa tiga TKI asal Lombok Timur, Nusa Tenggara Barat, memang diberondong peluru oleh lima polisi Malaysia. Hal itu disampaikan Bambang di Jakarta, Jumat (27/4), terkait kematian ketiga TKI secara sadis, yaitu Herman (34) dan Abdul Kadir (25) asal Dusun Pancor Kopong, Desa Pringgasela Selatan, Pringgasela, Lombok Timur, serta Mad Noor (28) yang beralamat di Dusun Gubuk Timur, Desa Pengadangan, Pringgasela, Lombok Timur.

Untukmenelusuriprosedurpenembakantiga TKI yang tidak wajar itu, Bambang sempat mendatangi kepolisian di Malaysia dan mendapatkan keterangan akan segera diumumkan pihak berwenang di sana. “Mereka hanya menegaskan secepatnya dan soal persis waktunya tidak disampaikan,” ujar Bambang. Menurut dia, penembakan tiga TKI terjadi di area Port Dickson, Negeri Sembilan, Malaysia, pada 24 Maret 2012 sekitar pukul 05.00 waktu setempat. “Penembakan dilakukan atas dugaan para TKI melakukan upaya perampokan di kawasan Kampung Tampin Kanan Tinggi, Port Dickson, Negeri Sembilan,” paparnya. Ketika diberondong tembakan, kata Bambang, ketiga TKI diketahui polisi menggunakan masker di wajah, membawa parang, serta

menggunakan sarung tangan. Keterangan yang diperolehjugamenyebutkan,paraTKIberusaha melawan sehingga polisi melepaskan tembakan berkali-kalikebagianwajahdantubuhataudada, yang kemudian membuat ketiganya meninggal dengan cara mengenaskan. Ia menambahkan, jasad para TKI lantas dibawakeRumahSakitPortDickson,tetapitidak langsung dilakukan tindakan otopsi karena ketiadaan data diri. Otopsi baru dilakukan pada 26 dan 27 Maret 2012 setelah ada penyataan oleh Wildan selaku keluarga dekat para korban, di samping penegasan seorang majikan bernama Lim Kok Wee, yang juga mengenal Abdul Kadir sebagai pekerjanya. Keduanya bertandang ke rumah sakit dengan diantar polisi pada 25 Maret 2012. Otopsi pertama dilakukan pada 26 Maret terhadap dua jenazah, yaitu Abdul Kadir Jaeleni

danHerman.JasadAbdulKadirditanganidokter Mohd Khairul Izzati Omar, sedangkan dokter MuhammadHuzaifahRahimmengotopsijasad Herman. Selanjutnya, keesokan harinta, giliran jasad Mad Noor yang diotopsi dokter Safooraf. “Hasilotopsimenyimpulkan,merekatewasoleh tembakan berkali-kali di bagian kepala atau tubuh korban,” kata Bambang. Sijil (sertifikat kematian) menyangkut ketiga TKI itu dikeluarkan rumah sakit pada 26 Maret untuk Abdul Kadir dan Herman, sementara untuk Mad Noor keluar pada 27 Maret. Informasi Ada Organ TKI yang Hilang Kepala Pusat Kedokteran dan Kesehatan Polri Brigadir Jenderal Ahmad Musaddeq mengatakan dugaan keluarga yang menyebut adapengambilanorgantubuhpadajenazahTKI asal Nusa Tenggara Barat tidak benar. Dugaan

itu, kata dia, wajar karena keluarga tidak mengetahui mengenai proses secara teknis otopsi yang dilakukan kepolisian Diraja Malaysia setelah adanya penembakan pada Herman, Abdul, Kadir Jaelani, dan Mad Noor. Kakak dari Abdul Kadir Jaelani, Hirman sempat menduga organ mata milik adiknya diambil. Kecurigaan itu muncul karena ada jahitan di sekitar matanya. Namun, ini dibantah oleh Musaddeq setelah mendapatkan hasil otopsi resmi dari pihaknya di Polda NTB. “Memang ada peluru yang kena alis mata kiri. Itu berarti kan mungkin menyerempet ke bola matanya sehingga bola mata itu harus dikeluarkan. Kita harus melihat lukanya kena seberapa, berapa besar lukanya dalam rangka kita untuk menentukan penyebab kematian,” paparnya. (kdc)

Warga Mencari Tulang-belulang Keluarganya Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Tapanuli, Metro Siantar, Metro Asahan, Metro Tabagsel) Chairman : Rida K Liamsi Komisaris Utama : Makmur Kasim Komisaris : Kadafi Direktur Utama : Marganas Nainggolan Direktur : Goldian Purba Pengasuh Pemimpin Umum/Penjab/GM : Marganas Nainggolan Wa PU/Pimpinan Perusahaan : Maranatha Tobing Pimred Metro Tapanuli : Alvin Nasution Pimred Metro Siantar : Pandhapotan MT Siallagan Pimred Metro Tabagsel : Muhiddin Hasibuan Pimred Metro Asahan : Eva Wahyuni Wapimred Metro Tapanuli : Daniel Simanjuntak Tim Ombudsman : Vincent Wijaya DIVISI PRODUKSI Departemen Redaksi Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Alvin Nasution, Eva Wahyuni, Muhidin Hasibuan, Daniel Simanjuntak, Leonardus Sihotang, Syafruddin Yusuf, Nurjannah, Hermanto Sipayung. Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput). Sekretaris Redaksi: Yanti Nurhapni METRO SIANTAR Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta) Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). METRO TABAGSEL Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina). METRO ASAHAN Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang). Departemen, Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS. Kordinator Teknisi, Maintenance IT: Irwan Nainggolan. Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria. Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika. Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman. Staf Pengembangan: Simson Winata, Roy Amarta, Ismail, Efendi Tambunan. Kordinator Ekspedisi: Jhon Tua Purba. Staf Ekspedisi: Nico, Ardi, Erik. Departemen Iklan Manager Iklan: Jamot S. Kord Iklan: Bambang Satria, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi. Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat. Perwakilan Metro Asahan Ka Perwakilan/Ka Biro Usaha: Darwin Purba. Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa. Kuasa Hukum: Binaris Situmorang SH Tarif Iklan: Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan: Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp: (0622) 7553511, Fax (0622) 7553501 Siantar. e-mail: metrosiantar@yahoo.com. Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak: PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733.

Sambungan Halaman 1 “Ternyata pekuburan baru HKBP Sibolga Julu longsor sepanjang sekitar 100 meter,” katanya. Diterangkan Albiner lagi, tulang- belulang juga berserak di bercampur tanah yang longsor. “Ada sekitar 50 kuburan yang ikut terkena longsor. Ada tulang

seperti tulang kaki dan tangan. Peti mati juga terbongkar. Dan ditaksir ada seratusan kuburan di lokasi perbukitan itu. Sebab dalam satu tempat ada dua dan tiga jenazah yang dimakamkan,” terang Albiner. Adalah Tiur Boru Panjaitan sambil menangis mencari tulangbelulang anggota keluarganya

Minta Anak-anak Kuat Sambungan Halaman 1 belum Angie diperiksa KPK. Menurutnya, saat diperiksa KPK pun yangdipikirkanAngiehanyalahanakanak. “Mohon doanya. Semoga Zahwa, Aaliya dan Keanu kuat,” ujarnya kepada detikHOT, Jumat (27/4). KPK telah menetapkan Angelina Sondakh sebagai tersangka kasus dugaan suap Wisma Atlet, Palembang dan korupsi anggaran di Kemendikbud.Sejumlahsaksidalam persidangan terhadap tersangka utama Nazarudin menyebut dugaan keterlibatan Angelina dalam kasus tersebut. KPK menahan Angelina Son-

dakhsetelahKPKmenemukanaliran dana yang diterima Angelina Sondakh dalam sejumlah proyek di beberapa universitas di Kemendiknas (Kementrian Pendidikan Nasional) atau sekarang Kemendikbud. Angelina atau Angie adalah tersangka kasus dugaan suap dalam kepengurusan anggaran di Kementerian Pemuda dan Olahraga serta di Kementerian Pendidikan Nasional (sekarang Kementerian Pendidikan dan Kebudayaan) 2010/ 2011. Angelina ditahan KPK seusai menjalani pemeriksaan selama sekitar tujuh setengah jam di gedung KPK.

Angie digiring petugas KPK dari pintu gedung KPK hingga ke Rumah Tahanan Salemba Cabang KPK yang berlokasi di basement Gedung KPK. Tampak puluhan anggota Kepolisian mengamankan jalannya AngiemenujuRutanKPKdibelakang gedung KPK. Mengikuti dalam rombongan, ayah Angie, Lucky Sondakh dan adik iparnya Mudjie Massaid. Dalam kasusnya, Angie selaku anggota Badan Anggaran DPR 2011 diduga menerima pemberian atau janji terkait kepengurusan proyek di dua kementerian tersebut. Berapa nilai uang yang diduga diterima Angie, belum disampaikan KPK. (int)

kan longsor. Kepada koran ini, Tiur mengaku anaknya Sabam Tambunan baru meninggal satu tahun lalu. Dan kepada Camat setempat, Tiur memohon bantuan untuk mencari tulangbelulang anggota keluarganya. Camat Sibolga Utara Marajahan Sitorus dan Lurah Angin Nauli Aek Parira Pariama Siburian, mengatakan telah berkoordinasi dengan Pdt HKBP Sibolga Julu S Siahaan STH bersama ruas HKBP, menanggulangi pemakaman yang terkena longsor. “Dalam satu minggu ini jika ada

Barcelona Kehilangan Pep

Sambungan Halaman 1

Pep didampingi Presiden Barcelona, Sandro Rosell, dan Direktur Olahraga, Andoni Zubizarreta. Pengumumannya disiarkan secara langsung di Barca TV dan secara streaming melalui situs klub. Pelatih berusia 41 tahun ini mengakhiri kontrak empat tahunnya bersama klub berjuluk “Blaugrana” itu. AFP mencatat keputusan Pep disampaikan pertama kali oleh Presiden, Rosell. “Saya selalu ingin kontrak yang singkat karena tuntutan Barcelona begitu besar,” ungkapnya seperti dilansir oleh Reuters. “Sekarang kami keluar dari dua kompetisi utama, ini adalah waktu yang baik untuk mengumumkannya. Alasannya sederhana. Empat tahun ini membuat semua orang lelah,” tambahnya kemudian. Keputusan ini diambil oleh Pep menyusulkegagalanBarcamelajuke babak final Liga Champions musim ini dan makin tipisnya peluang mereka untuk meraih gelar La Liga. Dalam kesempatan ini, pelatih berusia 41 tahun itu berharap pelatih Barca yang baru nanti dapat

membawa Carles Puyol dan kawankawan berprestasi dalam kompetisikompetisi yang diikuti. “Pelatih baru akan memberikan sesuatu yang tak dapat saya berikan sebelumnya,” katanya. Pep juga meminta maaf atas kesimpangsiuran berita mengenai masa depannya di Barcelona dalam dalam beberapa minggu terakhir. Dalam keterangan pers ini, Pep didampingiolehPresidenBarcelona, Sandro Rosell, dan Direktur Olahraga, Andoni Zubizarreta. Pengumumannya disiarkan secara langsung di Barca TV dan secara streaming melalui situs klub. Sementara Presiden Barcelona, Sandro Rosell, mengucapkan terima kasih yang tak terhingga kepada kinerja Pep selama ini. “Pep Guardiola tak akan melanjutkan perannya sebagai pelatih musim depan.Terimakasihuntukpekerjaan dan cintamu,” ungkap Rosell dalam keterangan pers bersama Pep di Camp Nou, Jumat Kabar hengkang Pep membuat BarcelonakembalimembidikPelatih Athletic Bilbao, Marcelo Bielsa, sebagai kandidat pelatih Lionel Messi dan kawan-kawan berikutnya.

NAFAS SESAK KARENA ASMA, HILANG BERKAT MINUM SUSU KAMBING dalam susu kambing bermanfaat Ketika asma sudah sehat, tidur jadi nyenyak, menyerang, saluran nafas mengalami penyempitan k a r e n a hiperaktifitas terhadap rangsangan tertentu, yang menyebabkan peradangan. Pada penderita asma, penyempitan saluran pernafasan merupakan respon terhadap rangsangan yang pada paru-paru normal tidak akan mempengaruhi saluran pernafasan. Penyempitan ini dapat dipicu oleh berbagai rangsangan, seperti serbuk sari, debu, bulu binatang, asap, udara dingin dan olahraga. Sekian lama berobat, akhirnya Karsini, seorang guru tertarik mencoba Milkuma, minuman serbuk susu kambing yang diproses secara alami, tanpa pemanis buatan dan bahan pengawet. Bahan dasarnya adalah susu kambing peranakan ettawa segar dan Gula Aren. "Sejak tahun 1990, saya menderita asma. Kalau sudah kambuh, nafas jadi payah atau sesak dan bunyi, mau ngomong jadi susah. Untunglah kini saya minum Milkuma, sekarang saya

yang ikut terkena longsor. “Di mana, di mana anakku, suamiku Gumpar, dan mertuaku yang aku sayangi itu. Tunjukkanlah dirimu, aku sudah rindu suamiku, ingin melihatmu. Aku tidak tahu lagi entah di mana keberadaan suamiku, anakku, dan mertuaku,” kata Tiur meratap sambil mengorek-ngorek tumpu-

berat badan pun sudah naik." Terang wanita berusia 52 tahun tersebut. Ia menceritakan, sudah 6 bulan ini minum Milkuma. Setelah merasakan manfaat susu kambing ini, ibu 3 orang anak ini pun mengajak orang lain untuk merasakan manfaatnya, "Mari kita sehat bersama Milkuma." Ajak warga Desa Pematang Raya, Kec. Raya, Kab. Simalungun, Sumatera Utara tersebut. Sebenarnya, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu kambing. Berbeda dengan susu sapi, sesungguhnya susu kambing memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Selain mengandung Riboflavin, vitamin B yang penting untuk produksi energi, susu kambing pun jarang menyebabkan alergi sehingga aman, dan bermanfaat untuk penderita asma. Satu gelas susu kambing memasok 20,0% dari nilai harian Riboflavin. Selain itu, mengkonsumsi Milkuma sebanyak 2 gelas sehari bermanfaat untuk menjaga daya tahan tubuh dan meningkatkan vitalitas. Fluorine yang terdapat

sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan tidak menimbulkan dampak diare pada orang yang mengkonsumsinya. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Ditambah dengan kandungan Gula Aren bermutu tinggi sebagai pemanisnya, menjadikan Milkuma sebagai pilihan bijak untuk kesehatan. Untuk memperoleh hasil yang maksimal, terapkan pola hidup sehat seperti disiplin dalam pola makan, dan berolahraga, serta mengkonsumsi air putih paling sedikit 8 gelas/ hari. Dapatkan informasi lengkap tentang Milkuma di www.milkuma.com. Milkuma sudah tersedia di apotek2 juga toko2 obat terdekat dikota anda, atau hubungi, Sumut : 085314072195 / 061-91128785. Depkes RI NO. PIRT.6.09.3328.01.395.

Bielsa yang sukses membawa Bilbao ke final Copa del Rey dan final Liga Europadinilaipunyakapasitasuntuk mengisi posisi tersebut. Namun, Bielsa bukan satusatunya kandidat. Dilaporkan bahwa manajemen Barcelona juga mempertimbangkan asisten Pep saat ini, Tito Vilanova. Pelatih AS Roma yang sempat menjadi bos Barcelona B, Luis Enrique, dan mantan pelatih yunior Barcelona, Oscar Garcia, juga masuk perhitungan. Namun, Bielsa tetap jadi favorit utama. Pep sendiri salah seorang yang memberikan kata pujian untuk pelatih asal Argentina itu. “Saat ini Bielsa pelatih terbaik di planet ini. Kami beruntung memiliki dia di La Liga (Liga BBVA), sehingga kami dapat belajar darinya. (Keberhasilan Bilbao) lolos (ke perempat final) adalah hadiah dari sebuah pertandingan,” ujar Guardiola. Bielsamemanglayakdipuji.Berkat tangan dinginnya, Bilbao menjadi kekuatan baru di Liga BBVA musim ini. Permainan indah satu dua sentuhan menjadi ciri khas Bilbao sejak ditangani Bielsa. (int)

yang mengenal mayat keluarganya, bisa diambil dengan cacatan harus ada laporan dari pemerintah setempat, setidaknya Kepling Lingkungan I Daula Hatun Marbun dan kepada Pdt HKBP,” kata Marajahan. “Sesudah satu minggu ini kita akan mengadakan penguburan massal di lokasi yang lebih strategis. Tapi untuk sekarang belum bisa kita pastikan dimana lokasi pemakaman itu, tunggu kordinasi dulu dengan pendeta HKBP dan ruas HKBP,” kata Marajahan. (ngo)

261 Anggota DPRD di Sumut Bermasalah JAKARTA- Sepanjang tahun 2004 hingga 2012, sudah dikeluarkan izin pemeriksaan terhadap 261 anggota DPRD Kabupaten/Kota se-Sumut. Jumlahinimendudukiperingkat keduasetelahJawaTengahyang sebanyak 658 anggota DPRD kabupaten/kota di sana telah diberikanizinpemeriksaan. Izin pemeriksaan dikeluarkan kepadaparawakilrakyatituuntuk status terdakwa, tersangka, maupun saksi. Untuk anggota DPRD kabupaten/kota di Aceh, hanya73izinpemeriksaan.Posisi keduadidudukiduadaerah,selain SumutadalahSulawesiUtara,yang sama-sama261izinpemeriksaan. Data ini merupakan hasil rekapan dari Kementerian DalamNegeri(Kemendagri)yang disampaikan Kapuspen Kemendagri, Reydonnyzar Moenek, kepada wartawan, kemarin(27/4). Total seluruh Indonesia jumlah anggota DPRD kabupaten/ kota yang sudah keluar izin untuk pemeriksaannya sebanyak 2.545 orang. Sedang untuk DPRD tingkat provinsi, jumlahnya mencapai 431 anggota dewan. Jadi, total mencapai 2.976 izin pemeriksaan untuk anggota dewan provinsi dan kabupaten/kota. Untuk 431 dewan provinsi, dirinci 137 izin pemeriksaan untuk kepolisian dan 294 untuk kejaksaan. Sayangnya, untuk data per provinsi ini, koran ini belummendapatkandata,guna

mengetahui berapa jumlah dewan Provinsi Sumut sepanjang 2004-2012 yang sudahadaizinpemeriksaannya. Hanya terdata bahwa untuk tingkat provinsi ini, kasus tertinggi adalah kasus korupsi yakni sebanyak 361 kasus (83,76 persen). Disusul pembunuhan 22 kasus, pemalsuan dokumen dan penggelapan barang masing-masing9kasus.Yanglain beragam, seperti perzinahan 1 kasus. Untuk tingkat dewan kabupaten/kota, sama saja. Terbanyak kasus korupsi 349 kasus (33,24 persen). Kasus penganiayaan 105, penipuan 119kasus,pemalsuandokumen 116 kasus, perzinahan/ pencabulan 22 kasus, perjudian 13 kasus, dan pembunuhan 6 kasus. Yang lain variatif. Reydonnyzar Moenek menjelaskan, data dijadikan evaluasidanmembuatregulasiregulasiterkaitmasalahtersebut, yang akan dimasukkan ke revisi UU Nomor 32 Tahun 2004. “Ini menyangkut apa dan bagaimana demokrasi dan demokratisasidimaknai,”ujarDonny, panggilan akrabnya. Yang dimaksud adalah bagaimana menekan ongkos politik saat pemilu legislatif. Karena semakin mahal, maka potensi bersikap korup makin besar. Ini karena kasus terbanyak adalah korupsi. “Ke depanakandirumuskanaturan agar biaya politik tak terlalu mahal,” ujarnya.(sam)

Ayah Pemerkosa Putri Kecilnya Ditangkap Sambungan Halaman 1 Informasi dihimpun METRO, penangkapan Egan dilakukan petugas Polres Asahan Unit Pelayanan Perempuan dan Anak (PPA). Di mana, sejak dilaporkan oleh istrinya karena memerkosa putrinya sejak umur 7 tahun, pelaku melarikan diri. Kasat Reskrim AKP Fahrizal mengaku pihaknya masih melakukan pemeriksaan terhadap pelaku pemerkosa putrinya. “Berdasarkan keterangan korban dan saksi-saksi serta hasil visum, besar dugaan tersangka melakukan perbuatan itu,” kata Fahrizal.Sementara Egan alias Sidabutar ketika ditanya, membantah semua tuduhan yang dialamatkan kepadanya. Dia menuturkan, sama sekali tidak ada melakukan perbuatan senonoh itu terhadap putrinya. “Tidak ada kujadikan putriku jadi budak sex,” katanya singkat. Sekadar mengingatkan, perbuatan Egan menggagahi putri kandungnya, Melati (11), terkuak saat putrinya mengigau karena mengalami demam

tinggi. Padahal, aksi Egan yang merupakan warga Kisaran itu, sudah terjadi selama setahun. Ibu kandung Melati yang juga istri Egan, Me (38) kepada METRO, Kamis (19/4) menerangkan, beberapa hari lalu Melati mengalami demam. Suhu tubuhnya cukup tinggi. Saat tidur, kata Me, Melati mengigau. “Jangan ayah, jangan ayah,” kata Melati berulangulang seperti ditirukan ibunya. Mengetahui kondisi putrinya, Me bingung dan merasa khawatir. Begitu Melati terbangun dan sadarkan diri, siswi kelas 6 SD itu langsung memeluk ibunya sambil menangis. Pelan-pelan, Me menanyakan kepada Melati apa yang telah terjadi. Sambil terus menangis, Melati mengaku telah menjadi budak nafsu ayahnya sendiri sejak setahun lalu. Mendengar pengakuan Melati, Me menjerit dan menangis. “Saya menjerit seketika saat anak saya mengadukan hal itu. Dari situlah mulai terbongkar kalau Melati selama ini menjadi

budak nafsu ayah kandungnya,” kata Me, sambil terus menangis. Me sama sekali tidak menyangka suami tercintanya itu tega merusak masa depan putri sulungnya. Padahal, kata Me, dirinya selalu berusaha melayani suaminya dengan baik, jangan sampai mengecewakan. “Entah setan apa yang merasuki sehingga dia tega berbuat demikian,” tukasnya. Masih menurut perempuan yang sehari-hari bekerja di kantor biro jasa itu, saat ini suaminya merantau ke luar daerah. Suaminya, sambungnya, belum tahu perbuatan bejadnya sudah terbongkar. “Dengan dukungan seluruh keluarga, saya akan membawa masalah ini ke ranah hukum, karena tindakan suami saya itu sudah di luar batas prikemanusiaan!” tegasnya. Paman korban, Warkam mengaku keluarga besarnya tidak terima atas perbuatan Egan. Keluarga, kata dia, memberikan dukungan moril agar Me melaporkan suaminya ke polisi. “Kami dukung Me melaporkan

suaminya ke polisi,” kata Warkam sembari meminta Melati jangan diwawancara karena masih trauma. Me mendatangi Polres Asahan untuk melapor. Selanjutnya Melati didampingi ibunya menuju RSU Kisaran untuk menjalani visum. Kapolres Asahan AKBP Yustan Alpiani melalui Kasubbag Humas AKP R Berutu didampingi Kanit Pelayanan Perempuan dan Anak ( PPA) Aptu Erika Tumanggor, membenarkan pihaknya ada menerima pengaduan ibu rumah tangga yang anaknya telah digagahi suaminya. “Laporannya diterima dan korban sudah diambil visumnya di RSU Kisaran,” kata Erika. Masih kata Erika, Me dan Melati sudah dimintai keterangan. Begitu juga saksi-saksi yang dihadirkan Me. “Sudah diambi keterangan dari korban, termasuk ibunya,” kata Erika sembari mejelaskan tindakan selanjutnya menunggu hasil visum dari RSU Kisaran. (sus/ smg)

DALAM PELIPUTAN, WARTAWAN METRO TAPANULI SELALU DIBEKALI IDENTITAS DIRI DAN TIDAK DIBENARKAN MEMINTA SERTA MENERIMA APAPUN DARI NARASUMBER BILA ADA YANG MERASA DIRUGIKAN OLEH WARTAWAN METRO TAPANULI, DIMINTA UNTUK MELAPOR KE PIHAK BERWAJIB ATAU HUBUNGI 0631-24676


SABTU

28 April 2012

Tanggul Aek Sirahar Jebol

Pos Pemantau Laut & TPI Terancam Hanyut BARUS-Pos Pemantau Laut dan Tempat Pelelangan Ikan (TPI) di Desa Pasar Terandam, Kecamatan Barus, Kabupaten Tapteng, terancam hanyut terseret arus Sungai Aek Sirahar. Penyebabnya, tanggul Aek Sirahar yang ada di hulu kedua bangunan pemerintah tersebut jebol dihantam banjir beberapa minggu lalu. Sehingga derasnya air sungai langsung menerjang pondasi bangunan Pos Pemantau Laut dan TPI tersebut. Menurut Syahnan Situmeang dan Rian Tanjung, warga setempat, Jumat (27/4), apabila tanggul tersebut tidak segera diperbaiki, dalam waktu dekat kedua bangunan tersebut akan ambruk dan terseret arus sungai. “Kalau setiap hari pondasi bangunan Pos Pemantau laut ini diterjang arus sungai, maka bangunan ini akan hanyut. Ka-

lau kedua bangunan ini hanyut, kerugian negara untuk membangun pos pemantau laut ini mencapai miliaran rupiah,” tutur Syahnan diamini Rian. Selain kedua bangunan pemerintah ini, tambah Syahnan, ratusan rumah penduduk yang ada di Desa Pasar Terendam juga terancam terjangan sungai Aek Sirahar. “Untuk itu kami atas nama masyarakat meminta kepada Pemerintah Tapanuli Tengah agar membangun tanggul penahan banjir yang jebol tersebut. Jika tidak dalam waktu dekat bencana dikhawatirkan akan menimpa warga setempat,” ujar keduanya.(mas/nasa)

Dody: Pemuda Motor Pembangunan

„ Inilah pos pemantau laut yang ada didesa Pasar Terandam terancam hanyut diterjang arus sungai, karena tanggul penahan banjir am.

Undian Simpedes se-Kanca BRI Psp

Tolip Batubara Peroleh Xenia New SIDIMPUAN- Pada penarikan Undian Simpedes Semester II tahun 2011 periode Juli-Desember 2011 se-Kantor Cabang (Kanca) BRI Psp, Jumat (27/4) di gedung nasional Psp, Tolip Batubara berhak mendapat 1 unit mobil Xenia New VVT-I 1.0 MI. Saat itu, Tolip Batubara yang merupakan nasabah BRI Unit Sipirok, Tapsel beruntung dengan nomor kupon 00001570173 yang menyebutnya menjadi pemenang hadiah utama. Pinca BRI Psp, Iskandar Zulkarnain melalui AMBM BRI Cabang Psp, H Muhammad Husni Lubis dalam sambutannya menyampikan, pena-

rikan undian Simpedes Semeter II tahun 2011 dilaksanakan 4 kali setahun. Rinciannya, pertama di tingkat Kantor Cabang BRI (2 kali setahun) di seluruh Kancar BRI seIndonesia. Nomor undian dihitung berdasarkan kelipatan Rp100.000 dari saldo terendah dalam setiap bulan takwin. Kedua, di tingkat kantor WilayahBRI(2kalisetahun)diseluruh Kanwil BRI se-Indonesia. Nomor undian dihitung berdasarkan kelipatan Rp100.000 dari saldo terendah dalam satu tahun takwin. Dalam pelaksanaan undian hadiahSimpedestersebutucapnya,di sampingmemberikanpeluangke-

padanasabahuntukmendapatkan hadiah, juga diharapkan dapat membinakomunikasidanmenjalin silaturahmi dengan para nasabah Simpedes yang telah menabungdi SimpedesBRI. Dalam kesempatan itu, pihaknya menyampaikan kinerja usaha BRI unit sewilayah Kanca BRI Psp posisi semeter II tahun 2011 dalam jutaan dengan rincian total Simpedes 68.677 orang dengan nominal Rp286.475,-, total Simpanan 74.075 orang dengan nominal Rp337.169,-, total KUR Mikor 5.040 orang dengan nominal Rp38.474,, total Kupedes 19.678 orang dengan nominal Rp453.152,-. Total

Simpedes dibandingkan dengan total Simpanan 84,96 persen dan total Simpedes dibandingkan total Kupedes 63,22 persen. Disampaikannya, adapun hadiah undian Simpedes periode Semester II tahun 2011 yang di undi Jumat(27/4)kemarinberjumlah40 hadiah. Hadiah utama, 1 unit mobil Daihatsu Xenia New VVT-I 1.0 MI P, hadiah ke-2 sepeda motor Mio Soul sebanyak 5 unit, hadiah ke-3 sepeda motor Vega ZR Jari sebanyak 6 unit, hadiah ke- 4 berupa TV LCD 32 inci Samsung sebanyak 8 unit, hadiah ke-5 berupa TV LCD 26 inci Samsung sebanyak 9 unit, hadiah ke-6 berupa mesin

cuci Sanken sebanyak 11 unit. Walikota Psp diwakili Asisten I Pemko Psp, Rahuddin Harahap menyampaikan, orang-orang yang menabung di bank terutama di BRI adalah orang-orang yang memikirkan masa depannya. “Gemas menabung di bank sangat baik sebagai bekal di masa depan,” ucap Rahuddin. Penarikan undian tersebut diungkapkannyabisasemakinmenjalinsilaturahmi antara BRI dengan nasabah disampinguntukmendapatkanhadiah. “Semoga BRI semakin jaya sesuai denganslogannya,besarbersamamasyarakat melayani sepenuh hati,” tutur Rahuddin.(neo/mer)

TAPTENG-Ketua KNPI Tapteng periode 2012-2017, Dody Chairuddin Batubara ST mengatakan, pemuda sebagai generasi penerus bangsa yang mandiri dan bermartabat harus jadi motor pembangunan bangsa. Untuk itu, diperlukan pengkaderan baik dari sisi moralitas keagamaan dan wawasan. Agar ke depan, pemuda dapat tumbuh positif. “Dari sisi moralitas, bahwa pemuda harus menjauhkan diri dari pandangan umum masyarakat dimana pemuda cenderung sukanya hura-hura dan gontokgontokan, tanpa arah. Image itu harus dihapus,” Dody Chairuddin Batubara ST saat ditanya soal arah pembangunan pemuda Tapteng oleh KNPI ke depannya, di Pandan, Tapteng, Jumat (27/4). KNPI Tapteng sendiri, sambung dia, siap mengawal dan berjalan seiring dengan pemerintah dearah. Namun bukan berarti lepas dari memberikan kritik dan saran membangun. Dan perlu digarisbawahi, bahwa pemuda harus melibatkan diri dan dilibatkan dalam menjalankan program pembangunan daerah. “Agenda saya nanti akan mengajak para pemuda yang terhimpun dalam wadah KNPI unutk duduk bersama membahas arah, program dan misi pembangunan di Tapteng bersama unsur pemerintah daerah. Seperti kita tahu, Tapteng kini sedang giat-giatnya membangun sektor pariwisata dengan brand name-nya Negeri Wisata Sejuta Pesona. Kita siap untuk berperan di dalamnya,” timpalnya. Sebelum terpilih menjadi ketua KNPI Tapteng pada Muskab XII lalu, Dody juga aktif di berbagai organisasi pemuda seperti menjadi wakil ketua Pemuda Muslimin Indonesia Tapteng, wakil sekretaris Pemuda Pancasila Tapteng, Ketua BPC HIPMI (Himpunan Pengusaha Muda Indonesia Tapteng), dan aktif di kepengurusan Kwarcab Pramuka Tapteng. Menurut pengusaha muda ini, pemuda adalah tolak ukur dan kunci maju mundurnya masa depan sebuah negara. Bagaimana kondisi pemuda saat ini, kata dia, begitulah masa depan bangsanya. “Kalau pemudanya tidak bagus sekarang, maka masa depan bangsa juga terancam hancur nantinya. Makanya perlu pengkaderan, untuk mempersiapkan pemuda itu sebagai pemimpin bangsa kelak,” pungkasnya. (mor/ nasa)


SABTU

28 April 2012

APA KATA MEREKA Kalau mentalnya pimpinan negara masih mental calo maka persoalan TKI takkan pernah usai. Yang penting fee nya aja, tapi waktu rakyatnya susah di luar negeri tidak diusut, perlindungannya tidak serius.

Pangan adalah hak asasi setiap warga negara sehingga dengan demikian semua rakyat tanpa kecuali harus terjamin haknya untuk memperoleh pangan. Untuk itu harus ada aturan terkait pangan yang berpihak kepada rakyat.

Ketua Komisi IX DPR Ribka Tjiptaning, Jumat (27/4)

Ketua Dewan Pertimbangan HKTI Jafar Hafsah, Jumat (27/4)

Pemerintah berbicara demi kepentingan rakyat, tapi kenyataan rakyat bagai tikus yang nyaris mati di lumbung padi. Politisi dan penguasa sekarang ini mencari harta dan kekuasaan supaya mereka sepuasnya bisa menikmati korupsi. Aktivis Anti Korupsi Teten Masduki, Jumat (27/4)

Kirim Opini Anda ke email: metrotapanuli @yahoo.com. Maksimal tulisan 5.000 karakter.

Sikap Kami Tragedi TKI tiada Bertepi DERITA yang menimpa tenaga kerja Indonesia (TKI) di luar negeri benar-benar tiada bertepi. Rantai kekerasan begitu kuat membelenggumereka.Deritademideritapunterus terulang. TragediteranyarmenimpatigaTKIasalDusun Pancor Kopong, Pringgasela Selatan, Lombok Timur,NusaTenggaraBarat(NTB),yaituHerman, 34, Abdul Kadir Jaelani, 25, dan Mad Nur, 28. Mereka yang merantau ke negeri jiran untuk mengaisuangjustrupulangtanpanyawa. KetigaTKIitutewasakibatlakubengisaparat KepolisianDirajaMalaysiayangmemberondong merekadengantembakandiareaPelabuhanPort Dickson, Negeri Sembilan, 25 Maret dini hari. Alasannya, korban merampok sehingga perlu dihadiahipelurutajamberkali-kali. Mayat korban bahkan diperlakukan layaknyabukanjasadmanusia.Saatdiautopsidi RS Port Dickson sehari setelah kejadian, sejumlah organ tubuh ketiga TKI itu hilang atau sengaja dicuri untuk diperdagangkan. Kepolisian Malaysia tentu membantah keras tudingan itu. Namun, autopsi ulang oleh ahli forensikRumahSakitBhayangkaraPoldaNTB, kemarin, menunjukkan sebaliknya. Jenazah korbanyangdiangkatdariliangkuburdiperiksa dan hasilnya sungguh mengagetkan. Menurutkeluargakorbanyangmenyaksikan autopsi,jasadHermansaratkeganjilan.Kedua matanya hilang, kepala terbelah, bahkan ditemukan plastik di kepala dan beberapa alat bedahtertinggalditubuhnya.Apapunpenyebabnya, ketiga TKI tak layak dibunuh. Dipandangdarisudutmanapun,menghilangkanorgantubuhmanusiaadalahkejahatanluarbiasa. Tragediitusekaligusmenguatkanfaktabahwa TKIakrabdenganpenistaan. Belum hilang dari ingatan ketika Kikim Komalasari,TKIasalCianjur,JawaBarat,disiksa lalu dibunuh sang majikan dan mayatnya dibuangketempatsampahdiArabSaudi,dua tahunsilam.Atau,saatSumiati,TKIasalDompu, NTB, digunting mulutnya. Harus diakui, tragedi tiada henti yang melanda TKI tak lepas dari kegagalan negara dalam mengelola para pendulang devisa itu. Menteri tenaga kerja sudah berkali-kali berganti, tapi proses rekrutmen dan pengiriman TKI tetap saja amburadul. Itulah yang menyebabkan TKI menjadi sasaran empuk kekejaman di negeri orang. Pemerintah selalu semringah ketika menyebut para TKI sebagai pahlawan devisa karena memang uang yang mereka kirim ke Tanah Air mencapai Rp100 triliun. Tetapi, proteksi terhadap mereka terus saja minimal. Jika pemerintah tetap inferior, jika pembelaan negara hanya tampak ketika terjadi insiden, derita yang menimpa TKI tak akan berkesudahan. Kasus yang menimpa Herman, Abdul Kadir, Mad Nur, dan TKI lainnya takhanyamencabiknilaikemanusiaan,tetapi juga melukai harkat dan martabat bangsa ini. Kita mendesak pemerintah bersikap tegas demi harga diri bangsa serta harkat dan martabat warga negara. Menuntut pertanggungjawaban pemerintah Malaysia adalah keharusan. Dengan segala risiko, penghentian pengiriman TKI patut dipertimbangkan karena faktanya negara gagal melindungi mereka. Sebagai pengganti, negara harus menyediakanlapangankerjaseluas-luasnyadidalam negeri. (***)

Mendidik Anak Jadi Tugas Siapa? Banyak kita jumpai anak-anak zaman sekarang dalam pergaulannya sudah menodai norma-norma sosial yang ada. Masalah tersebut menimbulkan suatu pertanyaan. Siapa yang bertanggung jawab, orang tua, guru ataukah lingkungan sosial?

Candrawansah DALAM Undang-Undang Sistem Pendidikan Nasional No. 20/2003, pendidikan adalah usaha sadar dan terencana guna mewujudkan suasana belajar dan proses pembelajaran agar peserta didik secara aktif mengembangkan potensi dirinya untuk memiliki kekuatan spiritual keagamaan pengendalian diri, kepribadian, kecerdasan, akhlak mulia, serta keterampilan yang diperlukan dirinya, masyarakat, juga negara. Peran Orangtua Orang tua mempunyai tanggung jawab dari membesarkan dan mendidik anak hingga paham norma-norma yang ada. Sebenarnya seorang anak dibentuk beberapa faktor. Pertama, keluarga yang berperan utama dalam membentuk kepribadian anak. Bahkan, dalam Aquran hampir semua ayat yang berbicara tentang pendidikan anak; di antaranya yang artinya ’’Dan rendahkanlah dirimu terhadap kedua (orang tua) dengan penuh kasih sayang dan ucapkanlah, ’’Wahai Ragaimana mereka berdua telah mendidik aku sewaktu kecil’’. (QS Al-Isra: 17:24). Orang tua hendaknya memiliki pengetahuan dan visi yang sahih (benar) dan jelas akan arah pendidikan anak. Ayat di atas memberi bekal para orang tua agar mengarahkan pendidikan anak ke sikap bersyukur kepada Allah. Selain itu, juga perbuatanperbuatan kebajikan (amal saleh) yang diridai Allah. Visi ini harus melekat kepada orang tua di tengah berbagai tarikan-tarikan materialisme dalam tujuan kehidupan. Kedua, apa yang dibacanya (ilmu) termasuk di dalamnya adalah guru (dosen) sebagai tenaga pendidik. Ketiga, lingkungan. Kalau ini baik, anak bisa baik, juga sebaliknya. Begitu pula baik dan buruk kadar pendidikan kita. Peran Pendidik Tenaga pendidik (guru/dosen) merupakan jabatan atau profesi yang memerlukan keahlian khusus. Pekerjaan ini tidak bisa dilakukan seseorang tanpa memiliki keahlian sebagai pendidik. Untuk menjadi seorang tenaga pendidik, diperlukan syaratsyarat khusus. Apalagi, seorang tenaga

pendidik yang profesional harus menguasai seluk beluk pendidikan dan mengajar dengan berbagai ilmu pengetahuan lainnya. Di mana perlu dikembangkan melalui masa pendidikan tertentu. Tenaga pendidik merupakan unsur penting dalam keseluruhan sistem pendidikan yang akan membentuk karakteristik anak. Oleh karena itu, peranan dan kedudukan tenaga pendidik dalam meningkatkan mutu dan kualitas anak didik perlu diperhitungkan dengan sungguh-sungguh. Status tenaga pendidik bukan hanya sebatas pegawai yang hanya semata-mata melaksanakan tugas tanpa ada rasa tanggung jawab terhadap disiplin ilmu yang diembannya. Dalam pendidikan itu, tenaga pendidik mempunyai tiga tugas pokok yang dapat dilaksanakan yang dapat berupa, pertama, tugas profesional. Yaitu tugas yang berhubungan dengan profesinya. Tugas profesional ini meliputi mendidik, mengajar, dan melatih. Mendidik berarti meneruskan dan mengembangkan nilai-nilai hidup. Mengajar yakni meneruskan serta mengembangkan ilmu pengetahuan dan teknologi. Sedangkan melatih berarti mengembangkan keterampilan. Kedua, tugas manusiawi. Yaitu tugas sebagai manusia. Dalam hal ini tenaga pendidik bertugas mewujudkan keinginan anak untuk merealisasikan seluruh potensi yang dimilikinya. Ketiga, tugas kemasyarakatan. Yaitu tenaga pendidik sebagai anggota masyarakat dan warga negara seharusnya berfungsi sebagai pencipta masa depan dan penggerak kemampuan. Bahkan, keberadaan tenaga pendidik merupakan faktor penentu yang tidak mungkin dapat digantikan komponen mana pun dalam kehidupan bangsa sejak dulu. Peran Lingkungan Lingkungan adalah sesuatu yang berada di luar batasan-batasan kemampuan dan potensi genetik seseorang. Dan, ia berperan dalam menyiapkan fasilitas-fasilitas bahkan menghambat seseorang dari pertumbuhan. Lingkungan sosial manusia adalah faktor

penting dalam pembentukan ciri khas kejiwaan dan norma manusia, bahasa dan adab, serta kearifan lokal. Syahid Mutahhari berkata, meski tidak bisa memisahkan hubungannya dengan genetik, lingkungan alam, sosial, dan sejarah zaman secara keseluruhan, manusia mampu melawannya. Sehingga bisa membebaskan dirinya dari ikatan faktor-faktor ini. Dari satu sisi, manusia dengan kekuatan akal dan ilmunya melalui kekuatan ikhtiar, mampu melakukan perubahan pada faktorfaktor ini. Faktor tersebut diubah sesuai kemauan, sehingga menjadi pemilik bagi nasibnya sendiri. Oleh karena itu, benar kalau kita katakan lingkungan memiliki peran mendasar dalam pembentukan kepribadian manusia. Akan tetapi, bukan faktor penentu yang pasti. Sebab, manusia memiliki ikhtiar. Para pakar mengatakan demikian. Sebab, ada orang yang lahir buta tetap tersenyum saat ibu mendekatinya. Jadi, seorang bayi memiliki rasa pada saat mendengar azan, juga memiliki jiwa yang bisa berhubungan dengan sekelilingnya. Karena itu, azan menjadi kalimat pertama yang diucapkan kepadanya. Karena saat membacakan azan, seorang muazin berhubungan dengan Allah. Inilah yang memberikan dampak bagi perkembangan anak ke depan. Kedua, sampai umur tujuh hari, kelahiran anak perlu disyukuri (akikah). Kalau begitu, jangan sampai terbetik dalam pikiran ibu/bapak merasa tidak mau atau tidak membutuhkannya. Sebab, saat itu sang anak sudah punya perasaan dan harus disambut dengan penuh syukur (akikah). Misal, ada orang yang mengharapkan anak laki-laki, namun lahir perempuan. Akhirnya, ia kecewa dan

tidak menerima serta menyukurinya. Semestinya perlu disyukuri, baik laki-laki maupun perempuan. Ketiga, setelah akikah, sang anak baru diberi nama yang terbaik karena dalam hadis disebutkan, ’’Di hari kemudian nanti orangorang itu akan dipanggil dengan namanya’’. Dalam hadis lain dijelaskan, ’’Nama itu adalah doa dan nama itu bisa membawa pada sifat anak kemudian’’. Jadi, pilihlah nama yang baik untuknya. Semua elemen sangat berpengaruh terhadap perkembangan anak, baik itu orang tua, tenaga pendidik, maupun lingkungan. (*) Penulis adalah Dosen Ilmu Komunikasi FISIP UM Lampung dan Mahasiswa Pascasarjana IAIN Raden IntanBandarlampung.


SABTU

28 April 2012

Perempuan Meksiko Mengandung 9 Bayi (int)

DUA VAGINA: Hazel Jones memiliki dua vagina yang ditawari bermain film porno.

GADIS DUA VAGINA

Ditawari Main Film Porno LONDON-Hazel Jones (27), perempuan yang didiagnosis medis memiliki dua vagina, dua rahim, dan dua cervix ini tiba-tiba saja menjadi sangat terkenal. Ketenaran Hazel Jones juga menyedot perhatian Steven Hirsch, pemilik Vivid Production, perusahaan film pornografi Amerika Serikat. Menurut TMZ.com, Hircsh sangat tertarik dengan perempuan berambut pirang yang berasal dari High Wycombe ini. Bahkan, Hircsh secara khusus mengirimkan surat yang berisi tawaran terhadap Hazel Jones sebesar 1 juta dollar AS. Hircsh berharap Jones bersedia membintangi salah satu film porno produksinya. “Anda (Hazel Jones) jelas seorang wanita luar biasa, dan saya ingin menawarkan peran yang menantang dalam salah satu film produksi Vivid. Kami akan membayar jasa Anda 1 juta dollar AS,” tulis Hircsh. Dalam surat tersebut, Hirsch juga berjanji akan menanggung seluruh biaya akomodasi dan semua fasilitas kelas satu seperti yang dinikmati para

selebriti di Los Angeles. “Kami akan menanggung seluruh biaya perjalanan dan akomodasi Anda selama berada di Los Angeles dengan fasilitas kelas utama,” tulis Hirsch. Steven Hirsch adalah pendiri Vivid Production, perusahaan yang memproduksi film-film dewasa yang menggunakan jasa selebriti papan atas. Beberapa selebriti yang menjadi bintang Vivid Production adalah Pamela Anderson, Tommy Lee, dan Kim Kardashian. Namun hingga saat ini, Hazel Jones belum menanggapi tawaran Steven Hirsch. Hazel Jones mengatakan kepada ITV, dia merasa nyaman dengan kondisinya. “Saya tidak perlu malu dengan kondisi saya. Akan saya perlihatkan kepada masyarakat—secara medis —tentang kelainan saya. Jika para wanita ingin mengetahui tentang kelainan yang saya derita, maka akan saya tunjukkan dan terangkan kepada mereka,” kata Jones kepada Holly Willoughby dan Phillip Schofield, pembawa acara ITV. (kps)

MEKSIKO CITY - Ketika sebagian perempuan harus menanti selama bertahun-tahun untuk memiliki banyak anak. Namun, tidak begitu halnya yang terjadi dengan seorang perempuan asal Meksiko ini. Bagaimana tidak, perempuan Meksiko yang diketahui bernama lengkap Karla Vanessa Perez, saat ini dikabarkan tengah mengandung sembilan bayi sekaligus. Enam dari bayi yang dikandung itu berjenis kelamin perempuan sementara tiga lainnya laki-laki.

Meski sangat antusias menyambut kehadiran bayi-bayinya tersebut. Namun, Perez mengaku ia belum menyiapkan nama untuk mereka. ”Masih terlalu dini untuk memikirkan nama bagi mereka. Yang terpenting adalah semuanya berjalan dengan lancar,” ujar Karla Vanessa Perez,

Jumat (27/4). Perez yang saat ini tengah dirawat di sebuah rumat sakit di ibu kota negara bagian Saltillo menjelaskan, dokter memperkirakan ia akan melahirkan pada 20 Mei mendatang. Terkait dengan kehamilannya yang tidak biasa itu Perez mengatakan, selama ini ia memang rutin melakukan perawatan kesuburan. ”Ternyata melakukan perawatan kesuburan secara rutin mengarah pada kehamilan ganda,” ujarnya. (oz)

„ Ilustrasi

WARGA TERKEJUT

Diundang Petinggi Swedia Tak Lewat Pos dan Alamat

Bersetubuh dengan Mayat

Diperbolehkan di Mesir MESIR-Di Mesir jika seorang suami atau istri baru saja meninggal, maka pasangan sahnya boleh “berhubungan suami-istri” dengannya. Syaratnya, usia si jasad tidak boleh lebih dari 6 jam. Itulah Undang-Undang yang kini sedang menjadi kontroversi di negeri Piramida itu. UndangUndangnya bernama “Farewell Intercourse” atau persetubuhan perpisahan. Penulis warga Ahmed Tsar Blenzinky yang mengutip berita Dailymail.co.uk menyebutkan, persetubuhan perpisahan itu menjadi kontroversi karena Dewan Nasional Mesir untuk Perempuan (Egypt’s National Council for Women /NCW) saat ini sedang menggugat UU tersebut ke parlemen Mesir agar Undang-undang itu digagalkan. Bersamaan

(int)

BERFOTO: Margareta Winberg berfoto bersama para elite pengambil kebijakan lingkungan Swedia setelah ia secara keliru diundang ke perjamuan makan malam para elite itu. „ Ilustrasi dengan gugatan Undangundang itu, NCW juga mengajukan gugatan terhadap Undang-undang yang mengatakan, anak perempuan boleh menikah mulai usia 14. Alasan kedua gugatan itu adalah ”Undang-undang ini akan memojokkan, merusak dan berpengaruh negatif terhadap status para perempuan Mesir dalam merencanakan pembangunan masa depan kaum perempuan,” tulis Ahmedi di Kompasiana, Jumat (27/4), mengutip kolumnis Mesir Amro Abdul Samea di situs Alarabiyah.net. (kps)

STOCKHOLM-Ketika Margareta Winberg mendapat undangan Pemerintah Swedia untuk menghadiri sebuah jamuan malam resmi, ia merasa tersanjung walau sedikit terkejut. Namun, karena ia menerima undangan itu melalui pos, dengan nama dan alamatnya tercantum di atasnya, dia tidak begitu khawatir tentang tujuan makan malam tersebut. Pensiunan berusia 67 tahun itu, yang berasal dari Sundbyberg di pinggiran kota Stockholm, tidak pernah bekerja untuk pemerintah. Namun, ia berpikir bahwa undangan itu mungkin ada

MENGATASI KELUHANAKIBAT MAAG TANPAEFEK Gentong Mas secara teratur, Harapnya. SAMPING Alhamdulillah kini sakit maag saya Gentong Mas adalah minuman

SepintasF i t r i aHarah apmeman g tampak s e h a t. Namun siapa y a n g menyangka wanita yang berprofesi sebagai guru ini sudah 10 tahun lamanya menderita maag, "Kalau sudah kambuh, perut saya sering terasa mual, penuh, dan seperti ada benjolan," terang wanita berusia 32 tahun tersebut. Bertahun-tahun mengatasi maag dengan mengkonsumsi obat kimia akhirnya menimbulka n kekhawatiran di diri ibu 2 orang anak ini akan efek samping yang ditimbulkannya. Karenanya, kini ia mengikuti anjuran suaminya untuk beralih pada pengobatan yang alami. Terbukti dalam jangka waktu 1 bulan, Fitria merasakan manfaatnya, "Setelah minum

sudah tidak kambuh, badan selalu fit." Ungkap wanita yang tinggal di Kisaran Timur, Asahan, Sumatra Utara tersebut. Gastritis atau lebih dikenal sebagai maag berasal dari bahasa Yunani yaitu Gastro, yang berarti perut/ lambung dan Itis yang berarti inflamasi/peradangan dengan gejala-gejala seperti perih atau sakit seperti terbakar pada perut bagian atas yang dapat menjadi lebih baik atau lebih buruk ketika makan, mual, muntah, kehilangan selera, kembung, terasa penuh pada perut bagian atas setelah makan, kehilangan berat badan. Setelah merasakan manfaat mengkonsumsi Gentong Mas, kini ibu 2 orang anak ini ingin sekali membagi pengalaman baiknya dengan orang lain, "Semoga pengalaman saya ini dapat bermanfaat bagi orang lain."

herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda) terbukti memiliki banyak manfaat untuk kesehatan. Habbatussauda bermanfaat untuk memelihara pembuluh darah, perbaikan sistem saraf, optimalisasi aktifitas hormon, meningkatkan proses penyembuhan dinding lambung, meningkatkan daya tahan tubuh dan bersifat anti bakteri. Selain itu juga, Habbatussauda dapat mengatasi gangguan tidur dan relaksasi. Cabe Jawa yang terdapat dalam Gentong Mas bermanfaat untuk mempercepat penyembuhan mukosa lambung. Sedangkan kandungan yang terdapat dalam Kayu Manis bersifat anti kembung dan mules. Kapulaga dalam Gentong Mas bermanfaat sebagai anti muntah serta radang lambung. Dan Gula Aren bermanfaat untuk menurunkan penyerapan lemak dan perbaikan sistem saraf. Untuk hasil cepat dan maksimal dianjurkan untuk makan teratur, hindari alkohol, rokok, kendalikan stress, dan jika memungkinkan hindari obat penghilang nyeri Manfaat yang hebat bagi kesehatan dan rasa yang lezat membuat semakin banyak masyarakat yang mengkonsumsi

hubungannya dengan pekerjaannya dulu sebagai asisten terapi okupasional.”Namun, saya tidak berpikir terlalu banyak tentang hal itu dan saya juga tidak tahu banyak tentang makan malam tersebut. Hanya saja, saya diundang dan bahwa itu ‘tentang lingkungan’,” katanya, Jumat (26/4). Jadi, saat tanggal makan malam itu—untuk menandai pembukaan sebuah konferensi lingkungan— tiba, Nyonya Winberg berdandan dan menampakkan dirinya di kompleks kantor Pemerintah Swedia di Rosenblad.

Barulah ketika itu para pejabat menyadari kekeliruan karena undangan itu seharusnya ditujukan untuk mantan wakil perdana menteri, menteri pertanian, dan duta besar untuk Brasil—yang kebetulan memiliki nama yang sama.Yang muncul bukan mantan menteri dan diplomat Margareta Winberg. Yang berdiri di depan mereka justru mantan asisten terapi okupasional Margareta Winberg. Sadar telah melakukan kesalahan, tuan rumah acara itu, Menteri Lingkungan Lena Ek, berusaha mengendalikan keadaan.

Nyonya Winberg diantar ke tempat duduk yang telah disiapkan untuk “dia” dan diperkenalkan kepada tamutamu lain—dengan penjelasan tentang apa yang sudah terjadi.Erik Bratthall, juru bicara pers Lena Ek, mengatakan kepada harian Swedia, Aftonbladet, “Ketika Lena menyadari kesalahan itu, dia melakukan semua yang dia bisa sehingga perempuan itu tidak akan merasa tidak nyaman.” Nyonya Winberg yang lain, yang menjadi sasaran undangan, kemudian menerima permintaan maaf dan dilaporkan menyebut kekeliruan itu sebagai humor

yang baik. “Saya berharap orang bernama sama dengan saya itu menikmati makan malam yang indah,” katanya kepada media Swedia.Meskipun hadir karena diundang secara keliru, Nyonya Winberg mengatakan, dia tidak merasa canggung telah ambil bagian dalam acara bersama para elite pengambil kebijakan lingkungan Swedia itu. “Saya menerima itu apa adanya, sebuah kesalahan, seperti yang dilakukan orang-orang lain. Saya menikmati waktu yang hebat dan mendengarkan dengan seksama semua pembicara,” katanya. (kps)

Israel Larang Iklan dengan Model Kurus

JERUSALEM-Sebentar lagi bakal tak ada model berbadan kurus dalam iklaniklan di Israel. Larangan ini sebagai langkah mencegah kian berkembangnya pola makan yang tak semestinya yang membuat badan kurus. Negara Yahudi ini mengatur larangan ini dalam undangundang (UU) yang disetujui kemarin. Dalam UU itu juga diharuskan adanya publikasi, guna mengungkapkan bahwa mereka menggunakan gambar dari model iklan yang memberi kesan bahwa model pria ataupun perempuan dalam iklan itu terlihat lebih kurus dibanding keadaan tubuh mereka yang sebenarnya. Larangan ini sebagai upaya pertama pemerintah Israel menggunakan legislasi mengatur industri fesyen yang dituduh telah menimbulkan kebiasan makan yang tak semestinya guna bisa memperoleh bentuk tubuh yang kelewat kurus. Pola makan yang tak

(int).

TOLAK IKLAN: Para model berbadan kurus ditolak sebagai iklan di Israel semstinya ini seperti bulimia (makan yang berlebihan dan kemudian dimuntahkan) dan anorexia (tak makan karena takut kegemukan). Pola hidup seperti ini kini berkembang di antara kaum muda Israel, terutama kaum perempuan. UU Israel ini menegaskan agar iklan lokal lebih baik menggunakan model iklan yang terlihat lebih sehat. Juga mencegah industri iklan menggunakan trik digital yang membuat para

perempuan model iklan terlihat terlalu kurus. “Kami ingin menghilangkan ilusi dengan menampilkan model sebagaimana tampilan nyatanya,” ujar Liad Gil-Har, asisten pada sponsor hukum Dr Rachel Adato, yang membandingkan upaya menentang pola makan yang tak semestinya ini, seperti upaya menekan kebiasaan merokok. Di Israel, sekitar 2 persen dari gadis berusia 14 - 18

tahun acapkali punya pola makan yang tak semestinya. “Tingkat yang sama dengan kondisi di negara-negara maju,” ujar antropolog Sigal Gooldin, yang melakukan studi soal pola makan yang tak wajar di kalangan anak muda di Israel. Israel ingin menerapkan standar Organisasi Kesehatan Dunia (WHO) perempuan dengan tinggi 172 sentimeter harus punya berat badan tidak kurang dari 54 kilogram. Tekanan pada industri fesyen di Israel ini kian intensif beberapa tahun ini, terutama dipicu dengan kematian sejumlah model perempuan di Brasil dan Uruguay, akibat komplikasi penyakit yang terkait dengan pola makan yang tak wajar ini. Model Uruguay, Luisel Ramos (22), pingsan dan meninggal dunia sesudah tampil di panggung Agustus 2006. Dia mengalami serangan jantung berkenaan dengan pola anorexia. (kps)


SABTU

28 April 2012

Ayah Bacok Anak

HINGGA TEWAS BANJARMASIN – Hanya gara-gara sepeda motor, seorang ayah tega membunuh anak kandungnya setelah membacok wajah, tangan, dan tubuh anaknya dengan menggunakan parang, kemarin malam pukul 23.35 Wita. Tragisnya, dengan kondisi tubuh penuh luka bacok, korban yang masih berusia 20 tahun ini dibiarkan saja terkapar di Lingkar Selatan, Jalan Gubernur Suhardjo, RT 20, Kecamatan Banjarmasin Selatan. Dalam kondisi terluka parah, korban bernama M Dodet, warga Jalan Sutoyo S Gang Kenanga RT 5, Kelurahan Teluk Dalam, dibawa temannya ke UGD Rumah Sakit Suaka

Insan Banjarmasin dengan menggunakan sepeda motor. Setelah beberapa jam dirawat tim medis, akhirnya korban menghembuskan napas terakhirnya. Anggota Reskrim Polsekta Banjarmasin Selatan yang mendapat laporan kejadian tersebut langsung meluncur ke lokasi kejadian. Setelah memeriksa beberapa orang saksi, petugas akhirnya mengetahui identitas pelaku

pembacokan terhadap Dodet, yang tak lain adalah ayahnya sendiri bernama Santoso alias Hasan Gepeng (45). Setelah dilakukan pencarian petugas akhirnya berhasil menangkap Hasan di Banjarbaru. Ketika ditangkap pelaku malah melawan dan berusaha menyerang petugas. Tak mau buruannya kabur, petugas kemudian melepaskan tembakan peringatan ke udara. Karena tak menggubris, petugas akhirnya mengarahkan tembakan ke kaki pelaku. Setelah ditembak, pelaku langsung roboh dan dibawa ke Rumah Sakit Bhayangkara Polda Kalsel.

Dari informasi yang dihimpun, pelaku bersama istri mudanya Nurhasanah dan dua temannya sengaja menjemput korban. Sekitar pukul 20.30 Wita, korban dijemput di daerah Tatah Bangkal. Hasan bermaksud menanyakan kepada anaknya terkait raibnya sepeda motor miliknya. Belum diketahui apakah sepeda motor tersebut dijual atau hanya dipinjam korban. Selain itu, pelaku juga kesal dengan anaknya karena memberitahukan keberadaannya kepada polisi. Pelaku diduga bandar narkoba yang masuk dalam Daftar Pencarian Orang

(DPO) jajaran Satnarkoba Polresta Banjarmasin. Karena tak curiga dengan ajakan ayahnya, korban kemudian mengikutinya. Sesampainya di lokasi kejadian, pelaku memukuli korban dan membacok dengan parang yang sudah dipersiapkan. Kapolsekta Banjarmasin Selatan AKP Hadi Suprianto membenarkan peristiwa penganiayaan yang mengakibatkan tewasnya korban.”Tersangka juga merupakan DPO narkoba karena diduga bandar narkoba. Saya sudah mengkonfirmasi informasi itu dan dibenarkan jajaran Satnarkoba,” ujarnya. (kim)

BEKASI-Seorang guru agama (Ustadz) bernama Jamaludin (23) diduga mencabuli empat remaja laki-laki berinisial AB (16), SAP (14), AR (13) dan AA (15) yang menjadi murid mengajinya di Jalan Jatirangga, Pondok Gede, Kota Bekasi, sejak Januari lalu. Kejahatan itu baru terbongkar setelah orangtua salah satu korban melapor ke Polresta Bekasi Kota kemarin. Kasat Reskrim Polresta Bekasi Kota Kompol Taufik Hidayat mengungkapkan, Jamaludin atau akrab disapa Jamal menyodomi keempat remaja itu selama kurun waktu hampir empat bulan. Status sebagai guru mengaji memudahkannya merayu keempat korban. Aksi itu dilakukan pelaku malam hari, usai pengajian usai. ”Mereka tidak diiming-imingi apaapa, hanya dirayu saja oleh pelaku,” ujarnya. Keempat korban dicabuli secara bergilir. Mulai dari dicium hingga disodomi. Bukan lagi sekadar merayu, setiap akan melampiaskan hawa nafsunya pelaku selalu mengancam korban hingga tidak berkutik. ”Korban selalu diancam dibunuh jika tidak nurut melakukan keinginan pelaku. Selain itu, pelaku meminta korban untuk tidak mengatakan kepada siapa pun,” tuturnya. Kecurigaan orangtua salah satu korban, kata dia,

yang akhirnya membongkar kasus itu. Orangtua korban baru menyadari setelah anaknya itu sudah tidak mau belajar mengaji lagi kepada Jamal. Si anak mengadu kepada orangtua takut dibunuh. Setelah ditanya kenapa, korban berkata jujur kalau telah dicabuli oleh pelaku. Jamal langsung dibawa orangtua korban ke polisi,” terangnya. Jamal pun terancam hukuman maksimal 15 tahun penjara karena melanggar pasal 82 UU RI Nomor 23 Tahun 2002 tentang Perlindungan Anak. Sementara itu, Jamal tak sedikit pun membantah tuduhan pelapor. Dia mengakui pencabulan terhadap empat murid mengajinya di mushola di Jalan Jatirangga, Pondok Gede, Kota Bekasi sejak Januari lalu. ”Saya khilaf mas melakukannya,” imbuhnya didampingi kuasa hukumnya Yasin Hasan di Polresta Bekasi Kota, Kamis (26/4). Pria lulusan SMA Pondok Gede Kota Bekasi itu mengaku tidak memiliki kelainan seksual. Dua bulan lalu dia baru saja putus dari sang pujaan hati, seorang perempuan. Pencabulan terhadap murid laki-laki itu diakuinya berawal dari sekadar cobacoba. ”Saya normal mas. Hanya coba-coba kok. Saya sudah melakukan empat kali pencabulan ke masing-masing korban,” ungkapnya. (dny)

Anak SMA Setubuhi Bocah 10 Tahun

(FOTO : LAZUARDY FAHMI)

OLAH TKP: Tim identifikasi Polresta Siantar yang sedang melakukan olah TKP pencurian di rumah Lukas barus yang berada di jalan Narumonda Pematangsiantar, Kamis (26/4).

Rumah Pejabat Tarukim Digasak

Harta Senilai Rp300 Juta Dibawa Kabur SIANTAR-Kediaman milik Lukas Barus (50), salah seorang Kepala Bidang di Dinas Tata Ruang dan Pemukiman (Tarukim) Kota Siantar, digasak kawanan maling bermobil, baru-baru ini. Dari rumah yang berada di Jalan Narumonda Bawah Kelurahan Karo, Siantar Selatan itu, pelaku membawa kabur harta senilai Rp300 juta. Informasi dihimpun, peristiwa terjadi saat rumah dalam keadaan kosong. Saat itu korban sedang pergi ke Kota Medan, untuk melihat anaknya Putra Barus (16) yang harus dioperasi setelah mengalami kecelakaan sepedamotor. Pagi itu, dua

Oknum Ustadz Sodomi 4 Muridnya

mobil jenis sedan dan Avanza menghampiri lokasi. Mobil-mobil itu langsung parkir di depan kediaman korban dan seolah sudah direncanakan. Sebab pelaku memarkirkan mobil dengan bagian depan mengarah ke jalan. Diduga itu dilakukan untuk memudahkan pelarian kawanan ini. Aksi pencurian pertama kali diketahui kerabat korban yang heran melihat pintu gerbang rumah sudah terbuka. Setelah diperhatikan, ia mulai curiga. Sebab sepengetahuannya, korban sedang dalam perjalanan ke Kota Medan. “Tadi penjaga rumahnya bermarga Tarigan yang

melihat gerbang terbuka. Karena curiga, ia memanggil warga lain dan mereka memeriksa isi rumah. Ternyata pintu samping juga sudah terbuka,” kata seorang warga kepada METRO. Setelah diperiksa, beberapa peralatan elektronik sudah tidak terlihat, di antaranya adalah tiga buah televisi. Mengetahui kejadian, mereka langsung menghubungi pemilik rumah. Selain itu, Tarigan bersama keluarga korban S Ginting langsung melaporkannya ke polisi. Mendapat laporan, polisi langsung terjun ke lokasi. Di sana, beberapa personel Sat Reskrim langsung melakukan

penyelidikan. Termasuk mengidentifikasi lokasi. Sore hari setelah pulang dari Medan, korban langsung datang ke Polres Pematangsiantar dan membuat pengaduan. Akibat kejadian, korban kehilangan peralatan elektronik, BPKB kendaraan dan perhiasan. Diperkirakan kerugian korban mencapai Rp300 juta. Menurut keterangan warga di lokasi kejadian, mereka sempat melihat dua unit mobil yang parkir di depan kediaman korban. “Tadi memang ada dua mobil berwarna hitam di depan itu. Salah satunya mobil sedan, yang lain jenis Avanza. Kami pikir mereka itu tamu di

rumah itu. Sebab selama ini rumah sering didatangi tamu bermobil,” katanya. Kanit Reskrim Iptu Asmon Bufitra yang dikonfirmasi METRO mengaku masih berada di Medan. “Saya masih di Polda, coba cek sama anggota di Polres,” katanya. Sedangkan korban yang hendak dikonfirmasi langsung tadi malam, belum berhasil ditemui. Menurut keluarganya, korban sedang tidak berada di rumah. “Tidak ada bapak itu, tapi yang kudengar perhiasan dan televisi-nya dicuri,” kata pria yang tak menyebutkan nama ini. (mag-4/hez)

Mobil Pemungut Retribusi Ditabrak Truk SILIMAKUTA- Satu unit mobil Isuzu Panther milik petugas pemungut retribusi galian C bernama Jasmar Girsang, ditabrak dump truk, Rabu (25/4). Diduga kuat, supir truk sengaja menabrakkan mobilnya. Menurut Jasmar Girsang, saat itu ia sedang bertugas di pos pemungutan

retribusi bersama dengan dua petugas Satpol PP. Tiba-tiba sebuah dump truk bermuatan material yang dikemudikan Jekson Girsang, datang dari lokasi galian C. “Kami berniat menyetop mobil untuk meminta retribusi, tapi kelihatannya dia tak mau berhenti. Setelah lewat pos, barulah mobilnya

berhenti. Selanjutnya mobil mundur dan menabrakkannya ke mobil pantherku yang sedang parkir,” kata Jasmar sembari mengatakan mobilnya ringsek akibat kejadian. Pasca kejadian, Jasmar langsung membuat pengaduan ke Polsek Saribudolok. Hal itu dibenarkan Kapolsek M

Aruan yang dikomfirmasi METRO. Menurutnya, kasus itu masih diselidiki. “Ya kita sedang periksa si korban. Hari ini kita periksa saksi, besok kita akan periksa tersangka Jekson Girsang,” katanya dari balik telepon. (sp/hez)

MEDAN- Malang betul nasib gadis di bawah umur ini. Sebut saja namanya Melati (10) pelajar sekolah dasar (SD) yang menetap di Jalan Binjai Dusun IV Desa Kampung L a l a n g , Kecamatan Sunggal. Ia dicabuli oleh EP (16) yang kediamannya m a s i h berdekatan dengan korban. Terkuaknya perbuatan itu setelah korban menceritakan kejadian kepada ibunya. Dalam laporannya, Melati mengaku sudah empat kali disetubuhi tersangka. Tak terima, ibu korban langsung melapor ke Polsek Sunggal, kemarin. Informasi dihimpun, peristiwa terjadi pada 18 Agustus 2011. Saat itu korban bermain dengan adik EP bernama Indah (nama samaran), di kediamannya. Tak lama bermain, korban dan Indah sedang mandi. Saat itulah korban dihampiri EP yang langsung menyuruh keduanya segera ke luar kamar mandi. Tanpa curiga, korban mengenakan pakaian miliknya, begitu pula dengan Indah. Lalu di sebuah kamar di rumah tersebut, petaka itu terjadi. Selesai ganti pakaian, Indah keluar terlebih dulu dari kamar. Lalu EP langsung memeluk korban yang belum selesai mengenakan pakaian

dan menyetubuhinya. EP juga meminta korban untuk tidak menceritakannya kepada siapapun. Merasa aksinya tak diketahui, pelaku kembali mengulanginya. Bahkan aksi bejad itu terulang hingga empat kali. Terakhir, pelajar SMA ini melakukannya pada 2 minggu silam. Saat itu korban tengah b e r m a i n dengan adik pelaku. Lalu EP memaksanya untuk melayani nafsu. Korban yang masih polos, semula ketakutan dan akhirnya menceritakan kejadian kepada ibunya ES (40). Sontak ES terkejut dan membawa putrinya membuat laporan ke Polsek Sunggal. “Siapa yang tak emosi kalau begini pak. Saya minta dia (pelaku, red) ditangkap dan diberi hukuman setimpal. Saya laporkan dia supaya dia tahu perbuatannya itu biadab. Masih anak sekolah sudah berani begitu. Harus ditangkap dia, jangan sampai ada korban lain,” kata ES kesal. Sementara Kapolsek Sunggal Kompol Budi Hendrawan saat di konfirmasi, membenarkan laporan tersebut. Dikatakannya, pihaknya akan memanggil saksi-saksi guna dimintai keterangan. “Kita akan tindaklanjuti dan panggil para saksi,” ungkap Budi. (wel/pmg)

Mencuri Sawit untuk Beli Rokok

Residivis Tiga Kali Masuk Penjara SIMALUNGUN- Supriadi alias Bodel (35), sudah dua kali menjalani hukuman di Lapas Kelas II-B Pematangsiantar. Itu setelah warga Nagori Pasar Bosi, Kecamatan Ujung Padang ini berulang kali tertangkap mencuri sawit. Itu diakui terdakwa pencurian sawit pada sidang yang digelar di Pengadilan Negeri Simalungun. Dalam dakwaannya, Jaksa Penuntut Umum (JPU) M Azril mengatakan,

terdakwa ditangkap pada 14 Januari 2012 karena mencuri tiga tandan sawit milik perkebunan PTPN IV Aek Nauli Nagori Pasar Bosi, Kecamatan Ujung Padang. “Terdakwa sudah dua kali ditahan akibat mencuri sawit menggunakan egrek. Dalam aksinya terakhir kali, ia membawa sawit seberat tiga kilogram ke perladangan warga. Akan tetapi aksinya diketahui petugas kemanan PTPN IV,” jelasnya.

Sementara saksi yang melakukan penangkapan, yakni Sabino, Sagino dan Subari, menyampaikan penangkapan itu berlangsung sekira pukul 13.30 WIB. “Saat sedang melakukan pengawasan, kami melihat terdakwa membawa tiga gondolan sawit menuju perladangan warga. Begitu dikejar, terdakwa masih sempat lari. Namun akhirnya berhasil diamankan. Akibat perbuatan-

nya, perusahaan mengalami kerugian sebesar Rp45 ribu,” ungkap saksi. Sedangkan terdakwa yang sempat ditanyai hakim mengaku, baru tiga kali mencuri sawit. Rencananya, hasil penjualan sawit digunakan membeli rokok. Tak hanya itu, terdakwa yang pernah melarikan diri dari ruang tahanan PN Simalungun ini mengaku pernah disuruh seseorang untuk mencuri sawit.

“Saya sudah dua kali menjalani hukuman karena mencuri. Pertama saya mencuri 18 tandan dan divonis lima bulan penjara. Selanjutnya mencuri enam tandan sawit dan divonis enam bulan penjara. Saya juga pernah melarikan diri dari ruang tahanan PN karena tidak ingin bertahun baru di Lapas. Saat itu saya pura-pura membuang sampah dan langsung lari menuju sungai,” sebutnya. (mua/hez)

(FOTO:IMELDA PURBA)

„ Supriadi saat menjalani sidang di Pengadilan Negeri Simalungun, Kamis (26/4).


SABTU

28 April 2012

Raja Adat Curhat ke Anggota DPD RI Sambungan Halaman 8 hak, baik pemerintah sendiri, swasta atau perorangan. Sutan meminta bantuan Parlindungan untuk menjejaki dan membantu upaya pengakuan tentag hak tanah ulayat di Tapsel. Mangaraja Kumala Oloan Nasutioan dari Madina menuturkan kesedihannya atas pernyataan salah seorang petinggi di Madina yang secara tegas mengatakan, tidak ada pengakuan hak untuk tanah ulayat. Akibatnya, hampir 6.600 hektare tanah ulayat dialihkan menjadi areal kontrak kerja PT Sorikmas Mining (SM) selaku perusahaan tambang emas di Madina. Diungkapkannya, saat ini di seluruh Madina terdapat 22 kekuriaan dan selama ini memiliki tanah ulayat namun tidak mendapat pengakuan. Padahal tahun 1929, hak ulayat mereka benar-benar diakui, utamanya saat terjadi sengketa perbatasan antara Kekuriaan Panyabungan Tonga dengan Kekuriaan Sayur Matinggi. “Ketika itu tercapai perdamaian, dan hasilnya dibuatlah pilar batas 1-8 yang sampai saat ini menjadi batas Kabupaten Tapsel dengan Madina. Tahun 1984 saat Tabagsel masih satu dan bernama Tapsel, Bupati Abdul Rasyid Nasution menyatakan secara tertulis tentang diakuinya keberadaan dan penguasaan tanah adat. Anehnya, sekarang justru tidak diakui,” katanya. Tahun 2001 terangnya, pihaknya sudah meminta Pemkab Madina membuat pengakuan terhadap tanah ulayat. Dimana saat itu ada pengakuan khusus terhadap kekuriaan yang bisa membuktikan tanah ulayatnya. Di tahun 2011, mereka menyurati PT SM yang mengatakan, yang akan dikelola itu adalah tanah ulayat mereka. PT SM mau berkoordinasi asal didampingi Pemkab Madina. Waktu itu Pj Bupati Madina Aspan Sopian menyetujuinya, tapi PT SM yang justru ingkar janji saat akan dilakukan koordinasi untuk mencari solusi. Dan sekarang justru tanah ulayat mereka tidak diakui. Sutan Dibata Oloan Harahap mewakili raja adat dari Paluta menceritakan, tanah ulayat mereka telah diserobot pemerintah yaitu dengan cara menjadikannya sebagai kawasan hutan register dan suaka marga satwa. Hal sama juga terjadi di Palas dan Psp. “Desa kami usianya sudah ratusan tahun, dan tanah ulayat itu merupakan warisan nenek moyang kami. Tapi ketika hendak membuat sertifikat atas tanah itu, BPN menolak dan menyebutnya masuk kawasan hutan resgiter,” tuturnya. Menyikapi keluh kesah dan ungkapan perasaan raja-raja adat tersebut, Parlindungan Purba menyatakan, di negara ini keberadaan tanah ulayat itu jelas-jelas masih diakui. Dia juga sudah menanyakan hal itu kepada para pakar hukum. “Saya barusan mengkomunikasikan tentang tanah ulayat ini dengan Dekan Fakultas Hukum USU Prof Runtung Sitepu. Dijelaskannya, hak ulayat itu jelasjelas masih ada. Jika memang bisa dibuktikan, para pemangku ulayat bisa meminta pengakuannya ke BPN,” ujarnya. Meski demikian, Parlindungan Purba menyatakan sekembalinya ke Jakarta, dia akan membahas permasalahan tersebut dengan para ahli hukum. Kemudian membawanya ke rapat DPD dan BPN pusat. “Memang apa yang sampaikan ini sifatnya masih sebatas janji-janji bagi para raja adat semua. Tapi dapat saya pastikan, saat kedatangan saya berikutnya, persoalan tanah ulayat sudah memiliki solusi. Berbohong dan sekedar janji, bukanlah sifat saya. Bisa kita buktikan berikutnya,” tegas anggota Komite II bidang perekonomian dan ESDM di DPD RI ini. Pada kesempatan itu, Parlindungan Purba yang datang bersama Plt Sekdakab Tapsel, Aswin Siregar, Kadis Tamben, Baduaman Siregar, Kasatker BBPJN Wil I, Bambang Pardede didaulat para raja adat untuk manortor bersama Daulat Raja Agung Panuturi Hasadaon Rambe. (neo/mer)

Sopir Ceroboh Jalinsum Macet Total Sambungan Halaman 8 Tak pelak, truk bermuatan beras ini pun mogok dan ikut menutupi sebagian badan jalan. “Meski demikian, masih ada jalan di sisi sebelah kiri yang bisa dilalui. Untuk menghindari kemacetan total kita awalnya melakukan sistim buka tutup khusus mobil pribadi dan bus

kecil,” ujar Kanit Patroli Tapteng IPDA Tohab Sibuea yang ditemui di lokasi kejadian. Akan tetapi ditambahkannya, beberapa mobil yang melalui sisi sebelah kiri tersebut terpaksa diderek karena kondisi jalan yang tak mendukung. Masih kata Tohap, sekitar pukul 13.00 WIB, seorang sopir truk tangki BBM BK 9149 CF yang datang

dari arah Sibolga tidak sabararan. Diapun melajukan kendaraannya tanpa aba-aba petugas kepolisian. Alhasil, akibat kecerobohan sopir tersebut, mobil tangki BBM yang dikemudikannya juga terperosok Badan jalan pun tertutup total. “Gara-gara mobil tangki itu kretapun tak bisa lewat. Semua

jangan membangun rumah di kemiringan minimum 45 derajat,” tutur Syarfi seraya mengakui semangat gotongroyong warga bila terjadi bencana alam sangat tinggi. Kadinsosnaker, Sanggaraja Sitompul SH sebelumnya melaporkan, total penerima bantuan yakni 48 KK. Itu terdiri dari para korban kebakaran dan longsor selama November 2011- Maret 2012. Tapi, batuan yang diberikan hari itu kepada 43 KK. Karena 5 KK lainnya

elah truk yang awalnya patah as selesai diperbaiki. Dari pantauan METRO di lapangan, banyak mobil khususnya truk pengangkut barang dan bus penumpang terjebak kemacetan. Kemacetan ini membuat sejumlah sopir, kernek, maupun penumpang turun ke jalan membantu memperbaiki truk yang rusak.(fred/nasa)

Klarifikasi dari Sahat Simatupang Dinantikan Pegawai Depkeu Pusat Sambungan Halaman 8 Kalaupun ada warga Tapteng yang berobat ke RSU Sibolga, itu merupakan pilihan, dan yang jelas itu dibayar bukan gratis. Dan itu juga membantu keuangan Pemko Sibolga, bukan merugikan,” tukas Milson. Milson juga mempertanyakan apakah pernyataan Sahat Simatupang tersebut sudah terlebih dahulu digodok oleh Pemko Sibolga. “Karena Sahat sebagai dosen yang telah menyampaikan pernyataan itu di media juga merupakan seorang pejabat di Pemko Sibolga, yakni sebagai Camat Sibolga Selatan. Oleh karena

itu kami ingin Sahat memberikan klarifikasi pada masyarakat Tapteng,” harapnya. Juga ditegaskannya, masyarakat Tapteng yang berada di perbatasan Kota Sibolga tidak pernah meminta atau memohon agar dimasukkan menjadi warga Sibolga. “Kalau benar rakyat yang minta, kita yakin Pemkab Tapteng tidak akan menolak kehendak rakyatnya. Tetapi yang terjadi justru masyarakat sudah menolak, namun kenapa Sahat memprovokasi. Maka dari itu kita tegaskan, bila seperti itu yang terjadi sampai kapanpun kami masyarakat Tapteng tidak akan setuju perluasan

itu dilakukan. Karena saat ini saja dengan adanya pernyataan itu, Pemko Sibolga tidak menghargai warga Tapteng, bagaimana nanti setelah perluasan,” tegasnya. Menurut Milson, wajar kalau Bupati Tapteng mengomentari langsung pernyataan Sahat Simatupang yang seolah merendahkan harga diri masyarakat dan Pemkab Tapteng. “Sesuai pernyataan Sahat, kalau memang perluasan itu menjadi beban Pemko Sibolga, untuk apa lagi harus dibuat perluasan?. Baiknya disudahi saja pembahasan tentang perbatasan itu,” pungkas Milson. (fred/nasa)

Warga Binaan Harus Kreatif dan Produktif Sambungan Halaman 8 panel, dan lain-lain. Di tempat lain ada batik, cinderamata. Lapas Porong mampu membuat mubeler dan kapal patroli. Untuk itu kita harapkan agar Lembaga Pemasyarakatan membina warga untuk melahirkan manusia

yang kreatif dan memiliki nilai jual yang tinggi. Dan diharapkan adanya kerja sama diantara petugas dan warga binaan,”paparnya. Dalam pidato Menkum dan HAM tersebut, juga memuat sejumlah prestasi yang dicapai warga binaan. Antara lain pemberantasan peyalah-

gunaan narkoba di dalam penjara. Selama kurun waktu 2012, dari seluruh Indonesia berhasil ditindak 12 kasus penyalahgunaan narkoba baik oleh warga binaan maupun oleh petugas. Disamping itu juga ditemukan 38 kasus penyelundupan alat komunikasi ke dalam lapas. (fred/nasa)

Menjala, 2 Sekawan Hilang Sambungan Halaman 8 tang Toru. Namun keduanya masih belum ditemukan. “Kita masih melakukan pencarian keduanya,” tutur Kapolsek. Kapolsek menambahkan, dari hasil penelusuran yang dilakukan Juned dan Andi bekerja sebagai

buruh bangunan di perumahan perusahaan yang ada di Kecamatan Batang Toru. “Dari informasi yang kita peroleh, Juned dan Andi ini berteman. Keduanya sama-sama bekerja borongan pembangunan perumahan di perkebunan di Kecamatan Batang

Toru. Andi, warga Siantar ini baru tiga bulan tinggal di Kecamatan Batang Toru, sedangkan Juned memang warga setempat. Kita perkirakan keduanya terpeleset saat menjala ikan dan jatuh ke sungai. Saat ini kita masih terus melakukan pencarian,” pungkas Kapolsek. (phn)

Madina Rawan Banjir dan Longsor Sambungan Halaman 8 hanya potensi banjir saja, tetapi potensi longsor juga banyak kita temukan di daerah pantai barat. Ini harus kita perhatikan bersama, dan apabila ada kekhawatiran agar segera mengambil tindakan,” ungkapnya. Pantauan METRO beberapa

hari terakhir di Panyabungan, tepatnya di simpang empat lintas timur di depan rumah makan Ladang Sari, setiap malam jalan lintas Sumatera sekitar 100 meter digenai air hujan dengan ketinggian sampai lutut orang dewasa. Mengingat di sekitarnya tidak ada rumah warga, maka banjir ini dibiarkan sampai kembali normal.

Begitu juga di jalan lintas di daerah kecamatan Panyabungan Utara, tepatnya di Sibaung-baung hingga ke Kampung Baru. Di sini terlihat banyak badan jalan yang berlubang yang ketika hujan, maka lubang itu tertutup oleh genangan air. Sehingga para pengguna jalan harus hatihati. Bila tidak, maka akan terjebak di dalam lubang tersebut. (wan)

Dapat Rp500 Ribu plus Beras dan Mi Instan Sambungan Halaman 1

jalan sudah tertutup total. Beberapa truk sudah mencoba untuk menarik mobil tangki itu, namun tak berhasil,” tutur A Tealambanua (28), salah satu sopir truk asal Nias yang rencananya akan mengantarkan karet ke Kota Tebingtinggi. Ditambahkannya, arus lalulintas akhirnya berangsur normal sekira pukul 14.30 WIB set-

sudah diberikan saat kejadian dalam bentuk bantuan darurat. “Saat kejadian pemko sudah meyalurkan bantuan awal, yakni beras dan mi instan. Yang ini bantuan berupa uang tunai sebesar Rp500 ribu per KK,” tuturnya. Berharap Rumahnya Diperbaiki Mei Hutagalung (63) korban tanah longsor di Kelurahan Hutabarangan dirawat di Rumah Sakit Umum FL Tobing Sibolga. Korban mengalami luka memar di tubuhnya dan retak pada tulang paha kirinya.

Pantauan di rumah sakit, keluarga korban berdatangan memberi semangat kepada korban yang terbaring lemah dengan tangan diinfus. Korban sesekali mengeluh kesakitan kepada suaminya. Suami korban Forman (63) mengucapkan terimakasih karena biaya berobat istrinya ditanggung pemerintah. “Saya berharap ada bantuan perawatan sampai istri saya sembuh,” pintanya. Korban lainnya Berlin Nababan (38) dan Rosminta boru Pandiangan (52),

Juniar Napitupu (40) juga berharap mereka dibantu membangun rumah yang rusak. Kemudian pemerintah juga membangun tanggul penahan di tanah bukit agar longsor tidak langsung menghantam rumah mereka. Sementara itu anggota DPRD Komisi I Jamil Zeb Tomori dan HJ Syuryanty Sidabutar Komisi II bersama Kadis Sosial Sanggaraja Sitompol meninjau lokasi longsor di Kelurahan Aek Manis. Jamil Zeb Tomori meminta Pemko Sibolga secepatnya memperbaiki kerusakan. (aris/dungo)

(FOTO:METRO/ARIS)

„ Mei br Hutagalung korban longsor yang masih dirawat di RSU Sibolga.

Nyalon Wali Kota Psp Sambungan Halaman 8

gangan dan jasa, kesehatan serta pendidikan. Saro mengatakan, dirinya adalah PNS aktif dan sekarang menjabat Kasubdit di Depkeu Jakarta dan saat ini sedang mengambil gelar doctor saat ini tinggal di Depok. Dikatakannya, sebagai bagian dari masyarakat Tapsel lama, dirinya yang lahir di Simangambat, Kabupaten Madina 43 tahun lalu ini menamatkan SD hingga SMP-nya di Simangambat. Kemudian SMA-nya ditamatkan di SMAN 4 Kota Psp dan dilanjutkan kuliah di FE Universitas Jambi. Keinginannya sebagai putra daerah Sumut merasa terpanggil untuk mendarmabaktikan sebagian usianya berjuang melawan kemiskinan dan kebodohan yang membelenggu sebagian besar rakyat Kota Psp dan berjuang untuk mencerdaskan serta mensejahterakannya. Ketika ditanya mengapa baru saat ini muncul, Saro mengatakan bahwa dirinya sudah sejak setahun lalu sudah berniat maju di pemilukada Psp yang diketahuinya pada saat pulang kampung. Namun baru saat ini, dirinya bisa datang langsung ke Psp dan menyatakan kesiapan maju. Selanjutnya pada awal Mei ini dirinya akan membentuk tim dan membentuk posko sekaligus menyampaikan kepada publik kesiapannya untuk bersaing menuju Salak I. Soal wakil, kata Saro, dirinya sudah mengantongi sejumlah nama, namun belum bisa disampaikannya hingga nantinya ditetapkan siapa nama yang akan menjadi pendampingnya. Sementara soal partai yang sudah dijajakinya, satu diantaranya adalah Partai Demokrat kemudian ada sekitar 5 partai besar yang juga sudah dijajaki dan kemungkinan besar akan menetapkannya sebagai usungan dalam pemilukada. “Soal wakil sudah ada tapi nanti akan kita sampaikan. Kalau partai ada 4 partai besar yang sudah kita komunikasi, namun saat ini kita fokus untuk mengikuti proses di Partai Demokrat, karena Partai Demokrat bisa mengusung langsung kandidat karena memiliki kursi penuh di DPRD,” ucapnya. Disambungnya, pada dua tahun lalu dirinya juga sudah pernah ikut dalam pemilukada yakni pada saat pemilukada Kabupaten Madina. Dimana dirinya saat itu sebagai calon wakil berpasangan dengan UN. Karena tidak mendapatkan partai, maka tidak sampai menjadi peserta atau tidak ikut mendaftar di KPU. ‘Dasar itulah mengapa saya begitu sangat ingin megaplikasikan apa yang saya miliki dan sudah saya peroleh selama ini di daerah saya. Tujuannya agar daerah ini semakin maju dan berkembang pesat,” tuturnya. Sebelumnya pada acara silaturahmi Sutan Bhatoegana dengan masyarakat Kota Psp di Hotel Bumi Asih, Saro Edi Hasibuan juga diperkenalkan oleh Sutan Bhatoegana kepada masyarakat bahwa Saro Edi sebagai salah satu balon yang tertarik mengikuti proses penjaringan di Partai Demokrat. (phn)

Bhatoegana, Pilih Gubsu Ketimbang Menteri Sambungan Halaman 1 Urbaningrum) untuk maju Pilgubsu. Terus dia bilang, Bang Sutan kan mau diklopkan jadi Menteri tahun 2014? Lalu saya ambil sikap memilih menjadi gubernur tahun 2013. Alasannya agar bisa mengabdi di kampung halaman,” sebut Sutan disambut tepuk tangan seluruh kader dan undangan. Menurut Sutan, Sumut selama beberapa periode terakhir terkesan ‘tidur’ dan jauh dari pembangunan. Terbukti dari lambatnya perkembangan pembangunan. “Puluhan tahun lalu, Sumut terkenal dengan daerah industri dan maju. Namun, beberapa periode terakhir Sumut berubah. Dan pembangunannya sangat lambat,” ungkapnya Atas kondisi ini, sambung Sutan, dia berniat maju pada Pilgubsu tahun depan dengan Partai Demokrat. “Sejuh ini belum ada calon yang diusung Partai Demokrat, baru saya yang akan maju dari partai. Seandainya ada yang mau maju dari partai yang saya bentuk ini, akan terjadi volling. Kalau pilihannya 1-3, sama saya 1 dan lawan saya 3, saya masih tetap akan diusung Partai Demokrat, tetapi kalau bandingannya 1-4 maka yang diusung jadi gubernur bukan saya lagi, melainkan yang lebih dipilih itu,” katanya.

Sutan juga menjelaskan, saat ini Sumut butuh pemimpin yang ‘BBM’ alais bersih, dan bekerja untuk masyarakat. “Jangan menjadi pemimpin yang SDM, selamatkan diri masing-masing. Saya sudah komitmen apabila saya menjadi Gubernur akan membangun Sumut ini lebih jaya dibandingkan dengan yang sekarang,” pungkasnya. Saat ditanya, siapa kira-kira yang akan menjadi pendampingnya pada Pilgubsu, Sutan menjawab tergantung situasi nanti. “Tergantung kondisi nanti lah. Sejauh ini belum ada pasangan wakil,” tambahnya. Dalam kesempatan itu, Bupati Madina HM Hidayat Batubara yang juga Ketua DPC Partai Demokrat Madina, menambahkan, Madina memiliki potensi dan sumber daya alam yang luar biasa. Dan, butuh sentuhan-sentuhan agar bisa dibina dan dibangun untuk kesejahteraan masyarakat. Hidayat juga menyebutkan, banyak sekali program yang akan dilaksanakan namun pihaknya masih mengalam sejumlah kendala untuk melobi anggaran itu. “Kami sangat berharap kepada bapak (Sutan Bhatoegana) yang duduk di Komisi III untuk membantu masyarakat Madina agar lebih sejahtera dengan perolehan anggaran yang lebih tinggi,” tandasnya.(wan)


SABTU

28 April 2012

Bariba

Pegawai Depkeu Pusat Nyalon Wali Kota Psp SIDIMPUANBertambah lagi bakal calon (Balon) Walikota Padangsidimpuan (Psp) yang akan maju dalam pemilukada Kota Psp Oktober mendatang. Kali ini PNS aktif di Departemen Keuangan (Depkeu) yang su„ Saro Edi Hasibuan dah menyatakan kesiapan dan maju dan mengklaim sudah berkomunikasi dengan partai-partai besar. H Saro Edi Hasibuan SE SPd MM MSE kepada wartawan, Kamis (26/4) malam di Hotel Natama, Kota Psp mengatakan, dirinya maju mencalon menjadi Walikota Psp adalah karena ingin memajukan Kota Psp ini dan menjadikan Kota Psp sebagai kota modern dengan menitikberatkan pada potensi perda-

‹ Baca Pegawai ...Hal ‹

7

Menjala, 2 Sekawan Hilang Sungai Batang Toru TAPSEL- Dua sekawan, Juned (27) dan Andi (28) menghilang di Sungai Batang Toru, Kecamatan Batang Toru, Kabupaten Tapanuli Selatan (Tapsel), sejak Rabu (25/4) sekira pukul 17.18 WIB. Hingga kemarin, Jumat (27/4), keduanya belum juga ditemukan. Diduga, mereka terpeleset lalu hanyut saat menjala ikan. Informasi yang dihimpun METRO dari Kapolsek Batang Toru Gunawan Pane mewakili Kapolres Tapsel AKBP Subandriya, menyebutkan, dari keterangan sejumlah saksi, saat itu Juned (27), warga Karang Moncol, Desa Bandar Hapinis, Kecamatan Muara Batang Toru, Tapsel bersama temannya Andi (28) yang diketahui warga Siantar pergi menjala ikan ke pinggiran Sungai Batang Toru. Keduanya, kata Kapolsek, menjala ikan tidak dari atas perahu. Diduga salah satu dari keduanya terpeleset dan jatuh ke sungai, kemudian hanyut terbawa arus. Melihat itu, temannya mencoba menolong dengan menarik jala. Naas, ia turut hanyut dibawa arus. Saat ini, sambung Kapolsek, jajarannya bersama muspika plus dan warga Muara Batang Toru masih melakukan pencarian dengan menyisir pinggiran dan seluruh Sungai Ba-

‹ Baca Menjala...Hal ‹

7

„ Malam hari di kota Panyabungan

Madina Rawan Banjir dan Longsor

MADINA-Selama dua minggu terakhir, di bupaten Mandailing Natal (Madina) aca ekstrem terus terjadi. Seperti, siang hari aca terasa panas dan gerah. Kemudian tika sore, hujan deras mengguyur. Dengan ndisi ini, Pemkab Madina mengimbau pada seluruh warga agar lebih waspada, rutama bagi yang bermukim di pinggir ngai dan daerah laut. Demikian disampaikan Kepala Badan nanggulangan Bencana Daerah Madina, zfan kepada METRO, Jumat (27/4). jelaskannya, selama beberapa minggu rakhir cuaca di Madina ekstrem dan tidak enentu. “Siang cuaca terasa panas dan khawatirkan terjadi kebakaran dan setiap re hujan deras selalu datang,” sebut Rizfan. Rizfan mengimbau warga yang bermukim kat dengan daerah laut dan pinggir sungai ar lebih waspada. Bagi nelayan agar lebih emperhatikan situasi cuaca sebelum meut. “Kita khawatir atas kondisi seperti ini sa menyebabkan banjir, mengingat Madia merupakan daerah rawan bencana. Bukan

‹ Baca Madina ...Hal ‹

SOPIR CEROBOH Jalinsum Macet Total SITAHUIS- Arus lalu lintas di Jalinsum Sibolga-Tarutung tepatnya di Km 17 Desa Rampa, Kecamatan Sitahuis, Tapteng, Jumat (27/4) kemarin macet total. Penyebabnya bukan faktor alam, melainkan gara-gara kecerobohan sopir dua mobil besar. Akibatnya, terjadi antrean sepanjang 2 km mulai pukul 09.00 WIB hingga pukul 14.30 WIB.

Kemacetan itu berawal saat satu unit truk BK 8389 BN yang datang dari arah Tarutung menuju Sibolga mengalami patah as di jalur tersebut. Ironisnya, posisi truk tepat berada di tengah badan jalan dan tidak dapat digeser ke pinggir. Awalnya jalan masih bisa dilalui

beberapa kendaraan. Namun sekitar 30 menit kemudian, truk dengan nomor polisi B 91127 PYT yang juga menuju Sibolga mencoba lewat dari sisi kanan. Akan tetapi belum sempat melewati truk yang patah as tersebut, roda depan truk ini terperosok ke beram jalan berlumpur.

Baca

...Hal 8

Terkait Tulisan Perluasan Kota Sibolga

Klarifikasi dari Sahat Simatupang Dinantikan

(FOTO : FREDDY)

„ Wakil Bupati Tapteng Syukran J Tanjung SE memimpin upacara menyambut Hari Bhakti Pemasyarakatan ke-48 di lapangan Lembaga Pemasyarakatan Sibolga.

Warga Binaan Harus Kreatif dan Produktif PANDAN-Wakil Bupati Tapteng, Syukran J Tanjung, Jumat (27/4), memimpin upacara Hari Bhakti Pemasyarakatan ke-48 di lapangan Lembaga Pemasyarakatan (Lapas) Sibolga. Dalam kesempatan itu, Syukran meminta warga binaan (napi dan tahanan) agar kreatif dan produktif selama dalam binaan. Hadir dalam acara tersebut, Kalapas Sibolga Drs Marasidin Siregar, Ketua Pengadilan Negeri Sibolga, Yosdy SH, Danramil 03/ Pandan Kapt Inf J Sidabutar, dan

disaksikan seluruh warga binaan. Dalam amanat Menteri Hukum dan HAM RI Amir Syamsudin yang dibacakan Wakil Bupati, menyampaikan tema hari Bhakti Pemasyarakatan tahun ini adalah “Membangun Optimisme Pemasyarakatan Produktif”. “Tema ini memiliki dua makna. Yaitu dari sisi petugas lapas dituntut untuk kreatif, inovatif dalam melaksanakan tugas. Dari sisi warga binaan, bahwa program pembinaan mampu membentuknya

menjadi pribadi-pribadi kreatif dan produktif,” ujar Syukran. Implementasinya, lanjut Syukran, berkaitan dengan tiga hal. Yakni komitmen petugas, pelatihan bekerja, serta artisipasi masyarakat secara aktif dengan tetap memperhatikan independensi. “Saya sudah lihat bahwa lembaga pemasyarakatan mampu membuat kreativitas. Contohnya Lapas klas IIa Padang mampu membuattianglistrik,

‹ Baca Warga ...Hal ‹

7

TANAH ULAYAT TAK DIAKUI

Raja Adat Curhat ke Anggota DPD RI

F:METRO/IST)

7

(FOTO : FREDDY)

„ Ketiga mobil menghadang seluruh badan jalan mengakibatkan macet total di Jalinsum Sibolga-Tarutung sepanjang 2 Km.

MANORTOR-Anggota DPDRI, Parlindungan Purba (tengah) bersama rombongan, manortor bersama Daulat Raja Agung Panuturi Hasadaon Rambe (dua kiri) di Istana Hasadaon, Aek Sabaon, Desa Sorik, Rabu sore.

TAPSEL-Raja-raja adat dari lima daerah di Tapanuli Bagian Selatan (Tabagsel) mencurhkan hati (curhat) kepada anggota Dewan Perwakilan Daerah (DPD)-RI asal pemilihan Sumut, Parlindungan Purba MM. Mereka menceritakan keberadaan tanah ulayatnya yang tidak diakui pemerintah dan diserobot banyak pihak. Keresahan ini mereka sampaikan saat Parlindungan Purba reses di Tabagsel dan dijamu Daulat Raja Agung Panuturi Hasadaon Rambe, di Istana Hasadaon, Aek Sombaon, Desa Sorik, Kecamatan Sayur Matinggi, Tapsel, Rabu (25/4) lalu. Sutan Kumala Pandapotan Pulungan dari luat Sayur Matinggi menyatakan, tanah ulayat mereka telah diserobot oleh berbagai pi-

‹ Baca Raja Adat ...Hal ‹

7

(FOTO:FREDDY)

„ Milson Silalahi SE SIBOLGA-Tulisan Sahat Simatupang terkait perluasan Kota Sibolga yang dipublikasikan melalui media beberapa hari lalu, tak hanya membuat Pemkab Tapteng saja yang gerah. Sebagian besar masyarakat Tapteng juga merasakan hal serupa. Salah satunya adalah Milson Silalahi SE, tokoh pemuda Tapteng yang juga merupakan Ketua LSM Format Sibolga-Tapteng. Aktivis yang terbilang vokal ini-

pun meminta kepada Sahat Simatupang selaku seorang dosen dan pemerhati pariwisata ini untuk mengklarifikasikan tulisannya tersebut ke publik. “Tulisan saudara Sahat Simatupang yang dipublikasikan salah satu media lokal berisi: Wacana yang digulirkan Pemko Sibolga ditanggapi oleh masyarakat dan Pemerintah Kabupaten Tapteng dengan nada minor, menimbulkan pertanyaan di tengah-tengah masyarakat. Apalagi suhu politik yang sedang memanas di Tapteng akhir-akhir ini. Apakah ini bentuk provokasi?,” tanya Milson. Ditambahkan Milson lagi, menyangkut pernyataan Sahat terkait sarana umum di Kota Sibolga, seperti RSU yang dinikmati oleh sebahagian warga Tapteng, mengartikan bahwa Sahat tidak memperhitungkan sarana di Tapteng seperti Bandara Pinang Sori. “Tapteng bahkan ada bandaranya. Apalagi RSU?, di Pandan ada dan rencananya juga akan dibangun lagi RSU di Barus.

‹ Baca Klarifikasi ...Hal ‹

7


SABTU

28 April 2012

Foto: Bernad L Gaol

„ Jembatan Aek Silalaen yang ambruk awal Februari lalu. Jembatan ini menghubungkan Dusun Sandaran, Desa Lobusikkam dengan Dusun Pangaloan, Desa Simanungkalit dan Kelurahan Situmeang. Warga setempat mendesak agar Pemkab segera memperbaikinya.

Warga Desak 2 Jembatan Ambruk Segera Diperbaiki TARUTUNG- Dua jembatan beton di Kecamatan Sipoholon, Taput tepatnya di Dusun Rianiate, Desa Simanungkalit, yang ambruk dihantam arus sungai, Rabu (1/2) lalu, belum juga diperbaiki. Padahal jembatan tersebut merupakan sarana perhubungan warga desa ke ibukota kecamatan. Ambruknya kedua jembatan membuat warga kesulitan membawa hasil pertanian ke kota. “Jembatan ini satu-satunya jalur transportasi warga untuk mengangkut hasil kebun. Hingga kini kami kesulitan

mengangkut hasil pertanian kami ke pasar. Kondisi ini memaksa kami memikul hasil bumi kami,” kata Beta Simanungkalit (39) warga Desa Lobu Sikkam kepada METRO, Jumat (27/4) di Sipoholon.

Foto:Bernad L Gaol

„ Jembatan Aek Sirongit yang ambruk namun belum diperbaiki.

Katanya, jembatan tersebut merupakan sarana utama bagi warga Dusun Sandaran, Desa Lobusikkam dengan Dusun Pangaloan, Desa Simanungkalit, Dusun Pangaloan, Dusun Sandaran, dan Dusun Rianiate dengan Kelurahan Situmeang Habinsaran. “Jembatan tersebut tidak hanya sarana perhubungan Desa Simanungkalit, tapi juga kebutuhan warga dari enam dusun dan Kelurahan Situmeang Habinsaran menuju ibukota kecamatan. Jembatan

itu juga urat nadi transportasi warga menuju sekolah, baik SD, SMP, maupun SMA. Juga layanan kesehatan seperti puskesmas. Kini jembatan itu tidak bisa dilalui kendaraan, dan tentu saja mengganggu aktivitas masyarakat,” terangnya. Karenanya, kata Berta, warga mengharapkan pemerintah segera membangun kembali kedua jembatan yang hancur diterjang arus Sungai Silalen dan Sirongit, Februari lalu.

Dishub Diminta Uji Kelayakan Kendaraan TAPUT- Anggota DPRD Tapanuli Utara Jasa Sitompul meminta Dinas Perhubungan (Dishub) dan Satlantas

Polres Taput melakukan uji kelayakan kendaraan umum dan angkutan. Sebab masih ada ribuan kendaraan

FOTO:HORDEN SILALAHI

TUMPANG SARI: Petani di Desa Matiti, Kecamatan Doloksanggul saat menunjukkan tanaman tomat dan cabai dengan sistem tumpang sari.

Pertanian Tumpang Sari Lebih Untung DOLOKSANGGUL- Petani holtikultura memilih sistem tumpang sari untuk efisiensi permodalan dan hasil produksi. Sebab secara efisiensi lahan dan perawatan pertanian, tumpang sari dinilai lebih menguntungkan oleh sejumlah petani di Desa Matiti, Kecamatan Doloksanggul, Kabupaten Humbang Hasundutan. Di Desa Matiti, sejumlah warga di lahannya menanam tomat yang digabung dengan cabai dan sayur manis. Namun

masa panen ketiga tanaman itu tidak serentak, melainkan bertahap dengan asumsi terjadinya perputaran modal. “Tanaman tomat, cabai, dan sayur tumbuh subur. Padahal, lahan cukup terbatas. Sehingga dengan lahan yang terbatas itu, kami mengolahnya dengan sistem tumpang sari supaya lebih menguntungkan,” sebut M br Marbun (42), Jumat (27/4). Ia menyebutkan, saat lahan

„) Baca Pertanian ...Hal 10

TAPUT- Rekanan atau kontraktor harus mampu memberikan jaminan kualitas proyek yang dikerjakannya, termasuk pembangunan dan perbaikan jalan. Hal ini disampaikan anggota DPRD Tapanuli

„ Warga yang mendapatkan pemeriksaan kesehatan gratis.

„) Baca Dishub...Hal 10

Utara Alamsah Sihombing, Jumat (27/4). Alamsah meminta Dinas Pekerjaan Umum (PU) Taput mengoptimalkan penggunaan anggaran yang disiapkan untuk perawatan jalan pada tahun 2012.

„) Baca Kontraktor ...Hal 10

„) Baca Warga ...Hal 10

Foto: Bernad L Gaol

angkutan umum belum mendapat uji kelayakan.

Kontaktor Harus Jamin Mutu Proyek

Senada dikatakan Prengki L Lubis (38) warga Dusun Pangaloan. Katanya, ambruknya kedua jembatan itu membuat masyarakat yang hendak menuju ibukota Kecamatan Sipoholon harus melewati jalanjalan di Desa Hutatinggi Kecamatan Parmonangan dengan jarak sekitar 15 kilometer. Jika jembatan itu sudah diperbaiki, maka akses sangat dekat, yaitu cukup menyeberangi jembatan tersebut.

Puskesmas Hutabaginda Gelar Pengobatan Gratis TARUTUNG- Pengobatan andor dinilai sangat gratis yang digelar Unit Pelamembantu masyarakat. Selain yanan Teknis (UPT) Pusbisa menolong pengobatan 50 kesmas Hutabaginda Taruwarga yang sebagian besar tung, Tapanuli Utara (Taput), Jumat (27/4) di Desa Siandor- „) Baca Puskesmas ...Hal 10

SMA Plus Lintongnihuta Terima Siswa Angkatan Pertama

FOTO:METRO/HORDEN SILALAHI

SMA PLUS: Gedung kantor dan laboratorium SMA Plus Lintongnihuta di Desa Silaban, Kecamatan Lintongnihuta.

HUMBAHAS- SMA Plus atau SMA Negeri 2 Lintongnihuta membuka pendaftaran siswa angkatan pertama tahun ini. Pendaftaran siswa baru dibuka 30 April dan ditutup 5 Mei 2012. Seleksi penerimaan siswa sepenuhnya diselenggarakan Universitas Negeri Medan (Unimed) bekerja sama dengan Dinas Pendidikan (Disdik) Humbang Hasundutan. Demikian dikatakan Kepala

Dinas Pendidikan (Kadisdik) Humbahas Drs Wisler Sianturi saat dihubungi METRO, Jumat (27/4). Wisler menjelaskan, tempat pendaftaran siswa baru dilaksanakan di gedung SMA Negeri 2 Lintongnihuta, Desa Silaban. “Syarat-syarat pendaftaran dapat diambil di lokasi,” ujar Wisler. Sedangkan ujian seleksi,

„) Baca SMA Plus ...Hal 10


SABTU

28 April 2012

Pertanian Tumpang Sari Lebih Untung Sambungan Halaman 9 sudah siap tanam, yang terlebih dahulu disemai adalah cabai. Beberapa minggu kemudian, di lahan yang ditanami cabai tersebut ditanam bibit tomat. “Setelah satu bulan, saat pohon cabai dan tomat sudah mulai tumbuh besar, kita tanam sayur-sayuran di sampingnya,” tambah M br Marbun. Masih kata M br Marbun, meskipun sayuran ditanam belakangan, namun masa panennya lebih cepat. “Kita panen sayur dulu, baru panen tomat, kemudian

cabai. Masa penennya kirakira berjangka dua minggu ke atas,” papar ibu empat anak itu. Dijelaskannya, ia sudah menggeluti sistem pertanian tumpang sari sejak empat tahun lalu. Menurutnya, cara bertani dengan sistem tumpang sari dapat mempercepat pengembalian sebagian modal pertaniannya. “Kan kalau kita sudah panen sayur duluan, modal kita sudah kembali sebagian. Kemudian setelah panen tomat dua kali, modal sudah bisa kembali semua. Jadi dari cabai tinggal ambil untung,” ungkapnya. (hsl)

Dishub Diminta Uji Kelayakan Kendaraan Sambungan Halaman 9 Jasa mengatakan, untuk menekan jumlah kendaraan yang belum melakukan uji kelayakan, Dishub diminta terus melakukan razia bersama Satlantas Polres Taput. “Jika pihak terkait terus melakukan razia kendaraan umum yang belum melakukan uji kelayakan, maka dengan sendirinya para pemilik kendaraan umum akan melakukan uji kelayakan ke Dinas Perhubungan,” kata Jasa, Jumat (27/4). Dikatakannya, Dishub Taput harus menelusuri penyebab banyaknya kendaraan umum yang belum melakukan uji kelayakan. “Apakah karena pemilik kendaraan dipersulit dengan aturan dalam perda, atau karena faktor biaya retribusi? Namun, kita juga harus pertanyakan apakah pihak Dishub mempersulit atau bagaimana. Kalau dulu, untuk kendaraan umum yang sudah tua, pihak Dishub menyesuaikan harga administrasi uji kelayakannya. Karena tentunya tidak mungkin disamakan dengan kendaraan umum keluaran terbaru,” sebutnya. Menurutnya, kendaraan

angkutan umum yang keluaran tahun lama, tidak dapat dipastikan layak beroperasi lagi. “Kalau memang lolos uji, mungkin karena faktor perawatannya bagus. Tetapi kalau belum lolos uji kelayakan, itu sangat membahayakan bagi penumpang yang dibawanya,” papar Jasa. Sebelumnya, Kepala Penguji Kelayakan Kendaraan Dishub Taput HL Tobing mengatakan, dari 2.500 unit kendaraan umum yang wajib melakukan uji kelayakan, hingga tahun 2011 tercatat hanya 977 unit yang sudah melakukan pengujian kelayakan. Sisanya, 1.523 unit kendaraan, termasuk kendaraan penumpang, tidak melakukan pengujian. Sehingga diduga sudah banyak kendaraan umum dan angkutan tidak layak beroperasi. Dikatakannya, meski pihaknya sudah beberapa kali melakukan razia, tetapi sejumlah pemilik angkutan umum masih membandel. “Karena setiap kita mau melakukan razia, pemilik angkutan umum langsung bersembunyi dan tidak beroperasi,” katanya. (cr- 02/ hsl)

RELAS PEMBERITAHUAN PUTUSAN VERSTEK Nomor: 17/Pdt.G/ 2010./PN.Trt; Pada hari ini, Jumat, tanggal 27 April 2012, saya ENDY AYAL, JURUSITA pada Pengadilan Negeri Tarutung, atas perintah Majelis Hakim Pengadilan Negeri Tarutung, dalam perkara perdata NO. 17/Pdt.G/ 2012./PN.Trt; TELAH MEMBERITAHUKAN KEPADA. BRESMAN LUMBANTOBING, Umur 52 Tahun, Wiraswasata, semula beralamat di Desa Pasaribu Dolok, Kecamatan Dolok Sanggul, Kabupaten Humbahas, sekarang tidak diketahui lagi alamatnya di wilayah indonesia, disebut sebagai;................TERGUGAT-1 Tentang Putusan Pengadilan Ngeri Tarutung, tanggal 01 September 2010, nomor :17/pdt.G/2010/PN. Trt, dalam perkara antara. DAUS LUMBANTOBING, DKK…………….Sebagai Para Pengugat Lawan BRESMAN LUMBANTOBING,DKK……......Sebagai Para Tergugat: Yang amarnya berbunyi sebagai berikut MENGADILI. 1. Menyatakan perkara ini diputus tanpa hadirnya tergugat( VERSTEK). 2. Mengabulkan gugatan penggugat – penggugat untuk sebahagian: 3. Menyatakan pengugat – pengugat adalah anak kandung / ahli waris Alm.Domitian Lumbantobing, Als,Ompu. Parulian 4. Menyatakan tanah terperkara sebagaimana yang tertera dalam sertifikat hak milik No.81 tahun 2002 tanggal :24 Desember 2002 atas nama tergugat -1 Bresaman Lumbantobing yang terletak di Desa Pasaribu, Lumban Sampur, Kec. Dolok Sanggul, Kab, Humbahas seluas 1.032 M2 dengan batas – batas sebagai berikut. • Sebelah Timur : Berbatasan dengan rumah Maruhum Lumbantobing • Sebelah Barat : Berbatasan dengan Rumah Alm.Domitian Lumbantobing • Sebelah Utara : Berbatasan dengan tanah warisan milik pengugat- pengugat • Sebelah Selatan : Berbatasan dengan parit: Adalah milik peninggalan Alm. Domitian Lumbantobing Als.Ompu. Parulian 5. Menyatakan tanah terperkara adalah merupakan tanah warisan peninggalan Alm. Domitian Lumbantobing ALS. Ompu Parulian yang diwariskan bagi pengugat – pengugat selaku anak kandung dari Alm. Domitian Lumbantobing. 6. Menyatakan tindakan tergugat – 1 yang mengklaim tanah terperkara seolah miliknya serta memohon penerbitan sertifikat hak milik dari tergugat II merupakan perbuatan melawan hukum.( Onrech Matige Daad) 7. Menyatakan tindakan tergugat- II yang menerbitkan sertifikat tanah terperkara ke atas nama tergugat –I tanpa seijin dan sepengetahuan pengugat- pengugat selaku anak kandung /ahli waris Alm. Domitian Lumbantobing ALS Ompu Parulian merupakan perbuatan melawan hukum. (Onrech Matige Daad ) 8. Menyatakan hukum sertifikat hak milik No. 81 tahun 2002 tanggal 25 desember 2002 atas nama tergugat- I Bresman Lumbantobing tidak berkekuatan hukum tetap. 9. Menghukum tergugat- I ataupun orang lain yang mendapat hak dari padanya untuk menyerahkan tanah terperkara dalam keadaan baik dan kosong kepada penggugat – penggugat selaku anak kandung / ahli waris Alm.Domitian Lumbantobing ALS Ompu Parulian selaku pemilik tanah terperkara dapat mengusahai dan menguasainya secara bebas dan leluasa. 10. Menghukum Tergugat untuk membayar ongkos perkara yang timbul dalam perkara ini sebesar Rp.1.591.000. 11. Menolak Gugatn penggugat selain dan selebihnya: Kepada tergugat- I saya jelaskan akan haknya untuk mengajukan perlawanan dalam tenggang waktu selama 14 hari terhitung setelah pemeberitahuan ini. Pemberitahuan putusan Verstek ini saya umukan melalui media massa Harian METRO TAPANULI karena tergugat - I sekarang alamatnya sudah tidak diketahui lagi di seluruh wilayah Indonesia dengan berpedoman pada pasal 718 ( 3) RBG dan pasal 390 HIR serta lembaran Negara No. 44 Tahun 1941 Demikianlah panggilan sidang ini saya perbuat dan saya tandatangani dengan harapan agar dapat dibaca oleh umum; YANG MEMANGGIL : JURUSITA ENDY JEREMES AYAL NIP .197009291993031004

PPL Berkontribusi Tingkatkan Produksi Pertanian BALIGE- Ketua Komisi C DPRD Toba Samosir Sakkan Siahaan meminta petugas penyuluh pertanian lapangan (PPL) bekerja lebih optimal melakukan pendampingan terhadap petani agar produksi pertanian bisa semakin meningkat. “Petugas PPL harus bisa menularkan ilmu pertanian yang dimiliki tentang budidaya tanaman agar para petani mengetahui teknik bercocok tanam untuk menghasilkan produksi yang maksimal,” ujar Sakkan di Balige, Jumat (27/4). Sebab, kata Sakkan, tugas pokok penyuluh pertanian adalah melakukan kegiatan persiapan pelaksanaan pengembangan penyuluhan serta evaluasi dan pelaporan sesuai yang telah digariskan dalam tupoksinya masing-masing. Dia menyebutkan, petugas PPL memberikan kontribusi cukup signifikan terhadap peningkatan produksi, melalui penyuluhan dan bimbingan

teknologi yang dianjurkan dapat dilaksanakan para petani dengan tepat. Fungsi PPL, kata Sakkan, antara lain memfasilitasi proses pembelajaran petani sebagai pelaku utama dan pelaku usaha untuk mengupayakan kemudahan terhadap sumber informasi teknologi dan sumber daya lainnya, sehingga para petani dapat mengembangkan usahanya. Selain itu, lanjutnya, meningkatkan kemampuan manajerial, membantu menumbuhkembangkan ekonomi berdaya saing tinggi dan produktif dengan menerapkan tata kelola berusaha yang baik untuk pemecahan masalah serta merespon peluang dan tantangan di tingkat petani. “Peran PPL sangat dibutuhkan untuk memberikan penyuluhan dan bimbingan guna peningkatan mutu dan produksi pertanian,” katanya. Sebelumnya, Kadis Pertanian Tobasa, Parlindungan Simanjuntak menyebutkan pemerintah

daerah setempat menargetkan pencetakan 150 hektare lahan pertanian organik untuk komoditi beras pada 2012 guna mewujudkan program Dinas Pertanian menuju visi “go organic 2015?. Ia menyebutkan, untuk mencapai sasaran tersebut, pihaknya telah menganggarkan dana berbagai sarana pendukung, seperti pembuatan rumah kompos, traktor tangan, mesin penggiling dan lumbung padi padi. Data dari Badan Pusat Statistik (BPS) menunjukkan, Kabupaten Tobasa memperoleh peringkat kedua hasil padi terbesar setelah Kabupaten Deliserdang. “Atas prestasi tersebut, kami menargetkan tahun ini sebagai penghasil beras organik terbesar di Sumut, melalui optimalisasi pemberdayaan petugas PPL dalam melakukan pendampingan dan penyuluhan untuk meningkatkan produksi pertanian,” kata Parlindungan. (ant/int)

Pemkab Gelar Talk Show Informasi Pembangunan BALIGE- Pemkab Toba Samosir menyelenggarakan program khusus “talk show” bertajuk informasi pembangunan agar masyarakat luas mengetahui perkembangan pembangunan di wilayah setempat. “Acara tersebut disiarkan melalui radio Tobasa FM 100.7 MHz guna menyampaikan informasi publik terkait pembangunan dan pelayanan yang telah dilakukan pemerintah,” kata Kepala Bidang Komunikasi dan Informatika Pemkab Tobasa, Marnaek Parhusip di Balige, Kamis (26/4). Talk show tersebut, kata dia, juga menggelar dialog interaktif, sehingga para pemirsa bisa berkomunikasi langsung dengan nara sumber dalam menyampaikan berbagai saran maupun kritikan dalam konteks percepatan pembangunan daerah Tobasa. Ia menyebutkan, sejumlah narasumber pada acara tersebut berasal dari Pimpinan Satuan

Kerja Lingkup Pemerintah Daerah yang siap memberikan solusi dan menampung berbagai masukan bermanfaat guna menyempurnakan sistem pelayanan pemerintah terhadap masyarakat dalam kabupaten tersebut. “Instansi terkait diharapkan bisa menjadikan acara itu sebagai referensi untuk evaluasi kinerja yang telah mereka lakukan,” ujar Marnaek. Dikatakannya, sistem pelaksanaan talk show dimaksud, diselenggarakan secara bergilir sesuai jadwal yang ditetapkan dalam surat nomor 550/123/ DPKI/II/2012 yang ditandatangani Bupati Tobasa Kasmin Simanjuntak. Materi talk show ditentukan serta dipersiapkan oleh SKPD terkait dan menyerahkannya satu atau dua hari sebelum siaran ke Dinas Perhubungan Komunikasi Informasi, untuk seterusnya disampaikan kepada Bupati Tobasa sebagai laporan. (ant/int)

Warga Desak 2 Jembatan Ambruk Segera Diperbaiki Sambungan Halaman 9 “Ambruknya jembatan itu tidak hanya mengganggu aktivitas warga. Tetapi sangat menyulitkan para pelajar saat pergi dan pulang sekolah. Mereka terpaksa harus berputar melintasi jalan lain yang relatif cukup jauh,” ujarnya, seraya berharap Pemkab Taput melalui dinas terkait segera memerbaiki kedua jembatan tersebut. Terpisah, Kepala Dinas Pekerjaan Umum (PU) Taput Ir Anggiat Rajagukguk mengatakan Pemkab tetap berusaha membangun

kembali dua jembatan yang rusak tersebut. Hanya saja, sambungnya, dananya masih diupayakan. “Kita berupaya membangun kembali kedua jembatan itu, sekalian membuka keterisoliran warga yang berdomisili di Desa Simanungkalit, Dusun Sandaran, Dusun Rianiate, dan Dusun Pangaloan Desa Lobusikkam, Sipoholon. Karena kedua jembatan itu merupakan akses jalan utama untuk transportasi menuju dan keluar kota kecamatan dan kabupaten,” terangnya melalui telepon seluler,

kemarin. Ia memastikan perbaikan kedua jembatan dilakukan tahun ini jika dana mencukupi. Hanya saja, sambungnya, upaya membangun kembali kedua jembatan itu membutuhkan proses. Jika dibangun sekaligus, tentunya membutuhkan dana cukup besar. Karenanya, kata Anggiat, pembangunan nantinya dilakukan bertahap dan merata. “Saat ini saja kita masih melakukan penghitunga biaya yang konkret. Kita hitung dulu, baru kita cari sumber dana untuk diusulkan,” terangnya.

Kontaktor Harus Jamin Mutu Proyek Sambungan Halaman 9 Karena menurutnya, dana yang berlebih tidak menjamin perbaikan sejumlah jalan di Taput berjalan baik. Pernyataan Alamsah tersebut menanggapi pernyataan Kabid Perencaan dan Teknis Dinas PU Taput yang mengatakan, merujuk draf rancangan kerja, seyogianya Dinas PU membutuhkan dana Rp80 miliar untuk perbaikan jalan di Taput. “Dana yang disiapkan itu kalau memang tepat dikelola, ya itu juga sudah cukup. Karena dana yang besar pun, kalau memang tidak dikerjakan dengan baik, itu tetap saja nantinya akan kurang,” katanya. Menurutnya, untuk masalah perbaikan jalan, Dinas PU harus memperketat pengawasan dan meminta jaminan

kepada pihak kontraktor, seberapa lama jalan yang diperbaikinya dapat digunakan. “Contohnya, pihak kontraktor harus dapat menjamin jalan yang diperbaikinya dapat bertahan hingga lima tahun. Nah, jangan seperti jalan yang ada di Siborongborong ini, baru siap dikerjakan tahun lalu, namun sekarang sudah rusak,” katanya. Alamsah juga menambahkan, selain melakukan ketatnya pengawasan oleh Dinas PU terhadap kontraktor yang mengerjakan perbaikan jalan, pihak terkait juga harus menertibkan kendaraan yang berjalan bebas dengan muatan berlebih yang mengakibatakan jalan-jalan cepat rusak. “Saya lihat banyak kendaraan yang melintas bebas di jalan desa yang muatannya lebih dari enam

ton. Nah , karena itu dalam waktu dekat itu akan kita bahas di DPRD mengenai berapa berat maksimal muatan kendaraan yang melintas di setiap jalan yag ada di Tapanuli Utara ini,” ujarnya. Sebelumnya, Dinas PU Taput melalui Kepada Bidang Perencanaan Teknis, Dalan Simanjuntak mengatakan, pihaknya telah mengusulkan dana sebesar Rp38,3 miliar untuk rehabilitasi sejumlah jalan yang rusak di daerah ini. Dana tersebut difokuskan untuk perbaikan di 129 titik. Namun, Dalan sempat mengatakan, jika dilihat dari rencana kerja, yang dibutuhkan Taput untuk memperbaiki jalan sebanyak Rp80 miliar. “Namun karena keterbatasan kita, ya itu lah dulu,” katanya kepada METRO baru– baru ini,” ujarnya. (cr-02)

SMA Plus Lintongnihuta Terima Siswa Angkatan Pertama Sambungan Halaman 9 katanya, panitia dari Unimed, akan menyelenggarakannya di gedung SMK Negeri 1 Doloksanggul. “Ujian diadakan 10 Mei mendatang,” sebutnya. HARI INI INVESTASI: Mulai besok dapat profit 7% Rp. 6.300.000 setiap harinya non stop selama 200 hari (Tanpa Rekrut) Minat???? SMS "Petunjuk" ke HP 0877 8847 7900

Masih kata Wisler, siswa angkatan pertama yang akan diterima sebanyak 60 orang. “Siswa yang diterima hanya 60 orang. Jadi hanya untuk kelas 1 yang diterima atau angkatan pertama tahun ini,” terangnya. Ditambahkan Wisler, pihak Unimed juga akan mengumumkan nama-nama guru dan kepala sekolah yang lulus seleksi minggu lalu.

“Unimed yang menentukan atas seleksi guru, kepala sekolah, dan siswa baru,” tandasnya. Untuk diketahui, 20 April lalu, panitia seleksi dari Unimed, menggelar ujian seleksi calon kepala sekolah dan guru SMA Plus Lintongnihuta, di gedung SMKN 1 Doloksanggul. Ada 250 guru bersaing memerebutkan posisi guru dan kepala sekolah. (hsl)

TOYOTA BARU ASTRA: Ready Avanza, innova, fortuner Hub. Purba 0813 9789 4633; 0813 9736 0333 PROMO MITSUBISHI: Pick Up L300 & T120ss. Colt Diesel Chassis & Dumptruck. Fuso, Triton, Pajero Sport. BB/BK >oke..! Kuning/ Hitam>oke!! Diskon spesial Hubungi: VINA NAULI SIREGAR 0812 6036 0000

DIBUTUHKAN GURU TK-SD: di Tj. Piayu Batam & guru bimbel di Marindal Medan, wanita single 18-30 th, min SMU HP 0852 6177 6326, 0813 6432 3472, 0821 6404 3077 DIJUAL: Mobil Minibus Suzuki carry Futura 1.3 thun 1991, body mulus, harga nego tanpa perantara hub. D. Simanjuntak HP 0813 7554 0521

MENYEDIAKAN ANEKA HEWAN PELIHARAAN: Burung hias/konsumsi, pheasant, bebek hias, reptile, kura-kura (import & lokal), hamster, landak mini, merpati, ayam, perkutut, anjing, kodok hias, kelinci, cicak, jangkrik, ulat Hongkong/Jerman, kroto, aksesories, pakan, kandang dll. hub. 0878 6849 0858 Medan DIJUAL: Mobil kijang LGX silver metallic 2001, 1800 CC, EFI, AC, Mulus, harga negos, serius hub. HP 0821 6159 0417 / 0813 6179 9055

Lebih lanjut Anggiat menyebutkan, jembatan Aek Rongit yang menghubungkan Dusun Pangaloan, Dusun Sandaran, dan Dusun Rianiate dengan Kelurahan Situmeang Habinsaran, Sipoholon direncanakan perbaikannya dilakukan tahun 2013 dengan konstruksi jembatan beton. Sedangkan jembatan Aek Silalaen yang menghubungkan Dusun Sandaran dan Desa Lobusikkam dengan Dusun Pangaloan, Desa Simanungkalit direncanakan pembangunannya tahun ini. “Kita sedang berkoordinasi dengan TNI untuk

pembangunan jembatan. Mudah-mudahan akan dilakukan secepatnya,” ujarnya. Diberitakan sebelumnya, dua jembatan beton di Sipoholon, tepatnya di Dusun Rianiate, ambruk setelah dihantam arus sungai, Rabu (1/2) malam. Tidak ada korban jiwa dalam peristiwa itu. Namun sedikitnya 400 kepala keluarga (KK) atau sekitar 1.500 jiwa yang berdomisili di Desa Simanungkalit, Dusun Sandaran, Dusun Rianiate, dan Dusun Pangaloan Desa Lobusikkam, Sipoholon terisolir. (cr-01)

Puskesmas Hutabaginda Gelar Pengobatan Gratis Sambungan Halaman 9 lanjut usia, juga dapat mengetahui penyakit apa saja yang diidap warga setempat. Dari pengobatan gratis tersebut diketahui hipertensi atau tekanan darah tinggi merupakan penyakit yang dominan diidap para lansia. Para lansia sangat rentan mengalami hipertensi karena pola makan yang salah. Padahal, dengan pola makan yang teratur serta pemenuhan gizi seimbang, dapat mengurangi resiko mengalami hipertensi. “Mayoritas para lansia mengalami hipertensi, selain penyakit lambung. Tentu kondisi ini kita pahami. Mereka adalah pekerja keras namun sering lupa makan. Mereka mengaku belum makan, tapi sudah minum kopi. Akibatnya mereka banyak yang sakit lambung,” ujar dr Andi Sitompul, dokter UPT Puskesmas Hutabaginda. Andi menambahkan, untuk anak-anak, penyakit Infeksi Saluran Pernafasan Atas (ISPA) masih mendominasi. Namun tidak ditemukan penyakit kulit pada masyarakat. “Pada anak-anak, infeksi saluran pernafasan. Secara umum mereka sangat menjaga kebersihan. Saya lihat mereka cukup bersih,” tambahnya. Sejumlah warga mengantre untuk memeriksakan kesehatan. Salah seorang warga, K Hutapea (70) mengaku sering pusing hingga aktivitasnya terganggu.

“Makanya saya datang mau mengecek tensi darah karena kepala saya sering pusing,” sebutnya Dia juga mengaku, selama dua tahun terakhir mengidap hipertensi. Selain hipertensi, dia juga mengalami gangguan lambung. “Memang saya bermasalah kalau urusan makan. Kadang saya terlambat makan, maklumlah kalau sudah tua, selera makannya sering terganggu,” ungkapnya. Penuturan lainnya diungkapkan M Silaban (40). Dia membawa anaknya yang berusia enam bulan dan lima tahun ke Puskesmas. Sebab sudah seminggu anaknya terserang batuk. “Batuknya sudah seminggu, jadi saya bawa ke mari,” ujarnya. Sementara bidan desa setempat Sabrina Damanik mengatakan, penyakit batuk sangat rentan dialami anak-anak, terutama di setiap pergantian musim. Penyakit ini bukan hanya dialami anak-anak, tetapi juga orang dewasa. “Biasanya kalau ada pergantian dari musim kemarau ke musim penghujan atau sebaliknya,” katanya. Katanya, pengobatan gratis ini diselenggarakan UPT Puskesmas Hutabaginda yang bertujuan membantu masyarakat memeroleh pengobatan berupa pemeriksaan dan pemberian obat. “Kebanyakan mereka mengeluhkan sakit kepala, asam urat, rematik, batuk, dan flu,” ujar Sabrina. (cr-01)


SABTU

28 April 2012

Internasional Terlibat Kejahatan Perang

Mantan Presiden Liberia Divonis BELANDA- Pengadilan khusus internasional di Den Haag memutuskan mantan pemimpin Liberia, Charles Taylor, bersalah telah membantu dan bersekongkol dalam kejahatan perang di Sierra Leone. Dia didakwa mendukung kelompok pemberontak dalam perang Charles Taylor saudara di Sierra Leone yang berlangsung tahun 1991 hingga 2002 dan menewaskan puluhan ribu orang. Saat membacakan keputusan, Hakim Richard Lussick, mengatakan jaksa penuntut sudah membuktikan kelompok pemberontak bertanggung jawab atas pembunuhan, pemerkosaan, dan penjagalan orang selama perang di Sierra Leone tersebut. ”Tuan Taylor, majelis pengadilan menyatakan Anda bersalah atas 11 dakwaan, termasuk teror, pembunuhan, pemerkosaan, dan memaksa anak-anak menjadi tentara,” kata Lussick kepada Charles Taylor. Ketika mendengarkan vonis mantan pemimpin Liberia tersebut tampak tidak memperlihatkan emosi. (kmc/int)

Penumpang Ancam Bajak Pesawat ISLAMABAD- Insiden menegangkan terjadi di dalam pesawat Pakistan. Pesawat tersebut terpaksa kembali ke bandara tak lama setelah lepas landas di Pakistan hari ini. Gara-garanya, seorang penumpang melontarkan ancaman pembajakan pesawat. Juru bicara maskapai penerbangan nasional, Pakistan International Airlines (PIA), Sultan Hasan mengatakan, pesawat rute domestik tersebut mengangkut lebih dari 50 penumpang dan 5 kru. Pesawat tersebut baru saja bertolak dari Kota Karachi untuk menuju Kota Bahawalpur, Pakistan timur. ”Segera setelah pesawat lepas landas, seorang penumpang di pesawat mengingatkan staf bahwa dia bisa membajak pesawat tersebut,” kata Hasan kepada kantor berita AFP, Jumat (27/4). ”Kapten diberitahu soal situasi tersebut, yang kemudian memutar kembali pesawat setelah mendapat persetujuan dari menara pengendali,” imbuhnya. Begitu mendarat kembali di Karachi, penumpang tersebut ditahan dan diserahkan ke pihak keamanan untuk ditanyai. Pesawat itu pun diperiksa dan kemudian dinyatakan aman. Industri penerbangan Pakistan belum lama ini menjadi pemberitaan media setelah pesawat Boeing 737 milik maskapai penerbangan swasta, Bhoja Air jatuh dekat Islamabad pada 20 April lalu. Seluruh penumpang dan kru yang berjumlah 127 orang tewas dalam musibah itu. (kmc/int)

AS Akan Tarik 9 Ribu Marinir dari Jepang TOKYO- Pemerintah Amerika Serikat (AS) telah membuat kesepakatan dengan Jepang untuk memindahkan 9 ribu Marinir AS dari Okinawa, Jepang. Mereka akan ditempatkan di Guam, Hawaii dan Australia. Dengan penarikan ini berarti akan mengurangi nyaris separuh jumlah personel AS yang masih berada di Jepang, yakni tinggal 10 ribu personel. Demikian hasil kesepakatan yang diumumkan dalam pernyataan bersama AS-Jepang seperti diberitakan kantor berita AFP, Jumat (27/4). ”Saya sangat senang karena setelah bertahun-tahun lamanya, kita telah mencapai kesepakatan dan rencana aksi penting ini,” kata Menteri Pertahanan AS Leon Panetta dalam sebuah statemen. ”Saya menghargai kerja keras dan upaya yang telah dilakukan untuk mewujudkan ini. Jepang bukan cuma sekutu dekat, namun juga teman dekat,” imbuh Panetta. Sesuai kesepakatan tersebut, 9 ribu Marinir AS di Jepang akan direlokasi. Sebanyak 5 ribu Marinir di antaranya akan ditempatkan di Guam. Sementara sisanya akan dikirimkan ke Hawaii dan Australia. Namun meski tercapainya kesepakatan ini, kedua negara belum sepakat tentang tuntutan penutupan pangkalan militer Futenma di Okinawa. Pemerintah AS menolak penutupan pangkalan tersebut karena Jepang dianggap belum bisa mencarikan lokasi alternatif jika pangkalan itu ditutup. Berbagai usulan yang ditawarkan pemerintah Jepang mendapat penolakan kelompok oposisi negeri Sakura tersebut. Selama ini keberadaan pasukan AS di Okinawa telah menjadi isu kontroversial. Warga Okinawa menginginkan pangkalan itu ditutup karena dianggap membahayakan dan sebagai penyebab utama kebisingan. (kmc/int)

KPK Pastikan Banding atas Putusan Nazaruddin JAKARTA- Vonis 4 tahun 10 bulan terhadap M Nazaruddin belum membuat tim jaksa KPK puas. Lembaga antikorupsi itu memastikan banding terhadap vonis pengadilan negeri Tipikor. ”Sudah dipastikan,” tutur Jubir KPK Johan Budi ketika dikonfirmasi, Jumat (27/4). Johan belum mengetahui secara pasti alasan jaksa KPK memutuskan untuk banding. Namun menurutnya, ada penerapan pasal yang masih dinilai kurang pas oleh KPK. ”Saya belum dapat penjelasan dari jaksa KPK tapi yang jelas karena vonis hakim belum sesuai dengan tuntutan jaksa KPK, baik dari

sisi penerapan pasal maupun hukuman yg dijatuhkan,” sambungnya. M Nazaruddin, divonis 4 tahun 10 bulan penjara, jauh lebih ringan dibanding tuntutan 7 tahun penjara. Dia dinilai terbukti bersalah dalam kasus suap wisma atlet lantaran menerima suap dari Manajer Marketing PT Duta Graha Indah (DGI), Mohammad El Idris. ”Menjatuhkan pidana oleh

karenanya pada terdakwa dengan pidana 4 tahun dan 10 bulan, menjatuhkan denda Rp 200 juta jika tidak dibayar diganti kurungan 4 bulan,” ujar ketua majelis hakim, Dharmawati Ningsih, di Pengadilan Tipikor, Jalan HR Rasuna Said, Jakarta, Jumat (20/4). Nazar menghadiri sidang dengan mengenakan kemeja batik lengan panjang warna biru. Selama sidang, dia menyimak dengan serius surat putusan yang dibacakan hakim. Nazar dinilai terbukti bersalah dalam pasal 11 UU 31/1999 sebagaimana diubah UU No 20/2001 tentang Pemberantasan Tipikor. (dtc/int)

Tersangka kasus suap wisma atlet Nazaruddin memberikan keterangan di persidangan.

Tembak TNI, 9 Anggota Brimob Gorontalo Tersangka JAKARTA- Mabes Polri menyebutkan pihaknya telah menetapkan sembilan anggota Brigade Mobil (Brimob) Polda Gorontalo sebagai tersangka dugaan penembakan terhadap anggota TNI AD di Gorontalo. Mereka diduga kuat sebagai pihak yang bertanggung jawab atas serentetan tembakan yang menewaskan seorang anggota TNI itu. “Sembilan anggota brimob yang melakukan penembakan sudah kita tetapkan (sebagai) tersangka dan tadi pagi sudah dilakukan gelar perkara yang dipimpin oleh Kadiv Propam Polri yang dihadiri juga oleh kepala Staf Kostrad,” ujar Karopenmas Div Humas Polri Brigjen (pol) M Taufik, di Jakarta, Jumat (27/ 4). Sembilan tersangka ini terdiri dari seorang perwira dan delapan lainnya berpangkat bintara. Kini anggota personil satuan tempur Polri itu sudah ditahan. Tidak hanya terancam pidana jika dalam persidangan nanti mereka terbukti bersalah ancaman pemberhentian dengan tidak hormat sudah menanti. “Dan proses selanjutnya kita upayakan percepatan pemberkasan dari perkara ini dan kita serahkan sesegera mungkin ke JPU,” imbuhnya. Seperti diketahui sejumlah prajurit Kostrad 221 Gorontalo diduga menjadi korban penembakan Sabtu (21/4) lalu di Taman Menara Kea-

gungan Limboto. Peristiwa tersebut kemudian membuat seorang anggota TNI bernama Prada Firman tewas setelah beberapa hari men-

jalani perawatan akibat luka. Untuk mencegah bentrok antar satuan, Mabes Polri dan TNI turun langsung menan-

gain kasus tersebut. Adapun adanya pelanggaran atau perbuatan pidana yang dilakukan oleh oknum atau person-

al yang dituduh tidak atas nama institusi, jadi hanya dilakukan beberapa orang,”pungkasnya.(zul/ jpnn)

Kapolri memberikan penjelasan pers terkait penetapan tersangka personel Brimob yang menembak TNI.

Kejagung Garap Dua Wajib Pajak Dhana JAKARTA - Kejaksaan Agung (Kejagung) tampaknya ekstra hati-hati dalam menangani kasus tersangka korupsi pajak Dhana Widyatmika (DW). Jajaran penyidik pada Jaksa Agung Muda Pidana Khusus memilih untuk fokus pada dua perusahaan wajib pajak. Alasannya, waktu penahanan Dhana yang segera berakhir membuat mereka harus segera merampungkan berkas perkara. “Kasus ini sangat besar. Kalau dikembangkan ke mana-mana tidak akan selesai-selesai berkasnya. Padahal DW kami tahan kan ada batas waktunya. Wajib pajak ini dulu biar rampung dan segera ke pengadilan,” kata JAM Pidsus Andhi Nirwanto usai salat Jumat di Kejagung kemarin (27/4).

Dua perusahaan wajib pajak itu adalah PT Mutiara Virgo (MV) dan PT Kornet Trans Utama (KTU). Penyidik mengantongi catatan aliran dana dari dua perusahaan tersebut ke Dhana dan Plt Kanwil Pajak Aceh Herly Isdiharsono sebesar Rp 30 miliar. Dana tersebut kemudian dipindahkan ke perusahaan Salman Maghfiroh yang juga bekas orang Ditjen Pajak. Tujuannya, asal usul dana tidak diketahui. Andhi mengakui, aliran dana hasil kerjasama Dhana dan rekan-rekannya menyebar ke berbagai pihak. Selain disetor ke sejumlah produk investasi, dana jumbo juga mengalir ke beberapa orang. Perusahaan wajib pajak yang memberi fee kepada Dhana tidak hanya PT MV dan PT

KTU. Tapi juga PT Trisula Artha Mega dan PT Riau Perta Utama. “Iya mereka itu nanti. Yang penting berkas DW dan pemeriksaan saksisaksi untuk pidana DW selesai dulu. Bahwa nanti manakala ada terkait yang lain, itu akan dilanjutkan,” kata mantan Sekretaris JAM Pidsus itu. Selain perusahaan wajib pajak yang hanya dua, penyidik juga baru menetapkan tersangka penyuap dari PT MV. Yakni Johnny Basuki yang menjabat sebagai Direktur Utama. Tersangka penyuap dari PT KTU sampai saat ini belum ada. “Itu masih dalam penyidikan. Saat ini belum sampai pada yang bersangkutan. Kami masih tetap mengarahkan ke sana,” tambah Jaksa Agung Basrief Arief. (aga/jpnn)

Ical: Tak Ada Capres Selain Saya JAKARTA- Posisi Ketua Umum DPP Partai Golkar Aburizal Bakrie untuk maju sebagai capres sepertinya sangat kuat. Pria yang akrab dipanggil Ical ini bahkan sudah berani sesumbar tidak ada calon lain dari partai berlambang pohon beringin itu. ”Jadi sayang sekali tidak ada sama sekali calon lain yang dibicarakan untuk menjadi capres selain saya,” tutur Ical dalam jumpa pers usai Rapat Pleno di DPP Partai Golkar, Jl Anggrek Neli Murni, Jakarta Barat, Jumat (27/4). Ical mendasarkan ucapannya itu pada keputusan Rapimnas II yang menurutnya sudah mengikat. Rapimnas II yang digelar tahun lalu itu sudah memutuskan Ical satusatunya capres dan menutup peluang calon lain. ”Untuk pencalonan presiden

Aburizal Bakrie

yang dipakai adalah keputusan Rapimnas II untuk penetapan dan pengukuhan Aburizal Bakrie sebagai capres,” katanya. Tidak ada hal yang berbeda dengan keputusan Rapimnas II di Golkar. Jika DPP Golkar tidak melaksanakan amanat Rampim-

nas, maka hal itu merupakan pelanggaran aturan organisasi. ”Bisa dikenakan sanksi,” ungkapnya. Rapat pleno yang digelar di DPP Golkar dipimpin oleh Aburizal Bakrie. Tokoh Golkar yang hadir antara lain Idrus Marham, Theo Sambuaga, Leo Nababan, dan Nurul Arifin. (dtc/int)

Petrus Sujendro (Kiri)

Belanja Pegawai Rendah, Daerah Boleh Angkat CPNS JAKARTA - Meski persyaratannya lebih rumit, namun pemerintah pusat tetap memberikan peluang kepada pemda untuk mengadakan seleksi CPNS tahun ini, khusus formasi tenaga kesehatan, pendidik, dan kebutuhan mendesak. Itupun dibatasi hanya untuk daerah yang belanja pegawainya di bawah 50 persen dari APBD. “Kebijakan moratorium pengangkatan CPNS bertitik tolak pada upaya penataan PNS, khususnya bagi daerah yang memiliki PNS dalam jumlah besar sehingga menyedot anggaran APBD. Bagi daerah yang belanja pegawainya melebihi 50 persen, kemungkinan mengajukan pengangkatan CPNS sangatlah kecil,” terang Kepala Sub Bagian Publikasi Badan Kepegawaian Negara (BKN) Petrus Sujendro dalam keterangan persnya, Jumat (27/4). Kebijakan moratorium PNS didasarkan pada keputusan bersama antara Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi, Menteri Dalam Negeri dan Menteri Keuangan yang pelaksanaannya berlaku hingga Desember 2012.

Dijelaskannya, sesuai amanat moratorium PNS, pengajuan penambahan pegawai hanya bisa diberikan untuk daerah yang mempunyai anggaran belanja pegawai kurang dari 50 persen. Meski begitu, daerah yang mempunyai peluang tersebut tidak serta merta bisa langsung mengajukan kebutuhan pegawai baru. “Pemdanya harus melengkapi beberapa persyaratan di antaranya melakukan penghitungan kebutuhan pegawai, analisis jabatan serta analisis beban kerja sesuai PerMenpan&RB No 26 Tahun 2011 tentang Pedoman Penghitungan Jumlah Kebutuhan PNS yang Tepat untuk Daerah,” bebernya. Apabila daerah yang bersangkutan tidak melakukannya, pemerintah pusat (Kementerian PAN&RB) tidak akan memberikan formasi. “Meski belanja pegawainya di bawah 50 persen tapi daerahnya tidak melengkapi syarat-syaratnya, dianggap tidak mengajukan pegawai baru. Itu artinya, jumlah pegawai di daerah tersebut sudah terpenuhi,” jelasnya. (esy/jpnn)

Nunun Enggan Ungkap Penyandang Dana Cek Pelawat JAKARTA - Terdakwa kasus cek pelawat pemilihan Deputi Gubernur Senior (DGS) BI, Nunun Nurbaetie kembali menjalani pemeriksaan di kantor Komisi Pemberantasan Korupsi(KPK).IstriPolitisiPKSAdangDaradjatun itu diperiksa untuk tersangka Miranda S Gultom.Sayangnya, Nunun tidak berkomentar saat ditanya tentang keterlibatan Miranda dalam kasus cek pelawat DGS BI ini serta

penyandang dana kasus itu. “Tanya KPK saja ya,” kata Nunung yang dikawal aparat kepolisian usai pemeriksaan di kantor KPK, Jumat (27/4) sekitar pukul 13.15 Wib. Dalam kasus ini, Nunun Nurbaetie disebut sebagai pihak yang membagi-bagikan 480 lembar cek pelawat BII dengan jumlah keseluruhan mencapai Rp24 miliar kepada Anggota Komisi IX DPR periode 1999-2004 lalu.

Pemberian tersebut diduga terkait pemilihan Miranda Goeltom sebagai DGS BI tahun 2004 Kabag Pemberitaan dan informasi KPK, Priharsa Nugraha kepada wartawan mengatakan, Nunun diperiksa sebagai saksi untuk tersangka Miranda Swaray Goeltom dalam kasus suap DGS BI tahun 2004. “Yang bersangkutan sebagai saksi bagi MSG,” kata Priharsa. (fat/jpnn)

Nunun didampingi penasehat hukumnya saat menjalani persidangan di Pengadilan Negeri Tipikor Jakarta.


SABTU

28 April 2012

8 Mei, PS Vita Masuk Pasaran Indonesia SONY mengumumkan konsol game portabel PlayStation (PS) Vita akan mulai tersedia di Indonesia pada 8 Mei mendatang. Model yang masuk ke Indonesia terlebih dahulu adalah PS Vita versi Wi-Fi. Tak seperti PSP (PlayStation Portable), PS Vita dilengkapi dengan dua stik analog tepat di bawah tombol navigasi bagian kanan dan kirinya. Untuk urusan layar, PS Vita memiliki layar sentuh berukuran 5 inci dengan rasio 16:9, dan beresolusi 960x544 piksel OLED. Layarnya yang multi touch bisa dioperasikan untuk tap, scroll, pinch, dan swipe. PS Vita dibekali dengan prosesor quad core ARM Cortex-A9 core, tersedia pula kamera belakang dan kamera depan. Selain Wi-Fi, PS Vita juga menyediakan Bluetooth untuk koneksi nirkabel. Sony belum menginformasikan secara pasti kapan PS Vita versi Wi-Fi + 3G akan masuk ke Indonesia. Yang jelas, PS Vita versi Wi-Fi dibanderol Rp 3.399.000. Sony akan membuka pemesanan awal untuk PS Vita value pack pada 1 sampai 6 Mei di toko-toko tertentu. Paket Value pack ini akan disertai dengan game Uncharted: Golden Abyss (versi Chinese & English), dan ModNation Racers: Road Trip (versi Asian English & Chinese). (int/mer)

Honda Punya Mini MPV dari Brio PERTENGAHAN Maret lalu, Honda Indonesia menginformasikan bahwa mereka sudah menyiapkan produk baru mini MPV (multi purpose vehicle=MPV) 7-penumpang untuk mengejar volume penjualan. Produk itu akan dikembangan menggunakan platform Brio, mobil kompak, sama seperti yang dilakukan Suzuki Ertiga diciptakan dari platform Swift. “Saat ini tim dari Honda Motor Company lagi di Indonesia untuk melakukan penelitian mendalam untuk produk ini.

MPV ini diciptakan khusus untuk Indonesia,” komentar Jonfis Fandy, Direktur Pemasaran

dan Layanan Purna Jual PT Honda Prospect Motor (HPM) di Jakarta, Kamis (26/4).

Dijelaskan, saat ini Honda baru memanfaatkan 40 persen kandungan lokal dari industri komponen Indonesia. Untuk MPV baru ini, komposisinya akan ditingkatkan. “Bahkan untuk persetujuan pemilihan komponen nanti langsung di Indonesia, karena pihak prinsipal menyiapkan perwakilannya di sini (Indonesia),” beber Jonfis. Seperti diketahui, Honda sudah memastikan komitmen investasi Rp3,1 triliun untuk membangun pabrik baru di Karawang, Jawa Barat, sehingga total produksi di Indonesia naik dari 60.000 unit

menjadi 180.000 unit per tahun. Pabrik ditargetkan mulai beroperasi awal 2014 dan memproduksi dua model baru Brio dan MPV (dari Brio). “Dengan masuk ke segmen low (Brio dan MPV Biro), Honda berharap bisa mendongkrak volume penjualan,” tutup Jonfis. Besarnya ceruk pasar MPV low di Indonesia makin menarik prinsipal lain untuk ikut memeriahkan segmen ini. Setelah Suzuki resmi meluncurkan Ertiga pekan lalu, Honda menyiapkan Brio MPV dan Chevrolet juga sudah punya PM7. (int/mer)

HP Z1, Komputer Workstation

“Beraroma” BMW Hewlett Packard (HP) merilis komputer desktop Workstation Z1. Komputer desktop besutan HP ini mengusung model All-in-One PC dengan “citarasa” sedan mewah BMW. Marketing Development Manager Workstation HP Indonesia, Erric Budiono menjelaskan HP menggandeng BMW Designwork Amerika Serikat untuk mendesain Workstation Z1 agar mirip dengan desain mobil BMW Z4. “Desktop tersebut didesain sedemikian rupa seperti mobil BMW. Misalnya performa dibuat powerful, tapi suhu tetap dingin dan tidak berisik,” kata Erric saat peluncuran HP Workstation Z1 di PT Tunas Mobilindo Parama, Authorized BMW Dealer, Jakarta, kemrin. Dari sisi performa, HP Z1 memiliki keunggulan dengan sifatnya yang “Hybrid”. Artinya kompuer ini bisa memakai prosesor Intel Quad Core Xeon, namun juga bisa memakai Intel Core i3. Dengan fitur “Hybrid” tersebut, workstation bisa dikonfigurasi menjadi PC biasa atau sekaligus menjadi server PC. Di sisi grafis, workstation tersebut bisa memakai kartu grafis Intel HD 2000 atau Intel HD 3000. Bila memerlukan performa lebih tinggi, HP telah menyediakan kartu grafis NVIDIA Quadro. Di sisi layar, monitornya memakai ukuran diagonal 27 inci dan mendukung lebih dari 1 miliar warna display LED. Sehingga akan memberikan sudut pandang yang luas 178 derajat serta panel in plane switching (IPS). Audionya mengadopsi speaker front facing dual core dan SRS Premium Sound. Sehingga menawarkan kejernihan tata suara. Fitur lain adalah tool-less chassis. Sehingga pengguna bisa dengan mudah menambahkan hard drive, kapasitas memori ataupun kartu grafis. Pengguna pun hanya langsung membuka chassis untuk mengeluarkan komponen yang diinginkan. Kapasitas penyimpanan storage pun bisa dipilih antara hard disk drive (HDD) atau solid state drive (SSD). Perangkat ini juga disertakan slot opti cal drive untuk Blu-ray Writer. (int/mer)

TV 3D Makin Sempurna LG Electronics Indonesia (LGEIN) baru saja melepas generasi terbaru LG Cinema 3D Smart TV. Ada perubahan besar yang semakin menyempurnakan fitur yang terdapat pada generasi pertama TV 3D yang dipasarkan tahun lalu. Dengan tetap mengusung teknologi Film Patterned Retarder (FPR), penyempurnaan generasi baru ini dimulai dari desainnya. Bingkai layarnya (bezel) yang setipis 1 milimeter, membuatnya seolah nyaris tak berbingkai. Desain yang mereka sebut Cinema Screen ini tak cuma membuat 3D TV makin menarik. Tidak heran jika Cinema 3D Smart TV baru ini memegang rekor sebagai 3D TV dengan bingkai tertipis di dunia saat ini. Untuk memperkuat posisi terkuat pasar TV 3D di negeri ini, pihak LGIN juga siap menghadirkan TV berlayar OLED (Organic Light Emitting Diode) yang pertama di Indonesia dengan produk LG EM9600. Produk TV 3D OLED ini layarnya hanya setebal 4 milimeter atau setara dengan tebal tumpukan tiga kartu kredit yang merupakan 3D TV tertipis di dunia saat ini. “Menjadi yang terdepan berarti memikul tanggung jawab memberi yang terbaik bagi konsumen setianya. Inilah yang menjadi semangat LG d a l a m memperkenalkan berbagai produk inovatif kami,” ujar Kim Weon Dae, Presiden Direktur PT LG Electronics Indonesia. TV pintar LG sebelum ini sukses menguasai pasar 3D TV di Indonesia. Penyempurnaan Selain bingkai, perbaikan TV 3D baru adalah kualitas visualisasi efek 3D, yaitu dengan memberi opsi mengatur kedalaman efek 3D sesuai keinginan hingga 20 tingkat. Terdapat pula fitur konversi 2D ke 3D yang membuat pengguna bisa mengubah setiap tayangan 2D menjadi format bernuansa 3D. Sebagai 3D TV pintar, juga beragam konten telah disertakan. Pemilik dapat menikmati berita, video on demand atau bahkan berbelanja online lewat 3D TV terbaru ini. Magic Remote Control sudah jauh lebih ramping dari sebelumnya, selain tak banyak tombol. Di dalamnya terdapat opsi magic gesture yang membuat akses menu pilihan cukup dengan gerak sapuan sederhana yang telah direkam remote control ini sebelumnya. Contohnya, pengguna dapat menyapukan bentuk “V” dan Magic Remote Control akan menerjemahkannya sebagai perintah mengakses menu Video. LG Cinema 3D Smart TV baru hadir dalam tiga varian, yaitu LG LM8600, LG LM7600 dan LG LM6700 yang tersedia dengan dimensi layar 42" hingga 55" dan dilengkapi Wi-Fi built-in. Selain itu juga tersedia seri LG LM9500 dengan lebar layar 72 inci, merupakan TV 3D terbesar di dunia saat ini. (int/mer)

„ Vespa S150ie

Kemarin (26/4), kiprah Vespa di pasar sepeda motor global sudah 66 tahun. PT Piaggio Indonesia memperingatinya di Menteng, Jakarta Pusat melalui acara gathering dan sekaligus peluncuran varian terbaru S150ie. Skuter ini sudahmemakai sistem injeksi dengan standar Euro3 yang dibanderol Rp27,5 juta on the road Jakarta. Produk asal Italia yang baru ini mengnusung sisi sporty, stylish dan sophisticated Vespa untuk menonjolkan viktalitas dan energi dari sebuah merek yang saat ini telah menjadi sebuah ikon desain yang penuh gaya. “Indonesia salah satu indikator dari negara-negara berkembang dan semua elemen positif ada di sini, khususnya untuk kendaraan roda dua. Vespa bisa membuat perbedaan di sini,” jelas Sergio Mosca, Managing Director PT Piaggio Indonesia. PT. Piaggio Indonesia yang memulai kiprahnya di tanah air pada Agustus 2011 telah menjual 5.000 unit sampai saat ini. “Sebenarnya untuk target tahun ini kita lebih berkonsentrasi pada pengembangan jaringan di Indonesia, jadi secara general kita akan terfokus pada itu,” tambah Mosca. (int/mer)


6

SABTU

28 April 2012

Tampil Polos, RIHANNA Dinilai Lebih Cantik Beberapa waktu lalu penyanyi Rihannamengunggahfotodirinya tanpa menggunakan make up di Twitter. Dari foto itu, banyak yang menilai Rihanna lebih keren jika tampil polos. Sebelumnya memang hampir jarang pelantun ‘California King Bed’ itu dinilai keren. Namun, ketika tampil tanpa make up Rihanna justru dinilai memperlihatkan kecantikannya. Meski tatanan rambutnya terlihat kusut, ia memang menunjukkan kelebihannya. Dalam foto tersebut, Rihanna tampak hanya memfokuskan kamera kepada wajahnya. Sedikit tersenyum, ia juga menggigit bagian bawah bibirnya. “She looked beautiful, arguably moresothanwhensheismadeup for an event or a video,” tulis DailyMail, Jumat (27/4). (dtc/int)

Gosip panas kembali berhembus menerpa rumah tangga penyanyi Krisdayanti yang dibangun 20 Maret 2011 dengan Raul Lemos. Pasangan yang telah dikaruniai bayi cantik ini dikabarkan pisah ranjang. Pelantun Pilihlah Aku ini pun meradang mendengarnya. Ditemui di House of Lusense, Kebayoran Baru, Jakarta Selatan pada Kamis (26/4), Krisdayanti mementahkan gosip tersebut. “Itu berita aku baru denger kemarin jam 11 malem pas landing di Jakarta. Ini berita yang sangat tidak benar dan tidak bertanggungjawab,” tandas Krisdayanti, “Ini memang orang yang tidak suka sehingga mencoba menghembuskan berita itu. Apa kehabisan berita artis-artis yang suka cari sensasi dengan gosip?” Krisdayanti pun menyesalkan berita yang muncul tanpa konfirmasi itu, terutama karena kini ia telah memiliki kehidupan dan keluarga baru. “Masalahnya saya punya kehidupan dan privasi yang sekarang lebih tertata. Karena suami saya bukan dari dunia hiburan, saya harus menjaga perasaan saya dan perasaan suami saya,” sesal wanita 37 tahun itu. Krisdayanti mencoba bijak dengan menganggap gosip tersebut sebagai ujian rumah tangganya, “Saya kaget diberitakan telah pisah ranjang. Bukan su’udzon, mungkin yang

T

menghembuskan berita ini memang tidak suka kepada kami. Ini merupakan ujian. Ujian itu bisa hadiah, hadiah yang baik, hadiah yang ganggu perasaan, tapi jalani saja,” tuturnya. CemburupadaAshanty Ashanty sepertinya sudah mulai mendekatkan diri kepada anak-anak dari calon suaminya, Anang Hermansyah. Pendekatan yang dilakukan Ashnaty tergolong berhasil, kini kedua anak Anang kian akrab dengannya. Kedekatan Ashanty dan anak-anak Anang, ternyata mengundang kecemburuan dari ibunda kandung mereka, Krisdayanti. Bahkan dengan nada bercanda, KD sempat ‘menegur’ anak keduanya, Azriel karena sering bersama Ashanty. ”Saya baru bercandain sama Azriel. Saya bilang sama dia, kalau saya cemburu karena dia kan sering sama bundanya (Ashanty),” ujarnya saat ditemui di kawasan Jakarta Pusat, Kamis (26/4). Meski begitu KD mengaku bersyukur mantan suaminya sudah menemukan pendampingnya yang baru. Ia pun berjanji akan datang ke pernikahan Anang. ”Saya bersyukur Anang temukan wanita yang bisa jadi istri dan ibu untuk anakanak,” paparnya. (dtc/kpl/int)

HOROSKOP HARI INI ARIES 19 Februari - 20 Maret

Proyek film omnibus milik aja, aku nangis baca cerita itu di Marcella Zalianty yang diambil novel. Di video klip ada dari novel karya Dewi Lestari, Lukman, jadi memang harus “Recto Verso,” sudah mulai Lukman yang memerankan. berjalan. Dan Alhamdulilah Rencana, syuting dia mau,” ujarnya akan dimulai saat ditemui di dalam waktu kantor Keana dekat ini. Untuk Production, Cikini, membuat film ini, Jakarta Pusat, Jumat Marcella (27/4). menggaet artis Meski sudah ”Deg-degan, beberapa cantik untuk kali bukan untuk bekerja di belakang menjadis sutradara. layar, Marcella sukses Mereka sudah mengaku gugup siap dengan pertama kali menjadi cerita masing-masing. sutradara dan produser dalam Marcella sendiri bertindak film yang ringan dan kental sebagai produser sekaligus dengan nuansa perempuan. sutradara. Ia membesut ”Deg-degan, bukan untuk “Malaikat Juga Tahu”. Marcella sukses. Ini pertama mendaulat Lukman Sardi menyutradari, padahal orangsebagai seorang yang menderita orang lainnya jauh lebih senior. autisme. Dalam video klip lagu Saya nggak bercita-cita jadi itu yang dinyanyikan Dewi sutradara Untuk film ini saya Lestari, Lukman juga yang pingin beri ruang dan inspirasi menjadi modelnya. coba sesuatu yang baru,” “Pemilihan cerita “Malaikat jelasnya siang itu. Juga Tahu” karena aku tersentuh (vnw/int)

Anda bisa mencapai sukses dalam setiap usaha Anda, tetapi sayangnya Anda hanya bisa bermimpi tanpa berbuat apa pun.

Aquarius

(20 Januari - 18 Februari)

Pekerjaan yang sekarang ternyata membawa Anda pada kenaikan jabatan atau mendapat bonus.

Virgo

(23 September - 22 Oktober)

Akan ada keberuntungan di kantor Anda

Scorpio

(23 Oktober - 22 November)

Anda mempunyai bakat dan kemampuan yang cukup banyak. Tetapi, Anda terkadang bingung harus menempatkan diri.

Libra

(23 Agustus-22 September)

Jangan terlalu lama memendam masalah yang Anda anggap sulit untuk dipecahkan sendiri.

Capricorn

(21 Desember -19 Januari)

Bersikaplah bijaksana. Jangan menyerang dari belakang mitra Anda. Tetaplah berbaik hati dengan membesarkan hati mitra Anda.

Sagitarius

( 23 November - 20 Desember)

Pesinetron Adly Fairuz kembali menyandang status jomblo setelah putus dari pacarnya akhir Desember lalu. Sejak itu, Adly mengaku banyak yang ingin menjodohkannya. ”Pelanpelan saja tapi pasti. Udah zaman sekarang nggak usahlah

Bersikaplah bijaksana. Jangan menyerang dari belakang mitra Anda. Tetaplah berbaik hati dengan membesarkan hati mitra Anda.

Pisces

19 Februari - 20 Maret

Kalau Anda konsisten di jalur yang saat ini, pasti Anda akan semakin matang dan berprestasi.

Taurus

(21 April - 20 Mei)

Jangan bersikap pamrih karena ini akan sangat menentukan untuk posisi tertentu di perusahaan.

Gemini

(21 Mei - 20 Juni)

Pekerjaan yang Anda pilih ini harus memberikan kesempatan untuk melatih kemampuan serta bakat yang Anda punyai.

Cancer

Leo

Febby Febiola

Rambah Bisnis Parfum

(21 Juni- 20 Juli)

Kendati sering bersitegang dengan atasan Anda, tapi Anda dianjurkan tetap mengerjakan setiap tugas dengan baik. (21 Juli-21 Agustus)

Anda tidak mempunyai rencana yang baik dalam menjalani pekerjaan. Sikap ini membuat Anda cepat merasa bosan. Segeralah susun rencana dan target.

dijodohin lagi,” ucapnya seraya tertawa saat ditemui di jalan Wijaya II, Jakarta Selatan, Kamis (26/4) malam. Bintang ‘Cinta Fitri’ itu mengaku saat ini sudah mulai membuka hatinya. Tapi Adly belum mau berpacaran karena ingin fokus dalam pekerjaan. ”Belum ada yang cocok ajah,” tambahnya. Cowok berusia 25 April itu mendambakan perempuan dengan kriteria fisik berambut panjang dengan kulit sawo matang. Adly berharap bisa menemukan pujaan hatinya, dan menikah saat usianya sudah 28 tahun. (dtc/int)

Setelah sukses menjadi pemain film dan menjadi seorang penyanyi, Febby Febiola kini memiliki kesibukan lain. Dirinya telah meluncurkan parfum yang diberi nama ‘Febiola’. Parfum yang didesain secara cantik dan elegan sesuai dengan karakter seorang perempuan itu identik dengan warna merah muda. Ia mengaku apa yang dilakukannya itu adalah hobi

yang selama ini gemar memakai wewangian. ”Saya percaya bahwa sesuatu yang dilakukan berdasarkan hobi pasti berhasil. Menurut saya parfum itu wewangian dan parfum mempunyai sebuah nilai tambah bagi wanita, kalau ada wanita yang suda cantik, bajunya bagus make upnya bagus tapi kalau nggak wangi ya tidak enak,” katanya

saat ditemui dikawasan Wijaya, Jakarta Selatan. Dengan membanderolnya seharga Rp399 ribu per botol, Febby yakin bahwa produk buatannya akan disukai oleh masyarakat luas. ”Ke depannya nanti mau ada rencana buat aroma yang lain. Nanti aku juga mau membuat body wash dan make up line,” papar Febby. (dtc/int)

Sherina

Pilih Jam Tangan Tahan Banting Dinilai mempunyai karakter yang sesuai dengan sebuah produk jam tangan, Sherina pun didaulat sebagai brand ambassador. Di samping punya gaya yang elegan, Sherina juga merupakan wanita yang enerjik. Sherina sendiri mengaku selalu membutuhkan jam tangan. “Kehidupan aku memang sangat berhubungan dengan waktu yah, jadi yang aku butuhkan ya jam. Tapi namanya juga entertainer, aku tetep pilih yang ada catchy-nya yah,” ungkapnya. Demi penampilan, ia pun

memilih jam produk terbaru. “Makanya ini pakai yang terbaru. Berguna, sangat aman yah untuk olahraga dan sangat tinggi kualitasnya, shock resistance lagi. Gak boleh hilang, marah kalo ilang. Kebanting-banting juga gak apa,” paparnya. Sherina yang dijumpai dalam acara Launching Casio Baby-G dan Sheen, di Djakarta Theater, Thamrin, Kamis (26/4), memang membutuhkan jam tangan yang sesuai dengan dirinya yang sporty dan sibuk dengan berbagai macam kegiatan di luar ruangan. (kpl/int)

T


SABTU, 28 April 2012

Pertanyaannya adalah, bisakah seorang mantan kemudian jadi teman? Ya, kami ulangi, seorang teman saja. Bisakah? Ok, sebagian langsung menjawab tidak bisa, sebagian lagi menjawab “why not?” Dan dalam kenyataannya memang sebagian orang dapat tetap menjadi teman baik sekalipun mereka sudah menyatakan perpisahan. Tak jarang juga ada yang saling memperkenalkan pasangan baru masing-masing dan mengatur jadwal kencan bersama agar lebih akrab. Menurut Savitha Mohan, seorangahlidalamhubunganasmara serta konsultan profesional, sebenarnya hubungan antar pasangan itu terus berkembang meskipun pada akhirnya ada kata putus. Perkembangannya bisa ke arah positif atau negatif. Yang dimaksud ke arah positif, setelah memutuskan untuk menjalani kehidupan masing-masing, tetapi mereka masih berteman baik. Sedangkan apabila perkembangannya ke arah negatif, maka cenderung akan bermusuhan dan tak jarang menjelek-jelekkan satu sama lain. Hal ini sebenarnya dipengaruhi pada jenis hubungan keduanya, apakah hubungan tersebut didasari niat baik dan sikap dewasa atau tidak. Mereka yang cenderung terbawa emosi dan tak bisa

berpikirpanjang,akanmengambil keputusan berpisah dengan tidak baik-baik, mewarnainya dengan pertengkaran atau caci maki. Dan inilah yang akhirnya membuat hubungan jadi retak dan tak ada kata pertemanan. Di sisi lain, banyak orang berpendapat bahwa setelah menjadi mantan memang sebaiknya tak usah berteman, karena ia akan terus menerus teringat dan tak bisa pindah ke lain hati. Sedikitnya pendapat tersebut benar, tetapi bisa dibilang itu adalah sebuah pembenaran mereka yang takut tak bisa mo ve on. Saat memutuskan untuk tidak ‘jalan berdua’ lagi, tentunya hal tersebut adalah keputusan yang sudah diambil masak-masak. Dan keputusan yang sudah diambil dan dipikirkan betul, tentunya tidak akan sampai mengganggu pikiran kan? Apabila memang keputusan untuk berpisah dibuat secara dewasa maka kedua belah pihak tidak akan takut mengubah status menjadi pertemanan. Yah, seperti di Facebook, status in relationship yang berubah menjadi single,namunnamakitamasihterlist sebagai temannya kan? Apabila memang saat ini masih ada keraguan dan ketakutan saat berteman dengan mantan, coba cek kembali hati Anda. Bisa jadi masih tersimpan cinta di sana, cari pula apa yang membuat Anda dan sidiaberpisahdanbagaimanajalan keluar yang terbaik (bukan putus tentunya, karena Anda masih sering merindukannya.)

Tumis Bayam Wijen

ALA KOREA

Bahan: 3 sdt minyak wijen 1 sdt bawang putih cincang 2 genggam besar bayam 1 sdt gula 1 sdt kecap asin 1 sdt wijen garam secukupnya Cara Membuat: 1. Panaskan wajan dengan api medium, sangrai wijen sampai berbau harum. Wijen matang dengan cepat, jadi harus diadukaduk dan segera pindahkan ke wadah dingin agar tidak gosong. 2. Panaskan 2 sdt minyak wijen dengan api medium. Begitu minyak panas, masukkan bawang putih. Tumis hingga bawang putih layu. 3. Masukkan bayam, aduk sesekali sampai bayam layu. Kecilkan api. 4. Masukkan gula dan kecap asin, angkat dari api. Tambahkan garam secukupnya. Saat masih hangat, siram lagi dengan sisa minyak wijen (1 sdt), taburi dengan wijen dan aduk rata. (kl/int)

Lupakan Pembalut,

Yuk Cari Tahu Cangkir Menstruasi SAAT menstruasi, banyak wanita yang menggunakan tampon dan pembalut sekali pakai. Faktanya, pembalut sekali pakai mengandung bahan kimia dan terkadang membuat pemakainya merasa tak nyaman. Kini ternyata tersedia alternatif baru, yang dinamakan nama cangkir menstruasi. Sesuai namanya, bentuk cangkir menstruasi seperti cangkir. Cangkir menstruasi ini terbuat dari silikon yang dirancang khusus untuk mengumpulkan darah menstruasi Anda, bukan menyerapnya. Penggunaan cangkir menstruasi ini dianggap lebih baik untuk dijadikan alternatif bagi kaum hawa, karena selain tidak mengandung bahan kimia, cangkir menstruasi ini juga ramah lingkungan dan cenderung tidak bocor. Cangkir menstruasi menggunakan metode pengumpulan, sehingga bebas bau anyir dan risiko toxic shock syndrome (TSS) juga rendah. “Kemungkinan, kaum perempuan akan menggunakan sekitar 11.000 tampon dalam hidupnya. Hal ini akan menyebabkan penumpukan limbah setelah digunakan selama bertahun-tahun,” papar seorang ahli, dilansir melalui Woman’shealth, Senin (23/4). Penggunaan cangkir menstruasi ini juga gampang. Pada kemasan, cangkir akan dilipat menjadi bentuk “U”, kemudian letakkan di dalam vagina, tepat di bawah leher rahim. Cangkir ini tidak akan jatuh karena akan tersanggah oleh otot-otot dinding vagina. Anda dapat menggantinya dua kali sehari dengan menarik ujung cangkir saat ingin melepasnya atau menggantinya. (kl/int)

Jangan Terlalu Sering Menimbang Berat Badan Tidak hanya tumpukan tugas dan kegilaan rutinitas sehari-hari yang bisa menyebabkan stres, ternyata kegiatan menimbang berat badan bisa menghasilkan stres sekalipun Anda sedang dalam kondisi bahagia. Kegiatan yang tampaknya sepele dan tidak memberikan dampak apapun ini bisa menjadi bumerang bagi Anda. Sebelum Anda mengecek berapa berat badan Anda, sebaiknya Anda mulai mempersiapkan diri, bisa jadi stres akan datang menghantui Anda. Timbangan Membunuh Mood Bahagia Berdasarkan survey seperti dilansir Self, beberapa wanita dibagi dalam dua kelompok, kelompok bahagia dan kelompok tidak bahagia. Mereka semua diminta untuk menimbang berat badan mereka. 30% dari wanita yang bahagia mengatakan bahwa mereka merasa termotivasi untuk tetap menjaga kesehatan setelah menimbang berat badan, misalnya melakukan olahraga, memilih makanan sehat dan kebiasaan sehat lainnya. Sedangkan pada kelompok wanita yang tidak bahagia, hanya 11% yang termotivasi untuk melakukan hal yang sama. Selain itu, berkaitan dengan stres dan mood, sebuah hasil mengejutkan didapatkan dari kedua kelompok wanita tersebut. 39% dari wanita yang tidak bahagia merasa buruk dan bad mood setelah menimbang badan. Sedangkan 7% wanita pada kelompok bahagia merasakan hal yang sama. Dengan

demikian, maka menimbang badan dapat menjadi pemicu stres, baik pada saat Anda merasa bahagia, terlebih lagi pada saat Anda sedang dalam kondisi tidak bahagia. Stres Akibat Menimbang Badan Harus Diatasi Tentunya yang menjadi pemicu dari stres tersebut bukan kegiatan menimbang berat badan, tetapi pada angka hasil dari menimbang badan. Biasanya para wanita akan stres jika mendapati angka timbangannya naik atau tetap . Angka

berat badan adalah salah satu dari sekian banyak hal sensitif yang bisa membuat seorang wanita langsung kehilangan mood, sehingga wajar jika Anda mengalaminya, Anda tidak sendirian. Lalu bagaimana mengatasinya? Pada saat seperti itu, Anda pasti akan menolak untuk makan cokelat atau makanan penghilang stres lainnya. Akan lebih baik jika Anda mengusir stres tersebut dengan olahraga atau kegiatan bergerak lainnya, tetapi jika Anda terlalu bad mood untuk melakukannya, ada cara lain untuk segera

mengusir perasaan bersalah dan stres akibat fakta pada angka timbangan Anda tidak berada pada angka yang seharusnya. Jika kondisi itu tidak diatasi, ada kemungkinan Anda akan melampiaskan stres itu pada makanan yang akan semakin memperparah kondisi Anda. Cintai Tubuh Anda Daripada Anda menimbang berat badan hanya sekali dalam sebulan, ada baiknya Anda melakukan berkala, setidaknya seminggu sekali. Dengan begitu, Anda tidak akan menemukan lonjakan angka yang terlalu besar. Sekalipun angka timbangan bukan faktor utama untuk tampil menawan, tidak seharusnya Anda menyalahkan diri sendiri. Anda harus melihat kembali apa yang telah menyebabkan tubuh Anda naik/tidak kunjung turun. Ini bisa menjadi motivasi untuk mengembalikan angka timbangan pada angka ideal. Apakah Anda sudah tidur dengan teratur dan berkualitas? Apakah Anda baru mengalami serangan makan tak terkendali karena stres dengan pekerjaan? Atau apakah Anda sudah olahraga tetapi berat badan tidak kunjung turun? Hal-hal itu bisa menjadi penyebab kenaikan berat badan Anda. Bisa jadi otot Anda terbentuk saat olahraga, tubuh lebih kencang sekalipun angka timbangan tetap. Karena itu, jangan terburu-buru menyalahkan diri Anda dan stres karenanya. Selalu jaga kesehatan tubuh Anda dengan tidak mengabaikan kesehatan mental Anda. (kl/int)

Aroma Tubuh Pria, Picu Gairah Wanita TAK perlu heran, karena memang aroma tubuh pria menjadi daya tarik yang istimewa bagi wanita. Dikatakan pula, bahwa aroma tubuh dan keringat pria mampu meningkatkan gairah seksual, serta menekan hormon stres wanita, seperti dikutip dari webmd. Adalah Claire Wyart, PhD, postdoctoral dari University of California, Berkeley Olfactory Research Project yang melakukan penelitian terhadap hal tersebut. Androstadienone atau AND semacam hormon yang dilepaskan melalui keringat dan aroma tubuh pria yang mempengaruhi wanita secara psikologikal. Bersama 21 mahasiswanya, yang terdiri wanita dengan rata-rata usia 22 tahun, Claire melanjutkan penelitian. setiap responden diteliti mood, dan sikapnya terlebih dahulu sebelum masuk ke perlakukan selanjutnya. Kemudian, masing-masing responden diminta mengendus aroma AND yang disimpan di dalam toples. AND ini juga ditemukan di dalam ragi yang telah dipanggang, yang bekerja sama baiknya dengan AND yang ada di dalam aroma tubuh dan keringat pria. Dari situ, responden kemudian diukur tekanan darah, detak jantung, pernafasan, dan temperatur kulit, sesudah dan sebelum mencium aroma AND. Responden digiring untuk menonton video klip lucu, sedih dan erotis, yang diikuti dengan video klip yang mengandung adegan emosional. Dari sinilah ditemukan bahwa AND memengaruhi emosi para responden secara maksimal. Baik perasaan bahagia maupun gairah seksual. Saat seseorang wanita mencium aroma AND, secara otomatis mood, gairah seksual dan hormon kortisul akan meningkat jumlahnya. Detak jantung juga semakin cepat, kelembaban kulit pun ikut meningkat. Nah, tidak heran lagi kan mengapa Anda suka memeluk dan mencium aroma pasangan? (kl/int)


SABTU

28 April 2012

Hayden: Rossi Pantang Menyerah Nicky Hayden benar-benar tidak percaya dengan rekanya di Ducati, Valentino Rossi yang akan memilih masuk pit saat balapan seri pertama MotoGP Qatar 2012. Hayden menilai bila Rossi adalan seorang pembalap yang memiliki daya tarung besar. Rossi memang mengawali musim ini dengan cukup tidak memuaskan. Dalam balapan yang berlangsung di sirkuit Losail tersebut, dirinya hanya menempati posisi ke-12 di babak kualifikasi. Saat sesi balapan pembalap asal Italia tersebut finis di posisi ke-10. Setelah balapan selesai The Doctor mengakui bila dirinya sempat ingin kembali ke pit dan tidak meneruskan balapan. “Saya berpikir untuk kembali ke pit, tapi dikarenakan menghormati tim dan juga untuk mengumpulkan

data-data, maka saya memilih untuk melanjutkan balapan,” katanya saat itu. Hayden yang saat di Qatar berhasil finis di tempat keenam, tidak percaya dengan hal tersebut. Ia menuturkan bila Rossi adalah orang yang tidak pantang menyerah dalam balapan. “Mingkin dia berpikir untuk menyerah, namunValentino adalah seorang petarung. Saya benarbenar sangat tidak yakin bila dirinyaakancepatmenyerah,”ujar Hayden seperti dilansir Autosport, Jumat (27/4). “Memang ia tidak meraih hasil yang cukup baik (di Qatar), tapi dirinya adalah pembalap yang mengkoleksi sembilan gelar juara dunia. Saya percaya ia akan menemukan kembali caranya untuk menjadi yang terdepan,” pungkasnya. (oz/int)

Chelsea Siapkan 35 Juta Pounds Gaet Higuain „ Hayden dan Rossi

5 Pemain ISL akan Bergabung ke Timnas Manajer tim nasional Indonesia, Ramadhan Pohan, mengatakan, lima pemain dari klub Indonesia Super League (ISL) telah menyatakan kesiapannya untuk bergabung dalam pemusatan latihan di Yogyakarta. Namun, Ramadhan masih merahasiakan nama-nama pemain tersebut.

P

emusatan latihan di Yogyakarta adalah bagian dari persiapan tim yang diasuh Nil Maizar untuk mengikuti turnamen Al-Nakbah di Palestina pada 13-23 Mei mendatang. Sebelumnya PSSI telah memanggil 15 pemain ISL untuk ikut bergabung dalam pelatnas. Namun, tidak ada satu pun pemain ISL datang ke pelatnas yang berlangsung sejak bergulir 19 April lalu. “Kisarannya sekitar lima pemain. Memang masih belum afdol karena pemain ISL belum bergabung. Baru 18 pemain yang

bergabung. Saya harapkan 15 pemain ISL bisa bergabung nanti,” kata Ramadhan kepada wartawan, Jumat (27/4). Pria yang menjabat Wakil Sekjen Partai Demokrat itu juga berjanji akan menempuh cara apa pun, termasuk bertemu dengan Aburizal Bakrie dan Nirwan Dermawan Bakrie, agar pemain ISL bergabung dengan timnas. “Seharusnya kalau sudah dipanggil untuk membela bangsa, tidak perlu ada negosiasi dan lobi. Tapi saya siap melakukan cara tersebut karena, dengan adanya pemain ISL, pelatih jadi

„ Ramadhan Pohan leluasa memilih pemain. Saya juga mengimbau untuk legowo untuk mengizinkan pemain bergabung dengan timnas karena

ini demi kepentingan bangsa,” kata Ramadhan. Setelah resmi menjabat posisi manajer timnas, Senin (23/4/

2012), Ramadhan langsung fokus memantau kegiatan timnas di Yogyakarta. Menurutnya, pelatnas timnas masih dengan sistem buka-tutup mengingat kompetisi belum berakhir. Pelatnas akan berjalan penuh pada bulan depan. “Timnas sudah komplet diurusi tim kepelatihan. Saya sebagai manajer memotivasi karena banyak pemain yang baru pertama kali membela timnas. Saya juga minta pemain jangan pernah merasakan rendah diri dan tidak berdaya,” ujarnya. Ramadhan berpesan kepada para pemain untuk tetap bersemangat meski prestasi sepak bola Indonesia sedang terpuruk. Ia meminta peristiwa kekalahan timnas dari Bahrain pada prakualifikasi Piala Dunia 2014 tidak menjadi beban. (kps/ int)

Chelsea dilaporkan tengah menyiapkan sebuah tawaran untuk merayu striker Real Madrid Gonzalo Higuain supaya bersedia merapat ke Stamford Bridge. Laporan yang dilansir dari kabar The Sun itu menyebut, The Blues sudah menganggarkan dana sekitar £35 juta untuk menghadapi bursa transfer musim panas mendatang. Kabarnya, kehadiran Higuain ini akan menggantikan tempat Didier Drogba yang santer terdengar bakal hengkang pada musim panas nanti. “Higuain sekarang ini menjadi daftar teratas dalam list belanja pemain,” kata seorang sumber di Chelsea. “Dia sudah menjadi seorang pencetak gol yang fenomenal buat Real Madrid dan juga Argentina. Namun demikian dia juga cukup banyak membantu pemain lain mencetak gol.” “Jadi kehadirannya bakal menjadi sempurna buat kami. Kami yakin dia akan menjadi pemain yang bisa berkembang di Liga Primer,” ujar sang sumber. (int)

„ Gonzalo Higuain

Rexy Pelatih Termahal Filipina

„ Greysia Polii-Meiliana Jauhari

India Open Superseries 2012

Srikandi Merah-Putih Bertumbangan Indonesia dipastikan harus puasa gelar pada nomor ganda putri di ajang India Open Superseries 2012. Pasalnya, tiga pasangan srikandi Merah- Putih yang turun di babak kedua harus tumbang oleh lawan-lawannya. Pertama adalah pasangan Vita/Nadya yang gagal mengulang sukses di Badminton Asia Championships 2012 pekan lalu di mana mereka kalahkan pasangan Jwala Gutta/Ashwini Ponnappa dari India. Namun, kali ini keduanya harus mengakui keunggulan Jwala/Ashwini, usai bertarung tiga game, 21-16, 1521, 17-21. Hal yang sama juga terjadi pada pasangan Anneke Feinya Agustin/Nitya Krishinda yang tunduk oleh ganda putri Jepang, Miyuki Maeda/Satoko Suetsuna. Meskipun mampu mencuri satu game dari pasangan unggulan ketiga ini. Anneke/Nitya harus rela kehi-

langan tiket perempat final saat Maeda/Suetsuna menyelesaikan pertandingan dengan kemenangan mereka, 21-15, 18-21, 21-14. Harapan terakhir Indonesia ada pada pasangan Greysia Polii/Meiliana Jauhari yang hanya membutuhkan dua poin lagi untuk maju ke perempat final saat unggul 19-16 di game kedua. Sayang, mereka juga harus tersingkir usai pasangan Bao Yixin/Zhong Qianxin mampu menekan balik pada poin-poin kritis dak akhinya menyamakan kedudukan menjadi 19-19. “Sebetulnya kuncinya ada di kedudukan 19-16, saya lihat Greysia/Meiliana tidak panik, namun lawannya semakin menekan terus dan membuat Greysia/Meiliana main bertahan terus dan tidak ada kesempatan menyerang” ujar pelatih ganda putri, Paulus Firman seperti dilansir PBSI. (oz/int)

Pelatih bulu tangkis asal Indonesia, Rexy Mainaky menargetkan membentuk tim Filipina untuk dapat lolos ke Olimpiade Rio de Janeiro 2016 mendatang. “Saya bukanlah seorang pesulap,” kata Rexy yang memilih menangani Filipina setelah mundur sebagai pelatih timnas Malaysia. “Saya hanya ingin melakukan yang terbaik. Saya harap dapat membentuk sebuah tim (Filipina) ke Olimpiade 2016. Ini rencana saya. Jika dalam dua tahun saya gagal, saya akan mundur.” Rexy dikabarkan menolak tawaran dari Inggris dan Rusia dan memilih Filipina. Untuk itu ia mendapat gaji sebesar 12 ribu dolar AS per bulan ditambah jaminan hidup buat keluarganya yang

„ Rexy Mainaky akan segera bergabung dengannya di Manila. Juara Olimpiade Atlanta 1996 ini memang pernah mengatakan tidak ingin terlalu jauh dari tanah air dan keluarga besarnya agar ia dapat setiap saat pulang.

Menurut Jojo Binay dari asosiasi bulu tangkis Filipina (PBA), pihaknya memang membutuhkan Rexy untuk kebangkitan bulu tangkis. “Kami memang sangat menginginkan dia, meski dia merupakan pelatih termahal. Ia akan membantu kami mewujudkan impian. Ia seorang yang sangat dispilin dan hal inilah yang kurang pada atletatlet kami.” Rexy akan berkeliling Filipina untuk melihat bakat para pemain berusia 12 hingga 17 tahun. “Kita tidak dapat meraih medali emas dalam waktu satu malam. Namun kami berharap dapat sejajar dengan tim-tim yang kuat. Kami akan memberi kebebasan penuh pada Rexy,” kata Albee Benitez dari PBA. (kps/int)

„ Kobe Bryant dan Pacman

Pacquiao Atlet Berpengaruh Legenda tinju Filipina, Manny Pacquiao masuk dalam daftar 10 besar atlet paling berpengaruh 2012 versi majalah Forbes. Pacquiao menjadi satu-satunya petinju yang masuk dalam daftar 10 besar tersebut. Pacquiao berada di bawah pebalap NASCAr, Jimmie Johnson dan dua pemain liga sepakbola Amerika (NFL), Tim Tebow dan Peyton Manning. Namun nama Pacquiao be-

rada di atas nama terkenal lainnya seperti Tom Brady (NFL/5) dan Jeremy Lin (NBA/10). Namanama ini terpilih dari polling yang dilakukan Nielsen Media Research dan E-Poll Market Research terhadap 1100 responden. Promotor Pacquiao, Bob Arum mengaku tidak kaget dengan populariats petinjunya tersebut. “Dia layak mendapatkannya. Saya tidak pernah memegang (atlet) sepopuler dia.” (kps/int)

Button: Uji Coba di Mugello Tak Ada Manfaat

„ Jenson Button

Pembalap asal McLaren, Jenson Button, menilai bila rencana uji coba dilakukan di Sirkuit Mugello pekan depan oleh McLaren tidak ada manfaat yang didapatkannya. Seperti diketahui, McLaren akan melakukan uji coba pembalapnya di Italia. Rencananya McLaren akan menguji para pembalapnya seperti, Gary Paffett dan Oliver Turvey, di sesi uji coba di Italia itu. Sebelumnya, Lewis Hamilton yang merupakan rekan satu timnya meminta pengaturan jadwal

ulang agar bisa menjalani istirahat usai tampil buruk di Bahrain. Sayang, tim tetap pada rencana awal, yang mana Paffett dan Turvey akan berbagi tempat di Mugello selama tiga hari. Soal uji coba ini, Button sendiri sejak awal tidak pernah berencan untuk ikut serta. Pasalnya, pembalap asal Inggris ini menilai tidak ada manfaat yang bisa didapati dari uji coba di Mugello. Terlebih, sirkuit itu sendiri belum pernah dipakai untuk uji coba sebelumnya. Alasan terakhir, adalah bila McLaren tidak

ada rencana untuk melakukan perubahan secara signifikan di Italia nanti. “Alasa kenapa kita tidak akan pergi kesana karena saya tak pernah ke Mugello sebelumnya. Saya merasa tidak akan pernah mendapatkan manfaat karena tidak perubahan besar di sana,” ujarnya Press Association, Jumat (27/4). “Untuk test Driver mendapatkan banyak jam terbang dan mencoba beberapa hal yang cukup ekstrim saya pikir bagus, Namun, kita sendiri tidak perlu ada di sana,” pungkasnya. (int)


SABTU

28 April 2012

PREMIERE LEAGUE KLASEMEN SEMENTARA 1 Man United

35

26

5

4

86-32

83

2 Man City

35

25

5

5

87-27

80

3 Arsenal

35

20

5

10

67-43

65

4 Newcastle U

34

18

8

8

53-42

62

5 Tottenham H

34

17

8

9

57-39

59

6 Chelsea

34

16

10

8

56-38

58

7 Everton

34

13

9

12

42-38

48

8 Liverpool

34

12

10

12

40-37

46

9 Fulham

34

12

10

12

45-44

46

10 WBA

35

13

6

16

41-47

45

11 Sunderland

35

11

11

13

42-41

44

12 Swansea City

35

11

10

14

39-45

43

13 Norwich City

35

11

10

14

47-60

43

14 Stoke City

34

11

9

14

32-48

42

15 Aston Villa

34

7

15

12

35-48

36

16 QPR

35

9

7

19

39-57

34

17 Wigan Ath

35

8

10

17

34-60

34

18 Blackburn R

35

8

7

20

47-73

31

19 Bolton W

33

9

3

21

37-66

30

20 Wolves

35

5

8

22

34-75

23

PENCETAK GOL

Euro 1996

Inggris Menangis Menjadi tuan rumah turnamen Akbar antarnegara Benua Biru yang digelar 8-30 Juni 1996 ini, Inggris kurang beruntung. Misinya, kandas di semi final dengan cara menyakitkan setelah kalah adu penalti dari Jerman. Shoutgate yang menjadi penendang terakhir Inggris gagal memperdaya Andreas Kopke. Sedangkan enam algojo Der Panzer, seluruhnya menaklukan David Seaman. Di fase grup, Inggris yang menghuni Grup A bersama Belanda, Skotlandia dan Swiss sebenarnya tampil garang. Dua kemenangan dan hasil sekali imbang dikantongi Union Jack. Asa tuan rumah sempat membara melihat The Three Lions sempat meruntuhkan Belanda dengan skor telak, 4-1, di partai pamungkas.

Tapi pada akhirnya Inggris gagal mewujudkan semua ambisinya seperti yang tertuang dalam motto yang diusungnya di turnamen itu “Football Comes Home”. Namun, setidaknya Inggris tidak terlalu kehilangan muka karena strikernya Alan Shearer menyabet Golden Boot. Digruplainsecaraumumtidakada kejutan berarti, hanya Italia yang tidak lolossetelahdipartaihidupmati,Italia hanya bermain imbang dengan Jerman. Hasil itu membuat Italia tersingkir karena kalah agregat gol dengan Rep Ceska yang menorehkan poin sama, 4 sedangkan Jerman kokoh di posisi puncak dengan poin 9. Kedua tim ini lah yang akhirnya bertempur di laga puncak. Rep Ceska yang di semi final mengandaskan

EURO- Keperkasaan Jerman di Euro 1996 usai menyingkirkan tuan rumah Inggris Prancis, ditundukan 2-1 dalam partai finalyangdigelardiWembleyStadium London itu. Dalam duel ini, mental baja Der Panzer sungguh teruji. Meski sempat tertinggal di menit 60, Jerman

Van Persie Wayne Rooney Sergio Aguero

hanya diikuti delapan tim, melainkan 16timyangterbagidalamempatgrup, menyusul bertambahnya negara di Eropa usai pecahnya Uni Soviet. Di Inggris ini untuk pertama kali nama ‘Euro’ dipakai. (int)

ARSENAL

STOKE CITY 27 26 22

membalikkan keadaan dengan gol Oliver Bierhoff di menit 73 dan mengunci gelar dengan golden goal di menit 95. Yang tak kalah penting dicatat dalam edisi kali ini, Euro tidak lagi

Arsenal Man United Man City

LIGA SPANYOL KLASEMEN SEMENTARA 1 Real Madrid

34 28

4

2

109-30

2 Barcelona

34 25

6

3

97-26

88 81

3 Valencia

34 15

10

9

54-42

55

4 Malaga

33 15

6

12

49-46

51

5 Levante

34 14

7

13

48-47

49

6 Ath Bilbao

34 12

12

10

49-44

48

7 Atl Madrid

34 13

9

12

47-42

48

8 Sevilla

34 12

10

12

41-39

46

9 Atl Osasuna

33

11

13

9

37-53

46

10 Espanyol

34 12

9

13

44-46

45

11 Getafe

34 12

9

13

38-45

45

12 Mallorca

34

11

10

13

36-41

43

13 Real Betis

34 12

6

16

40-49

42

14 Real Sociedad

34 10

10

14

41-50

40

15 R Vallecano

34 12

4

18

50-60

40

16 Granada

34

11

6

17

31-49

39

17 Villarreal

34

8

13

13

35-48

37

18 Sporting G

34

8

7

19

35-64

31

19 Real Zaragoza

34

8

7

19

29-60

31

20 R Santander

34

4

14

16

24-53

26

Kekalahan telak 0-3 di kandang Newcastle memang tidak berarti apa-apa bagi Stoke. Pasukan Tony Pulis kini duduk di peringkat ke-14 dengan raihan 42 poin. Stoke terkesan tampil setengah hati karena hanya memiliki target untuk bertahan di premier league. Pulis berharap anak asuhnya tetap dapat menunjukkan permainan yang menghibur para fans yang akan datang. Pulis juga me-

nginginkan balas dendam atas kekalahan 1-3 di Emirates pada putaran pertama. Bagi ARsenal, setelah kalah 1-2

BURSA TARUHAN

dari Wigan, mereka kembali gagal menang setelah ditahan imbang tanpa gol oleh Chelsea. Kini posisi Arsenal diancam oleh Newcastle. Kedua tim hanya berjarak tiga poin, namun Newcastle masih menyimpan 1 pertandingan sisa. Pelatih Arsene Wenger meminta anak asuhnya untuk bangkit dan memenangi semua pertandingan sisa. Hal senada juga diutarakan oleh kapten tim, Van Persie yang

METRO Stoke City Arsenal

1/2 0

HEAD TO HEAD: 23 Okt 2011 8 Mei 2011

Arsenal Stoke

vs vs

Stoke Arsenal

3-1 3-1

5 PERTANDINGAN TERAKHIR STOKE CITY

PENCETAK GOL

„ Crouch

21 Apr 2012 9 Apr 2012 7 Apr 2012 31 Mar 2012 24 Mar 2012

Newcastle Aston Villa Stoke Wigan Stoke

vs vs vs vs vs

Stoke Stoke Wolves Stoke Man City

3-0 1-1 2-1 2-0 1-1

5 PERTANDINGAN TERAKHIR ARSENAL 21 Apr 2012 16 Apr 2012 11 Apr 2012 8 Apr 2012 31 Mar 2012

Arsenal Arsenal Wolves Arsenal QPR

vs vs vs vs vs

Chelsea Wigan Arsenal Man City Arsenal

0-0 1-2 0-3 1-0 2-1

optimis timnya akan bangkit dan kembali ke jalur kemenangan. Biasanya tim papan atas Inggris urutan pertama, kedua dan ketiga langsung masuk ke babak penyisihan grup Liga Champions, dengan tim yang selesai keempat masuk ke pertandingan kualifikasi awal. Tetapi jika Chelsea, yang saat ini keenam, mengalahkan Bayern Munich di final 19 Mei, mereka akan mendapatkan jatah kualifikasi dengan mengorbankan klub urutan keempat di Liga Premier. Jenkinson ingin mengakhiri musim Liga Premier dengan tim asuhan Arsene Wenger berada dalam persaingan elit Eropa musim depan, daripada mengandalkan Bayern mengalahkan Chelsea. “Tentu saja Chelsea bisa menang, mereka tidak akan pergi sejauh ini jika mereka tidak memiliki keinginan untuk menang,” kata Jenkinson.nal baru menang sekali dalam empat kunjungan terakhir mereka ke kandang Stoke City Britannia Stadium, terakhir kalah pada sebuah kekalahan 3-1 Mei lalu. (int)

ENGLISH PREMIER LEAGUE Everton vs Fulham Sunderland vs Bolton Swansea vs Wolves West Brom vs Aston Villa Wigan vs Newcastle Norwich vs Liverpool

0 : 1/2 0 : 1/2 0:1 0 : 1/4 0:0 1/2 : 0

ITALIAN SERIE A Cagliari vs Chievo Palermo vs Catania Roma vs Napoli

0 : 1/4 0 : 1/4 0:0

SPANISH LA LIGA Espanyol vs S Gijon Getafe vs Mallorca Levante vs Granada R Sociedad vs Santander Villarreal vs Osasuna

0 0 0 0 0

: : : : :

1 1/2 1/2 1 3/4

„ Szczesny

LIVE Malam Ini Pukul 20:30 WIB

42 41 21

Ronaldo Lionel Messi Higuaín

Real Madrid Barcelona Real Madrid

SERIA A ITALIA KLASEMEN SEMENTARA 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Juventus Milan Lazio Udinese Napoli Roma Inter Catania Chievo Siena Palermo Bologna Parma Atalanta Fiorentina Cagliari Genoa Lecce Novara Cesena

33 33 33 33 33 33 33 33 33 33 33 33 33 33 33 33 33 33 33 33

19 20 16 14 13 15 14 11 11 11 11 10 10 11 9 9 9 8 5 4

14 8 7 10 12 5 7 13 10 9 8 11 11 13 11 11 9 11 10 10

0 5 10 9 8 13 12 9 12 13 14 12 12 9 13 13 15 14 18 19

57-18 63-27 49-41 44-32 58-41 52-46 47-45 44-43 30-40 41-35 46-51 34-39 44-50 37-36 32-38 33-42 44-62 38-49 27-56 21-50

71 68 55 52 51 50 49 46 43 42 41 41 41 40 38 38 36 35 25 22

PENCETAK GOL

24 20 20

Ibrahimovic Cavani Diego Milito

Milan Napoli Inter

Spanyol Digdaya

„ Athletic Bilbao dan Atletico Madrid berhasil menciptakan All Spanish Final UEFA 2012

Walau gagal di Liga Champion setelah Barcelona dan Real Madrid tersingkir, namun kedigdayaan klub Spanyol masih terasa di Liga UEFA. Athletic Bilbao dan Atletico Madrid sukses menciptakan final sesama klub Spanyol di Liga Europa musim ini. Itu menjadi “final Spanyol” keenam di Eropa, sebuah rekor tersendiri. Di partai leg II semifinal Liga Europa,Jumat(27/4)dinihariWIB,Bilbao dan Atletico sama-sama berhasil mengamankantiketkepartaipuncak. Di kandang Valencia, Atletico

berhasil menang 1-0 untuk menambah agregat menjadi 5-2 sementara Bilbao yang menjamu Sporting Lisbon menang 3-1 untuk menjadikan agregat 4-3. Keberadaan Bilbao dan Atletico di final Liga Europa itu menjadi kali keenam dua klub Spanyol bersaing dalam partai puncak kompetisi antarklub Eropa, seperti dicatat Infostrada Live. Torehan tersebut merupakan rekor tersendiri, melewati capaian lima partai final antara sesama klub asal Italia di kancah Eropa. (int)

METRO SIANTAR  
METRO SIANTAR  

Terbesar, Terbaik Dan Terbaik Di Siantar Simalungun

Advertisement