Page 1




Rabu, 21 November 2012



EDISI 213 „ Tahun X


Khadafi:Ira MenamparSaya SIANTAR- Khadafi (32) alias Kha, mengakui menendang dan mengancam parang Maimunah br Sitinjak (52) dan putrinya Ira Warni (28). Hal itu disebabkan Ira memukul dan menamparnya lebih dulu saat mereka bertengkar di Simpang Lalahi, Nagori Karang Sari, Minggu (18/11) pukul 13.00 WIB. Khadafi mengaku Ira merupakan istri sirinya sejak Juli lalu. Khadafi mendatangi kantor METRO, Selasa (20/11) pukul 15.00 WIB, untuk meluruskan „) Baca Khadafi: Ira ...Hal 7

MANCHESTER- Mission impossible. Itulah gambaran sulitnya Manchester City untuk melaju ke babak 16 besar Liga Champions musim ini. Mereka bukan hanya membutuhkan dua kemenangan di dua laga sisa, juga berharap pesaingnya tergelincir.

Ya, saat ini City baru mengemas dua poin. Dengan begitu, agar bisa lolos ke babak 16 besar, mereka harus berharap para pesaingnya seperti Real „) Baca Ambisi ...Hal 7

Alasan Bantu Kerjakan PR, Guru Setubuhi Siswi 6 Kali TANAH JAWA- Setubuhi siswinya sendiri hingga 6 kali, guru MTs Al Ikhlas Bah Jambi, Surya Winata (27) warga Pondok Sejahtera Emplasmen PTPN IV Bah Jambi, diringkus Unit Reskrim Polsekta Tanah Jawa di Jalan Asahan, Batu 8 Nagori Dolok Hataran, Kecamatan Siantar, Selasa (20/11) sore.


„ Suasana pemilihan Rektor USI yang berlangsun di ruanga Aula Yayasan USI, Selasa (20/11).

Pemilihan Rektor USI

Hisarma Saragih Raih Suara Terbanyak SIANTAR- Drs Hisarma Saragih MHum, akhirnya memenangkan pemilihan Rektor Universitas Simalungun (USI) periode 20122016, Selasa (20/11) di Biro Rektor USI, Jalan SM Raja, Pematangsiantar. Alumni Pascasarjana Universitas Gajah Mada (UGM) ini mengungguli tiga kandidat lainnya, dalam pemilihan yang berlangsung tiga putaran. Pemilihan Rektor yang dipimpin Ketua Senat Universitas, DrsUlung Napitu MSi didampingi Sekretarisnya, Riduan Manik MH, diikuti 22 orang dari 29 orang anggota Senat Universitas yang memiliki hak suara. „) Baca Hisarma Saragih ...Hal 7

Dinkes ‘Tertutup’

Pemeriksaan Mi Basah SIANTAR- Dinas Kesehatan Kota Siantar memeriksa mi basah milik Aliong pada Senin pagi (19/11). Namun Dinkes terkesan tertutup terkait hasil yang mereka peroleh. Anehnya lagi, Kadis Kesehatan Ronal Saragih enggan menjalin kerjasama dengan polisi terkait masalah ini. Kadis Kesehatan Ronal Saragih, dihubungi melalui telepon selulernya Senin (19/11) mengatakan, sedang berada di Kementerian Kesehatan di Jakarta. Dia mengaku sudah memerintahkan anggotanya melakukan pemeriksaan ke tempat „) Baca Pemeriksaan ...Hal 5

„ Tersangka guru MTs Al Ikhlas Bah Jambi saat menjalani pemeriksaan di Polsekta Tanah Jawa.

Akibat kejadian tersebut , korban FRL (13) warga Dolok Sinumbah yang duduk di bangku kelas II harus mengalami trauma seumur hidup. Kini tersangka yang sudah punya istri dan dua anak yang masih kecil terpaksa meringkuk di Rutan Mapolsekta Tanah Jawa. Korban dalam pengaduannya mengatakan, awal pertama „) Baca Alasan Bantu ...Hal 5

Olivia Zalianty

BikinTas dariSampah Di tangan artis peran Olivia Zalianty, sisa potongan kain batik yang biasanya terbuang begitu saja justru bisa menjadi sebuah benda yang memiliki nilai ekonomis. Yup, sisa potongan kain batik yang tak terpakai oleh Olivia bisa dirancang menjadi sebuah tas modis. “Ini bahannya dari sisa potongan batik yang mungkin selama ini dianggap sampah,” kata Olivia dalam jumpa pers Pekan Produk Kreatif Indonesia (PPKI), di Epicentrum Walk, Kuningan, Jakarta Selatan, belum lama ini. Olivia menganggap ini bisa menjadi peluang usaha bagi masyarakat Indonesia. Dirinya pun sengaja mendatangi sekolah-sekolah di daerah terpencil untuk mengajarkan siswa setempat membuat tas dari sisa kain batik. “Sampai masuk ke pedalaman ngajarin murid-murid di sana,” kata adik kandung artis peran Marcella Zalianty ini. Olivia memang tak asal berbicara soal peluang bisnis ini. Buktinya, belumlamainidiakebanjiran pesanan dari luar negeri. “Beberapa tas kami foto dan posting di sosial media, ternyata banyak yang suka, dan Singapura memesan 700 tas,” cerita Olivia. Sayangnya, Olivia justru tak bisa meladeni pesanan itu karena terbatas sumber daya manusia. “Ini bukan masalah gimana cara masarin-nya, market selalu ada. Tapi yang enggak ada itu tenaganya, tas ini kan dibuat sama yang benar-benar bisa membuatnya,” kata Olivia. (int)



„ Kebakaran di Purba Hinalang yang menghanguskan dua unit rumah, Selasa (20/11)

PURBA- Dua unit rumah di Dusun Purba Hinalang, Nagori Purba Sipinggan, Kecamatan Purba, Kabupaten Simalungun, rata dengan tanah setelah dilalap si jago merah (api), Selasa (20/11) sekira pukul 21.00 WIB. Kedua rumah tersebut adalah milik Juliana br Sinaga (75) serta rumah Ganda Saragih (43) dan istrinya Nelli br Purba. Informasi dihimpun METRO dari Ayu br Sinaga, pemilik rumah yang bertetangga dengan Juliana br Sinaga menjelaskan, saat api mulai membesar, dia sedang keluar rumah hendak buang air kecil. Namun tiba-tiba dia melihat api menyala di ruang depan rumah Juliana br Sinaga. Spontan, dia berteriak melihat api yang makin membesar. Sementara malam itu gerimis sedang turun di lokasi kejadian disertai angin kencang yang semakin memudahkan api menjalar ke seluruh bagian rumah. Warga yang mendengar teriakan Juliana dan melihat api semakin membesar bergegas memadamkan api dengan peralatan seadanya, seperti ember dan jerigen. Selama 30 menit „) Baca Dua Rumah ...Hal 5


Ngaku Flu, Chondri Mangkir SIANTAR- Tersangka penipuan pencalonan CPNS, Chondri Silitonga yang merupakan anggota DPRD Siantar, mangkir dari panggilan pertama penyidik Polres Siantar, Selasa (20/11) pukul 13.00 WIB. Chondri mangkir dengan alasan sakit flu. Chondri ditetapkan sebagai tersangka dalam kasus ini sejak September lalu. Pengacara Chondri Silitonga, Sarles Gultom SH MH dihubungi melalui telepon selulernya Selasa (20/11) pukul 13.00 WIB mengatakan, kliennya anggota DPRD Kota Siantar Chondri Silitonga, tidak bisa memenuhi panggilan


„) Baca Ngaku Flu...Hal 5

„ Sarles Gultom SH MH pensehat hukum Chondry, tertawa ketika ditanyakan tentang Chondry, sambil melambaikan tangannya di Mapolresta Siantar.

Metro Siantar RABU, 21 NOVEMBER 2012


21 Nopember 2012

Interaktif Komplek Perumahan Griya


Jalan Kartini Mirip Kubangan Kerbau SIANTAR- Jalan rusak adalah masalah yang sering dihadapi masyarakat. Seperti yang terjadi di Jalan Kartini Bawah Kelurahan Proklamasi, Siantar Barat, tepatnya tak jauh dari stasiun kreta api (KA).

KADIS Pendidikan Simalungun terhormat, tolong ditertibkan para pelajar yang suka bolos di kompleks Griya. Kini kompleks Griya menjadi markas pelajar cabut. Di sana mereka minum alkohol dan merokok. 082164457xxx


Kaset Bajakan Bebas Beredar di Siantar

Dimana jalan di lokasi itu terlihat rusak parah, dan mirip dengan kubangan kerbau. Kondisi itu sudah berlangsung lebih dari dua tahun. Stasiun kereta api adalah salah satu sentral yang banyak didatangi warga, terlebih untuk bepergian ataupun baru pulang dari luar kota. Demikian halnya dengan stasiun kereta api Siantar yang masih berada di pusat kota. Namun sangat disayangkan, jalan di depan stasiun itu rusak dan terkesan dibiarkan begitu saja. Kerusakan jalan di sana pun menjadi pemandangan yang lumrah dan seakan tidak ada masalah karena warga sudah terbiasa. (mag-05/osi)

Kapolres Siantar terhormat, kenapa dibiarkan kaset bajakan bebas beredar di Kota Pematangsiantar. Padahal menurut peraturan perundangundangan siapa yang mengedarkan atau menjual kaset bajakan bisa dijerat hukuman pidana. 081397296xxx


KALAPAS Terhormat, tolong ditindak pegawai yang melakukan pungutan liar dari tamu tahanan Lapas Kelas 2 B Jalan Asahan. Kalau tidak diberikan uang, tamu tidak diizinkan masuk. 081260687xxx

Telepon Penting PMI (Palang Merah Indonesia) 118, 0622-433911 Alamat Jl Sutomo No. 248, Pematangsiantar Kantor Imigrasi Alamat: Jl. Raya Medan Km. 11,5 Pematang Siantar Telepon : (0622)465018, 465014 Samsat Dipendasu Jln Sangnawaluh No 37A 0622 7552345.

RS dr Djasamen Saragih Jln Sutomo No 230. 0622 (23824) Hotel Sapadia Jl.Diponegoro No.21 A P.Siantar Telp:0622-435922 Nice Trans Siantar-Medan Medan. (061) 4558844 Siantar (0622)7000200 085275144777

Diprioritaskan Pembangunannya JALAN Kartini masih berada di pusat Kota Siantar. Sangat tidak baik, jika masih ada jalan yang mirip kubangan kerbau berada di pusat kota. Sebaiknya pemerintah memprioritaskan pemb an gu n ann ya. (osi) Ferry Aritonang, Warga Siantar

Penggunaan Anggaran Tidak Tepat Sasaran BANYAK penggunaan anggaran Pemko Siantar yang tidak tepat sasaran. Semisalnya, perbaikan tugu yang berada di tengah Taman Bunga, yang kondisinya masih dalam keadaan bagus, tetapi sudah diperbaiki kembali. Kemudian, trotoar di pusat kota yang masih baru dikramik, dirusak dan dibangun baru lagi. Itu artinya, banyak anggaran yang penggunaannya sia-sia. (Mag-06) Maruli Nainggolan, Mahasiswa

SEKARANG SAYA TIDAK TAKUT MAKAN DAN MINUM YANG MANIS Gula Aren adalah jenis palma yang tidak hanya m a n i s rasanya, namun juga kaya manfaat b a g i kesehatan. Tidak percaya? Gentong Mas yang salah satu bahan dasarnya Gula Aren, telah terbukti menurunkan kadar gula banyak penderita diabetes. Salah seorang yang telah membuktikan manfaatnya adalah Siti Rosnih (53 thn). PNS ini menceritakan, sudah 2 tahun lamanya menderita penyakit berbahaya ini, "Karena pola makan yang kurang terjaga, saya menderita diabetes. Akibatnya, badan sering kali terasa lemas, pusing, dan mudah lapar," papar ibu 5 orang anak tersebut. Diabetes adalah peningkatan kadar glukosa darah akibat kekurangan insulin baik yang sifatnya absolut maupun relatif atau resistensi reseptor insulin. Diabetes melitus sangat erat kaitannya dengan mekanisme pengaturan gula normal. Tapi sekarang setelah rutin minum Gentong Mas, kesehatannya sudah mulai membaik, "Sekarang keluhan saya sudah hilang dan tidak takut lagi

LOWONGAN PEKERJAAN Sebuah perusahan yang bergerak dibidang Otomotif. Membutuhkan segera tenaga kerja dibidang :


Syarat-Syarat : 1. Pria maximal 35 tahun. 2. Pendidikan minimal tamatan SMA / sederajat 3. Cekatan,Jujur,Disiplin dan Bertanggung jawab. 4. Memiliki SIMA 5. Berpengalaman di bidangnya minimal 2 tahun. Surat lamaran lengkap di alamatkan ke:

PT SUTAN INDO ANEKA MOBIL (Authorized TOYOTA Dealer) Jl. Medan KM 2,8 P. Siantar Surat lamaran ditunggu, paling lambat 22 November 2012 dengan m e l a m p i r k a n . F o t o c o p y K T P, Fotocopy SIM A, Fotocopy ijazah, daftar riwayat hidup dan Phasphoto terbaru ukuran 3x4 sebanyak 2 lbr. (TIDAK MELAYANI LEWAT TELEPON)

makan yang manis." Ungkap warga Desa Tegalsari, Kec. Medan Denai, Medan tersebut penuh syukur. Karena telah merasakan manfaatnya, Siti Rosnih ingin sekali membagi pengalaman baiknya itu dengan orang lain, "Mudah-mudahan pengalaman saya ini dapat bermanfaat untuk orang lain." Pungkasnya. Obat apapun, memang belum dapat melakukan pencegahan terhadap diabetes tipe 1, dimana ketidakmampuan pankreas memproduksi insulin sejak lahir. Berbeda dengan tipe 2, yang sering dicetuskan oleh faktor genetik, obesitas, kurang olahraga, serta pola makan yang tidak sehat, sesungguhnya diabetes dapat dicegah, salah satunya dengan terapi Gentong Mas. Gentong Mas adalah minuman kesehatan herbal alami dengan bahan utama Gula Aren dan Nigella Sativa (Habbatussauda) yang terbukti manfaatnya bagi penderita dari berbagai penyakit, termasuk diabetes. Habbatussauda dipercaya dapat meningkatkan fungsi insulin dan mengurangi resistensi reseptor insulin, sedangkan Gula Aren berperan dalam optimalisasi kerja reseptor insulin. Gentong Mas juga mengandung Chromium yang efektif memperlancar metabolisme gula

darah dan mengatur kepekaan sel terhadap insulin sehingga meringankan kerja pankreas. Selain itu, indeks glisemik dalam Gentong Mas yang sangat aman bagi kesehatan yaitu hanya 35 (aman jika indeks glisemik dibawah 50), mampu menjaga dan merawat pankreas agar tetap berfungsi dengan baik. Meski demikian, untuk mendapatkan hasil maksimal, disarankan untuk mengatur pola makan, olahraga, pengaturan berat badan seideal mungkin, diet rendah lemak, kontrol stress, dan menghindari rokok serta alkohol. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan silahkan hubungi:0813 8477 7787 Medan, Sidikalang, Gunungtua, Batubara, Tobasa, Nias Madina, Tapsel : 081384777787, Dolok Sanggul : 082129284752, Tebing Tinggi/Siantar : 081322099495, Binjai/pakam : 081398666166, Langkat/karo : 082167538828, Kisaran : 06237014362, Tanjung balai : 081263495563, Labura : 081370590972, Labuhan batu : 082365222011, Sibolga: 081376252569 Taput : 081263243034 Depkes:P-IRT:812.3205.01.114


21 November 2012 “Apabila berhasil dan MK sepakat juga dengan kesimpulan DPR atas dugaan keterlibatan Boediono dalam skandal bailout Century, maka DPR bisa melanjutkannya dengan impeachment,” Anggota Timwas Century DPR, Bambang Soesatyo.

“Kita mendesak sebelum masa timwas century berakhir agar KPK menyerahkan surat pernyataan yang seperti dikatakan Pak Abraham tadi, bahwa Pak Boediono sebagai Wapres, tidak bisa melakukan penyelidikan dan menyerahkan kasus ini Anggota Timwas Century DPR, kepada DPR,” Akbar Faisal.

Etika Politik dan Perilaku Politisi

Kode etik penyelenggara pemilihan umum akhirakhir ini menjadi perbincangan yang menarik di kalangan praktisi hukum, politisi, dan akademisi. Bahkan, publik dari berbagai elemen juga menaruh perhatian terhadap tema ini. Etika yang selama ini tidak dilihat sebagai norma sosial bagi para aktor politik dan politisi, justru kini bagaikan monster yang mulai ’’memakan mangsa’’. Di manakah letak moralitas yang selalu menggerus etika politik para politisi kita?

Oleh : Yusrizal Karana ANDAI saja Niccolo Machiavelli (1469-1527) masih hidup, ia mungkin akan datang ke Indonesia untuk melihat bagaimana teori eigentum-nya yang kian beroleh humus dari sejumlah politik ’’menghalalkan segala cara’’ dan sekaligus memberi support atas perilaku politisinya. Saking semrawutnya wajah politik kekinian di negeri ini, hingga kita makin sulit menyentuh pucuk perenungan demokrasi yang sesungguhnya. Bagaimana tidak, Dewan Kehormatan Penyelenggara Pemilu (DKPP) memberhentikan ketua Panwaslu DKI Jakarta karena terbukti melanggar kode etik penyelenggara pemilu. Ini adalah putusan pelanggaran berat yang kelima sejak DKPP dibentuk, setelah sebelumnya memecat ketua dan tiga anggota Komisi Independen Pemilihan (KIP) dan lima komisioner anggota Komisi Pemilihan Umum (KPU) Tulangbawang. Sedangkan yang jadi korban pertama atas putusan DKPP adalah lima anggota KPU Provinsi Sulawesi Tenggara dan disusul pemecatan ketua KPU Kota Depok dengan tuduhan yang sama.

Selain memutuskan pemberhentian secara tetap, DKPP juga memberi sanksi berupa teguran tertulis kepada ketua KPU DKI Jakarta dan peringatan keras kepada ketua dan satu anggota KPU Pati, Jawa Timur, serta ketua dan seluruh anggota KPU Timor Tengah Utara, NTT. DKPP juga menolak gugatan sekaligus merehabilitasi nama baik tergugat kepada anggota Panwaslu Sulawesi Tenggara, ketua KPU Lampung Barat, ketua dan anggota KPU Kota Batu, serta ketua KPU Banggai Kepulauan. Sedangkan di Kabupaten Talaud, DKPP memberikan putusan berupa penetapan pencabutan kepada tergugat ketua KPU daerah setempat (lihat tabel). Munculnya para komisioner yang tersandung kasus pelanggaran kode etik meneguhkan keyakinan kita betapa para aktor politik bersama politisi bergerak liar melabrak keluhuran politik. Sementara rakyat yang seharusnya mendapat pendidikan politik luhur jauh terbuang ke ruang-ruang ketidakpercayaan politik. Inilah wajah perpolitikan kita akhir-akhir ini. Politik yang hampa dari etika.

Jargon siap kalah siap menang yang selalu diikrarkan menjelang pemilihan kepala daerah (pilkada) oleh kontestan, ternyata hanya sebatas basa-basi belaka. Kenyataannya, politisi kita hanya siap menang tetapi tidak mau kalah. Karenanya, langkah culas pun ditempuh dengan berkolusi dengan penyelenggara pemilu. Keberpihakan inilah yang kemudian menjadi malapetaka bagi para komisioner yang akhirnya DKPP menjatuhkan putusan atas pelanggaran kode etik. Yaitu pelanggaran terhadap etika penyelenggara pemilu yang berpedomankan sumpah dan/atau janji sebelum menjalankan tugas sebagai penyelenggara pemilu (Pasal 251 UU No. 8/2012 tentang Pemilu). Dengan kata lain, penyelenggara pemilu termakan sumpah atas janji saat dilantik menjadi penyelenggara pemilu. Putusan DKPP yang diproses melalui semi peradilan sesungguhnya berbeda secara prosedural dengan Dewan Kehormatan KPU/Bawaslu sebelum terbentuknya DKPP. Jika Dewan Kehormatan melakukan peradilan tertutup, DKPP secara terbuka. Hal ini tentu dimaknai sebagai bentuk transparansi atas kasus yang digelar agar tidak timbul fitnah dan kasak-kusuk dengan pihak yang bermasalah. Sebuah terobosan yang cukup mengobati rasa keadilan DKPP, yang konon hanya satu-satunya di dunia. Daftar Putusan Sidang Pelanggaran Kode Etik DKPP No Daerah Putusan Komisioner 1. Sulawesi Tenggara Pem-

berhentian tetap Ketua dan anggota KPU 2. Depok Pemberhentian tetap Ketua KPU 3. Tulangbawang Pemberhentian tetap Ketua, anggota, sekretaris KPU 4. Aceh Tenggara Pemberhentian tetap Ketua dan 3 anggota KIP 5. DKI Jakarta Pemberhentian tetap Ketua panwaslukada 6. DKI Jakarta Teguran tertulis Ketua KPU 7. Pati, Jatim Peringatan keras Ketua dan 1 anggota KPU 8. Timor Tengah Utara, NTT Peringatan keras Ketua dan anggota KPU 9. Sulawesi Tenggara Ditolak/direhabilitasi Anggota panwaslu 10. Lampung Barat Ditolak/direhabilitasi Ketua KPU 11. Kota Batu Ditolak/direhabilitasi Ketua dan anggota KPU 12. Banggai Kepulauan Ditolak/direhabilitasi Ketua KPU 13. Talaud Penetapan pencabutan Ketua KPU Sumber: Diolah dari informasi DKPP Barang Langka Ternyata selain satwa langka, konon etika juga perlu mendapat ’’suaka’’. Sebab, selain tergolong ’’barang’’ yang harus dilindungi, juga sulit ditemui di ranah politik, hukum, ekonomi, sosial, dan lainnya. Politik seakan berjalan tanpa arah. Sementara hukum makin liar dengan segala keputusan yang serba absurd. Ekonomi pun makin termehek-mehek dengan segala modus untuk memiskin-

kan rakyat, sedangkan kehidupan sosial makin compangcamping dengan segala stigma yang negatif. Pendek kata, etika dari semua lini makin termarjinalisasi karena terdesak oleh hiruk-pikuk kekuasaan dan hedonisme para politisi. Secara faktual, etika sudah lama ditinggalkan dan tidak menjadi tuntunan bagi para aktor politik dan politisi kita. Jika diukur, syahwat politik jauh meninggalkan norma-norma etika untuk mengejar kekuasaan. Mereka seakan tenggelam dengan strategi pemenangan agar segera duduk di kursi kekuasaan. Baik pada legislatif maupun eksekutif. Akan halnya dengan penyelenggara pemilu, sejatinya setali tiga uang: larut dalam praktik kolusi, terkooptasi, nepotisme, dan nyaman dalam suasana politik pragmatisme bersama lakon para politisi busuk. Etika, menurut para ahli, sesungguhnya tidak lain adalah aturan perilaku, adat kebiasaan manusia dalam pergaulan antarsesama untuk menegaskan mana yang benar dan mana yang salah. Secara khusus, dikaitkan dengan seni pergaulan manusia, etika ini dijelaskan dalam bentuk aturan (code) tertulis yang secara sistematik sengaja dibuat berdasarkan prinsip-prinsip moral, dan pada saat dibutuhkan bisa difungsikan untuk menghakimi segala macam tindakan yang secara logikarasional umum (common sense) dinilai menyimpang dari kode etik. Jadi, etika adalah refleksi dari apa yang disebut dengan ’’self control’’. Sebab, segala sesuatunya dibuat dan diterapkan dari dan untuk kepentingan profesi itu. Oleh karenanya, sebuah profesi dapat memperoleh kepercayaan dari masyarakat bilamana dalam diri para elite profesional tersebut ada kesadaran kuat untuk mengindahkan etika profesi pada saat mereka ingin memberikan jasa keahlian profesi kepada masyarakat yang memerlukannya. Etika sebagai sistem nilai berkaitan dengan kebiasaan yang baik, tata cara hidup yang baik. Etika sebagai sistem nilai dipahami sebagai nilai yang dipergunakan sebagai pedoman, petunjuk, arah bagaimana manusia harus bersikap dan berperilaku baik, karena etika tersebut memuat berbagai perintah yang harus dipatuhi serta larangan yang tidak boleh dilanggar. Semoga tidak ada lagi komisioner yang diberhentikan oleh DKPP karena mengabaikan kode etik. (*) Penulis adalah Pemerhati Etika Politik/Dosen FISIP Universitas Muhammadiyah Lampung

Ketua Komisi Hukum DPR, Gede Pasek Suardika.

“Ini adalah kemajuan yang sangat berarti dari janji KPK sebelumnya. Kan KPK berjanji sampai akhir tahun dan terbukti sebelum akhir tahun sudah ada kemajuan,”

Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter

Sikap Kami Skandal Century di Puncak Hierarki KOMISI Pemberantasan Korupsi (KPK) gemar menebar janji. Berulang kali pimpinan KPK berjanji menaikkan status kasus pemberian dana talangan Rp6,7 triliun ke Bank Century ke penyidikan dan menetapkan tersangka. Tim Pengawas Century DPR pun nyaris kehabisan energi mengawasi kasus itu. Berulang kali pula tim pengawas menggelar rapat dengan KPK, tetapi belum ada tanda-tanda KPK segera menetapkan tersangka, minimal anak tangga pertama untuk menguak misteri penyaluran dana ke bank sakit itu. Padahal, Pansus Bank Century DPR pada awal Maret 2010 telah terang benderang merekomendasikan sejumlah nama petinggi negara yang mesti diproses secara hukum karena terindikasi melakukan penyimpangan dalam bailout Century. Ada nama Wakil Presiden Boediono yang kala itu menjabat Gubernur Bank Indonesia. Bank Indonesia (BI) diduga tidak memberikan informasi dan data akurat perihal indikator keuangan Bank Century. Selain Boediono, masih ada sejumlah nama lain dalam gerbong BI yang harus diperiksa. Ada pula nama Sri Mulyani Indrawati yang saat itu menteri keuangan. Direktur Pelaksana Bank Dunia itu terindikasi melakukan penyimpangan karena Bank Century sebenarnya tidak berdampak sistemis. Sri Mulyani kemudian kepada Wakil Presiden Jusuf Kalla mengaku dikibuli BI. Pemberian dana talangan ke Bank Century sungguh misterius. Dana sebesar Rp6,7 triliun bisa dengan mudah mengalir ke bank sakit, tanpa ada pejabat tinggi yang bertanggung jawab. Kalla terang-terangan menyebut bailout Century merupakan operasi senyap. Kini setelah dua tahun berlalu, KPK pun membidik dua pejabat BI, yakni BM dan SF, menjadi tersangka. Kabar itu dibocorkan anggota tim pengawas Century DPR Akbar Faisal (Hanura). Hasil audit investigasi Badan Pemeriksa Keuangan (BPK) menyebutkan BM menerima aliran dana Rp1 miliar yang belakangan diketahui sebagai pinjaman yang akan dikembalikan. SF memberikan disposisi pemberian dana talangan ke Century meski bank itu tidak layak. Bagi Akbar Faisal, jika benar BM dan SF ditetapkan sebagai tersangka, itu bukanlah prestasi KPK. Sejak 2010 Pansus Century telah jelas merekomendasikan sejumlah nama itu diproses secara hukum. Lagi pula BM dan SF bukanlah pejabat paling tinggi dalam hierarki di Bank Indonesia. Karena itu, tidak semestinya hanya mereka yang menjadi korban. Setiap kebijakan selalu melekat dan taat pada hierarki. Karena itu, tanggung jawab pun melekat secara hierarkis. Dalam bahasa serdadu, tidak ada prajurit yang salah; yang salah ialah panglima. Keputusan pengucuran dana talangan Rp6,7 triliun ke Bank Century pasti tidak di tangan BM dan SF. Secara hierarkis, mereka berdua tidak mempunyai kekuasaan yang amat perkasa untuk bisa menetapkan aliran dana sebesar itu. Kebijakan itu merupakan keputusan di puncak hierarki. Karena itu, di mana tanggung jawab Gubernur BI kala itu? Di manakah pula tanggung jawab Dewan Gubernur BI? Kalau menjadi tersangka, tentu BM dan SF hanyalah anak tangga pertama. Bukan anak tangga terakhir. Lalu kapan KPK menetapkan anak tangga berikutnya? Jangan seperti kasus Hambalang yang tertahan di anak tangga pertama. (*)


21 November 2012

PNS BISA DITURUNKAN PANGKAT ATAU DIPECAT Jika Ketahuan Dukung Mendukung Cagubsu MEDAN- Pegawai Negeri Sipil (PNS) di semua jajaran, baik provinsi maupun kabupaten/kota serta pejabat di lingkungan Badan Usaha Milik Negara (BUMN) atau Badan Usaha Milik Daerah (BUMD), dilarang untuk memberi dukungan kepada pasangan calon (paslon) kepala dan wakil kepala daerah di Pemilihan Gubernur Sumatera Utara (Pilgubsu) 2013 mendatang. Tidak hanya itu, PNS juga dilarang keras terlibat dalam kegiatan kampanye untuk dukungan terhadap para calon kepala daerah/wakil kepala daerah. Karena, pada prinsipnya jabatan PNS harus mengedapankan netralitas dan harus senantiasa menjunjung tinggi kehormatan negara, pemerintah dan martabat PNS, serta senantiasa mengutamakan kepentingan negara diatas kepentingan pribadi, seseorang atau golongan. “Pelarangan terhadap PNS itu, dalam rangka upayapencegahanterjadinyapelanggaranPemilu pada Pemilihan Umum Kepala Daerah dan Wakil Kepala Daerah (Pemilu Kada), tanpa terkecuali di Pilgubsu 2013, khususnya politisasi PNS sebelum mulai tahap pendaftaran dan penetapan Calon Gubernur (Cagub) dan Wakil Gubernur Sumatera Utara (Wagubsu) 2013,” ungkap Ketua Panitia Pengawas Pemilihan Umum (Panwaslu) Provinsi Sumatera Utara (Provsu), David Susanto, Selasa (20/11).

Maka dari itu, sambung David, Panwaslu telah mengeluarkan surat tertanggal 1 November 2012, No:/PANWASLU-SU/XI/2012, tentang instruksi pengawasan terhadap netralitas PNS dan pejabat di BUMN/BUMD pada Pilgubsu 2013, yang ditembuskan kepada Panwaslu kabupaten/kota se-Sumut. “Panwaslu Kabupaten/Kota Se-Sumut untuk memperhatikan banyak, pertama dalam UU No.43/1999 tentang perubahan atas UU No.8/ 1974 tentang pokok-pokok kepegawaian, yang mengatur pasal 3, 1) ayat (1), dimana PNS berkedudukan sebagai unsur aparatur negara yang bertugas untuk memberikan pelayanan kepada masyarakat secara professional, jujur, adil dan merata dalam penyelenggaraan tugas negara, pemerintah dan pembangunan. Kemudian, 2) ayat(2),dalamkedudukandantugassebagaimana dimaksud pada ayat (1), PNS harus netral dari semua pengaruh golongan dan partai politik serta tidak diskriminatif dalam memberikan pelayanan kepada masyarakat”. Dan 3) ayat (3), untuk menjamin netralitas PNS dilarang menjadi anggota dan/atau anggota partai politik,” rinci David. Lebih lanjut, David menerangkan, pada pasal 26,ayat(2)disebutkan,PNSbersumpah/janjiakan senantiasamenjunjungtinggikehormatannegara, pemerintah dan martabat PNS, serta akan

senantiasa mengutamakan kepentingan negara dari pada kepentingan pribadi, seseorang atau golongan. Untuk sanksi yang mestinya diberikan bagi PNS yang tetap bersikukuh, dan larut serta memberi dukungan kepada pasangan calon yang bersaing, disesuaikan dengan pasal 4, angka 15 Peraturan Pemerintah(PP) No.53/2010tentangdisiplinPNS, yang mengatur antara lain PNS dilarang memberikan dukungan kepada calon kepala daerah/wakil kepala daerah, dengan cara, terlibat dalam kegiatan kampanye untuk mendukung calon, menggunakan fasilitas yang terkait dengan jabatan dalam kegiatan kampanye, membuat keputusan dan/atau tindakan yang menguntungkan atau merugikan salah satu pasangan calon selama masa kampanye; dan/ atau. Selanjutnya, dilarang mengadakan kegiatan yang mengarah kepada keberpihakan terhadap pasangan calon yang menjadi peserta pemilu sebelum, selama, dan sesudah masa kampanye meliputi pertemuan, ajakan, imbauan, seruan, atau pemberian barang kepada PNS dalam lingkungan unit kerjanya, anggota keluarga, dan masyarakat. Humas Panwaslu Provsu, Fakhruddin menambahkan, PNS yang tidak menaati ketentuan tersebut dijatuhi hukuman disiplin dengan tingkatan hukuman disiplin sebagai berikut, hukuman disiplin ringan, yakni teguran

lisan, teguran tertulis dan pernyataan tidak puas secara tertulis. Selanjutnya, lanjut Fakhruddin, hukuman disiplin sedang, yakni penundaaan kenaikan gaji berkala selama satu tahun dan penurunan pangkat setingkat lebih rendah selama satu tahun. Dan hukuman disiplin berat, yakni penurunan pangkat setingkat lebih rendah selama tiga tahun, pemindahan dalam rangka penurunan jabatan setingkat lebih rendah, pembebasan dari jabatan, pemberhentian dengan hormat tidak atas permintaan sendiri sebagai PNS dan pemberhentiantidakdenganhormatsebagaiPNS. “Hukuman disiplin sedang dijatuhkan bagi pelanggaran terhadap larangan memberikan dukungan kepada calon kepala daerah/wakil kepala daerah dengan cara terlibat dalam kegiatan kampanye untuk mendukung calon kepala daerah/wakil kepala daerah serta mengadakan kegiatan yang mengarah kepada keberpihakan terhadap pasangan calon yang menjadi peserta Pemilu sebelum, selama, dan sesudah masa kampanye meliputi pertemuan, ajakan, imbauan, seruan,ataupemberianbarangkepadaPNSdalam lingkungan unit kerjanya, anggota keluarga, dan masyarakat sebagaimana dimaksud dalam Pasal 4 angka 15 huruf a dan huruf d,” jelas Fakhruddin. Lebih lanjut, Fakhruddin menerangkan, untuk hukuman disiplin berat dijatuhkan bagi pelanggaran terhadap larangan antara lain, memberikan dukungan kepada calon kepala

daerah/wakil kepala daerah, dengan cara menggunakan fasilitas yang terkait dengan jabatan dalam kegiatan kampanye dan/atau membuat keputusan dan/atau tindakan yang menguntungkan atau merugikan salah satu pasangan calon selama masa kampanye sebagaimana dimaksud dalam Pasal 4 angka 15 huruf b dan huruf c. Selainitu,tambahFakhruddinlagi,jugadilarang melakukan penggunaan fasilitas dan anggaran pemerintah dan pemerintah daerah, yang antara lain penggunaan fasilitas pemerintah dan pemerintah daerah berupa sarana mobilitas seperti kendaraan dinas meliputi kendaraan pejabat negara dan kendaraan dinas pegawai, serta alat transportasi dinas lainnya. Sama halnya dengan gedung kantor, rumah dinas, rumah jabatan milik pemerintah, milik pemerintah provinsi, milik pemerintah kabupaten/kota, kecuali daerah terpencil yang pelaksanaannya harus dilakukan dengan memperhatikan prinsip keadilan. Dan sarana perkantoran, radio daerah dan sandi/telekomunikasi milik pemerintah daerah provinsi/kabupaten/kota, dan peralatan lainnya, serta bahan-bahan. Hal yang sama juga adalah dilarang menggunakan dan/atau memanfaatkan dana yang bersumber dari keuangan pemerintah dan pemerintah daerah baik secara langsung maupun tidak langsung. (ari)

ALASAN BANTU KERJAKAN PR, GURU SETUBUHI SISWI 6 KALI Sambungan Halaman 1 perbuatan hubungan suami istri terjadi Sabtu, 16 Juli sekira pukul 14.30 WIB di rumah tersangka. Saat pulang sekolah, tersangka menyuruh korban datang ke rumahnya membawa buku pekerjaan rumah (PR). Korban yang polos langsung mengantar buku PR setelah sebelumnya diiming-imingi akan membantunya mengerjakan PR tersebut. Saat itu tidak ada orang di rumah selain mereka berdua. Setelah mengerjakan PR korban, tersangka merayu korban untuk menuruti kemauannya. Korban ditarik ke dalam kamar dan disetubuhi.

„ Gamawan Fauzi

JAKARTA- Pemerintah Daerah di Sumatera Utara maupun di sejumlah daerah lain, dituntut harus mampu melaksanakan ‘Standar Pelayanan Minimal’. Jika tidak, maka siap-siap menghadapi gugatan dari masyarakat. Karena hal tersebut merupakan kewajiban tugas aparatur sebagai pelayan masyarakat. “Standar Pelayanan Minimal (SPM) ini sudah terlaksana belum? Bagaimana pelayanan kita di bidang pendidikan dan bagaimana di bidang kesehatan?” ujar Menteri Dalam Negeri (Mendagri) Gamawan Fauzi dalam Rapat Koordinasi Nasional (Rakornas) Kediklatan Antar Kementerian/Lembaga dan Pemda Tahun 2012 di Jakarta, Selasa (20/11). Untuk itu sebagai langkah awal, Badan Pendidikan dan Pelatihan (Diklat) di daerah, menurut Gamawan, harus dapat lebih aktif lagi dalam menjalankan tanggungjawabnya. Sehingga mutu maupun kemampuan aparatur dalam memberdayakan daerah, dapat lebih baik lagi terlaksana. “Karena saat ini kita sedang menujukesana.Jadisiap-siapsajadigugat kalau kita tidak melakukan (standar pelayanan minimal) tersebut,” katanya. Ia mencontohkan semisal kemampuan tenaga penyuluh pertanian di lapangan.Badandiklatdidaerahmaupun kementerian terkait, menurutnya perlu secara berkala memberi masukan informasi maupun penambahan pengetahuan yang benar-benar dibutuhkan masyarakat. “Karena jangan-jangan malahpetaninyayanglebihtahuperkembangan daripada penyuluhnya,” katanya. Selain itu Gamawan juga menilai, mungkin ke depan perlu ada sertifikasi bagi aparatur yang telah mengikuti diklat. Jika ini dilakukan, maka ia yakin semua kebutuhan yang diinginkan daerah akan segera terjawab. Karena paling tidak denganadanyasertifikasi,dapatdiketahui sejauh mana kemampuan aparatur yang ada. “Karena walau bagaimana pun, pemberdayaan daerah jauh lebih penting. Sebab saat ini kewenangan pusat jauh lebih sedikit,” katanya. (gir)

Sambungan Halaman 1 berusaha, akhirnya api berhasil dipadamkan, namun dua rumah tersebut sudah rata dengan tanah. Juliana br Sinaga, pemilik rumah di mana api mulai muncul mengatakan, kebetulan dirinya meninggalkan rumahnya sejak pukul 15.00 WIB, pergi ke rumah cicitnya yang sedang sakit. Dia mengetahui rumahnya hangus terbakar setelah mendengar teriakan warga. Sementara Ganda Saragih, pemilik rumah kedua yang turut terbakar mengaku bahwa

polisi disebabkan sakit flu. Namun Sarles enggan merinci kondisi sakitnya Chondri tersebut. Sekitar pukul 14.00 WIB, Sarles Gultom dengan menaiki Kijang Innova BK 1109 WZ mendatangi Unit Reskrim Polres Siantar. Disinggung mangkirnya Chondri dari panggilan polisi, dia kembali menegaskan, Chondri tidak bisa datang disebabkan sakit flu. “Dia sakit flu, kalau sakit tak mungkin bisa memenuhi panggilan polisi. Kalau rumah sakit tempat dia dirawat ada di Kota Siantar ini,” ujarnya tanpa merinci rumah sakit dimaksud. Dia menambahkan, sesuai surat yang dia terima, Chondri dipanggil dengan status tersangka dalam kasus PNS gate yang dilaporkan Lalo Hutapea. Chondri menerima surat ini pada Sabtu dan diterima pengacaranya pada Senin. Dikatakan, kasus yang menjerat kliennya ini bermula adanya iming-iming menjadi PNS di Pemko Siantar dengan cara membayar. Di mana ada 12 orang yang dijanjikan masuk PNS dengan membayar uang Rp140 juta hingga Rp150 juta per orang. “Sekitar Rp150 juta per orang dengan jumlah yang terlibat dalam masalah ini sebanyak 12 orang. Hasil pengembangan kasus di kepolisian, Chondri diduga terlibat. Kalau saya tidak salah, uang yang terkumpul dalam kasus ini Rp1 miliar lebih,” ujarnya. Dijelaskan Sarles, Chondri diindikasikan terlibat dari laporan Lalo Hutapea, orangtua dari Sandro Hutapea. Di mana Sandro Hutapea telah mengeluarkan uang Rp140 juta terkait keinginan menjadi PNS di Pemko Siantar.

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel)

Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Atas kejadian tersebut, kerugian ditaksir mencapai Rp200 juta, termasuk uang kontan milik Ganda Saragih yang merupakan pengusaha sayur mayur, sekitar Rp50 juta. Kapolsek Tiga Runggu AKP M Manurung melalui personel yang turun ke lapangan mengatakan, akan memproses kejadian ini lebih lanjut. Sampai berita ini diturunkan belum diketahui penyebab kebakaran. Namun pihak kepolisian mengharapkan kerja sama masyarakat untuk memberi keterangan apabila suatu saat dibutuhkan untuk mengikuti proses pemeriksaan. (sp)

Sambungan Halaman 1

Anggota SPS No: 438/2003/02/A/2007 Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba

saat api mulai berkobar dirinya dan keluarga sedang berada di ruang tengah dan tidurtiduran. Karena mendengar ada ledakan dua kali, dia langsung keluar dan melihat api sudah berkobar di rumah milik Juliana br Sinaga yang bergandengan dengan rumahnya. Dia pun bergegas membangunkan istri dan anaknya yang saat itu sedang tidur. Akhirnya tak ada harta benda yang bisa terselamatkan dan semuanya rata dengan tanah. Personel Polsek Tiga Runggu juga tampak turun ke loakasi kejadian melakukan olah TKP.

Ngaku Flu, Chondri Mangkir

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pemimpin Perusahaan Metro Asahan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

pada Jumat (16/11) juga di rumah tersangka saat istrinya sedang ke rumah orangtuanya. Semakin intimya hubungan kedua sejoli tersebut, membuat rekan-rekan korban curiga. Akhirnya kecurigan ini sampai juga kepada orangtua korban. Awalnya korban tidak mau berterus terang. Namun setelah dibujuk, akhirnya korban mengakui perbuatan cabul yang dilakukan gurunya. Saat itu juga korban bersama kedua orangtuanya membuat pengaduan resmi ke Polsekta Tanah Jawa. Sementara itu tersangka yang ditanyai METRO mengatakan, awalnya korban sering mengirim SMS kepadanya. Lama-kelamaan,

isi SMS menjurus ke arah cabul. Dari situlah awalnya mereka menjadi intim. Perbuatan persetubuhan tersebut sering dilakukan saat istri tersangka tidak berada di rumah. Agar tidak hamil, tersangka mengaku menggunakan kondom. Kapolsekta Tanah Jawa Kompol B Siallagan SH ketika dikonfirmasi METRO di ruang kerjanya, membenarkan adanya pengaduan cabul yang dilakukan gurunya sendiri. Saat ini tersangka sudah diamankan di Mapolsekta Tanah Jawa. Dia mengatakan, tersangka melanggar pasal 81 UU RI Nomor 23 tahun 2002 dengan ancaman hukuman 15 tahun penjara. (iwa)



Pemda Siapsiap Digugat

Meski korban menolak, tersangka tetap merayu untuk melakukuan hubungan suami istri. Tubuh korban dibaringkan di tempat tidur, seluruh tubuh korban diraba hingga korban ditelanjangi. Kesempatan baik tersebut tidak disiasiakan tersangka. Sore itu, tersangka berhasil merengut kesucian korban. Puas melampiskan hawa nafsunya, korban disuruh pulang. Namun, tersangka menjadi ketagihan. Perbuatan yang sama terus berlangsung saat istri tersangka pergi ke kampung Bazoka, Bah Jambi menemui orangtuanya. Perbuatan terakhir tersangka dilakukan


„ Sarles Gultom SH MH Penasehat Hukum Chondry tertawa ketika ditanyakan tentang Chondry, sambil melangkah meninggalkan Mapolresta Siantar, Selasa (20/11). Selain Chondri Silitonga, turut diadukan dalam kasus ini dan juga sudah ditetapkan sebagai tersangka yaitu Kepala Seksi Keuangan Sekretariat DPRD Kota Siantar, Sumarni. “Ya kalau saya sebagai pengacaranya, disarankan kepada klien saya untuk hadir pada panggilan kedua. Kami akan berusaha membawa yang bersangkutan nantinya. Namun azas praduga tak bersalah (presumption of innocent) harus tetap dikedepankan dalam kasus ini,” ujarnya. Kapolres Siantar AKBP Alberd TB Sianipar melalui Kasat Reskrim AKP Daniel Marunduri

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Chandro Purba, Nasa Putramaylanda, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Pala MD Silaban, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Freddy Tobing, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva

SIK, dihubungi kemarin sore membenarkan status Chondri dalam kasus CPNS gate ini telah tersangka. Chondri ditetapkan tersangka sejak September kemarin sesuai hasil gelar perkara di Polda Sumut. Terkait mangkirnya Chondri pada panggilan pertama, menurutnya hal itu sahsah saja. Namun pihaknya akan segera melayangkan panggilan kedua kepada yang bersangkutan. “Saya akan koordinasikan dulu dengan Kapolres untuk panggilan kedua. Kalau kedua juga tidak mau, panggilan ketiga akan kita lakukan dengan paksa,” ujarnya. (ral)

Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Niko, Hotlan Doloksaribu Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

Sambungan Halaman 1 mi basah Aliong di Lorong 20, Kelurahan Pondok Sayur, Siantar Martoba. “Sudah saya perintahkan anggota ke sana tadi pagi melakukan pemeriksaan,” ujarnya saat dihubungi METRO pukul 10.30 WIB. Saat dihubungi kembali sekira pukul 14.30 WIB, Ronal mengatakan belum mengetahui hasil pemeriksaanyangdilakukananggotanya.Diajuga terkesan tidak mau melakukan koordinasi dengan kepolisian terkait masalah ini. Padahal Polsek Martoba ingin berkoordinasi dengan Dinas Kesehatan memeriksa tempat usaha Aliong. “Ngapain aku koordinasi sama Kapolsek, sama anggotaku dululah aku koordinasi,” jawabnya melalui telepon. KapolsekSiantarMartobaAKPMukson,ditemui di ruangannya mengatakan, mereka akan koordinasidenganUnitEkonomiReskrimPolresSiantar terkait keluhan warga ini. Kapolsek mengatakan, merekaakanmenyelidikidugaanpemakaianformalin di tempat usaha mi basah milik Aliong. “Kalau Dinas Kesehatan mau melakukan pemeriksaan ke sana, lebih baik didampingi polisi. Kita siap melakukan koordinasi dengan Dinas Kesehatan,” ujarnya. Sekitar pukul 15.00 WIB METRO mendatangi kantorDinkesKotaSiantar.BeberapastafdiBagian Penyehatan Lingkungan enggan memberikan komentar terkait hasil pemeriksaan yang mereka lakukan pada usaha mi basah Aliong. Salahsatustafdibidanginimenyebutkan,Kabid PenyehatanLingkunganbermarga Paranginangin, sedang di luar. Saat diminta nomor telepon seluler Kabid ini, staf itu mengatakan, Kabid sedang sakit. “Bapak sedang tidak di sini Bang. Bapak sedang di luar. Besok saja Bang datang ke sini, saya akan sampaikan kepadanya mengenai kedatangan Abang.NgertilahBang,gimanayangnamanyasakit jantung.Besokpastiakanketemusetelahapelpagi. Dan Abang bisa tanyakan mengenai hal tersebut, ”ujarnya lagi. Padapukul15.30WIBketikakeluardariruangan tersebut, METRO melihat ada seseorang laki-laki keturunanTionghoanaikkeruanganstafyangbaru saja ditemui itu. Priaitunaikbesertaanakgadisnyakeruanganstaf tersebut. Keduanya menggunakan sepedamotor Supra X BK 3845 TU dan memarkirkan sepedamotornyadiJalanAmoy,bukandidepanDinkes. Keduanyaberadadiruanganstaftersebutselama 20menit.SaatkeluardariDinkes,keduanyamemilih melalui Jalan Amoy, tidak melalui pintu depan kantor Dinkes. Keduanya berjalan cepat meninggalkanDinkestanpamenolehkebelakang. (ral/mag-7)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



6 474 Pejabat Daerah Terlibat Kasus Korupsi depan seluruh Sekretaris Daerah di Indonesia akan dipanggil untuk melaporkan perkembangannya. ”Saya Senin panggil seluruh sekda untuk melaporkan,” katanya. Gamawan juga bercerita soal kasus terpidana korupsi Rp 20 miliar, Gubernur Bengkulu Agusrin Najamudin yang menggugat Pemerintah ke Pengadilan Tata Usaha Negara (PTUN) Jakarta, terkait penerbitan Keputusan Presiden tentang pemberhentian tetap dirinya sebagai Gubernur Bengkulu, pasca-putusan kasasi Mahkamah Agung (MA). Agusrin juga menggugat Keputusan Presiden tentang pengangkatan Gubernur definitif Bengkulu yang menggantikannya. Alasan gugatan adalah perkara korupsi yang menjeratnya kini sedang dalam proses PK ”Itu kan sudah incracht (tingkat pertama), sehingga dapat diberhentikan. Saya usul ke Presiden diberhentikan dan ditandatangani oleh Presiden. Saat hari akan dilantik penggantinya, sudah ada kue, bunga, tamu sudah datang. Pukul 09.00 WIB saya fax ke sana, pelantikan ditunda karena ada putusan sela di PTUN. Saya tanya saya harus patuh itu atau UU? Kementerian sering menghadapi kasus seperti ini,” ungkap Gamawan. (dtc/int)

„ Gamawan Fauzi JAKARTA - Ternyata banyak pejabat daerah di seluruh Indonesia yang terlibat kasus hukum yakni kasus dugaan korupsi. Menteri Dalam Negeri Gamawan Fauzi menyebutkan ada 474 pejabat daerah yang terlibat kasus hukum. ”474 Pejabat daerah yang terlibat hukum. Tersangka 96, terdakwa 49, dan terpidana 330,” ujar Gamawan. Hal itu dikatakan dalam diskusi bertema ‘Menegaskan Pemberantasan Korupsi: Larangan Menjabat bagi Mantan Terpidana Korupsi’ di Kemenkum HAM, Jalan HR Rasuna Said, Jakarta, Selasa (20/11). Menurut Gamawan, angka tersebut dapat terus bertambah. Senin (26/11) pekan

Praktek Menetap


Penyakit Kronis

Bpk. FERDIANSYAH AL QURAISY Bpk. AFRIZAL APT 7036 6797 0823 6209 9575 HP 0852

Menakertrans Minta TKI di Malaysia Mogok Kerja JAKARTA Menakertrans Muhaimin Iskandar mendorong seluruh TKI di Malaysia untuk mogok kerja.


KPK Ajukan Permohonan

PERPANJANGAN MASA TUGAS 7 PENYIDIK POLRI JAKARTA- Komisi Pemberantasan Korupsi (KPK) mengajukan permohonan perpanjangan tujuh penyidik Polri yang habis masa tugas di komisi tersebut. Namun, hingga saat ini, Polri belum memutuskan akan memperpanjang ketujuh penyidik tersebut atau tidak. ”Biasanya habis dulu (masa tugasnya), nanti baru ada jawaban,” ujar Kepala Biro Penerangan Masyarakat Divisi Humas Polri Brigjen Boy Rafli Amar di Mabes Polri, Selasa (20/11). Menurut dia, Bagian Sumber Daya Manusia

Polri tengah menggodok hal tersebut. “Sedang dalam penyiapan staf SDM Polri,” kata dia. Sebelumnya, ada 14 penyidik Polri yang habis masa tugas di KPK. Enam di antaranya penyidik yang telah dialihstatuskan KPK menjadi pegawai tetapnya. Satu orang atas keinginan pribadi memilih tidak memperpanjang tugasnya di KPK. Tujuh penyidik lagi belum jelas status masa tugas mereka. KPK menginginkan agar masa tugas ketujuh penyidik itu diperpanjang. Keinginan itu telah disampaikan melalui surat ke Polri. (dtc/int)

JHANG JHIANG Cabang Jakarta

Sasaran Alamat: dari mana saja yang melewati Jl. SM Raja minta turun oas depan Rumah Makan PT Bintang Utara atau 100 M sebelum Hotel Mutiara dari Arah Terminal, lihat papan nama KLINIK ALTERNATIF JHANG JHIANG

JAKARTA - Ternyata banyak pejabat daerah di seluruh Indonesia yang terlibat kasus hukum yakni kasus dugaan korupsi. Menteri Dalam Negeri Gamawan Fauzi menyebutkan ada 474 pejabat daerah yang terlibat kasus hukum.

”474 Pejabat daerah yang terlibat hukum. Tersangka 96, terdakwa 49, dan terpidana 330,” ujar Gamawan. Hal itu dikatakan dalam dis-


NB: Ingat khusus untuk Kota Siantar kami tidak buka cabang di tempat lain hanya di Jl. SM Raja No. 15

Kesehatan adalah faktor yang sangat penting bagi tubuh manusia. Apabila tubuh manusia di Gerogoti oleh penyakit akan mengakibatkan traumatik bagi penderita dan berakibat sangat efek buruk bagi fisik dan mental, hilang ketenangan, hilang kesempatan kerja dan berkarir. Banyak cara pengobatan Alternatif ditawarkan saat ini dengan tingkat penyembuhan cepat, kami tidak memberi janji, tapi bukti, bergaransi metode pengobatan ALTERNATIF JHANG JHIANG yang terkenal manjur dan mujarab dari ramuan herbal resep rahasia Tiongkok dan dibantu theraphy Acupresor, Refleksiologi Biro Energi, Getar Alektro dan Infrared, secara klinis terbukti dapat menyembuhkan berbagai penyakit kronis luar dalam.


SISTEM SARAF • Migren / Penyempitan • Imsomnia / Vertigo • Ayan / Epilepsi • Kanker Saraf / Otak

SISTEM PENCERNAAN • Maag Kronis / Lambung • Usus Buntu / Apendik • Wasir / Ambeyen • Hernia / Turun Berok • Ingin Gemuk / Langsing

SISTEM PERADARAN DARAH • Jantung Bocor / Coroner • Hipertensi, Anemia, Leukemia • Lumpuh / Stroke


SISTEM REPRDODUKSI • Kanker Rahin / Kandungan

• Spilis / Raja Singa • Teling Bernanah • Lever / Sakit Kuning • Gatal-gatal / exsim • Muka / jerawat


• Keputihan / Pektay • Ingin Punya Keturunan • Haid Tidak Lancar • Tumor / Kanker Kandungn


• TBC / Batuk Kering • Pilek Menahun • Bronchitis • Asma / Sesak Nafas • Kanker Paru-paru

Muhaimin lantas memaparkan persoalan-persoalan TKI akhir-akhir ini. Muhaimin mengaku prihatin menyangkut kasus penembakan, pemerkosaan, hingga pemutusan hubungan kerja sepihak TKI. Muhaimin menilai pemerintah Malaysia telah melanggar MoU yang disepakati dengan Indonesia. ”Ada pemerkosaan oleh tiga polisi Malaysia yang diproses dan kita terus melakukan pendampingan hukum melalui lawyer tepatnya yang ada di KBRI kita. Kasus lain ada TKI on sale, ada cara-cara tidak manusiawi dalam memasukkan TKI. Ini sudah melanggar MoU,” katanya. Dalam kesempatan ini Muhaimin juga menyampaikan banyak masukan terkait RUU tengan Perlindungan Tenaga Kerja Indonesia di luar negeri. Menurut Muhaimin, pemerintah terus berupaya memperluas komunikasi dengan sejumlah negara yang menjadi sasaran penempatan TKI. ”Kita juga memperhatikan perlindungan TKI di Trinidad. 163 pelaut Indonesia pernah terdampar di sana. Penanganan selama ini sudah kita pulangkan, namun masih ada proses terus untuk kita pulangkan semuanya. (dtc/int)

474 Pejabat Daerah Terlibat Kasus Korupsi

Klinik Alternatif

Jl. SM Raja No. 15 Kel. Bane Kec. Siantar Utara P. Siantar BUKA

”Moratorium pengiriman TKI ke Malaysia dulu sudah berhasil membuat Malaysia tunduk dan menandatangani seluruh aturan baru. Namun jalur-jalur ke Malaysia begitu mudah sehingga begitu banyak saudara kita di Malaysia lebih dari 1,2 juta warga Indonesia tinggal dan bekerja di Malaysia,” kata Muhaimin dalam paparan terkait perlindungan TKI di Malaysia di Komisi IX DPR, Senayan, Jakarta, Selasa (20/11). Menurut Muhaimin, harus ada langkah konkret untuk membuat Malaysia menghormati jasa-jasa TKI. Kalau perlu, TKI menggelar demonstrasi besar-besaran. ”Mungkin bila perlu kita menyerukan warga kita di Malaysia bersatupadu satu komando agar kita dihargai. Kalau perlu satu hari mogok kerja untuk menghormati saudara kita yang menjadi korban pelanggaran, yang menyangkut hubungan kerja maupun peristiwa kriminal di luar hubungan kerja,” kata Muhaimin.

„ Pimpinan KPK Abraham Samad mengaku pihaknya sudah melayangkan surat permohonan perpanjangan masa tugas 7 penyidik ke Polri.


Alamat Praktek


21 November 2012

• Asam Urat / Reumatik • Gondok / Steroid • Amandel / Polip

SISTEM URINE / KENCING • Ginjal / Kencing Batu • Prostad / Kanker Prostad • Kecing Manis / Diabetes

Tersedia Ramuan Khusus Bagi Anda Yang Belum Mempunyai Momongan Pria Tanpa Batas Usia Wanita Dibawah 45 Tahun, 1 Bulan Insya Allah Langsung Berhasil

kusi bertema ‘Menegaskan Pemberantasan Korupsi: Larangan Menjabat bagi Mantan Terpidana Korupsi’ di Kemenkum HAM, Jalan HRRasuna Said, Jakar-

ta, Selasa (20/11). Menurut Gamawan, angka tersebut dapat terus bertambah. Senin (26/11) pekan depan seluruh Sekretaris Daerah di Indonesia akan dipanggil untuk melaporkan perkembangannya. ”Saya Senin panggil seluruh sekda untuk melaporkan,” katanya. Gamawan juga bercerita soal kasus terpidana korupsi Rp 20 miliar, Gubernur Bengkulu Agusrin Najamudin yang menggugat Pemerintah ke Pengadilan Tata Usaha Negara (PTUN) Jakarta, terkait penerbitan Keputusan Presiden tentang pemberhentian tetap dirinya sebagai Gubernur Bengkulu, pasca-putusan kasasi Mahkamah Agung (MA). Agusrin juga menggugat Keputusan Presiden tentang pengangkatan Gubernur definitif Bengkulu yang menggantikannya. Alasan gugatan adalah perkara korupsi yang menjeratnya kini sedang dalam proses PK ”Itu kan sudah incracht (tingkat pertama), sehingga dapat diberhentikan. Saya usul ke Presiden diberhentikan dan ditandatangani oleh Presiden. Saat hari akan dilantik penggantinya, sudah ada kue, bunga, tamu sudah datang. Pukul 09.00 WIB saya fax ke sana, pelantikan ditunda karena ada putusan sela di PTUN. Saya tanya saya harus patuh itu atau UU? Kementerian sering menghadapi kasus seperti ini,” ungkap Gamawan. (dtc/int)

Kavling & Perumahan

1. Harga termasuk bias Sertifikat Hak Milik (SHM) 2. Jalan lebar 6 Meter Onderlag

Jl. Lapangan Bola Atas / Jl. Durian Gg. Partam Kantor Pemasaran MARANATHA FOTOCOPY

Contact Person

• Arman Pasaribu SE HP 0813 6138 4712 • Friska Silitonga HP 0821 6123 6469 • Pdt Asbon Manurung HP 0812 6405 5558

Peta Situasi Lokasi

Jl. Seribu Dolok No. 206 P. Siantar Jl. Diponegoro No. 25 P. Siantar (depan SAPADIA)


21 November 2012

Supir Ngantuk, Colt Diesel Terguling Sambungan Halaman 8 dua puluh centimeter di pinggir jalan umum ini. Sejurus kemudian, truk ini langsung menyeruduk pohon pinang di pinggir jalan hingga pohon tersebut tumbang dan truk ini terbalik dan ringsek di pinggir jalan. Warga yang melihat kejadian langsung berhamburan dan melihat kondisi para korban yang mengemudikan truk tersebut. Kejadian ini menyebabkan kemacetan panjang di Jalan Umum SiantarParapat karena lokasi dipenuhi warga. Tak lama kemudian dua petugas Unit Laka Polsek Dolok Panribuan tiba dilokasi dan langsung mengatasi kemacetan. Sementara supir truk langsung dilarikan warga ke Puskesmas Dolok Panribuan karena mengalami luka-luka di kaki dan tangan. Hendra (34), warga Nagori Tiga

Dolok, Kecamatan Dolok Panribuan mengatakan, saat kejadian supir truk ini tampak tergenjet pintu truk dan kakinya mengalami luka lecet.” Saya menduga pengemudi truk ini ngantuk sehingga laju kendaraannya tidak stabil. Ini kan jalan lurus, bukan tikungan. Tadi ketika saya tolong, kaki supir itu terjepit pintu. Namun tidak terlalu berbahaya karena saat kejadian dia menggunakan sabuk pengaman, jadi sempat tergantung tadi dia,”katanya. Kaposlantas Polsek Dolok Panribuan Ipda H Ompusunggu membenarkan kecelakaan lalu lintas ini. Supir truk masih diperiksa, sementara kejadian ini merupakan kecelakaan tunggal dan supirnya masih dalam perawatan.”Kita akan periksa dulu supirnya dan memang kejadian ini tanpa ada lawan. Penyebab kecelakaan sejauh ini masih dalam penyelidikan kita,”katanya.(yan)

5 Ekor Kerbau Hilang..

Sambungan Halaman 8 Kasian, Silau Buttu, dengan cara tali kerbaunya diikatkan ke pohon. Seperti biasanya, setiap pukul 13.00 WIB, para pemilik lembu istirahat untuk makan siang. Karena di sana belum pernah kehilangan kerbau di ladang, para pemilik kerbau tersebut merasa nyaman pulang makan ke rumah. Seusai makan siang, mereka kembali ke ladang untuk mengangonkan kerbau yang sudah hampir 3 tahun dipeliharanya. Setibanya di ladang, mereka terkejut karena tidak melihat lagi kelima kerbaunya. Kemudian mereka pun mencari di seputaran ladang, namun pencarian itu tidak membuahkan hasil. Para pengangon lainnya yang mereka tanyai, tak satu pun yang mengetahui atau melihat kerbaunya dicuri.

Diduga pelaku melakukan aksinya dengan cara membuka ikatan tali nilon dari pohon tempat angonan kerbau, kemudian menarik kerbaukerbau tersebut sampai ke jalan besar Silau Buttu, dan memasukkan ke dalam mobil yang telah stanbay (bersiap-siap) di sana. Setelah upaya pencarian mereka tidak berhasil, saat itu juga mereka mendatangi Polres Simalungun membuat laporan pengaduan. Akibat kejadian ini, ketiga pemilik ternak kerbau tersebut mengalami kerugian sekitar Rp66 juta. Kapolres Simalungun AKBP M Agus Fajar SIK saat dikonfirmasi melalui Kasubag Humas AKP H Panggabean SH mengatakan pihaknya telah menerima laporan pengaduan dari ketiga korban, dan langsung menugaskan personil melakukan penyelidikan. (osi)

Saya Mengakui Barang Itu..

Sambungan Halaman 8 informasiitu,merekapunlangsungterjun ke lokasi menggunakan mobil patroli. Kemudian setibanya di tempat yang dimaksud,merekasudahmelihatmasyarakat ramai disebuah warung. Setelah mendatangi warung itu, mereka sudah melihat terdakwa beserta tiba bungkus ganja yang dibungkus dengan kertas koran. “Saat di lokasi itu saya sudah melihat terdakwa berada di sebuah warung. Sementarabarangbuktitigabungkuskecil ganja seberat 8 gram itu sudah dipegang oleh warga setempat yang juga sipil. Setelah itu, terdakwa pun saya amankan dandibawakePolsekBosarMaligasguna melakukan penyelidikan,” jelasnya. Saat jaksa penuntut umum (JPU) Julius Butar-butarbertanyabarangitudigunakan untuk apa, saksi mengaku bahwa dia tidak ada bertanya karena langsung menyerahkannya ke Polsek. Terdakwa bertugas hanyaitumenangkapdanyangmemeriksa terdakwaituadalahjuruperiksadiPolsek. Kuasahukumterdakwa,FereriusPurba bertanya apakah Napitupulu menanya-

kan barang itu milik siapa ! Saksi pun mengaku saat menangkap tidak ada bertanyabarang itu milik siapa. Selain itu, ia juga tidak menanyakan kepada terdakwa bahwa barang itu miliknya atau tidak dan darimana diperoleh. Mendengar itu, hakim sempat heran melihat saksi yang menangkap terdakwa tanpa bertanya. Apalagi saat melakukan penangkapan itu, warga cukup banyak dan yang memegang barang bukti bukan terdakwa melainkan saksi Poiman atau Heriyanto. Usai mendengar keterangan saksi, hakim meminta terdakwa untuk menanggapiketerangantersebut.kemudian terdakwapunmengakubahwabarangitu bukan miliknya. “Barang itu bukan milik saya pak. Saya terakhir mengakui barang itu karena dipukuli waktu diperiksa,” ungkap pria yang bekerja sebagai kuli bangunan tersebut. Selanjutnya,hakimpunmemintajaksa untuk menghadirkan polisi yang melakukan pemeriksaan dan saksi yang memegang barang itu. sidang pun ditunda dan dilanjut pada Selasa (27/11).(mua)

GADIS SEKAMPUNG DIHAMILI 4 BULAN Sambungan Halaman 8 seharusnya belum pantas mereka lakukan.Beberapakalidiajak,Bungatetap menolak. Hal ini tidak membuat niat Subio berhenti untuk menodai Bunga. Bujuk rayu Subio yang berjanji akan menikahinya,akhirnyaberhasilmembuat Bunga bersedia melayani nafsu Subio. “Aku mau melakukan itu karena dia

Sambungan Halaman 8 Mesron yang setiap hari menulis angka tebakan jenis togel dan KIM. Untuk menangkap Mesron, polisi menyaruh sebagai pembeli togel.

berjanjiakanmenikahiaku,”terangBunga saat diperiksa di Polres Simalungun. Bahkan hubungan suami istri yang seharusnya belum layak mereka lakukan sudah mereka lakukan berkali-kali di rumah Subio. Namun setelah mengetahui Bunga hamil 4 bulan, Subio malah tidakmaubertanggungjawab.Berkali-kali Bunga meminta pertanggungjawaban dariSubioagardiadinikahi,Subiomenge-

lak dan mengatakan tidak mau menikahi Bunga. Jawaban yang dilontarkan Subio, pun membuat Bunga geram, lantas menceritakankehamilannyaitukepadaorangtuanya. Setelah mengetahui Bunga hamil, orangtua Bunga mendatangi Subio meminta pertanggungjawaban atas kehamilan Bunga. Saat itu, orangtua Bunga

mendapat jawaban yang tidak memuaskan. Subio tidak mau menikahi Bunga,namuntanpamemberikanalasan yang jelas. Kapolres Simalungun AKBP M Agus Fajar SIK melalui Kabag Humas AKP H Panggabaen SH membenarkan telah menerima laporan pengaduan dari korbanpencabulanwargaNagoriNagasaribu dengan tersangka Subio. (osi)

Saat Mesron mengeluarkan kertas dan pulpen untuk menulis angka tebakan polisi yang sedang menyaruh, polisi langsung menangkapnya. Ketika digeledah, dari kantong Mesron diamankan 2 unit Handphone

berisi angka tebakan, serta uang ratusan ribu rupiah hasil penjualan togel. Kapolres Siantar AKBP Albert TB Sianipar SIK ketika dikonfirmasi melalui Kasat Reskrim AKP Daniel

Marunduri mengatakan bahwa Mesron dan barang bukti 2 unit Handphone dan uang ratusan ribu rupiah telah diamankan. Saat ini Mesron masih dimintai keterangan untuk dilakukan pengembangan. (mag-05)

Tiga Raja, Kecamatan Girsang Sipangan Bolon. Terdakwa berulang kali melakukan persetubuhan dengan korban dengan ancaman akan menyebarkan hubungan yangselamainimerekalakukan,”sebutnya. Dia menerangkan, tidak hanya itu saja, terdakwa juga pernah menghubungi korbanyangmasihdudukdibangkuSMA melaluihandphone.Cozenmenyebutkan bahwa ada pria bernama Rianto Situmorang (divonis lima tahun, red) yang menghubunginyamerupakantemannya. Cozen meminta korban untuk menuruti apa yang diminta temannya itu.

“Selanjutnyaditempatyangsamayakni di penginapan Simarjarunjung Jalan Sirikki, Kelurahan Tiga Raja Kecamatan Girsang Sipangan Bolon, Cozen pun melakukan persetubuhan itu. Sama halnya dengan Rianto, juga mengajak korban melakukan persetubuhan di tempat yangsama dan terakhir diberikan uang Rp100 ribu,” ungkap Pasaribu. “Sehinggaatasperbuatanitu,adabeberapa pertimbanganatasperbuatanterdakwa.Untuk halmemberatkanperbuatanterdakwamerusakmasadepankorban.Halmeringankan,terdakwa berterus terang di persidangan,

mengakuiperbuatannya,menyesaldanberjanjitidakmengulanginyakembali,”terangnya lagi. Sehingga dengan pertimbangan itu, majelis hakim yang mengadili perkara ini memutuskan menyatakan terdakwa bersalah. Selanjutnya menjatuhkan hukumanpidanaterhadapterdakwayakni enamtahunpenjaradengandendaRp100 juta subsidair tiga bulan. Selanjutnya usai mendengarkan putusan itu, terdakwa yang saat itu mengenakanbajutahananhanyaterdiam saja.Kemudianiapunmenerimaputusan yang dijatuhkan hakim.(mua)

masing-masing. Setelah mendapat laporan dari warga, polisi berhasil menangkap tiga pelaku dari rumahnya masing-masing. Pelaku yang pertama diamankan adalah Rizal, saat Rizal diciduk di rumahnya, tak sedikit pun melakukan perlawanan. Berdasarkan pengembangan dari Rizal, Efendi dan Diki pun saat itu juga langsung diciduk dari rumahnya. Dari tangan ketiganya, polisi menyita 3 Laptop dari 14 Laptop yang dibobol, 8 Iped dan 2 LCD. Selanjutnya, ketiga orang pelaku ini digiring ke Mapolres

Siantar untuk diamankan. Berdasarkan informasi dari tiga pencuri ini, dua anggota sindikat lain pun berhasil ditangkap yaitu Benny dan Bela dari rumahnya masing-masing. Sehingga polisi berhasil menangkap lima pembobol toko laptop 88. Eka Wahyudi (18) penjaga ruko sekaligus karyawan Toko 88 mengatakan saat terjadinya kebongkaran, dirinya sedang nyenyak tidur di lantai tiga. Saat bersamaan, juga hujan turun deras, sehingga membuat Eka tidak mendengar para pelaku masuk. Ia mengatakan mengetahui ruko

yang ditempatinya kebongkaran, ketika baru bangun tidur sekitar pukul 06.00 WIB. Saat turun ke lantai 1 untuk mandi, ia terkejut melihat barang-barang di ruko berantakan. Kasat Reskrim AKP Daniel Marunduri Sik saat dikonfirmasi membenarkan penangkapan kelima tersangka. “Pertamanya ada tiga tersangka yang ditangkap oleh Sat Intelkam Polres Siantar, setelah dilakukan pengembangan oleh Sat Reskrim Polres Siantar, maka dua orang tersangka lainnya pun berhasil diamankan,” ujarnya. (mag-05)

nya, Risma br Siagian (20) dan Rosmaida br Siagian (25) kakak beradik, tinggal bersama Julonggo dirumah yang hanya berjarak sekitar 20 meter dari warung. Memang lagi apes, Selasa (20/11) pukul 03.00 WIB, salah seorang tetangga korban yang bekerja di sebuah perusahaan coca-cola, melihat pagi itu pintu kedai samping belakang dalam keadaan terbuka. Dia mengira, pintu tersebut sengaja dibuka oleh pemiliknya. Setelah dicek ternyata tidak ada orang, pemuda yang baru saja pulang bekerja itu langsung memberitahu kepada pemilik kedai bahwasannya pintu kedai kopi miliknya sudah terbuka. Mendapat kabar, Jolunggo selaku pemilik warung sontak terkejut dan langsung mengecek bersama kedua karyawan yang tinggal bersamanya. Setelah dicek, ternyata televisi ber-

ukuran 45 inci sudah tidak lagi berada di tempatnya. Untungnya, uang beserta rokok yang ditaruh dalam steling dibawa masuk dalam rumah, sehingga pelaku pencurian yang telihat bekas mengacak steling tidak menemukan apa-apa. Atas kejadian tersebut, Jolunggo mencoba memberitahu kepada putranya Ipda Daniel Arta Sasta Tambunan yang kebetulan dinas di Kelapa Dua Depok, Jakarta. Saran perwira kepada ibunya, agar membuat laporan resmi kepada pihak kepolisian di wilayah hukum tersebut. ”Laporkan saja ke polisi, mudahmudahan pelakunya dapat di tangkap,” kata Julonggo mengulangi perkataan anaknya. Selasa (20/11) pukul 10.00 WIB, Julonggo mendatangi Polsek Bangun guna membuat laporan kehilangan atas kasus pembongkaran

warung kopi. Mendapat laporan itu, tiga personil Polsek Bangun terjun ke lokasi guna melakukan olah tempat kejadian perkara (TKP). Rosmaida, penjaga warung menyebutkan, malam sebelum kejadian, warung terlihat sepi, sehingga warung tutup lebih awal dari biasanya. Biasanya tutup sekira pukul 23.00 WIB sampai 24.00 WIB, malam itu warung tutup pukul 22.00 WIB. ”Tadi malam kedai tutup cepat bang sekitar pukul 22.00 WIB, karena kebetulan pelanggan lagi sepi,” kata Rosmaida. Kapolsek Bangun AKP Hitler Sihombing membenarkan adanya laporan kasus pencurian tersebut, untuk saat ini pihaknya sedang melakukan penyelidikan lebih lanjut. “Kita akan selidiki siapa pelaku pencurian itu, kita kembangkan dari hasil olah TKP,” tegas Kapolsek. (eko)

Petani Nyambi Jurtul Togel

Tersangka Cabul Dihukum Enam Tahun

Sambungan Halaman 8 Pengadilan Negeri Simalungun. Hakim berkesimpulan perbuatan terdakwa itu melanggar pasal 81 ayat 2 UU RI No 23 tahun 2002 tentang perlindungan anak. Terdakwa juga terbukti melakukan tipu muslihatdanmengancamkorbanAT(17) untuk melakukan persetubuhan. “Berdasarkan keterangan saksi dan keterangan terdakwa di persidangan terungkap peristiwa itu berlangsung pada Juli 2011 sekira pukul 20.00 WIB di kamar penginapan Simarjarunjung, Kelurahan

Sindikat Pembobol Laptop 88 Diringkus

Sambungan Halaman 8 Jalan Jeruk, Kelurahan Bantan, Siantar Barat. Kemudian Rizal Hamdani (29) warga Jalan Maluku, Kelurahan Bantan. Dan Diki Abdullah Siregar (21) warga Jalan Seram, Kelurahan Bantan. Setelah dilakukan pemeriksaan dan pengembanganterhadapketigatersangka, polisi lalu menangkap dua lagi tersangka, yakni Benny (23) Jalan Siak, Kelurahan BantandanBela(21)JalanMaduraBawah, KelurahanBantan. Informasi dihimpun, kelima tersangka diciduk polisi dari rumah mereka

Sambungan Halaman 8 merk Tosiba ukuran 42 inci seharga Rp 5 juta, untuk ditaruh dalam kedai. Sekitar Juli kemarin, warung kopi milik Julonggo nyaris kebongkaran. Dimana pagi hari, saat karyawannya ingin membuka pintu warung, terlihat bekas congkelan benda keras tepat di bagian engsel gembok. Diduga pencuri mengalami kesulitan, lalu mereka pergi tanpa membawa hasil apapun. Saat kejadian itu korban mulai resah, dan menganggap lingkungan sekitar rumah dan warung kopi sudah tidak aman lagi. Alhasil pintu kedai bagian samping depan, selain di gembok dari luar, korban juga membuat palang besi dari bagian dalam, untuk menjaga keamanan. Usai berjualan, kedai tidak ada yang menjaga. Dua orang karyawan-

Warung Kopi Digasak Maling

Sambungan Halaman Satu Khadafi: Ira Menampar Saya Sambungan Halaman 1 beberapa pernyataan dari Maimunah yang dianggapnya tidak tepat. Menurutnya, selain dipukul dan ditampar Ira, ada hal lain yang mendasarinya menendang, mencekik dan mengancam parang Ira. “Saya mencekik leher dan menendang, disebabkan Ira memukul dan menampar saya. Lihat ini muka saya masih ada bekas luka. Cuma saya tidak mengambil visum,” jelasnya. Alasan lain, Ira menginjak kaki anak perempuannya berumur tiga tahun saat mereka bertengkar. Kemudian, ayahnya yang menderita sakit paru-paru dan stroke, melihat pertengkaran tersebut, sehingga dia kawatir kondisi ini akan membuat ayahnya jatuh sakit. “Saya juga tidak ada bilang kalau kau macam-macam, kubunuh kau, saat mengacungkan parang itu. Yang kubilang sama mereka, pergi kalian dari sini. Jangan sampai gara-gara ini mati

orangtuaku. Kalau mati orangtuaku, kumatikan nanti kalian. Itu yang kubilang kemarin,” jelasnya. Dia juga berkilah, dia mengambil parang ke dapur disebabkan melihat Maimunah saat itu memegang kayu atau broti. Menurutnya, Maimunah nyaris saja mengacungkan broti ke arahnya. “Ancaman bunuh tak ada kubilang sama si Dedi. Yang kubilang itu sama dia, kau jangan ikut campur dengan urusan ini. Karena masalah keributan ini orangtua saya meninggal, sampai kapanpun kau akan kucari dan kuhabisi juga,” ujarnya mengingat kejadian itu. Dia Istri Siri Saya Khadafi mengatakan, Ira merupakan istri sirinya sejak Juli lalu. Keduanya menikah siri di Nagori Karang Sari, Gunung Malela. Dia juga mengakui pernikahan ini tidak memiliki kekuatan hukum secara administrasi kenegaraan. “Dia istri siri saya, memang kami menikah di bawah tangan. Istri pertama saya K br Batubara yang tinggal di Medan

juga sudah tahu kalau saya nikah siri sama si Ira. Saya kenal sama Ira sejak Juli lalu,” jelasnya. Dia juga heran memiliki utang Rp12 juta kepada Ira. Dia mengakui ada memiliki utang Rp7,5 juta untuk membayar tunggakan sepedamotor Vega R hitam miliknya. Kemudian Rp1,2 juta sebagai uang mengambil laptop di Pengadaian. “Mungkin biaya hidup saya selama di Siantar ini dianggap utang juga sama Ira, makanya menjadi Rp12 juta. Memang kuakui di Siantar ini belum memiliki pekerjaan tetap. Tapi saya bukan pengangguran, saya juga ikut-ikut proyek,” ujarnya lagi. Diberitakan sebelumnya, Maimunah br Sitinjak (52) dan putrinya Ira Warni (28) warga Jalan Mataram Siantar Barat, mengaku ditendang dan diancam parang pria berinisial Kha (32) di Simpang Lalahi, Nagori Karang Sari, Gunung Malela, Minggu (18/11) pukul 13.00 WIB. Keduanya mendatangi Kha untuk menagih utang Rp12 juta. Ironisnya, pengaduan mereka ditolak Polsek Bangun dan menganjurkan agar melapor ke Polres Simalungun di Raya. (ral)

Hisarma Saragih Raih Suara Terbanyak Sambungan Halaman 1

Pada putaran pertama, Hisarma Saragih memeroleh 20 suara, sedangkan Djarusdin Sitio MH memeroleh 1 suara, Marlan memeroleh 1 suara dan Anggiat Sinurat tak dana suara. Menurut Statuta USI Tahun 2012, Senat Universitas harus mengusulkan 2 nama, yakni kandidat suara terbanyak 1 dan 2. Tetapi karena suara terbanyak kedua jumlahnya sama, maka dilakukan putaran kedua yang diikuti Djarusdin Sitio dan Marlan. Pada putaran kedua ini, Djarusdin memeroleh 17 suara dan Marlan 5 suara. Dengan demikian, kandidat yang berhak maju ke putaran ketiga adalah Hisarma Saragih dan Djarusdin Sitio. Pada putaran ketiga, Hisarma Saragih memeroleh 21 suara, sedangkan Djarusdin Sitio hanya memeroleh 1 suara. Sesuai dengan Statuta USI pada Pasal 54 ayat 5-6 tentang Tata Cara Pemilihan Rektor, bahwa penyampaian hasil

pemilihan kepada Pengurus Yayasan, ditetapkan dengan Surat Keputusan Senat Universitas dengan usulan sebanyak 2 orang, yang diurutkan berdasarkan suara terbanyak. Karena itulah, nama Drs Hisarma Saragih dan Djarusdin Sitio diusulkan kepada Pengurus Yayasan. Usulan Senat Universitas ini akan digodok oleh Pengurus Yayasan USI, paling lambat 30 hari sebelum berakhirnya masa jabatan Rektor. Rektor USI saat ini DrsUlung Napitu MSi sendiri akan mengakhiri masa tugasnya pada 24 Desember 2012 mendatang. Rektor USI, Ulung Napitu yang merupakan Ketua Senat Universitas, sebelum menutup Rapat Pemilihan, berharap agar pemilihan ini bisa diterima semua pihak. Menurutnya, jabatan Rektor merupakan amanah, yang tugas-tugasnya sangat berat. Karena itulah diharapkan agar semua pihak, civitas akademika USI bisa bekerjasama dalam rangka membangun USI menjadi universitas yang lebih baik ke depan. (pra)

AMBISI HABISI CITY Sambungan Halaman 1 Madrid (7 poin) tergelincir di dua laga sisa dan dan Ajax Amsterdam kalah dari Borussia Dortmund, dini hari nanti. Berbeda dengan Real yang hanya butuh satu kemenangan atau seri dan Ajax kalah dari Dortmund. Jadi, bentrok melawan Real pada matchday kelima dini hari nanti akan menjadi penentuan buat City. “Kami harus menang. Tidak ada pilihan lain. Kami menyadari sangat berisiko, tapi itulah yang terjadi,” kata David Silva, gelandang serang City kepada AS. Meski peluangnya tipis, City menolak

menyerah. “Kami hanya harus lebih percaya diri. Kami semua ingin merasakan sukses di Eropa, bukan hanya (Roberto) Mancini,” lanjutnya. Masalahnya, tantangan City sungguh berat. Saat menghadapi tekanan sebegitu besar, mereka tidak bisa turun dengan pasukan terbaiknya. Manajer City Roberto Mancini tidak bisa menggunakan tenaga Gael Clichy, Joleon Lescott, James Milner, Micah Richards, dan Jack Rodwell. Untungnya, performa City sedang mantap. Setelah kekalahan dari Ajax Amsterdam 1-3 (24/10), mereka tidak pernah tersentuh kekalahan. Dalam lima

pertandingan terakhir, tim berjuluk The Citizens itu menang tiga kali dan dua kali seri. Performa hebat City itulah yang membuat bek Real Sergio Ramos agak heran mengapa mereka terseok-seok di Liga Champions. “Bagi saya agak mengejutkan mereka nyaris tersingkir dari Liga Champions,” bilang Ramos, seperti dikutip Daily Mail. “City merupakan tim hebat, bukan hanya sekadar secara individu. Tetapi, hal seperti itu memang tidak menjamin sukses di Liga Champions. Ini adalah grup yang berat dan semuanya punya kapasitas untuk lolos,” jelas bek timnas Spanyol itu. Berangkat ke Etihad Stadium, Real hanya

butuh setidaknya seri untuk bisa lolos, asalkan Borussia Dortmund menang atas Ajax. Tetapi itu tidak menjadi alasan untuk bermain aman. “Real tidak pernah bermain bertahan. Itu bukan kebiasaan kami. Kami datang untuk menang,” kata Ramos. Senada dengan Ramos, gelandang asal Jerman Sami Khedira juga menilai mereka harus menyerang melawan City. “Dortmund menunjukkan cara yang tepat mengalahkan mereka. Bermain kompak, berjuang untuk setiap bola, dan tetap bertahan pada gaya permainan sendiri,” katanya. Real punya bekal bagus untuk pulang dengan kemenangan atau paling tidak seri.

Entrenador Jose Mourinho hanya kehilangan Gonzalo Higuain dan Marcelo. Kedua pemain bisa digantikan dengan baik oleh Karim Benzema dan Fabio Coentrao. “Kami harus fokus melawan mereka. Kami ingin segera memastikan tiket lolos ke babak 16 besar. Kami akan memainkan gaya kami dan menghabisi mereka. Tidak boleh membiarkan mereka menekan kami,” ujar Khedira. Kalau City penasaran lolos ke babak 16 besar, maka Real memiliki target yang jauh lebih besar musim ini. Mereka menginginkan gelar kesepuluh Liga Champions. Kali terakhir Real menjuarai Liga Champions pada 2001-2002 lalu. (ham)



21 NOVEMBER 2012

Supir Ngantuk, Colt Diesel Terguling DOLOK PANRIBUAN- Truk Colt Diesel BK 8934 BJ yang dikemudikan L Sidabutar (43), warga Kelurahan Bahkapul, Siantar Sitalasari, terguling di Jalan Siantar Parapat KM 12, Nagori Tiga Dolok, Dolok Panribuan, Selasa (20/11) pukul 13.00 WIB. Truk ringsek, sementara supir mengalami luka ringan di kaki dan tangan. Informasi dihimpun METRO, awalnya truk yang mengangkut enam ton makanan ringan ini melaju dari arah Siantar menuju Parapat dengan kecepatan tinggi. Tiba dilokasi kejadian, mendadak truk tersebut oleng. Tak lama kemudian truk tersebut langsung menabrak beram jalan sedalam

„) Baca Supir Ngantuk .Hal 7

Gadis Sekampung Dihamili 4 Bulan SUBIO LEPAS TANGGUNGJAWAB SIMALUNGUN- Gadis belia sebut saja namanya Bunga (17) warga Nagori Nagasaribu, Kecamatan Silimakuta, Simalungun, rela berhubungan intim berkali-kali dengan pacarnya hingga hamil empat bulan. Setelah Bunga hamil, pacarnya Subio (26)yang juga sekampungnya itu, malah lepas tanggungjawab. Bunga pun memilih mengadu ke Polres Simalungun, Selasa (20/11). Informasi dihimpun, antara Bunga dan Subio lebih setahun menjalin hubungan pacaran. Bahkan Subio pun sudah sering membawa

Bunga ke rumahnya. Singkatnya, Mei lalu, Subio seorang diri di rumahnya, Bunga pun dipanggil. Bunga yang tidak menduga ada niat

jahat Subio, orang diri ke Subio. Sesampainya di sana, Subio langsung mengajak Bunga melakukan hubungan suami istri yang

datang ser u m a h



IS7 D A G alaman H

Tersangka Cabul Dihukum Enam Tahun SIMALUNGUN- Cozen Sinaga (29) warga Parapat, Kecamatan Girsang Sipangan Bolon dihukum enam tahun penjara dan denda Rp100 juta subsider tiga bulan penjara, Selasa (20/11. Hukuman ini jauh lebih ringan daripada tuntutan JPU Josron Malau yaitu 10 tahun penjara. Hal itu disampaikan majelis hakim yang dipimpin Ramses Pasaribu beranggotakan Monalisa dan Siti Hajar pada persidangan yang digelar di Foto.Rhano

„ Usai periksa tiga tersangka, polisi berhasil menangkap dua lagi tersangka baru. Lima pembobol laptop 88 yang diamankan di Polres Siantar.

Sindikat Pembobol Laptop 88


„ Penulis Togel Mesron Siahaan diamankan polisi.

Petani Nyambi Jurtul Togel SIANTAR – Mesron Siahaan (48) warga Jalan Manunggal Karya, Kelurahan Pematang Marihat, Kecamatan Siantar Marihat, diciduk dari salah satu warung di seputaran rumahnya. Pria yang sehariharinya bertani padi ini ditangkap tangan sedang menulis angka tebakan togel, Senin (19/11) pukul 15.00 WIB. Informasi dihimpun, bahwa Mesron merupakan target operasional sat reskrim Polres Siantar. Sebab masyarakat di sana sudah sangat resah, akibat perbuatan

„) Baca Petani .Hal 7

Warung Kopi Digasak Maling SIMALUNGUN- Warung kopi milik Julonggo br Naibaho (45)di Simpang Laut Simbah, Jalan Ulakma Sinaga, Nagori Rambung Merah, Kecamatan Siantar, digasak maling Selasa (20/11) pukul 03.00 WIB. Akibatnya warung milik orangtua anggota Brimob Ipda Daniel Arta Sasta Tambunan ini mengalami kerugian Rp5 juta. Julonggo br Naibaho mengaku, kedai kopi itu sudah berdiri sejak sebelas tahun

silam lalu disewakan kepada Simaremare, Pangulu disana. Dan Mei kemarin, setelah habis kontrak, korban memilih membuka usaha sendiri. Setelah warung kopi diusahai Julonggo, dia merubah sedikit tampilan bangunan serta memperluas lokasi karena mau dijadikan tempat nonton bola bareng. Setelah selesai, dia membeli televisi

„) Baca Warung ..Hal 7

5 Ekor Kerbau Hilang dari Ladang

„) Baca Tersangka .Hal 7



„ Tiga personil Polsek Bangun usai melakukan olah TKP, Selasa (20/11).

SIANTAR- Unit Reskrim Polres Siantar meringkus lima anggota sindikat pembobol Laptop 88 Jalan Kartini, Siantar Barat. Usai memeriksa tiga pencuri yang ditangkap

Sabtu lalu (17/11), polisi kembali meringkus dua anggota sindikat ini dari dua lokasi berbeda di Kota Siantar pada Minggu (18/11). Laptop 88 dibobol Selasa lalu (6/11).

Ketiga pelaku yang berhasil diringkus pertama kali antara lain Rustam Efendi Siregar (42) warga

„) Baca Sindikat .Hal 7


“Saya Mengakui Barang Itu Karena Dipukuli” SIMALUNGUN – JP Napitupulu (37) anggota Polri dari Polsek Bosar Maligas mengaku mengamankan terdakwa Hendratmo (39) tanpa bertanya kepada terdakwa di lokasi penangkapan di Huta Balokbalok, Nagori Sidomulio, Bosar Maligas. Terdakwa sendiri mengatakan, dia mengakui ganja itu miliknya karena dipukuli polisi saat

diperiksa. Hal itu terungkap dipersidangan di Pengadilan Simalungun dengan Hakim Ketua Samuel Ginting beranggotakan Adria Dwi Afanti dan Heriyanti, Selasa (20/11). Usai membuka persidangan dan dibuka untuk umum, Napitupulu pun mulai menceritakan kronologi kejadian.“Kebetulan saat itu saya

bersama anggota lainnya sedang piket. Kemudian kita mendapat laporan dari masyarakat sering terjadi transaksi narkotika di Lorong Batakan Huta Balok-balok Nagori Sidomulio, Kecamatan Bosar Maligas,” sebut saksi. Dia menerangkan, berdasarkan

„) Baca Saya Mengakui .Hal 7

SIMALUNGUN-Sebanyak lima ekor kerbau yang diternakkan warga di Perladangan Bambu, Dusun Kasian, Nagori Silau Buttu, Kecamatan Raya, diembat kawanan pencuri spesialis ternak, Selasa (19/11) pukul 14.45 WIB. Kerbau ini hilang saat pemiliknya makan siang dirumah masing-masing. Para pemilik kerbau ini antara lain Jumpa Sinaga (53) warga Jalan Kartini, Kelurah-

an Pematang Raya, Kecamatan Raya, Jan Hendri Damanik (38), dan Sarmauli Sinaga (50) warga Nagori Silau Buttu, Kecamatan Raya serentak membuat laporan pengaduan ke Mapolres Simalungun. Informasi dihimpun, bahwa setiap hari kelima kerbau tersebut diternakkan di Perladangan Bambu, Dusun

„) Baca 5 Ekor .Hal 7


21 NOVEMBER 2012

Coffee Morning Pengurus Kecamatan Hatonduhan

IPK Dukung Program Pemerintah HATONDUHAN- IPK Kecamatan Hatonduhan siap mendukung program pemerintah untuk mensukseskan pembangunan agar berjalan baik, seperti harapan masyarakat. Dukungan yang dimaksud itu adalah untuk menjaga Kecamatan Hatonduhan agar tetap kondusif, serta membantu terbentuknya kenyamanan bagi investor yang

hendak menanamkan modal di daerah ini. Demikian diungkapkan Ketua IPK Kecamatan Hatonduhan Herbet Sinaga, didampingi sekretaris Pahala Sihombing dan bendahara Waster Manurung, kepada METRO, di sela-sela acara coffee morning bersama seluruh pengurus, dan anggota di RM Makan Isabella Hatonduhan, Selasa (20/11).

Herbet juga menambahkan, IPK harus tumbuh lebih dewasa, dengan rasa tanggung jawab dan menjauhi pendekatan secara anarkis dan emosional. “Kita siap mendukung pemerintah daerah dalam menjalankan program pembangunan dan mensukseskan roda pemerintahan (FOTO : IRWANSYAH)

Baca IPK ...Hal 10

Ketua IPK Kecamatan Hatonduhan Herbet Sinaga (Kanan), berfoto bersama pengurus dan anggota.

Pemerintah Harus Tegur Pengusaha CV Teknik Sikap arogan pengusaha CV Teknik terhadap sejumlah ketua RT dan warga Kelurahan Merdeka, Siantar Timur, mendapat kecaman dari sejumlah warga. Mereka meminta agar pemerintah menyampaikan teguran kepada pengusaha tersebut.

Bangunan Tanpa IMB ‘Menjamur’ di Parapat


PARAPAT- Bangunan rumah, penginapan dan hotel yang diduga tanpa IMB (Izin Mendirikan Bangunan) ‘menjamur’ di Parapat, Ke-

Aksi donor darah Solidaritas Masyarakat Peduli Kemanusiaan (SOMALIKA) Kabupaten Simalungun, Selasa (20/11).

SOMALIKA Sumbang 15 Kantong Darah

camatan Girsang Sipangan Bolon, Simalungun.

Baca Bangunan ...Hal 10

SIMALUNGUN- Solidaritas Masyarakat Peduli Kemanusiaan (SOMALIKA) Kabupaten Simalungun, mewujudkan bukti solidaritas kepada sesama dengan aksi donor darah di Balai Karya Murni, Perdagangan, Minggu (18/11). Ketua Panitia Agus Salim Siregar didampingi Sekretaris Esau Pardede ST mengatakan, aksi ini merupakan kegiatan sosial anggota SOMALIKA untuk menunjukkan kepedulian kepada masyarakat sekitar. “Kita merasa dengan mendonorkan darah dapat meringankan beban masyarakat lain yang membutuhkannya. Terlepas siapa pun yang menggunakannya kelak, tetapi SOMALIKA ingin menunjukkan bahwa kita

Baca SOMALIKA ...Hal 10


Purba Hinalang Cup

IMB- Salah satu bangunan di kawasan Parapat yang diduga tidak mempunyai IMB (Izin Mendirikan Bangunan).

Layak Mendapat Perhatian Pemerintah

130 Hektare Sawah Telantar

PURBA- Setelah memperhatikan antusiasme masyarakat yang cukup tinggi selama pelaksanaan turnamen sepakbola Purba Hinalang Cup VIII 2012 yang berlangsung sejak Oktober 2012, panitia merasa perlu untuk melanjutkan kegiatan tersebut pada 2013 mendatang. Hal itu disampaikan Ketua Panitia Purba Hinalang Cup VIII Sendi Warto Purba kepada METRO, Selasa (20/11). “Kita melihat antusias masyarakat yang cukup tinggi mengikuti dan menyaksikan pertandingan ini. Jadi,

Berpotensi Dijadikan Pembibitan Ikan

PURBA- Ratusan hektare sawah di Purba Sipinggan, Kecamatan Purba, Simalungun, dibiarkan telantar dan tidak difungsikan. Pa-

dahal lokasi sangat berpotensi jika dijadikan sebagai tempat pembibitan ikan. Sawah itu tersebar di beberapa tempat di nagori yang berjarak 10 kilometer dari Haranggaol. Di antaranya berada di Dusun Purba

Hinalang seluas kurang lebih 80 hektare, di Dusun Sipinggan lebih kurang 20 hektare, di Dusun Banua lebih kurang 20 hektare, dan di Dusun Sirpang Gajapokki Bunga

Baca 130 Hektare ...Hal 10

Bantuan untuk Jompo Diduga Digelapkan

Camat Akan Usut Tuntas

mahasiswa yang kelak menjadi wajib pajak, harus mengerti pentingnya arti pajak. Selain itu, mahasiswa dapat memberikan pemahaman kepada keluarga dan masyarakat tentang pentingnya pajak bagi kelangsungan pembangunan.

Baca Yang Muda ...Hal 10

Baca Camat ...Hal 10


Panitia dan peserta sosialisai Tax Goes to Campus KPP Pratama Pematangsiantar, berfoto bersama di halaman STIE YP Sultan Agung, Selasa (20/11).

KPP Pratama Sosialisasi Tax to Campus

Yang Muda Peduli Pajak, Peduli Indonesia Kegiatan itu terselenggara berkat kerjasama KPP Pratama Siantar dengan pihak STIE Sultan Agung. Kegiatan langsung dibuka oleh Ketua STIE Dr Darwin Lie dan juga dihadiri langsung oleh Ketua YP Sultan Agung Aken. Dalam sambutannya, Kepala KPP Pratama Pematangsiantar Pardamean Tambunan mengungkapkan, para

Baca Pemerintah ...Hal 10

SIMALUNGUN- Camat Siantar Sabmenta Pasaribu mengaku akan mengusut tuntas bantuan untuk para orangtua jompo yang hingga kini belum dikeluarkan Unit Pengelola Sosial (UPS) Nagori Dolok Hataran, segera diusut. Hal itu untuk mengetahui masih ada tidaknya dana tersebut sekaligus persoalan penyalurannya. Demikian dikatakan Sabmenta kepada METRO, Selasa (20/11), sekaligus menindaklanjuti laporan Pangulu Dolok Hataran. Dia menuturkan, program bantuan P2KP itu terlaksana sebelum dia menjabat di Kecamatan Siantar. Namun ia mengakui, sejauh ini pihaknya kurang koordinasi dengan pengurus UKM yang diketuai Isum Parlan Haloho itu. “Saya sudah coba koordinasi dengan pejabat operasional kegiatan mandiri Wirdani, namun hasilnya tetap kurang memuaskan. Karena Wirdani mengaku, pihak UKM belum menyerahkan laporan pembukuan pengelolaan bantuan PNPM itu kepada Penanggung Jawab Operasional Kerja (PJOK). Akibatnya, sampai sekarang para jompo

Baca Layak ...Hal 10

SIANTAR- Kantor Pelayanan Pajak (KPP) Pratama Pematangsiantar menyelenggarakan seminar sosialisasi pemahaman pajak bagi mahasiswa di Aula STIE Sultan Agung, Jalan Surabaya, Siantar Barat, Selasa (20/11) pukul 09.00 WIB. Sosialisasi itu mengambil tema ‘Yang muda peduli pajak, yang muda peduli Indonesia’.

Kepada METRO, Selasa (20/ 11), B Saragih (30), warga Jalan Linggarjati mengaku sangat kesal atas sikap pengusaha showroom sepedamotor itu. Dia menganggap, si pengusaha terlalu mengandalkan kekayaannya dalam bertindak. “Ini negara hukum dan masyarakatnya masih menjunjung nilai-nilai kesopanan. Jangan mentang-mentang dia seorang pengusaha jadi suka-sukanya,” cibir B Saragih. Dia menambahkan, pemerintah jangan menganggap kejadian tersebut sebagai angin lalu saja, melainkan harus diberi teguran. “Seharusnya mereka malu karena belakang rumahnya orang yang membersihkan. Bukan malah marah-marah dan menghina ketua RT dan warga. Pemerintah harus bersikap tegas, jangan sampai amarah warga memuncak,” sambungnya lagi. Senada disampaikan O Panjaitan (40) warga Jalan Perwira. Dia mengatakan bahwa Walikota Pematangsiantar Hulman Sitorus telah menginstruksikan kepada seluruh warga untuk menjaga kebersihan, terutama di pekarangan rumah masingmasing. “Kita juga tak sepenuhnya melaksanakan

Punguan Raja Panjaitan se-Kota Pematangsiantar

Jalin Tali Asih ke Panti Asuhan SIANTAR- Dalam rangka menyambut Natal pada Desember 2012 yang semakin dekat, Punguan Raja Panjaitan, Boru, Bere, Ibebere se-Kota Pematangsiantar, berbagi kasih ke panti asuhan, Selasa (20/11). Ketua Pelaksana Harian Punguan Drs Hasoloan Panjaitan mengatakan, pihaknya berbagi kasih dengan anak-anak di beberapa panti asuhan yang ada di Kota Siantar, dengan memberikan bantuan berupa beras dan mi instan. “Ini merupakan bentuk kepedulian Pomparan Raja Panjaitan /Boru/Bere/Ibebere se-Kota Pematangsiantar. Selain itu, kegiatan merupakan program kegiatan sosial

Baca Jalin Tali ...Hal 10


Ketua Panitia Pelaksana Punguan Panjaitan Drs Hasoloan Panjaitan, bersama sekretaris dan bendahara, menyerahkan bantuan beras dan mi instan ke Panti Asuhan Elim HKBP.


21 NOVEMBER 2012

Camat Akan...

sambungan halaman 9

belum mendapatkan bantuan,” ujarnya. Lebih lanjut Sabmenta menerangkan, Pangulu Dolok Hataran juga sudah menyampikan keluhan para pengurus panti jompo yang berada di Nagori Dolok Hataran. Tapi kerena program bantuan itu sudah ada sebelum ia menjabat di sana, Sabmenta pun mengatakan, membutuhkan waktu untuk mengusut tuntas kasus tersebut. ”Saya akan berupaya tuntaskan permasalahan ini. Dengan adanya laporan pangulu, dalam waktu dekat kita akan kumpulkan seluruh pengurus yang mengkelola jetor, agar diketahui di mana kendala yang mereka alami. Jika memang terbukti ada penyimpangan, akan kita tindaklanjuti,” tambahnya. Terpisah, Pangulu Dolok Hataran Suhardi yang sempat di wawancarai METRO mengungkapkan, jika terbukti adanya penggelapan uang hasil pemanfaatan jetor sebesar Rp26,6 juta itu, pihaknya akan membuat laporan ke pihak kepolsian. ”Jika hasil rapat nanti diketahui ada kasus penggelapan yang dapat dibuktikan, kita akan lapor ke polisi. Biar hukumlah yang akan memprosesnya,” tegas pangulu. (eko)

Jalin Tali Asih... sambungan halaman 9 dalam rangka menyambut Natal 2012. Tujuannya untuk untuk mengokohkan silahturahmi, menjalin rasa persaudaraan, dan menyentuh kepedulian Punguan Raja Panjaitan terhadap sesama umat manusia, terlebih anak-anak bangsa yang berada di Panti Asuhan,” katanya. Hasoloan menambahkan, Punguan Raja Panjaitan juga akan memberikan bantuan kepada warga yang tidak mampu, kepada janda dan duda yang kurang mampu, serta kepada anak-anak yang berprestasi. Bantuan itu akan diberikan pada perayaan Natal Punguan Raja Panjaitan yang akan berlangsung tanggal 17 Desember 2012. Sementara Pdt Sihar Alaris Sinaga pada kesempatan itu mengungkapkan rasa syukurnya atas kepedulian dan perhatian Punguan Raja Panjaitan se-Kota Pematangsiantar. “Semoga dengan pemberian ini, tuhan memberikan berkat yang berlimpah kepada seluruh pomparan Raja Panjaitan/boru/bere/dan ibebere,” ujarnya. Kegiatan juga dihadiri Sekretaris Panitia Natal Punguan Raja Panjaitan /boru/bere/dan ibebere, Serma Berlin Panjaitan, serta Humas Thimoteus Panjaitan SE. (mag-06)

SOMALIKA... sambungan halaman 9 manusia harus saling peduli,” kata Agus. Sementara Kepala Unit Pelaksana Teknis Transfusi Darah Palang Merah Indonesia Cabang Siantar-Simalungun dr Abadi Sinaga mengatakan, pihaknya menyampaikan apresiasi kepada seluruh elemen masyarakat yang menjadikan aksi donor darah sebagai salah satu kegiatan sosial termasuk kepada SOMALIKA Kabupaten Simalungun. “Semakin banyak yang peduli kepada sesama, kita yakin akan semakin mudah memecahkan permasalahan yang terjadi di tengah-tengah masyarakat, termasuk permasalahan dalam bidang kesehatan,” kata Dr Abadi Sinaga. Dijelaskan Abadi, permasalahan kesehatan terutama pemenuhan kebutuhan darah segar dan sehat masih belum mampu dituntaskan sampai saat ini. Pihaknya secara rutin melakukan sosialisasi kepada elemen masyarakat di Siantar-Simalungun untuk mengajak serta membudayakan gerakan donor darah, sebagai salah satu perilaku hidup sehat. “Di samping menjaga kebugaran tubuh melalui olahraga teratur, makan makanan bergizi dan berimbang serta istirahat yang cukup, maka donor darah rutin akan lebih menyempurnakan hidup sehat,” kata dr Abadi. Ditambahkan dr Abadi, aksi donor darah SOMALIKA berhasil mengumpulkan 15 kantong darah segar dan akan disalurkan kepada masyarakat di Siantar-Simalungun yang membutuhkan sesuai rekomendasi dokter. (esa)

Pemerintah Harus Tegur Pengusaha CV Teknik sambungan halaman 9 instruksi walikota itu. Namun ketika ketua RT mulai bergerak, kita pun jadi terpanggil dan merasa malu kalau sampai pekarangan rumah saya pun harus orang lain yang membersihkan. Saya pun segera membersihkan pekarangan rumah saya. Namun bagi pengusaha CV Teknik, mereka bukannya merasa malu atau berterima kasih saat belakang rumahnya dibersihkan, malah marah-marah dan bersikap arogan. Malah dia menuding ketua RT dan warga meminta uang darinya. Pengusaha apa itu,” kesalnya dengan nada meninggi. Dia meminta Walikota Hulman Sitorus harus menegur atau langsung memberikan sanksi kepada pengusaha ini agar tidak mengulangi perbuatannya dan segera membersihkan pekarangan belakang rumahnya. “Jangan karena dia pengusaha, pemerintah justru membiarkan kelakuannya seperti itu. Sudah dana CSR (Coorporate Social Responsibility) tidak pernah dirasakan warga, malah

buat masalah lagi. Justru mereka yang memancing kemarahan warga yang cukup sabar selama ini. Pemerintah yang harus bertindak terlebih dahulu sebelum amarah warga menjadi-jadi,” kesalnya. Dia mengatakan, warga Kelurahan Merdeka dihuni oleh orang-orang cerdas dan tidak akan terima jika dilecehkan begitu saja. “Jangan kira warga di sini bisa dilecehkan begitu saja. Tidak ada satu pengusaha pun yang bisa berbuat semaunya di daerah kami. Semua harus ikut aturan dan menjunjung tinggi kesopanan, termasuk CV Teknik, juga harus berlaku bagi pengusaha yang lain,” ujar Panjaitan. Sementara, Lurah Merdeka JR Saragih yang dimintai komentarnya soal kemarahan warga ini mengatakan bahwa pihaknya akan menyampaikan teguran kepada pengusaha tersebut. “Ya, kita sedang siapkan teguran untuk pengusaha itu. Semua harus mematuhi peraturan, tak terkecuali. Walikota sudah menginstruksikan untuk membersihkan lingkungan dan semua warga harus melak-

sanakannya. Bukan malah marah-marah saat dilakukan pembersihan,” ujar lurah yang baru beberapa minggu dilantik ini. Diberitakan sebelumnya, niat baik sejumlah Ketua RT dan warga Kelurahan Merdeka, Kecamatan Siantar Timur untuk bergotong royong membersihkan parit, malah mendapat perlawanan dari pengusaha CV Teknik Jalan Ahmad Yani Pematangsiantar. Saat sejumlah Ketua RT dan warga membersihkan parit, Senin (19/11) sekira pukul 08.00 WIB, pengusaha showroom sepedamotor ini malah marah-marah dan menantang Ketua RT 7 B Silaban dan sejumlah warga. Informasi dihimpun METRO, pagi itu sejumlah ketua RT dan warga melaksanakan gotong royong membersihkan parit di belakang barisan rumah Jalan Ahmad YaniLinggar Jati. Ini merupakan instruksi Walikota Pematangsiantar yang sebelumnya telah menyampaikan surat edaran agar masingmasing warga membersihkan sekeliling rumahnya.

Bangunan Tanpa IMB ‘Menjamur’ di Parapat sambungan halaman 9 Pantauan METRO, Selasa (20/11), tampak bangunan-bangunan baru yang berdiri di Parapat, sedang dikerjakan tanpa memiliki IMB. Seperti bangunan yang berada di Jalan Bukit Barisan, Jalan Josep Sinaga, Jalan Nelson (jalan menuju Ajibata), dan di Jalan Merdeka. Diakui Camat Girsang Sipangan Bolon Drs Ojahan Nainggolan baru-baru ini, masyarakat di kecamatannya sering mengurus IMB

setelah bangunan yang didirikan selesai. “Itupun diurus karena ada keperluan dengan bangunan tersebut,” ujarnya. Dia menambahkan, sejauh ini pihak kecamatan hanya berwenang mengeluarkan IMB untuk pembangunan rumah warga. Itu sesuai Peraturan Bupati Simalungun (Perbup 2012), bahwa untuk pembangunan perhotelan dan penginapan, merupakan wewenang Badan Pelayanan dan Perizinan Terpadu (BPPT) Simalungun. “Yang menjadi kendala dalam pengurusan IMB di Kota Pariwisata Parapat ini, karena

banyak masyarakat yang belum tahu kegunaan IMB. Namun ketika IMB itu diperlukan, barulah masyarakat berbondongbondong mengurusnya, saat rumah selesai dibangun,” paparnya. Bagi masyarakat yang akan mengurus IMB, terlebih dulu harus membuat surat permohonan, serta melengkapinya dengan surat tanah dan silang sengketa tanah (SS). “Kalau masalah biaya, sudah ada rumus untuk perhitungannya dalam Perbub. Yang pasti kita tetap akan mempermudah masyarakat dalam pengurusan IMB,” ucapnya. (TH)

Yang Muda Peduli Pajak, Peduli Indonesia sambungan halaman 9 Pada sosialisasi tersebut, turut hadir Ketua Tim Penyuluhan Walter Sidebang, Sekretaris Penyuluhan dan Kepala Seksi Pelayanan Pajak Luseria Tampubolon, Pengawas dan Konsultasi I Reonald Hutagalung, Pengawas dan konsultasi III Edwin H Siahaan, bersama dengan beberapa Panitia dari KPP Pratama Pematangsiantar, yang menaungi pelayanan pajak untuk daerah Siantar dan Simalungun. Sementara Walter Sidebang yang diberi kesempatan menyampaikan materi mengatakan, program itu memang ditujukan kepada generasi muda agar memahami pajak sejak dini. Para mahasiswa merupakan calon wajib pajak, sehingga sejak saat ini sudah harus mengerti pajak. Sedangkan Edwin H Siahaan pada acara

itu sempat berpesan tentang peran penting pajak bagi negara. Pajak adalah kontribusi wajib kepada negara, yang terutang oleh orang pribadi atau badan, yang bersifat memaksa berdasarkan Undang-Undang, dengan tidak mendapatkan imbalan secara langsung dan digunakan untuk keperluan negara bagi sebesar-besarnya kemakmuran rakyat. Tanpa pajak, pembangunan dan biaya operasional negara tidak akan berjalan. Anggaran Pendapatan Belanja Negara (APBN) sangat ditentukan oleh pajak. Negara membutuhkan dana yang sangat besar untuk membiayai penyelenggaraan negara. Pajak diperuntukkan menciptakan kemakmuran bagi seluruh masyarakat dengan menyediakan fasilitas pendidikan, fasilitas umum, fasilitas sosial, agama, kebudayaan dan sebagainya.

Pajak daerah yang dikelola oleh Pemda adalah pajak provinsi dan pajak kabupaten. Pajak provinsi yang terdiri dari pajak kendaraan bermotor, bea balik nama kendaraan bermotor, pajak bahan bakar kendaraan bermotor, pajak pengambilan dan pemanfaatan air bawah tanah dan air permukaan, dan lain-lain. Sedangkan pajak kabupaten meliputi, pajak hotel, pajak reklame, pajak restoran, pajak hiburan, pajak parkir, pajak penerangan jalan, dan lainnya. Dalam makalahnya, Reonald Hutagalung juga memaparkan tentang nomor peserta wajib pajak (NPWP) yang artinya nomor yang diberikan kepada wajib pajak sebagai sarana administrasi perpajakan. NPWP digunakan sebagai tanda pengenal diri atau identitas dalam melaksanakan hak dan kewajiban perpajakan. (mag-05)

IPK Dukung Program Pemerintah sambungan halaman 9 agar lebih maju lagi,” ujarnya. Herbet mengungkapkan, IPK berupaya independen dan mandiri dalam melaksanakan tugas keorganisasiannya. IPK Hatonduhan tidak akan terpengaruh oleh individu atau partai lain. “Ke depan, saya berharap OKP ini tidak dikait-kaitkan dengan ormas atau preman yang mengedepankan kekerasaan,” ungkapnya. Sebelum mengakhiri keterangannya, Herbet sempat mengucapkan bahwa dalam waktu dekat, pihaknya akan melakukan turnamen bola volley antar pelajar se Hatonduhan. Sementara Camat Hatonduhan Daniel Silalahi MSi melalui Kasipem Rikkot Damanik SH kepada METRO mengatakan, peran organisasi kemasyarakatan (ormas) sangat diperlukan untuk membantu

pemerintah dalam kegiatan pembangunan. Semua itu demi mencapai tujuan nasional dalam wadah Negara Kesatuan Republik Indonesia (NKRI) yang berdasarkan Pancasila dan Undang-undang Dasar 1945. “Ormas sudah ada sebelum kemerdekaan. Jadi fungsi ormas adalah, sebagai wadah penyalur kegiatan sesuai kepentingan anggota, serta selaku pembina dan pengembangan anggota,” terang Rikkot Damanik. Selain itu, Ormas juga berperan serta dalam usaha menyukseskan pembangunan nasional, sarana penyalur aspirasi anggota, dan sarana komunikasi sosial terhadap anggota, terhadap sesama ormas, dan dengan organisasi sosial politik, pemerintah. Rikkot menambahkan, ia berharap IPK Hatonduhan turut mewujudkan pembangunan ekonomi dan inventasi di Hatonduhan agar menjadi lebih baik. “Kami menyambut baik kegiatan IPK

Sensasi Goyang Siantar





** Menyuguhkan lagu-lagu Dangdut dan Daerah **

On-Air : 05.30 - 18.00 : Lagu Dangdut & India On-Air : 18.00 - 24.00 : Lagu Daerah

Kantor & Studio : Jl. A Yani No. 2-4 Pematangsiantar Sumut Telp Kantor : 0622 - 75 500 55 Fax: 7550968 Telp Studio : 0622 - 7551799; SMS 0821 6356 3000

Website : Email :

Hatonduhan ini, mudah-mudahan IPK bisa menjadi contoh bagi organisasi-organisasi kepemudaan yang ada di bumi Hatonduhan. Kami juga mengharapkan peran serta organisasi kepemudaan untuk bisa membantu mendorong program pemerintahan menjadi lebih baik dari sebelumnya,” ungkap Rikkot. Tak hanya IPK, seluruh elemen masyarakat maupun organisasi-organisasi lainnya, ia mengungkapkan harapannya untuk bisa bersama-sama mensukseskan program pembangunan Hatonduhan ke arah yang lebih baik. Sebab tanpa ada peran masyarakat, tentu program pembangunan tidak bisa berjalan sesuai yang diharapkan. “Mari kita atasi permasalahan yang ada di Hatonduhan secara bersama-sama, namun tidak menimbulkan masalah baru,” tukas Rikkot mengakhiri sambutanya. (iwa)

Tiba-tiba pengusaha CV Teknik itu datang dan marah-marah kepada sejumlah ketua RT dan puluhan warga. dia mengaku keberatan karena pembakaran tanaman liar itu. “Asapnya mengganggu kerja kami di dalam,” bentaknya. Malah pria keturunan Tionghoa ini semakin menjadi-jadi dengan menuding para ketua RT dan warga ingin sejumlah uang darinya. “Kalian mau uang ya? Mau berapa uang sama kalian,” ujarnya dengan nada meninggi. Tudingan ini pun membuat emosi sejumlah ketua RT dan warga. Ketua RT 7 B Silaban tampak marah atas ucapan pengusaha yang dikenal arogan ini. “Kami sudah melakukan tugas dengan benar. Sudah saya jumpai ke depan tadi, anda tidak ada. Pintu belakang rumah anda pun tak ada. Lagipula ini sudah kotor sekali dan harus dibersihkan. Kau jangan sepele ya, kami tak butuh uangmu. Kami juga punya banyak uang,” balas B Silaban hingga perdebatan semakin panjang. (mag-07)

Layak Mendapat... sambungan halaman 9 panitia perlu menghidupkan kegiatan kembali pada 2013 mendatang. Sehingga diharapkan, semangat olahraga yang sempat tumbuh di jiwa masyarakat tidak patah begitu saja,” ungkap Sendi. Sendi menjelaskan, antusias masyarakat itu bisa dilihat dari ramainya lapangan saat pertandingan digelar. Selain itu banyak tim-tim lain yang minta diundang pada turnamen mendatang. “Puluhan tim yang mengikuti pertandingan mampu merebut perhatian masyarakat dari berbagai penjuru. Sehingga terkadang secara tidak sengaja, bisa mengganggu arus lalulintas. Itu karena penonton tumpah ruah sampai ke jalan raya,” katanya. Selain itu, sebagai bukti bahwa kegiatan ini menghidupkan olahraga di masyarakat, sejak kegiatan direncanakan hingga saat ini, hampir semua lapangan di daerah itu disibukkan dengan kegiatan sepakbola sore. Padahal sebelumnya kegiatan seperti itu hampir tak pernah kita lihat selama bertahun-tahun. Untuk itu, Sendi berharap penuh kepada Pemkab Simalungun melalui instansi terkait, agar bersedia menampung dana kegiatan Purba Hinalang Cup ke IX pada 2013 mendatang di APBD Simalungun. “Kami juga berharap hal ini menjadi perhatian para anggota DPRD Simalungun, khususnya yang berasal dari dapem V. Ini olahraga masyarakat dan merupakan aspirasi masyarakat. Jadi kami mohon dukungan para anggota dewan,” katanya (SP)

130 Hektare... sambungan halaman 9 Sampang seluas 10 hektare. Ketua kelompok Tani Perikanan Sondang Purba mengatakan, dulunya sawah-sawah itu difungsikan masyarakat sekitar sebagai kolam ikan, baik ikan mas, maupun ikan nila. Namun karena saat itu harga ikan tidak begitu memuaskan, masyarakat meninggalkannya dan akhirnya sawah telantar. “Banyak lintah dan pacat di sawah ini, sehingga masyarakat takut untuk mengelolanya,” kata Sondang. Hal senada disampaikan Jon Roy Marsen Purba. Dia mengatakan, masyarakat sempat berpikir bahwa mengelola sawah terbilang sia sia. Meskipun berguna, untungnya jauh lebih menjanjikan saat mereka mengelola ladang. Akhirnya masyarakat meninggalkan sawahsawah itu. Padahal jika ditinjau dari keberadaan Haranggaol sebagai sentra yang menghasilkan ribuan ekor bibit ikan nila dan mas, maka Purba Sipinggan sangat berpotensi dijadikan penghasil bibit ikan untuk Haranggaol dan sekitarnya. (SP)



21 November 2012

Peringati 1 Muharam 1434

Ribuan Siswa Pawai Taaruf TANAH JAWA-Dalam rangka memperingati 1 Muharam 1434 Hijriyah, ribuan pelajar dari sekolah umum dan Depag se-Tanah Jawa mengikuti pawai taaruf. Peserta pawai dilepas Kepala UPTD Disdik Tanah Jawa Rosmidar Lubis SPdI di lapangan Sepak Bola PTPN IV Balimbingan, Tanah Jawa, Simalungun, Kamis (15/ 11).

Kepala UPTD Disdik Tanah Jawa Rosmidar Lubis SPdI mengatakan, peserta dalam kegiatan itu sekitar 3.500 orang, terdiri dari siswa PAUD, SD,SMP/MTsN, SMA, dan SMK dan guru se-Kecamatan Tanah Jawa. Kegiatan digelar sebagai upaya Disdik untuk mengingatkan, dan menghayati serta mengamalkan sejarah dari nilai-nilai satu Muharam yakni hijrahnya Nabi Muhammad SAW dari Mekah ke Madinah. “Selain perayan sebagai hari besar Islam, ini juga sebagai upaya pelesatrian sejarah Islam, dimana satu Muharam ini adalah sejarah Nabi Muhammad yang hijrah dari Mekah ke Madinah sebagai upaya Syiar Islam,” ungkap Rosmidar Lubis. Ditempat terpisah, Ka MTs Negeri Tanah Jawa Dra Faizah Nasution menambahkan, momen ini diharapkan mampu meningkatkan perbaikan akhlak siswa di Tanah Jawa.”Kita ingin siswa tidak hanya cerdas dan pintar, tapi juga mempunyai akhlak mulia,” tuturnya. Faizah Nasution berpandangan, momen 1 Muharram sudah seharusnya dimanfaatkan umat muslim untuk melakukan evaluasi selama setahun terakhir. Tujuannya agar umat, utamanya siswa sekolah, mengetahui hal-hal apa saja yang mesti diperbaiki pada tahun baru agar ke depan lebih baik lagi. Dengan acara ini, dia juga berharap para siswa yang sebagian besar beragama Islam dapat mengenal lebih dalam apa makna 1 Muharam yang sebenarnya. Dengan begitu, siswa tidak ikut terbuai memeriahkan tahun baru yang kerap dirayakan masyarakat dengan cara yang kurang bermanfaat. “Selama ini, anak-anak tahunya hanya tahun baru 1 Januari. Makanya, semarak 1 Muharam kita adakan setiap tahunya, agar mereka mengetahui Tahun Baru Islam,” ujarnya. Pawai taaruf sepanjang 3 km mulai star dari lapangan Sepak Bola PTPN IV Balimbingan, Kecamatan Tanah Jawa, Simalungun, dan finis di Madrasah Tsanawiyah Negeri (MTsN) simpang Nagojor. Kegiatan ini diisi acara doa bersama, dan diiringi marching band dari SMPN I. (iwa)

„ BlackBerry Bold.

Pengguna XL “Masih Setia” dengan BlackBerry

(foto : IRWANSYAH)

MELEPASKAN-Kepala UPTD Disdik Tanah Jawa Rosmidar Lubis SPdI melepaskan peserta pawai taaruf di lapangan PTPN IV Balimbingan, Tanah Jawa, Kamis (15/11) siang.

IPK Hatonduhan Akan Gelar Turnamen Bola Voli Antar Pelajar HATONDUHAN-Mempererat hubungan silaturahmi antar pelajar, Ikatan Pemuda Karya (IPK) Simalungun akan menggelar Turnamen Bola Voli antar pelajar Sekolah Dasar se-Kecamatan Hatonduhan. Ketua IPK Honduhan Herbet Sinaga kepada METRO, Selasa (20/11) mengatakan, pesiapan untuk Turnamen Bola Voli sudah valid, baik perlengkapan olahraga dan atlet. “Hanya saja tinggal menunggu momen saja,” tegasnya. Menurut Herbet Sinaga, kegiatan ini bertujuan untuk mengangkat frekuensi turnamen yang selama ini minim di Hatonduhan. Padahal, katanya, olahraga merupakan alat mempersatukan pelajar, dan mencari bibit yang berprestasi bidang olahraga voli. “Dengan adanya kegiatan ini, hobi dan bakat para remaja tersalur, serta terhindar dari kenakalan remaja, minuman keras(miras)dannarkoba,”katanyadengan penuh harapan.

(foto : IRWANSYAH).

FOTO BERSAMA-Pengurus IPK Kecamatan Hatonduhan foto bersama setelah memberikan keterangan pers. Herbet Sinaga menambahkan, Hatonduhan merupakan gudangnya atletatletolahraga.Namunmimimnyafrekuensi pertandingan sehingga prestasi para atlet

Berhadiah langsung


menjadi tenggelam. “Dalam hal ini, IPK Kecamatan Hatonduhan merasa peduli membangkitkan kembali prestasi olahraga voli ini,” ujarnya mengakhiri. (iwa)

JAKARTA-Mayoritaspelanggan smartphone PT XL Axiata Tbk (XL) masih menggunakan perangkat besutanResearchInMotion(RIM), BlackBerry. Meski begitu, perusahaan penyedia layanan telekomunikasimelihatpertumbuhan perangkat yang berbasis Android cukup signifikan di Indonesia. Direktur Marketing XL Joy WahyudisaatmeluncurkanXLRumahnya Android di FX Senayan, Jakarta, Selasa (20/11) memaparkan bahwa dari keseluruhan pelanggan XL yang mencapai 42,3 juta pada kuartal tiga 2012, sekira 6 juta atau 14 hingga 15 persen diantaranyatelahmenggunakansmartphone dan sisanya masih menggunakan feature phone. “PenggunaBlackBerrydiXLada 2,8 juta, sedangkan Android baru 800 ribu. Tapi kami perkirakan pengguna smartphone Android akan tumbuh,” ungkapnya. Joy melihat, smartphone berbasis Android yang disokong oleh sejumlah vendor lokal maupun internasional membuat perangkat tersebut diperkirakan tumbuh pesat. Oleh sebab itu, untuk memberikan layanan yang mumpuni bagi pengguna Android maupun calon pengguna Android, XL meluncurkanprogram“XLRumahAndroid” berkolaborasi dengan Google. Selain menggandeng perusahaan teknologi asal California itu, XL juga mnggandeng komunitas Android, dengan begitu, perusahaan berharap dapat meningkatkan pelanggan baru dengan starterpack “XmartPlan Android”.

Kali ini, XL bukan hanya menjual produk bagi para pengguna Android. Perusahaan juga membuat sejumlah layanan yang diklaim dapat memberikan manfaat lebih bagi para pengguna smartphone “Robot Hijau”. Joymenambahkan,XLpunmemastikan bahwa pengguna perangkat Android dapat menikmati sejumlah aplikasi dan layanan Android yang langsung tersedia di telefon genggam mereka. Di luar itu, XL juga membangun Android Corners di sejumlah tempat di Tanah Air. Melalui fasilitas itu para pelanggan dapat mencoba handset teranyar dari para mitra serta aplikasi anyar dari para developer. Selain itu, perusahaan juga mengembangkan aplikasi khusus, MyXL yang akan disematkan pada perangkat Android besutan mitra perusahaan. Aplikasi itu dapat digunakan untuk melihat kuota, membeli paket, dan mengukur kecepatan download dan upload. Tak cukup sampai di situ, guna membangun komunitas Android yang solid, perusahaan juga akan menggelar serangkaian kegiatan seperti workshop dan roadshow di beberapa kota besar dengan mengundang pakar dan pengembang aplikasi Android. Untukdiketahui,XmartPlanAndroid yang dikhususkan untuk perangkat Android dapat dinikmati dengan merogoh kocek Rp49 ribu. Dengan program ini, Anda akan memperolehkuotadata3GBselama 90 hari, termasuk gratis 200 menit telefondangratis200SMS.(oz/nik)

HARAPAN SURYA KAVLING Kec. Tapian Dolok Kel. Sinaksak

Bagi 10 orang Pembeli pertama


Café Bebek Jl. Sudirman No. 29 P. Siantar


Telp. 0622 - 430303 HP 0812 6351 4716 0813 7606 1300

Harga 19-26 juta sudah termasuk SHM

Kavling Simpang Dua

Peta Situasi Lokasi

Lokasi: Gurgur Simpang Dua Pematangsiantar Hanya 700 M dari Timbangan Simpang Dua Fasilitas: • Harga termasuk biaya Sertifikat Hak Milik (SHM) • Jalan lebar 6 M di Onderlag

Kantor Pemasaran:

Jl. Diponegoro No. 25 P. Siantar


Jl. Seribu Dolok No. 206 P. Siantar • Arman Pasaribu SE HP 0813 6138 4712 • Bonggas Sibarani HP 0852 9764 6662 • Friska Silitonga HP 0821 6123 6469 • Rudi A Nainggolan AMd HP 0821 6615 1867


RABU 21 November 2012


L ife

12 Siantar Plaza Lt. 2 Samping Eskalator

ong Ponsel

Perdana Xl Blackberry

Full Service 3 bulan unlimited.. HARGA

Rp 90 rb

stok terbatas!!! buruan...

Nokia 1280 Rp. 190.000

Nokia X1-01 Rp. 380.000 + MMC 2 Gb

Nokia X2-02 Rp. 700.000 + MMC 2 Gb

Nokia C1-01 Rp. 485.000 + MMC 2 Gb

Nokia C2-03 Rp. 820.000 + MMC 2 Gb

Nokia X2-01 Rp. 685.000 + MMC 2 Gb

Nokia N100 Rp. 240.000

Nokia X2.00 Rp. 890.000 + MMC 2 Gb

Nokia N101 Rp. 320.000 + MMC 2 Gb

i ans l r a G na io Nas 2 GB MC na + M erda +P

PROMO !!!!

“Beruntung Beli Laptop ACER” DAPATKAN “1 buah lucky dip” (Gimmic ACER) untuk Setiap Pembelian Laptop ACER Garansi RESMI ACER Indonesia +++ DAPATKAN KALENDER 2013 !!! (Untuk setiap pembelian Laptop Merek apa saja)

NB : Selama Persediaan msh ada

Hanya di

ART COM Smart Computer

LOWONGAN KERJA Daerah operasional : Tobasa, Taput, Humbahas, Sibolga dan Tapteng. Dibutuhkan beberapa orang untuk ditempatkan pada posisi : 4. SPG 1. Sales 5. Admin 2. Merchandiser 3. Sales Representative Persyaratan : 1. Pria (1, 2, 3, 4, 5) wanita (3, 4, 5) 2. Berorientasi target (1, 2, 3, 4) 3. Pendidikan minimal SMA sederajat (1, 2, 4, 5 ) D3 (3) 4. Usia max 30 tahun (1, 2, 3, 4, 5) 5. Memiliki sepeda motor (1, 2, 3) 6. Memiliki SIM C (1, 2, 3) 7. Bersedia menjalani masa training (1, 2, 3, 4, 5) 8. Jujur dan bertanggung jawab (1, 2, 3, 4, 5) 9. Berpenampilan menarik (3, 4) 10. Menguasai Ms. Office dan Internet (3, 5 )

Jln. Merdeka No 80 ( 0622-7072808 Fax.0622-7346080 E_mail :


Yudea Jaket

Jl. Sibolga No. 12 depan SMPN 12 Pematangsiantar. HP 0852 7648 0231


Berlaku selamanya

“WESLY TOUR & TRAVEL” Melayani Penjualan Tiket Pesawat dan Tiket Kapal Laut

Menerima Pesanan:

LOWONGAN KERJA PT. Prudential Agency membuka lowongan kerja untuk menjadi Agen Asuransi Prudential. Tidak terikat waktu (Free Lance), dan hanya bagi orang yang ingin sukses dan ingin berpenghasilan uang besar. Dengan syarat: • Pria/Wanita usia 20 - 45 thn, punya KTP dan masih berlaku. • Mempunyai relasi yang luas • Bersedia mengikuti ujianAAJI, Anda akan mendapatkan: • Komisi selama 5 thn per nasabah • Bonus Tambahan Rp.1 juta • Jalan jalan Gratis kedalam/Luar negeri • Jenjang karir yang bergengsi

Segera hub. 0812

6354 0888

Prudential Manager

Harga mulai

400 rb



INFORMAN & AGENS G R AT I S • Jasa penagihan utang piutang sampai tuntas dan dapat orangnya • Pelacakan / pencarian mobil, sepeda motor, orang lari/hilang • Detiksi keberadaan orang lain dari nomor HP, Pin BB, email dan karater tulisan • Investigasi pasangan selingkuh • Menjual alat-alat GPRS, CCTV, rekam kamera pcasil, sadap kamera intai • Jasa pelunasan utang di Bank / Blacklist dan mempercepat pinjaman dan mudah cair • Jual beli rumah, mobil, sepeda motor, warnet, over kredit Hubungi:

0896 9282 4096; 0812 6041 9170 Pin BB : 21D91174



Obat kuat terbaru saat ini paten, membuat ereksi lebih lama, tanpa efek samping isi 10 tablet tanpa bekas



Terobosan terbaru obat VIMAX menambah ukuran alat vitl secara permanent sekaligus menambah kejantanan pria, isi 30 capsule

PUSAT PELANGSING HERBAL PELANGSING SUPER CEPAT Cukup 1 pak Fatloss langsung terbukti turun berat badan 8 - 12 Kg dalam jangka 1 Minggu, 100& alami dan tanpa efek samping, dijamin CREAM PYDR + VACUUM 100% original import 1 kali pakar langsung terbukti besar, kencang, padat dan mengembalikan payudara, baik gadis atau ibu-ibu dijamin PENINGGI BADAN SUPER


Spontan kuat keras dan tahan lama 3 X lebih kuat dari obat kuat lainnya, aman di konsumsi tanpa efek samping


Sekali semprot ampuh Capsul USAtelah dan terbukti meninggikan tambah gairah seks pria badan dengan cepat, memperkuat daya ingat, 1-2 minggu bertambah tinggi 5 - 8 CM tanah lama, tanpa pasti (semua umur) menimbulkan rasa kebas, panas, aman dan tanpa TERSEDIA: •Gemuk Badan •Obat Jerawat •Pemerah Bibir •Pembesar Pantat •Sedia aneka kondom antik r efek samping ta

An IS !Melayani pesanan luar kota AT Via Transfer - Paket Kilat GR

ASEN HP 0852 7558 7299

Jl. Tanah Jawa No. 83 (depan ruko baru, Simp Jl Cokro) ) P. Siantar Jl. Cokro No. 349 Simp. Malik Kisaran Jl. Sirandorung NO, 63 Simp. Jl. Pardamean Rantau Prapat

8, 14 Jan 13 USD 2445 12 hr + hermon

2 Nov, USD 2450

12 Feb 13, USD 2370

3 Des USD 2450

18, 25 Feb, USD 2445 12 hr + hermon

20 Des, USD 3100, 12 hr petra

4 Mar 13, USD 2445, 12 hr + hermon

21 Des 2850 ghr

11 Mar 13, USD 2370


Jl. Kesatria No. 18 BDB Simp. Lor. 21 P. Siantar. Telp./Fax: 0622 - 7552525; 0813 7007 5873; 0813 6200 9333


Mercy C Class Mercy E Class Fortuner TRD

14 Nov USD 2600, 12 hr petra

8, 21 Jan 13 USD 2295




Paket Holyland : Ziarah Tour 11 Hari

Papan bunga ukuran kecil & jumbo Harga terjangkau


Untuk kesembuhan penyakit • Ambeian • Kolestorel • Asam Lambung • Asam Urat • Ginjal • Gula • dll Buka : Jam 09.30 - 21.00 WIB

Beli 5 jaket dan rompi

Jl. Sibolga No. 29 P. Siantar Telp. 0622 - 22484; HP 0811 6200 011


Melayani pengobatan

Full Body Refleksi Khaki Terapi Lilin Kop / Bekam



PIN BB 295597B6

Jl. Cipto No. 22 di Wisma Pangkas Lt. 2 P. Siantar. HP 0852 7695 4557 0813 6071 0199

h erianda ceria A ah M r u M ti a pas Harg

Informasi lebih lanjut hub. Bpk. Siswandi Hp 0819 880 881

dan kebutuhan sex P/W dewasa

SinShe Aciu / Aling

Menjual berbagai:


Telah tercecer dompet warna hitam An. Syafruddin Yusuf yang berisikan ATM, SIM, STNK sepeda motor. Tercecer antara Jl. Rakuta Sembiring - Jl. Ahmad Yani - Jl. sangnawaluh. Bagi yang menemukan harap mengembalikan. HUBUNGI HP 081260623215 Tidak akan dituntut tapi di beri hadiah yang sepantasnya.

Peter Refleksi

Terima laptop seCOND Komputer Warnet BB Qwerty

P. Siantar & Simalaungun

DI JEMPUT HP 0852 7551 8062

Hub: Bp. ARI

Telp. 061 - 77064774; HP 0813 7729 4474


21 November 2012

Gagal menikah dengan aktor muda Iko Uwais tak membuat Jane Shalimar larut dalam nestapa. Ia malah mendapatkan calon suami bukan sembarangan orang. Jane Shalimar segera naik pelaminan pertengahan Desember 2012. Ibu satu anak ini kabarnya akan disunting oleh Mahardika Soekarno Putra atau Didi, anak Rachmawati Sukarno Putri. Pasangan ini juga akan menggelar prosesi lamaran.

“Lamarannya mungkin akhir bulan ini (November),” ujar Anto, asisten Didi melalui sambungan telepon, Selasa (20/ 11). Namun Anto enggan menjelaskan lebih jauh soal tanggal serta tempat lamaran itu. Yang pasti, Jane sudah mulai mencari model kebaya di sebuah butik milik desainer ternama. ”Belum fitting tapi masih caricari (model) aja. Saya ikut nemenin Jane juga kok. Jadi memang belum fitting,” jelas Anto. Sebagai asisten, Anto juga

tak tahu sejak kapan keduanya berkenalan dan resmi berpacaran. Rencana pernikahan itu dibenarkan Sunan Kalijaga, pengacara yang juga sahabat dekat Didi. Ia mengaku sudah mendapat kabar bahagia itu langsung dari yang bersangkutan. “Sebagai sahabat Didi dan Jane, saya menyambut positif kabar bahagia itu,” kata Sunan, Selasa (20/11). Menurut Sunan, rencana pernikahan mereka itu masih dibahas oleh keluarga masing-

Kegemarannya membaca dan profesinya sebagai penulis membuat Dewi Lestari menjadi kolektor buku. Namun, buku simpanannya seolah menjajahnya. Banyak ruangan habis karena bukunya yang jumlahnya sudah sangat banyak. “Buku menjadi bagian dunia pustaka, tapi lamalama saya dijajah sama buku. Perpustakaan saya menghabiskan space dari ruangan manapun,” ujar Dee, sapaan akrabnya di Jakarta. Maklum, sebagai seorang penulis, Dewi Lestari sangat gemar

ORANGTUA khawatir Gisel ‘Idol’ dilamar Gading Marten. Mengapa? ”Orangtuaku malah khawatir, aku kan, anak tunggal dan perempuan. Masih umur segini (21 tahun), dianggap masih kecil, jadi kekhawatiran banyak. Mereka kasih izin sih, tapi kasih wejangan banyak banget, selalu diingetin,” ungkapnya di Kebon Jeruk, Jakarta Barat, Selasa (20/11). Namun, bukan berarti Gisel tak boleh menikah dengan Gading. Malahan, kedua orangtuanya ingin Gisel mandiri bersama Gading. ”Malah mama yang ngomong, dari dulu sebelum aku niat menikah. ‘Mama mending tinggal sendiri, pusing lihat kamu sama suami kamu’, ” kata Giselle menirukan ucapan mamanya. Sengaja Bikin Gading Cemburu Ingin diperhatikan, Gisel ‘Idol’ sengaja membuat Gading Marten cemburu. ”Dia (Gading) susah cemburunya, kadang aku pancingpancing biar dia cemburu,” ujar Gisel di RCTI, Kebon Jeruk, Jakarta Barat, Selasa (20/11). ”Aku senang kalau dia cemburu. Habis aku cemburuan dia nggak pernah cemburu,” imbuhnya. Namun, karena seprofesi, Gisel tak pernah marah karena cemburu berlebihan. (idc/int)

Paramitha Rusady akhirnya resmi bercerai dengan suaminya Nenad Bago. Setelah berbulan-bulan menjalani proses persidangan di Pengadilan Agama Jakarta Selatan, Mitha dan Nenad Bago diputus cerai oleh hakim. “Hari ini agendanya keputusan. Permohonan talak dikabulkan,” kata kuasa hukum Nenad Bago, Anthony Alexander SH saat

masing. Lewat akun twitternya, Jane sempat mencetuskan tanggal pernikahannya dengan Didi, yaitu 12-12-2012. Wah, tanggal cantik dong? Mantan kekasih Iko Uwais ini sudah memesan kebaya pengantin dari desainer Anne Avantie. Dari pernikahan sebelumnya, Jane dikaruniai satu anak bernama Muhammad Zarno. (tr/int)

membaca buku. Ia rutin mengumpulkan buku yang ia baca sejak kuliah. Setahun belakangan, ia mulai tertarik dengan buku digital. Dan suaminya, Reza Gunawan, lah yang berjasa menginisiasi Dee. Bahkan ia sering membeli buku digital, jika tak ada buku yang ia maksud, barulah membeli buku konvensional. Sekarang, ia telah merasakan manfaat membaca buku digital. Ia tak “dijajah” oleh koleksi bukunya. Mau tak mau, penulis pun akan memasuki sebuah transisi. Dari buku konvensional ke teknologi buku digital. Penulis Supernova dan Madre ini mengatakan bahwa tiga tahun silam, dirinya belum melirik buku digital. Dengan membeli, lalu membaca buku konvensional, ia merasa ada kenyamanan dan romantisme tersendiri.

dijumpai di Pengadilan Agama Jakarta Selatan, Selasa (20/11). Selain bercerai, ketua majelis hakim sudah mengabulkan beberapa keputusan yang sempat diajukan oleh kedua belah pihak. “Kesepakatan lain dikabulkan juga. Kita diminta untuk melakukan sesuai kesepakatan. Perjanjian untuk anak, nafkah, dan hak asuh,” jelas Anthony. (nov/int)

Zaskia Sungkar

Ketagihan Jalan di Catwalk SETELAH menikah pada 29 September, pasangan Hollywood Anne Hathaway dan Adam Shulman ingin segera membangun sebuah keluarga. Anne pun berharap dirinya bisa hamil secepatnya. ”Aku ingin sekali punya bayi,” ujarnya seperti dilansir The Hollywood Reporter, Selasa (20/11). Bintang film ‘The Dark Knight Rises’ itu memang cukup lama memendam impiannya menjadi seorang ibu. Salah satu temannya mengungkapkan, Anne adalah perempuan tradisional. Ia hanya mau punya anak setelah resmi menikah. Anne dan Adam menikah setelah empat tahun berpacaran. Anne berhubungan dengan Adam setelah putus dari kekasih lamanya, Raffaello Follieri pada 2008 lalu. Mereka menggelar pernikahan secara tertutup di Big Sur, California. Kabarnya hanya ratusan orang saja yang menghadiri acara tersebut. (dtc/int)

BERLENGGAK lenggok di atas catwalk bukan hal baru bagi Zaskia Sungkar. Tak heran, ketika diajak untuk memamerkan busana rancangan istri Indra Bekti, Adila Jelita, Zaskia tak bisa menolaknya. ”Ini bukan yang pertama aku jalan di catwalk. Kemarin sempat ikutan di Jakarta Fashion Show, itu baru pertama di event besar,” ujar Zaskia saat ditemui di acara fashion show, Indra Indri & Dilla Albis, Plaza FX,

Jakarta, Selasa (20/11). Zaskia ketagihan saat menjajal catwalk di event besar JFW. “Pas ngerasain di JFW kemarin jadi ketagihan, enak juga, seru ternyata jalan di catwalk, deg-degan soalnya,” ujarnya malu-malu. Diungkapkan Zaskia, ia nyaris tak bisa menahan tawa saat tampil bersama Nycta Gina dalam fashion show kali ini. “Aku menahan ketawa, habis ada Gina, kocak, tapi seru sih,” tawanya. (nov/int)



21 Nopember 2012

Pemain Bulutangkis Indonesia


Dari empat wakil Indonesia di tiga nomor yang mesti melalui babak kualifikasi Hong Kong Open, dua tiket sudah digenggam Belaetrix Manuputty dan Andre Kurniawan Tedjono. Sementara satu tiket yang melayang gagal disabet duet ganda campuran.

Pasangan ganda campuran Alvent Yulianto Chandra/Rizki Amelia Pradipta,

sudah lebih dulu gugur di fase perdana babak kualifikasi. Keduanya tumbang dari duet China, Qiu Zihan/Luo Yu setelah dinyatakan

Maria Sharapova

Simpan Hasrat Jadi Bintang Film DENGAN usianya baru 25 tahun, Maria Sharapova memiliki banyak keinginan untuk dilakukan. Petenis rangking dua dunia itu mengungkapkan keinginannya untuk membintangi film Hollywood pada suatu saat nanti. Dengan parasnya yang cantik, keinginan itu bisa saja terwujud. Apalagi, Sharapova sudah cukup terbiasa dengan akting saat ia didapuk sebagai model beberapa produk, termasuk model baju renang di sebuah majalah olahraga terkemuka beberapa tahun lalu. “Untuk sekarang, terlalu banyak yang terjadi dalam hidupku. Aku terikat dengan pertandinganpertandinganku, brand associations dan beberapa komitmen lainnya,” kata Sharapova saat berada di New Delhi untuk menghadiri acara sebuah perusahaan real estate di mana ia jadi brand ambassador-nya. “Tapi suatu hari, jika diberi kesempatan aku sangatinginberaktingdisebuahfilmHollywood,ungkap dia seperti yang dilansir Larry Brown Sports. Selain beraksi di lapangan tenis, Sharapova juga menjadi model sejumlah ambassador sejumlah brand ternama di dunia. Belum lama ini, petenis ranking dua dunia itu memasarkan produk permen premium “Sugarpova”. Sharapova juga mengomentari rivalitasnya dengan Serena Williams. Sepanjang sejarah keduanya sudah bertemu 12 kali namun Sharapova hanya bisa menang dua kali saja melawan ratu tenis Amerika Serikat itu.(int)

YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 /bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari YAYASAN MAHAGA SEJAHTERA: membutuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515 1742 CV SENTOSA ABADI: Perusahaan baru yang sedang berkembang membutuhkan banyak karyawan/ti usia max. 24 tahun, untuk posisi Staf Gudang Administrasi, SPV, Distributor, OB/OG dan Deff Colector (1 800.000,- s.d 3.000.000,) lamaran diantar ke: Jl. Medan KM 6 No. 58 (+ 5 M sebelum Simp. HKBP) P. Siantar LOWONGAN KERJA (Laptop 88): • ADM min. D3 • Marketing SMA • Teknisi (dapat mengoperasikan komputer.) Antarkan langsung lamaran anda ke TOKO LAPTOP 88. Jl. Kartini. Hub 0878 9238 8901 LOWONGAN KERJA: Dibutuhkan Asisten Salon yang sudah berpengalaman, Tamatan SMA/Sederajat. Usia 18-30 tahun. Bagi yang memenuhi kriteria Hubungi kami di KIMS SALON, Jl. Sutomo No. 142. Telp: 0812 6438 658 (Tidak melayani SMS)

ASTRA DAIHATSU Promo Akhir Tahun • Daihatsu Paket Ringan • Gran Max Pick Up Dp. 11Jtan angs 2Jtan • Xenia Dp. 27Jtan angs 3Jtan • Terios Dp. 24Jtan angs 4Jtan Proses cepat, dan pasti oke + hadiah menarik Rudi Astra, 0813 9611 6389


• All New Xenia Ready stok • Terios Ready stok • Luxio Dp 15%(hadiah menarik) • Sirion Dp 15 % • Pick up Dp 15 % • Mini Bus Dp 15 % hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Proses cepat data dijemput. Menyediakan TEST DRIVE!!

DIJUAL: Super kijang grand kencana biru metalic, tahun 93 akhir, PS, pasboart sedan, semi PW, AC, atas bawah, BK asli Medan, siap pakai, harga 46 jt. Mobil Jl. Asahan Hub. 0812 6424 2115 DIJUAL: Daihatsu Terios, tahun 2007, warna hitam, ban 4 baru, harga 148 jt, nego, hub. HP 0831 9658 0886 TOYOTA 100% BARU : Dealer Resmi Ready Stock : All New Avanza, Vioz, Innova, Yaris, Fortuner, Dyna. Dapatkan Diskon Special + Hadiah langsung (Kaca Film, Car Wash & Alas Dasar). Proses cepat, angsuran ringan, dan data siap dijemput Hub: WENDY, HP 0813 7554 4990


kalah WO alias Walk-Over. Tetapi harapan masih ada di pundak Belaetrix di nomor tunggal putri serta Andre, yang tampil di tunggal putra. Sebelumnya pagi tadi, baik Belaetrix maupun Andre, sukses melewati babak pertama kualifikasi atas lawannya masing-masing. Belaetrix menang straight set, 21-18 dan 2118, atas pebulutangkis tuan rumah, Cheung Ngan Yi. Sementara Andre juga menang lewat dua set langsung, 21-13 dan 21-9, dari wakil Rusia, Ivan Sozonov. Babak kedua pun mesti dimainkan

Heboh Tulisan Allah di Kepala CR7

Di tengah ramai pemberitaan cedera pelipis Cristiano Ronaldo saat menghadapi Levante, ada kisah lain yang tak kalah heboh. Itu terkait dengan pola rambut CR7 yang terlihat membentuk tulisan Allah. Pelipis kiri Ronaldo mengeluarkan darah segar saat Real Madrid bertamu ke Levante dalam lanjutan Liga Spanyol, Senin (12/11) dinihari


• Carry Pick Up 1.5 L Dp. 10Jtan atau Ang 2Jtan • Carry Extra Mega Pick Up 1,5 L Dp. 20Jtan atau Ang 2Jtan • APV Arena 1.5 L Dp. 30Jtan atau Ang 3Jtan • Ertiga 1.4 L New Dp. 40Jtan atau Ang 3Jtan • X Over 1.5 L Dp. 50Jtan atau Ang 3Jtan Data lengkap 2 hari mobil keluar, setelah survey PT Trans Sumatera Agung, Dealer Resmi SuzukiHub: Edwardo Manik, 0813 7583 8337



"PROMO PAKET DAHSYAT MOBIL SUZUKI BARU BULAN OKTOBER • Carry Pick Up Dp. 8Jtan Ang. 2Jtan • APV Dp. 20Jtan Ang. 3Jtan • Ertiga (ready stock) Dp. 35Jtan Ang. 3Jtan Proses cepat, mudah dan data dijemput. Dijamin Ok Hub: Indra 0821 6278 7179; 061-7715 4060 Dealer Resmi Suzuki Adam Malik Medan

PROMO SPEKT AKULER TOYOT A SPEKTAKULER TOYOTA • All New Avanza ..Ready, Bonus Lengkap ! • All New Avanza VELOZ ...Bonus Lengkap !! • New Rush ..... Ready!! • Grand New Innova ...Ready!! • Grand New Fortuner VNTurbo ... Ready!! • Menangkan Lexus GS250, New Yaris, New iPad, Samsung Galaxy S III, dan hadiah lainnya. Hub : RICKY. M / Hp: 0812 6505 3191 – 0853 7199 9499 SALES EXECUTIVE TOYOTA SIANTAR. Data dijemput, Cash & Credit PROSES CEPAT..!!


- Carry pick up Ang 2.425/48x menjadi 2,4 Jt/ 48x - AVP Mega carry Ang 2.532/48x menjadi 2,5 Jt/48x - Ertiga Ang 3.919/48x menjadi 3.9 Jt/48x - APV ARENA Angs 4.567/35x menjadi 4.5 Jt/35x Proses Cepat Data di Jemput HUB ; ARNOLD SINAGA 085261263339 / 08126036424 PIN BB 29E6E49D DIJUAL: Kijang rover tahun 90, warna merah metalik, mesin ok, AC dingin, tape USB, 6 speed, velg racing, pajak panjang bulan Juli 2013, plat Sibolga, lokasi mobil di Siantar, harga net 40 jt, hub. HP 0813 1096 1048 PROMO KIA 2012 100% BARU * All New PICANTO. Dp: 28 Jt’an Atau Angs: 2 Jt’an (ECO ON Mesin Dual CVVT) * All New RIO Dp: 37 Jt’an Atau Angs: 2 Jt’an (Bluetooth Sensir parking+ Air Bag + Velg 15) *All New SPORTAGE Dp: 5 Jt’an Atau Angs :3 Jt’an *BIG-UP BOX Gratis Dp: 25% *PREGIO 12 Saet Cocok Untuk Travel / 2700 cc. Garansi 5 Tahun (PICANTO, RIO dan SPORTAGE) Garansi 2 Tahun (BIG-UP dan PREGIO) Hubungi: YONO Hp. 0813 7562 5407.

DAIHATSU PEMATANGSIANTAR 100% BARU!! All new xenia.............Dp 30jt-an angs 4 jt-an Terios.........................Dp 30jt-an angs 4 jt-an Luxio..........................Dp 20jt-an angs 4 jt-an Grandmax Mini Bus...DP2jt-an Angs 3jt-an Grandmax Pic Up.......Dp 12jt-an Angs 2jt-an Sirion..........................Dp 30jt-an Angs3 jt-an Terbaru.... Ayla sudah bisa pesan...!! Hub : AGUS HP: 085275194102 / 081375756462 DIJUAL: Kijang LSX 97, diesel, mobil pribadi, mulus, khusus pemakai. KIJANG pick up 2002, mulus dan original, warna hitam, khusus pemakai, hub. HP 0813 6101 3296 (No. SMS / TP)

WIB. Kepala CR7 berbeturan dengan sikut David Navarro dalam sebuah perebutan bola di udara, yang membuat pesepakbola asal Portugal itu mengalami masalah pengelihatan dan kemudian ditarik keluar. Saat mendapatkan perawatan di pinggir lapangan akibat cedera tersebut, salah satu kamera televisi menyorot Ronaldo dari arah belakang. Pada momen itulah terlihat tulisan Allah terbentuk akibat pola rambut Ronaldo. Video tersebut kemudian di-upload di Youtube dengan judul “Allah written in Arabic on Cristiano Ronaldo’s head?” dan mengundang banyak komentar. Ada yang meragukan keaslian potongan gambar tersebut dan menganggapnya sebagai hasil olah digital. Namun pada beberapa video lain yang menampilkan momen peristiwa yang sama, tulisan di kepala Ronaldo tersebut masih terlihat. Karena Ronaldo selama ini dikenal suka berganti-ganti gaya rambut, ada yang beranggapan lafaz Allah tersebut hanya kebetulan semata. Apalagi rambut Ronaldo ketika itu sudah tak lagi rapi di tengah pertandingan. Sementara yang lain menganggapnya dengan berbeda. Yang jelas, Ronaldo adalah salah satu pencetak gol kemenangan 2-1 El Real dalam laga itu. (int)

Jorge Lorenzo

Pertimbangkan Pensiun Setelah 2014 JORGE Lorenzo akan fokus membalap untuk Yamaha dalam kurun waktu dua tahun ke depan. Setelah itu, Lorenzo akan mempertimbangkan masa depannya di dunia MotoGP. Lorenzo baru saja sukses merebut gelar juara dunianya yang kedua pada tahun ini. Dia tampil sangat baik sepanjang musim, finis pertama atau kedua hampir di semua seri. Rider yang kini berusia 25 tahun itu cuma gagal di Assen dan Valencia karena mengalami kecelakaan. Lorenzo sebenarnya punya peluang untuk pindah ke Honda karena dia ditawari jadi pengganti Casey Stoner yang pensiun. Tapi, dia menolak dan memilih untuk meneken kontrak baru berdurasi dua tahun dengan Yamaha. “Saya akan membalap untuk dua tahun ke depan. Setelah itu, kita lihat saja,” tuturnya yang dikutip Autosport. “Saat masih 15 tahun, segalanya menyenangkan, tapi kemudian olahraga ini bisa jadi rutinitas,” kata Lorenzo. Selain itu, kecelakaan fatal yang dialami Marco Simoncelli tahun lalu juga jadi bahan pertimbangan Lorenzo sebelum memutuskan kelanjutan kiprah di ajang balap motor paling bergengsi ini. “Kematian Marco Simoncelli merupakan sebuah pukulan untuk kita semua, dan membuat kita berpikir bahwa itu bisa terjadi ke siapa saja. Tapi, kami tahu bahwa risiko adalah bagian dari olahraga,” ujarnya.(int)


• All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya Promo Akhir Tahun • Carry Pick Up 1.5 Dp. 10Jtan Angs 2Jtan • Ertiga GL Dp. 30Jtan Angs 3Jtan • APV Pick Up New Dp. 19Jtan Angs 3Jtan • APV Arena GL Dp. 25Jtan Angs 3Jtan Hub: 0852 7681 3610 Hendry Siahaan, PIN BB: 2A4CFC6E PT. Trans Sumatera Agung Jl. SM. Raja Medan AMplas

DP Angsuran • All N Xenia 24 jt 4.440.000 • Terios 24 jt 4.981.000 • Luxio 20 jt 4.902.000 • Pick up 11 jt 2.600.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0821 6308 7454. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio

Belaetrix dan Andre, beberapa jam setelah fase awal, atau tepatnya Petang ini. Belaetrix harus melewati rubber set, 6-21 21-16 dan 2118, dari wakil Jepang, Nozomi Okuhara. Adapun Andre yang dibabak kedua bersua Tanongsak Saensomboonsuk, juga dipaksa main tiga set sebelum menamatkan pebulutangkis Thailand itu dengan kemenangan, 19-21 21-10 dan 21-14. Dengan begitu, Belaetrix dan Andre dipastikan maju ke putaran final, menyusul sejumlah rekannya yang sudah otomatis masuk ke putaran final. (int)

• L300....................................................Ready Stock • Colt Diesel ..........................................Ready Stock • T120 SS .............................................Ready Stock • FUSO ................................................Ready Stock GEBYAR Pajero SUZUKI SIANTAR Sport • DP Angsuran .......................................Ready Stock •• Carry Pick Sport Up .................................Ready Dpt diatur Nego Outlander •Stock APV Arena Rp 2 jt Rp 3 jt •• Ertiga 5 jt Rp 3Mirage Jtan Berhadiah langsung tanpa diundi* Stock bagi ..............................................Ready pengunjung ke Bank Mandiri Siantar, Hub: SIMARMATA 0852Pusat 7775 P. 9705 hub. Prancis Sitohang HP 0812 6035 4787 GEBYAR ERTIGA SIANTAR Promo akhir tahun di Bank Mandiri Pusat P. Siantar, hanhanya hari ini DP Hanya Angsuran • Carry Pick Up Rp 2 jt an Rp 2 jt an • APV Arena Rp 2 jt an Rp 3 jt an • Ertiga Rp 5 jt an Rp 3 Jt an Hadiah langsung bagi yang hadir* Info: Ferdy HP 0852 7084 7017 DIJUAL: Sepeda motor sport bajaj fulsar is 135 cc, tahun 2010, warna merah, BK Siantar, pajak panjang, kondisi mulus, harga 7,5 jt, hub. HP 0821 2188 8872 (TP)

CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442.

DIKONTRAKKAN: 1 (satu) unit rumah permanen di Perumahan BAS, Jl. Asahan, P. Siantar. Kondisi rumah, 3 kamar ber-AC, listrik, air dan lengkap dengan perabotan. Bagi yang berminat hub. Ibu Purba HP 081361133367

CASH & CREDIT: 5 x 20 m, 10 x 20 m, 15 x 20 m, 20 x 20 m Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT TANAH: 5 x 25 m, 5 x 20 m cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Menyediakan rumah dan tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; 7070442 P. Siantar CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 10 x 21,8 m 20 x 22 m jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 1.908 M2 cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No. Telp. 0813 7612 2445; 0812 6207 631; (0622) 7070442 P. Siantar

Diskon DP 500 rb

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442; P. Siantar

Menjual segala jenis sepeda motor Honda, Suzuki, Yamaha dan second, cash n kredit: • Honda Absolute Revo • Honda SX 125 • Scoopy, Vario Techno • Mio, Mio Soul • Jupiter Z • Satria FU, Spin, hub. 0622 - 22305; 24077; HP 0853 7070 9507; 0852 7601 5848. Jl. Merdeka No. 330 P. Siantar

CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442.


CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar. CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Jl.Pdt Wismar Saragih Gg Karsim Blok B 47, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 47, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

DIJUAL: 2 unit rumah siap huni, lokasi Jl. Kabanjahe Ujung P. Siantar, fasilitas: Sertifikat Hak Milik (SHM), listrik dan PAM, harga 200 jt (Nego), hub. HP 0853 7210 6784 (TP)

CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar HP 0813 7658 8917 PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852 7600 0031; 08139688 9800 SinShe Aciu / Aling: Mengobati Peter Refleksi segala penyakit •Asam lambung •Asam urat •Ambeian •Gula •Kolestrol dll Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0852 7695 4557; 0813 6017 0199 Buka : Jam 09.00 - 21.00 WIB

FATNER GIBSUM: Menerima pemasangan •Plafon gibsum •Instalasi listrik, hub. Jhonny Purba HP 0813 9609 9231. Jl. H Ulakma Sinaga No. 167 (depan Gereja RK Rambung Merah) P. Siantar CV UTARA MULTI PROMOSINDO ADVORSING: Mengerjakan spanduk digital, neon box, plank merk, sablon, batu nisan, prasasti, baliho, stempel dll, alamat Jl. Pattimura No. 42 P. Siantar. Telp. 0622 - 27521; HP 0813 6234 7943 Bengkel mobil RONAULI: Menjual spear part mobil dan jetor, menerima bongkar mesin dan service, pispot, ganti oli, tambal ban, las listrik/karbit, harga terjangkau, serba lengkap. Hub 081264730695. Jl. Simpang Rininggol Nagori Silakkidir, Hutabayu Raja, Simalungun.

RM AMPERA WK: Buka 06.00 - 21.00 WIB. Menyediakan: •Serapan pagi (lontong, mie balap) •Nasi sop pindang • Nasi campur • Es campur • Gorengan. Jl. Asahan Komp. Megaland N Blok A No. 49 HP 0813 6205 0540 (Free WiFi) Zona Megaland Siap Antar. JOVNI CELLULER: Menjual HP baru, dengan harga terjangkau mulai dari Rp 200 rb + Memori 2 Gb, dengan fitur lengkap seperti: •Kamera •Radio FM •Dual SIM GSM •MP3, dengan beragam model HP terbaru segera kunjungi: Jl. Cipto No. 59 P. Siantar (Lewat Simp. Surabaya) PRI CILY SALON: Menerima: •Make up salon •rias pengantin •pengantin sanggul • smothing, bronding Jl. Melanthon Siregar Gg PD P. Siantar. HP 0812 6339 2197 MONICA FLORIST: Menerima pesanan bunga papan,krans bunga,untuk pesta pernikahan, kemalangan, wisuda dll, alamat: Jl. Bola Kaki No. 4 (Depan Pertamina) P. Siantar HP 0813 7075 3200 AMANAH TOURS & TRAVEL: Tiket promo: Medan - Jakarta - Singapura - Bangkok dll, Garuda, Lion, Batavia, Sriwijaya, dll. Hotel promo domestik dan Internasional, tiket taman hiburan Universal Studio. Info: Jl. Patuan Anggi No. 159 P. Siantar. Telp. 0622 - 22115; HP 0813 6443 2665. Dan juga menerima peluang usaha agen tiket UD ARMADA SARANA TEHNIK: Melayani: •Servis perbaikan isi freon •AC •Frezer •Kulkas •Mesin cuci •Dispenser, hub. Armada Purba HP 0812 6406 6568, Jl. Handayani No. 8 P. Siantar DICARI: Agen Kelapa Santan untuk wilayah Medan, Pematangsiantar, Simalungun. Daging tebal, santan banyak. Kelapa cocok untuk pembuatan es dawet dll. Harga Rp5.000 per gandeng diantar sampai tempat. Harga bisa naik/ turun sewaktu-waktu tergantung permintaan pasar. Kelapa dari Batubara. Berminat, untuk wilayah pematangsiantar hub. 081260623215. Medan hub 081264745666 (Heri). TANAM GAHARU INVESTASI MELEBIHI EMAS! Jual bibit gaharu aquilaria malaccensis tinggi mulai 20-100 CM, sedia fusarium ingul dan teknik mokulasi, sedia bibit kemenyan toba dll. Jl. Viyata Yudha Pematangsiantar. hub. HP 0813 1476 2472; 0812 2756 8840

GT FAMILI COM Cash & credit: Menjual dan service komputer, laptop (notbook), accesories, printer dll. Barang baru, harga terjangkau, menerima ketikan makalah, warnetan dan kursus komputer. Hub 0823 6832 4222. Jl. Kartini samping B. Karya Murni Perdagangan. CV MITRA JASA KS (Consultan Adminitration): • Jasa pengurusan surat-surat penting • Anda ingin KPR Perumahan • Pengurusan ijin usaha butuh NPWP • Pinjaman uang ke Bank, juga perli NPWP Wow... kami berikan kepeda anda NPWP Gratis..!!! Segera datang ke alamat unit kami: Jl. Dahlia No. 4 P. Siantar. (K Saragih HP 0852 7584 8884; 0823 6377 4445) Kami siap melayani. PRICILY SALON: Menerima: •Make up sanggul •Rias pengantin •Perawatan rambut •Smothing •Bonding. Jl. Melanthon Siregar Gg PD P. Siantar. HP 0812 6339 2197

LA ROSS SALON & FLORIST: Menerima: Make up dan sanggul, Rias pengantin, perawatan rambut, shomoting rambut. Juga menerima Roncean melati, Bunga tangan, Bunga papan, Bunga saub, Dekorasi pelaminan dan menjul mawar holan dll. Jl. SM Raja No. 324 Telp.0812 638 2759 BUTUH DANA CEPAT: Agunan BPKB mobil/ sepeda motor, proses cepat, kendaraan anda kami asuransikan, hub. 0813 6146 0422 Rino Reynaldi HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” BUTUH DANA TUNAI: Hanya jaminan BPKB, kendaraan anda, proses cepat dan diskon 1 x, angsuran dapatkan hadiah langsung barang elektronik, hub. Linda HP 0813 9724 7131

REZEKI SAHABAT: Servis, ganti oli, pispot. Jl. Gereja No. 60 P. Siantar. Telp. 0622 29768. DISTRO Jl. Melanthon Siregar. CAROLINA PONSEL Jl. Melanthon Siregar

BUTUH DANA CEPAT: • Sepeda motor tahun 2003 • Mobil tahun 1994, melayani take over kredit, dan pajk mati hub: 0852 6074 9962; 0812 6043 7499. Erik Silalahi

RABU 21 November 2012








2 Man United







3 Chelsea







4 West Bromwich A 12






Jadwal Liga Champions Matchday 5 Kamis (22/11) Pukul 01.45 WIB: Porto vs Dinamo Zagreb Grup A Dynamo Kyiv vs PSG Grup A Arsenal vs Montpellier Grup B Schalke 04 vs Olympiacos Grup B Zenit St. Petersburg vs Málaga Grup C Anderlecht vs AC Milan Grup C Ajax vs Borussia Dortmund Grup D Manchester City vs Real Madrid Grup D

PENCETAK GOL NAMA 1 L Suárez 2 D Ba 3 R van Persie 4 Michu 5 E Džeko 6 M Fellaini

KLUB Liverpool Newcastle United Manchester United Swansea City Manchester City Everton

GOL 10 8 8 7 6 6

PREDIKSI SKOR Arsenal 2-0 Montpellier BURSA METRO Arsenal 0 : 1 ¼ Montpellier




12 11




2 Atlético Madrid







3 Real Madrid







4 Málaga








Winger Arsenal Aaron Ramsey mengatakan, timnya harus menang menghadapi Montpellier pada laga lanjutan Champions League di Emirates Stadium, Kamis (22/11) dinihari.


PENCETAK GOL NAMA 1 L Messi 2 Cristiano Ronaldo 3 R Falcao 4 Aduriz 5 G Higuaín 6 Negredo

KLUB Barcelona Real Madrid Atlético Madrid Athletic Club Real Madrid Sevilla

GOL 17 12 10 8 7 7

SERIA A ITALIA KLASEMEN SEMENTARA 1 Juventus 2 Internazionale 3 Napoli 4 Fiorentina

13 10 12 9 13 8 12 7

2 0 3 3

1 3 2 2

29-9 24-13 22-11 19-9

32 27 27 24

PENCETAK GOL NAMA 1 S El Shaarawy 2 E Cavani 3 E Lamela 4 A Di Natale 5 M Klose 6 D Milito

KLUB Milan Napoli Roma Udinese Lazio Internazionale

GOL 10 8 8 7 7 7

BUNDESLIGA KLASEMEN SEMENTARA 1 München 2 Schalke 04 3 Frankfurt 4 Dortmund

12 10 12 7 12 7 12 6

1 2 2 4

1 3 3 2

33-5 22-14 25-18 26-13

PENCETAK GOL NAMA 1 M Mandžukiæ 2 A Meier 3 S Kießling 4 Á Szalai 5 R Lewandowski 6 T Müller

KLUB Bayern München Eintracht Frankfurt Bayer Leverkusen Mainz 05 Borussia Dortmund Bayern München

GOL 9 9 8 8 7 7


31 23 23 22

osisi Arsenal masih belum aman, mereka berada pada posisi kedua dengan poin 7 terpaut1angkadariSchalkedanunggul 1 angka atas Olympiakos di klasemen sementara grup B. “Grup ini cukup ketat, jadi kami harus menang pada pertandingan itu. Kami berada di rumah, mudahmudahankamimeraihkemenangan untuk memantapkan posisi kami agarbisalolos.KetikabermaindiPerancis, kami dalam tekanan selama pertandingan dan kami mendapatkan hasil yang baik,” ujar Ramsey. Montpellier cuma mendapatkan 1 poin hingga saat ini, artinya Mapou Yanga-Mbiwa dan kawan-kawan dipastikan gagal lolos ke babak selanjutnya. “Mereka telah bersaing menghadapi setiap tim di grup ini dan mereka bisa menciptakan ancaman, tentumerekatanpabeban.Merekaakan membuktikan sesuatu, jadi kami harusmewaspadaiitu,”jelasRamsey mengenai calon lawannya itu. Pemain tim nasional Wales berusia 21tahunitusangatberharapagarThe Gunners dapat lolos sebagai juara grup demi menghindari tim unggulan lainnya, seperti Barcelona, pada babak knock out. “Kami finis kedua di grup pada beberapa musim lalu dan bertanding menghadapi Barcelona. Tapi yang terpenting kami harus lolos. Jika berhasilmakakamiakan percaya diri untuk menghadapi tim manapun di kompetisi ini,” tutup mantan pemain Cardiff City itu. Sementara striker Arsenal Olivier Giroudengganmemandangsebelah matamantantimnyaitukalaberjumpa tengah pekan ini.

The Gunners butuh kemenangan atas juara Prancis itu di Emirates, Kamis(22/11)dinihari.Dengantambahan tiga poin, Arsenal akan dipastikan akan menempati satu slot di babak 16 Besar. Sebaliknya kekalahan akan sangat berisiko bagi Arsenal. Apabila Olimpiakos bisa mengalahkan Schalke maka peluang lolos Giroud cs akan mengecil dan harus ditentukan di laga grup pamungkas. Setelahgagalmenangditigalagasebelumnya,moralArsenalkiniterdongrak usai memenangi derby London Utara versus Tottenham Hotspur pada akhir pekan lalu. Sedangkan Montpellier, yang dipastikan tak mungkin lagi lolos tengah terpuruk di kompetisi lokal dengan menduduki peringkat 14 klasemen Ligue 1. Melihat situasi ini, sepertinya skuad Ars e n e Wenger akan mudah

DATADAN FAKTA -Pertemuan pertama kedua tim terjadi pada September 2012 di Liga Champions, dimana Arsenal sukses menekuk Montpellier dengan skor 12. Saat itu Montpellier unggul lebih awal melalui gol Y Belhanda, namun terbalaskan dua gol oleh L Podolski dan Y Gervinho untuk kemenangan Arsenal. -Arsenal meraih dua kemenangan, dua kali imbang dan satu kali kalah dari lima laga terakhirnya. Liga Inggris pekan lalu mereka sukses meraih poin penuh saat berhadapan Tottenham Hotspur, dengan skor akhir 5-2. -Sementara Montpellier hanya memperoleh satu kemenangan, tiga kali seri dan kalah satu kali dari lima laga terakhir mereka. Terakhir kali Montpellier hanya berakhir imbang saat melawan Valenciennes di Ligue 1, dengan skor akhir 1-1. -Arsenal memiliki kinerja yang baik jika bermain di kandang, mereka meraih tiga kemenangan, satu kali seri dan satu kali menelan kekalahan dari lima laga kandang terakhirnya. -Sedangkan Montpellier memiliki performa yang cukup buruk jika bertandang ke markas lawan. Mereka belum pernah menang dari lima laga kandang terakhirnya, hanya menahan imbang tiga kali dan dua kali kalah. -Arsenal sementara di peringkat ke-2 klasemen Grup B dengan perolehan 7 poin dari empat pertandingan, selisih satu poin dari Schalke 04 di puncak klasemen. Sedangkan Montpellier di posisi ke-4 klasemen yang hanya mengoleksi 1 poin.

saja melewati hadangan Montpellier. Giroud, yang sudah mencetak tujuh gol sejak hijrah ke London, menolak meremehkan bekas klubnya itu. “Iniadalahlagawajibmenangbuat kami karena Arsenal harus lolos ke faseberikutnyadikompetisiini,”seru strikerinternasionalPrancisitudiThe Sun. “Montpellier tak punya apapun untukdipertaruhkanseakrangmereka sudah tersingkir tapi kami tetap harus berhati-hati karena saat itulah biasanya yang paling berbahaya.” “Mereka tidak tampil sebagai juara Prancis dengan tidak memiliki kualitas. Kami tidak boleh jemawa saat mereka menyambangi Emirates,” sahutGiroudsembarimemperingatkan. Montpellier Takut Kalah Gelandang Montpellier Younes Belhanda takut jika klub Perancis tersebut dapat kebobolan delapan gol saat menghadapi Arsenal di Liga Champions mendatang. Juara bertahan Ligue 1 itu hanya mendapatkan empat poin dari lima pertandingan di musim ini dan mendapatk a n kekalahan ketiga mereka di musim ini denganskor3-0 oleh tim yang baru mendapat promosi ke liga utama Reims hari Jumat lalu. Arsenal menaklukan Southampton dengan skor 6-1 di Premier League Sabtu lalu, dan Belhanda percaya Montpellier harus kembali ke performamerekasecepatnyadanmemperkuat mental mereka jika mereka ingin terhindar dari kekalahan di Stade de la Mosson. “Jikakamibermainsepertiini,kami akan kebobolan delapan gol,” ujar Belhanda. “Kamiharusmenunjukkansecepat mungkin bahwa kami seorang pria, karenakamiterlihatsepertianakkecil di lapangan. Kami tidak berbahaya, juga tidak cukup tajam.” Pelatih Montpellier Rene Girard mengatakan bahwa ia tidak menyadari timnya saat ini yang telah me-

KLASEMEN SEMENTARA LIGA CHAMPIONS Grup A No Team M 1 Porto 4 2 Paris Saint Germain 4 3 Dynamo Kyiv 4 4 Dinamo Zagreb 4

M 3 3 1 0

S 1 0 1 0

K 0 1 2 4

SG 6-2 10-2 5-7 0-10

Nilai 10 9 4 0

Grup B No Team 1 Schalke 04 2 Arsenal 3 Olympiacos 4 Montpellier

M 4 4 4 4

M 2 2 2 0

S 2 1 0 1

K 0 1 2 3

SG 8-5 7-6 7-7 5-9

Nilai 8 7 6 1

Grup C No Team 1 Málaga 2 Milan 3 Anderlecht 4 Zenit

M 4 4 4 4

M 3 1 1 1

S 1 2 1 0

K 0 1 2 3

SG 8-1 4-4 1-4 3-7

Nilai 10 5 4 3

Grup D No Team 1 Borussia Dortmund 2 Real Madrid 3 Ajax 4 Manchester City

M 4 4 4 4

M 2 2 1 0

S 2 1 1 2

K 0 1 2 2

SG 6-4 10-7 6-8 6-9

Nilai 8 7 4 2

Grup E No Team 1 Chelsea 2 Shakhtar Donetsk 3 Juventus 4 Nordsjælland

M 4 4 4 4

M 2 2 1 0

S 1 1 3 1

K 1 1 0 3

SG 10-6 7-5 8-4 1-11

Nilai 7 7 6 1

Grup F No Team 1 Valencia 2 Bayern München 3 BATE Borisov 4 Lille

M 4 4 4 4

M 3 3 2 0

S 0 0 0 0

K 1 1 2 4

SG 10-4 10-5 8-9 2-12

Nilai 9 9 6 0

Grup G No Team 1 Barcelona 2 Glasgow Celtic 3 Benfica 4 Spartak Moscow

M 4 4 4 4

M 3 2 1 1

S 0 1 1 0

K 1 1 2 3

SG 8-5 6-5 3-4 6-9

Nilai 9 7 4 3

Grup H No Team 1 Manchester United 2 CFR 1907 Cluj 3 Galatasaray 4 Braga

M 4 4 4 4

M 4 1 1 1

S 0 1 1 0

K 0 2 2 3

SG 9-4 5-6 4-5 5-8

Nilai 12 4 4 3

menangkan gelar juara pada musim lalu dan yakin timnya mungkin terlalu percaya diri sebelum dimulainya musim ini. “Kami seharusnya malu pada diri kami sendiri,” ujarnya usai kalah dari Reims. “Untuk pertama kali, saya menanyakan banyak pertanyaanpadadirisayasendiri.Merekatelahmelupakan beberapa nilai.” (int)

HEAD TO HEAD 18 September 2012 : Montpellier 1 – 2 Arsenal, Liga Champions 5 PERTANDINGAN TERAKHIR ARSENAL : 17/11/2012 : 10/11/2012 : 06/11/2012 : 03/11/2012 : 30/10/2012 :

Arsenal Arsenal Schalke 04 Man United Reading

5–2 3–3 2–2 2–1 5–7

Tottenham Hotspur, Fulham, Arsenal, Arsenal, Arsenal,

Liga Inggris Liga Inggris Liga Champions Liga Inggris Piala Liga

5 PERTANDINGAN TERAKHIR MONTPELLIER : 17/11/2012 : 11/11/2012 : 06/11/2012 : 03/11/2012 : 31/10/2012 :

Valenciennes Montpellier Olympiakos Troyes Montpellier

1–1 1–1 3–1 1–1 1–0

Montpellier, PSG, Montpellier, Montpellier, Bordeaux,

Ligue 1 Ligue 1 Liga Champions Ligue 1 Coupe de la Ligue


RABU 21 November 2012


ANDALKAN EL SHAARAWY Harian Italia Tuttosport, pernah memberi judul berita headline-nya “Stephan El Shaarawy: Heart and Soul”. Sangat jarang ada media Italia yang memberikan tempat utama untuk pemain muda di halaman depan.

AC MILAN (4-3-1-2): Abbiati- De Sciglio - Bonera - Acerbi - Antonini- Montolivo - Ambrosini - NocerinoBoateng-Pazzini - El Shaarawy ANDERLECHT (4-2-3-1): Proto-Gillet - Wasilewski - Kouyate - Deschacht-Biglia - Kljestan-Bruno - Kanu - Iakovenko-Jovanovic


emua itu dilakukan hanya untuk El Shaarawy, penyelamatACMilanmusim ini. Termutakhir, lesakan dua gol pemain Italia berdarah Mesir itu menyelamatkan “I Rossoneri” dari pahitnya kekalahan di kandang Napoli. Skor kedua tim pun berakhir 2-2. Koleksi 10 gol dari 13 pertandingan Serie-A membuktikan bakat besar El Shaarawy. Jumlah tersebut berarti setengah gol Milan musim ini adalah berkat bantuan eks pemain Genoa dan Padova itu. Sebuah fakta menunjukkan bahwa klub asuhan Massimiliano Allegri tersebut begitu bergantung kepada El Shaarawy. Jika tak ada gol-gol dari El Shaarawy, posisi Milan di klasemen sementara Serie-A Liga Italia adalah juru kunci! Beruntung, El Shaarawy mampu tampil trengginas dan dapat menjaga Milan jauh dari zona merahdegradasi.Padausiabaru20 tahun, El Shaarawy sudah me-


HEAD TO HEAD : 19 Sep 2012: AC Milan 2 Nov 2006 : AC Milan 18 Okt 2006 : Anderlecht

0-0 4-1 0-1

Anderlecht Anderlecht AC Milan

(Liga Champion) (Liga Champion) (Liga Champion)

LIMA PERTANDINGAN TERAKHIR ANDERLECHT 11 Nov 2012 Anderlecht 6-1 Bruges (LJB) 7 Nov 2012 Anderlecht 1-0 Zenit st Petersburg (UCL) 4 Nov 2012 KV Mechelen 1-4 Anderlecht (LJB) 31 Okt 2012 Anderlecht 5-0 KAA Gent (LJB) 28 Okt 2012 Royal Charleroi 2-0 Anderlecht (LJB)

ngambil tugas berat menolong Milan tetap bernapas musim ini. Pada awal musim, tak ada yang mengiraElShaarawybakalmenjadi juru selamat Milan. Pasalnya, musim pertama El Shaarawy di San Siro hanya mengoleksi empat gol dari 28 pertandingan. Semua itu tak terlepas dari kebe-

DATADAN FAKTA: - AC Milan sejauh ini baru bertemu 3 kali menghadapi Anderlecht, dari pertandingan tersebut, AC Milan memenangkan dua pertandingan dan 1 kali seri. - AC Milan tampil kurang konsisten dari pertandingan terakhirnya. - Anderlecht sendiri baru meraih 1 kemenangan dari 5 pertandingan terakhir. Mereka meraih 1 kemenangan, 3x seri, dan 1x kalah. Pertandingan terakhir mereka berakhir dengan skor 1-1 ketika menghadapi Lierse. - Ini adalah kali pertama bagi Anderlecht mengikuti fase grup Liga Champion, terakhir mereka dapat lolos dari kualifikasi pada tahun 2006/2007. - Rekor AC Milan ketika menghadapi tim asal Belgia ada memenangkan 5 pertandingan, 3x seri, dan 2x kalah. Tim terakhir asal Belgia yang berhasil mengalahkan AC Milan adalah Club Brugge, dengan skor 0-1. - Anderlecht memiliki catatan yang buruk ketika menghadapi tim Italia, mereka belum pernah menang melawan tim asal Italia, mereka mencatat 6 kali seri, dan 9 kali kalah. - AC Milan berada diposisi ke-12 di Liga Italia saat ini. - Sedangkan Anderlecht berada diposisi ke-2 Liga Belgia dengan point 13 dari 7 pertandingan, mendapatkan 3 kemenangan, dan 4x seri.

LIMA PERTANDINGAN TERAKHIR AC MILAN 11 Nov 2012 AC Milan 1-3 Fiorentina 7 Nov 2012 AC Milan 1-1 Malaga 4 Nov 2012 AC Milan 5-1 Chievo 31 Okt 2012 Palermo 2-2 AC Milan 28 Okt 2012 AC Milan 1-0 Genoa

radaan Zlatan Ibrahimovic yang tidak tersentuh di Milan. Setelah Ibrahimovic pergi ke Paris SaintGermain, mau tak mau Milan memaksimalkan kemampuan pemain berjuluk “Firaun Kecil” itu. Untungnya, El Shaarawy bisa membayar kepercayaan yang diberikan Milan. Jika terus tampil konsisten dan berkontribusi lebih untukMilan,julukan“FiraunKecil” sepertinya sudah tak cocok lagi untuknya. Mungkin saja, julukan ElShaarawynantimenjadi“Firaun kota Milan”. Dinihari nanti, AC Milan akan bertandang ke Belgia untuk melawan Anderlecht. Meski sejauh catatanyangmerekapunya,dalam tiga kali pertemuan, AC Milan unggul dua kali dan sekali seri. Namun performa Milan yang mengendur belakangan membuat

(SA) (UCL) (SA) (SA) (SA)

fanskhawatir.BisakanElShaarawy dan kawan-kawan pulang dengan membawa tiga poin. Usai menahan imbang Napoli beberapa hari lalu, pelatih Massimiliano Allegri merasa terpuaskan. Tapi, karena saat itu Rossoneri masih membuat terlalu banyakkesalahan,Allegrimeminta timnya berbenah. “Kami menghadapi sejumlah situasi yang sebenarnya bisa dihindari dan disebabkan kesalahan-kesalahan kami,” ungkap Allegri di Football Italia. “Kami harus berkembang karena kami masih membuat terlalu banyak kesalahan pada level individu. Ini adalah tim yang harus dewasa dan belajar dari kesalahan-kesalahan dan juga posisinyadiklasemen,”ujarAllegri. (int)

Iniesta Tak Bermimpi Raih Ballon d’Or BARCELONA- Gelandang Barcelona Andres Iniesta Lujan tidak pernah bermimpi mendapatkan Ballon d’Or 2012. Iniesta berpikir, lebih cocok gelar itu disematkan kepada Lionel Messi rekan satu tim Iniesta di Barcelona. Gelandang kreatif Barcelona dan Timnas Spanyol ini menegaskan tidak pernah memiliki ambisi untuk memenangi trofi Ballon d’Or. Musim panas tahun ini dia telah berhasil memenangkanpenghargaanPemainTerbaik Eropa. Namun, pemain berusia 28 tahun itu menjelaskan sudah

sangat senang dapat bermain di level yang sekarang. “Saya berusaha memainkan gaya sendiri dan yang terpenting orang-orang menyadari kemampuan saya, tetapi saya tidak menganggap itu hal yang penting untuk dipikirkan. Saya tidak pernah memikirkan Ballon d’Or dan saya menganggap hal yang tidak penting jika fokus terhadap penghargaan individu. Namun, bila saya memenanginya tentu sangat senang,” kata Iniesta kepada RMC. “Saya merasa sangat senang dapat bermain dengan tim ter-

baik saat ini. Barcelona dan Timnas Spanyol adalah tempat di mana saya ingin bermain setiap hari dan menjadi baik setiap harinya,” pungkas gelandang Spanyol ini. Iniesta langsung mengalihkan pembicaraan menyinggung tentang teman satu timnya Lionel Messi.”Messi adalah pemain terbaik dunia,” tambah Iniesta. “Dia melakukan banyak hal dengan alami dan jika bermain dengan dia(Messi) sangat mudah, sama seperti semua pemain yang bermain dengan saya,” ujar Iniesta. (int)







Edisi 126 „ Tahun IX


3 Rumah Terancam Roboh Akibat Longsor ‹ ‹ Baca

3 Rumah...Hal 6 FOTO: FREDDY)

„ Tiga rumah warga Lingkungan V, Angin Nauli, yang terancam rubuh pasca longsor yang terjadi Senin (19/11).

2 Pencuri Hp Ditembak

Memasuki Era BUMN Multinational Corporation (2/habis) PT Timah yang mengalami kesulitan menghadapi penjarahan tambangnya di Bangka Belitung memang harus berpikir keras dan tidak mudah menyerah. Penegak hukum betulbetul tidak bisa diandalkan untuk pengamanan aset PT Timah di Babel. Bagaimana bisa, produksi timah gelap dari lahan PT Timah lebih besar dari produksi PT

Timah sendiri. Ini mirip dengan tidak berfungsinya penegak hukum di Sumsel yang membiarkan terjadinya pencurian minyak mentah Pertamina secara masif, terbuka, terangterangan, di mana-mana, dengan menggunakan teknologi kelas berat. Di tengah persoalan dalam ‹ ‹ Baca

Memasuki...Hal 6

Tak Berikan Standar Pelayanan Minimal

Pemda Siap-siap Digugat

„ Gamawan Fauzi

JAKARTA- Pemerintah Daerah di Sumatera Utara maupun di sejumlah daerah lain, dituntut harus mampu melaksanakan 'Standar Pelayanan Minimal'. Jika tidak, maka siap-siap menghadapi gugatan dari masyarakat. Karena hal tersebut merupakan kewajiban tugas aparatur sebagai pelayan masyarakat.

‹ ‹ Baca

Pemda...Hal 6

PNS Bisa Diturunkan Pangkat atau Dipecat Jika Ketahuan Dukung Mendukung Cagubsu MEDAN- Pegawai Negeri Sipil (PNS) di semua jajaran, baik provinsi maupun kabupaten/ kota serta pejabat di lingkungan Badan Usaha Milik Negara (BUMN) atau Badan Usaha Milik Daerah (BUMD), dilarang untuk memberi dukungan kepada pasangan calon kepala dan wakil kepala daerah di Pilgub Sumut 2013 mendatang. Tidak hanya itu, PNS juga dilarang keras terlibat dalam kegiatan kampanye untuk dukungan terhadap para calon kepala daerah/wakil kepala

daerah. Karena, pada prinsipnya jabatan PNS harus mengedapankan netralitas dan harus senantiasa menjunjung tinggi kehormatan negara, pemerintah dan martabat PNS, serta senantiasa mengutamakan kepentingan negara di atas kepentingan pribadi, seseorang atau golongan. “Pelarangan terhadap PNS itu, dalam rangka upaya ‹ ‹ Baca

PNS...Hal 7

KOTAPINANG- Kawanan pencuri yang menyatroni rumah H Syahmolek Siregar (37) dan istrinya Hj Anisa (35) di Dusun Padangri, Desa Simatahari, Kecamatan Kotapinang, Labusel, digulung polisi, Selasa (20/11). Dua diberondong peluru setelah mencoba kabur dari kejaran petugas. ‹ ‹ Baca


„ Dua Tersangka pencuri Hp yang ditembak, sedang menjalani perawatan di RSU Kotapinang, Selasa (20/11).

2 Pencuri...Hal 6

Dokter dari Medan Periksa Orang Gila di Tapteng TAPTENG- Kadis Kesehatan Tapteng Margan Sibarani menuturkan, tim dokter gangguan jiwa dari Medan akan melakukan pelayanan pemeriksaan orang yang menderita gangguan kejiwaan di Kecamatan Sibabangun, Pinangsori dan Badiri, Rabu-Kamis (2122/11). Selanjutnya secara bertahap dilakukan di kecamatan lain. “Besok lokasinya

11 Terjangkit AIDS, 4 Meninggal

di Puskesmas Pinangsori yang juga mencakupi Badiri. Sesuai data kami, di Pinangsori ada 35 orang dan di Badiri ada 11 orang yang mengidap gangguan jiwa. Lusa di Puskesmas Sibabangun, di sana ada sekitar 20 orang pengidap gangguan jiwa yang berhasil kami data,” tukas Margan Sibarani di Pandan, Selasa (20/ 11). Margan melanjutkan, tim dokter akan memeriksa kondisi pengidap, yang mana kategori berat, sedang dan ringan.

„ Margan Sibarani

‹ ‹ Baca

Selama 2012 TAPTENG- Penderita HIV/AIDS di Kabupaten Tapteng terus mengalami peningkatan setiap tahunnya. Berdasarkan data Dinas Kesehatan setempat, jumlah penderita AIDS mengalami peningkatan sekitar 40 persen setiap tahunnya, dan jumlah tersebut diperkirakan bisa meningkat terus. Sebab data yang diperoleh tersebut, masih data para penderita yang mau didata oleh dokter. Sedangkan usia penderita mulai dari balita sampai usia produktif. “Memang benar, jumlah penderita HIV/AIDS di daerah kita ini terus mengalami peningkatan. Tahun ‹ ‹ Baca

11 Terjangkit...Hal 7

Dokter...Hal 6

Rustam Terancam 20 Tahun Penjara MEDAN- Pengadilan Tipikor Medan menggelar sidang kasus dugaan korupsi pengadaan buku perpustakaan SD di Sibolga dengan terdakwa mantan Kepala Dinas Pendidikan Sibolga Rustam Manalu, Selasa (20/11). Rustam Manalu didakwa melakukan korupsi dana pengadaan buku perpustakaan SD untuk 17 sekolah dari Dana Alokasi Khusus (DAK) APBD

MANCHESTER- Mission impossible. Itulah gambaran sulitnya Manchester City untuk melaju ke babak 16 besar Liga Champions musim ini. Mereka bukan hanya membutuhkan dua kemenangan di dua laga sisa, juga berharap pesaingnya tergelincir.

Pemko Sibolga tahun anggaran 2010 sebesar Rp1,5 miliar yang merugikan negara Rp570 juta. Dalam dakwaannya, jaksa penuntut umum (JPU) dari Kejari Sibolga Nanang Prihanto menyatakan terdakwa Rustam bersama Lamser Tinambunan selaku Pejabat Pembuat Komitmen (PPK) (dalam berkas dan persidangan terpisah), pada tahun 2010 melakukan perbuatan memperkaya diri sendiri atau orang lain atau suatu koorporasi yang dapat merugikan keuangan negara. ‹ ‹ Baca

Rustam...Hal 6

Ya, saat ini City baru mengemas dua poin. Dengan begitu, agar bisa lolos ke babak 16 besar, mereka harus berharap para pesaingnya seperti Real Madrid (7 poin) tergelincir di dua laga sisa dan dan Ajax Amsterdam kalah dari Borussia Dortmund, dini hari nanti.

„ Drg Megawati

Berbeda dengan Real yang hanya butuh satu kemenangan atau seri dan Ajax kalah dari Dortmund. Jadi, bentrok melawan Real pada matchday kelima dini hari nanti akan menjadi penentuan buat City. “Kami harus menang. Tidak ada pilihan lain. Kami me-

nyadari sangat berisiko, tapi itulah yang terjadi,” kata David Silva, gelandang serang City kepada AS. Meski peluangnya tipis, City menolak menyerah. “Kami hanya harus lebih ‹ ‹ Baca

Ambisi...Hal 6

Metro Tapanuli RABU, 21 NOVEMBER 2012


21 November 2012

Tak Sesuai Hitungan Volume

Proyek Bendungan Irigasi Mombangboru Dihentikan TAPTENG-Pembangunan proyek rehabilitasi atau perbaikan dan peningkatan infrastruktur daerah irigasi (DI) di Desa Mombangboru, Kecamatan Sibabangun, Tapteng seluas 890 Ha terpaksa dihentikan sementara. Pasalnya, pembangunan proyek bendungan irigasi Mombangboru yang telah berjalan sejak awal Agustus 2012 itu terhenti pengerjaannya akibat tidak adanya kesesuaian penghitungan volume antara rekanan dengan UPT Dinas PSDA Sibundong Batangtoru.


„ Kapolsek Barus Iptu Ferymon saat memperlihatkan empat kubik kayu yang di amankan dari Desa Pangaribuan, Andam Dewi di Mapolsek Barus, Selasa (20/11).

Empat Kubik Kayu di Barus Diamankan Polisi BARUS-Personil Polsek Barus yang tergabung dalam satuan unit reserse criminal (Reskrim), Minggu (18/11) lalu sekira pukul 20.30 WIB mengamankan empat kubik kayu yang di duga kayu jenis meranti dan kayu kapur di Desa Pangaribuan, Kecamatan Andam Dewi, Kabupaten Tapteng. Informasi di himpun, penangkapan ini berawal dari adanya informasi yang di terima petugas Polsek Barus akan adanya 1 unit truk yang akan membawa sejumlah kayu tanpa di lengkapi dokumen resmi di De-

sa. Mendapati infromasi itu, petugas pun akhirnya menyisir lokasi di maksud dan menemukan satu unit truk dengan nomor polisi BM 8903 FC yang di kemudikan Renson Sihotang (51) membawa kayu olahan yang di duga jenis meranti dan kayu kapur sebanyak 4 kubik. Tak ayal, petugas Polsek Barus pun langsung mengamankan supir truk warga Desa Pananggahan Kecamatan Barus Utara itu bersama barang bukti ke Mapolsek Barus guna pengambangan kasus. Kapolres Tapteng AKBP Dic-

ky Patrianegara melalui Kapolsek Barus Iptu Ferymon saat dikonfirmasi METRO membenarkan hal itu, di mana pihaknya mengamankan sebanyak 4 kubik kayu yang tidak memiliki dokumen resmi. “Supir truk beserta muatannya ditangkap hari Minggu lalu, sebab mengangkut kayu olahan jenis maranti dan kapur yang di duga hasil illegal loging. Saat ini, oknum supir dan seluruh barang bukti sudah di amankan di Mapolsek Barus,” ujar Ferymon. Berdasarkan hasil pemerik-

saan, sambung Ferymon, kayu olahan tersebut di akui berasal dari Desa Pardomuan, Kecamatan Sirandorung yang akan di jual ke salah satu panglong di Desa Pananggahan, Barus utara. “Pemilik kayu tersebut yakni Artion Marbun (56) warga Desa Pardomuan, Kecamatan Sirandorung. Dan pemilik kayu juga sudah mengaku kalau kayu olahan itu di rambah dari kawasan hutan lindung di desa Pardomuan Kecamatan Sirandorung,” bebernya. Saat ini, sambung Ferymon, pihaknya telah menetapkan pe-

milik kayu yakni Artion Marbun sebagai tersangka dan Renson Sihotang hanya sebagai saksi sebab dirinya hanya berharap dari ongkos mobil yang di bawanya. “Meskipun sudah di tetapkan sebagai tersangka, kita tidak menahannya, karena tersangka selalu kooperatif setiap kita panggil untuk di periksa,” tandas Ferymon lantas berharap peran serta masyarakat dalam memberikan informasi kepada polisi cukup membantu meminimalisir terjadinya kejahatan. (mas/tob).

SEKARANG SAYATIDAK TAKUT MAKAN DAN MINUM YANG MANIS Gula Aren adalah jenis palma yang tidak hanya manis rasanya, namun juga kaya manfaat bagi kesehatan. T i d a k percaya? Gentong Mas yang salah satu bahan dasarnya Gula Aren, telah terbukti menurunkan kadar gula banyak penderita diabetes. Salah seorang yang telah membuktikan manfaatnya adalah Siti Rosnih (53 thn). PNS ini menceritakan, sudah 2 tahun lamanya menderita penyakit berbahaya ini, "Karena pola makan yang kurang terjaga, saya menderita diabetes. Akibatnya, badan sering kali terasa lemas, pusing, dan mudah lapar," papar ibu 5 orang anak tersebut. Diabetes adalah peningkatan kadar glukosa darah akibat kekurangan insulin baik yang sifatnya absolut maupun relatif atau resistensi reseptor insulin. Diabetes melitus sangat erat kaitannya dengan mekanisme pengaturan gula normal. Tapi sekarang setelah rutin minum Gentong Mas, kesehatannya sudah mulai membaik, "Sekarang keluhan saya sudah hilang dan tidak takut lagi makan yang manis." Ungkap warga Desa Tegalsari, Kec. Medan Denai,

Medan tersebut penuh syukur. Karena telah merasakan manfaatnya, Siti Rosnih ingin sekali membagi pengalaman baiknya itu dengan orang lain, "Mudah-mudahan pengalaman saya ini dapat bermanfaat untuk orang lain." Pungkasnya. Obat apapun, memang belum dapat melakukan pencegahan terhadap diabetes tipe 1, dimana ketidakmampuan pankreas memproduksi insulin sejak lahir. Berbeda dengan tipe 2, yang sering dicetuskan oleh faktor genetik, obesitas, kurang olahraga, serta pola makan yang tidak sehat, sesungguhnya diabetes dapat dicegah, salah satunya dengan terapi Gentong Mas. Gentong Mas adalah minuman kesehatan herbal alami dengan bahan utama Gula Aren dan Nigella Sativa (Habbatussauda) yang terbukti manfaatnya bagi penderita dari berbagai penyakit, termasuk diabetes. Habbatussauda dipercaya dapat meningkatkan fungsi insulin dan mengurangi resistensi reseptor insulin, sedangkan Gula Aren berperan dalam optimalisasi kerja reseptor insulin. Gentong Mas juga mengandung Chromium yang efektif memperlancar metabolisme gula darah dan mengatur kepekaan sel terhadap insulin sehingga meringankan kerja pankreas.

Selain itu, indeks glisemik dalam Gentong Mas yang sangat aman bagi kesehatan yaitu hanya 35 (aman jika indeks glisemik dibawah 50), mampu menjaga dan merawat pankreas agar tetap berfungsi dengan baik. Meski demikian, untuk mendapatkan hasil maksimal, disarankan untuk mengatur pola makan, olahraga, pengaturan berat badan seideal mungkin, diet rendah lemak, kontrol stress, dan menghindari rokok serta alkohol. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan silahkan hubungi:0813 8477 7787 Medan, Sidikalang, Gunungtua, Batubara, Tobasa, Nias Madina, Tapsel : 081384777787, Dolok Sanggul : 082129284752, Tebing Tinggi/Siantar : 081322099495, Binjai/pakam : 081398666166, Langkat/karo : 082167538828, Kisaran : 06237014362, Tanjung balai : 081263495563, Labura : 081370590972, Labuhan batu : 082365222011, Sibolga: 081376252569 Taput : 081263243034 Depkes:P-IRT:812.3205.01.114

SILVER HANGER: Jl. Ahmad Yani no. 48 Sibolga Square, baju Online-Tas Branded-Accessories Distro Cloth, Belanja online tidak sesuai keinginan? Pengen tas branded? Aksesoris unik? Atau ingin sablon kaos 1 pcs full warna desain bebas dan tentunya tidak luntur dan bisa disetrika harga terjangkau? Silahkan ke Outlet dan buktikan.

DICARI: Agen Kelapa Santan untuk wilayah Medan, Pematangsiantar, Simalungun. Daging tebal, santan banyak. Kelapa cocok untuk pembuatan es dawet dll. Harga Rp5.000 per gandeng diantar sampai tempat. Harga bisa naik/ turun sewaktu-waktu tergantung permintaan pasar. Kelapa dari Batubara. Berminat, untuk wilayah P. Siantar hub. 081260623215. Medan hub 081264745666 (Heri).


TOKO RIOON: Menjual berbagai macam peralatan Rumah Tangga dan perkantoran seperti : Lemari Pakaian, Lemari buku, Buppet, Kasur, Sofa, Rak piring, dll. Serta Meubeler Kantor seperti: Kursi Kantor, Meja tulis, dll Segera berbelanja di tempat kami Di Perumahan Sarudik Permai/ Eks. Komp. Hock ley No. 1B Buka setiap hari kecuali minggu.

Authorized Toyota Dealer • All new Avanza ready !!! • Veloz accesories full !!! • Grand new innova ready !!!! • Yaris bonus paling lengkap dan full discount • New Rush ready !!! Hub. David Maruhawa, HP 0813 9648 7188; 0831 9355 3180. PIN BB 26C3BF8D (Sales Executive). Data dijemput !!! proses cepat !!!. NB: Harga Siantar = Harga Medan YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 / bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari

DIJUAL: Mobil Kijang Kapsul LSX 2001, hitam metallic, tangan pertama, plat BB Tarutung. Hub: 0853 60 500 800 TAMBAH MODAL? Usaha kecil 6 % / tahun, cair 20 s.d 40 hari kerja (Syarat dan ketentuan berlaku) Gunakan bantuan warnet/internet: e-Proposal, klik menu CSR untuk mendaftar KABAR GEMBIRA !!! Telah Hadir di kota anda Spesialis perbaikan dan suku cadang Laptop, note book, sperpat computer ber alamat Jl. SM Raja No. 2 sibolga HP 0852 6229

MAYANG DEKORATION: Menyewakan: alat-alat pesta, pelaminan, Rias pengantin, taratak. Dengan HARGA TERJANGKAU, anda akan nuasa pesta Yang beda, dengan pelaminan KUBAH & TARATAK Yang tinggi& jumbo Hub. RANI JULIANA Jl. Ahmad Yani No. 7 B, Pandan, Tapteng HP 0813 6692 8998 SURYA JAYA MOTOR

Menjual beli segala jenis sepeda motor HONDA

Cash & Credit Type Harga Supra 125 Thn 2011 10 Jt Blade model Baru 10 Jt Blade Bisa 8 Jt Harga bisa nego Hub Kami: Jl. Padang Sidempuan depan Hotel Pandan Cerita Pandan Hp 085358124743

UD. JASO MALINDO: menjual santan murni dan kelapa parut, kamipun menerima tempahan/ mengasah mata parutan. Ruko No.5 Pasar Gelugur RANTAU PRAPAT . No HP 081264552871 (IWAN) DIJUAL RUMAH: Beralamat Jl. Solo No. 3 P. Sidimpuan samping Mesjid Raya Sagumpal Bonang, ukuran tanah L = 17,5 dan P = 29 surat sertifikat. Bagi yang berminat hubungi Kunan Nst di Lopian ke. Badiri Tapteng HP 0853 7338 5246 LOWONGAN KERJA: Dibutuhkan segera tenaga kerja untuk rangkai bunga papan Di GRACINDO FLORIST Jl. SM Raja No.47 A depan SPBU Pandan Krisman Tumanggor (081362328010)

Pasang Iklan Anda Hub. Hub.: 0631 -


ngan pengajuan termin saat ini saja, perusahaan telah dipersulit kuasa pengguna anggaran (KPA) dengan dalil penyesuaian volume yang dipaksakan harus sama dengan volume yang ada dalam RAB. “Penghentikan pekerjaan sementara ini juga telah kami beritahukan melalui surat kepada KPA dan PPTK. Sesuai dengan bunyi kontrak perjanjian, tetapi KPA dan PPTK hingga kini belum ada menyikapi surat yang kami layangkan tersebut,” tukasnya. Terpisah,KepalaUPTPengelola Sumber Daya Air (PSDA) Sibundong Batangtoru provinsi Sumut, Panahatan Sirait didampingi Pejabat Pelaksana Teknis Kegiatan (PPTK),HermanHarahapdikonfirmasi di ruang kerjanya di Pandan, Selasa (20/11) menyatakan, pekerjaan tersebut sejatinya tidak dihentikan. “Sampai saat ini pekerjaan masih dilaksanakan. Cuma lagi saat ini memang rekanan sedang mengajukan permohonan pembayaran termin dan masih menjadi tarik menarik pembahasan terkaittambahkurang-nyaprogres pekerjaan.Halitumemanghaknya setiap rekanan jasa kontruksi untuk pengajuan termin,” ujarnya. Disinggung progres fisik pekerjaan di lapangan menurut Dinas PSDA, Herman menjelaskan, sesuai di lapangan sudah mencapai 60-an persen lebih. “Sejatinya, memang wajar saja pihak rekanan mengajukan termin bila progres pekerjaan telah mencapai diatas 50 persen. Tetapi memang selaku Kuasa Pengguna Anggaran tentu harus membahas hal ini dengan cermat,” kilah Herman. Ditanya soal RAB tak sesuai dengan acuan gambar pekerjaan, Herman menampik hal itu dan ia menjelaskan, yang menjadi persoalan sehingga pengajuan termin pihak rekanan terkesan dipersulit, hanya permasalahan tambah kurang volume yang belum mendapatkan titik temu. “Ini yang sedang kita upayakan guna mendapatkan kesepakatan bersama. Kita juga langsung turun ke lapangan guna mencek langsung,” ucap Kepala PSDA, Panahatan Sirait. Menanggapi hal itu, Dewan pendiri Front Pemantau Pelaksanaan Pembangunan Indonesia (FP3i) Tapanuli Tengah, Sutoyo didampingi tim investigasi P Sitanggang menyesalkan keterbatasan pihak PSDA Sibundong Batangtoru tersebut. “Setelah kami telaah dan investigasi serta mengumpulkan data-data, terhambatnya proyek itu akibat ketidakmampuan PSDA Sibundong Batangtoru. Sehingga proyek bernilai miliaranrupiahituterancamgagal, padahal sangat di butuhkan warga setempat,” tukasnya. (Cr-1/tob).

GRACINDO: Cetak Kalender 2013 • Kalender kerja • Kalender Meja •Kalender Standard • Kalender Triwulan • Kalender Caturwulan • Kalender Poster • Juga Melayani Segala Jenis Cetakan, Papan Bunga dan Papan Digital Pesan di : GRACINDO PANDAN Jln.SM.Raja Depan SPBU Pandan Telp : 0631-371789 Hp: 0813 6232 8010 (Krisman Tumanggor)

SALMA D’CAFÉ menyediakan sarapan pagi, nasi serba 7000 dengan hidangan istimewa. Nasi goring, mie goring, bakso, pangsit, siomai, Batagor, bandrek, aneka juice. Menerima nasi kotak dan rantangan. Hub: Ibu salma , 081263497777 Jl. Kula Tanjung Kebun Kopi Indrapura, Batubara.

JUAL NOMOR CANTIK DAN HOKI • 0812 600 83 168 (95) • 0813 600 47 168 (95) • 0813 62 68 69 69 (95) • 0812 6545 1111 (250) Ada nomor lain. Hub. 0813 6269 1856 (Sibolga)

“ RM DENAI MINANG ” Menjual masakan khas padang, dengan menu istimewa: Nasi serba Rp8000, rendang, gulai pari, daging sapi, ikan mas, khas masakan rendang padang, menerima pesanan nasi kotak. Hub: Ibu AS , HP : 0817 4798 835. Jalinsum LimaPuluh BatuBara RM. (TB) TELAGA BIRU : Khas Minang, terkenal masakannya lezat. Tersedia kopi susu, teh susu, & Juice. Terima pesan nasi kotak. Jl. Jend. Sudirman No. 72, Indrapura, Batubara. Hub: 0813 9782 3094

SATU-SATUNYA DI INDONESIA!!! JASA PENGEBORAN SUMUR DALAM Dengan MESIN MODERN (mampu hingga 200 Meter) dan menggunakan alat Pelacak Jalur Aliran Sumber Air (Sungai) bawah tanah. Akurasi 90% SUKSES kini hadir di Sibolga Hub : 082 191 238 883; 085 2255 88838 www.

TERIMA: • Terima beli per bekas • Terima beli oli bekas • Terima bikin kartu nama • Terima bikin gokkon Hub. 0813 6269 1856 (Sibolga – Tapteng, Bisa dijemput )


Anda ingin memper cantik rumah anda???? Dengan decoration yang indah Menyadiakan dan menerima pesanan macam-macam gordyn model terbaru untuk; JENDELA, PINTU, RUMAH DAN KANTOR,DLL Hub kami; 0812 6094 4442 JL. P. 8,5 Sibuluan 1 Kec. Pandan Tapteng Cabang, ISTANA GORDYN SIBULUAN NALAMBOK

Akibatnya, warga setempat yang umumnya bekerja sebagai petani sangat khawatir areal persawahan mereka tak lagi tergenang air saat memasuki musim tanam nanti akibat terhentinya pembangunan bendungan tersebut. Sementara, batas akhir pelaksanaan pekerjaan hingga akhir Desember 2012 mendatang. “Sebenarnya, kami tidak serta mertamenghentikanpelaksanaan pekerjaan ini. Buktinya, mesin pompa air sebanyak 3 unit tetap kami operasikan selama 24 jam. Sekalipun pekerjaan fisik saat ini memang dihentikan sementara,” kata General Supertendent PT. Nunut Agung Perkasa (NAP) UsmanMarbun,Jumat(16/11)pekan lalu. Disinggung alasan dihentikannya pekerjaan, Usman enggan berkomentar banyak. “Saya hanya menjalankan perintah atas an saya. Selebihnya saya tidak mengetahui hal itu,” ucapnya. Sementara,DirekturVPT.Nunut Agung Perkasa, Martin Lumbantobing menyatakan, selaku rekanantidakadabermaksudmenghentikan pekerjaan tersebut. Namun,dirinyamerasadipersulitdan dalam suatu permainan, sehingga pada akhirnya mengalami kerugian. Menurut Martin, sejak dimulainya pekerjaan itu pihaknya telah mengajukan pengukuran bersama dan dituangkan dalam berita acara. “Namun hasil pengukuran yang telah dilakukan bersama tersebut tidak pernah dituangkan dalam bentuk berita acara pengukuran (MC-0),” bebernya. Sehingga hal ini, sambungnya, membuatnya merasa tidak mengetahui apa yang sebenarnya harusdikerjakandilapangansesuai dengan kebutuhan yang ada. Kendati PT. NAP telah menyurati hingga beberapa kali, namun tidak mendapat tanggapan apapun dari pihak Dinas PSDA Sibundong Batangtoru. “Kami (PT. NAP-red) merasa dijebak agar mengalami kerugian besar atas pekerjaan itu. Perlu saya tegaskan, perencanaan proyek itu sangat jauh berbeda antara gambar dengan perhitungan RAB. Sementara pelaksanaan di lapangan kami mengikuti gambar kerja yang ada dan intruksi dari pengawas lapangan, PPTK dan KPA. Jadi, bila kita paksakan untuk mengerjakannya sesuai gambar kerja yang ada, maka sama saja dengan menyumbang secara cuma-cuma. Artinya, apa yang telah dikerjakan, tetapi tidak sepenuhnya dapat diklaim PT. NAP pencairannya,” bebernya. Menurutnya, langkah menghentikan sementara pekerjaan di lapangan ini sudah matang di putuskan perusahaan. Sebab, de-

COOL TECH: Sarung jok untuk motor anda pertama di Indonesia: Mamfaat dari cool tech - Meredam panas hingga 80% - Menambah kenyamanan Kendaraan bermotor - Variasi Motor Hub: Herry HP 0811 6260 343 Jl. Albertus No.18 Sibolga. NB: Dicari Sub Agen Untuk Wilayah Sibolga dan Tapteng.

BROKOLI CERIA: sajian spaghetti sehat. Menyediakan sajian: Mie Ayam, Mie Ketela, Mie Wortel, Mie buah, Martabak sayur, Aneka Juice, Kopi Luwak, Softdrink. Harga Terjangkau. Jl. Jalinsum KM 99.5 Sei Suka, Batubara. HP: 0812 6217 910 RUMAH MAKAN BERSAMA: Menyajikan berbagai masakan, Nasi Goreng, Mie Goreng, Soto. Berbagai minuman, Aneka juice, teh manis, kopi susu, ginseng. SERBA EKONOMIS. Simpang Kuala Tanjung, Indrapura, Batubara

R.M MINANG RAYA: Tersedia khas masakan minang, ayam panggang, ikan panggang, kare kambing, Gulai kakap, ikanmas ARSIK, menu istimewa, terima pesanan katering/nasi kotak. Hub: VERY08216666 5855, Jalinsum, tanah merah, simp. 4 Indrapura, Batubara.


21 November 2012 “Apabila berhasil dan MK sepakat juga dengan kesimpulan DPR atas dugaan keterlibatan Boediono dalam skandal bailout Century, maka DPR bisa melanjutkannya dengan impeachment,” Anggota Timwas Century DPR, Bambang Soesatyo.

“Kita mendesak sebelum masa timwas century berakhir agar KPK menyerahkan surat pernyataan yang seperti dikatakan Pak Abraham tadi, bahwa Pak Boediono sebagai Wapres, tidak bisa melakukan penyelidikan dan menyerahkan kasus ini Anggota Timwas Century DPR, kepada DPR,” Akbar Faisal.

Ketua Komisi Hukum DPR, Gede Pasek Suardika.

“Ini adalah kemajuan yang sangat berarti dari janji KPK sebelumnya. Kan KPK berjanji sampai akhir tahun dan terbukti sebelum akhir tahun sudah ada kemajuan,”

Kirim Opini Anda ke email: metrotapanuli Maksimal tulisan 5.000 karakter

Sikap Kami Skandal Century di Puncak Hierarki KOMISI Pemberantasan Korupsi (KPK) gemar menebar janji. Berulang kali pimpinan KPK berjanji menaikkan status kasus pemberian dana talangan Rp6,7 triliun ke Bank Century ke penyidikan dan menetapkan tersangka. Tim Pengawas Century DPR pun nyaris kehabisan energi mengawasi kasus itu. Berulang kali pula tim pengawas menggelar rapat dengan KPK, tetapi belum ada tanda-tanda KPK segera menetapkan tersangka, minimal anak tangga pertama untuk menguak misteri penyaluran dana ke bank sakit itu. Padahal, Pansus Bank Century DPR pada awal Maret 2010 telah terang benderang merekomendasikan sejumlah nama petinggi negara yang mesti diproses secara hukum karena terindikasi melakukan penyimpangan dalam bailout Century. Ada nama Wakil Presiden Boediono yang kala itu menjabat Gubernur Bank Indonesia. Bank Indonesia (BI) diduga tidak memberikan informasi dan data akurat perihal indikator keuangan Bank Century. Selain Boediono, masih ada sejumlah nama lain dalam gerbong BI yang harus diperiksa. Ada pula nama Sri Mulyani Indrawati yang saat itu menteri keuangan. Direktur Pelaksana Bank Dunia itu terindikasi melakukan penyimpangan karena Bank Century sebenarnya tidak berdampak sistemis. Sri Mulyani kemudian kepada Wakil Presiden Jusuf Kalla mengaku dikibuli BI. Pemberian dana talangan ke Bank Century sungguh misterius. Dana sebesar Rp6,7 triliun bisa dengan mudah mengalir ke bank sakit, tanpa ada pejabat tinggi yang bertanggung jawab. Kalla terang-terangan menyebut bailout Century merupakan operasi senyap. Kini setelah dua tahun berlalu, KPK pun membidik dua pejabat BI, yakni BM dan SF, menjadi tersangka. Kabar itu dibocorkan anggota tim pengawas Century DPR Akbar Faisal (Hanura). Lagi pula BM dan SF bukanlah pejabat paling tinggi dalam hierarki di Bank Indonesia. Karena itu, tidak semestinya hanya mereka yang menjadi korban. Setiap kebijakan selalu melekat dan taat pada hierarki. Karena itu, tanggung jawab pun melekat secara hierarkis. Dalam bahasa serdadu, tidak ada prajurit yang salah; yang salah ialah panglima. Keputusan pengucuran dana talangan Rp6,7 triliun ke Bank Century pasti tidak di tangan BM dan SF. Secara hierarkis, mereka berdua tidak mempunyai kekuasaan yang amat perkasa untuk bisa menetapkan aliran dana sebesar itu. Kebijakan itu merupakan keputusan di puncak hierarki. Karena itu, di mana tanggung jawab Gubernur BI kala itu? Di manakah pula tanggung jawab Dewan Gubernur BI? Kalau menjadi tersangka, tentu BM dan SF hanyalah anak tangga pertama. Bukan anak tangga terakhir. Lalu kapan KPK menetapkan anak tangga berikutnya? Jangan seperti kasus Hambalang yang tertahan di anak tangga pertama. (*)

Etika Politik dan Perilaku Politisi Kode etik penyelenggara pemilihan umum akhirakhir ini menjadi perbincangan yang menarik di kalangan praktisi hukum, politisi, dan akademisi. Bahkan, publik dari berbagai elemen juga menaruh perhatian terhadap tema ini. Etika yang selama ini tidak dilihat sebagai norma sosial bagi para aktor politik dan politisi, justru kini bagaikan monster yang mulai ’’memakan mangsa’’. Di manakah letak moralitas yang selalu menggerus etika politik para politisi kita?

Oleh : Yusrizal Karana ANDAI saja Niccolo Machiavelli (1469-1527) masih hidup, ia mungkin akan datang ke Indonesia untuk melihat bagaimana teori eigentum-nya yang kian beroleh humus dari sejumlah politik ’’menghalalkan segala cara’’ dan sekaligus memberi support atas perilaku politisinya. Saking semrawutnya wajah politik kekinian di negeri ini, hingga kita makin sulit menyentuh pucuk perenungan demokrasi yang sesungguhnya. Bagaimana tidak, Dewan Kehormatan Penyelenggara Pemilu (DKPP) memberhentikan ketua Panwaslu DKI Jakarta karena terbukti melanggar kode etik penyelenggara pemilu. Ini adalah putusan pelanggaran berat yang kelima sejak DKPP dibentuk, setelah sebelumnya memecat ketua dan tiga anggota Komisi Independen Pemilihan (KIP) dan lima komisioner anggota Komisi Pemilihan Umum (KPU) Tulangbawang. Sedangkan yang jadi korban pertama atas putusan DKPP adalah lima anggota KPU Provinsi Sulawesi Tenggara dan disusul pemecatan ketua KPU Kota Depok dengan tuduhan yang sama. Selain memutuskan pemberhentian secara tetap, DKPP juga memberi sanksi berupa teguran tertulis kepada ketua KPU DKI Jakarta dan peringatan keras kepada ketua dan satu anggota KPU Pati, Jawa Timur,

serta ketua dan seluruh anggota KPU Timor Tengah Utara, NTT. DKPP juga menolak gugatan sekaligus merehabilitasi nama baik tergugat kepada anggota Panwaslu Sulawesi Tenggara, ketua KPU Lampung Barat, ketua dan anggota KPU Kota Batu, serta ketua KPU Banggai Kepulauan. Sedangkan di Kabupaten Talaud, DKPP memberikan putusan berupa penetapan pencabutan kepada tergugat ketua KPU daerah setempat (lihat tabel). Munculnya para komisioner yang tersandung kasus pelanggaran kode etik meneguhkan keyakinan kita betapa para aktor politik bersama politisi bergerak liar melabrak keluhuran politik. Sementara rakyat yang seharusnya mendapat pendidikan politik luhur jauh terbuang ke ruang-ruang ketidakpercayaan politik. Inilah wajah perpolitikan kita akhir-akhir ini. Politik yang hampa dari etika. Jargon siap kalah siap menang yang selalu diikrarkan menjelang pemilihan kepala daerah (pilkada) oleh kontestan, ternyata hanya sebatas basa-basi belaka. Kenyataannya, politisi kita hanya siap menang tetapi tidak mau kalah. Karenanya, langkah culas pun ditempuh dengan berkolusi dengan penyelenggara pemilu. Keberpihakan inilah yang kemudian menjadi malapetaka bagi para komisioner yang ak-

hirnya DKPP menjatuhkan putusan atas pelanggaran kode etik. Yaitu pelanggaran terhadap etika penyelenggara pemilu yang berpedomankan sumpah dan/atau janji sebelum men_jalankan tugas sebagai penyelenggara pemilu (Pasal 251 UU No. 8/2012 tentang Pemilu). Dengan kata lain, penyelenggara pemilu termakan sumpah atas janji saat dilantik menjadi penyelenggara pemilu. Putusan DKPP yang diproses melalui semi peradilan sesungguhnya berbeda secara prosedural dengan Dewan Kehormatan KPU/Bawaslu sebelum terbentuknya DKPP. Jika Dewan Kehormatan melakukan peradilan tertutup, DKPP secara terbuka. Hal ini tentu dimaknai sebagai bentuk transparansi atas kasus yang digelar agar tidak timbul fitnah dan kasak-kusuk dengan pihak yang bermasalah. Sebuah terobosan yang cukup mengobati rasa keadilan DKPP, yang konon hanya satu-satunya di dunia. Daftar Putusan Sidang Pelanggaran Kode Etik DKPP No Daerah Putusan Komisioner 1. Sulawesi Tenggara Pemberhentian tetap Ketua dan anggota KPU 2. Depok Pemberhentian tetap Ketua KPU 3. Tulangbawang Pemberhentian tetap Ketua, anggota, sekretaris KPU 4. Aceh Tenggara Pemberhentian tetap Ketua dan 3 anggota KIP 5. DKI Jakarta Pemberhentian tetap Ketua panwaslukada 6. DKI Jakarta Teguran tertulis Ketua KPU 7. Pati, Jatim Peringatan keras Ketua dan 1 anggota KPU 8. Timor Tengah Utara, NTT Peringatan keras Ketua dan anggota KPU 9. Sulawesi Tenggara Dito-


SHING-CINOLING Di tangani langsung oleh: Mr. Nai HP 082194932600 Jika anda yakin berobat dijamin 100% SEMBUH di tempat kami SHING-CINOLING 1. Stroke 2. Jantung 3. Tumor 4. Hernia 5. Gondok 6. Gagal Ginjal 7. Maag 8. Lambung 9. Asma 10. Asam urat 11. Kencing manis, dll

4 minggu bebas dari kursi roda 3 minggu sembuh total 3 minggu sembuh total 4 minggu sembuh total 3 minggu sembuh total 4 minggu sembuh total 2 minggu sembuh total 2 minggu sembuh total 2 minggu sembuh total 2 minggu sembuh total 3 minggu sembuh

lak/direhabilitasi Anggota panwaslu 10. Lampung Barat Ditolak/direhabilitasi Ketua KPU 11. Kota Batu Ditolak/direhabilitasi Ketua dan anggota KPU 12. Banggai Kepulauan Ditolak/direhabilitasi Ketua KPU 13. Talaud Penetapan pencabutan Ketua KPU Sumber: Diolah dari informasi DKPP Barang Langka Ternyata selain satwa langka, konon etika juga perlu mendapat ’’suaka’’. Sebab, selain tergolong ’’barang’’ yang harus dilindungi, juga sulit ditemui di ranah politik, hukum, ekonomi, sosial, dan lainnya. Politik seakan berjalan tanpa arah. Sementara hukum makin liar dengan segala keputusan yang serba absurd. Ekonomi pun makin termehek-mehek dengan segala modus untuk memiskinkan rakyat, sedangkan kehidupan sosial makin compangcamping dengan segala stigma yang negatif. Pendek kata, etika dari semua lini makin termarjinalisasi karena terdesak oleh hiruk-pikuk kekuasaan dan hedonisme para politisi. Secara faktual, etika sudah lama ditinggalkan dan tidak menjadi tuntunan bagi para aktor politik dan politisi kita. Jika diukur, syahwat politik jauh meninggalkan norma-norma etika untuk mengejar kekuasaan. Mereka seakan tenggelam dengan strategi pemenangan agar segera duduk di kursi kekuasaan. Baik pada legislatif maupun eksekutif. Akan halnya dengan penyelenggara pemilu, sejatinya setali tiga uang: larut dalam praktik kolusi, terkooptasi, nepotisme, dan nyaman dalam suasana politik pragmatisme bersama lakon para politisi busuk. Etika, menurut para ahli, se-

Penulis adalah Pemerhati Etika Politik/Dosen FISIP Universitas Muhammadiyah Lampung


Jl. Hiu No.88 arah laut Sibolga • Tes Kadar Lemak Perut • Pemeriksaan Kepadatan Tulang • Pemeriksaan Usia Sel • Pemeriksaan Kadar Air • Pemeriksaan Kepadatan Tulang • Pemeriksaan Massa Otot dan Ranting Fisik Suplemen yang terbuat dari nutrisi buah-buahan dan sayur-sayuran 100% NUTRISI LENGKAP


• Dapat Menurunkan Berat Badan 3-10kg/bulan • Dapat Menaikan Berat Badan • Menambah Nutrisi Tubuh

Alamat praktek: Jl. P. Sidempuan. Perumahan Sibuluan Nalambok Blok B. No. 2 Tapteng Buka setiap hari. Pkl: 08.00 s/d 21.00 HARI BESAR DAN HARI LIBUR LAINNYA TETAP BUKA

sungguhnya tidak lain adalah aturan perilaku, adat kebiasaan manusia dalam pergaulan antarsesama untuk menegaskan mana yang benar dan mana yang salah. Secara khusus, dikaitkan dengan seni pergaulan manusia, etika ini dijelaskan dalam bentuk aturan (code) tertulis yang secara sistematik sengaja dibuat berdasarkan prinsip-prinsip moral, dan pada saat dibutuhkan bisa difungsikan untuk menghakimi segala macam tindakan yang secara logikarasional umum (common sense) dinilai menyimpang dari kode etik. Jadi, etika adalah refleksi dari apa yang disebut dengan ’’self control’’. Sebab, segala sesuatunya dibuat dan diterapkan dari dan untuk kepentingan profesi itu. Oleh karenanya, sebuah profesi dapat memperoleh kepercayaan dari masyarakat bilamana dalam diri para elite profesional tersebut ada kesadaran kuat untuk mengindahkan etika profesi pada saat mereka ingin memberikan jasa keahlian profesi kepada masyarakat yang memerlukannya. Etika sebagai sistem nilai berkaitan dengan kebiasaan yang baik, tata cara hidup yang baik. Etika sebagai sistem nilai dipahami sebagai nilai yang dipergunakan sebagai pedoman, petunjuk, arah bagaimana manusia harus bersikap dan berperilaku baik, karena etika tersebut memuat berbagai perintah yang harus dipatuhi serta larangan yang tidak boleh dilanggar. Semoga tidak ada lagi komisioner yang diberhentikan oleh DKPP karena mengabaikan kode etik. (*)

Hubungi EFFENDY MANALU HP 0812 6307 414; 0813 7068 2243; 0852 7774 2645


Buka setiap hari SENIN s/d SABTU (Jam 08.00 - 21.00 WIB)



21 November 2012

Duda Cabuli Siswi SMA

5EKORKERBAUDICURI DARITEMPATANGONAN SIMALUNGUN-Sebanyak 5 ekor kerbau yang diternakkan warga di Perladangan Bambu, Dusun Kasian, Nagori Silau Buttu, Kecamatan Raya diembat kawanan pencuri spesialis ternak, Selasa (19/11) pukul 14.45 WIB. Para pemilik ternak tersebut, Jumpa Sinaga (53) warga Jalan Kartini, Kelurahan Pematang Raya, Kecamatan Raya, Jan Hendri Damanik (38), dan Sarmauli Sinaga (50) warga Nagori Silau Buttu, Kecamatan Raya serentak membuat laporan pengaduan ke Mapolres Simalungun. Informasi dihimpun, bahwa setiap hari kelima kerbau tersebut diternakkan diperladangan Bambu, Dusun Kasian, Silau Buttu, dengan cara tali kerbaunya diikatkan ke pohon. Seperti biasanya, setiap tiba pukul 13.00 WIB, para pemilik lembu tersebut istirahat makan siang. Karena di sana belum pernah kehilangan kerbau di ladang, para pemilik kerbau tersebut merasa nyaman pulang makan ke rumah. Seusai makan siang, mereka kembali ke ladang untuk mengangonkan kerbau yang sudah hampir 3 tahun dipeliharanya. Setibanya di ladang, mereka

terkejut karena tidak melihat lagi kelima kerbaunya. Kemudian mereka pun mencari di seputaran ladang, namun pencarian itu tidak membuahkan hasil. Para pengangon lainnya yang mereka tanyai, tak satu pun yang mengetahui atau melihat keberadaan kerbaunya tersebut. Setelah upaya pencarian mereka tidak berhasil, saat itu juga mereka mendatangi Polres Simalungun membuat laporan pengaduan. Akibat kejadian ini, ketiga pemilik ternak kerbau tersebut mengalami total kerugian sebesar Rp66 juta. Diduga pelaku mengambil kerbau tersebut dengan cara membuka ikatan tali nilon dari pohon tempat angonan, kemudian menarik kerbau-kerbau tersebut sampai ke jalan besar Silau Buttu, dan memasukkan ke dalam mobil yang telah stanbay (bersiapsiap) di sana. Kapolres Simalungun AKBP M Agus Fajar SIK saat dikonfirmasi melalui Kabag Humas AKP H Panggabean SH mengatakan pihaknya telah menerima laporan pengaduan dari ketiga korban, dan langsung menugaskan personil melakukan penyelidikan. (osi)

HamiliPacar,Subio DilaporkePolisi SIMALUNGUNSungguh malang nasib gadis yang masih tergolong belia ini, sebut saja namanya Bunga (17) warga Nagori Nagasaribu, Kecamatan Silimakuta, Simalungun, dalam kondisinya hamil 4 bulan malah ditinggal pacarnya, Subio (26). Pacarnya yang juga masih sekampung dengannya, tidak mau bertanggungjawab untuk menikahi Bunga. Informasi dihimpun, Selasa (20/11), bahwa antara Bunga dan Subio sudah bertahun menjalin hubungan pacaran. Bahkan Subio pun sudah sering membawa Bunga ke rumahnya. Singkatnya, pada bulan Mei, saat Subio hanya seorang diri di rumahnya, Bunga dipanggil untuk datang ke rumah tersebut. Bunga yang tidak menduga ada niat jahat Subio, dia pun datang seorang diri. Sesampainya di sana, Subio langsung mengajak Bunga melakukan hubungan suami istri yang seharusnya belum pantas mereka lakukan. Beberapa kali diajak, Bunga tetap menolaknya. Meski ajakannya terus ditolak, ternyata tidak membuat Subio berhenti sampai disitu saja. Bujuk rayu Subio yang berjanji akan menikahinya, akhirnya berhasil membuat Bunga bersedia melayani nafsu Subio. “Aku mau melakukan itu karena dia berjanji akan

menikahi aku,” terang Bunga saat diperiksa di Polres Simalungun. Bahkan hubungan suami istri yang seharusnya belum layak mereka lakukan sudah terjadi di rumah Subio. Namun setelah diketahui Bunga tengah hamil 4 bulan, Subio malah tidak mau bertanggungjawab. Berkali-kali Bunga meminta pertanggungjawaban dari Subio agar dia dinikahi, Subio mengelak dan mengatakan tidak mau menikah Bunga. Jawaban yang dilontarkan Subio, pun membuat Bunga geram, lantas menceritakan kehamilannya itu kepada orangtuanya. Setelah mengetahui Bunga hamil, orangtua Bunga mendatangi Subio meminta pertanggungjawaban atas kehamilan Bunga. Saat itu pun, orangtua Bunga mendapata jawaban yang tidak memuaskan. Subio tidak mau menikahi Bunga, namun tanpa memberikan alasan yang jelas. Kesal bercampur malu, saat itu juga, Bunga bersama orangtuanya langsung membuat laporan pengaduan ke Polres Simalungun. Kapolres Simalungun, AKBP M Agus Fajar SIK saat dikonfirmasi melalui Kabag Humas, AKP H Panggabaen SH membenarkan telah menerima laporan pengaduan dari korban pencabulan warga Nagori Nagasaribu dengan tersangka Subio. (osi)

SIMALUNGUN-Dengan bujuk rayu janji akan menikahi, Suyadi (36) duda anak 2 ini berhasil merenggut keperawanan Melati (16) siswi kelas 2 SMA warga Kelurahan Sigulang-gulang, Kecamatan Siantar Martoba. Namun setelah 6 kali melakukan hubungan suami istri, Suyadi malah lepas tanggungjawab.

„ Melati saat dimintai keterangan di ruang PPA Polres Simalungun.

Foto:Tonggo Sibarani

WARUNGKOPIDIGASAKMALING SIMALUNGUN-Warung kopi milik Julonggo br Naibaho (45) di Simpang Laut Simbah, Jalan Ulakma Sinaga, Nagori Rambung Merah, Kecamatan Siantar, digasak maling, Selasa (20/11) pukul 03.00 WIB. Akibatnya warung milik orangtua anggota Brimob Ipda Daniel Arta Sasta Tambunan ini mengalami kerugian Rp5 juta. Julonggo br Naibaho mengaku, kedai kopi itu sudah berdiri sejak sebelas tahun silam lalu disewakan kepada Simaremare, Pangulu disana. Dan Bulan Mei kemarin, setelah habis kontrak, korban memilih membuka usaha sendiri. Setelah warung kopi diusahai Julonggo, dia merubah sedikit tampilan bangunan serta memperluas lokasi karena mau dijadikan tempat nonton bola bareng. Setelah selesai, dia membeli televisi ukuran 42 inci seharga Rp5 juta, untuk ditaruh dalam kedai. Sekitar Juli kemarin, warung kopi milik Julonggo nyaris kebongkaran. Dimana pagi hari, saat karyawannya ingin membuka pintu warung, terlihat bekas congkelan benda keras tepat di bagian engsel gembok. Diduga pencuri mengalami kesulitan, lalu mereka pergi tanpa membawa hasil apapun. Saat kejadian itu korban mulai resah, dan menganggap lingkungan sekitar rumah dan warung kopi sudah tidak aman lagi. Alhasil pintu kedai bagian samping depan, selain di gembok dari luar, korban juga membuat palang besi dari bagian dalam, untuk menjaga keamanan. Usai berjualan, kedai tidak ada yang menjaga. Dua orang karyawannya, Risma br Siagian (20) dan Rosmaida br Siagian (25) kakak beradik, tinggal bersama Julonggo dirumah yang hanya berjarak sekitar 20 meter dari warung. Memang lagi apes, Selasa (20/ 11) pukul 03.00 WIB, salah se-


„ Tiga personil Polsek Bangun usai melakukan olah TKP, Selasa (20/11). orang tetangga korban yang bekerja di sebuah perusaahan coca cola, melihat pagi itu pintu kedai samping bagian belakang dalam keadaan terbuka. Dia mengira, pintu tersebut sengaja dibuka oleh pemiliknya. Setelah dicek ternyata tidak ada orang, pemuda yang baru saja pulang bekerja itu langsung memberitahu kepada pemilik kedai bahwasannya pintu kedai kopi miliknya sudah terbuka. Mendapat kabar, Jolunggo selaku pemilik warung sontak terkejut dan langsung mengecek bersama kedua karyawan yang tinggal bersamanya. Setelah dicek, ternyata televisi berukuran 45 inci sudah tidak lagi berada di tempatnya. Untungnya, uang beserta rokok yang ditaruh dalam steling dibawa masuk dalam rumah, sehingga pelaku pencurian yang telihat bekas mengacak steling tidak menemukan apa-apa. Atas kejadian tersebut, Jolunggo mencoba memberitahu kepada putranya Ipda Daniel Arta Sasta Tambunan yang kebutalan dinas di Kelapa Dua Depok, Jakarta. Saran perwira kepada ibunya, agar membuat laporan resmi kepada pihak kepolisian di

wilayah hukum tersebut. ”Laporkan saja ke polisi, mudah-mudahan pelakunya dapat di tangkap,” kata Julonggo mengulangi perkataan anaknya. Selasa (20/11) pukul 10.00 WIB, Julonggo mendatangi Polsek Bangun guna membuat laporan kehilanga atas kasus pembongkaran warung kopi. Mendapat laporan itu, tiga personil Polsek Bangun terjun ke lokasi guna melakukan olah tempat kejadian perkara (TKP). Rosmaida, penjaga warung menyebutkan, malam sebelum kejadian, warung terlihat sepi, sehingga warung tutup lebih awal dari biasanya. Biasanya tutup sekira pukul 23.00 WIB sampai 24.00 WIB, malam itu warung tutup pukul 22.00 WIB. ”Tadi malam kedai tutup cepat bang sekitar pukul 22.00 WIB, karena kebetulan pelanggan lagi sepi,” kata Rosmaida. Kapolsek Bangun AKP Hitler Sihombing membenarkan adanya laporan kasus pencurian tersebut, untuk saat ini pihaknya sedang melakukan penyelidikan lebih lanjut. “Kita akan selidiki siapa pelaku pencurian itu, kita kembangkan dari hasil olah TKP,” tegas Kapolsek. (eko/osi)

Lampung Tengah ini, para tetangga membatin, “Wah, ini rupanya calon menantu Pak Dahlan.” Benarkah Murtono calon menantu Pak Dahlan? Tidak jelas benar. Sebab Mimi sendiri tak merasa Murtono ini sebagai kekasihnya. Dia dianggap sebagai teman kuliah semata, karena Murtono sering membantu dalam studinya. Untuk menjadi kekasih nanti dululah, karena sepertinya lelaki ini tak masuk kriteria. Yang Mimi tidak suka, cowok ini suka emosian, mudah tersinggung. Belum jadi apa-apanya sudah sok ngatur ini dan itu. Kalau dipanggil harus datang, memangnya DPR ngajak RDP apa? Ini beda sekali dengan penilaian Murtono. Bagi dia, cintanya pada Mimi tinggal ketok palu saja. Maka beberapa hari lalu dia nekad menyatakan cintanya, bla bla bla! Untuk menolak serta merta, Mimi tak enak juga, sehingga katanya: “Saya belum memikirkan perkawinan, karena konsentrasi

pada kuliah dulu, Mas.” Rupanya Murtono tersinggung atas ucapan itu, menganggap bahwa Mimi menolak cintanya mentah-mentah. Padahal dia sudah membayangkan, sebelum Oktober 2014 harus sudah menjadi suami istri bersama Mimi. Karena gadis itu tak juga mau memberi ketegasan, mental “ratu sabrangan”-nya muncul. Dia ambil pisau, dan dihunjamkan ke perut Mimi. Ketika gadis itu ambruk, dia malah mengambil HP dan uangnya sebanyak Rp600.000,- dan langsung kabur meninggalkan korban. Mimi ditemukan seseorang dan dilarikan ke RSUD Abdulmuluk Bandar Lampung. Pak Dahlan orangtuanya tentu saja kaget, ketika diberi tahu polisi putrinya KO di rumahsakit. Kondisi Mimi kini kritis, tapi sempat cerita bahwa yang melakukan Murtono teman kuliahnya. Berdasarkan laporan itu ditambah buktibukti yang ada, kini Murtono sedang dicari-cari polisi. Kalau “ratu sabrangan” pasti punya Togog, dia.(int)

Ini Bukan ‘Ratu Sabrangan’ DALAM dunia perwayangan, ratu sabrangan (raja negeri seberang) akan ngamuk jika lamarannya ditolak. Rupanya Murtono, 24, begitu juga kelakuannya. Sakit hati Mimi, 21, gadis idola menolak cintanya, langsung emosi. Cewek teman kuliah itu ditusuk hingga pingsan, sementara Murtono diudak-udak polisi Lampung Tengah. Dalam dunia pakeliran, politik menghalalkan segala cara biasa dilakukan oleh tokohtokoh ratu sabrangan. Dia akan menantang perang dan mengancam takbruki bathang sayuta (kukirim sejuta mayat) jika putri tuan rumah menolak lamarannya. Biasanya kemudian yang meladeni tantangan itu Gatutkaca atau Sencaki, dan setelah ratu sabrangan kalah, ajudannya si Togog dan Bilung ikutan lari terbirit-birit. Rupanya kelakuan Murtono menduplikasi ratu sabrangan dalam dunia perwayangan. Meski mukanya tidak merah

menyala, mata tidak melotot dan giginya juga tak ber-siung (taring), tapi mahasiswa perguruan tinggi swasta di Metro ini temperamental sekali. Tersinggung sedikit, marah. Maunya, siapapun harus tunduk pada keinginannya. Bahkan kepada cewek yang ditaksirnya, bisa juga dia berbuat kasar. Padahal Dasamuka dari Ngalengkadiraja, meski Dewi Sinta selalu menolak untuk disenggama, dia tak pernah

tega menganiaya. Murtono dewasa ini memang sedang kasmaran pada gadis Mimi, teman kuliahnya. Mereka kenal sudah lama, tapi baru nampak dekat setelah Idul Fitri kemarin. Ini nampak dari seringnya mereka jalan berdua, bahkan di Senin dia juga biasa “apel” di rumah Mimi, meski tanpa kerek bendera dan nyanyi lagu Indonesia Raya. Karena seringnya Murtono ke rumah di Dusun 4 Gayau Sakti, Seputih Agung,

Melati yang tidak berterima atas perbuatan pacarnya itu, akhirnya Melati memberanikan diri bercerita kepada orangtuanya atas apa yang dialaminya. Mendengar cerita Melati, orangtuanya pun langsung mendatangi Suyadi ke rumahnya di Jalan Sutomo, Kampung Jawa, Pematang Raya, Simalungun meminta pertanggungjawaban. Saat diminta bertanggungjawab atas perbuatannya, Suyadi malah menolak tidak mau menikahi Melati. Setelah mendengar jawaban dari Suyadi itu, orangtua Melati langsung berbalik pulang dan menuju Polres Simalungun membuat laporan pengaduan. Saat pemeriksaan, Melati mengatakan bahwa Suyadi mengajaknya melakukan hubungan suami istri di rumahnya dengan janji akan dinikahi. Selama 6 kali melakukan hubungan terlarang itu, semuanya berlokasi di rumah Suyadi. Anak kelima dari 7 bersaudara ini menceritakan, perkenalan pertama kalinya dengan Suyadi melalui telepon seluler (HP). Dimana, seorang temannya bernama Rendi Tampubolon selaku kernek mobil angkutan umum memberikan nomor HP-nya kepada Suyadi. Setelah ada komunikasi melalui HP, Suyadi pun menghubungi Melati dan mengajak untuk bertemu di Jalan Sisingamangaraja tepatnya di depan salah satu rumah ibadah. “Setelah kami bertemu pertama kali bulan Juni lalu, dia mengajak saya ke Siantar Plaza, untuk membeli jajanan. Sepulang dari Siantar Plaza, kemudian dia mengajak saya ke

Rajawali untuk makan malam. Usai makan malam, dia beranjak pulang ke raya,” terang Bunga. Menurut Bunga, setelah pertemuan pertama itu, dua hari kemudian Suyadi kembali menghubungginya dan untuk ketemu ditempat yang sama. Saat itu, Suyadi datang dengan menumpangi sepedamotor. Dengan sepedamotor itu, mereka berboncengan keliling pusat Kota Siantar. “Kami keliling Kota Siantar sampai larut malam. Karena sudah malam, saya takut pulang ke rumah. Lalu dia mengajak saya ke rumahnya di Pematang Raya. Setiba di rumahnya sekitar pukul 22.00 WIB, dia menyuruh saya supaya tidur. Tepatnya jam 24.30 WIB, dia membangunkan saya dan mengajak ke salah satu kios di samping rumahnya. Dikios itulah terjadi pertama kali hubungan suami istri itu,”paparnya. Bukan hanya sekali itu, sambung Melati, selama 6 kali melakukan hubungan intim, dia berjanji akan bertanggungjawab. “Sewaktu melakukan hubungan itu, dia berjanji akan menikahi saya. Tapi, saat ditanya keluarga saya dia mengelak dan tidak mau bertanggungjawab,”kesalnya. Kapolres Simalungun AKBP M Agus Fajar SIK saat dikonfirmasi melalui Kabag Humas AKP H Panggabean SH mengatakan telah memeriksa 3 orang saksi. Setelah pemeriksaan saksi dan berkasnya dinyatakan lengkap, kasus tersebut segera dilimpahkan ke Kejaksaan Simalungun untuk diproses lebih lanjut. (osi)

DOLOK PANRIBUAN- Truk Colt Diesel BK 8934 BJ yang dikemudikan L Sidabutar (43), warga Kelurahan Bahkapul, Siantar Sitalasari, terguling di Jalan Siantar Parapat KM 12, Nagori Tiga Dolok, Dolok Panribuan, Selasa (20/11) pukul 13.00 WIB. Truk ringsek, sementara supir mengalami luka ringan di kaki dan tangan. Informasi dihimpun METRO, awalnya truk yang mengangkut enam ton makanan ringan ini melaju dari arah Siantar menuju Parapat dengan kecepatan tinggi. Tiba dilokasi kejadian, mendadak truk tersebut oleng. Tak lama kemudian truk tersebut langsung menabrak beram jalan sedalam dua puluh centimeter di pinggir jalan umum ini. Sejurus kemudian, truk ini langsung menyeruduk pohon pinang di pinggir jalan hingga pohon tersebut tumbang dan truk ini terbalik dan ringsek di pinggir jalan. Warga yang melihat kejadian langsung berhamburan dan melihat kondisi para korban yang mengemudikan truk tersebut. Kejadian ini menyebabkan kemacetan panjang di Jalan Umum Siantar-Parapat karena lokasi dipenuhi warga. Tak lama kemudian dua petugas Unit Laka

Polsek Dolok Panribuan tiba dilokasi dan langsung mengatasi kemacetan. Sementara supir truk langsung dilarikan warga ke Puskesmas Dolok Panribuan karena mengalami luka-luka di kaki dan tangan. Hendra (34), warga Nagori Tiga Dolok, Kecamatan Dolok Panribuan mengatakan, saat kejadian supir truk ini tampak tergenjet pintu truk dan kakinya mengalami luka lecet. ”Saya menduga pengemudi truk ini mengantuk sehingga laju kendaraannya tidak stabil. Ini kan jalan lurus, bukan tikungan. Tadi ketika saya tolong, kaki supir itu terjepit pintu. Namun tidak terlalu berbahaya karena saat kejadian dia menggunakan sabuk pengaman, jadi sempat tergantung tadi dia,”katanya. Kaposlantas Polsek Dolok Panribuan Ipda H Ompusunggu membenarkan kecelakaan lalu lintas ini. Supir truk masih diperiksa, sementara kejadian ini merupakan kecelakaan tunggal dan supirnya masih dalam perawatan.”Kita akan periksa dulu supirnya dan memang kejadian ini tanpa ada lawan. Penyebab kecelakaan sejauh ini masih dalam penyelidikan kita,”katanya. (yan/osi)

SupirMengantuk, ColtDieselTerguling

PETANINYAMBI JURTULTOGEL SIANTAR – Mesron Siahaan (48) warga Jalan Manunggal Karya, Kelurahan Pematang Marihat, Kecamatan Siantar, diciduk dari salah satu warung di seputaran rumahnya. Pria yang sehari-harinya bertani padi ini ditangkap tangan sedang menulis angka tebakan togel, Senin (19/11) pukul 15.00 WIB. Informasi dihimpun, bahwa Mesron merupakan target operasional sat reskrim Polres Siantar. Sebab masyarakat di sana sudah sangat resah, akibat perbuatan Mesron yang setiap hari menulis angka tebakan jenis togel dan KIM. Untuk menangkap Mesron, polisi menyaruh sebagai pem-

beli togel. Saat Mesron mengeluarkan kertas dan pulpen untuk menulis angka tebakan polisi yang sedang menyaruh, polisi langsung menangkapnya. Ketika digeledah, dari kantong Mesron diamankan 2 unit Handphone berisi angka tebakan, serta uang ratusan ribu rupiah hasil penjualan togel. Kapolres Siantar AKBP Albert TB Sianipar SIK ketika dikonfirmasi melalui Kasat Reskrim AKP Daniel Marunduri mengatakan bahwa Mesron dan barang bukti 2 unit Handphone dan uang ratusan ribu rupiah telah diamankan. Saat ini Mesron masih dimintai keterangan untuk dilakukan pengembangan. (mag-05/osi)



21 November 2012

Rustam Terancam 20 Tahun Penjara Sambungan Halaman 1 Di hadapan majelis hakim yang diketuai Suhartanto, jaksa menuturkan pada tahun 2010 Dinas Pendidikan Sibolga mendapat alokasi dana untuk melaksanakan kegiatan pengadaan buku perpustakaan SD untuk 17 sekolah di Kota Sibolga. Kemudian ditandatangani surat perjanjian pemborongan antara Lamser Tinambunan dan Rafandi Malau selaku Wakil Direktur CV Alpha Centauri. “Penandatanganan itu diketahui dan disetujui terdakwa Rustam Manalu selaku kuasa pengguna anggaran,” terang jaksa. Dalam kontrak perjanjian, nilai anggaransebesarRp1,5miliaryang harus sudah selesai dan diserahkan kepada PPK selambatlambatnya tanggal 26 Desember 2010. Sesuai surat perintah mulai kerja (SPMK) No.027/3125.a/XI/ 2010 tanggal 26 November 2010 ditandatangani Lamser Tinambunan dan Rafandi Malau sebagai pelaksana pengadaan buku perpustakaan SD dimaksud. Waktu penyelesaiannya selama 30 hari kerja. Kemudian pada tanggal 20 Desember 2010, Rafandi Malau menerbitkan permohonan realisasi pencairan dana 100 persen dengan prestasi pekerjaan telahselesai100persen.Akantetapi dalam kenyataannya, pengadaan buku perpustakaan SD tersebut belumdiserahkankepadaLamser. Setelahpencairandana100persen dilakukan, ternyata Rafandi Malau

belum juga menyelesaikan pekerjaan sesuai perjanjian kontrak. “Bahkan, buku yang diserahkan Rafandi Malau kepada PPK tidak sesuai dengan apa yang tertuang dalam perjanjian kontrak,” beber jaksa. Berdasarkan hasil audit Badan Pengawas Keuangan dan Pembangunan(BPKP)Perwakilan Provinsi Sumut pada 22 Juli 2011 lalu diketahui akibat perbuatan terdakwa, negara dirugikan sebesar Rp570 juta. Di mana Rustam Manalu menyalahgunakan jabatannya dan Lamser Tinambunan bertanggung jawab dalam administrasi serta fisik pengadaan barang. Sedangkan Rafandi Malau tidak diketahui keberadaannya dan ditetapkan sebagai DPO (daftar pencarian orang). Akibat perbuatannya, Rustam Manalu dan Lamser Tinambunan didakwa melanggar Pasal 2 ayat (1) Jo, Pasal 3 Jo, Pasal 18 UU Nomor 31 Tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi yang telah diubah menjadi UU Nomor 20 Tahun 2001 tentang Pemberantasan Tindak Pidana Korupsi Jo Pasal 55 ayat (1) ke-1 KUHP. “Denganancamanmaksimal20 tahun penjara,” tandas jaksa. Kemudian jaksa mengaku akan menghadirkansedikitnya20orang saksi di persidangan berikutnya. Majelis hakim kemudian menunda persidangan pada Selasa (27/11) mendatang dengan agenda mendengarkan keterangan saksi. (gib/pmg)

Ambisi Habisi City Sambungan Halaman 1 percaya diri. Kami semua ingin merasakan sukses di Eropa, bukan hanya Mancini,” lanjutnya. Masalahnya, tantangan City sungguh berat. Saat menghadapi tekanan sebegitu besar, mereka tidak bisa turun dengan pasukan terbaiknya. Manajer City Roberto Mancini tidak bisa menggunakan tenaga Gael Clichy, Joleon Lescott, James Milner, Micah Richards, dan Jack Rodwell. Untungnya, performa City sedang mantap. Setelah kekalahan dari Ajax Amsterdam 1-3 (24/10), mereka tidak pernah tersentuh kekalahan. Dalam lima pertandingan terakhir, tim berjuluk The Citizens itu menang tiga kali dan dua kali seri. Performa hebat City itulah yang membuat bek Real Sergio Ramos agak heran mengapa mereka terseok-seok di Liga Champions. “Bagi saya agak mengejutkan mereka nyaris tersingkir dari Liga

Champions,” bilang Ramos, seperti dikutip Daily Mail. “City merupakan tim hebat, bukan hanya sekadar secara individu. Tetapi, hal seperti itu memangtidakmenjaminsuksesdi Liga Champions. Ini adalah grup yang berat dan semuanya punya kapasitas untuk lolos,” jelas bek timnas Spanyol itu. Berangkat ke Etihad Stadium, Real hanya butuh setidaknya seri untuk bisa lolos, asalkan Borussia Dortmund menang atas Ajax. Tetapi itu tidak menjadi alasan untuk bermain aman. “Real tidak pernah bermain bertahan. Itu bukan kebiasaan kami. Kami datang untuk menang,” kata Ramos. Senada dengan Ramos, gelandang asal Jerman Sami Khedira jugamenilaimerekaharusmenyerang melawan City. “Dortmund menunjukkan cara yang tepat mengalahkan mereka. Bermain kompak, berjuang untuk setiap bola,” katanya. (ham)

2 Pencuri Hp Ditembak Sambungan Halaman 1 Informasi dihimpun menyebutkan, kejadian bermula sekitar pukul 02.00 WIB dini hari. Saat itu, H Syahmolek dan istrinya sedang tidur. Mendengar suara berisik, Hj Anisa terbangun. Ternyata, dua pria sudah berada di lantai dua rumahnya dan sedang mengambil handphone (Hp) Nokia C3 yang diletakkan di kamar. Selanjutnya Hj Anisa berteriak maling, sehingga mengejutkan kedua pelaku dan langsung melompat dari lantai dua ke halaman rumah. Sementara di depan rumah, telah menunggu mobil yang telah dinyalakan dan kedua pria bersama mobil langsung tancap gas.

Warga yang mendengar teriakan Hj Anisa langsung mendatangi rumah korban, selang beberapa menit dua pengendara sepedamotor jenis Supra tanpa plat mendatangi kerumunan warga dan bertanya apa yang sedang terjadi. Keduanya membawa jerigen berisi bensin lima liter. Hj Anisa mengenali keduanya sebagai pelaku yang baru mencuri dari rumahnya, dari baju kotakkotak yang dipakai salah satu pria itu. Melihat gelagatnya dicurigai, keduanya langsung pergi. Curiga, warga langsung mengejar keduanya yang melarikan diri menuju Kabupaten Padang Lawas Utara (Paluta). Di perempatan jalan, mobil

warga berhasil mencegat sepedamotor, salah satu di antaranya berhasil melarikan diri. Sementara salah satu pencuri bernama Wahid (30), berhasil ditangkap warga. Kepada warga, Wahid mengaku minyak yang dibawa untuk mobil Toyota Avanza B 8907 HJ yang kehabisan minyak. Sementara Kapolsek Kotapinang, Kompol Janner Panjaitan menjelaskan, setelah mendapat informasi dari warga, pihaknya melakukan pengembangan di dua lokasi tempat kejadian perkara, yakni di simpang Dusun Padangri Kecamatan Kotapinang hingga Desa Siancimun, Kecamatan Holongan, Kabupaten Paluta. “Anggota sempat kejar-kejaran dengan

3 Rumah Terancam Roboh Akibat Longsor Sambungan Halaman 1 SIBOLGA- Tiga kepala keluarga yang berdomisili di lereng bukit Lingkungan V, Kelurahan Angin Nauli, Kecamatan Sibolga Utara sontak terkejut setelah mendengar suara reruntuhan material yang longsor tepat di halaman depan rumah mereka. Terlebih saat bongkahan material itu menghantam dapur satu rumah warga di bawah pebukitan itu. Bencana longsor yang terjadi Senin (19/ 11) pagi sekira pukul 06.00 WIB ini pun sontak membangunkan seluruh warga yang bermukim di sekitar lokasi kejadian. Akibat longsor ini, tiga rumah warga yang merupakan rumah tangga miskin (RTM) terancam roboh. Ketiga kepala keluarga yang terancam longsor rumahnya yakni, Resiga Utama Manurung (45), Najaro Jamili (47), dan Darman Sinaga (63). Saat ditanyai di kediamannya, Selasa (20/11), Resiga Utama menerangkan, longsor tersebut sangat membuat mereka khawatir. Saat ini halaman rumah mereka sudah terkena longsor. Bahkan, rumah Resiga tersebut posisinya sudah sangat kritis. Sebab tanah yang longsor tepat berada sejajar dengan dinding rumahnya. Dia mengatakan, sebelumnya tanah yang longsor tepat di depan rumah mereka ini dibuat tembok beton penahan tanah sepanjang 20 meter dengan ketinggian 2,5 meter. Diduga karena belakangan ini sering turun hujan, tembok penahan tanah yang dibangun sejak tahun 2004 itu longsor dan menimpa dapur rumah Herlan Matondang yang

berada di bawah kediaman mereka sekitar 25 meter. “Sebelum longsor, jarak dinding rumah ini hingga ke tembok penahan tanah berjarak sekitar 1 meter. Namun sekarang sudah terbawa longsor semua, hingga bekas longsoran sejajar dengan dinding rumah ini,” ungkap Resiga saat diwawancarai sambil menunjukkan bekas longsor. Karena itu, lanjut Resiga, mereka sangat khawatir tinggal di rumah ini. “Longsor yang kedalamannya sekitar 2,5 meter dan tepat sejajar dengan dinding rumah ini membuat kita khawatir jika terjadi longsor susulan dan bisa membawa separuh rumah ini,” ungkapnya. Darman Sinaga menambahkan, rumah dempet yang dihuni tiga kepala keluarga ini terancam dengan kondisi saat ini. Terutama bila sedang turun hujan. Sementara saat ini mereka mengaku belum mampu untuk membangun kembali tembok penahan tanah yang berada tepat di depan rumah mereka. “Cara satu-satunya sebenarnya harus ditembok kembali bekas longsoran ini. Namun karena terkendala biaya, sampai saat ini kami belum bisa berbuat apa-apa. Sementara ini, kami mencoba membendung tanah dengan kayu dan membuat tembok seperti terasering. Kalaupun itu tak cukup membantu mengatasi longsor, paling tidak kita berupaya dan berdoa semoga tak terjadi hal-hal yang tak diinginkan,” kata Darman. Roma Dona Manurung anak Resiga Utama saat ditanyai bagaimana perasaannya tinggal di kediaman mereka yang terancam roboh, mengaku hanya

pasrah. Dia mengungkapkan, mereka waswas saat datang hujan. “Yang kita khawatirkan saat turun hujan. Melihat kondisi pondasi rumah ini yang sudah sejajar dengan bekas longsoran, kita takut pondasi ini juga akan roboh karena sudah tidak ada penyangga lagi. Namun bagaimanalah, keluarga tidak mampu. Meski takut, kita pasrah saja,” ungkapnya. Mereka mengatakan, rumah Herlan Matondang yang berada di bawah rumah mereka juga terancam. Sebab, bila bekas longsoran ini tak segera ditembok, mereka khawatir terjadi longsor susulan dan arahnya nanti tepat mengarah ke rumah Herlan. “Kami sangat berharap bantuan semua pihak yang peduli. Terlebih kepada Pemko, kami sangat memohon bantuan. Bagaimanapun juga, mengingat biaya untuk perbaikan tembok penahan tanah ini cukup besar, kami tak mampu,” tutur mereka. Pantauan di lokasi kejadian, halaman rumah warga yang longsor panjangnya sekitar 20 meter dengan kedalaman sekitar 2,5 meter. Rumah Resiga Utama Manurung terlihat kondisinya sangat kritis dan dikhawatirkan akan roboh. Setelah kejadian ini, mereka mencoba menahan pondasi rumah Resiga dengan beberapa kayu yang dipancangkan ke tanah dan kemudian disanggahkan ke pondasi serta ditutup dengan seng agar tidak basah saat hujan turun. Sementara sebagian bekas longsoran dibedeng (tembok) dengan memancangkan kayukayu. (cr-1)

Dokter dari Medan Periksa Orang Gila di Tapteng Sambungan Halaman 1 “Kita lihat besok bagaimana pertimbangan mereka, apakah yang sudah berat itu akan dikirim ke rumah sakit jiwa di Medan, terus apakah yang sedang atau ringan memungkinkan ditangani di sini,” kata Margan seraya menyebutkan bila nanti tim dokter menimbang ada yang bisa

ditangani di daerah, maka pihaknya akan memfungsikan Puskesmas Pinangsori yang telah memiliki fasilitas rawat inap. Soal biaya, sambung Margan, akan ditampung melalui dana Jamkesda Tapteng TA 2013 mendatang dan dana Jamkesda provinsi. Sebelumnya, Bupati Tapteng Raja Bonaran Situmeang mengungkapkan, pelayanan tersebut

adalah bukti janjinya akan ada upaya pendataan dan pengobatan bagi penderita gangguan jiwa di Tapteng. “Besok kami mulai. Pemerintah daerah sangat serius mengatasi masalah ini. Jangan sampai tragedi di HKBP Ressort Simanosor, Desa Simanosor, Kecamatan Sibabangun terulang kembali,” tutur Bupati. (mora)

kedua tersangka. Dua tersangka yakni Memet (29) alias Bolot warga Karang Sari Desa Sabungan, Sei Kanan bersama rekannya Parju (22) warga Gunung Tua ditangkap di Desa Siancimun Kecamatan Holongan Kabupaten Paluta,” katanya. Dijelaskannya, kedua tersangka sempat mau melarikan diri dan melakukan perlawanan, akhirnya petugas pun melakukan penembakkan kepada kedua tersangka. “Ada empat tersangka, yang tertangkap ada tiga, sedangkan temannya berinisal S masih daftar pencarian orang (DPO). Barang bukti berupa linggis, handphone, senjata api, senjata mainan mirip mancis, pisau cutter, dan mobil Toyata Avanza diamankan,” katanya. (mhr)

Pemda Siap-siap Digugat Sambungan Halaman 1 “StandarPelayananMinimal(SPM) ini sudah terlaksana belum? Bagaimana pelayanan kita di bidang pendidikan dan bagaimana di bidang kesehatan?” ujar Menteri Dalam Negeri (Mendagri) Gamawan Fauzi dalam Rapat Koordinasi Nasional (Rakornas) Kediklatan Antar Kementerian/Lembaga dan Pemda Tahun 2012 di Jakarta, Selasa (20/11). Untuk itu sebagai langkah awal, Badan Pendidikan dan Pelatihan (Diklat) di daerah, menurut Gamawan, harus dapat lebih aktif lagi dalam menjalankan tanggung jawabnya. Sehinggamutumaupunkemampuan aparatur dalam memberdayakan daerah, dapat lebih baik lagi terlaksana. “Karena saat ini kita sedang menuju ke sana. Jadi siap-siap saja digugat kalau kita tidak melakukan (standar pelayanan minimal) tersebut,” katanya. Ia mencontohkan semisal kemampuan tenaga penyuluh pertanian di lapangan. Badan diklat di daerah maupun kementerian terkait, menurutnya perlu secara berkala memberimasukaninformasimaupun penambahan pengetahuan yang benar-benar dibutuhkan masyarakat. “Karenajangan-janganmalahpetaninya yang lebih tahu perkembangan daripadapenyuluhnya,”ujarnya. Selain itu Gamawan juga menilai, mungkinkedepanperluadasertifikasi bagi aparatur yang telah mengikuti diklat.Jikainidilakukan,makaiayakin semua kebutuhan yang diinginkan daerah akan segera terjawab. Karena paling tidak dengan adanya sertifikasi, dapat diketahui sejauh mana kemampuan aparatur yang ada. “Karena walau bagaimana pun, pemberdayaan daerah jauh lebih penting. Sebab saat ini kewenangan pusat jauh lebih sedikit,” pungkasnya. (gir)

Memasuki Era BUMN Multinational Corporation (2/habis) Sambungan Halaman 1 negeri yang berat itu, PT Timah tetap harus mengambil peran sebagai mesin pertumbuhan ekonomi nasional. Demikian juga PT Antam (Persero) Tbk. Harus mempercepat langkahnya untuk membangun pabrik alumina di Kalbar. Tahun depan PT Inalum di Sumut sudah kembali ke tangan pemerintah Indonesia. Siapa yang akan menjadi pemasok bahan baku untuk Inalum? Selama 40 tahun di tangan Jepang, tentu Jepanglah yang memikirkan pasokan untuk Inalum. Tapi, begitu kembali ke pemerintah Indonesia, harus ada yang menggantikannya. Kebetulan, Antam sudah berencana membangun pusatpeleburanaluminadiKalbar. Di samping Semen Gresik dan PT Timah, beberapa BUMN besar juga didorong untuk terus mengembangkan sayap. Kalau dulu kita dikenal sebagai suka menjual BUMN, kini berubah total: giliran BUMN yang beli, beli, beli. Dulu, setelah krisis, negara kita memang miskin dan lemah. Me-

Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan : Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana:... Kordinator Liputan Ridwan Butarbutar, Asisten Kordinator Liputan (Bonapasogit): Horden Silalahi. Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Marihot Simamora, Freddy Tobing, Milson Silalahi, Masril Rambe , Rinawati Marbun (koresponden barus), Jonter (Humbahas), Bernard Lumbangaol, Hengki Tobing (Taput), Hermanto Turnip. METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Pala Silaban, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Candro Purba, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina)

nggaji pegawai negeri saja hampirhampir tidak mampu. Pemerintah di waktu itu memilih menjual beberapa BUMN. Itulah yang menimbulkan kesan jual, jual, jual. Tapi, kejadian di masa lalu itu tidak perlu terus-menerus disesali. Kita tidak boleh terlalu larut dalam penyesalan. Apa yang telah terjadi di masa lalu harus jadi pendorong semangat untuk memperbaiki masa depan.Yang penting, kita tidaklagimengulangicarajual,jual, jual itu. Tahun depan PT Telkom (Persero ) Tbk juga mulai "membeli". PT Telkom melakukan ekspansi ke luar negeri: Timor Leste. Selama ini telekomunikasi Timor Leste dikuasai perusahaan Portugal. Tahun depan PT Telkom mulai beroperasi di Timor Leste. Tekad direksi Telkom tidak kecil: menguasai pasar telekomunikasi negara tetangga itu. PT Telkom, sebagaimana dikemukakan Dirutnya, Arief Yahya, punya kemampuan untuk itu. Kemampuan manajerial, peralatan, maupun pendanaan. Telkom yang kemampuan keuangannya melonjak tahun ini juga sedang menyiapkan langkah

METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Hotlan Doloksaribu Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani

ke beberapa negara tetangga, namunbelumperludisebutdisini. Dua bank besar kita (Bank Mandiri dan BRI) sebenarnya juga sangat mampu beli, beli, beli. Namun, di dunia perbankan aturannya amat ketat. Cabang Bank Mandiri di Singapura, misalnya, tetap masih dilarang menjadi bank umum yang bergerak ke ritel. Padahal, bankbank milik Singapura di Indonesia begitu bebasnya. Begitu juga di Malaysia. Begitu banyak larangan untuk bank kita di sana. Padahal, bank-bank Malaysia di Indonesia menikmati longgarnya aturan kita. Saya yakin, kalau mendapat perlakuan yang sama di Singapura dan Malaysia, Bank Mandiri, BRI, dan juga BNI bisa segera jadi jagoan kita di Asia Tenggara. Tahun depan memang akan menjadi tahun politik. Dunia politik akan bergejolak. Tapi, BUMN tidak boleh terpengaruh, apalagi terseret dan larut ke dalamnya. Di tahun depan yang bakal kian panas itu, BUMN harus tetap berada di jalur moto ini: kerja, kerja, kerja! (*)

Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli: Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon,Tamy Arfandhi (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



21 November 2012

Perlombaan Olahraga Meriahkan HUT Korpri Sambungan Halaman 8 Reformasi Birokrasi. “Sehingga diharapkan melalui tema itu, seluruh korps pegawai di Pemerintahan Kota Sibolga dapat menuntaskan pelaksanaan reformasi birokrasi di tempat kerja masing-masing,” tegasnya.

Menurutnya, hal itu sangat penting guna meningkatkan jalinan kerjasama produktif dengan semua pemangku kepentinga pembangunan, melanjutkan kerja keras dan kerja cerdas sebagai Abdi Negara, Abdi Masyarakat, Abdi Pemerintah. “Selain itu, hal ini huga guna memastikan Korpri

7 Anak Punk Ditertibkan Sambungan Halaman 8

menjadi anak punk yang dinilainya tak punya masa depan. “Kita minta dukungan dan partisipasi warga agar tidak dibiarkan anak-anak seperti itu. Jika memang anak ingin pengembangan di bidang seni, kan ada tempat dan jalurnya,” lanjutnya. Sijabat menambahkan, dalam pertumbuhan anak, para orang tua juga hendaknya berperan serta mengawasi

anak-anak, dan tidak membiarkan mereka minum-minuman keras malam hari di sekitar jalan-jalan yang ada di Sibolga. “Kita ingin agar anak-anak jangan minum-minuman keras di tengah jalan, sebab selain merusak kesehatan merekaanak, juga akan mengganggu para pengguna jalan. Hingga saat ini, sejauh yang kita ketahui mengenai anak punk, keberadaan mereka belum terorganisir di Sibolga,” pungkasnya. (son)

Kredit Macet Capai Rp1,5 Miliar

Sambungan Halaman 8

proses pengembaliannya sangat jauh dari harapan,” ujar Ichwan Simatupang kepada METRO, Selasa (20/11) di ruang kerjanya. Ichwan membeberkan, program dana kemitraan tersebut merupakan salah satu program yang di plot Pemko Sibolga guna membantu meningkatkan derajat perekonomian masyarakat, khususnya para pelaku usaha mikro dan kecil dalam pengembangan usahanya. Sangat disesalkan, banyak masyarakat yang enggan mengembalikan dana yang sudah diterima, dibuktikan tingginya angka tunggakan pembayaran dari masyarakat selaku debitur. “Dari total Rp 1,7 miliar lebih dana yang disalurkan, hingga saat ini baru sebesar Rp 200 juta lebih yang dikembalikan. Sementara Rp 1,5 miliar lagi masuk dalam kategori kredit macet,” jelas Ichwan. Berangkat dari pengalaman tersebut, sambung Ichwan, pada tahun anggaran 2012, Pemko Sibolga terpaksa bertindak lebih selektif dalam penyalurannya. Hingga posisi Oktober lalu, program dana kemitraan baru dapat diberikan kepada sebanyak 18 orang saja dengan jumlah pembiayaan yang variatif antara Rp 3 juta hingga Rp 10 juta perorang. “Total debitur yang sudah memanfaatkan pembiayaan dari program dana kemitraan sejak tahun 2009 lalu mencapai 225 debitur. Termasuk 18 orang debitur yang memeroleh realisasi pembiayaan senilai Rp 83 juta dari cadangan dana Rp 1 miliar pada TA 2012,” sebut Ichwan. Dia mengatakan, saat melakukan survey, petugas lapangan Disperindagkop dan UKM Sibolga bersama tim survey dari Bank Sumut cabang Sibolga yang di-

tunjuk Pemko Sibolga untuk menyalurkan dana kemitraan tersebut benar-benar selektif melakukan pendataan terhadap calon debitur. “Maka itu, debitur penerima dana kemitraan tahun ini merupakan orang-orang tepat dan dinilai paling layak dalam hal pengembangan usahanya. Sementara, pelaku usaha yang telah mengajukan permohonan untuk memeroleh dana kemitraan kepada kita, jumlahnya sudah mencapai ratusan orang,” tukas Ichwan. Sebarkan Imbauan Pengembalian Utang Terkait pengembalian dana kredit macet, Ichwan Simatupang menegaskan, dalam waktu dekat pihaknya akan membuat surat edaran sekaligus imbauan kepada masyarakat yang ikut memanfaatkan dana kemitraan tersebut untuk segera melakukan pembayaran. “Dana kemitraan ini bukan hibah atau bantuan cumacuma, melainkan dana bergulir yang dapat digunakan oleh masyarakat pelaku usaha lainnya. Karena semua masyarakat pelaku usaha memiliki hak yang sama untuk menggunakan dana kemitraan ini yang diprogramkan oleh Pemko Sibolga,” sebut Ichwan. Dia menambahkan, proses penagihan utang dari debitur yang menunggak akan menjadi program prioritas Disperindagkop dan UKM Sibolga. Maka itu, pihaknya mengimbau kepada seluruh debitur segera melakukan pembayaran cicilan kreditnya. “Daftar debitur yang menunggak pengembalian dana kemitraan dari Pemko Sibolga ini akan segera kita umumkan di seluruh kantor-kantor Kelurahan dan Kecamatan di Kota Sibolga, selain itu kita juga akan mengumumkannya di media elektronik,” tandasnya. (tob)

dapat tampil sebagai organisasi profesi yang ikut meningkatkan daya saing bangsa melalui kehadiran pelayanan publik yang berkualitas,” tandasnya. Sebelumnya, ketua panitia hut Korpri ke 41 di Kota Sibolga Juneidi Tanjung dalam laporannya menyampaikan, sejumlah cabang lomba yang di

pertandingkan dalam memeriakan hut Korpri ke41 di Kota sibolga, yang di ikuti seluruh SKPD di lingkungan Pemerintah Kota Sibolga. “Selain pegawai di lingkungan Pemko Sibolga, ada juga beberapa instansi vertikal yang ada di Kota Sibolga mengikuti perlombaan tersebut yakni pertandingan

futsal dan tenni meja ganda putra,” jelasnya. Untuk pemilihan pegawai terbaik, lanjutnya, akan di laksanakan hari Rabu (21/11), lari goni, master of ceremoni serta lomba dan joget di pertandingkan pada tanggal 22 Nopember 2012. “Diharapkan, dengan di adakannya perlombaan ini sema-

kin meningkatkan soliditas dan solidaritas, serta rasa kesetiakawanan anggota Korpri sekaligus meningkatkan kesehatan jasmani dan rohani anggota Korpri agar dapat bekerja lebih semangat sebagai pelayan publik di Kota Sibolga,” tandasnya. Menurutanya, puncak peringatan Hut Korpri ke-41 di Kota

Binner Siahaan di PAW Dari DPRD Sibolga Sambungan Halaman 8 terhitung sejak tanggal pengucapan Sumpah/Janji sebagai Anggota DPRD Kota Sibolga. Wakil Ketua DPRD Kota Sibolga Tonny Agustinus Lumbanto-

bing saat di konfirmasi via seluler membenarkan telah mengetahui soal Surat Keputusan Gubsu terkait peresmian pemberhentian dan pengangkatan anggota DPRD Kota Sibolga tersebut. “Memang saya belum meli-

hat surat dari Gubsu terkait PAW salah satu anggota DPRD Sibolga, sebab kami masih bintek di Jakarta,” tukas Tonny. Begitupun, sambung Tonny, dalam waktu dekat pihaknya akan membentuk Banmus

Masyarakat Diimbau Pro Aktif Baca DPS BARUS- Menjelang pemilihan Gubernur Sumatra Utara (Pilgubsu) tahun 2013 mendatang, seluruh masyarakat di Kecamatan Barus diimbau untuk pro aktif membaca daftar pemilih sementara (DPS) di setiap desa atau kelurahan. “Untuk memperlancar pelaksanaan Pilgubsu tahun 2013, kami mengimbau seluruh masyarakat di Kecamatan Barus ini agar pro aktif membaca, memeriksa dengan teliti apakah namanya sudah tercantum dalam DPS atau tidak,” ungkap anggota PPK Barus Saidil Amin Sinaga dan JA Waruwu kepada METRO, Selasa (20/11) di kantor PPK Barus. Menurut Saidil, hal ini perlu sebab misalnya jika nama seorang warga belum tercantum atau salah nama agar dapat di beritahukan kepada panitia pemilihan pemungutan suara yang ada di desa atau kelurahan. “Dengan begitu, kita dengan cepat bisa melakukan perbaikan sehingga masyarakat tidak ada yang di rugikan dalam hal hak suara dalam pilgubsu mendatang. Apalagi saat ini tahapan Pilgubsu sudah masuk dalam tahapan pengumuman dan pengesahan DPS,” tukas Saidil. Panitia Pemilihan Kecamatan (PPK) melalui PPS yang ada di desa dan kelurahan. Lanjutnya, sudah menempelkan DPS tersebut di tempattempat starategis misalnya di kedaikedai ataupun di kantor Kepala Desa dan Kelurahan. “Sebab masa tenggang waktu pengumuman DPS di mulai tanggal 12 hingga 30 November mendatang. Kemudian tanggal 1 hingga 3 Desember

masuk dalam masa perbaikan DPS dan tanggal 4 hingga 6 Desember masa pengumuman DPSHP (daftar pemilih sementara hasil perbaikan),” bebernya. Untuk itu, katanya, masyarakat masih memiliki waktu untuk melakukan pemeriksaan apakah sudah terdaftar namanya dalam DPS dan bila kemungkinan adanya perobahan atau perbaikan data di DPS, masyarakat dapat melaporkannya kepada PPS yang ada di desa maupun kelurahaan dengan membawa KTP, KK atau identitas lainnya.”Sedangkan pelaksanaan Pilgubsu sendiri akan di laksanakan tanggal 7 Maret 2013 mendatang. Namun batas waktu penetapan daftar pemilih tetap (DPT) baru akan dilaksanakan pada tanggal 29 hingga 30 Desember 2012,” tandasnya lanta mengimbau masyarakat untuk tidak menyia-nyiakan waktu yang ada. (mas/tob)

(Badan Musyawarah) DPRD Kota Sibolga guna membahas surat dari Gubsu tersebut untuk segera di paripurnakan. “Secepatnya kita akan membentuk Banmus untuk membicarakan surat dari Gubsu tersebut, sekali-

pencegahan terjadinya pelanggaran Pemilu pada Pemilihan Umum Kepala Daerah dan Wakil Kepala Daerah (Pemilukada), tanpa terkecuali di Pilgubsu 2013, khususnya politisasi PNS sebelum mulai tahap pendaftaran dan penetapan calon gubernur (Cagub) dan Wakil Gubernur Sumatera Utara (Wagubsu) 2013,” ungkap Ketua Panitia Pengawas Pemilihan Umum (Panwaslu) Provinsi Sumut David Susanto, Selasa (20/11). Maka dari itu, sambung David, Panwaslu telah mengeluarkan surat tertanggal 1 November 2012, No:/ PANWASLU-SU/XI/2012, tentang instruksi pengawasan terhadap netralitas PNS dan pejabat di BUMN/BUMD pada Pilgubsu 2013, yang ditembuskan kepada Panwaslu kabupaten/kota se-Sumut. “Panwaslu Kabupaten/Kota se-Sumut untuk memperhatikan banyak, pertama dalam UU No.43/1999 tentang perubahan atas UU No.8/1974 tentang pokok-pokok kepegawaian, yang mengatur pasal 3, 1) ayat (1), dimana PNS berkedudukan sebagai unsur aparatur negara yang bertugas untuk memberikan pelayanan kepada masyarakat secara profesional, jujur, adil dan merata dalam penyelenggaraan tugas negara, pemerintah dan pembangunan. Kemudian, 2) ayat (2), dalam kedudukan dan tugas sebagaimana dimaksud pada ayat (1), PNS harus netral dari semua pengaruh golongan dan partai politik serta tidak diskriminatif dalam memberikan pelayanan kepada masyarakat. Dan 3) ayat (3), untuk menjamin netralitas PNS dilarang menjadi anggota dan/atau anggota partai politik,” rinci David. Lebih lanjut, David menerangkan, pada pasal 26, ayat (2) disebutkan, PNS

bersumpah/janji akan senantiasa menjunjung tinggi kehormatan negara, pemerintah dan martabat PNS, serta akan senantiasa mengutamakan kepentingan negara dari pada kepentingan pribadi, seseorang atau golongan. Untuk sanksi yang mestinya diberikan bagi PNS yang tetap bersikukuh, dan larut serta memberi dukungan kepada pasangan calon yang bersaing, disesuaikan dengan pasal 4, angka 15 Peraturan Pemerintah (PP) No.53/2010 tentang disiplin PNS, yang mengatur antara lain PNS dilarang memberikan dukungan kepada calon kepala daerah/ wakil kepala daerah, dengan cara, terlibat dalam kegiatan kampanye untuk mendukung calon, menggunakan fasilitas yang terkait dengan jabatan dalam kegiatan kampanye, membuat keputusan dan/atau tindakan yang menguntungkan atau merugikan salah satu pasangan calon selama masa kampanye; dan/atau. Selanjutnya, dilarang mengadakan kegiatan yang mengarah kepada keberpihakan terhadap pasangan calon yang menjadi peserta pemilu sebelum, selama, dan sesudah masa kampanye meliputi pertemuan, ajakan, imbauan, seruan, atau pemberian barang kepada PNS dalam lingkungan unit kerjanya, anggota keluarga, dan masyarakat. Humas Panwaslu Provsu, Fakhruddin menambahkan, PNS yang tidak menaati ketentuan tersebut dijatuhi hukuman disiplin dengan tingkatan hukuman disiplin sebagai berikut, hukuman disiplin ringan, yakni teguran lisan, teguran tertulis dan pernyataan tidak puas secara tertulis. Selanjutnya, lanjut Fakhruddin, hukuman disiplin sedang, yakni penundaaan kenaikan gaji berkala selama satu tahun dan penurunan

pangkat setingkat lebih rendah selama satu tahun. Dan hukuman disiplin berat, yakni penurunan pangkat setingkat lebih rendah selama tiga tahun, pemindahan dalam rangka penurunan jabatan setingkat lebih rendah, pembebasan dari jabatan, pemberhentian dengan hormat tidak atas permintaan sendiri sebagai PNS dan pemberhentian tidak dengan hormat sebagai PNS. “Hukuman disiplin sedang dijatuhkan bagi pelanggaran terhadap larangan memberikan dukungan kepada calon kepala daerah/wakil kepala daerah dengan cara terlibat dalam kegiatan kampanye untuk mendukung calon kepala daerah/wakil kepala daerah serta mengadakan kegiatan yang mengarah kepada keberpihakan terhadap pasangan calon yang menjadi peserta Pemilu sebelum, selama, dan sesudah masa kampanye meliputi pertemuan, ajakan, imbauan, seruan, atau pemberian barang kepada PNS dalam lingkungan unit kerjanya, anggota keluarga, dan masyarakat sebagaimana dimaksud dalam Pasal 4 angka 15 huruf a dan huruf d,” jelas Fakhruddin. Fakhruddin menerangkan, untuk hukuman disiplin berat dijatuhkan bagi pelanggaran terhadap larangan antara lain, memberikan dukungan kepada calon kepala daerah/wakil kepala daerah, dengan cara menggunakan fasilitas yang terkait dengan jabatan dalam kegiatan kampanye dan/atau membuat keputusan dan/atau tindakan yang menguntungkan atau merugikan salah satu pasangan calon selama masa kampanye sebagaimana dimaksud dalam Pasal 4 angka 15 huruf b dan huruf c. Selain itu, tambah Fakhruddin lagi, juga dilarang melakukan penggunaan fasilitas dan anggaran pemerintah dan pemerintah daerah, yang antara lain penggunaan

gus juga untuk membahas tentang penjadwalan Rapat Paripurna Istimewa DPRD Kota Sibolga dalam rangka pengucapan sumpah dan janji anggota DPRD yang menggantikan Binner Siahaan,” tandasnya. (tob)

Pemko Anggarkan Dana Rp1 Miliar Sambungan Halaman 8 lokasi pusat pasar tradisional yang menjadi tempat kebanggaan warga untuk berbelanja. “Selama ini, kita banyak menerima keluhan dari warga baik pedagang maupun masyarakat umum yang berbelanja di Pasar Sibolga Nauli, bahwa kondisi pasar tersebut semakin tidak representative. Maka itu, kita terus berjuang dan mengusulkan anggarannya supaya dapat ditampung melalui APBD Kota Sibolga TA 2013,” ujar Ichwan seraya berharap, dengan alokasi dana sebesar Rp1 miliar tersebut, Pasar Sibolga Nauli menjadi pasar yang bersih dan tertata dengan baik.

Beberapa waktu lalu, sambung Ichwan, sejumlah anggota DPRD Sibolga dari Komisi II Jimmy Ronald Hutajulu, Pantas Lumbantobing, Hj Syurianty Sidabutar, Herri Yon Marbun di dampingi Wakil Ketua DPRD Imran Simorangkir, sudah melakukan peninjauan ke Pasar Sibolga Nauli. Saat kunjungan tersebut, anggota dewan juga mendukung upaya penataan, rehabilitasi atau perbaikan terhadap sejumlah fasilitas yang mengalami kerusakan, sekaligus meminta seluruh pedagang kaki lima yang tidak berjualan di tempat yang telah ditentukan supaya ditertibkan. (tob)

Guru Berperan Mencerdaskan Anak Bangsa Sambungan Halaman 8 hiran,” ungkap Syarfi dalam makalah berjudul Be a genious Teacher (Mendidik dengan Kreatif) yang di bacakan Sekda Kota Sibolga M Sugeng dalam Seminar Pendidikan dalam menyambut Hut PGRI tahun 2012 di Kota Sibolga. Menurutnya, belajar merupakan proses membangun makna atau pemahaman oleh si pembelajar/guru terhadap pengalaman dan informasi yang disaring dengan persepsi, pikiran, perasaan. “Belajar berarti memproduksi gagasan yang diasumsikan sebagai proses individual, proses social, menyenangkan, tak pernah berhenti, membangun makna, sedangkan pembelajaran adalah merubah dari konsep belajar ke pembelajaran untuk mengembangkan keterampilan sikap dan pemahaman,” katanya seraya menambahkan pembelajaran memungkinkan seorang guru menggunakan berbagai sumber alat bantu belajar supaya lebih menarik, menyenangkan dan efektif. Pembelajaran itu sendiri, sambungnya, dibagi menjadi dua yakni pembelajaran interaktif

PNS Bisa Diturunkan Pangkat atau Dipecat Sambungan Halaman 1

Sibolga akan di gelar tanggal 26 Nopember mendatang di gabung dengan peringatan Hut PGRI dan Hari Guru Nasional. “Pada puncak acaranya nanti, kita akan memberikan bingkisan kepada 72 orang purna bhakti PNS yang pensiun TMT 29 Nopember 20121S/D 29 Nopember 2012,” tandasnya. (tob)

fasilitas pemerintah dan pemerintah daerah berupa sarana mobilitas seperti kendaraan dinas meliputi kendaraan pejabat negara dan kendaraan dinas pegawai, serta alat transportasi dinas lainnya. Sama halnya dengan gedung kantor, rumah dinas, rumah jabatan milik pemerintah, milik pemerintah provinsi, milik pemerintah kabupaten/kota, kecuali daerah terpencil yang pelaksanaannya harus dilakukan dengan memperhatikan prinsip keadilan. Dan sarana perkantoran, radio daerah dan sandi/telekomunikasi milik pemerintah daerah provinsi/kabupaten/ kota, dan peralatan lainnya, serta bahanbahan. Hal yang sama juga adalah dilarang menggunakan dan/atau memanfaatkan dana yang bersumber dari keuangan pemerintah dan pemerintahdaerahbaiksecaralangsungmaupun tidaklangsung. “Dalam mengawasi netralisasi PNS dalam rangka Pilkada, serta penggunaan fasilitas dan anggaran pemerntah dan pemerintah daerah tersebut, menggunakan strategi pencegahan pelanggaranyaitustrategipencegahapelanggaran administrasi dan pidana dilakukan dengan tindakan, langkah-langkah, dan upaya optimal mencegah secara dini terhadap kemungkinan timbulnyapotensipelanggarandan/atauindikasi awal timbulnya pelanggaran tersebut," terangnya lagi. Fakhruddinmengemukakan,PanwasluProvsu jugamengimbauataumengingatkanmelaluisurat resmikepadaBupati/Walikotadiwilayahmasingmasing,agarmelarangPNSterlibatdalamPilkada sesuai peraturan perundang-undangan, dan melarang PNS menggunakan fasilitas dan anggaran pemerintah dan pemerintah daerah untukkepentingancalonkepaladaerahdanwakil kepaladaerah.Sertamempublikasikan(konferensi pers, press release, red) imbauan dan peringatan tersebutuntukmeresponisuspesifikyangmuncul. Mensosialisasikan imbauan dan peringatan tersebut, secara hirarkis kepada Panwaslu di wilayahnya masing-masing agar dipahami dan mendapatperhatiankhusus.(ari)

yang memberikan kesempatan pada siswa untuk menjalin kerja sama yang bermakna dengan teman dan guru. Sedangkan pembelajaran inspiratif adalah pembelajaran yang mendorong dan memicu mahasiswa untuk mencari temukan hal-hal yang baru dan innovativ. “Agar pembelajaran efektif, guru harus memperhatikan efisiensi waktu, memberikan panduan tugas yang jelas, yang memungkinkan murid dalam suasana tanpa tekanan, bebas, terlibat secara psikis dan fisik. Sedangkan ciriciri pembelajaran yang kreatif adalah melatih kebiasaan mengarah kepada kebersihan, keindahan, kerindangan, ketertiban, keamanan, dan kekeluargaan. Di mana suasana pembelajaran, hendaknya menyenangkan, mengaswyikkan, mencerdaskan dan menguatkan,” tandasnya. Hadir dalam acara tersebut, Kadis Pendidikan Kota Sibolga Alpian Hutauruk, Asisten II Pemko Sibolga Junedi Tanjung, Zulkifli Simatupang dosen Biologi Unimed sebagai nara sumber, para kepala sekolah, guru-guru serta para pelajar di Kota Sibolga. (son/tob)

11 Terjangkit AIDS, 4 Meninggal Sambungan Halaman 1 2011, jumlah penderita yang sudah positif sebanyak 8 orang, dan 3 diantaranya meninggal dunia. Untuk 2012 meningkat menjadi 11 orang sampai September lalu dan 4 orang meninggal dunia. Ini adalah jumlah penderita yang mau berobat dan bersedia untuk didata, sedangkan yang tak mau atau yang tersembunyi pasti ada,” kata Kadis Kesehatan Tapteng melalui Kepala Bidang Pengendalian Kesehatan, drg Megawati Tarigan di ruang kerjanya, Selasa (20/11). Dikatakan Mega, masalah AIDS ini adalah bagaikan fenomena gunung es, yang kelihatan sedikit yang tidak kelihatan sangat banyak. Hal itu bisa saja disebabkan karena rasa malu sehingga tidak mau memeriksakan dirinya. “Kita sudah melakukan pendekatan kepada masyarakat khususnya yang bekerja di lokalisasi agar mau memeriksakan dirinya, tapi banyak juga yang merasa malu atau merasa minder. Tentu hal itu tidak dapat kita paksakan. Kalau tidak dilakukan pemeriksaan manalah bisa kita ketahui seseorang itu menderita penyakit HIV/AIDS,” ungkapnya. Meski demikian, lanjutnya, pendekatan secara konseling tetap dilakukan Dinas Kesehatan kepada masyarakat khususnya yang bekerja di lokalisasi dan juga di kafe-kafe, agar mau memeriksakan dirinya. Dan untuk saat ini RSUD Pandan sudah memiliki Klinik Fisity dan gratis untuk melakukan pengecekan. “Jadi kepada masyarakat yang ingin memeriksa dirinya atau merasa curiga dengan kesehatannya, silahkan langsung cek ke Klinik Fisity, karena kerahasiaan pasien terjaga di sana, sehingga tak perlu merasa malu jika datang berobat. Dengan adanya hasil dari pemeriksaan itu, maka sudah ada kepastian dan tidak perlu lagi ragu-ragu,” terangnya. Ditanya apakah penyebaran penyakit mematikan itu di Tapteng karena narkoba atau hubungan seks? Menurut Mega, dari data yang mereka peroleh, rata-rata penderita di Tapteng dikarenakan hubungan seks. Belum ada yang ditemukan karena jarum suntik narkotika, karena masalah harga barang haram tersebut. Untuk itu pihaknya mengimbau masyarakat, agar berhatihati dan menjaga diri. “Kalaupun terpaksa melakukan hubungan seks di lokalisasi harus pakai pengaman demi kenyamanan dan keselamatan,” tandasnya. (nasa)


21 November 2012

Binner Siahaan Di-PAW Dari DPRD Sibolga SIBOLGA- Anggota DPRD Kota Sibolga dari Partai Gerakan Indonesia Raya (Gerindra) Binner Siahaan dalam waktu dekat bakal resmi diganti. Hal ini menyusul dengan turunnya Surat Keputusan dari Gubernur Sumatera Utara (Gubsu) Nomor 188.44/693/KPTS/Tahun 2012 Tentang Peresmian Pemberhentian dan Pengangkatan Anggota DPRD Kota Sibolga. Dalam isi surat itu, Gubsu memutuskan memberhentikan dengan hormat Binner

Siahaan SE dari kedudukannya sebagai Anggota Dewan Perwakilan Rakyat Daerah

(DPRD) Kota Sibolga, disertai ucapan terimakasih atas pengabdian dan jasa-jasanya

selama menjadi anggota DPRD Kota Sibolga. Pada poin selanjutnya dalam Surat Keputusan tersebut menyatakan, mengangkat Irsan Wahyudi Simatupang sebagai Pengganti Antar Waktu Anggota Dewan Perwakilan Rakyat Daerah Kota Sibolga ‹ ‹ Baca

Binner ...Hal 7

Guru Berperan Mencerdaskan Anak Bangsa


„ Kadis Pendidikan Sibolga dan Sekda Kota Sibolga terlihat berbincang-bincang sebelum acara seminar dalam rangka HUT PGRI di gelar, Selasa (20/11) di Sibolga.

SIBOLGA- Wali Kota Sibolga HM Syarfi Hutauruk menegaskan, guru adalah pendidik profesional dengan tugas utama mendidik, mengajar, membimbing, mengarahkan, melatih, menilai dan mengevaluasi peserta didik pada pendidikan anak usia dini jalur pendidikan fomal, pendidikan dasar dan pendidikan menengah yang bertujuan

mencerdaskan anak bangsa. “Guru mempunyai peranan yang sangat besar dalam mendidik murid-murid sejalan dengan falsafah pendidikan kenegaraan yang berarti “Built the nation”. Profesi keguruan menuntut guru-guru melengkapi diri mereka dengan pelbagai pengetahuan dan kema‹ ‹ Baca

Guru ...Hal 7

(foto: milson silalahi)

„ Tujuh anak punk yang ditertibkan oleh aparat Satpol PP Sibolga.

7 ANAK PUNK DITERTIBKAN SIBOLGA- Personel Satpol PP Sibolga menertibkan tujuh anak punk yang berkeliaran di sekitar pasar malam Sibolga Square dalam razia rutin, Sabtu (17/11). Ketujuh anak punk tersebut, tiga orang dari Medan yakni IK (21), SM (22) dan Man (21). Satu dari Dumai yaitu Fe (25), satu dari Kabupaten Tapteng, De (17), dan dua dari Kota

Sibolga masing-masing Os (25) dan Bu (19). Kepala Satpol PP Sibolga Singkat Sijabat, Senin (19/11) mengatakan, dari tujuh anak punk tersebut, beberapa di antaranya sudah beberapa kali pernah diamankan namun masih kembali berkeliaran. “Operasi rutin yang kita laksanakan bertujuan agar anak-anak punk tidak ada lagi

di Sibolga, dan yang berasal dari luar kota dapat kembali ke daerahnya masing-masing. Sedangkan yang tinggal di Sibolga dikembalikan kepada orang tuanya,” jelasnya. Tujuan lain operasi rutin ini, sebut Sijabat, agar dapat mengarahkan anak-anak ke arah masa depannya, bukan justru ‹ ‹ Baca

7 Anak ...Hal 7

Perlombaan Olahraga Meriahkan HUT Korpri SIBOLGA- Berbagai kegiatan olahraga, di antaranya tennis meja, lari goni, futsal, dan lainnya meriahkan rangkaian peringatan hari ulang tahun Korps Pegawai Republik Indonesia (Korpri) ke 41 di Kota Sibolga. Acara itu sendiri di buka Sekda Kota Sibolga Mochamad Sugeng yang mewakili Wali Kota Sibolga HM Syarfi Hutauruk, Selasa (20/11) di lapangan Simaremare Kota Sibolga. Dalam sambutannya yang di bacakan Sekda, Wali Kota Sibolga mengatakan Hut Korpri ke 41 tahun 2012 senagaj mengambil tema Pemantapan Jiwa Korps Pegawai Republik Indonesia Guna Mempercepat ‹ ‹ Baca

Perlombaan...Hal 7



„ Sekda Kota Sibolga Mochamad Sugeng melakukan tendangan pertama pertandingan soccer dalam rangkaian memperingati Hut Korpri ke 41, Selasa (20/11).

Pemko Sibolga Selektif Salurkan Dana Kemitraan Kepada UKM

Kredit Macet Capai Rp1,5 Miliar SIBOLGA- Kepala Dinas Perindustrian Perdagangan Koperasi dan Usaha Kecil Menengah (Perindagkop dan UKM) Kota Sibolga Ichwan Simatupang mengungkapkan, tahun ini Pemerintah Kota (Pemko) Sibolga telah men-

cadangkan dana sebesar Rp 1 miliar dari Anggaran Pendapatan dan Belanja Daerah (APBD) untuk disalurkan kepada pelaku usaha mikro dan kecil (UMK). “Tetapi dalam proses penyalurannya, kami terpaksa

ekstra hati-hati dan lebih selektif. Pasalnya, sejak program dana kemitraan ini digulirkan kepada masyarakat pelaku UMK pada tahun anggaran 2009 silam secara bertahap, ‹ ‹ Baca

Kredit ...Hal 7

Rehab Pasar Sibolga Nauli

Pemko Anggarkan Dana Rp1 Miliar SIBOLGA- Pada tahun anggaran 2013 mendatang, Pemko Sibolga akan mengalokasikan dana sebesar Rp 1 miliar lebih untuk rehabilitasi pusat pasar tradisional yaitu Pasar Sibolga Nauli. Dana tersebut dikhususkan untuk perbaikan seluruh lantai yang mengalami kerusakan, termasuk atap pasar yang bocor-bocor. “Alokasi dana sebesar Rp1 miliar lebih tersebut sudah kita usulkan untuk ditampung di APBD Kota Sibolga TA 2013, mudah-mudahan mendapat persetujuan dari Badan Anggaran (Banggar) eksekutif (Pemko) dan legislatif (DPRD) Sibolga,” ungkap Kadis Perindagkop dan UKM Sibolga Ichwan Simatupang kepada METRO, Selasa (20/11) di ruang kerjanya. Ichwan mengatakan, Pemko


„ Sejumlah pengunjung bertransaksi jual-beli kebutuhan bahan makanan di Pasar Sibolga Nauli. Tahun 2013, Pemko Sibolga menganggarkan dana Rp1 miliar untuk penataan dan rehabilitasi pasar tersebut. Sibolga terus berupaya memberikan pelayanan terbaik kepada masyarakat. Salah satunya

melalui upaya pembenahan ‹ ‹ Baca

Pemko ...Hal 7



METRO BONAPASOGIT Teraktual dari Tarutung, Balige, Humbahas dan Samosir

Rabu, 21 November 2012

Foto: Juandi Sihombing

Pelaku Curanmor Teriaki Polisi Perampok PETUGAS NYARIS DIMASSA

TEWAS: Jasad SS saat berada di Puskesmas Sigompul, Kecamatan Lintongnihuta.


TARUTUNG- Diteriaki perampok oleh pelaku curanmor, petugas Polsek Adiankoting, Kabupaten Taput, nyaris menjadi bulan-bulanan warga saat berusaha meringkus IC (25) di rumahnya Kampung Batak Sibolga, Selasa (20/11) sekira pukul 05.00 Wib. IC sendiri merupakan salahsatu sindikat pencurian sepedamotor di wilayah Taput.

Warga Titipan Tewas Gantung Diri di Sel HUMBAHAS- Dilaporkan melarikan gadis di bawah umur, SS (21) warga Desa Lumban Julu, Kecamatan Lintongnihuta, Kabupaten Humbang Hasundutan, nekad mengakhiri hidupnya di sel tahanan Polsek Lintongnihuta, Selasa (20/11) sekira pukul 03.30 Wib. SS sendiri telah dilaporkan

Kapolsek Adiankoting AKP Viktor Simanjuntak kepada METRO, Selasa (20/11) di Mapolres Taput mengatakan, selain IC, dua rekannya terlebih dahulu dibekuk polisi. Adalah ABD (27) dan EP (27), keduanya warga Sibolga.

ke pihak Kepolisian Rokan Hilir, Pekan Baru. SS dituding melarikan Bunga (14) warga Pekan Baru. Kapolsek Lintongnihuta AKP A Pangaribuan kepada METRO membenarkan bahwa almarhum merupakan titipan warga karena

„) Baca Pelaku ..Hal 10


Resahkan Warga

„) Baca Warga .Hal 10

Foto Bernad L Gaol

DIGIRING: Ketiga tersangka curanmor saat digiring ke Mapolres Taput, Selasa (20/11).

Foto Hermanto Turnip

„ Lahan pertanian masyarakat sengaja dilengkapi pernak pernik bertujuan untuk mengusir hama burung yang melanda beberapa desa di Tobasa, Selasa (20/11).

Pulang Main Bola, Pelajar SMA Tewas

Hama Burung Resahkan Petani TOBASA- Puluhan petani padi di Tobasa dibuat kewalahan akibat serangan hama burung yang memakan bulir padi yang sedang menguning. Serangan burung terjadi di beberapa desa dan kecamatan. Petani mengaku serangan hama burung ini tidak bisa dikendalikan karena jumlahnya tidak sedikit dan bergerombolan.

Berbagai cara telah dilakukan oleh petani seperti layaknya kebiasaan membuat orangorangan di lahan, mendinding dengan plastik sampai membuat jaring agar burung tak bisa masuk. Namun upaya itu belum sepenuhnya berhasil. Karman Hutagaol, warga Du-

„) Baca Hama ...Hal 10

Ketersediaan Pangan Tobasa Terus Meningkat BALIGE- Ketersediaan pangan pokok berupa beras, jagung dan ubi hasil produksi Kabupaten Toba Samosir, terus meningkat setiap tahun. “Ketersediaan pangan dapat terpenuhi sejalan dengan peningkatan produksi padi, jagung dan ubi, sebab pertanian merupakan andalan dalam menggerakkan roda perekonomian daerah,” kata Kepala Kantor Ketahanan Pangan Toba Samosir, Marsarasi Simanjutak di Balige, Senin (19/11).

Edisi 126 „ Tahun IX


Menurut dia, ketersediaan pangan perlu terus ditingkatkan guna menjamin konsumsi pangan yang cukup, menuju kemandirian sebagai upaya mencegah terjadinya krisis pangan di daerah berpenduduk 175.277 jiwa di Kabupaten dekat pinggiran Danau Toba itu. Setiap tahun, lanjutnya, produksi padi terus meningkat yakni tahun 2009 sebanyak 103.760 ton, pada 2010 meningkat jadi 105.389 ton serta pada 2011 menjadi 117.582 ton. (ant/int)


RUMAH DUKA: Suasana haru di rumah duka almarhum Ebenezer Sitorus, Selasa (20/11).

BONATUA LUNASI- Ebenezer Sitorus (17), pelajar SMA Negeri Pardinggaran tewas setelah sepedamotor jenis Honda Revo BB 6446 EC yang ditumpanginya bersama rekannya Parsaoran Nainggolan (14), siswa SMPN Lumban Julu, laga kambing dengan truk fuso BB 9053 FA di Jalan Lintas Sumatera, Desa Lumban Lobu, Kecamatan Bonatua Lunasi, Kabupaten Toba Samosir, Senin (19/11) sekira pukul 18.00 Wib. Almarhum Ebenezer Sitorus sendiri telah dimakamkan, Selasa (20/11) di Desa Silamosik, Kecamatan Porsea, Toba Samosir. Sedangkan rekannya, Parsaoran Nainggolan masih kritis akibat mengalami luka dalam di bagian dada, masih dirawat di salahsatu rumah sakit di Kota Pematangsiantar. Informasi dihimpun METRO dari

„) Baca Pulang ...Hal 10

TARUTUNG- Aktivitas galian C di perbukitan Sitakka, Kecamatan Tarutung, Kabupaten Tapanuli Utara dinilai meresahkan masyarakat. Selain menyebabkan kerusakan jalan, juga dikhawatirkan dapat menimbulkan bencana longsor. “Aktivitas galian C itu bukan hanya mengancam kelestarian lingkungan saja, tetapi lalu lintas truk pengangkut material galian juga turut mempercepat kerusakan infrastruktur jalan. Memang belum ada longsor, namun apabila

„) Baca Resahkan ...Hal 10

Foto Bernad L Gaol

TRUK: Satu unit truk membawa muatan berupa tanah yang diduga dari perbukitan Sitakka. Akibat truk tak ditutup membuat tanah berserak di jalan.

Saul Situmorang Dilantik jadi Sekda Humbahas DOLOK SANGGUL- Saul Situmorang SE MSi resmi dilantik menjadi Sekretaris Daerah (Sekda) Humbahas, Selasa (20/ 11) di Pendopo Kantor Bupati Humbahas, Bukit Inspirasi, Dolok Sanggul. Saul dilantik Wakil Bupati Humbang Hasundutan Drs Marganti Manulang. Bersamaan dengan pelantikan Saul, 19 pejabat eleson IV jugaturut dilantik. Acara pelantikan dihadiri Kapolres Humbahas AKBP Heri Sulesmono, para pejabat Pemkab Humbahas, serta keluarga yang dilantik. Saul Situmorang sendiri, dilantik berdasarkan keputusan Plt Gubernur Sumatera Utara Gatot Pujo Nugroho Nomor :821.23/4612/2012. Sebelumnya, Saul menjabat sebagai Kepala Badan

Foto: Horden Silalahi

Perencanaan Pembangunan Daerah (Bappeda) Humbahas. Wakil Bupati Humbahas Marganti Manulang usai pelantikan menegaskan, agar para pejabat yang baru dilantik khususnya Sekda Saul Situmorang, mengemban tugas secara profesional, jujur dan bertanggungjawab. Selain itu, ia juga berharap, agar setiap pejabat di daerah itu, dapat bekerjasama dengan seluruh pegawai yang ada di lingkungan Pemkab Humbahas untuk mewujudkan visi kabupaten itu, yakni Menuju Humbang Hasundutan Yang Mandiri dan Sejahtera. Kata Marganti, jabatan bukanlah

LANTIK: Wakil Bupati Humbahas Drs Marganti Manullang saat melantik Sekda Humbahas yang baru, Saul Situmorang SE MSi, Selasa (20/11).

„) Baca Saul Situmorang .Hal 10


21 November 2012

Warga Titipan Tewas Gantung Diri di Sel Sambungan Halaman 9 dilaporkan melarikan anak orang tanpa sepengetahuan keluarga ke Lintongnihuta. “Senin (19/11) sekira pukul 21.00 Wib, warga Desa Pargaulan, Simpang Lintongnihuta menitipkan SS ke Polsek Lintongnihuta demi keamanan, karena takut dimassa warga. Begitu menerima laporan warga, kita langsung koordinasi dengan Kepolisian Rokan Hilir. Mereka berjanji akan segera menjemput SS untuk diperiksa. Karena sudah dilaporkan di sana, kita tidak melakukan pemeriksaan dan langsung kita masukkan ke ruang tahanan,” jelas Pangaribuan. Bahkan, untuk menghindari hal-hal yang tak diinginkan, sambung Pangaribuan, pihaknya langsung memberi arahan kepada SS. Bahkan, sebelum dimasukkan ke ruang tahanan, SS diminta melepaskan sebagian pakaian demi pengamanan sesuai dengan standar kepolisian. “Mencegah hal yang tak diinginkan SS dimasukkan ke sel hanya menggunakan kaos kutang dan celana dalam. Namun, dia gantung diri dengan kaos kutangnya sekira pukul 03.30 WIB. Padahal, anggota sudah rutin mengecek kondisi

korban. Bahkan, sekira pukul 03.00 Wib, petugas masih melihatnya tidur,” jelas Pangaribuan. Jasad SS sendiri, yang dibawa ke Puskesmas Sigompul, Kecamatan Lintongnihuta untuk divisum. Dari keterangan medis Puskesmas tidak ditemukan indikasi tanda-tanda kekerasan di tubuh korban. ”Tidak ada kami temukan unsurunsur kekerasan. Hanya bekas memar akibat jeratan di leher saja,” jelas dr Henri Hutasoit. Informasi lain yang dihimpun METRO, Selasa (20/11) di Polsek Lintongnihuta, SS sebelumnya telah dilaporkan keluarga Bunga di Riau. Setelah ditelusuri pihak keluarga Bunga, ternyata SS ketahuan berada di Lintongnihuta bersama Bunga. Mengetahui informasi itu, keluarga Bunga langsung menghubungi salah seorang keluarga yang kebetulan berada di Lintongnihuta. Tidak menunggu lama, SS pun berhasil dicegat dan ditangkap warga di Desa Pargaulan, Simpang Lintongnihuta. Untuk menghindari amukan massa, SS langsung diserahkan ke Polsek Lintongnihuta, Senin (19/11) sekira pukul 21.00 WIB. (juan/des)

Pelaku Curanmor Teriaki Polisi Perampok Sambungan Halaman 9 “Tersangka mengaku baru sekali mencuri. Namun, kita tetap melakukan penyelidikan untuk mengungkap kebenarannya,” ujar Viktor Simanjuntak. Dikatakan, terkuaknya kasus ini berkat pengaduan salah seorang warga yang kehilangan satu unit kreta Supra X 125 BK 4223 AAG milik Joni Panggabean, Minggu (18/11) malam. Ironisnya, sehari sebelum para tersangka ditangkap, ketiganya baru saja beraksi di Desa Sibalangan, Kecamatan Adiankoting, Kabupaten Tapanuli Utara, Senin (19/11). “Penangkapan ini dilakukan setelah Polsek Adiankoting menyelidiki kasus hilangnya kreta Supra X 125 dengan nomor polisi BK 4223 AAG milik Joni Panggabean yang hilang Minggu (18/11) malam,” ujarnya.

Didampingi Kasubag Humas Polres Taput Aipda W Baringbing, Viktor menjelaskan, dari hasil penelusuran, petugas mencurigai tersangka lari menuju Sibolga dan langsung memburunya. Tepatnya di Desa Sitahuis, Tapteng perbatasan Sibolga-Adiankoting, masyarakat menggelar razia. “Saat itu, warga Sitahuis menggelar razia karena sering kehilangan ternak dari daerah itu. Mereka curiga kepada ABD dan EP, lalu menginterogasi keduanya. Kemudian warga menghubungi polisi. Sedangkan tersangka IC berhasil lari dengan sepedamotor hasil curian tersebut. ABD dan EP, saat itu juga langsung kita bawa ke kantor polisi untuk penyelidikan lebih lanjut,” ungkapnya. Kepada polisi, ABD dan EP mengaku baru saja mencuri kreta. Namun, kreta tersebut dibawa lari oleh IC. Berdasarkan keterangan kedua ter-

sun Sosor Dolok, Desa Hutagaol, Kecamatan Balige mengaku, jaring yang dia pasangbertujuanagarburungtidakmasuk danmemakanpadi. Selain itu, penggunaan jaring bisa juga agar burung tidak bersarang di lokasi itu. Dasarmemilikinalurimencarimakan,burungjustrudatangsecaragerombolandan hinggadiatasjaring.Dariatasjaringitulah denganbebasburungmemakanpadiyang siap panen. “Jumlahnya bisa mencapai ratusanekorhinggapdijaring,adajugayang lolos masuk melalui celah-celah jaring,” ungkap Karman, Selasa (20/11) di Sosor Dolok. Hamaburung,katanya,jugamenyerang tanaman padi petani di Desa Sianipar Sihailhail,KecamatanBalige.Samahalnya di desa lain, warga juga sudah melakukan berbagaiupayauntukmenghalau. “Sebulaninirutindijagajanganhabistotal,” ujar T Tumanggor, petani di Desa Sianipar Sihailhail. Dia perkirakan, akibat serangan hama burung tersebut, hasil panenmiliknyamengalamipenurunan. KepalaDinasPertanianKabupatenTobaSamosirParlindunganSimanjuntaksaat dikonfirmasimembenarkanhamaburung melanda beberapa daerah pertanian di Tobasa.

KataParlindungan,gelombangserangan hama burung tersebut dikarenakan daerah Kecamatan Laguboti, Porsea, Ajibatasudahselesaimelakukanpanen. Diperkirakan,burungburunginihijrah ketempatlainuntukmencaritempatpersediaanmakananyangbaru.Perkembangan hamaburunginidipengaruhiolehfaktor,di antaranya, kelangsungan ketersediaan makanan bagi burung selalu ada karena menyangkutpolatanam. “Disatudesasudahpanen,tetapididesa tetangga baru menguning. Karena ketersediaan makanan selalu tercukupi maka burung berkembang pesat. Itu lah kami selalu menyarankan agar pola tanam serempakdapatditerapkandiseluruhdaerah di Kabupaten Toba Samosir,” kata Parlindungan seraya mengatakan keuntungan pola tanam serempak juga dapat meminimalisirseranganpenyakitdanhama. Parlindungan juga menyampaikan, bahwa musim tanam di Desa Sianipar Sihailhail sempat mengalami keterlambatan,disebutkannyaketerlambatantersebut dikarenakan adanya pembangunan beberapa saluran irigasi seperti jitut dan jides. ”Setelah peningkatan saluran irigasi tersebut,sayayakin,kedepanmasyarakat petanidisanasudahdapatmengikutipola tanamserempak,”tambahnya.(cr-03)

tersangka mengaku mencuri sepedamotor dengan menggunakan kunci palsu. “Kami mencurinya pakai kunci palsu. Rencananya, hasil curian ini akan kami bagi rata,” terang IC kepada METRO. Ditanya sudah berapa kali menjalankan aksi serupa, IC mengaku baru sekali. “Baru sekali bang. Rencananya, sepedamotor itu akan kami jual dan hasil penjualan dibagi rata,” akunya. IC juga mengaku, melakoni pekerjaan itu berkat ajakan teman-temannya. “Ada sejumlah pemuda yang selama ini menjalankan kegiatan yang sama. Tetapi saya tidak tahu nama mereka,” ucapnya singkat. Untuk mempertanggungjawakan perbuatannya, para tersangka kini ditahan di sel tahanan Mapolres Taput. Mereka akan dijerat Pasal 363 ke3e KUHPidana dengan ancamana maksimal 7 tahun penjara. (cr-01/des)

Pulang Main Bola, Pelajar SMA Tewas Sambungan Halaman 9

Hama Burung Resahkan Petani Sambungan Halaman 9

sangka, petugas langsung melacak keberadaan IC di rumahnya. Ternyata benar, Selasa (20/11) subuh sekitar pukul 05.00 WIB, petugas berhasil menangkap dari rumahnya di Kampung Batak Sibolga. Hanya saja, saat penangkapan, petugas nyaris dimassa wargga karena diteriaki IC sebagai perampok. “Saat penangkapan IC, kita diteriaki rampok oleh IC dan melakukan perlawanan. Mendengar itu, warga setempat datang berduyun duyun. Beruntung kita cepat menunjukkan identitas, kalau tidak, kita bisa saja jadi korban amukan massa,” terangnya. Berdasarkan hasil pemeriksaan, tersangka menyimpan sepedamotor hasil curian tersebut di rumah temannya di Sibolga Kota. “Spedamotor curian itu kita sita dari salahsatu rumah teman tersangka,” ujarnya. Disela-sela pemeriksaan polisi,


„ Truk yang bertabrakan dengan sepeda motor korban. Insert: Sepedamotor korban.

sejumlah pihak menyebut, bahwa kedua korban baru pulang bermain sepakbola dari sekolah mereka. Tepat di Jalinsum Desa Lumban Lobu, kecelakaan pun terjadi. Namun, sejauh ini, belum diketahui siapa saksi mata atas kejadian tersebut. Pantauan METRO, Selasa (20/11) di rumah duka almarhum Ebenezer, teman satu sekolahnya didampingi sejumlah guru datang melayat. Teman korban tampak sedih dan menangis terisak, demikian juga kedua orangtua korban dan keluarga. Evi J Manurung, salahsatu teman satu sekolah korban, saat melayat ke rumah duka mengatakan, korban merupakan seorang siswa yang baik dan tidak pernah mendapat surat penggilan dari guru. “Saya terkejut mendengar berita ini, padahal pukul 16.00 Wib sampai pukul 17.30 Wib saya masih menonton mereka main bola di sekolah. Dia (almarhum Ebenezer-red) siswa yang baik, tidak pernah dapat surat panggilan dari guru,” ujar Evi dengan raut wajah sedih. Salah seorang petugas medis di Rumah Sakit Umum Daerah (RSUD) Porsea membenarkan almarhum sempat dibawa ke rumah sakit tersebut. Hanya saja, saat berada di ru-

mah sakit, almarhum sudah meninggal. “Saat dibawa ke rumah sakit, almarhum sudah meninggal dunia, sementara rekannya sedang kritis. Kemudian keluarga yang kritis itu membawanya ke salahsatu rumah sakit di Pematangsiantar,” kata petugas medis yang enggan disebutkan namanya. Sementara itu, Kapos Lantas Porsea Iptu D Aritonang membenarkan peristiwa lakalantas itu. Hanya saja, hingga Selasa (20/11), pihaknya belum tahu penyebab kecelakaan tersebut. Katanya, pihaknya masih melakukan penyelidikan dan olah Tempat Kejadian Perkara (TKP). ”Sejauh ini, penyebab kecelakaan belum dapat disimpulkan, petugas sudah mengamankan truk dan sepedamotor korban. Sedangkan sopir truk melarikan diri. Jadi, kita masih melakukan penyelidikan,” ujar Aritonang. Ia menambahkan, selain melakukan olah TKP, pihaknya kini sedang mengumpulkan keterangan dari sejumlah saksi terkait kasus kecelakaan itu. ”Kasus ini masih dalam penyelidikan dan pengembangan. Supir truk sedang kita kejar,” ucapnya. (jantro/hsl)

Saul Galian C di Perbukitan Sitakka Situmorang Resahkan Warga Sambungan Halaman 9 penggalian terus menerus dilakukan akan merusak lingkungan dan membahayakan warga sekitar,” kata Daut Liston Lumbantobing (41) salah seorang warga setempat kepada METRO, Selasa (20/11). Untuk itu lah pemeritah setempat diharapakan segera melakukan penertiban terhadap aktivitas pengerukan tanah di perbukitan Sitakka tersebut. “Pemkab Taput diharapkan berkomitmen atau berupaya menertibkan aktivitas pengambilan tanah di bukit itu. Aktivitas itu membuat masyarakat sangat resah,” ujarnya. Meski plegalitas galian tersebut tidak jelas, namun pihak Kecamatan Tarutung dinilai tidak mampu menertibkan aktivitas pengambilan tanah tersebut yang beroperasi di perbukitan Sitakka. “Camat Tarutung, sepertinya tidak berkutik terhadap pengusaha galian C. Sebab, galian C

nyata-nyata tidak ada rekomendasi izin dari warga setempat,” ucapnya. Menurutnya, sebelum aktivitas itu berlangsung, jalan menuju desa mereka lumayan bagus. Namun sekarang, jalan itu sudah sulit dilalui kendaraan akibat kerusakan ada dimanamana. Dengan kondisi kerusakan jalan itu warga menjadi kesulitan bila ingin melakukan perjalanan ke kota. Senada dikeluhkan H Lamhot Sinaga, warga lain. Dia mengatakan, sedikitnya 50 hingga 100 kali damtruk pengangkut tanah di kawasan itu lalu lalang setiap harinya. Bahkan, tak satu pun truk pengangkut tanah yang tertutup. Sehingga tanah muatannya kerap berserak di badan jalan. “Pengusaha yang mendapat hasil dari sini, sementara kami menghirup debu yang setiap hari beterbangan akibat galian itu,” tandasnya.

BRILIANT SERVICE Layanan Service Resmi Sibolga - Tapanuli Tengah DVD-TV-AC-Lemari Es-Mesin cuci DVD-TV-AC-Lemari Es-Mesin cuci

DVD-TV-AC-Lemari Es-Mesin cuci

Konka Elektroniks Home Teater Jl.Mojopahit No.107 Sibolga HP 0812 6546 161; 0852 9665 6161



Hub: Bp. ARI

Telp. 061 - 77064774; HP 0813 7729 4474

Pertama & Nomor 1 di Indonesia

Telah masuk Warna-warna baru dengan Motif-motif baru

Sementara Plt Camat Tarutung Renhard Lumbantobing belum memberi keterangan resmi terkait hal itu. Namun, salah seorang pegawai Kantor Camat Tarutung mengatakan akan menanggapi keresahan warga tersebut. “Nanti akan kita cek dan membuat surat larangan mengambil tanah dari kawasan itu,” singkatnya seraya menolak namanya dipublikasikan. Pantauan METRO, Selasa (20/11), pemilik truk membiarkan bak terbuka sehingga tanah berjatuhan dan bersera di jalan. Kondisi itu juga mengundang rawan kecelakaan bagi pengendara sepedamotor. Selain itu, kerusakan jalan terjadi di beberapa titik. Ruas Jalan Sitakka tampak mendaki dan menurun serta bergelombang dipenuhi dengan lubanglubang dengan kedalaman bervariasi antara 20 hingga 50 centimeter. Sebagian badan jalan juga amblas. (cr-01)


Sambungan Halaman 9 segalanya. Namun jabatan adalah kepercayaan dan tanggung jawab yang diberikan pimpinan kepada pegawai yang dianggap memiliki kemampuan secara universal. “Dengan demikian, saya berharap agar tanggung jawab dan tugas baru yang diberikan ini benar-benar dapat dilaksanakan dan dipertanggungjawabkan dengan baik demi kemajuan Humbahas,” imbaunya. Saul Situmorang sendiri, usai acara pelantikan kepada METRO mengatakan, tugas yang ia terima tersebut adalah tugas berat. Pasalnya, Pemkab Humbahas dalam usia ke-9 tahun, sudah mampu meraih sejumlah prestasi, yakni peringkat pertama Laporan Pengelolaan Pemerintahan Daerah (LPPD) atas Evaluasi Keuangan Pemerintah Daerah (EKPD) di Provinsi Sumatera Utara dua tahun berturut-turut, yakni Tahun 2010 dan 2011, serta yang terakhir, mendapat opini Wajar Tanpa Pengecualian (WTP) dari Badan Pemeriksa Keuangan (BPK) atas Laporan Keuangan Pemerintah Daerah (LPKD) Tahun Anggaran 2011. Untuk memimpin Pegawai Negeri Sipil (PNS) di Pemkab Humbahas, Saul menyebut, dia akan menerapkan motto 3 E, yakni Emotional Corps, Etika Pemerintahan dan Etos Kerja. “Artinya, seluruh pegawai di lingkungan Pemkab Humbahas harus benar-benar mempedomani tiga motto itu sebagai modal utama memajukan Humbahas ke depannya. Namun, saya tetap membutuhkan masukanmasukan yang baik dari masyarakat sehingga program-program yang baik selama ini, terutama keberhasilan yang sudah diraih Humbahas dapat dipertahankan,” ujar Saul. Terakhir, Saul juga berharap dukungan dan masukan dari seluruh pihak untuk menjalankan pelayanan pemerintahan di daerah itu.(hsl)




21 November 201 2



„ Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho ST.

„ Plt Gubsu H Gatot Pujo Nugroho didampingi Bupati Humbahas Maddin Sihombing dan pejabat lainnya disambut pelajar saat akan memasuki komplek SMAN 2 Lintongnihuta.

„ Kadis Pendidikan Humbang Hasundutan Drs Wisler Sianturi.

„ Bupati Humbang Hasundutan Drs Maddin Sihombing Msi.

„ Kepala SMA Negeri 2 Lintongnihuta Drs Nelson Tambunan MM.

Pengukuhan Siswa Sekolah Unggulan SMA N 2 Lintongnihuta

Raih Prestasi dengan Disiplin dan Takut Akan Tuhan

„ Plt Gubsu H Gatot Pujo Nugroho didampingi Bupati Humbahas Maddin Sihombing saat menerima pengalungan bunga.

„ Plt Gubsu H Gatot Pujo Nugroho saat menyematkan secara simbolis atribut siswa SMAN 2 Lintongnihuta.

„ Bupati Humbahas Maddin Sihombing saat menyematkan secara simbolis atribut siswa SMAN 2 Lintongnihuta.

„ 60 pelajar SMAN 2 Lintongnihuta yang akan dikukuhkan sebagai siswa angkatan pertama.

„ Maddin Sihombing, Plt Gubsu H Gatot Pujo Nugroho, Ketua DPRD Humbahas Bangun Silaban, anggota DPRD Sumut Aduhot Simamora.

„ Dua pelajar SMAN 2 Lintongnihuta, Christine Natalia Tripama Lumbantoruan dan Tamaguna Nainggolan berfoto dengan kedua orangtua usai pengukuhan.

„ Istri Bupati Humbahas Ny Anne Rosma Napitupulu, saat menyalam para orangtua siswa SMAN 2 Lintongnihuta.

„ Maddin Sihombing saat menyalam Jumaga Nainggolan, orangtua dari Tamaguna Nainggolan.

„ Plt Gubsu H Gatot Pujo Nugroho, saat menjadi inspektur upacara pada pengukuhan siswa SMAN 2 Lintongnihuta.

„Ketua DPRD Humbahas, Bangun Silaban, saat memasang jaket siswa SMAN 2 Lintongnihuta.

„ Pelajar asal Kecamatan Parlilitan saat memperagakan Tor-tor Sawan saat acara pengukuhan siswa SMAN 2 Lintongnihuta. Teks dan Foto : Horden Silalahi, Lokasi : di Lintongnihuta.

„ Mantan Sekda Humbahas Martuaman S Silalahi, Ketua PN Tarutung Rosmina, Sekda Humbahas Saul Situmorang.

„ Wakil Bupati Humbahas Marganti Manullang, Wakil Bupati Taput Bangkit P Silaban, Kapolres Humbahas AKBP Heri Sulesmono, dan Kasi Intel Kejaksaan Negeri Dolok Sanggul Ondo Purba duduk bersama.


21 November 2012

Interaktif Tapanuli Penggusuran Pedagang Pilih Kasih Pak Walikota yang terhormat, kenapa penggusuran pedagang kaki lima di Pasar Sibolga Nauli pilih kasih? Yang digusur hanya pedagang pakaian dan sendal saja, sementara pedagang lain tidak digusur. Mohon perhatiannya Pak. Pengirim: 085261259XXX

Tangkap Preman Peras Pedagang Bapak Kapolres Tapteng yang terhormat, kami atas nama pedagang Pasar Hutabalang minta tolong kepada Bapak. Tolong tangkap dan adili preman Pasar Hutabalang yang selalu memeras kami para pedagang. Kami sudah pernah melaporkannya ke Polsek Pinangsori, namun dia dilepaskan. Kami sangat mengharapkan kebijakan Bapak sebagai pimpinan tertinggi di Polres Tapteng ini. Terima kasih. Pengirim: 085296062XXX

‘Gua Maut’ Ancam Pengendara PANDAN- Sebuah lubang besar berdiameter sekitar satu meter di sisi ruas Jalan AR Surbakti Sihaporas, Sibuluan, Kecamatan Pandan, Tapteng, mengancam keselamatan pengendara. Parahnya, lubang yang membentuk gua itu sudah setahun dibiarkan begitu saja tanpa ada upaya perbaikan. Amatan METRO, libang ini terbentuk karena amblasnya

tanah yang mengakibatkan terjadinya lubang dengan ke-

dalaman sekitar 1 meter. Dulunya lubang ini merupakan parit yang kemudian ditimbun setelah adanya perbaikan Jalan AR Surbakti. Lubang yang berada pada sisi kanan jalan ini sangat membahayakan pengendara, terutama bagi yang melintas dari arah PLTA Sipan Sihaporas menuju jalan Padangsidimpuan.

Selain itu, kondisi jalan yang sedikit membelok ke kanan dari arah PLTA Sipan Sihaporas ini juga sangat membahayakan, di mana posisi lubang tersebut sudah memakan badan jalan sekitar 50 cm. Sementara tidak ada tanda-tanda adanya lubang pada jalan ini. Informasi dari sejumlah

warga, sudah banyak pengendara yang jadi korban dalam lubang ini. Ada yang terperesok ke dalam, ada juga yang terjatuh karena berusaha mengelakkan lubang itu, terutama waktu malam hari khususnya pengendara yang melintas dari arah PLTA Sipan Sihaporas menuju Jalan Padangsidimpuan. (cr-01)

KITA sangat menyayangkan pihak Dinas Pekerjaan Umum dalam hal ini dan juga Pemkab setempat. Jelas, lubang yang menganga pada sisi Jalan AR Surbakti ini sangat mengancam nyawa pengendara yang melintas. Seharusnya jalan ini diperbaiki atau paling tidak ditimbun. Kalaupun tidak mampu untuk menimbun jalan ini, sebaiknya diberikan tanda, agar pengendara yang melintas dapat mengetahui adanya lubang pada jalan ini.

Riston Sipayung, Warga

Tindak Lanjuti Kasus Judi Yang terhormat Bapak Kapolres Tapteng, tolong tindak lanjuti kasus ST dan marga Si yang ditangkap sedang bermain judi. Setelah satu malam ditahan di Polsek, kemudian dilepas lagi. Mereka itu oknum guru PNS SMP dan pegawai kantor pos. Terima kasih. Pengirim: 08236553XXX

Korban Pasang Gelora Butuh Perhatian Pak Walikota Sibolga, tolong diperhatikan para korban musibah pasang gelora di setiap tempat warga yang mengalaminya di Sibolga. Kami mengaharapkan kebijakannya Pak. Terima kasih. Pengirim: 082162962XXX

Kades Habis Masa Kerja Masih Dipakai Pak Bupati yang terhormat, kenapa masih ada kepala desa yang sudah habis masa aktifnya/kerjanya tapi masih dipakai juga di Kecamatan Sitahuis? Tolong diperhatikan Pak. Terima kasih. Pengirim: 081269125XXX

„ Jalan berlubang cukup dalam di sisi ruas Jalan AR Surbakti Sihaporas yang mengancam keselamatan pengendara. Warga berharap ada perbaikan.


Pemilik Rumah Bordil Jadi Kepala Daerah NEVADA - Lance Gilman, pengusaha rumah bordil yang sudah menyediakan lapangan pekerjaan kepada 80 orang pekerja seks komersil (PSK) terpilih sebagai Kepada Daerah Storey, Negara Bagian Nevada, Amerika Serikat (AS). Gilman menjadi pengusaha rumah bordil pertama yang terpilih sebagai kepala daerah. Pemilik rumah bordil The Mustang Ranch itu menjadi kepala daerah pertama yang memiliki latar-belakang sebagai pengusaha di sektor prostitusi. Nevada sendiri sudah melegalkan praktik prostitusi sejak 1971 silam.

Pria berusia 68 tahun itu merupakan seorang politisi Partai Republik yang mengaku cinta dengan Amerika. Saat berkampanye di wilayah yang dihuni 4 ribu jiwa, Gilman berhasil meraih 62 persen suara. ”Dia merupakan seorang

„ Lance Gilman. yang langka, tentu saja itu karena prostitusi merupakan bisnis ilegal di seluruh wilayah AS,

kecuali di wilayah pedalaman Nevada,” ujar sejarahwan Guy Rocha, Selasa (20/11). Gilman adalah seorang ayah dari empat orang anak dan kakek dari sembilan cucu. Salah satu putrinya bekerja di sektor usaha keluarganya. Sekira 20 rumah bordil dioperasikan secara legal di 10 wilayah pedalaman Nevada. Selain wilayah-wilayah itu, Las Vegas dan Reno juga menjadi wilayah yang menghalalkan praktik bisnis seks. Rumah bordil yang dikelola Gilman terletak di sepanjang

jalan antar-negara bagian dari wilayah timur Reno. Selama ini, rumah bordil Gilman sudah memberikan kontribusi sebesar USD5 juta atau sekira Rp48 miliar (Rp9643 per USD1) terhadap anggaran daerah. The Mustang Ranch juga mempekerjakan 44 orang karyawan tetap dan 80 orang PSK. Gilman menegaskan bahwa, 99 orang warga memandang rumah bordil itu bak bisnis pada umumnya. Namun Gilman mengaku, bisnis pelacuran adalah bisnis yang dapat membantu kesejahteraan AS. (oz/nik)

Primata Juga Alami Krisis Paruh Baya LONDON- Penelitian tentang primata menunjukkan hewan ini kemungkinan mengalami krisis paruh baya seperti halnya pada manusia. Para ilmuwan melakukan penelitian atas 500 simpanse dan orangutan di seluruh dunia.Para petugas dan sukarelawan diminta untuk menilai sikap primata yang mereka jaga, termasuk interaksi sosial.Sejumlah penelitian dalam sepuluh tahun terakhir menunjukkan kebahagian manusia cukup tinggi pada masa muda dan turun pada usia paruh baya kemudian naik lagi dalam usia tua. Hasil penelitian yang diterbitkan dalam jurnal Proceedings of the National Academy of Sciences menyebutkan pola yang sama terjadi pada simpanse dan orangutan yang tinggal di kebun binatang dan pusat penelitian di seluruh dunia.Andrew Oswald, peneliti dari Universitas Warwick, Inggris, mengatakan krisis paruh baya ini kemungkinan terjadi karena lingkungan primata serupa dengan interaksi sosial pada manusia. Masalah Biologi Oswald mengatakan kemungkinan primata juga merasa kecewa bila misalnya mereka tidak menjadi jagoan di dalam kelompoknya.Sementara peneliti lain, Profesor Alexander Weiss dari Universitas

„ Simpanse.

Edinburgh mengatakan hasil itu menunjukkan krisis paruh baya dapat diterangkan secara biologi dan fisiologi.”Di satu sisi kemungkinan ada faktor sosial yang memicu (kriris paruh baya) namun ada sesuatu yang lebih dalam pada penelitian ini dan mencakup sejarah evolusi manusia yang serupa dengan simpanse dan orangutan. Jadi, apa yang terjadi adalah masalah biologi,” kata Weiss. Primata yang diteliti termasuk 155 simpanse di kebun binatang Jepang, 181 ekor di Amerika dan Australia serta 172 orangutan di kebun binatang sejumlah negara termasuk Kanada dan Singapura.Tiga

kelompok primata yang diteliti menunjukkan binatang ini mengalami krisis paruh baya dengan titik nadir pada usia 28 dan 35 tahun sementara manusia pada umur antara 45 sampai 50 tahun. Paling Cerdas Simpanse betina berumur 20 tahun dari kawasan konservasi di Pulau Ngamba, Uganda, dinyatakan sebagai simpanse palingcerdasberdasarkanrisetMaxPlanck Institute for Evolutionary Anthropology di Leipzig. Natasha dinobatkan sebagai simpanse ‘genius’ setelah melalui beberapa tes. Beberapa tes yang dilalui antara lain tes

pengetahuan spasial, menghindari jebakan, mencari makanan serta mengenali warna, ukuran dan bentuk. Esther Herrmann dan Josep Call, para peneliti, mengidentifikasi kecerdasan hewan dengan cara melihat perilakunya. Di antaranya, apakah simpanse menggunakan peralatan untuk tujuan tertentu, pemahaman kuantitas serta kemampuan mengambil kesimpulan. Contoh simpanse cerdas yang pernah dijumpai adalah simpanse yang menggunakan peralatan untuk mendapatkan rayap. Simpanse mencabut batang pohon, membersihkannya dari daun dan membaginya menjadi dua sehingga salah satu ujungnya menjadi berserabut. Natasha terbukti bisa melewati serangkaian tes sehingga dinyatakan paling cerdas.Sebelumnya,iajugamenjadiberita besar dengan mampu melarikan diri dari kandang dikelilingi pagar listrik menggunakan batang pohon dan menggoda manusia untuk melemparkan makanan padanya hanya untuk menyemprotkan mair pada manusia yang tergoda. Penemuan kecerdasan Natasha membuktikan bahwa “genius” juga ditemukan di kalangan hewan. Namun, belum diketahui apa penyebab perbedaan kecerdasan pada hewan. (kps/nik)


PAMERAN-Pohon Natal sebagai pameran yang terbuat dari Lego dibangun di Manchenster, Inggris.

Lego Buat Pohon Natal Setinggi 9 Meter MANCHESTER - Sebuah pohon natal unik dibangun di Manchester, Inggris. Pohon natal itu memiliki tinggi 9 meter dan disertai 108 cabang pohon serta 450 pernak-pernik. Pohon natal terbuat dari 350.000 buah lego ini dipamerkan di Manchester Trafford Centre pada awal bulan ini. Menjelang Natal lazimnya banyak ulah unik yang dilakukan untuk merayakannya. Selain 108 cabang yang dihiasi dengan pernak-pernik 450 Lego dan lam-

pu-lampu berkelap-kelip, pengunjung juga bisa melihat ke Lego Harry Potter tokoh yang dibuat untuk menjaga pohon, Selasa (20/11). Sebelumnya pada tahun 2011, sebuah perusahaan mainan membangun pohon natal dengan tinggi 12 meter. Pohon natal itu terbuat dari 600.000 batu bata Lego di St Pancras International di London. Pohon itu juga dilengkapi 172 cabang dan lebih dari 1.000 pernak-pernik didalamnya. (oz/nik)


21 November 2012

Zaskia Sungkar

Gagal menikah dengan aktor muda Iko Uwais tak membuat Jane Shalimar larut dalam nestapa. Ia malah mendapatkan calon suami bukan sembarangan orang. Jane Shalimar segera naik pelaminan pertengahan Desember 2012. Ibu satu anak ini kabarnya akan disunting oleh Mahardika Soekarno Putra atau Didi, anak Rachmawati Sukarno Putri. Pasangan ini juga akan

Ketagihan Jalan di Catwalk

Berlenggak lenggok di atas catwalk bukan hal baru bagi Zaskia Sungkar. Tak heran, ketika diajak untuk memamerkan busana rancangan istri Indra Bekti, Adila Jelita, Zaskia tak bisa menolaknya. ”Ini bukan yang pertama aku jalan di catwalk. Kemarin sempat ikutan di Jakarta Fashion Show, itu baru pertama di event besar,” ujar Zaskia saat ditemui di acara fashion show, Indra Indri & Dilla Albis, Plaza FX, Jakarta, Selasa (20/ 11). Zaskia ketagihan saat menjajal catwalk di event besar JFW. “Pas ngerasain di JFW kemarin jadi ketagihan, enak juga, seru ternyata jalan di catwalk, deg-degan soalnya,” ujarnya malu-malu. Diungkapkan Zaskia, ia nyaris tak bisa menahan tawa saat tampil bersama Nycta Gina dalam fashion show kali ini. “Aku menahan ketawa, habis ada Gina, kocak, tapi seru sih,” tawanya. (nov/int)

SCORPIO (23 Oktober – 22 November) Karier: Cobalah lebih terbuka dalam menghadapi masalah Anda. Komunikasikan dengan atasan dan rekan kerja Anda. Asmara: Patah hati tidak membuat Anda menjadi tak bergairah. Dari sejumlah ‘fans’ Anda, ada yang berniat serius.

Paramitha Rusady akhirnya resmi bercerai dengan suaminya Nenad Bago. Setelah berbulan-bulan menjalani proses persidangan di Pengadilan Agama Jakarta Selatan, Mitha dan Nenad Bago diputus cerai oleh hakim. “Hari ini agendanya keputusan. Permohonan talak dikabulkan,” kata kuasa hukum Nenad Bago, Anthony Alexander SH saat dijumpai di Pengadilan Agama Jakarta Selatan, Selasa (20/11). Selain bercerai, ketua majelis hakim sudah mengabulkan

(20 Januari - 18 Februari)

Karier: Janganlah memaksakan diri menerima semua tawaran kerja di kantor. Mintalah waktu istirahat, sebelum kondisi Anda bertambah buruk. Asmara: Semakin hangat.


19 Februari - 20 Maret

Karier: Perkembangan karier Anda sangat cerah dan cukup menjanjikan di masa yang akan datang. Asmara: Sulit-sulit dahulu, bersenangsenang kemudian alias Anda harus berusaha lebih keras lagi untuk merebut hatinya.


dibahas oleh keluarga masingmasing. Lewat akun twitternya, Jane sempat mencetuskan tanggal pernikahannya dengan Didi, yaitu 12-12-2012. Wah, tanggal cantik dong? Mantan kekasih Iko Uwais ini sudah memesan kebaya pengantin dari desainer Anne Avantie. Dari pernikahan sebelumnya, Jane dikaruniai satu anak bernama Muhammad Zarno. (tr/int)

mengumpulkan buku yang ia baca sejak kuliah. Setahun belakangan, ia mulai tertarik dengan buku digital. Dan suaminya, Reza Gunawan, lah yang berjasa menginisiasi Dee. Bahkan ia sering membeli buku digital, jika tak ada buku yang ia maksud, barulah membeli buku konvensional. Sekarang, ia telah merasakan manfaat membaca buku digital. Ia tak “dijajah” oleh koleksi bukunya. Mau tak mau, penulis pun akan memasuki sebuah transisi. Dari buku konvensional ke teknologi buku digital. Penulis Supernova dan Madre ini mengatakan bahwa tiga tahun silam, dirinya belum melirik buku digital. Dengan membeli, lalu membaca buku konvensional, ia merasa ada kenyamanan dan romantisme tersendiri. Didukung pula, ia berkecimpung di dunia tulis menulis. Buku menjadi bagian dari pekerjaannya. (tr/int)

(21 Desember -19 Januari)

Karier: Perubahan jam kerja di kantor, membuat Anda repot membagi waktu untuk urusan kantor dan keluarga. Asmara: Tidak ada masalah, bahkan bisa dibilang semakin dekat.


Anto. Sebagai asisten, Anto juga tak tahu sejak kapan keduanya berkenalan dan resmi berpacaran. Rencana pernikahan itu dibenarkan Sunan Kalijaga, pengacara yang juga sahabat dekat Didi. Ia mengaku sudah mendapat kabar bahagia itu langsung dari yang bersangkutan. “Sebagai sahabat Didi dan Jane, saya menyambut positif kabar bahagia itu,” kata Sunan, Selasa (20/11). Menurut Sunan, rencana pernikahan mereka itu masih

Kegemarannya membaca dan profesinya sebagai penulis membuat Dewi Lestari menjadi kolektor buku. Namun, buku simpanannya seolah menjajahnya. Banyak ruangan habis karena bukunya yang jumlahnya sudah sangat banyak. “Buku menjadi bagian dunia pustaka, tapi lamalama saya dijajah sama buku. Perpustakaan saya menghabiskan space dari ruangan manapun,” ujar Dee, sapaan akrabnya di Jakarta. Maklum, sebagai seorang penulis, Dewi Lestari sangat gemar membaca buku. Ia rutin



menggelar prosesi lamaran. “Lamarannya mungkin akhir bulan ini (November),” ujar Anto, asisten Didi melalui sambungan telepon, Selasa (20/ 11). Namun Anto enggan menjelaskan lebih jauh soal tanggal serta tempat lamaran itu. Yang pasti, Jane sudah mulai mencari model kebaya di sebuah butik milik desainer ternama. ”Belum fitting tapi masih caricari (model) aja. Saya ikut nemenin Jane juga kok. Jadi memang belum fitting,” jelas

(21 Maret - 20 April)

beberapa keputusan yang sempat diajukan oleh kedua belah pihak. “Kesepakatan lain dikabulkan juga. Kita diminta untuk melakukan sesuai kesepakatan. Perjanjian untuk anak, nafkah, dan hak asuh,” jelas Anthony. (nov/int)

Karier: Berkat usaha Anda yang cukup gigih, maka hasilnya sudah mulai terlihat bagus. Asmara: Hari-hari bersamanya terasa manis dan sangat menyenangkan.


(21 April - 20 Mei)

Karier: Urusan pekerjaan Anda di kantor adem ayem dan tidak terlalu sibuk. Asmara: Pertemuan manis dengan seseorang membuat hidup Anda terasa lebih bersemangat.


(21 Mei - 20 Juni)

Karier: Banyak kejadian yang menyenangkan maupun yang menyebalkan. Hal itu akan membuat konsentrasi kerja Anda sedikit terganggu. Asmara: Semakin bersemi. Waspada, hal ini bisa membuat Anda lupa diri.


(21 Juni- 20 Juli)

Karier: Ada kesibukan baru yang akan segera menyita waktu Anda. Proyek ini kelak akan menjadi tambahan pemasukan bagi Anda. Asmara: Teman baru bertambah, ada yang ingin mendekati Anda. Tetapi jangan terlalu berbesar hati dulu.


(21 Juli-21 Agustus)

Karier: Beberapa pekerjaan yang tengah Anda lakukan dapat menimbulkan risiko. Berhati-hatilah dalam mengambil keputusan. Asmara: Berjalan lancar. Hanya saja, Anda harus bersikap sedikit lebih romantis.


(23 Agustus-22 September)

.Karier: Banyak dukungan dari teman dan anggota keluarga. Kondisi itu harus dipertahankan, supaya Anda tidak membuat kesalahan yang sama dua kali. Asmara: Siap-siap akan ada kejuatan dari pasangan Anda, yang selama ini ditunggu-tunggu.


(23 September - 22 Oktober)

Karier: Ada pekerjaan baru yang lebih menantang. Jika berhasil, promosi jabatan menanti Anda Asmara: Hampir tidak ada konflik. Tetapi jangan menurunkan perhatian Anda.


( 23 November - 20 Desember)

Karier: Kesibukan kerja semakin bertambah. Cari waktu untuk beristirahat. Asmara: Bertemu teman lama yang mengajak bernostalgia.

SETELAH menikah pada 29 September, pasangan Hollywood Anne Hathaway dan Adam Shulman ingin segera membangun sebuah keluarga. Anne pun berharap dirinya bisa hamil secepatnya. ”Aku ingin sekali punya bayi,” ujarnya seperti dilansir The Hollywood Reporter, Selasa (20/11). Bintang film ‘The Dark Knight Rises’ itu memang cukup lama memendam impiannya menjadi seorang ibu. Salah satu temannya mengungkapkan, Anne adalah perempuan tradisional. Ia hanya mau punya anak setelah resmi menikah. Anne dan Adam menikah setelah empat tahun berpacaran. Anne berhubungan dengan Adam setelah putus dari kekasih lamanya, Raffaello Follieri pada 2008 lalu. Mereka menggelar pernikahan secara tertutup di Big Sur, California. Kabarnya hanya ratusan orang saja yang menghadiri acara tersebut. (dtc/int)

ORANGTUA khawatir Gisel ‘Idol’ dilamar Gading Marten. Mengapa? ”Orangtuaku malah khawatir, aku kan, anak tunggal dan perempuan. Masih umur segini (21 tahun), dianggap masih kecil, jadi kekhawatiran banyak. Mereka kasih izin sih, tapi kasih wejangan banyak banget, selalu diingetin,” ungkapnya di Kebon Jeruk, Jakarta Barat, Selasa (20/ 11). Namun, bukan berarti Gisel tak boleh menikah dengan Gading.

Malahan, kedua orangtuanya ingin Gisel mandiri bersama Gading. ”Malah mama yang ngomong, dari dulu sebelum aku niat menikah. ‘Mama mending tinggal sendiri, pusing lihat kamu sama suami kamu’,” kata Giselle menirukan ucapan mamanya. Sengaja Bikin Gading Cemburu Ingin diperhatikan, Gisel ‘Idol’ sengaja membuat Gading Marten cemburu. ”Dia (Gading) susah cemburunya, kadang aku pancing-pancing biar dia cemburu,” ujar Gisel di RCTI, Kebon Jeruk, Jakarta Barat, Selasa (20/11). ”Aku senang kalau dia cemburu. Habis aku cemburuan dia nggak pernah cemburu,” imbuhnya. Namun, karena seprofesi, Gisel tak pernah marah karena cemburu berlebihan. (idc/int)

Rabu, 21 November 2012

„ Bupati Tapteng Raja Bonaran Situmeang meneteskan vaknisasi polio kepada balita pada Pencanangan Kesatuan Gerak PKK KB Kes dan Pelayanan KB Kontap Tapteng tahun 2012.

„ Bupati Tapteng Raja Bonaran Situmeang memukul gong Pencanangan Kesatuan Gerak PKK KB Kes dan Pelayanan KB Kontap Tapteng tahun 2012, Selasa (20/11).

Pencanangan Gerak PKK KB Kes & Pelayanan KB Kontap

Hanya Tapteng yang Miliki Badan KB & KS

„ Bupati Tapteng Raja Bonaran Situmeang memberikan vitamin C kepada perwakilan ibu hamil, dan balita.

„ Ketua TP PKK Tapteng Normaida br Simatupang

„ Bupati Tapteng Raja Bonaran Situmeang

KEPALA Badan Kependudukan dan Keluarga Berencana Nasional (BKKBN) Sumut Widwiono bangga terhadap Pemkab Tapteng sebagai satu–satunya daerah kabupaten/kota di Indonesia yang memiliki Badan Keluarga Berencana dan Keluarga Sejahtera (KB & KS). “Itu bukti bahwa Tapteng sangat fokus dan komit pada pelayanan KB dan KS.

„ Ketua TP PKK Tapteng Normaida br Simatupang meneteskan vaksinasi polio kepada bayi.

Kalau di daerah lain nama kantornya bercampur– campur entah gimana,” kata Widwionosaat menghadiri acara Pencanangan Kesatuan Gerak PKK-KB-Kes dan Pelayanan Kontap (Mow dan Mop) di Aula Bina Graha Kantor Bupati Tapteng di Pandan, Selasa (20/11). Acara itu dibuka secara resmi oleh Bupati Tapteng Raja Bonaran Situmeang. Widwiono juga bangga atas alokasi anggaran untuk Badan KB dan KS Tapteng yang terbilang cukup besar, Rp3 miliar pada TA 2013 mendatang. Sementara bila dibandingkan dengan daerah lain, hanya berkisar Rp50 juta-Rp100 juta saja. Minimnya dana itu membuktikan bahwa darah tersebut kurang komit menyukseskan program KB dan KS. “Terimakasih kepada Bupati Tapteng dan DPRD yang merealisasikan pembentukan Badan KB dan KS ini. Saya minta perda-nya, biar saya dapat

„ Kaban KB & KS Tapteng Budiman Ginting

membawanya ke Jakarta, mana tahu pemerintah pusat dapat menambah alokasi anggaran untuk Badan KB dan KS Tapteng,” ucap Widwiono. Dengan keberadaan Badan KB dan KS, masih Widwiono, maka cita-cita masyarakat Tapteng yang sejahtera kan lebih cepat tercapai. “Semoga dengan semangat ini, pemerintah daerah dan masyarakat hingga ke tingkat kelurahan/desa sukses menuju keluarga sejahtera,” ungkapnya. Widwiono meminta pemerintah daerah untuk membentuk Petugas Lapangan Keluarga Berencana (PLKB) di setiap kelurahan/desa, agar pelayanan PKK KB Kes mudah terjangkau masyarakat. Kemudian dia juga meminta pemberdayaan para bidan desa menjadi PLKB dan diberi sepedamotor dalam pelaksanaan tugasnya. Menurut Bupati Tapteng Raja Bonaran Situmeang, apa yang telah diupayakan dan dilakukan oleh pemkab Tapteng masih merupakan ikhtiar yang belum maksimal dan masih perlu dilahirkan berbagai kebijakan, strategi, program dan kegiatan lainnya untuk mendorong percepatan penurunan angka kelahiran dan upaya mengendalikan laju pertumbuhan penduduk serta menurunkan angka kematian ibu melahirkan. “Saya berharap, kegiatan ini dapat memberikan manfaat bagi masyarakat dan kepada kita semua dapat meningkatkan semangat dan motivasi dalam mengabdi dan membangun Tapteng yang maju, mandiri dan sejahtera. Kepada seluruh jajaran kecama-

„ Kadis Kesehatan Tapteng Margan Sibarani

tan dan tim penggerak PKK kecamatan yang berhasil melaksanakan kegiatan ini dengan baik, akan diberikan piagam penghargaan sebagai apresiasi terhadap upaya yang dilakukan,” ucap Bupati. Sebelumnya juga, Bupati mengatakan, pencanangan Kesatuan Gerak PKK KB Kes merupakan sebuah momentum yang memiliki nilai yang sangat strategis dalam mewujudkan keluarga kecil, sehat, bahagia dan sejahtera. Hal itu bila melihat angka laju pertumbuhan penduduk (LPP) Tapteng menurut hasil sensus penduduk tahun 2011 adalah sebesar 2,4 persen per tahun dan total fertility rate (TFR) sebesar 3,01 persen dengan jumlah penduduk sebanyak 349.363 jiwa. “Berulangkali dalam berbagai kesempatan saya mengatakan, pertumbuhan penduduk di Tapteng belakangan ini ibarat kanker yang perlu diantisipasi sesegera mungkin,” tandasnya. Turut memberikan sambutan/laporan Kaban KB dan KS Tapteng Budiman Ginting, Kadinkes Margan Sibarani dan Ketua Tim PKK Normaida br Simatupang. di kesempatan itu Bupati mengukuhkan Ikatan Penulis Keluarga Berencana (IPKB) Tapteng dan pengukuhan Kelompok Kerja Operasional Posyandu (Pokjanal) KB Kes. Kemudian pemberian vitamin secara simbolis kepada lima perwakilan ibu hamil dan obat cacing MP-ASI kepada balita. Usai kegiatan, Bupati bersama Kepala BKKBN Sumut dan rombongan meninjau pemasangan vaksektomi dan tubektomi terhadap 200 peserta akseptor mantap se-Tapteng di RSUD Pandan. (mora)

„ Penampilan fragmen yang bercerita tentang perbedaan keluarga KB dan non KB oleh siswa SMA Negeri 1 (Plus) Matauli Pandan.

„ Proses operasi vasektomi (pria) dan tubektomi (perempuan) yang dilakukan di RSUD Pandan. „ Bupati Raja Bonaran Situmeang bersama Ketua TP PKK Normaida br Simatupang bercengkrama akrab dengan para ibu-ibu peserta tubektomi.

„ Kaban KB & KS dan Kadinkes disaksikan Bupati menandatangani kesepakatan bersama mensukseskan program KB Kes di Tapteng.

„ Bupati Tapteng, Kepala BKKBN, Kaban KB dan KS Tapteng, dan Kadinkes Tapteng bersama para awak jurnalis Ikatan Penulis KB yang dikukuhkan.

„ Bupati Raja Bonaran Situmeang bersama Ketua TP PKK Normaida br Simatupang bercengkrama akrab dengan para ibu-ibu peserta tubektomi.

„ Kepala BKKBN Sumut Widiono berdialog dengan akseptor KB Kontap.

„ Para ibu-ibu peserta tubektomi dari berbagai kecamatan di Tapteng menyalami Bupati.

„ Raja Bonaran Situmeang dan rombongan Muspida menyapa para peserta KB Kontab warga Tapteng.










2 Man United







3 Chelsea







4 West Bromwich A 12






Jadwal Liga Champions Matchday 5 Kamis (22/11) Pukul 01.45 WIB: Porto vs Dinamo Zagreb Grup A Dynamo Kyiv vs PSG Grup A Arsenal vs Montpellier Grup B Schalke 04 vs Olympiacos Grup B Zenit St. Petersburg vs Málaga Grup C Anderlecht vs AC Milan Grup C Ajax vs Borussia Dortmund Grup D Manchester City vs Real Madrid Grup D

PENCETAK GOL NAMA 1 L Suárez 2 D Ba 3 R van Persie 4 Michu 5 E Džeko 6 M Fellaini

KLUB Liverpool Newcastle United Manchester United Swansea City Manchester City Everton

GOL 10 8 8 7 6 6

PREDIKSI SKOR Arsenal 2-0 Montpellier BURSA METRO Arsenal 0 : 1 ¼ Montpellier




12 11




2 Atlético Madrid







3 Real Madrid







4 Málaga








Winger Arsenal Aaron Ramsey mengatakan, timnya harus menang menghadapi Montpellier pada laga lanjutan Champions League di Emirates Stadium, Kamis (22/11) dinihari.


PENCETAK GOL NAMA 1 L Messi 2 Cristiano Ronaldo 3 R Falcao 4 Aduriz 5 G Higuaín 6 Negredo

KLUB Barcelona Real Madrid Atlético Madrid Athletic Club Real Madrid Sevilla

GOL 17 12 10 8 7 7

SERIA A ITALIA KLASEMEN SEMENTARA 1 Juventus 2 Internazionale 3 Napoli 4 Fiorentina

13 10 12 9 13 8 12 7

2 0 3 3

1 3 2 2

29-9 24-13 22-11 19-9

32 27 27 24

PENCETAK GOL NAMA 1 S El Shaarawy 2 E Cavani 3 E Lamela 4 A Di Natale 5 M Klose 6 D Milito

KLUB Milan Napoli Roma Udinese Lazio Internazionale

GOL 10 8 8 7 7 7

BUNDESLIGA KLASEMEN SEMENTARA 1 München 2 Schalke 04 3 Frankfurt 4 Dortmund

12 10 12 7 12 7 12 6

1 2 2 4

1 3 3 2

33-5 22-14 25-18 26-13

PENCETAK GOL NAMA 1 M Mandžukiæ 2 A Meier 3 S Kießling 4 Á Szalai 5 R Lewandowski 6 T Müller

KLUB Bayern München Eintracht Frankfurt Bayer Leverkusen Mainz 05 Borussia Dortmund Bayern München

GOL 9 9 8 8 7 7


31 23 23 22

osisi Arsenal masih belum aman, mereka berada pada posisi kedua dengan poin 7 terpaut1angkadariSchalkedanunggul 1 angka atas Olympiakos di klasemen sementara grup B. “Grup ini cukup ketat, jadi kami harus menang pada pertandingan itu. Kami berada di rumah, mudahmudahankamimeraihkemenangan untuk memantapkan posisi kami agarbisalolos.KetikabermaindiPerancis, kami dalam tekanan selama pertandingan dan kami mendapatkan hasil yang baik,” ujar Ramsey. Montpellier cuma mendapatkan 1 poin hingga saat ini, artinya Mapou Yanga-Mbiwa dan kawan-kawan dipastikan gagal lolos ke babak selanjutnya. “Mereka telah bersaing menghadapi setiap tim di grup ini dan mereka bisa menciptakan ancaman, tentumerekatanpabeban.Merekaakan membuktikan sesuatu, jadi kami harusmewaspadaiitu,”jelasRamsey mengenai calon lawannya itu. Pemain tim nasional Wales berusia 21tahunitusangatberharapagarThe Gunners dapat lolos sebagai juara grup demi menghindari tim unggulan lainnya, seperti Barcelona, pada babak knock out. “Kami finis kedua di grup pada beberapa musim lalu dan bertanding menghadapi Barcelona. Tapi yang terpenting kami harus lolos. Jika berhasilmakakamiakan percaya diri untuk menghadapi tim manapun di kompetisi ini,” tutup mantan pemain Cardiff City itu. Sementara striker Arsenal Olivier Giroudengganmemandangsebelah matamantantimnyaitukalaberjumpa tengah pekan ini.

The Gunners butuh kemenangan atas juara Prancis itu di Emirates, Kamis(22/11)dinihari.Dengantambahan tiga poin, Arsenal akan dipastikan akan menempati satu slot di babak 16 Besar. Sebaliknya kekalahan akan sangat berisiko bagi Arsenal. Apabila Olimpiakos bisa mengalahkan Schalke maka peluang lolos Giroud cs akan mengecil dan harus ditentukan di laga grup pamungkas. Setelahgagalmenangditigalagasebelumnya,moralArsenalkiniterdongrak usai memenangi derby London Utara versus Tottenham Hotspur pada akhir pekan lalu. Sedangkan Montpellier, yang dipastikan tak mungkin lagi lolos tengah terpuruk di kompetisi lokal dengan menduduki peringkat 14 klasemen Ligue 1. Melihat situasi ini, sepertinya skuad Ars e n e Wenger akan mudah

DATADAN FAKTA -Pertemuan pertama kedua tim terjadi pada September 2012 di Liga Champions, dimana Arsenal sukses menekuk Montpellier dengan skor 12. Saat itu Montpellier unggul lebih awal melalui gol Y Belhanda, namun terbalaskan dua gol oleh L Podolski dan Y Gervinho untuk kemenangan Arsenal. -Arsenal meraih dua kemenangan, dua kali imbang dan satu kali kalah dari lima laga terakhirnya. Liga Inggris pekan lalu mereka sukses meraih poin penuh saat berhadapan Tottenham Hotspur, dengan skor akhir 5-2. -Sementara Montpellier hanya memperoleh satu kemenangan, tiga kali seri dan kalah satu kali dari lima laga terakhir mereka. Terakhir kali Montpellier hanya berakhir imbang saat melawan Valenciennes di Ligue 1, dengan skor akhir 1-1. -Arsenal memiliki kinerja yang baik jika bermain di kandang, mereka meraih tiga kemenangan, satu kali seri dan satu kali menelan kekalahan dari lima laga kandang terakhirnya. -Sedangkan Montpellier memiliki performa yang cukup buruk jika bertandang ke markas lawan. Mereka belum pernah menang dari lima laga kandang terakhirnya, hanya menahan imbang tiga kali dan dua kali kalah. -Arsenal sementara di peringkat ke-2 klasemen Grup B dengan perolehan 7 poin dari empat pertandingan, selisih satu poin dari Schalke 04 di puncak klasemen. Sedangkan Montpellier di posisi ke-4 klasemen yang hanya mengoleksi 1 poin.

saja melewati hadangan Montpellier. Giroud, yang sudah mencetak tujuh gol sejak hijrah ke London, menolak meremehkan bekas klubnya itu. “Iniadalahlagawajibmenangbuat kami karena Arsenal harus lolos ke faseberikutnyadikompetisiini,”seru strikerinternasionalPrancisitudiThe Sun. “Montpellier tak punya apapun untukdipertaruhkanseakrangmereka sudah tersingkir tapi kami tetap harus berhati-hati karena saat itulah biasanya yang paling berbahaya.” “Mereka tidak tampil sebagai juara Prancis dengan tidak memiliki kualitas. Kami tidak boleh jemawa saat mereka menyambangi Emirates,” sahutGiroudsembarimemperingatkan. Montpellier Takut Kalah Gelandang Montpellier Younes Belhanda takut jika klub Perancis tersebut dapat kebobolan delapan gol saat menghadapi Arsenal di Liga Champions mendatang. Juara bertahan Ligue 1 itu hanya mendapatkan empat poin dari lima pertandingan di musim ini dan mendapatk a n kekalahan ketiga mereka di musim ini denganskor3-0 oleh tim yang baru mendapat promosi ke liga utama Reims hari Jumat lalu. Arsenal menaklukan Southampton dengan skor 6-1 di Premier League Sabtu lalu, dan Belhanda percaya Montpellier harus kembali ke performamerekasecepatnyadanmemperkuat mental mereka jika mereka ingin terhindar dari kekalahan di Stade de la Mosson. “Jikakamibermainsepertiini,kami akan kebobolan delapan gol,” ujar Belhanda. “Kamiharusmenunjukkansecepat mungkin bahwa kami seorang pria, karenakamiterlihatsepertianakkecil di lapangan. Kami tidak berbahaya, juga tidak cukup tajam.” Pelatih Montpellier Rene Girard mengatakan bahwa ia tidak menyadari timnya saat ini yang telah me-

KLASEMEN SEMENTARA LIGA CHAMPIONS Grup A No Team M 1 Porto 4 2 Paris Saint Germain 4 3 Dynamo Kyiv 4 4 Dinamo Zagreb 4

M 3 3 1 0

S 1 0 1 0

K 0 1 2 4

SG 6-2 10-2 5-7 0-10

Nilai 10 9 4 0

Grup B No Team 1 Schalke 04 2 Arsenal 3 Olympiacos 4 Montpellier

M 4 4 4 4

M 2 2 2 0

S 2 1 0 1

K 0 1 2 3

SG 8-5 7-6 7-7 5-9

Nilai 8 7 6 1

Grup C No Team 1 Málaga 2 Milan 3 Anderlecht 4 Zenit

M 4 4 4 4

M 3 1 1 1

S 1 2 1 0

K 0 1 2 3

SG 8-1 4-4 1-4 3-7

Nilai 10 5 4 3

Grup D No Team 1 Borussia Dortmund 2 Real Madrid 3 Ajax 4 Manchester City

M 4 4 4 4

M 2 2 1 0

S 2 1 1 2

K 0 1 2 2

SG 6-4 10-7 6-8 6-9

Nilai 8 7 4 2

Grup E No Team 1 Chelsea 2 Shakhtar Donetsk 3 Juventus 4 Nordsjælland

M 4 4 4 4

M 2 2 1 0

S 1 1 3 1

K 1 1 0 3

SG 10-6 7-5 8-4 1-11

Nilai 7 7 6 1

Grup F No Team 1 Valencia 2 Bayern München 3 BATE Borisov 4 Lille

M 4 4 4 4

M 3 3 2 0

S 0 0 0 0

K 1 1 2 4

SG 10-4 10-5 8-9 2-12

Nilai 9 9 6 0

Grup G No Team 1 Barcelona 2 Glasgow Celtic 3 Benfica 4 Spartak Moscow

M 4 4 4 4

M 3 2 1 1

S 0 1 1 0

K 1 1 2 3

SG 8-5 6-5 3-4 6-9

Nilai 9 7 4 3

Grup H No Team 1 Manchester United 2 CFR 1907 Cluj 3 Galatasaray 4 Braga

M 4 4 4 4

M 4 1 1 1

S 0 1 1 0

K 0 2 2 3

SG 9-4 5-6 4-5 5-8

Nilai 12 4 4 3

menangkan gelar juara pada musim lalu dan yakin timnya mungkin terlalu percaya diri sebelum dimulainya musim ini. “Kami seharusnya malu pada diri kami sendiri,” ujarnya usai kalah dari Reims. “Untuk pertama kali, saya menanyakan banyak pertanyaanpadadirisayasendiri.Merekatelahmelupakan beberapa nilai.” (int)

HEAD TO HEAD 18 September 2012 : Montpellier 1 – 2 Arsenal, Liga Champions 5 PERTANDINGAN TERAKHIR ARSENAL : 17/11/2012 : 10/11/2012 : 06/11/2012 : 03/11/2012 : 30/10/2012 :

Arsenal Arsenal Schalke 04 Man United Reading

5–2 3–3 2–2 2–1 5–7

Tottenham Hotspur, Fulham, Arsenal, Arsenal, Arsenal,

Liga Inggris Liga Inggris Liga Champions Liga Inggris Piala Liga

5 PERTANDINGAN TERAKHIR MONTPELLIER : 17/11/2012 : 11/11/2012 : 06/11/2012 : 03/11/2012 : 31/10/2012 :

Valenciennes Montpellier Olympiakos Troyes Montpellier

1–1 1–1 3–1 1–1 1–0

Montpellier, PSG, Montpellier, Montpellier, Bordeaux,

Ligue 1 Ligue 1 Liga Champions Ligue 1 Coupe de la Ligue




21 November 2012


„ Bupati, Asisten II Aris Sutrisno dan Kabag Humas Iwan RM Sinaga memberikan arahan kepada warga.

„ Bupati Tapteng Raja Bonaran Situmeang sangat antusias mencangkul bersama warga di Kelurahan Bajamas.

Bupati Tapteng Tinjau Jumat Bersih

„ Bupati dan warga mencangkul parit Jalan Banyuwangi Kelurahan Bajamas.

Bupati Tapanuli Tengah Raja Bonaran Situmeang meninjau kegiatan gotong-royong Jumat Bersih di Kecamatan Sirandorung, Jumat (16/11) yang dipusatkan di tiga titik masingmasing Jalan Bayuangi, Keluarahan Bajamas, Kecamatan Sirandorung sepanjang 1,5 km. Kegiatan jumat bersih diikuti berbagai lapisan masyarakat yang berasal dari kelurahan tersebut. Pantauan METRO, di lokasi Jumat bersih, ratusan warga tampak antusias mengikuti kegiatan gotong- royong Jumat Bersih. Mereka membersihkan jalan, drainase yang dianggap menggangu kelancaran air. Bupati menyempatkan diri meninjau SMPN 1 Sirandorung, dan beramah-tamah dengan kasek, guru, dan para siswasiswi. Berbagai peralatan pendukung kebersihan seperti sapu, cangkul, parang dan mesin potong rumput dikerahkan untuk membesihkan jalan eks transmigrasi tersebut. Demikian juga alat angkut sampah seperti angkong dan ember. Lurah Bajamas Wiyono melaporkan warga, dan pemerintah setempat ritun melaksanakan gotong-royong jumat bersih. Aksi ini mulai dari perbaikan jalan, parit,

pembersihan rumah-rumah ibadah dan pekarangan rumah masing-masing. Serta menimbun Jalan Bayuangi sepanjang 1,5 km karena jalan ini sudah banyak lobang-lobang. Bupati Tapanuli Tengah Raja Bonaran Situmeang merasa salut dan bangga terhadap warga Kelurahan Bajamas yang selalu rutin melaksanakan Jumat Bersih di lingkungan masing-masing. Dimana kegiatan itu membawa dampak positif dalam mengantisipasi timbulnya berbagai macam penyakit. Lingkunganpun menjadi bersih, dan pemandangan menjadi indah dan udara makin sejuk. Disamping itu, sarana dan prasaran yang dibangun pemerintahpun menjadi terawat. Kepedulian untuk merawat jalan tidak cukup pemerintah, namun juga masyarakat supaya bangunan tersebut bisa bertahan lama.”kata Bonaran Program Pemkab Tapteng ini terus digalakkan sejak tahun lalu, namun masyarakat hanya sebahagian kecil yang melaksanakannya secara terusmenerus. Salahsatunya kelurahan Bajamas di Kecamatan Sirandorung. “ Bupati akan terus memantau kegiatan jumat bersih di seluruh Kabupaten Tapanuli Tengah. (mas)

„ Raja Bonaran Situmeang mencicipi keripik hasil industri warga Bajamas, Kecamatan Sirandorung.

„ Warga beristirahat usai melaksanakan gotong–royong bersama Bupati.

„ Bupati memberikan arahan kepada warga Bajamas usai bergotongroyong.

„ Warga menyorong angkong untuk menimbun jalan-jalan yang berlubang.

„ Warga mengangkat pasir untuk menimbun jalan-jalan yang telah berlubang.

„ Bupati Tapteng Raja Bonaran Situmeang memberikan arahan kepada warga.

„ Bupati menyalami warga ketika meninjau lokasi gotong–royong di Kelurahan Bajamas.

„ Lurah Bajamas Wiyono disaksikan Camat Sirandorung memberikan penjelasan kepada Bupati.

„ Warga serius bergotong-royong untuk memperbaiki Jalan Banyuangi.

„ Bupati memberikan arahan kepada warga di sela-sela gotongroyong.

„ Bupati Raja Bonaran Situmeang sedang menyalami, dan beramahtamah dengan siswa/I SMPN 1 Sirandorung di sela-sela gotong-royong.

„ Warga Bajamas sedang beristirahat usai melaksanakan gotong-royong Jumat bersih.

Foto dan Teks: Masril Tua Rambe dan Humas Pemkab Tapteng, Lokasi: Kelurahan Bajamas, Kecamatan Sirandorung, Jumat (16/11).





Rabu, 21 Nopember 2012

9 ○

Edisi 278 „ Tahun V


Karyawan PTPN III Sei Silau Tewas

PNS Terancam Pecat Jika Ketahuan Dukung Cagubsu MEDAN- Pegawai Negeri Sipil (PNS) di semua jajaran, baik provinsi maupun kabupaten/ kota serta pejabat di lingkungan Badan Usaha Milik Negara (BUMN) atau Badan Usaha

KISARAN-Hidup Benje Siburian (53) berakhir tragis. Karyawan PTPN III, Kebun Sei Silau Buntu Pane Asahan ini meregang nyawa, Selasa (20/11) pukul 11.30 WIB, dalam insiden lakalantas di Jalinsum jurusan Medan – Rantauprapat KM 160 – 161, tepatnya tugu selamat datang, Kelurahan Sentang, Kecamatan Kisaran Timur. Insiden yang menewaskan Benje terjadi, ketika almarhum yang mengendarai sepedamotor Suprat X BK 3501 VAM meluncur menuju daerah Simpang Katerina. Menurut informasi yang diperoleh METRO dari sejumlah rekan korban yang datang ke rumah sakit, sebelum insiden itu, Benje baru saja mengecek kondisi kesehatannya, di RSU PTPN III Sei Dadap, Kecamatan Sei Dadap. “Kasihan sekali. Padahal, dia (Benje,red) baru pulang dari RS Sei Dadap, kalau tak salah Check-Up. Ngga lama dia pulang, kami dengar


‹‹ Baca Tangan ...Hal 6

informasi ini. Terus, waktu kami datang bawa ambulance ke TKP, ternyata sudah dibawa sama polisi ke sini,” kata seorang pegawai RSU PTPN III Sei

Keharmonisan Dipertaruhkan SEMENTARA itu, sikap partai politik (parpol) yang terkesan mendadak dalam menetap kan pasangan bakal calon (balon) gubernur dan wakil gubernur Sumatera Utara (Sumut) menyiratkan beragam penafsiran di kalangan masyarakat. Salah satunya, parpol memaksakan pasangan bagi balon yang diusungnya. Fenomena “kawin paksa” politik ini dinilai sebagai hasil

‹‹ Baca Keharmonisan...Hal 6

Warning !! Jalan Mahoni Rawan Perampokan (FOTO : SUSILAWADI)

TEWAS-Petugas membawa jenazah Benze Siburian, staf PTPN III Sei Silau, yang tewas dalam insiden kecelakan lalulintas, di Jalinsum Sentang, Kisaran, Selasa (20/11).

Pelajar SMAN 1Kisaran Runner-Up Duta Wisata Sumut KISARAN-Keke Putri Larasati siswa, pelajar kelas XI IPS 1, SMAN I Kisaran, runner-up putri Duta Wisata tingkat Sumatera Uara dipastikan bertolak ke Bali, untuk perlombaan duta wisata tingkat nasional. Gadis belia berparas rupawan ini,

akan mendampingi M Rizki Pranata, mahasiswa Universitas Asahan, yang terpilih sebagai juara duta wisata Sumut kotegori pria, dan Dira Arsani Hasibuan, juara duta wisata Sumut kategori wanita. Ditemui di komplek SMAN 1 Ki-

saran, putri semata wayang, buah cinta pasangan Sugianto, dan Sri Purnawati yang berdomisili di Jalan Gergaji Sidodadi, Kecamatan Kisaran Barat in mengaku memendam keinginan, suatu saat kelak dapat menjadi panutan bagi orang-orang

‹‹ Baca Warning ...Hal 6

Yayasan TK Gracia Meradang

‹‹ Baca Pelajar ...Hal 6

Sekitar pukul 06.40 WIB sosok yang dimaksud tiba. Dengan kemeja putih yang biasa dikenakannya dan celana kain hitam. Perhatian pun langsung terpusat kepada pria berkacamata yang pascaturun dari mobil langsung bergegas masuk ke pintu gedung utama Polmed. Tanpa dikomando para mahasiswa yang jumlahnya ratusan orang itu membentuk barisan di halaman gedung utama. Tak lama Dahlan keluar dengan kostum yang sudah berganti. Kaos putih dari panitia

KISARAN-Pihak Yayasan TK Gracia English Studies ( GES ) Jalan DR Sutomo Kisaran mengaku kecewa dengan sikap Susanti (30) mantan bendahara lembaga tersebut. Kekecewaan pihak yayasan terhadap warga Jalan Pramuka Kisaran itu, mengemuka seiring dengan bantahan yang dilontarkannya, dalam sidang di PN Kisaran, di mana Susanti duduk di kursi pesakitan dengan status terdakwa dalam kasus penggelapan. Muharawty, pimpinan Yayasan TK GES Kisaran, Selasa ( 20/11 ) mengatakan, pihaknya selaku pimpinan Yayasan kecewa ketika terdakwa Susanti yang berdasarkan fakta fakta yang ada telah melakukan penggelapan uang perpisahan yang dihimpun dari orang tua murid membantah dakwaan yang diala-

‹‹ Baca Dari ...Hal 7

‹‹ Baca Yayasan ...Hal 6

Dari Gangnam Style tanpa Musik hingga Zikir di Masjid Raya

CERAMAH: Menteri BUMN Dahlan Iskan saat ceramah Masjid Al Mahsun, Medan, kemarin, Minggu (18/11).

alisa Awi ( 20 ), warga jalan DR Sutomo Kisaran jadi korban perampokan yang dilakukan sekelompok pemuda, Minggu (18/11) malam lalu. Informasinya, peristiwa itu terjadi ketika korban melintas seorang diri sekitar pukul 21.00 WIB. Kala itu, sekelompok pemuda menghadang, lantas menodongnya dengan sebi-

di sekitarnya. Didampingi Kepala Sekolah SMAN 1 Kisaran, Jumadi, SPd, MM, Keke menuturkan, pengalaman barunya membawa nama Asahan

MENGIKUTI KEGIATAN DAHLAN ISKAN DI MEDAN Minggu pagi (18/11) di kampus Politeknik Negeri Medan (Polmed) menjadi pemandangan yang tidak biasa. Halaman gedung utama dipenuhi mahasiswa berpakaian training. Mereka duduk-duduk dan menyebar di berbagai sisi. Tak terkecuali para petinggi kampus dengan setelan yang sama. Ternyata, mereka menunggu Menteri BUMN, Dahlan Iskan.

MAPOLRESIni peringatan bagi warga Kota Kisaran, dan sekitarnya. Agar berhati-hati jika melintas dari kawasan jalan Mahoni Kisaran. Pihak polisi menegaskan, daerah ini rawan terhadap aksi kejahatan, khususnya perampokan, setelah Hermawan

Mantan Bendahara Bantah Lakukan Penggelapan

Metro Asahan RABU, 21 NOVEMBER 2012


21 November 2012


Menakertrans Minta TKI di Malaysia Mogok Kerja JAKARTA Menakertrans Muhaimin Iskandar mendorong seluruh TKI di Malaysia untuk mogok kerja.

Tewaskan 112 Warga GAZA - Korban jiwa terus bertambah akibat serangan-serangan Israel di wilayah Jalur Gaza. Tiga warga Palestina tewas dalam dua serangan terpisah di Gaza pada Selasa pagi tadi waktu setempat. Sejak hari pertama serangan Israel hingga hari ke 10 sudah 112 warga Palestina yang menjadi korban. ”Dua warga negara menjadi martir dalam dua serangan di daerah Mughraqa, di bagian selatan Gaza City, dan yang ketiga tewas di Beit Lahiya,” kata juru bicara dinas ambulans Palestina, Adham Abu Selmiya seperti dilansir kantor berita AFP, Selasa (20/11). Dengan tiga korban jiwa tersebut berarti sejauh ini sudah 112 orang yang tewas akibat serangan-serangan Israel di Gaza dalam sepekan terakhir. Sementara jumlah korban luka-luka mencapai lebih dari 920 orang. Menurut militer Israel, mereka telah menyerang sekitar 100 target di wilayah Jalur Gaza sepanjang Senin, 19 November malam dengan menggunakan pesawat, kapal-kapal perang dan artileri. Dinas emergensi Palestina menyatakan, serangan-serangan itu menimbulkan kerusakan parah pada gedung National Islamic Bank di Gaza City milik Hamas. ”Sebuah institusi keuangan yang digunakan Hamas untuk memotori aktivitas terornya, ditargetkan di bagian utara Jalur Gaza,” demikian statemen militer Israel. Serangan-serangan Israel itu juga mengenai rumah-rumah sejumlah pemimpin pejuang Palestina, termasuk Raed Aatar, komandan senior sayap bersenjata Hamas, Brigade Ezzedine al-Qassam. (dtc/int)

Staf Keamanan Kedubes AS di Tel Aviv

DISERANG ISRAEL- Para petugas keamanan Kedutaan Besar Amerika Serikat di Tel Aviv, Israel, melepaskan tembakan pada seorang pria yang menyerang mereka dengan sebilah pisau dan kapak, kata juru bicara kepolisian Israel, Selasa (20/11). ”Tersangka tiba di Kedubes AS pada pukul 11.00 dengan sebuah pisau dan kapak lalu menyerang seorang petugas keamanan,” kata Luba Samri, juru bicara kepolisian. Menurut Samri, petugas tersebut terluka di kaki. “Petugas keamanan lainnya menembak pelaku,” jelasnya. ”Pelaku itu tidak terluka,” ujar Samri, yang menambahkan bahwa si penyerang yang telah ditangkap “bukan orang Arab.” Samri tidak memberi penjelasan lebih lanjut tentang identitas pelaku, kecuali mengungkap bahwa dia berasal dari kota Bat Yam, yang terletak di selatan Tel Aviv. Tidak ada keterangan apakah insiden itu terkait dengan serangan Israel terhadap Jalur Gaza. (dtc/int)


„ Dirut PT Merpati Nusantara Airlines (MNA) Rudy Setyopurnomo, usai dimintai keterangan oleh Badan Kehormatan (BK) DPR RI, Selasa (21/11) di Gedung Parlemen di Jakarta.

Diperiksa, Dirut PT PAL Akui Oknum Anggota DPR Memeras JAKARTA – Tidak sampai satu jam Direktur PT PAL Firmansyah Arifin keluar dari ruang Badan Kehormatan DPR pada Selasa (20/11) siang ini. Ia lalu berjalan keluar dengan dikelilingi para stafnya yang berusaha menjauhi pimpinannya itu dari sorot kamera wartawan. Tidak satu pun kata yang keluar dari mulut Firmansyah kendati puluhan wartawan menghujaninya dengan berbagai macam pertanyaan. Firmansyah merupakan salah satu direksi yang dipanggil Badan Kehormatan hari ini terkait kasus dugaan pemerasan anggota dewan terhadap BUMN. Firmansyah langsung bergegas menuruni tangga dan berjalan cepat hingga mencapai lobi. Sambil menunggu mobilnya, mulut Firmansyah masih terkunci rapat. Setelah didesak terusmenerus, Firmansyah akhirnya mau buka mulut juga. Secara tidak langsung, Firmansyah membenarkan adanya upaya pemerasan yang dilakukan anggota DPR. Namun, ia enggan menyebutkan modus dan nilai yang diminta anggota dewan itu. Ia menyatakan hanya ada satu orang anggota dewan yang berupaya memerasnya. “Yang saya tahu hanya satu orang. Kalian sudah tahulah. Ini terkait penyertaan modal negara (PMN), kan kalian juga sudah tahu. Saya sudah bicara semua di sana (Badan Kehormatan),” kata Firmansyah lagi. Sikap menghindar Firmanysah ini jauh berbeda dengan sikap Dirut PT

Garam Yulian Lintang yang menjelaskan secara terbuka modus yang dilakukan anggota dewan. Hal yang sama juga dilakukan Dirut PT Merpati Rudy Setyopurnomo. Kendati bersikap tertutup, Ketua Badan Kehormatan M Prakosa menyatakan tidak menemui kendala dalam meminta konfirmasi dari seluruh direksi yang hadir. “Yang jelas kami sudah temukan ada pertemuan-pertemuan lebih dari dua kali yang dilakukan di luar kantor DPR yang patut dicurigai,” ucap Prakosa. BK DPR: Ada Indikasi Pemerasan BUMN Badan Kehormatan DPR telah mengklarifikasi Dirut PT Merpati Nusantara Airlines, PT Garam, dan PT PAL hari ini. BK DPR mengambil sejumlah kesimpulan, adanya indikasi pelanggaran kode etik yang dilakukan anggota dewan terkait permintaan jatah kepada BUMN. ”Sanksinya bisa berat, bisa sedang, kalau yang berat bisa diberhentikan sementara, bisa diberhentikan tetap. Kalau dianggap sedang, ya bisa dicopot dari alat kelengkapan. Itu tergantung proses konfrontasinya besok,” kata Ketua BK DPR, M Prakosa, kepada wartawan usai mengklarifikasi 3 Dirut BUMN, di Gedung DPR, Senayan, Jakarta, Selasa (20/11). Menurut Prakosa, para direksi BUMN memang tak memberikan bukti yang autentik. Namun BK DPR melihat adanya indikasi pelanggaran kode

etik oleh sejumlah anggota DPR. ”Kalau di dalam etika ini kan tidak dibutuhkan bukti autentik. Kalau ini kan pelanggaran etika, ini tidak dibutuhkan bukti autentik hukum, tapi pertemuan berkali-kali dengan direksi BUMN ini kan kita menengarai pelanggaran,” ungkap Prakosa. Anggota DPR, lanjut Prakosa, seharusnya tak menemui direksi BUMN selain dalam rapat resmi. Prakosa akan menggunakan bukti SMS dari anggota DPR ke Dirut BUMN terkait ajakan pertemuan-pertemuan ini. ”Seorang anggota dewan bertemu rekan kerja di suatu tempat itu yang patut diduga ada sesuatu di luar kewajaran. Mungkin SMS-nya masih bisa dicari. Itu saja sudah ada indikasi pelanggaran kode etik, lebih dari dua kali itu membicarakan apanya, itu kan patut diduga,” katanya. Karena itu pemeriksaan anggota DPR yang disinyalir memeras BUMN dikonfrontir dengan para Direksi BUMN Rabu (21/11) besok menjadi sangat penting. “Kalau menyangkal, tetap kita konfrontir, patut diduga, mungkin pelanggaran ringan, itu ditetapkan adanya indikasi pelanggaran,” tegasnya. Sebelumnya diberitakan Dirut PT PAL dan Dirut PT Garam menambahkan dua nama anggota DPR pemeras BUMN. Sementara di depan BK, Dirut PT Merpati Nusantara Alirlines (MNA) menjelaskan dua nama yang dicabut Dahlan Iskan dari laporannya ke BK DPR yakni Andi Timo Pangerang (FPD) dan M Ikhlas El Qudsi (PAN) lantaran tidak hadir di rapat tentang Penyertaan Modal Negara (PMN) pada 1 Oktober 2012 lalu. Dalam rapat inilah sejumlah anggota DPR meminta jatah ke Direksi BUMN. BK DPR pun berencana memeriksa semua anggota DPR yang telah dilaporkan Dahlan dan direksi-direksi BUMN ini ke BK. Rencananya para anggota DPR akan dikonfrontir dengan Direksi BUMN tersebut esok Rabu selepas pukul 12.00 WIB, saat ini BK sedang menyusun undangannya. (dtc/int)

”Moratorium pengiriman TKI ke Malaysia dulu sudah berhasil membuat Malaysia tunduk dan menandatangani seluruh aturan baru. Namun jalur-jalur ke Malaysia begitu mudah sehingga begitu banyak saudara kita di Malaysia lebih dari 1,2 juta warga Indonesia tinggal dan bekerja di Malaysia,” kata Muhaimin dalam paparan terkait perlindungan TKI di Malaysia di Komisi IX DPR, Senayan, Jakarta, Selasa (20/11). Menurut Muhaimin, harus ada langkah konkret untuk membuat Malaysia menghormati jasa-jasa TKI. Kalau perlu, TKI menggelar demonstrasi besar-besaran. ”Mungkin bila perlu kita menyerukan warga kita di Malaysia bersatupadu satu komando agar kita dihargai. Kalau perlu satu hari mogok kerja untuk menghormati saudara kita yang menjadi korban pelanggaran, yang menyangkut hubungan kerja maupun peristiwa kriminal di luar hubungan kerja,” kata Muhaimin. Muhaimin lantas memaparkan persoalan-persoalan TKI

akhir-akhir ini. Muhaimin mengaku prihatin menyangkut kasus penembakan, pemerkosaan, hingga pemutusan hubungan kerja sepihak TKI. Muhaimin menilai pemerintah Malaysia telah melanggar MoU yang disepakati dengan Indonesia. ”Ada pemerkosaan oleh tiga polisi Malaysia yang diproses dan kita terus melakukan pendampingan hukum melalui lawyer tepatnya yang ada di KBRI kita. Kasus lain ada TKI on sale, ada cara-cara tidak manusiawi dalam memasukkan TKI. Ini sudah melanggar MoU,” katanya. Dalam kesempatan ini Muhaimin juga menyampaikan banyak masukan terkait RUU tengan Perlindungan Tenaga Kerja Indonesia di luar negeri. Menurut Muhaimin, pemerintah terus berupaya memperluas komunikasi dengan sejumlah negara yang menjadi sasaran penempatan TKI. ”Kita juga memperhatikan perlindungan TKI di Trinidad. 163 pelaut Indonesia pernah terdampar di sana. Penanganan selama ini sudah kita pulangkan, namun masih ada proses terus untuk kita pulangkan semuanya. Perlu kita perhatikan karena di sana mayoritas pelaut, atase kita di sana tidak ada, saya juga tidak tahu di mana Trinidad tapi kita terus berusaha apa yang bisa dilakukan,” tegasnya. (dtc/int)

474 Pejabat Daerah Terlibat Kasus Korupsi JAKARTA - Ternyata banyak pejabat daerah di seluruh Indonesia yang terlibat kasus hukum yakni kasus dugaan korupsi. Menteri Dalam Negeri Gamawan Fauzi menyebutkan ada 474 pejabat daerah yang terlibat kasus hukum. ”474 Pejabat daerah yang terlibat hukum. Tersangka 96, terdakwa 49, dan terpidana 330,” ujar Gamawan. Hal itu dikatakan dalam diskusi bertema ‘Menegaskan Pemberantasan Korupsi: Larangan Menjabat bagi Mantan Terpidana Korupsi’ di Kemenkum HAM, Jalan HR Rasuna Said, Jakarta, Selasa (20/11). Menurut Gamawan, angka tersebut dapat terus bertambah. Senin (26/11) pekan depan seluruh Sekretaris Daerah di Indonesia akan dipanggil untuk melaporkan perkembangannya. ”Saya Senin panggil seluruh sekda untuk melaporkan,” katanya. Gamawan juga bercerita soal kasus terpidana korupsi Rp 20 miliar, Gubernur Bengkulu Agusrin Najamudin yang menggugat Pemerintah ke Pengadilan Tata Usaha Negara (PTUN) Jakarta, terkait penerbitan Keputusan Presiden tentang pemberhentian tetap dirinya sebagai Gubernur

„ Gamawan Fauzi Bengkulu, pasca-putusan kasasi Mahkamah Agung (MA). Agusrin juga menggugat Keputusan Presiden tentang pengangkatan Gubernur definitif Bengkulu yang menggantikannya. Alasan gugatan adalah perkara korupsi yang menjeratnya kini sedang dalam proses PK ”Itu kan sudah incracht (tingkat pertama), sehingga dapat diberhentikan. Saya usul ke Presiden diberhentikan dan ditandatangani oleh Presiden. Saat hari akan dilantik penggantinya, sudah ada kue, bunga, tamu sudah datang. Pukul 09.00 WIB saya fax ke sana, pelantikan ditunda karena ada putusan sela di PTUN. Saya tanya saya harus patuh itu atau UU? Kementerian sering menghadapi kasus seperti ini,” ungkap Gamawan. (dtc/int)

SEKARANG SAYATIDAK TAKUT MAKAN DAN MINUM YANG MANIS Gula Aren adalah jenis palmayangtidak hanya manis rasanya, namunjugakaya manfaat bagi kesehatan. Tidak percaya? Gentong Mas yang salah satu bahan dasarnya Gula Aren, telah terbukti menurunkan kadar gula banyak penderitadiabetes.Salahseorangyang telahmembuktikanmanfaatnyaadalah Siti Rosnih (53 thn). PNS ini menceritakan, sudah 2 tahun lamanya menderita penyakit berbahaya ini, "Karena pola makan yang kurang terjaga, saya menderita diabetes. Akibatnya, badan sering kali terasa lemas, pusing, dan mudah lapar,"paparibu5oranganaktersebut. Diabetesadalahpeningkatankadar glukosadarahakibatkekuranganinsulin baik yang sifatnya absolut maupun relatif atau resistensi reseptor insulin. Diabetes melitus sangat erat kaitannya dengan mekanisme pengaturan gula normal. Tapi sekarang setelah rutin minum Gentong Mas, kesehatannya sudah mulai membaik, "Sekarang keluhan saya sudah hilang dan tidak takut lagi makan yang manis." Ungkap warga Desa Tegalsari, Kec. Medan Denai, Medan tersebut penuh syukur. Karena telah merasakan

manfaatnya, Siti Rosnih ingin sekali membagi pengalaman baiknya itu denganoranglain,"Mudah-mudahan pengalamansayainidapatbermanfaat untuk orang lain." Pungkasnya. Obat apapun, memang belum dapat melakukan pencegahan terhadap diabetes tipe 1, dimana ketidakmampuan pankreas memproduksi insulin sejak lahir. Berbeda dengan tipe 2, yang sering dicetuskan oleh faktor genetik, obesitas, kurang olahraga, serta pola makan yang tidak sehat, sesungguhnya diabetes dapat dicegah, salah satunya dengan terapi Gentong Mas. Gentong Mas adalah minuman kesehatanherbalalamidenganbahan utama Gula Aren dan Nigella Sativa (Habbatussauda) yang terbukti manfaatnya bagi penderita dari berbagai penyakit, termasuk diabetes. Habbatussauda dipercaya dapat meningkatkan fungsi insulin dan mengurangi resistensi reseptor insulin, sedangkan Gula Aren berperan dalam optimalisasi kerja reseptor insulin. Gentong Mas juga mengandung Chromium yang efektif memperlancar metabolisme gula darah dan mengatur kepekaan sel terhadap insulin sehingga meringankankerjapankreas. Selain itu, indeks glisemik dalam Gentong Mas yang sangat aman bagi

kesehatan yaitu hanya 35 (aman jika indeks glisemik dibawah 50), mampu menjaga dan merawat pankreas agar tetap berfungsi dengan baik. Meski demikian, untuk mendapatkan hasil maksimal, disarankan untuk mengatur pola makan, olahraga, pengaturan berat badan seideal mungkin, diet rendah lemak, kontrol stress, dan menghindari rokok serta alkohol. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan silahkan hubungi:0813 8477 7787 Medan, Sidikalang, Gunungtua, Batubara,Tobasa,NiasMadina,Tapsel : 081384777787, Dolok Sanggul : 082129284752, Tebing Tinggi/ Siantar : 081322099495, Binjai/ pakam : 081398666166, Langkat/ karo : 082167538828, Kisaran : 06237014362, Tanjung balai : 081263495563, Labura : 081370590972, Labuhan batu : 082365222011, Sibolga: 081376252569 Taput : 081263243034 Depkes:P-IRT:812.3205.01.114


21 November 2012 “Apabila berhasil dan MK sepakat juga dengan kesimpulan DPR atas dugaan keterlibatan Boediono dalam skandal bailout Century, maka DPR bisa melanjutkannya dengan impeachment,” Anggota Timwas Century DPR, Bambang Soesatyo.

“Kita mendesak sebelum masa timwas century berakhir agar KPK menyerahkan surat pernyataan yang seperti dikatakan Pak Abraham tadi, bahwa Pak Boediono sebagai Wapres, tidak bisa melakukan penyelidikan dan menyerahkan kasus ini Anggota Timwas Century DPR, kepada DPR,” Akbar Faisal.

Etika Politik dan Perilaku Politisi Kode etik penyelenggara pemilihan umum akhirakhir ini menjadi perbincangan yang menarik di kalangan praktisi hukum, politisi, dan akademisi. Bahkan, publik dari berbagai elemen juga menaruh perhatian terhadap tema ini. Etika yang selama ini tidak dilihat sebagai norma sosial bagi para aktor politik dan politisi, justru kini bagaikan monster yang mulai ’’memakan mangsa’’. Di manakah letak moralitas yang selalu menggerus etika politik para politisi kita?

Oleh : Yusrizal Karana ANDAIsajaNiccoloMachiavelli (1469-1527)masihhidup,iamungkin akan datang ke Indonesia untukmelihatbagaimanateorieigentum-nya yang kian beroleh humus dari sejumlah politik ’’menghalalkan segala cara’’ dan sekaligus memberi support atas perilaku politisinya. Saking semrawutnya wajah politik kekinian di negeri ini, hingga kita makin sulit menyentuh pucuk perenungan demokrasi yang sesungguhnya. Bagaimana tidak, Dewan Kehormatan Penyelenggara Pemilu (DKPP) memberhentikan ketua Panwaslu DKI Jakarta karena terbukti melanggar kode etik penyelenggara pemilu. Ini adalah putusan pelanggaran berat yang kelima sejak DKPP dibentuk, setelah sebelumnya memecat ketua dan tiga anggota Komisi Independen Pemilihan (KIP) dan lima komisioner anggota Komisi Pemilihan Umum (KPU) Tulangbawang.Sedangkanyangjadikorban pertama atas putusan DKPP adalah lima anggota KPU Provinsi Sulawesi Tenggara dan disusul pemecatan ketua KPU Kota Depok dengan tuduhan yang sama. Selain memutuskan pemberhentian secara tetap, DKPP juga memberi sanksi berupa teguran tertulis kepada ketua KPU DKI Jakarta dan peringatan keras kepada ketua dan satu anggota KPU Pati, Jawa Timur, serta ketua dan seluruh anggota KPU Timor Tengah Utara, NTT. DKPP juga menolak gugatan

sekaligus merehabilitasi nama baik tergugat kepada anggota Panwaslu Sulawesi Tenggara, ketuaKPULampungBarat,ketuadan anggota KPU Kota Batu, serta ketua KPU Banggai Kepulauan. Sedangkan di Kabupaten Talaud, DKPP memberikan putusan berupa penetapan pencabutan kepada tergugat ketua KPU daerah setempat (lihat tabel). Munculnya para komisioner yang tersandung kasus pelanggarankodeetikmeneguhkankeyakinan kita betapa para aktor politik bersama politisi bergerak liar melabrak keluhuran politik. Sementara rakyat yang seharusnya mendapat pendidikan politik luhur jauhterbuangkeruang-ruangketidakpercayaan politik. Inilah wajah perpolitikan kita akhir-akhir ini. Politik yang hampa dari etika. Jargon siap kalah siap menang yang selalu diikrarkan menjelang pemilihan kepala daerah (pilkada) oleh kontestan, ternyata hanya sebatas basa-basi belaka. Kenyataannya, politisi kita hanya siap menang tetapi tidak mau kalah. Karenanya, langkah culas pun ditempuh dengan berkolusi dengan penyelenggara pemilu. Keberpihakan inilah yang kemudian menjadi malapetaka bagi para komisioner yang akhirnya DKPP menjatuhkan putusan atas pelanggaran kode etik. Yaitu pelanggaran terhadap etika penyelenggara pemilu yang berpedomankan sumpah dan/atau janji sebelum menjalankan tugas sebagai

penyelenggara pemilu (Pasal 251 UU No. 8/2012 tentang Pemilu). Dengan kata lain, penyelenggara pemilutermakansumpahatasjanji saat dilantik menjadi penyelenggara pemilu. Putusan DKPP yang diproses melalui semi peradilan sesungguhnya berbeda secara prosedural dengan Dewan Kehormatan KPU/Bawaslu sebelum terbentuknya DKPP. Jika Dewan Kehormatan melakukan peradilan tertutup, DKPP secara terbuka. Hal ini tentu dimaknai sebagai bentuk transparansi atas kasus yang digelar agar tidak timbul fitnah dan kasak-kusuk dengan pihak yang bermasalah. Sebuah terobosan yang cukup mengobati rasa keadilan DKPP, yang konon hanya satu-satunya di dunia. DaftarPutusanSidang PelanggaranKodeEtikDKPP No Daerah Putusan Komisioner 1. SulawesiTenggara Pemberhentian tetap Ketua dan anggota KPU 2. Depok Pemberhentian tetap Ketua KPU 3. Tulangbawang Pemberhentian tetap Ketua, anggota, sekretaris KPU 4. Aceh Tenggara Pemberhentiantetap Ketuadan3anggota KIP 5. DKIJakarta Pemberhentian tetap Ketua panwaslukada 6. DKIJakarta Tegurantertulis Ketua KPU 7. Pati,Jatim Peringatankeras Ketua dan 1 anggota KPU 8. Timor Tengah Utara, NTT Peringatan keras Ketua dan anggota KPU 9. SulawesiTenggara Ditolak/ direhabilitasi Anggota panwaslu 10. Lampung Barat Ditolak/ direhabilitasi Ketua KPU 11. Kota Batu Ditolak/direhabilitasi Ketua dan anggota KPU 12. Banggai Kepulauan Ditolak/direhabilitasi Ketua KPU 13. Talaud Penetapan pencabutan Ketua KPU

Ketua Komisi Hukum DPR, Gede Pasek Suardika.

“Ini adalah kemajuan yang sangat berarti dari janji KPK sebelumnya. Kan KPK berjanji sampai akhir tahun dan terbukti sebelum akhir tahun sudah ada kemajuan,”

Kirim Opini Anda ke email: metroasahan Maksimal tulisan 5.000 karakter

Sikap Kami Skandal Century di Puncak Hierarki Sumber: Diolah dari informasi DKPP BarangLangka Ternyata selain satwa langka, konon etika juga perlu mendapat ’’suaka’’. Sebab, selain tergolong ’’barang’’ yang harus dilindungi, juga sulit ditemui di ranah politik, hukum,ekonomi,sosial,danlainnya. Politik seakan berjalan tanpa arah.Sementarahukummakinliar dengan segala keputusan yang serbaabsurd.Ekonomipunmakin termehek-mehek dengan segala modusuntukmemiskinkanrakyat, sedangkan kehidupan sosial makin compang-camping dengan segala stigma yang negatif. Pendek kata, etika dari semua lini makin termarjinalisasi karena terdesak oleh hiruk-pikuk kekuasaan dan hedonisme para politisi. Secara faktual, etika sudah lama ditinggalkan dan tidak menjadi tuntunan bagi para aktor politik dan politisi kita. Jika diukur, syahwat politik jauh meninggalkan norma-norma etika untuk mengejar kekuasaan. Mereka seakan tenggelam dengan strategi pemenangan agar segera duduk di kursi kekuasaan. Baik pada legislatif maupun eksekutif. Akan halnya dengan penyelenggara pemilu, sejatinya setali tiga uang: larut dalam praktik kolusi, terkooptasi, nepotisme, dan nyaman dalam suasana politik pragmatisme ber-

sama lakon para politisi busuk. Etika, menurut para ahli, sesungguhnya tidak lain adalah aturan perilaku, adat kebiasaan manusia dalam pergaulan antarsesama untuk menegaskan mana yang benar dan mana yang salah. Secara khusus, dikaitkan dengan seni pergaulan manusia, etika ini dijelaskan dalam bentuk aturan (code) tertulis yang secara sistematik sengaja dibuat berdasarkan prinsip-prinsip moral, dan pada saat dibutuhkan bisa difungsikan untuk menghakimi segala macam tindakan yang secara logikarasional umum (common sense) dinilai menyimpang dari kode etik. Jadi,etikaadalahrefleksidariapa yang disebut dengan ’’self control’’. Sebab, segala sesuatunya dibuat dan diterapkan dari dan untuk kepentingan profesi itu. Oleh karenanya,sebuahprofesidapatmemperoleh kepercayaan dari masyarakatbilamanadalamdiriparaelite profesional tersebut ada kesadaran kuat untuk mengindahkan etikaprofesipadasaatmerekaingin memberikan jasa keahlian profesi kepada masyarakat yang memerlukannya. (*) Penulis adalah Pemerhati Etika Politik/Dosen FISIP Universitas Muhammadiyah Lampung


Hub: Bp. ARI

Telp. 061 - 77064774; HP 0813 7729 4474

KOMISI Pemberantasan Korupsi (KPK) gemar menebar janji. Berulang kali pimpinan KPK berjanji menaikkan status kasus pemberian dana talangan Rp6,7 triliun ke Bank Century ke penyidikan dan menetapkan tersangka. Tim Pengawas Century DPR pun nyaris kehabisan energi mengawasi kasus itu. Berulang kali pula tim pengawas menggelar rapat dengan KPK, tetapi belum ada tanda-tanda KPK segera menetapkan tersangka, minimal anak tangga pertama untuk menguak misteri penyaluran dana ke bank sakit itu. Ada nama Wakil Presiden Boediono yang kala itu menjabat Gubernur Bank Indonesia. Bank Indonesia (BI) diduga tidak memberikan informasi dan data akurat perihal indikator keuangan Bank Century. Selain Boediono, masih ada sejumlah nama lain dalam gerbong BI yang harus diperiksa. Ada pula nama Sri Mulyani Indrawati yang saat itu menteri keuangan. Direktur Pelaksana Bank Dunia itu terindikasi melakukan penyimpangan karena Bank Century sebenarnya tidak berdampak sistemis. Sri Mulyani kemudian kepada Wakil Presiden Jusuf Kalla mengaku dikibuli BI.Pemberian dana talangan ke Bank Century sungguh misterius. Dana sebesar Rp6,7 triliun bisa dengan mudah mengalir ke bank sakit, tanpa ada pejabat tinggi yang bertanggung jawab. Kalla terang-terangan menyebut bailout Century merupakan operasi senyap. Kini setelah dua tahun berlalu, KPK pun membidik dua pejabat BI, yakni BM dan SF, menjadi tersangka. Kabar itu dibocorkan anggota tim pengawas Century DPR Akbar Faisal (Hanura). Lagi pula BM dan SF bukanlah pejabat paling tinggi dalam hierarki di Bank Indonesia. Karena itu, tidak semestinya hanya merekayangmenjadikorban.Setiapkebijakanselalumelekatdan taat pada hierarki. Karena itu, tanggung jawab pun melekat secara hierarkis. Dalam bahasa serdadu, tidak ada prajurit yang salah; yang salah ialah panglima. Keputusan pengucuran dana talangan Rp6,7 triliun ke Bank Century pasti tidak di tangan BM dan SF. Secara hierarkis, mereka berdua tidak mempunyai kekuasaan yang amat perkasa untuk bisa menetapkan aliran dana sebesar itu. Kebijakan itu merupakan keputusan di puncak hierarki. Karena itu, di mana tanggung jawab Gubernur BI kala itu? Di manakah pula tanggung jawab Dewan Gubernur BI? (*)



21 November 2012



HamiliPacar,Subio DilaporKePolisi SIMALUNGUN-Sungguh malang nasib gadis yang masih tergolong belia ini, sebut saja namanya Bunga (17) warga Nagori Nagasaribu, Kecamatan Silimakuta, Simalungun, dalam kondisinya hamil 4 bulan malah ditinggal pacarnya, Subio (26). Pacarnya yang juga masih sekampung dengannya, tidak mau bertanggungjawab untuk menikahi Bunga. Informasi dihimpun, Selasa (20/11), bahwa antara Bunga dan Subio sudah bertahun menjalin hubungan pacaran. Bahkan Subio pun sudah sering membawa Bunga ke rumahnya. Singkatnya, pada bulan Mei, saat Subio hanya seorang diri di rumahnya, Bunga dipanggil untuk datang ke rumah tersebut. Bunga yang tidak menduga ada niat jahat Subio, dia pun datang seorang diri. Sesampainya di sana, Subio langsung mengajak Bunga melakukan hubungan suami istri yang seharusnya belum pantas mereka lakukan. Beberapa kali diajak, Bunga tetap menolaknya. Meski ajakannya terus ditolak, ternyata tidak membuat Subio berhenti sampai disitu saja. Bujuk rayu Subio yang berjanji akan menikahinya, akhirnya berhasil membuat Bunga bersedia melayani nafsu Subio. “Aku mau melakukan itu karena dia berjanji akan

menikahi aku,” terang Bunga saat diperiksa di Polres Simalungun. Bahkan hubungan suami istri yang seharusnya belum layak mereka lakukan sudah terjadi di rumah Subio. Namun setelah diketahui Bunga tengah hamil 4 bulan, Subio malah tidak mau bertanggungjawab. Berkali-kali Bunga meminta pertanggungjawaban dari Subio agar dia dinikahi, Subio mengelak dan mengatakan tidak mau menikah Bunga. Jawaban yang dilontarkan Subio, pun membuat Bunga geram, lantas menceritakan kehamilannya itu kepada orangtuanya. Setelah mengetahui Bunga hamil, orangtua Bunga mendatangi Subio meminta pertanggungjawaban atas kehamilan Bunga. Saat itu pun, orangtua Bunga mendapata jawaban yang tidak memuaskan. Subio tidak mau menikahi Bunga, namun tanpa memberikan alasan yang jelas. Kesal bercampur malu, saat itu juga, Bunga bersama orangtuanya langsung membuat laporan pengaduan ke Polres Simalungun. Kapolres Simalungun, AKBP M Agus Fajar SIK saat dikonfirmasi melalui Kabag Humas, AKP H Panggabaen SH membenarkan telah menerima laporan pengaduan dari korban pencabulan warga Nagori Nagasaribu dengan tersangka Subio. (osi)

Duda Cabuli Siswi SMA SIMALUNGUN-Dengan bujuk rayu janji akan menikahi, Suyadi (36) duda anak 2 ini berhasil merenggut keperawanan Melati (16) siswi kelas 2 SMA warga Jalan Bah Kapul, Kelurahan Sigulang-gulang, Kecamatan Siantar Martoba. Namun setelah 6 kali melakukan hubungan suami istri, Suyadi malah lepas tanggungjawab.

„ Melati saat dimintai keterangan di ruang PPA Polres Simalungun.

Foto:Tonggo Sibarani

WARUNGKOPIDIGASAKMALING SIMALUNGUN-Warung kopi milik Julonggo br Naibaho (45) di Simpang Laut Simbah, Jalan Ulakma Sinaga, Nagori Rambung Merah, Kecamatan Siantar, digasak maling, Selasa (20/11) pukul 03.00 WIB. Akibatnya warung milik orangtua anggota Brimob Ipda Daniel Arta Sasta Tambunan ini mengalami kerugian Rp5 juta. Julonggo br Naibaho mengaku, kedai kopi itu sudah berdiri sejak

sebelas tahun silam lalu disewakan kepada Simaremare, Pangulu disana. Dan Bulan Mei kemarin, setelah habis kontrak, korban memilih membuka usaha sendiri. Setelah warung kopi diusahai Julonggo, dia merubah sedikit tampilan bangunan serta memperluas lokasi karena mau dijadikan tempat nonton bola bareng. Setelah selesai, dia membeli televisi ukuran 42 inci seharga Rp5 juta, untuk ditaruh dalam kedai. Sekitar Juli kemarin, warung kopi milik Julonggo nyaris kebongkaran. Dimana pagi hari, saat karyawannya ingin membuka pintu warung, terlihat bekas congkelan benda keras tepat di bagian engsel gembok. Diduga pencuri mengalami kesulitan, lalu mereka pergi tanpa membawa hasil apapun. Saat kejadian itu korban mulai resah, dan menganggap lingkungan sekitar rumah dan warung kopi sudah tidak aman lagi. Alhasil pintu kedai bagian samping depan, selain di gembok dari luar, korban juga membuat palang besi dari bagian dalam, untuk menjaga keamanan. Usai berjualan, kedai tidak ada yang menjaga. Dua orang karyawannya, Risma br Siagian (20) dan Rosmaida br Siagian (25) kakak beradik, tinggal bersama Julonggo dirumah yang hanya berjarak sekitar 20 meter dari warung. Memang lagi apes, Selasa (20/ 11) pukul 03.00 WIB, salah seorang tetangga korban yang bekerja di sebuah perusaahan coca cola, melihat pagi itu pintu kedai samping bagian belakang dalam keadaan terbuka. Dia mengira, pintu tersebut sengaja dibuka oleh pemiliknya. Setelah dicek ternyata tidak ada orang, pemuda yang baru saja

pulang bekerja itu langsung memberitahu kepada pemilik kedai bahwasannya pintu kedai kopi miliknya sudah terbuka. Mendapat kabar, Jolunggo selaku pemilik warung sontak terkejut dan langsung mengecek bersama kedua karyawan yang tinggal bersamanya. Setelah dicek, ternyata televisi berukuran 45 inci sudah tidak lagi berada di tempatnya. Untungnya, uang beserta rokok yang ditaruh dalam steling dibawa masuk dalam rumah, sehingga pelaku pencurian yang telihat bekas mengacak steling tidak menemukan apa-apa. Atas kejadian tersebut, Jolunggo mencoba memberitahu kepada putranya Ipda Daniel Arta Sasta Tambunan yang kebutalan dinas di Kelapa Dua Depok, Jakarta. Saran perwira kepada ibunya, agar membuat laporan resmi kepada pihak kepolisian di wilayah hukum tersebut. Selasa (20/11) pukul 10.00 WIB, Julonggo mendatangi Polsek Bangun guna membuat laporan kehilanga atas kasus pembongkaran warung kopi. Mendapat laporan itu, tiga personil Polsek Bangun terjun ke lokasi guna melakukan olah tempat kejadian perkara (TKP). Rosmaida, penjaga warung menyebutkan, malam sebelum kejadian, warung terlihat sepi, sehingga warung tutup lebih awal dari biasanya. Biasanya tutup sekira pukul 23.00 WIB sampai 24.00 WIB, malam itu warung tutup pukul 22.00 WIB. Kapolsek Bangun AKP Hitler Sihombing membenarkan adanya laporan kasus pencurian tersebut, untuk saat ini pihaknya sedang melakukan penyelidikan lebih lanjut. (eko/osi)

Melati yang tidak berterima atas perbuatan pacarnya itu, akhirnya Melati memberanikan diri bercerita kepada orangtuanya atas apa yang dialaminya. Mendengar cerita Melati, orangtuanya pun langsung mendatangi Suyadi ke rumahnya di Jalan Sutomo, Kampung Jawa, Pematang Raya, Simalungun meminta pertanggungjawaban. Saat diminta bertanggungjawab atas perbuatannya, Suyadi malah menolak tidak mau menikahi Melati. Setelah mendengar jawaban dari Suyadi itu, orangtua Melati langsung berbalik pulang dan menuju Polres Simalungun membuat laporan pengaduan. Saat pemeriksaan, Melati mengatakan bahwa Suyadi mengajaknya melakukan hubungan suami istri di rumahnya dengan janji akan dinikahi. Selama 6 kali melakukan hubungan terlarang itu, semuanya berlokasi di rumah Suyadi. Anak kelima dari 7 bersaudara ini menceritakan, perkenalan pertama kalinya dengan Suyadi melalui telepon seluler (HP). Dimana, seorang temannya bernama Rendi Tampubolon selaku kernek mobil angkutan umum memberikan nomor HPnya kepada Suyadi. Setelah ada komunikasi melalui HP, Suyadi pun menghubungi Melati dan mengajak untuk bertemu di Jalan Sisingamangaraja tepatnya di depan salah satu rumah ibadah. “Setelah kami bertemu pertama kali bulan Juni lalu, dia mengajak saya ke Siantar Plaza, untuk membeli jajanan. Sepulang dari Siantar Plaza, kemudian dia mengajak saya ke

Rajawali untuk makan malam. Usai makan malam, dia beranjak pulang ke raya,” terang Bunga. Menurut Bunga, setelah pertemuan pertama itu, dua hari kemudian Suyadi kembali menghubungginya dan untuk ketemu ditempat yang sama. Saat itu, Suyadi datang dengan menumpangi sepedamotor. Dengan sepedamotor itu, mereka berboncengan keliling pusat Kota Siantar. “Kami keliling Kota Siantar sampai larut malam. Karena sudah malam, saya takut pulang ke rumah. Lalu dia mengajak saya ke rumahnya di Pematang Raya. Setiba di rumahnya sekitar pukul 22.00 WIB, dia menyuruh saya supaya tidur. Tepatnya jam 24.30 WIB, dia membangunkan saya dan mengajak ke salah satu kios di samping rumahnya. Dikios itulah terjadi pertama kali hubungan suami istri itu,”paparnya. Bukan hanya sekali itu, sambung Melati, selama 6 kali melakukan hubungan intim, dia berjanji akan bertanggungjawab. “Sewaktu melakukan hubungan itu, dia berjanji akan menikahi saya. Tapi, saat ditanya keluarga saya dia mengelak dan tidak mau bertanggungjawab,”kesalnya. Kapolres Simalungun AKBP M Agus Fajar SIK saat dikonfirmasi melalui Kabag Humas AKP H Panggabean SH mengatakan telah memeriksa 3 orang saksi. Setelah pemeriksaan saksi dan berkasnya dinyatakan lengkap, kasus tersebut segera dilimpahkan ke Kejaksaan Simalungun untuk diproses lebih lanjut. (osi)

PetaniNyambiJurtulTogel SIANTAR – Mesron Siahaan (48) warga Jalan Manunggal Karya, Kelurahan Pematang Marihat, Kecamatan Siantar, diciduk dari salah satu warung di seputaran rumahnya. Pria yang sehari-harinya bertani padi ini ditangkap tangan sedang menulis angka tebakan togel, Senin (19/11) pukul 15.00 WIB. Informasi dihimpun, bahwa Mesron merupakan target operasional sat reskrim Polres Siantar. Sebab masyarakat di sana sudah sangat resah, akibat perbuatan Mesron yang setiap hari menulis angka tebakan jenis togel dan KIM. Untuk menangkap Mesron, polisi menyaruh sebagai pem-

beli togel. Saat Mesron mengeluarkan kertas dan pulpen untuk menulis angka tebakan polisi yang sedang menyaruh, polisi langsung menangkapnya. Ketika digeledah, dari kantong Mesron diamankan 2 unit Handphone berisi angka tebakan, serta uang ratusan ribu rupiah hasil penjualan togel. Kapolres Siantar AKBP Albert TB Sianipar SIK ketika dikonfirmasi melalui Kasat Reskrim AKP Daniel Marunduri mengatakan bahwa Mesron dan barang bukti 2 unit Handphone dan uang ratusan ribu rupiah telah diamankan. Saat ini Mesron masih dimintai keterangan untuk dilakukan pengembangan. (mag-05/osi)



21 Nopember 2012

Karyawan PTPN III Sei Silau Tewas Dadap, yang ditemui di IGD RSUD Kisaran, saat membesuk jenazah Benje di IGD. Di lokasi kejadian, sejumlah saksi mata menyebutkan, kecelakaan maut itu terjadi, saat Benje yang memacu kendaraannya dengan kecepatan tinggi, mencoba mendahului satu unit mobil minibus yang melaju di depannya. Di saat bersamaan, dari arah berlawanan, muncul truck berbadan besar yang kemudian menyambar sepedamotor Benje,. “Pas mau nyalip, dari arah Kisaran ada truck. Kreta dia (Benje,red) disambar, terus terpelanting ke beram jalan. Trucknya langsung kabar arah Rantau. Jenis trucknya, kalau tak salah truck fuso gitu,” kata Andi, seorang pedagang es kelapa muda, yang berada di sekitar lokasi kejadian. Ningrum, seorang pedagang es kelapa muda lainnya mengaku peristiwa itu terjadi begitu cepat. Sehingga, pengemudi truck dengan mudahnya langsung mlarikan diri. Posisi korban, sebut Ningrum setelah insiden itu, tergeletak di sisi kanan beram jalan, dengan posisi telungkup. Sedangkan sepe-

damotornya, teronggok di depannya, dengan kondisi ringsek. “ Cepat kali kejadiannya dek.. Makanya, supir itu bisa kabur. Ketepatan, pengunjung-pengunjung pondokpondok kelapa muda ini lagi sepi, kan pas jam makan siang itu. Untung, patroli PJR lagi lewat, makanya langsung dibawa ke RSUD,” sebut Ningrum. Di IGD RSUD Kisaran, dr Diah, dokter piket yang menangani jenazah Benje mengemukakan, saat tiba di RSU, korban sudah dalam kondisi tidak bernyawa. Almarhum, kata dia, menderita luka-luka yang cukup serius di tubuhnya. Sejumlah tulang tubuhnya, kata dr Diah diduga mengalami patah, dan bagian wajah remuk. “Bagian wajah korban remuk, namun helm nya masing terpasang,” jelas dr Diah. Sementara itu, dari komplek perumahan karyawan PTPN III Kebun Sei Silau, di kawasan Pulau Mandi dilaporkan, jenazah korban tiba di rumah duka, dengan menumpang ambulance milik RSUD Kisaran. Di rumah duka, jenazahnya disambut puluhan rekan-rekan korban sesama karyawan. “Ngga nyangka, secepat ini.

Warning !! Sambungan Halaman 1 lah pisau. “Korban dihadang, dan ditodong. Lalu, kawanan pelaku menjarah barangbarang milik korban, berupa dua unit Hp Nokia type 5310, dan Nokia Type 6760. Korban lalu disuruh pulang, dan diancam untuk tidak mempersoalkan kejadian itu,” kata AKP R Berutu, juru bicara polres Asahan, Selasa, kemarin., Menurut R Berutu, peristiwa yang menimpa korban ini, merupakan yang kesekian kalinya terjadi di Jalan Mahoni Kisaran. Hal ini kata dia, diharapkan menjadi bagi masyarakat, untuk berhati-hati melintasi kawasan tersebut. “Segenap elemen harus memperhatikan kondisi ini,

agar jangan ada korban lagi. Memang kawasan itu rawan, salah satu penyebabnya, minimnya sarana penerangan,” tegasnya. Khairul, seorang tokoh pemuda Kisaran juga menilai, rawannya kawasan jalan Mahoni Kisaran itu diakibatkan kurangnya penerangan lampu jalan. Bahkan, kata dia, taman yang dibangun pemerintah di kawasan itu, sering dijadikan tempat mangkal para pelaku kejahatan. “Selain jalan Mahoni, ada beberapa tempat lain yang rawan kejahatan seperti : Jalan Cokro, Jalan Juanda, Jalan Durian, dan Jalan Madong Lubis,” tegas eks pengurus pada salahsatu organisasi kemasyarakatan pemuda itu.(Sus)

dalam ajang perlombaan Duta Wisata Sumatera Utara, merupakan sebuah moment istimewa sepanjang hayatnya. Sebab, kata dia, pagelarang itu dapat dipergunakannya, untuk mempromosikan potensi-potensi wisata yang ada di Asahan, yang selama ini mungkin belum dikenal sama sekali. “Semua proses seleksi lancar-lancar saja. Cuma, pertanyaan yang sulut itu adalah, waktu ditanyai mengenai daerah wisata di daerah Tapanuli. Jujur saja, Keke belum pernah ke sana. Tapi, Alhamdulilah, semuanya lancar,”tegasnya. Sementara itu, Kepala Sekolah SMAN Kisaran, Jumadi, SPd, MM mengaku bangga dengan prestasi yang

diraih anak didiknya itu. “Kita berharap seluruh siswa SMAN I Kisaran, dapat mengukir prestasi terbaik sesuai bakat mereka masing-masing,” tegasnya. Dia juga menjanjikan, setiap pelajar yang berprestasi di sekolah itu, akan diganjar dengan beasiswa selama 1 tahun, sebagai bentuk motivasi. Sebagaimana pernah diberitakan, M Rizki Pranata, peserta lomba Duta wisata utusan Kabupaten Asahan, berhasil terpilih sebagai Duta Wisata Sumatera Utara, bersama dengan peserta utusan Kabupaten Serdang Bedagai, Dira Arsani Hasibuan. Kedua anak muda ini akan mewakili Sumut dalam ajang Duta Pariwisata Indonesia di Bali Desember 2012 mendatang.(Mar/Smg)

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Suasana berkabung saat penyambutan jenazah, plus jeritan histeris keluarga, membuat upaya wawancara tidak mungkin dilakukan, se-

suai anjuran salahseorang kerabat korban. “Tolong mengertilah Dek. Kalau Anda wartawan, pahami kondisi keluarga kami saat ini,” jelas seorang

keluarga korban di rumah duka. Adapun Kasat Lantas AKP Eko Hartanto, ketika dikonfirmasi mengatakan, untuk penyidikan kasus ini, pihaknya

akan terlebih dahulu melakukan serangkaian penyelidikan. “Kita lakukan penyelidikan dulu, untuk mengungkap kasus ini,” tegasnya. (Sus)

Keharmonisan Dipertaruhkan Sambungan Halaman 1 ke putusan segelintir elite par tai politik untuk mem pertahankan ataupun merebut kekuasaan. Keharmonisan pa sang an itu jika memimpin nanti akan menjadi taruhannya. Sebagai contoh, pasangan Ef fendi Muara Sakti Simbolon- Jumiran abdi muncul di dua hari terakhir pendaftaran. Padahal, sebelumnya dua tokoh ini tidak pernah ikut dalam proses penjaringan di Partai Demokrasi Indonesia (PDI) Perjuangan. Mereka disokong pula oleh Partai Peduli Rakyat Nasional (PPRN) dan Partai Damai Sejahtera (PDS). Pasangan balon dari Partai Demokrat, Amri TambunanRus tam Effendi (RE) Nainggolan menjadi pendaftar terakhir di KPU. RE yang awalnya ingin menjadi balon gubernur mengalah menjadi wakil. Pasangan ini sempat diisukan mendapatkan penolakan dari sejumlah kader di daerah, meski akhirnya didaftarkan juga. Kemudian, pasangan Chairuman Harahap-Fadly Nurzal yang didukung koalisi Partai Golkar-Partai Persatuan Pembangunan (PPP), juga terkesan sebagai hasil “perkawinan paksa.” Kader partai berlambang pohon beringin ini di daerah banyak

Sambungan Halaman 1

Pelajar SMAN 1Kisaran Runner-Up Duta Wisata Sumut Sambungan Halaman 1

Padahal, tadi Cuma ngeluh demam dia,” sebut seorang rekan korban. Sayangnya, upaya mewawancarai keluarga korban gagal dilakukan.

yang menginginkan Tenku Erry Nuradi untuk diusung, bukan Chairuman. Meskipun akhirnya elite Golkar yang menentukan. Fadly sendiri awalnya tidak dipernah digadang-gadang kader PPP berpasangan dengan Chairuman. Sementara Tengku Erry Nuradi dipasangkan dengan Gatot Pujo Nugroho berdasarkan hasil survei Partai Keadilan Sejahtera (PKS) yang menunjukkan nilai Erry kedua tertinggi. Sikap Erry pun menuai pecopotan dirinya dari jabatan Ketua Dewan Pengurus Daerah (DPD) Partai Golkar Serdangbedagai. Pasangan yang boleh dibilang aman dari intervensi elite par pol adalah Gus Irawan Pasaribu-Soekirman. Padahal, koalisi parpol yang mendukung pasangan ini paling banyak di antara kandidat lainnya, yakni 23 parpol, diantaranya Partai Amanat Nasional (PAN), Gerindra, PKB, PBB, PPIB, PBR, Pelopor. Diketahui, Gus sejak jauh-jauh hari mengidamkan Soekirman menjadi pendampingnya, yakni pada Januari 2012. Pengamat politik Universitas Sumatera Utara (USU) Mur yanto Amin mengatakan, fak ta memang menunjukkan ke pala daerah dan wakil kepala daerah yang tidak sejalan saat memimpin dikarenakan “perkawinan” pasangan itu ter

jadi tiba-tiba dan di ujung masa pendaftaran. Sebab, pasangan tersebut dipaksa untuk “kawin”, padahal proses dari awal tidak mereka jalani bersama-sama. Ini terjadi karena ke tidakrelaan elite parpol dalam proses perebutan kekuasaan sehingga mengabaikan keinginan masyarakat dan konstituennya. “Pemilihan langsung itu semangatnya untuk lebih mendekatkan pemimpin dengan masyarakat. Tapi dalam Pilgubsu 2013 ini saya melihat hal itu tidak terjadi, karena mayoritas pasangan dipaksa “kawin” oleh elite parpol. Kalau seperti ini, masyarakat bisa pragmatis karena politisi tidak mendidik politik masyarakat. Seharusnya praktik begini tidak lagi ter jadi karena masyarakat kita sudah melek politik dan ada kesadaran diperalat parpol,” katanya. Dalam proses penetapan pasangan calon oleh parpol, sebenarnya banyak yang mengejutkan karena indikasi “kawin paksa” itu sangat kentara. Ada proses di parpol, yang awalnya ti dak terpikirkan, tiba-tiba nama tersebut muncul. Akibatnya masyarakat bertanya-tanya dengan hal ini. Apalagi akses informasi saat ini sudah sa ngat liberal. Awalnya mereka

sudah memiliki pilihan, tapi karena prosesnya dinilai tidak tepat, masyarakat bisa berubah. Muryanto menyebutkan, dalam perkembangan Pilgubsu 2013 saat ini juga terjadi oligarki parpol. Sebagai upaya untuk mempertahankan kekuasaan, keputusan politik hanya dilakukan oleh beberapa elite parpol saja. Maka, sangat dimungkinkan jika pasangan “kawin paksa” itu menang dalam Pilgubsu. Selain berpeluang besar tidak sejalan saat memimpin, pasangan ini juga menjadi alat atau boneka dari elite parpol yang berhasil mengawinkan mereka.“Kalau terpilih, itu nanti berantem. Bisa juga dimanfaatkan elite parpol,” ujarnya. Pengamat politik lainnya, Nuzirwan Lubis menilai ada skenario masing-masing parpol soal penetapan balon yang di nilai melalui proses “kawin paksa”. Bisa dengan survei atau dengan penunjukkan. Ada pula fenomena tidak banyak tokohtokoh yang muncul. “Media juga mendorong kepentingan parpol menguat dalam penetapan calon. Prediksi media, saya nilai memengaruhi kebijakan politik parpol,” bebernya. Untuk kasus Effendi Simbolon-Jumiran Abdi, dia menilai cukup menarik.

Awalnya kecenderungan PDI Perjuangan adalah mengusung RE Nainggolan, tapi di akhir masa malah ber ubah 180 derajat. “Saya melihat memang ada unsur kedekatan Effendi Simbolon dengan petinggi PDI Perjuangan da am penetapan ini,” tukasnya. Sementara Amri Tambunan-RE Nainggolan merupakan implikasi dari sikap politik PDI Perjuangan. Mau tidak mau Demokrat memilih Amri yang sebenarnya memiliki hasil survei jauh di bawah. “Yang kita sayangkan, harusnya Demokrat menetapkan calon jauh lebih awal. Karena me reka satu-satunya parpol yang memiliki syarat mengusung calon,” tukasnya. Soal Chairuman-Fadly Nurzal, menurut Nuzirwan, merupakan langkah besar PPP karena mampu menempatkan kader terbaik sebagai pemain utama. Sedangkan Gus-Soe kirman, memang sudah lama menjalin komunikasi di antara mereka dan tidak menempatkan parpol sebagai penentu. Jadi, mereka membangun chemistry-nya sendiri dengan cara mereka sendiri pula. “Karena itu saya menilai Pilgubsu 2013 akan menjadi pe nentu tetap sosok figur calon. Kita lihat saja hasilnya,” pungkasnya.(SIC/ Int)

PNS Terancam Pecat

Milik Daerah (BUMD), dilarang untuk memberi dukungan kepada pasangan calon (paslon) kepala dan wakil kepala daerah di Pemilihan Gubernur Sumatera Utara (Pilgubsu) 2013 mendatang. Tidak hanya itu, PNS juga dilarang keras terlibat dalam kegiatan kampanye untuk dukungan terhadap para calon kepala daerah/wakil kepala daerah. Karena, pada prinsipnya jabatan PNS harus mengedapankan netralitas dan harus senantiasa menjunjung tinggi kehormatan negara, pemerintah dan martabat PNS, serta senantiasa mengutamakan kepentingan negara diatas kepentingan pribadi, seseorang atau golongan. “Pelarangan terhadap PNS itu, dalam rangka upaya pencegahan terjadinya pelanggaran Pemilu pada Pemilihan Umum Kepala Daerah dan Wakil Kepala Daerah (Pemilu Kada), tanpa terkecuali di Pilgubsu 2013, khususnya politisasi PNS sebelum mulai tahap pendaftaran dan penetapan Calon Gubernur (Cagub) dan Wakil Gubernur Sumatera Utara (Wagubsu) 2013,” ungkap Ketua Panitia Pengawas Pemilihan Umum (Panwaslu) Provinsi Sumatera Utara (Provsu), David Susanto, Selasa (20/11). Maka dari itu, sambung David, Panwaslu telah mengeluarkan surat tertanggal 1 November 2012, No:/PANWASLU-SU/XI/2012, tentang instruksi pengawasan terhadap netralitas PNS dan pejabat di BUMN/BUMD pada Pilgubsu 2013, yang ditembuskan kepada Panwaslu kabupaten/ kota se-Sumut. “Panwaslu Kabupaten/Kota Se-Sumut untuk memperhatikan banyak, pertama dalam UU No.43/

1999 tentang perubahan atas UU No.8/1974 tentang pokokpokok kepegawaian, yang mengatur pasal 3, 1) ayat (1), dimana PNS berkedudukan sebagai unsur aparatur negara yang bertugas untuk memberikan pelayanan kepada masyarakat secara professional, jujur, adil dan merata dalam penyelenggaraan tugas negara, pemerintah dan pembangunan. Kemudian, 2) ayat (2), dalam kedudukan dan tugas sebagaimana dimaksud pada ayat (1), PNS harus netral dari semua pengaruh golongan dan partai politik serta tidak diskriminatif dalam memberikan pelayanan kepada masyarakat”. Dan 3) ayat (3), untuk menjamin netralitas PNS dilarang menjadi anggota dan/atau anggota partai politik,” rinci David. Lebih lanjut, David menerangkan, pada pasal 26, ayat (2) disebutkan, PNS bersumpah/janji akan senantiasa menjunjung tinggi kehormatan negara, pemerintah dan martabat PNS, serta akan senantiasa mengutamakan kepentingan negara dari pada kepentingan pribadi, seseorang atau golongan. Untuk sanksi yang mestinya diberikan bagi PNS yang tetap bersikukuh, dan larut serta memberi dukungan kepada pasangan calon yang bersaing, disesuaikan dengan pasal 4, angka 15 Peraturan Pemerintah (PP) No.53/2010 tentang disiplin PNS, yang mengatur antara lain PNS dilarang memberikan dukungan kepada calon kepala daerah/wakil kepala daerah, dengan cara, terlibat dalam kegiatan kampanye untuk mendukung calon, menggunakan fasilitas yang terkait dengan jabatan dalam kegiatan kampanye, membuat keputusan dan/atau tindakan

Departemen Redaksi METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin PurbaEva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput)

yang menguntungkan atau merugikan salah satu pasangan calon selama masa kampanye; dan/atau. Selanjutnya, dilarang mengadakan kegiatan yang mengarah kepada keberpihakan terhadap pasangan calon yang menjadi peserta pemilu sebelum, selama, dan sesudah masa kampanye meliputi pertemuan, ajakan, imbauan, seruan, atau pemberian barang kepada PNS dalam lingkungan unit kerjanya, anggota keluarga, dan masyarakat. Humas Panwaslu Provsu, Fakhruddin menambahkan, PNS yang tidak menaati ketentuan tersebut dijatuhi hukuman disiplin dengan tingkatan hukuman disiplin sebagai berikut, hukuman disiplin ringan, yakni teguran lisan, teguran tertulis dan pernyataan tidak puas secara tertulis. Selanjutnya, lanjut Fakhruddin, hukuman disiplin sedang, yakni penundaaan kenaikan gaji berkala selama satu tahun dan penurunan pangkat setingkat lebih rendah selama satu tahun. Dan hukuman disiplin berat, yakni penurunan pangkat setingkat lebih rendah selama tiga tahun, pemindahan dalam rangka penurunan jabatan setingkat lebih rendah, pembebasan dari jabatan, pemberhentian dengan hormat tidak atas permintaan sendiri sebagai PNS dan pemberhentian tidak dengan hormat sebagai PNS. “Hukuman disiplin sedang dijatuhkan bagi pelanggaran terhadap larangan memberikan dukungan kepada calon kepala daerah/ wakil kepala daerah dengan cara terlibat dalam kegiatan kampanye untuk mendukung calon kepala daerah/wakil kepala daerah serta mengadakan kegiatan yang

mengarah kepada keberpihakan terhadap pasangan calon yang menjadi peserta Pemilu sebelum, selama, dan sesudah masa kampanye meliputi pertemuan, ajakan, imbauan, seruan, atau pemberian barang kepada PNS dalam lingkungan unit kerjanya, anggota keluarga, dan masyarakat sebagaimana dimaksud dalam Pasal 4 angka 15 huruf a dan huruf d,” jelas Fakhruddin. Lebih lanjut, Fakhruddin menerangkan, untuk hukuman disiplin berat dijatuhkan bagi pelanggaran terhadap larangan antara lain, memberikan dukungan kepada calon kepala daerah/ wakil kepala daerah, dengan cara menggunakan fasilitas yang terkait dengan jabatan dalam kegiatan kampanye dan/atau membuat keputusan dan/atau tindakan yang menguntungkan atau merugikan salah satu pasangan calon selama masa kampanye sebagaimana dimaksud dalam Pasal 4 angka 15 huruf b dan huruf c. Selain itu, tambah Fakhruddin lagi, juga dilarang melakukan penggunaan fasilitas dan anggaran pemerintah dan pemerintah daerah, yang antara lain penggunaan fasilitas pemerintah dan pemerintah daerah berupa sarana mobilitas seperti kendaraan dinas meliputi kendaraan pejabat negara dan kendaraan dinas pegawai, serta alat transportasi dinas lainnya. Sama halnya dengan gedung kantor, rumah dinas, rumah jabatan milik pemerintah, milik pemerintah provinsi, milik pemerintah kabupaten/kota, kecuali daerah terpencil yang pelaksanaannya harus dilakukan dengan memperhatikan prinsip keadilan. Dan sarana perkantoran, ra-

METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Hotlan Doloksaribu Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ardi, Roy Amarta, Ferdinan. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

dio daerah dan sandi/ telekomunikasi milik pemerintah daerah provinsi/ kabupaten/kota, dan peralatan lainnya, serta bahan-bahan. Hal yang sama juga adalah dilarang menggunakan dan/ atau memanfaatkan dana yang bersumber dari keuangan pemerintah dan pemerintah daerah baik secara langsung maupun tidak langsung. “Dalam mengawasi netralisasi PNS dalam rangka Pilkada, serta penggunaan fasilitas dan anggaran pemerntah dan pemerintah daerah tersebut, menggunakan strategi pencegahan pelanggaran yaitu strategi pencegaha pelanggaran administrasi dan pidana dilakukan dengan tindakan, langkah-langkah, dan upaya optimal mencegah secara dini terhadap kemungkinan timbulnya potensi pelanggaran dan/atau indikasi awal timbulnya pelanggaran tersebut,” terangnya lagi. Dikemukakan Fakhruddin lagi, Panwaslu Provsu juga mengimbau atau mengingatkan melalui surat resmi kepada Bupati/Walikota di wilayah masing-masing, agar melarang PNS terlibat dalam Pilkada sesuai peraturan perundang-undangan, dan melarang PNS menggunakan fasilitas dan anggaran pemerintah dan pemerintah daerah untuk kepentingan calon kepala daerah dan wakil kepala daerah. Serta mempublikasikan (konferensi pers, press release, red) imbauan dan peringatan tersebut untuk merespon isu spesifik yang muncul. Mensosialisasikan imbauan dan peringatan tersebut, secara hirarkis kepada Panwaslu di wilayahnya masing-masing agar dipahami dan mendapat perhatian khusus.(ari/smg)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


RABU 21 November 2012

7 Jam Diperiksa Kadis PU Ditahan

Supir Truk Dipungli Sesuai Kesepakatan SIANTAR- Warga yang mengaku sebagai petugas kebersihan dan keamanan di Jalan Patuan Anggi kawasan Pasar Dwikora, Siantar Utara, mengaku pengutipan yang dilakukan mereka terhadap supir truk pengangkut ikan, sudah sesuai kesepakatan. Seperti yang diungkapkan seorang petugas Serikat Pekerja Transportasi Indoneisa (SPTI) Safruddin Saragih, ketika ditemui METRO, Senin (19/11). “Banyak kotoran-kotoran sisa ikan di lokasi, setelah mereka membongkar ikan dan dijual kepada para pedagang. Kamilah yang membersihkannya. Kami menyewa pipa dan menyemprot kotoran itu hingga bersih. Jadi wajar kami meminta biaya kebersihan,” ujarnya. Dia menambahkan, selama ini tidak pernah ada supir yang keberatan atas pekerjaan yang mereka lakukan di Jalan Patuan Anggi. Namun ia curiga ada orang yang tidak senang, dan bermaksud mengganggu ketentraman

Sambungan Halaman 8

mereka yang tinggal di Jalan Patuan Anggi tersebut. “Truk ikan itu datang jam 2 pagi, kemudian mereka bongkar muat. Setelah ikan diturukan, mereka pergi. Nah, tugas kamilah yang menjaga ikannya itu, dan membagikannya sesuai daftar yang diberikan, Jadi uang untuk jasa itulah yang mereka berikan,” tambahnya. Syafruddin menambahkan, semisal ada ikan yang hilang, pihaknya selalu bersedia mengganti rugi kehilangan itu. Sebab sudah tugas merekalah menjaga ikan saat diturunkan dari mobil. “Termasuk membersihkan dan menyiram sisa-sisa ikan yang berserak di aspal itu. Siapa lagi yang membersihkannya kalau bukan kami?” ungkapnya. Dengan demikian ia berharap tidak ada persoalan antara pengurus SPTI dengan pada supir truk pengangkut ikan. (pra)


„ GOR Mini di Kelurahan Sei Raja Kecamatan Sei Tualang Raso Kota Tanjungbalai yang belum diserah terimakan berbiaya ratusan juta rupiah diterlantarkan. Foto dijepret, Selasa (20/11).

Gedung GOR Mini Ditelantarkan Anggaran Rp700 Juta Sia-sia Sambungan Halaman 8

Dinas PU, atau KONI. Kepala Dinas Pemuda Olah Raga, Kebudayaan dan Pariwisata (Kadisporabudpar) Tanjungbalai Hafifi, Selasa (20/11) mengatakan, gedung itu belum difungsikan karena belum ada serah terima dari pihak rekanan kepada Disporabudpar. Bahkan menurut Hafifi, Pemko Tanjungbalai juga belum ada menetapkan apakah banguna tersebut dikelola Disporabudpar, KONI atau Dinas PU. “Bagaimana mau dikelola atau dimanfaatkan. Sampai sekarang kami saja tak tahu siapa yang mengelola,” katanya. Hafifi menyebutkan, jika dilihat dari peruntukannya, maka gedung yang dibangun dengan biaya ratusan juta itu merupakan kewenangan KONI untuk mengelolah. “Kalau melihat dari peruntukannya, bangunan itu mungkin untuk KONI. Bangunan itu dibangun masa Wali Kota dr Sutrisno Hadi. Jadi, saat

ini kami tidak tahu siapa yang mengelola bangunan GOR Mini. Bahkan dibangun untuk apa kami juga nggak tahu. Yang tahu menahu masalah ini adalah wali kota yang lama,” katanya sembari menambahkan, soal angaran biaya pembangunan pun dirinya sama sekali tidak tahu. Terpisah, Ketua KONI Tanjungbalai M Nur didampingi Asmuni Sinaga mengatakan, bangunan GOR dibangun sejak tahun 2003 dan dananya bersumber dari Kementerian Pemuda dan Olahraga semasa di Zaman Mahadi Sinambela. “KONI pernah turun ke lokasi bangunan GOR Mini untuk memantau kondisi bangunan. Dari pengamatan, arus listrik, air, dan bangku untuk penonton belum ada,” terang M Nur. M Nur membenarkan, jika belum ada serah terima GOR Mini tersebut dari Pemko Tanjungbalai ke KONI. “Kalau misalnya berita acara serah terima dari pemko telah kami dapat, KONI sendiri menyatakan kesiapannya untuk mengelola,” tambahnya. (ck3).

kejaksaan. Menurut Syafaruddin, kedatangannya ke kantor kejaksaan hanya sebatas pemeriksaan saja. Kepala Kejaksaan Negeri Tanjungbalai Edi Winarto SH MH didampingi Kasi Intel Kifli Harahap SH dan Kasi Pidsus Ahmad EP Hasibuan SH MH ketika dikonfirmasi menjelaskan, Syafaruddin diperiksa dalam beberapa kasus dugaan korupsi beberapa proyek di Tanjungbalai. Edi mengatakan, Syafaruddin resmi

ditahan setelah pemeriksaan berkas perkaranya selesai dan telah dilengkapi bukti yang lengkap. Menurut Ahmad, dari seluruh proyek yang diduga melibatkan Syafaruddin negara dirugikan Rp603.127.911. Edi menambahkan, selama ini pihaknya bukan tidak mau menahan Syafaruddin, tetapi pihak kejaksaan menunggu waktu hasil audit BPKP tentang kerugian keuangan negara serta penyidikan kasus tersebut dengan sempurna.

Sempat Tutup, Klinik Siti Khadijah Kembali Beroperasi Sambungan Halaman 8

Siti Khadijah tersebut dilakukan beberapa hari lalu dan bersamaan dengan penyambutan Tahun Baru Islam 01 Muharram 1434 H. Ketua Pimpinan Daerah (PD) Aisyiyah Asahan Khamsidah SPd didampingi pengurus lainnya Asmiwati SPd, Makhniyar M, Selasa (20/ 11) mengutarakan, selama ini Klinik Siti Khadijah dikelola Pimpinan Cabang Aisyiyah Kecamatan Kisaran Timur. Karena sesuatu hal, maka klinik tersebut tidak dioperasikan. Namun setelah pengelolaannya diambil alih PD Aisyiyah Asahan, sejak itu pula klinik tersebut kembali difrungsikan. Aisyiyah sebut Khamsidah adalah wadah bagi kaum ibu atau perempuan pada organisasi Muhammadiyah yang di antara visi-misinya untuk memberdayakan kaum pe-

rempuan. “Karena diperlukan adanya wadah kaum perempuan Muhammadiyah, maka diproklamirkan Aisyiyah yang akan mengurusi hak-hak dan kewajiban kaum perempuan di negeri tercinta ini. Di Asahan juga dikenal dengan nama Aisyiyah sebagai pendamping setia Muhammadiyah. Dalam sepak terjangnya, Aisyiyah di Asahan telah banyak berbuat seperti menggelar kegiatan amal social dan termasuk adanya klinik yang dikelolanya. Ditambahkannya, selain mengelola Klinik Siti Khjadijah, Aisyiyah juga membuat acara pengajian yang dilaksanakan dua kali sebulan secara bergilir di cabang Aisyiyah yang ada di Asahan. Bahkan bersamaan dengan dibukanya Klinik Siti Khadijah, Aisyiyah Asahan menggelar acara pengajian dan bertindak sebagai penceramah adalah Al Ustadz H Sahmuda Sagala BA. (van)

“Penyilidikan terhadap kasus ini dimulai sejak Februari 2011 lalu, namun dikarenakan pejabat kejaksaan dimutasi sehingga penyelidikan menjadi terhambat, dan pada Maret 2012 tahun ini penyilidikan kembali dilanjutkan dengan agenda pemeriksaan terhadap mereka yang terlibat kasus ini, termasuk beberapa kasus lainnya yang kami periksa proses penyelidikannya secara cermat,” katanya. Menurut Edi pemeriksaan terhadap kasus revitalisasi tanggul Sungai Asahan senilai Rp8,159 miliar lebih kembali dilanjutkan, dan kegiatan ini sebenarnya terdapat sekitar 25 sub kegiatan tetapi dikemas di dalam satu paket dengan kontrak serta rekanan yang berbeda. “Di dalam pemeriksaan ditemukan indikasi dugaan penyelewengan yang tidak sesuai dengan bestek atau tidak benar sesuai hasil penyelidikan dan ekspos yang dilaksanakan pada Maret lalu bahwa nilai pekerjaan 50 sampai 80 persen yang sudah siap. Tidak ada yang mencapai seratus perses tetapi dananya sudah habis dicairkan sampai 100 persen,” jelasnya. Dia mengungapkan, kejaksaan

sudah punya bukti-bukti akurat untuk diteruskan ke tingkat penyidikan. Sementara Kasi Pidsus Kejari Tanjungbalai Ahmad EP Hasibuan mengatakan, Syafaruddin melanggar pasal 2 ayat 1 pasal 3 dan 8 junto dan pasal 18 Undang-Undang nomor 31 tahun 1999 tentang tindak pidana korupsi. Di mana Syafaruddin bersama Pejabat Pembuat Komitmen (PPK) Haris Munandar ST bersama-sama ditetapkan jadi tersangka dan ditipkan di lembaga pemasyarakat Pulau Simardan Tanjungbalai. “Segera tindak lanjutnya kita akan serahkan berkas perkaranya ke Pengadilan Negeri Tanjungbalai,” katanya. Ahmad menyebutkan saat ini keterangan kasus penangkapan Syafaruddin tersebut hanya bisa diberikan sebatas itu saja. Karena pihak kejaksaan masih mengembangkan kasusnya. “Sudah dulu ya hanya segitu dulu, kita masih lakukan pengembangan,” ujarnya. Pantauan METRO, Syafaruddin hanya tertunduk saat digiring memasuki mobil tahanan kejaksaan. Syafaruddin langsung dibawa ke LP Pulau Simardan. (ilu)

Siswa SMK Terima Sertifikat dari Imigrasi Sambungan Halaman 8

Tanjungbalai Riduan Manurung melalui Dhanu mengatakan, pemberian sertifikat terhadap para siswa itu perlu dilakukan. Itu sebagai bentuk penghargaan kantor Imigrasi terhadap siswa yang telah 5 bulan mengikuti pelatihan. Menurutnya, selama mengikuti

pelatihan di kantor imigrasi, para siswa diajarkan tentang tata cara penyusunan buku administrasi dan pengetahuan lainnya. Ada pun para siswa yang menerima sertifikat penghargaan dari kantor imigrasi yakni Agustina Simanjuntak, Muliana Marbun, Murni, Yeni, Fauzi Tumbun, Ema Yanti, Fuspita, Muhayar, Ijo. (ilu)


„ Warga melintas di jalan penghubung di Kecamatan Setia Janji yang rusak parah. Warga berharap pemkab melakukan perbaikan jalan.

Perbaiki Jalan Penghubung di Setia Janji! Sambungan Halaman 8


„ Siswa SMK Negeri Tanjungbalai foto bersama pejabat kantor Imigrasi usai menerima sertifikat.

ran kecamatan. Namun hingga saat ini pembangunan jalan tidak dilakukan,” kata B Samosir warga Desa Urung Pane Kecamatan Setia Janji, Selasa (20/11). Dikatakannya, di Kecamatan Siata Janji terdapat beberapa desa yang jalan umumnya sangat buruk, misalnya jalan umum Urung Pane ke Desa Sei Silau Maraja maupun ke Desa Silau Tua, Desa Sei Silau Barat dan Bangun Sari.

Sebagian besar permukaan jalan umum tersebut adalah tanah merah atau tanahliat.Bilamusimhujanjalanjadilicin sehingga pengemudi sepedamotor sulit melaluinya. Bila musim kemarau, jalan berdebu dan sangat mengganggu bagi pengendera sepedamotor. Senada dikatakan Badrul llmi, warga Bangun Sari. Menurut Bangun, warga di daerah itu terkesan belum menikmati pembangunan infrastruktur jalan. Menurutnya Pemkab Asahan kurang memperhatian nasib mereka. (van)

Sambungan Metro Asahan Dari Gangnam Style tanpa Musik hingga Zikir di Masjid Raya Sambungan Halaman 1 bertuliskan Polmed, celana training dan sepatu sport berinisial DI. Sepatu yang kerap digunakannya jika akan berolahraga. Bukan inisial namanya, tapi Demi Indonesia; begitu yang kerap ia jawab jika ditanyakan inisial sepatu itu. Hari itu, Polmed mengundang Dahlan untuk senam pagi bersama. Bagi para penghuni Polmed, ini kali kedua mereka melihat wajah Dahlan. Malam sebelumnya, mantan Dirut PLN ini sudah didaulat mengisi kuliah umum tentang wirausaha. Senam pun dimulai. Dipandu instruktur, Dahlan yang sebelumnya melakukan pemanasan kecil lalu turut mengikuti gerakan instruktur. Cukup lincah dan bersemangat. Senyum tak pernah lupa ia lemparkan. Namun baru 10 menit berjalan, musik tiba-tiba berhenti. Para instruktur bingung dan terlihat panik. Ternyata ada gangguan. Dahlan tidak panik, dia malah terus bergerak tanpa musik. “Ikut saya,” teriaknya, langsung mengambilalihjabataninstruktur. Lalu ia melakukan gerakangerakan dengan tangan dan goyangan tubuhnya. Terlihat asingbagipesertasenamkarenaitu diiringi dengan keheranan dan gelak tawa. “Ini senam saraf,” kata Dahlan yang diikuti tawa peserta. Belum berhenti sampai di situ, Dahlan lalu melakukan gerakan lain. Kalau yang ini sudah cukup populer. “Gangnam style” yang dipopulerkan penyanyi asal Korea, Psy. Seperti gerakan

menunggang kuda dan Dahlan sepertinya cukup fasih melakukannya. Setelah merasa cukup berkeringat, ia langsung turun berbaur dengan peserta. Dahlanpunlangsungdiserbupara mahasiswa yang berebutan untuk menyalaminya. Jadwal kegiatan setelah senam adalah mengunjungi bengkelbengkel buatan Polmed itu. Karena itu Dahlan tak ingin membuang waktu dan langsung bergegas memasuki bengkel. Ada alat pemecah biji kopi, biji pinang dan lainnya. Kesemuanya merupakanhasilkreasimahasiswa Polmed. Dahlan pun mengamati benda-benda ini satu per satu. Kali ini pandangannya berubah serius. “Ini bagus. Tapi banyak makan energi karena bahannya tidak cukup. Harus diimbangi dengan barang-barang yang juga canggih,”katanyamengamatialatalat yang konvensional itu di bengkel mesin. Dari satu bengkel ke bengkel yang lainnya, gerakan Dahlan cukup cepat. “Lasak kali Pak Dahlan ini,” kata salah seorang mahasiswa. Usai memantau bengkel, Dahlan kembali ke gedung utama untuk mandi. Di perjalannya tentu saja ia dicegat para mahasiswa yang meminta berfoto bersamanya. Bahkan sehabis mandi pun sudah ramai yang mengantre untuk berfoto bersama. Baik mahasiswa maupun dosen-dosen. Dan, semuanya coba dilayani Dahlan. Sebelum meninggalkan Polmed, Dahlan diminta secara simbolis menanamkan satu bibit

pohon manggis di halaman gedung.“Inikaminamakanpohon manggis Dahlan. Nanti mungkin Pak Dahlan datang lagi ke sini, pohonnya sudah besar,” kata Direktur Polmed Medan, Syahruddin yang disambut tawa Dahlan. Selepas itu, puluhan mahasiswa berpakaian training oranye menunggunya. Dengan spanduk bertuliskan kampanye hemat energi, Dahlan diminta melepas mereka. “Mic-nya sudah hidup. Ayo senam lagi,” katanya disambut tawa para mahasiswa. Dahlan menyambut positif langkah Polmed yang bekerjasama dengan mahasiswa Jurusan Teknik Elektro USU itu. Namun ia juga meminta tindakan yang lebih konkret dari sekedar imbauan kepada masyarakat. “Kampanye hemat energi tidak akan ada gunanya kalau orang tidak mau peduli untuk berhemat. Jadi harus disikapi dengan cara yang demokratis. Jadi menghemat energy harus dilakukan dengan teknologi. Bukan sekadar imbauan,” katanya. Salah satunya saran untuk mendalami lampu LED yang disebutnya punya andil besar untuk penghematan energi. “Saya berharap ada tiga atau empat orang mahasiswa yang khusus mendalamisoallampuLED.Tidak hanya merakit tapi bahkan bisa membuat kristalnya. Itu bisa menghemat energi sampai 70 persen. Jika benar dilakukan dari BUMN siap bekerja sama,” ujarnya. Sebagai bentuk penghargaan perwakilan mahasiswan menye-

matkan pin di dadanya. “Pak Dahlan itu menteri yang berintegritas.KamisalutsamaBapak,” ujar salah seorang mahasiswa yang beralmamater USU. Sekitar pukul 07.30 WIB, Dahlan pun izin untuk pamit karena harus mengikuti kegiatan lain yang padat. Tak lebih dari satu jam ia berada di Polmed namun sudah cukup untuk memberikan keceriaan dan pelajaran berharga untuk para mahasiswa. Siang harinya Dahlan sudah ada di Masjid Raya Al Mahsun. Dia menghadiri zikir bersama yang diadakan oleh Majelis zikir Tazkira Sumatera Utara (Sumut). Acara ini bertujuan untuk menentramkan hati yang dihadiri 3.000 umat Islam se-Sumut. Pada kesempatan itu, Dahlan memberi ceramah singkat tentang berapa pentingnya zikir pada manusia. Ia menceritakan, beberapa waktu dan kelurga mencari para ulama atau kyai sebagai teman cerita. “Kalau sudah jumpa mereka Jadi saya bisa lupa dengan PLN dan komisi 7 (tujuh),” ucapnya. Setelah memberikan ceramah singkat Dahlan bergegas untuk bertolak ke Aceh untuk melakukan ziarah ke makam Syeikh Kuala. Terpisah Ketua umum Majelis zikir Tazkira Sumatera Utara (Sumut Kyai H Amiruddin mengatakan, bangga dengan kehadiran Dahlan Iskan. “Kita sangat senang Pak Dahlan Iskan hadir di tempat yang berbahagia ini. Karena, Dahlan merupakan sosok kenegaraan yang sangat baik dan dekat dengan Allah,”

ucapnya. Sebelumnya, Dahlan Iskan kunjungi perkampungan suluk tariqat Naqshabandiyah di Kecamatan TanjungPura, Langkat, Sabtu (17/11) malam, untuk bersilaturahim dengan tuan guru Syech H Hasyim Syarwani. Dahlan bersama rombongan tiba sekitar pukul 22.03 WIB di perkampungan suluk setelah mengikuti suatu kegiatan di Medan. Seakan menjadi kebiasaannya, mantan Dirut PLN ini meminta diperkenankan menginap untuk beristirahat (tidur) malam di kompleks tersebut. Tanpa agenda resmi dan membicarakan sesuatu materi yang urgen, Dahlan dan Tuan Guru Babussalam dalam hitungan menit saling bertukar cerita tentang ajaran tariqat. “Apabila tuan guru tidak keberatan, saya bersama rekanrekan kiranya diperkenankan malam ini beristirahat atau menginap di kompleks persulukan ini. Selepas salat subuh, kita harus sudah sampai ke Medan lagi mengikuti suatu kegiatan,” tutur Dahlan saat berhadapan dengan Tuan Guru Syech H Hasyim Syarwani. Kendati menyahuti keinginan itu, namun Tuan Guru Babussalam mengingatkan rombongan tetap saja terlebih dahulu menyantap makan malam sekaligus sarapan sebelum bertolak ke Medan usai melakukan ibadah lima waktu. “Bapak menteri malam ini tidur di rumah saya saja, tidak apa-apa. Namun, sebelum

bertolak ke Medan ba’da subuh nanti harus makan dulu atau sarapan. Tetapi begitupun, sebelum istirahat makan dulu ya sebab sudah dipersiapkan,” ucap Tuan Guru Babussalam. Tanpa protokoler maupun pengawalan layaknya pejabat negara, Dahlan yang sebelumnya mohon waktu melihat-lihat lokasi madrasah besar seketika mengarahkan ke makam Syeikh Abdul Wahab Rokan. Warga sekitar kompleks persulukan yang baru mengetahui kehadiran Dahlan, seketika berbaris di tepi jalan di luar madrasah ingin melihat langsung sosoknya.

Usai diperkenankan memasuki area makam Syeikh Abdul Wahab Rokan, Dahlan langsung memimpin tahlilan persis di sisi pusara pendiri tariqat tersebut. Hanya hitungan menit, Dahlan pun dipersilahkan ke rumah tuan guru Babussalam untuk beristirahat sementara staf bersama rombongan lainnya diberikan mess yang tak jauh dari tempat Dahlan istirahat. (don/ Mag-19/mag-4)

Yayasan TK Gracia Meradang Sambungan Halaman 1 matkan kepadanya, “ Sudah jelas-jelas dia yang melakukan pengutipan uang, dan membawa kabur uang itu. Saat diperiksa polisi, dia juga mengakuinya. Nah , kenapa giliran di sidang dia membantah,”tutur Muharawaty, saat berbincang dengan awak koran ini. Muharawati menilai, jika yang bersangkutan tidak melakukan penggelapan uang tersebut, tidak mungkin kasusnya bergulir sampai ke persidangan. Tindakan Susanti yang membantah semua tuduhan, dinilai Muharawati sebagai bentuk pembohongan terhadap hukum, yakni kepada kepolisian, dan kejaksaan. “Bukti penggelapan sudah cukup, mengapa saat disidangkan dia malah membantah? Harusnya diakuinya saja, toh di

penyidik dia sudah mengaku,” tegasnya, lantas menjelaskan, pihaknya berharap berharap pekara ini akan menjadi terang setelah disidangkan, bersadarkan fakta – fakta yang ada. Sebelumnya, Susanti yang menjabat sebagai bendahara pada Yayasan TK Gracia English Studies dilaporkan oleh Muharawaty Pimpinan Yayasan karena menggelapkan uang wisuda yang dihimpun dari orang tua murid sebesar Rp.11.800.000. Perkara itu lantas dilaporkan ke Polres Asahan pada 14 Juni 2012. LP/746/VI/SU/Res Ash, yang lantas menjadikan polisi menetapkan Susanti sebagai tersangka, dan kepadanya dipersangkakan melakukan pelanggaran pasal 374 sub 372 KUHP tentang penggelapan dalam jabatan. (Sus)

RABU Edisi 278 thn V

21 November 2012

Jadwal Keberangkatan Kereta Api


7 Jam Diperiksa Kadis PU Ditahan TANJUNGBALAI-Mantan Pelaksana Tugas Wali Kota Tanjungbalai yang saat ini menjabat sebagai Kepala Dinas Pekerjaan Umum (Kadis PU) Tanjungbalai Ir H Syafaruddin Nasution MM, Selasa (20/11) ditahan pihak Kejaksaan Negeri Tanjungbalai.


Berangkat (Tanjung) Tiba (Medan)

KA Putri Deli

I. 06.50 WIB

11.17 WIB

KA Putri Deli

II. 12.50 WIB

17.27 WIB

KA Putri Deli III. 17.50 WIB

22.15 WIB

Sumber: Stasiun Kereta Api Tanjungbalai




yafaruddin diduga terlibat dalam kasus dugaan korupsi proyek tahun 2009 sebesar Rp603 juta. Pantauan METRO, Syafaruddin yang awalnya dipanggil untuk diperiksa mendatangi kantor kejaksaan sekitar pukul 10.00 WIB. Syafaruddin yang saat itu memakai baju kemeja garis-garis, pakai kacamata dan celana keper warna hitam tampak memasuki salah satu ruangan di kantor kejaksaan. Hanya saja, pemeriksaan Syafaruddin berlangsung tertutup. Setelah 7 jam diperiksa, tepatnya sekitar pukul 16.00 WIB Syafaruddin tampak keluar dari ruang pemeriksaan bersama jaksa yang memeriksanya. Oleh jaksa, Syafaruddin digiring masuk ke mobil kijang BK 559 SN milik kejaksaan. Syafaruddin yang hendak dikonfirmasi terkait pemeriksaan dirinya memberikan jawaban singkat sebelum masuk ke dalam mobil


„ Mantan Pelaksana tugas Wali Kota Tanjungbalai Ir H Syafaruddin keluar dari ruangan pemeriksaan berjalan menuju mobil tahanan kejaksaan, Selasa (20/11).

„) Baca 7 Jam...Hal 7

Perbaiki Jalan Penghubung di Setia Janji! KISARAN- Kondisi jalan penghubung di Kecamatan Setia Janji memperihatinkan. Pemkab Asahan diminta melakukan perbaikan jalan. Pasalnya, akibat kerusakan badan jalan membuat warga di sana kesulitan untuk membawa hasil panennya karena kondisi jalan yang tidak ada per-

baikan. “Kami warga di daerah ini merasa terkucil karena pembangunan infrastruktur jalan hingga saat ini tergolong tak ada. Semula warga optimis bahwa pembangunan infrastruktur akan segera diperbaiki dengan adanya pemeka-

„ Kajari memberikan keterangan pers terkait penangkapan Syafaruddin yang diduga terlibat dalam beberbagai kasus dugaan korupsi, Selasa (20/11). KASUS DUGAAN KORUPSI PROYEK YANG MELIBATKAN SYAFARUDDIN: 1. Pembangunan tembok penahananan tanah pada ruas Simpang Empat. 2. Pembangunan proyek tanggul di Sei Asahan di Desa Opa Padang Mahondang Kecamatan Pulau Rakyat Asahan. 3. Proyek pembangunan badan jalan tembok penahan di Jalan Kabupaten Asahan. 4. Kasus kanopi gedung DPRD Tanjungbala. 5. Revitalisasi tanggul Sungai Asahan senilai Rp8,159 miliar lebih 6. Kasus proyek pasca bencana alam tahun 2009 yang berasal dari dana APBN Tahun Anggaran 2009 sebesar Rp8,1 miliar.

Gedung GOR Mini Ditelantarkan Anggaran Rp700 Juta Sia-sia TANJUNGBALAI-Bangunan Gedung Olahraga Mini yang dibangun dengan biaya sekitar Rp700 juta di Kelurahan Sei Raja Kecamatan Sei Tualang Raso Kota Tanjungbalai hingga

saat ini telantar dan tidak difungsikan. Padahal, bangunan itu sudah selesai dikerjakan sejak akhir tahun 2003. Data dihimpun METRO, tidak difungsikannya bangunan itu karena

„) Baca Gedung ...Hal 7

Siswa SMK Terima Sertifikat dari Imigrasi

„) Baca Perbaki ...Hal 7


„ Pengurus PD Aisyiyah Asahan berbincang-bincang di depan Klinik Siti Khadijah Kisaran usai dibukanya kembali klinik tersebut.

Sempat Tutup, Klinik Siti Khadijah Kembali Beroperasi KISARAN- Setelah lama tidak dibuka, kini Klinik Siti Khadijah Kisaran di Jalan Setia Budi Asahan kembali beroperasi dan siap me-

„) Baca Tokoh ....Hal 7

Pemko Tanjungbalai hingga sekarang belum menetapkan siapa pengelola bangunan, apakah Disporabudpar,

layani pasien yang hendak berobat ke tempat itu. Pembukaan Klinik

„) Baca Sempat...Hal 7

TANJUNGBALAI- Puluhan siswa Sekolah Menengah Kejuruan (SMK) Negeri Tanjungbalai mendapatkan sertifikat dari Kepala kantor Imigrasi Tanjungbalai, Selasa (20/11). Sertifikasi ini diberikan setelah mereka menyelesaikan masa pelatihan sejak 7 Juli hingga 20 November. Agustina S salahseorang siswi SMK yang menerima sertifikat dari kantor Imigrasi mengatakan, ada 10 orang siswa yang mengikuti pelatihan selama 5 bulan di kantor Imigrasi Tanjungbalai. Menurutnya pengalaman yang mereka peroleh selama mengikuti pelatihan menjadikan mereka bisa mengetahui administrasi pembukuan. “Selama di lingkungan kantor Imigrasi kami dapat beradaptasi sesama pejabat di kantor Imigrasi. Sementara itu kepala Imigrasi

„) Baca Siswa ...Hal 7

Diana Nasution adalah sosok penyanyi populer pada era 1970-an hingga 1990-an. Lahir di Medan, Sumatra Utara, 6 April 1944, ia banyak menelurkan lagulagu yang jadi hit di masanya, di antaranya lagu Benci Tapi Rindu, Ayah, Dasar Lelaki, Katakan Sejujurnya, Jangan Biarkan, Sayang Bilang Sayang dan Pergi Untuk Kembali. Pada sekitar 1970-an, Diana pernah menelurkan duet bersama kakaknya Rita Nasution dengan duo Nasution Sisters yang juga mendapat sambutan antusias penggemarnya. Pada Festival Penyanyi Nasional 1977, Diana pernah berduet dengan Alm. Melky Goeslaw (ayah Melly Goeslaw) membawakan lagu Bila Cengkeh Berbunga dan Malam Yang Dingin ciptaan Minggus Tahitoe. Namun keduanya kalah unggul dengan penyanyi Hetty Koes Endang yang tampil sebagai juara pertama. Diana yang kemudian menikah dengan Minggus Tahitoe itu juga pernah bermain film, CINTAKU TERGADAI (1977) bersama Paul S. Murry. Salah satu putra dari Diana, Marcello Tahitoe atau lebih sering dipanggil Ello, kini mengikuti jejaknya sebagai penyanyi. Di awal 2010, Diana kembali ke panggung musik. Ia menerima tawaran Titi DJ untuk berduet di lagu Jangan Biarkan yang diambil dari album teranyar Titi, TITI TO DIANA, sebuah album tribute Titi untuknya. Sementara itu, Diana harus berjuang untuk melawan kanker payudara stadium 3B. Ia sudah menjalani pengobatan, seperti kemoterapi, yang sempat membuat rambutnya rontok dan tubuhnya jadi kurus. Namun kini, keadaannya sudah membaik. (int)

B a ko m b u r

Wak Alang: 9 anggota DPRD katanyo sepakat maneken hak angket pemanggilan walikota. Wak Ongah: Kapan ondak dipanggil pak. (**)

Rabu, 21 November 2012




„) Baca Rumah Warga .....Hal 10


„ Saluran air di Jalan Sekip longsor dan mengancam pemukiman di sekitarnya.

Biarkan Warga Kelola Dana CSR! BATANG TORU- Pengelolaan dana tanggung jawab sosial perusahaan atau corporate social responsibility (CSR) dari perusahaan tambang emas PT Agincourt Resources (AR) di Batang Toru seharusnya tidak diserahkan kepada pemerintah, tetapi melalui sebuah lembaga resmi yang dikelola oleh masyarakat. Ketika dana CSR dikelola pemerintah, tidak pernah sampai secara langsung kepada masyarakat, baik berupa pembangunan atau lainnya. Bahkan penggunan dana tersebut, selama ini juga tidak diketahui masyarakat Batang Toru, yang jelas-jelas paling berhak „) Baca Biarkan Warga ...Hal 10

„ Petani membajak sawah dengan bantuan kerbau.

Air Masam Rusak Pertanian Warga MADINA-Sudah hampir 30 tahun, air masam (acid drainage) sudah merusak areal pertanian masyarakat di beberapa desa di kecamatan Lembah Sorik Merapi Kabupaten Mandailing Natal (Madina). Selain cost (biaya) perawatan padi yang bertambah, hasil panen petani juga jauh berkurang. Hingga kini permasalahan air masam ini belum juga dituntaskan pemerintah. Kepala Desa Aek Marian, Bahsanuddin SPd kepada METRO, Selasa (20/11) menerangkan, air masam ini sudah terjadi sejak tahun 1983 dan sudah merusak sejumlah sarana perta„) Baca Air Masam .....Hal 10



Rumah Warga Terancam Ambruk

RANTAU- Tingginya curah hujan yang melanda Rantauprapat dan sekitarnya mengancam pemukiman warga. Erosi dan longsor akibat banjir, menjadikan sejumlah lokasi pemukiman rawan ambruk. Seperti yang terlihat di kawasan Jalan Sekip Rantauprapat. Banjir terus menggerus dinding parit dikawatirkan merubuhkan rumah warga. “Kami kawatir saluran drainase longsor dan rumah kami juga menjadi sasaran berikutnya,” kata Suriyanto dan Sugianto, warga Jalan Sekip Bawah, Selasa (20/11). Menurut mereka, kalau hal ini terus dibiarkan berlanjut maka akan jatuh korban materi dan bahkan korban nyawa.



„ Kedua tersangka pelaku pencuri yang ditembak dirawat di RSU Kotapinang, Selasa (20/11).

KOTAPINANG- Kawanan pencuri yang menyatroni rumah H Syahmolek Siregar (37) dan Istrinya Hj Anisa (35) di Dusun Padangri Desa Simatahari Kecamatan Kotapinang Labusel berhasil digulung polisi dan masyarakat. Dua diantaranya dilumpuhkan dengan timah panas, setelah mencoba melarikan diri dari kejaran warga dan petugas. Informasi yang dihimpun, Selasa (20/11) di RSU Kotapinang, H Syahmolek dan istrinya

sedang tidur, Selasa dini hari sekira Pukul 02.00. Tiba-tiba tak diketahui dari mana berasal, dua pria sudah berada di lantai dua rumahnya dan sedang mengambil handphone Nokia C3 yang diletakkan di kamar. Hj Anisa berteriak maling, sehingga mengejutkan kedua pelaku dan langsung melompat dari lantai dua ke halaman rumah. Sementara di depan „) Baca 2 Ditembak.....Hal 10

PENCULIK & PEMERKOSA MURID SD DITANGKAP RANTAU-Pria bertompel di bagian wajah berinisal DD (35) warga Simpang Mangga Rantauprapat, pelaku penculik dan pemerkosa murid SD, sebut saja Bunga (13), Senin (19/11) berhasil diringkus polisi. Penangkapan residivis yang pernah dihukum 8 tahun atas kasus yang sama ini, berdasarkan kecurigaan keluarga korban terhadap ciri-ciri pelaku. „) Baca Penculik & Pemerkosa.....Hal 10

Keluarga Korban Mengamuk MENGETAHUI pelaku penculikan telah ditangkap, orangtua Bunga dan keluarganya mengamuk di luar ruangan unit PPA Polres Labuhanbatu. KL (47) ayah korban, MI (41) ibu korban, Nenek dan Paman korban ber-

teriak-teriak memaki pelaku yang diperiksa dalam ruangan tertutup. “Saya minta kepada polisi agar menghukum pelaku de-


„) Baca Keluarga ...Hal 10

„ Suasana di halaman Mapolres Labuhanbatu ramai ketika keluarga korban mengamuk, setelah diketahui pelaku penculikan dan pemerkosaan ditangkap, Minggu (20/11).

Awasi Pengerjaan Proyek di Musim Hujan

Erwin Pardamean Bantu Korban Kecelakaan MARBAU- Wagiran (34), warga Dusun VI Desa Simpang Empat Kecamatan Marbau Labuhanbatu Utara yang mengalami kecelakaan kerja di Kampung Pajak sekitar Agustus 2012 lalu masih menjalani perawatan di RSUD Pringgadi Medan. Setelah 6 minggu menjalani perawatan, Wagiran belum pulih dan masih membutuhkan rawatan lanjutan sehingga rekomendasi dari Pemkab Labura diminta kembali. „) Baca Erwin Pardamean ...Hal 10

„ Erwin Pardamean

SIDIMPUAN- Dinas Pekerjaan Umum Kota Padasidimpuan (Psp) di bidang Pengairan dan Bina Marga harus mengawasi pelaksanaan proyek dari APBD Kota Psp TA 2012. Dikhawatirkan saat pengerjaan proyek ini, rekanan bisa saja berbuat nakal, misalnya terus mengerjakan proyeknya meski sedang hujan. Demikian diingatkan anggota DPRD Psp dari Komisi II, Sopian

Harahap, Selasa (20/11). Saat ini, katanya, banyak di Kota Psp terlihat pengerjaan berbagai proyek APBD pengerjaan fisik. Karena, hasil pengerjaan itu, harus membuat Kota Psp semakin maju dan berkembang dan manfaatnya dirasakan masyarakat. Politisi muda dari Partai RepublikaN ini, saat ini sedang musim hujan, „) Baca Awasi ...Hal 10

Ini Bukan ‘Ratu Sabrangan‘ DALAM dunia perwayangan, ratu sabrangan (raja negeri seberang) akan ngamuk jika lamarannya ditolak. Rupanya Murtono (24) begitu juga kelakuannya. Sakit hati Mimi (21) gadis idola menolak cintanya, langsung emosi. Cewek teman kuliah itu ditusuk hingga pingsan, sementara Murtono diudak-udak polisi Lampung Tengah.

DALAM dunia pakeliran, politik menghalalkan segala cara biasa dilakukan oleh tokoh-tokoh ratu sabrangan. Dia akan menantang perang dan mengancam takbruki bathang sayuta (kukirim sejuta mayat) jika putri tuan rumah menolak lamarannya. Biasanya kemudian yang meladeni tantangan itu Gatutkaca atau Sencaki, dan setelah ratu sabrangan kalah, ajudannya si Togog dan Bilung ikutan lari terbirit-birit. Rupanya kelakuan Murtono menduplikasi ratu sabrangan dalam du-

nia perwayangan. Meski mukanya tidak merah menyala, mata tidak melotot dan giginya juga tak bersiung (taring), tapi mahasiswa perguruan tinggi swasta di Metro ini temperamental sekali. Tersinggung sedikit, marah. Maunya, siapapun harus tunduk pada keinginannya. Bahkan kepada cewek yang ditaksirnya, bisa juga dia berbuat kasar. Padahal Dasamuka dari Ngalengkadiraja, meski Dewi Sinta selalu „) Baca Ini Bukan .....Hal 10


21 Nopember 2012

PEREKONOMIAN MEROSOT, WARGA DESAK PERBAIKAN JALAN SIPIROK- Untuk meningkatkan perekonomi masyarakat, harus didukung berbagai sektor, salahsatunya sarana parasara transportasi (jalan). Sarana ini sangat berperan besar untuk menentukan harga jual berbagai komoditi sebagai sumber pendapatan masyarakat. Sayanganya, harapan untuk meningkatkanya taraf perekonomian dan kesejahteraan itu, masih sangat jauh bagi masyarakat yang berdomisili di beberapa desa tertinggal di wilayah Luat Harangan, Kecamatan Sipirok, Kabupaten Tapanuli Selatan (Tapsel). Sudah bertahun-tahun masyarakat Luat Harangan sangat berharap perhatian pemerintah untukpembangunansaranajalanyanglebihlayak kedaerahmereka.Jumlahmasyarakatyangtinggal di seberang Sungai Batang Ilung sekitar 250 KK yang terdiri dari empat dusun dari dua desa, yakni Desa Panaungan dan Desa Pargarutan. AmatanMETROketikadigelarbaktisosialbersama NNBS dan Polsek Sipirok beberapa waktu lalu, jika berangkat dari Pasar Sipirok sekitar pukul 9.00 WIB dengan kenderaan gardang 2, sampai di jembatan gantungatauRambingAekBatangIlungsekitarpukul 11.30WIB. Jarak tempuh yang sekitar 30 km, hanya 7 km berupa jalan hotmix, sekitar 5 km jalan lapen dengan kualitas tidak rusak parah, dan selebihnya merupakanjalanyangrusakparahdansulitdilalui. Bahkan di beberapa titik, yang seharusnya ada jembatan, hanya dibuat dengan batang kayu. Belum lagi jurang di sisi kiri dan kanan jalan, tanjakan dan turunan yang curam serta tikungan patah berliku-liku. Memang perjalanan menuju Luat Larangan membutuhkan mental dan nyali petualang. Sesampai di Desa Pangaribuan hingga Dusun Salese atau sekitar 6 km. Sekalipun di kiri kanan badan jalan ada jurang. Namun kesungguhan masyarakat untuk mengembangkan tanaman kakao sangat giat, pasalnya sepanjang jalan dipenuhi tanaman kakao yang telah menghasilkan. Namun, melihat kondisi jalan yang begitu parah, sudah sepantasnya pemerintah daerah memprioritaskan pembangunan jalan menuju wilayah tersebut. Kepala Desa Panaungan, Mara Deman Siregar dan Kepala Desa Pargarutan serta tokoh masyarakat lainnya kepada METRO kemerin mengatakan, banyak hasil bumi dari wilayah itu, namun karena faktor sarana tranportasi yang kurang mendukung, berdampak perekonomi masyarakat. “Karena kurang baiknya sarana transportasi ini, akibat masyarakat kesulitan menjual hasil bumi mereka, akibatnya harganya jauh berkurang. Bahkan, banyak hasil bumi yang tak sempat dipasarkan dan menjadi busuk karena tak ada angkutan. Kami sangat membutuhkan perhatian masyarakat agar jalan ke Luat Larangan segera diperbaiki,” harap mereka. Seorang tokoh masyarakat Desa Paragutan, Muhammad Rohim (50) kepada METRO mengatakan, dengan kondisi jalan yang sebagian besar berupa jalan tanah, membuat masyarakat yang berjumlah 100 KK terpaksa terus mengandalkan kuda sebagai sarana pengangkutan hasil bumi seperti getah karet, kakao, kopi dan hasil hutan lainnya ke pasar.Demikian juga ketika membawa kebutuhan hidup dari pasar. (ran/mer)

Awasi Pengerjaan Proyek di Musim Hujan Sambungan Halaman 9 sehingga jika pengerjaan proyek terus dipaksanakan maka hasilnya tidak akan maksimal. “Kita minta Dinas PU Psp untuk mengawasi pekerjaan proyek yang tetap dipaksanakan dikerjakan saat sedang hujan. Pasalnya, hasilnya atau mutu pekerjaan bisa saja jelek. Kita minta pelaksanaan proyek itu diawasi dan jika ada rekanan yang membuat kesalahan, agar ditegur dan jangan diberikan lagi pekerjakan tahun mendatang,” tuturnya. Sopian Harahap juga berharap, kalau nantinya hasilnya menjadi jelek dengan memaksakan pekerjaan tetap dikerjakan disaat musim hujan seperti ini, agar jangan waktu jatuh tempo pelaksanaan kerja dijadikan sebagai alasan. “Memang umumnya kesalahan pengerjaan proyek selalu murni dengan alasan karena factor cuaca. Kendati demikian, kita berharap agar Dinas PU Psp tetap mengawasi pelaksanaan proyek dengan baik. Jangan karena mengejar waktu jatuh tempo, hasilnya menjadi buruk. Uuntuk apa begitu,” sarannya. Kata Harap, sampai hari ini rata-rata kegiatan pelaksanaan proyek fisik sudah mencapai sekitar 80 persen, sekarang ini bulan November dimana kegiatan proyek itu pada 15 Desember itu harus selesai semuanya atau 100 persen. Diharapkannya, seluruh kontraktor masyarakat jasa konstruksi yang melaksanakan kegiatan proyek di Kota psp, agar tidak ada satupun proyek yang tidak bisa diselesaikan dalam tahun anggaran 2012 ini. “Kepada seluruh kontraktor yang sudah memenangkan tender proyek, maka harus cepat menyelesaikannya. Apabila melihat kondisi waktu yang tersisa saat ini hanya tinggal 1 bulan, bila tidak bisa selesai maka harus berpacu dengan mengerjakannya pada malam hari. Tapi ingat, jangan jadikan faktor cuaca sebagai alasan hasilnya tidak maksimal,” tukas Sopian. Diingatkannya lagi, bila kontraktor mengerjakan proyek pada malam hari maka mereka harus membuat surat kepada PPK-nya tentang kegiatan malam hari ini, jangan sampai kegiatan malam hari ini membuat kualitas proyek itu menjadi menurun, jadi tidak ada alasannya. “Dengan kegiatan malam itu tidak boleh membuat kualitas proyek menjadi menurun, harus tetap seperti kontrak yang ditawarkan,” tegasnya. (phn/mer)

2 DITEMBAK, 1 LOLOS Sambungan Halaman 9 rumah, menunggu sebuah mobil yang telah dinyalakan dan kedua pria bersama mobil langsung tancap gas. Warga yang mendengar teriakan pemilik rumah langsung ramai mendatangi rumah korban, berselang beberapa menit dua pengendara sepedamotor jenis Supra tanpa plat mendatangi kerumunan warga dan bertanya apa yang sedang terjadi. Keduanya membawa jerigen berisi minyak bensin isi 5 liter. Pemilik rumah mengenali keduanya sebagi pelaku yang baru

mencuri dari rumahnya, baju kotak-kotak yang dipakai salah satu pria mengingatkan pemilik rumah. Melihat gelagat dicurigai, keduanya langsung pergi. Merasa curiga warga mengejar keduanya yang melarikan diri menuju Kabupaten Paluta. Di perempatan jalan, mobil warga berhasil mencegat sepedamotor, salah satu diantaranya berhasil melarikan diri. Sementara salah satu pencuri bernama Wahid (30), berhasil ditangkap warga. Kepada warga, Wahid mengaku minyak yang dibawa untuk mobil Daihatsu Avanza B 8907 HJ yang kehabisan minyak,

Sementara Kapolsek Kotapinang, Kompol Janner Panjaitan menjelaskan, setelah mendapat informasi dari warga pihaknya melakukan pengembangan di dua lokasi tempat kejadian perkara yakni di Simpang Dusun Padangri Kecamatan Kotapinang hingga Desa Siancimun Kecamatan Holongan Kabupaten Paluta. “Anggota sempat kejar-kejaran dengan kedua tersangka. Dua tersangka yakni Memet (29) alias Bolot warga Karang Sari Desa Sabungan, Sei Kanan bersama rekannya Parju (22) warga Gunung Tua ditangkap di Desa

Siancimun Kecamatan Holongan Kabupaten Paluta,” katanya. Dijelaskannya, kedua tersangka sempat mau melarikan diri dan melakukan perlawanan, akhirnya petugas pun melakukan penembakkan kepada kedua tersangka. “Ada empat tersangka, yang tertangkap ada tiga yaitu berinisial W, M dan P sedangkan berinisal S masih daftar pencarian orang (DPO). Barang bukti berupa linggis, Hp, senjata api jenis sofgan, senjata mainan mirip mancis, pisau cuter , mobil Daihatsu Avanza diamankan,” katanya. (mhr)

PENCULIK & PEMERKOSA MURID SD DITANGKAP Sambungan Halaman 9 Kapolres Labuhanbatu AKPB Hirbak Wahyu Setiawan melalui Kasubag Humas AKP MT Aritonang menjelaskan, DD pria yang memiliki ciri-ciri seperti yang dituturkan Bunga ditangkap polisi bersama keluarga korban setelah mendatangi rumahnya. “Setelah mendapat laporan dari keluarga korban, petugas langsung mengecek ciri-ciri pelaku. Bersama keluarga korban, petugas mendatangi kediaman pelaku dan menangkapnya,” kata Aritonang. Dijelaskan Aritonang, pelaku ditangkap dari rumahnya sekira Pukul 23.30 WIB tengah malam, pada hari yang sama. “Kita belum dapat memberikan keterangan lengkap, tersangka masih diperiksa. Kami juga

masih menunggu hasil visum korban,” kata Aritonang singkat. Informasi dihimpun METRO, pelaku penculikan sekaligus perkosaan terhadap Bunga, sebelumnya pernah ditahan atas tuduhan kasus pelecehan seksual terhadap anak di bawah umur. Keluarga Bunga, setelah mendapat laporan dari Bunga langsung menduga bahwa pria yang disebutkan telah dua kali menikah dan memiliki tiga orang anak ini sebagai pelakunya. Setelah dipastikan, ternyata DD memang benar pria yang menculik Bunga. Sebelumnya diberitakan, Bunga diculik dan tersadar dalam keadaan tubuh telanjang bersama pria bertompel di wajahnya. Bunga baru pulang sekolah setelah mengikuti ujian try out sekira Pukul 09.30 WIB. Ketika itu,

pelaku mendatanginya serta berpesan untuk menyampaikan surat anaknya karena tidak bisa hadir ke sekolah. Lokasi kejadian itu sendiri hanya berjarak sekitar 500 meter dari sekolah korban. Merasa tidak kenal dan aneh, Bunga berlari meninggalkan pria tersebut, tetapi Bunga dikejar, dijegal hingga terjatuh. Kemudian pelaku membekap Bunga dengan saputangan, sehingga Bunga lemas dan pingsan, tersadar setelah 2 jam kemudian dan dalam keadaan telanjang di lokasi yang sepi di Jalan By.Pass Rantauprapat. Pelaku menyuruh Bunga untuk memakai pakaiannya, sebelum diantarkan ke Jalan Ahmad Dahlan Rantauprapat. Bunga kemudian melapor ke Pos Lantas yang berada di Jalan Ahmad Dahlan. (CR-01)

Erwin Pardamean Bantu Korban Kecelakaan Sambungan Halaman 9 Rasina (36), saudara perempuan Wagiran kepada METRO, Selasa (20/11) mengatakan, adiknya bekerja sebagai buruh bangunan pada proyek di Kampung Pajak. Ketika bekerja bersama rekannya pada lantai tiga bangunan, Wagiran menyodorkan sepotong besi kepada temannya, ternyata besi tersebut menyentuh kabel listrik yang melintas di samping bangunan. Wagiran kena strum arus listrik dan terlempar. Oleh rekan-rekannya segera dilarikan ke klinik sekitar bangunan, namun setelah dua minggu dirawat tidak ada perkembangan kesehatan. Tangannya tidak dapat digerakkan seperti biasa. Karena biaya pengobatan semakin minim, Wagirin dibawa pulang ke rumahnya di Desa Simpang Empat. Selama dua minggu, pria beranak dua ini dirawat istrinya di

rumah sambil berobat jalan, tetapi tetap belum ada tanda-tanda kesembuhan. “Akhirnya kami minta petunjuk kepada Kepal Desa Simpang Empat Erwin Pardamean, selanjutnya oleh Kepala Desa disarankan untuk dibawa ke Puskesmas Marbau,” kata Rasina. Ditambahkan Rasina, Puskesmas Marbau akhirnya merujuk ke RSU Rantauprapat dan kemudian dirujuk ke RSUD Pringadi Medan. Secara pribadi Erwin memberikan Rp1 juta kepada Wagirin untuk digunakan selama berobat di Medan. “Sekarang memang sudah banyak kemajuan, mudah-mudahan semakin baik, tapi rujukan diminta untuk diperpanjang” katanya. Terpisah, Kepala Desa Simpang Empat Erwin Pardamean mengaku sangat prihatin, ,turut perihatin atas musibah tersebut dan saya merasa kasihan dan prihatin dengan kehidupan keluarganya , jadi saya membantunya untuk

meringankan beban mereka dan saya ikhlas, lagi pula saya tau dia (wagiran) bekerja sebagai buruh cari upahan, ungkap erwin . Masih kata erwin, Wagiran telah satu bulan dua minggu berada di Rumah sakit pirngadi medan dan kabar dari keluarganya wagiran semakin membaik namun masih perlu perwatan yang rutin dari tim medis , selanjutnya pada pagi hari ini pukul,7.30 wib tadi 20/11 saat mau ke kantor kepala desa di perjalanan keluarganya meminta rekomendasi (surat keterangan) untuk di tanda tangani guna untuk memperpanjang surat rujuk rumah sakit dari saya dan surat tersebut untuk di tindak lanjuti ke Puskesmas Marbau dan seterusnya untuk ke RSUD Labura,dan langsung saya tanda tangani . ungkap erwin. Masih kata erwin kabar dari keluarga nya bahwa keadaan erwin saat ini semakin membaik. (st)

Biarkan Warga Kelola Dana CSR! Sambungan Halaman 9 atas dana CSR tersebut. Hal ini ditegaskan tokoh pemuda Batang Toru, Irwansyah Pulungan, Selasa (20/11), “Saya melihat, dana CSR dikelola pemerintah tidak pernah sampai ke masyarakat Batang Toru, baik secara langsung berupa pembangunan atau lainnya. Bahkan, penggunannya juga tidak diketahui masyarakat Batang Toru yang jelas-jelas paling berhak atas dana CSR tersebut,” katanya. Seharusnya, tambah Irwansyah, yang paling berhak merasakan dana CSR adalah masyarakat sekitar tambang atau di Batang Toru. “Bukannya maksud kita mengkotakkotakkan, tetapi wajarlah jika yang menerima dan merasakan dana CSR itu adalah masyarakat Batang Toru. Kenapa dana itu digunakan untuk membangun wilayah lain, bukan di Batang Toru. Jadi, apa untungnya untuk masyarakat Batang Toru,” tanyanya. Dana CRS yang dikelola pemerintah,

penggunannya atas keinginan pemerintah tanpa memikirkan keinginan warga di sekitaran Batang Toru. Akibanya, penggunaan dana CSR dari perusahaan PT AR tidak jelas untuk apa. “Beginilah kalau pemerintah juga ikut mencampuri masalah CRS. Masa dana CSR yang seharusnya warga berhak mendapatkannya, malah tidak tahu ke mana dana itu dipergunakan. Anehkan,” tuturnya. Pria yang aktif di organisasi kepemudaan ini dan akrab dipanggil Romel ini menambahkan, ke depan seharusnya pengelolaan CSR dikelola langsung warga Batang Toru yang dikumpulkan dalam suatu wadah atau lembaga resmi. Nantinya, susunan kepengurusan lembaga itu adalah para tokoh masyarakat yang dipercayai masyarakat. Nantinya, penggunaannya harus sesuai keinginan masyarakat, pemerintahan hanyalah sebagai pembina atau pengarah saja. “Yang kita mau, harusnya masyarakatlah yang mengelola dana CRS itu. Bukan seperti

sekarang pemerintah yang mengelolanya. Akibatnya, arah penggunaan dana tidak jelas dan tidak dirasakan masyarakat Batang Toru. Saya sebagai warga asli Batang Toru meminta pemerintah untuk tidak lagi mencampuri urusan CSR, dan menyerahkan pengelolaannya kepada masyarakat melalui lembaga resmi yang dibentuk masyarakat dan pemerintah hanyalah sebagai pengarah saja,” tegasnya. Lembaga ini nantinya bukan hanya mengurus masalah CRS saja, tetapi juga menjadi jembatan antara masyarakat dengan perusahaan. Lembaga ini juga berfungsi sebagai audit publik, pengawasan pekerjaan hingga ikut memperogramkan dana CSR perusahaan. “Pemerintah sifatnya hanya mengawasi saja, sedangkan yang menjadi aktor utamanya adalah lembaga independent, sehingga rakyat benar-benar mendapatkan manfaat dari keberadaan perusahaan,” harapnya. (phn/mer)

Air Masam Rusak Pertanian Warga Sambungan Halaman 9 nian seperti irigasi dan sebagainya, belum lagi hasil panen yang jauh menurun. Sehingga apabila dikalkulasikan secara ekonomi, masyarakat pada dasarnya rugi mengerjakan lahan pertanian mereka. Mengingat bertani satu-satunya usaha masyarakat, mereka tetap meneruskan dengan harapan hasil taninya masih bisa membaik. ”Air masam ini sudah merugikan masyarakat petani sejak hampir 30 tahun terakhir. Akibat air masam ini, sarana pendukung pertanian sudah banyak yang rusak karena zat belerang air masam ini bisa merusak,” ungkap Bahsan. Dijelaskannya, petani sudah rugi dari jumlah pemupukan yang bertambah dari biasanya.

Sebab sebelum adanya air masam ini, petani hanya melakukan pemupukan 1 sampai 2 kali saja, tetapi sekarang mereka harus mengeluarkan biaya untuk 3-5 kali pemupukan. Selain itu air masam ini juga mengurangi mata pencaharian warga yang memiliki kolam ikan. Karena air masam ini menyebabkan tidak ada lagi ikan yang bertahan hidup, sehingga kolam-kolam ikan masyarakat sekarang tidak bisa lagi difungsikan. ”Dan bagi masyarakat sendiri, apabila mandi di irigasi di sekitar sawah mereka, mata terasa perih akibat air yang sudah bercampur air masam atau air yang telah bercampur dengan belerang itu. Selain itu warga tidak bisa menggunakan air di daerah persawahan untuk mencuci, karena kain akan menjadi lapuk dan mudah sobek apabila sudah kering,” ucapnya.

Seluruh warga tujuh desa di kecamatan itu berharap agar Pemerintah segera memberikan perhatian khusus dalam menuntaskan permasalahan air masam itu. Sebab hampir semua desa mengalami air masam, bahkan akibatnya banyak petani yang beralih profesi menjadi pedagang. ”Sebenarnya kami sudah beberapa kali menyampaikan ini kepada Pemerintah, namun sejauh ini belum ada tindaklanjutnya. Harapan kami pemerintah segera turun tangan dan memberikan penanganan khusus atas persoalan yang dihadapi warga, jika tidak saya yakin masyarakat akan terus terhimpit di bidang ekonomi karena rata-rata masyarakat di kecamatan Lembah Sorik Merapi adalah petani,” harapnya. (wan)

Keluarga Korban Mengamuk Sambungan Halaman 9 ngan seberat-beratnya,” kata SR (50), Nenek korban. Sementara paman Bunga, JN mengatakan, pihaknya mengetahui pelaku telah ditangkap tadi malam. Pelaku merupakan warga sekampung JN di Simpang Mangga. Ciri wajah tompel, mengingatkan dirinya kepada warga sekampungnya, setelah mendapat informasi dari keponakannya. “DD memang dikabarkan memiliki kelainan seks, saya ceritakan kepada petugas dan ternyata memang benar sesuai ciri-cirinya,” katanya. Dijelaskan JN, beberapa bulan lalu, pelaku juga pernah dilaporkan kepolisi dengan kejadian yang serupa. Namun, entah mengapa pelaku dilepaskan. “Kami datang ke Polres labuhanbatu meminta keadilan, sebab kami khawatir pelaku kembali dilepaskan, seperti kasus sebelumnya,” kata JN. Pantauan METRO, seorang pria yang diduga kuat pelaku penculikan dan pencabulan sedang diperiksa secara tertutup di ruangan UPPA Polres Labuhanbatu. DD merupakan warga Simpang Mangga Kelurahan Urung Kompas. Pelaku tinggal bersama istri keduanya di Jalan Simpang Mangga, DD juga pernah tinggal di Jalan Bacang Kelurahan Cendana Rantau Utara bersama istri pertamanya. Menurut tetangga DD berinisial RN (35) dan BA (38), DD bercerai dengan istri pertamanya dikabarkan karena memiliki kelainan seks. Dari istri pertama DD memiliki tiga anak, sementara dengan istri keduanya DD tidak memiliki keturunan. Beberapa bulan lalu, beberapa orang mendatangi rumah DD dan terjadi keributan. DD diancam akan dilaporkan ke polisi atas kasus pencabulan. “Kami hanya berharap, jika DD pelakunya segera dihukum berat agar kita tidak was-was dan khawatir terhadap keselamatan anak,” katanya. (CR-02)

Rumah Warga Terancam Longsor Sambungan Halaman 9 “Kami meminta pemerintah segera mengambil tindakan pencegahan, agar rumah warga tidak terbawa longsor. Hal senada disampaikan Anto dan Sugi. Pihaknya berharap pemerintah lebih serius memperhatikan drainase dan segera memperbaikinya sebelum kekawatiran warga menjadi kenyataan. “Kita minta agar drainase yang ada segera diperbaiki, karena sudah sangat mengancam bagi warga sekitar,” kata mereka. Dijelaskan Anto, drainase di Jalan Sekip dibangun pada tahun 2011 lalu. Sebagian besar sudah rusak dan tumbang, karena kikisan air dan disebabkan kondisi pondasi serta lantai drainase kurang kokoh. Sementara sedikitnya 60 meter sambungan bangunan drainase belum diperbaiki dan telah mengalami longsor. (riz)

Ini Bukan ‘Ratu Sabrangan‘ Sambungan Halaman 9 menolak untuk disenggama, dia tak pernah tega menganiaya. Murtono dewasa ini memang sedang kasmaran pada gadis Mimi, teman kuliahnya. Mereka kenal sudah lama, tapi baru nampak dekat setelah Idul Fitri kemarin. Ini nampak dari seringnya mereka jalan berdua, bahkan di Senin dia juga biasa “apel” di rumah Mimi, meski tanpa kerek bendera dan nyanyi lagu Indonesia Raya. Karena seringnya Murtono ke rumah di Dusun 4 Gayau Sakti, Seputih Agung, Lampung Tengah ini, para tetangga membatin, “Wah, ini rupanya calon minantu

Pak Dahlan.” Benarkah Murtono calon menantu Pak Dahlan? Tidak jelas benar. Sebab Mimi sendiri tak merasa Murtono ini sebagai kekasihnya. Dia dianggap sebagai teman kuliah semata, karena Murtono sering membantu dalam studinya. Untuk menjadi kekasih nanti dululah, karena sepertinya lelaki ini tak masuk kriteria. Yang Mimi tidak suka, cowok ini suka emosian, mudah tersinggung. Belum jadi apa-apanya sudah sok ngatur ini dan itu. Kalau dipanggil harus datang, memangnya DPR ngajak RDP apa? Ini beda sekali dengan penilaian Murtono.

Bagi dia, cintanya pada Mimi tinggal ketok palu saja. Maka beberapa hari lalu dia nekad menyatakan cintanya, bla bla bla! Untuk menolak serta merta, Mimi tak enak juga, sehingga katanya: “Saya belum memikirkan perkawinan, karena konsentrasi pada kuliah dulu, Mas.” Rupanya Murtono tersinggung atas ucapan itu, menganggap bahwa Mimi menolak cintanya mentah-mentah. Padahal dia sudah membayangkan, sebelum Oktober 2014 harus sudah menjadi suami istri bersama Mimi. Karena gadis itu tak juga mau memberi ketegasan, mental “ratu sabrangan”-nya muncul. Dia ambil pisau, dan dihunjamkan ke

perut Mimi. Ketika gadis itu ambruk, dia malah mengambil HP dan uangnya sebanyak Rp 600.000,- dan langsung kabur meninggalkan korban. Mimi ditemukan seseorang dan dilarikan ke RSUD Abdulmuluk Bandar Lampung. Pak Dahlan orangtuanya tentu saja kaget, ketika diberi tahu polisi putrinya KO di rumahsakit. Kondisi Mimi kini kritis, tapi sempat cerita bahwa yang melakukan Murtono teman kuliahnya. Berdasarkan laporan itu ditambah bukti-bukti yang ada, kini Murtono sedang dicari-cari polisi. Kalau “ratu sabrangan” pasti punya Togog, dia. (*)


21 November 2012

PEMILIK Rumah Bordil

Jadi Kepala Daerah NEVADA - Lance Gilman, pengusaha rumah bordil yang sudah menyediakan lapangan pekerjaan kepada 80 orang pekerja seks komersil (PSK) terpilih sebagai Kepada Daerah Storey, Negara Bagian Nevada, Amerika Serikat (AS). Gilman menjadi pengusaha rumah bordil pertama yang terpilih sebagai kepala daerah. Pemilik rumah bordil The Mustang Ranch itu menjadi kepala daerah pertama yang memiliki latar-belakang sebagai pengusaha di sektor prostitusi. Nevada sendiri sudah melegalkan praktik prostitusi sejak 1971 silam. Pria berusia 68 tahun itu merupakan seorang politisi Partai Republik yang mengaku cinta dengan Amerika. Saat „ Lance Gilman berkampanye di wilayah yang dihuni 4 ribu jiwa, Gilman berhasil meraih 62 persen suara. ”Dia merupakan seorang yang langka, tentu saja itu karena prostitusi merupakan bisnis ilegal di seluruh wilayah AS, kecuali di wilayah pedalaman Nevada,” ujar sejarahwan Guy Rocha, Selasa (20/11). Gilman adalah seorang ayah dari empat orang anak dan kakek dari sembilan cucu. Salah satu putrinya bekerja di sektor usaha keluarganya. Sekira 20 rumah bordil dioperasikan secara legal di 10 wilayah pedalaman Nevada. Selain wilayah-wilayah itu, Las Vegas dan Reno juga menjadi wilayah yang menghalalkan praktik bisnis seks. Rumah bordil yang dikelola Gilman terletak di sepanjang jalan antar-negara bagian dari wilayah timur Reno. Selama ini, rumah bordil Gilman sudah memberikan kontribusi sebesar USD5 juta atau sekira Rp48 miliar (Rp9643 per USD1) terhadap anggaran daerah. (oz/nik)



Kembalikan Uang Rp8 Miliar Setinggi 9 Meter SINGAPURA-Apa yang akan Anda lakukan jika menemukan uang sebesar 900.000 dollar AS atau sekitar Rp8,6 miliar? Bagi seorang pengemudi taksi asal Singapura, Sia Ka Tian (70), jawaban dari pertanyaan tadi adalah mengembalikan uang itu ke pemiliknya. Sia Ka Tian sangat terkejut saat menemukan kantung hitam berisi uang di kursi belakang taksinya, setelah dia mengantar penumpangnya ke sebuah pusat perbelanjaan di Singapura. “Saat saya melihat uang itu, saya berfikir, saya akan kena masalah. Saya yakin sedikitnya ada 200.000 dollar AS di dalam kantung itu,” kata lelaki yang sudah 31 tahun mengemudikan taksi itu seperti dikutip harian The Strait Times. Namun, saat dia membawa kantung berisi uang itu ke bagian barang hilang perusahaan taksinya Comfort

„ Sia Ka Tian. DelGro, betapa terkejutnya Tian dan kawannya setelah tahu jumlah uang itu.”Uang itu tidak penting bagi saya. Itu bukan milik saya, jadi bagaimana bisa saya menggunakannya?” ujar Tian. Pasangan wisatawan asal Thailand kemudian melaporkan kehilangan mereka

ke perusahaan itu. Tian menunggu mereka saat wisatawan itu datang untuk mengambil uangnya yang sempat hilang itu. Sebagai tanda terima kasih Sia Ka Tian menerima sejumlah uang dari kedua turis itu yang tak ingin disebutkan namanya. Perusahaan juga berencana memberi penghargaan untuk Sia Ka Tian atas pelayanannya yang sangat baik itu. ”Menemukan hampir satu juta dollar AS tunai tak mungkin terjadi setiap hari dan kami bertanya-tanya berapa banyak orang yang tergoda untuk memilikinya,” kata juru bicara perusahaan taksi Comfort DelGro, Tammy Tan. ”Kami sangat bangga kepadanya dan senang penumpang kami akhirnya menemukan uang mereka,” lanjut Tammy.(kps/nik)

MANCHESTER - Sebuah pohon natal unik dibangun di Manchester, Inggris. Pohon natal itu memiliki tinggi 9 meter dan disertai 108 cabang pohon serta 450 pernak-pernik. Pohon natal terbuat dari 350.000 buah lego ini dipamerkan di Manchester Trafford Centre pada awal bulan ini. Menjelang Natal lazimnya banyak ulah unik yang dilakukan untuk merayakannya. Selain 108 cabang yang dihiasi dengan pernak-pernik 450 Lego dan lampu-lampu berkelap-kelip, pengunjung juga bisa melihat ke Lego Harry Potter tokoh yang dibuat untuk menjaga pohon, Selasa (20/11). Sebelumnya pada tahun 2011, sebuah perusahaan mainan membangun pohon natal dengan tinggi 12 meter. Pohon natal itu terbuat dari

LONDON- Penelitian tentang primata menunjukkan hewan ini kemungkinan mengalami krisis paruh baya seperti halnya pada manusia. Para ilmuwan melakukan penelitian atas 500 simpanse dan orangutan di seluruh dunia.Para petugas dan sukarelawan diminta untuk menilai sikap primata yang mereka jaga, termasuk interaksi sosial.Sejumlah penelitian dalam sepuluh tahun terakhir menunjukkan kebahagian manusia cukup tinggi pada masa muda dan turun pada usia paruh baya kemudian naik lagi dalam usia tua. Hasil penelitian yang diterbitkan dalam jurnal Proceedings of the National Academy of Sciences menyebutkan pola yang sama terjadi pada simpanse dan orangutan yang tinggal di kebun binatang dan pusat penelitian di seluruh dunia.Andrew Oswald,

„ Simpanse peneliti dari Universitas Warwick, Inggris, mengatakan krisis paruh baya ini kemungkinan terjadi karena lingkungan primata serupa dengan interaksi sosial pada manusia. Masalah Biologi Oswald mengatakan kemungkinan primata juga merasa kecewa bila misalnya

mereka tidak menjadi jagoan di dalam kelompoknya.Sementara peneliti lain, Profesor Alexander Weiss dari Universitas Edinburgh mengatakan hasil itu menunjukkan krisis paruh baya dapat diterangkan secara biologi dan fisiologi.”Di satu sisi kemungkinan ada faktor sosial yang memicu

(kriris paruh baya) namun ada sesuatu yang lebih dalam pada penelitian ini dan mencakup sejarah evolusi manusia yang serupa dengan simpanse dan orangutan. Jadi, apa yang terjadi adalah masalah biologi,” kata Weiss. Primata yang diteliti termasuk 155 simpanse di kebun binatang Jepang, 181 ekor di Amerika dan Australia serta 172 orangutan di kebun binatang sejumlah negara termasuk Kanada dan Singapura.Tiga kelompok primata yang diteliti menunjukkan binatang ini mengalami krisis paruh baya dengan titik nadir pada usia 28 dan 35 tahun sementara manusia pada umur antara 45 sampai 50 tahun. PALING CERDAS Simpanse betina berumur 20 tahun dari kawasan konservasi di Pulau Ngamba, Uganda, dinyatakan sebagai simpanse paling cerdas berdasarkan riset Max Planck

Perkasa :

Memperbaiki masalah Prostate, Menghilangkan Sakit Pinggang, Kegairahan Pria, Kualitas Sperma, menghilangkan Lemak, Mencantikan kulit tubuh, Tekanan darah, Liver, Kolestrol, Dll. HUB: 0823 6597 9555

Promo Akhir Tahun • Daihatsu Paket Ringan • Gran Max Pick Up Dp. 11Jtan angs 2Jtan • Xenia Dp. 27Jtan angs 3Jtan • Terios Dp. 24Jtan angs 4Jtan Proses cepat, pasti oke+hadiah menarik Rudi Astra, 0813 9611 6389


XENIA Dp 25 %, angsuran 2 Jt-an TERIOS Dp 25 %, angsuran 3 Jt-an LUXIO Dp 25 %, angsuran 3 Jt-an PICKUP Dp 20 %, angsuran 2 Jt-an SIRION Dp 25 %, angsuran 3 Jt-an Proses cepat data dijemput Hub: L. Rivai Sembiring 0812 6457 0000


-Ertiga DP. 25Jt-an Ang. 5Jt-an -APV Arena DP. 19Jt-an Ang. 3Jt-an -Carry PickUp DP. 18Jt-an Ang. 2Jt-an -Mega Carry DP. 19Jt-an Ang. 3Jt-an -Swift ST DP. 36Jt-an Ang. 4Jt-an -Splash DP. 46Jt-an Ang. 3,6Jt-an Syarat Ringan&Proses Cepat. Hub: PT. Trans Sumatera Agung, Jl. SM. Raja KM. 7,3 Medan HP: 0812 6037 9028

MENTARI MOTOR Melayani servis, cas

batre (basah ~ kering). Menjual alat2 sepeda motor, Asessoris, Oli, & alat2 mesin gendong.Jl. Jalinsum Simpang Kebun kopi, Indrapura

NEW NISSAN : Grand Livina, Juke, X-

Trail. Navara, Murano. Ready Stock, cash/ credit. Hub: Mili 0852 7033 7739


Pajero sport, outlander sport,Mirage, Strada Triton, Lancer,(Chasis,Box, Tangki, Bus, Dump Truck Colt Diesel & Fuso, Pick Up & Minibus L300 & T120ss), Hub: DONI: 0813 6224 2904 ; 0852 6130 5040


penjualan sepeda motor merek Suzuki khusus yang baru secara chas n credit. Ayo buruan dapatkan sepeda motor Suzuki. Hub Koord. Sales Bpk ARIFIN Hp : 085276045145. Jl. Jalinsum simp. Kebun Kopi Kuala

YAMAHA HORAS MOTOR, Jual sepeda motor Yamaha, cash& credit terbaru, dapatkan Helm LOVENZO Cuma-cuma dengan pembelian new zupiter Z1 (kesempatan terbatas). Dialer Telp:0622-31883. Jl. Jend. Sudirman Kota Indrapura, B.Bara.


Menjual sepeda motor honda, yamaha, suzuki Viar, baru dan bekas; Cash & Credit; Tukar tambah; Urus Perpanjang STNK, BBN. • Jl. Jend. Sudirman No. 389 ABCD, Indrapura ( 0622-31788) • Jl. Acces Road, Simp. Durian, Kuala Tanjung.

MITSUBISHI READY STOCK: Pajero Sport,Outlander Sport, Mirage, Strada Triton, Lancer,(Chasis, Box,Tangki, Bus,Dump Truck Colt Diesel & Fuso,Pick Up & Minibus L300&T120ss), Bunga angsuran/cicilan mulai dari “ 0% “ BAYU : 0852 7696 8284 . 0852 7787 6633


• Pick Up Dp. 25% angsuran 2 Jtan • Xenia Dp. 25% angsuran 3 Jtan • Terios Dp. 25% angsuran 3 Jtan • Luxio Dp. 25% angsuran 3 Jtan • Sirion Dp. 25% angsuran 3 Jtan Hub: ZUL CAPELLA, 0823 6253 2633

NAGA MAS MOTOR: Services - Ganti

Oli - Spare Parts - Accessoris. Jl. Teuku Umar Ujung, Tj.Balai. Hub: AKIET - 0852 7668 8988

DIJUAL CEPAT/MURAH Kebun sawit, luas 3.5H. Surat camat, harga 150 juta (Nego). Lokasi Tanah Teluk Dalam, Kec. Teluk Dalam. Hub: 0812 6426 549; 0823 6566 7959


kredit)–Rumah Baru, 2 KT, Pos Satpam, PDAM, komplek H. Bahren Kampung Baru, Belakang SUZUYA, RANTAU PRAPAT. Hub: 0813 6048 3699

DIJUAL CEPAT Rumah : Lebar 5, panjang 50, bangun 45, di Jl. A.Yani/Psr.Merah Simp.4 TalawiBatubara (dpn SPBU). Hub: 0821 6839 0096.

SECRET HERBAL ASPETRI Mitra depkes RI no.BM. Solusi tepat penyembuhan alamiah, illahiah, ilmiah. Mengobati macam penyakit baru ataupun kronis. Seperti : kanker, tumor, struk, lemah syahwat, impoten, ramuan khusus bagi yg belum punya keturunan, dll. Praktek di Jl. WR. Supratman Gg.Sado no. 1 R. Prapat. Hp : 0813 6112 8555.Website:

APOTIK&CLINIK AULIA FARMA : menyediakan berbagai macam obat yg bermutu dan harga terjangkau.Terima rawat inap, Periksa ibu hamil, Bersalin, Sunat, Imunisasi, EKG, USG. Tersedia, LAB, CLINIK, &ambulan.DAPAT KONSULTASI GRATIS dgn apoteker. Desa Tanjung Gading Sei Suka, Indrapura, Kab. B.Bara. Hub: 0622-632088

TOKO FOFA: Melayani

antar jemput air minum isi ulang, Gas Elpiji 3kg & 12kg maupun Aqua 19L. Jl. Diponegoro no. 368 KISARAN. HP: 0813 7586 1969

“UD MANDIRI”: menjual segala Sparepart

UD. JASO MALINDO: menjual santan

BINTANG PANGKAS: Khusus pangkas pria.Rapi, indah, bersih, trendy & memuaskan. Mode masa kini. Hub: Rahmad, 0878 1892 0095. Samping Pertamina, Parepare, Indrapura, Batubara

sepeda motor & menerima boring, pasang botol,siting klep, pasang sokar, jual accessories & sepeda anakanak, menjual secara Grosir & eceran. Access Road Kuala Tanjung, Hub: UDIN - 0813 7024 4402.

murni & kelapa parut, jg menerima tempahan/ mengasah mata parutan. Ruko No.5 Pasar Gelugur R.PRAPAT. HP: 0812 6455 2871 (IWAN)

UD. JANNAH: Menjual alat2 pancing, Kantor, Olahraga, Sekolah, Komputer, dan Perlengkapan Sholat, HARGA GROSIR. Jl. Lintas Medan-Kisaran, Simpang Kebun Kopi, B.Bara. HP: 0852 7680 942

UD. ’’Digital Photo” Menjual: alat-alat

kantor, fotocopy, pass photo expres, cuci cetak photo expres, dan photo pra wedding, shoting video, cetak undangan dan agen pulsa. Hub: 0812 6023 7607, Jl. Acess Road (Inalum) Kuala Tanjung, B.Bara



Menjual : Barang&Alat-alat Bangunan, Kontraktor, Levelansir. Harga standart & terjangkau , dll. Jl. Masjid Lama No. 41 Talawi Batu Bara. Hub: Hj. Ani - 0852 7508 7880 .



Lengkap, Harga terjangkau. Terima pasien & konsultasi kesehatan. Jalinsum Desa Tj. Gading, Simp. Kuala Tanjung, Indrapura, B.Bara. Telp: 0622-632751

"Balai Pengobatan ELLY” Izin No


: 800/3244/DINKES SOS/2008, Penanggung Jawab: Dr. HIDAYAT, M. Kes. Sedia berbagai Jenis obat, dan mengobati penyakit untuk kesehatan anda & keluarga, bersedia datang ke rumah anda untuk panggilan pengobatan di rumah; waktu 24 Jam. Empat Negri, Kec. Lima Puluh, Kab.Batu Bara. Hub: IBU ELLY-0852 7668 2236 KLINIK MIFTAH HAKIM, UGD buka 24 jam, pemeriksaan ibu hamil, sunatan, ibu bersalin,imunisasi, rawat inap, tersedia mobil ambulan. Konsultasi kesehatan, penyakit. Jl. BESAR LIMA PULUH KOTA (Dp n Mesjid besar limapuluh), Kab. B.Bara

“RC” THERAPY CERAGEM: pengobatan therapy

dari batu giok, mengobati penyakit-penyakit kronis-non kronis, tanpa operasi, tanpa makan obat dan injeksi. Buka pukul 08.00 s/d 22.00, hari libur tetap buka.1 x terapi hanya dipungut biaya Rp. 5000. Jl. Jend. Sudirman, Siparepare 1, depan simp. Bodrek, Indrapura, Batubara. Hub : 0852 7002 444.

"CV. ANUGRAH JAYA" Kontraktor, Lepelansir, Biro Jasa, Dagang umum, Pertanian, menyediakan&menjual barang-barang serta peralatan bangunan,dll. Jl. Merdeka Pasar Mereng Desa Suka Maju Kec. Tanjung Tiram,Batubara. hub:Ibu Ani-0853 6067 1005 COLOUMBIA, CASH & CREDIT FURNITURE & ELEKTRONIK harga terjangkau, paket murah meriah (cicilan ringan). Pasar 8 Jl. Jend. Sudirman, Indrapura, Batubara


Menjual berbagai prabot rumah tangga, lemari, kursi, tempat tidur, terbaru dan lengkap. Furniture harga Famili, barang istimewa dan memuaskan. Simpang gallon Jl. Access Road INALUM, Kuala tanjung, HP: 0823 6986 5100

DIJUAL: Bahan & Peralatan Chrom yang masih

berjalan diberikan pelatihan & alamat Suplier bahan baku, Peminat serius Hub:061-7870503 (Jam Kerja)


Pengalaman, rajin, bersih, jaminan 60 ribu / hari + makan Hub : 0852 4000 3011 Medan


jilbab, busana muslim, pakaian pria & wanita, pakaian serta perlengkapan baby, accesoris jilbab, mukenah,dll. Jl. Merdeka No.03 Depan kantor PLN Tanjung Tiram & Jl. Rakyat No.40 (Depan Pajak Tanjung Tiram) Batu Bara. Hub:Jonni Hendra, SPd. - 0823 6269 4535

menjual segala jenis papan, khususnya papan Boat/ Sampan dan alat-alat bangunan, Menerima tempahan, Khususnya ukuran panjang dari ukuran standartnya. Dusun II Jl. Merdeka Tanjung Tiram B.Bara. Hub : Bapak Irfan, HP : 0812 6456 2615.

APOTIK KARYA: Jual berbagai obat dan


600.000 batu bata Lego di St Pancras International di London. Pohon itu juga dilengkapi 172 cabang dan lebih dari 1.000 pernakpernik didalamnya. (oz/nik)


MEMS Rahasia Untuk Pria Gagah &



„ Pohon Natal sebagai pameran yang terbuat dari Lego

segala jenis Sepatu, Tas, dll. BLOK D No. 19 Lt. 1 Komplek PASAR GLUGUR R.Prapat. HP: 0821 6520 7590

“CAHAYA PRABOT” cash & credit,

berbagai macam prabot, rak tv, meja makan, sofa, springbed, meja belajar, elektronik, kulkas, mesin cuci, tv, LCD, DVD, kompor gas, dll. Kunjungi: Jl. Access road inalum, desa pakam raya no.20 (depan pajak sore). (0622)31326/3327.

“DINDA Keyboard”

Entertainment Musik Melayu Modern, & TOKO D.J 2 Elektronik, Cash & Credit segala jenis elektronik. Hub: Iwan (0811 6282 272 – 0852 7599 9772), di Simpang Tiga Pahang, Talawi, Batubara.


kursi, lemari dan semua jenis barang-barang perabot rumah tangga lainnya,di jual dgn harga yg murah & terjangkau. Jl. Besar Simpang Dolok, Lima Puluh, B.Bara, Serta menyediakan tempat Rekreasi pemandian “ Kolam Lima Putri “ Untuk keluarga anda, Jl.Besar Air Hitam Simpang Dolok. Hub: Bapak Agam, HP : 0812 6474 707



Menjual berbagai macam mas dan perak dgn berbagai bentuk tempahan: cincin, kalung, gelang rante, anting2, mutu memuaskan, kunjungi kami di: Pajak Pagi Kebun Kopi, Indrapura, Batubara

Toko Batik NUR’ ALFI: Jual batik pekalongan berbagai jenis, pakaian sempit (pas-pasan), Couple, baju anak2, Blus, kemeja, dll. Murah dan terjangkau. Jl. A. Yani/ Psr Mereng Simp. 4 Talawi, B.Bara. Hub: Rosini - 0812 6002 9388


Terima Tempahan: Cetakan Gypsum, Profil Plafon Rumah/Kantor Design&Pemasangan, Profil Furniture, Ukiran , aksara/ Kaligrafi Timbul, Miniator, aneka peralatan Fiber Glass; Service kapal (boat), fiber Glass & Laminating, Bak/ Tanki Air/ minyak bahan Fiber Glass. Hub : Mardi T 0852 6520 1878; 0812 6432 0521; d/a RM. Jaso Bundo, Jl. Jend. Sudirman No. 293 MERANTI

ANDREAN GYPSUM: Profesional dalam pemasangan Plafon Gypsum, Accessories Gypsum, atap baja ringan, stainless stell & desainer. Dapat juga pertamanan, poid balkon, kanopy, dll. Jl. Diponegoro No.212/283 KISARAN. Telp:(0623)-43611; HP: 0812 6399 062. Pimpinan Baginda Muslim Harahap(Asien) ”PIONER GYFSUM” : Menerima pemasangan design, Plafon gyfsum rumah dan Perkantoran dgn tenaga yg berpengalaman.serta menjual sgala macam keperluan gyfsum. Hubungi: 087818917066 (Bpk Anwar); 0853 5910 8633 (Ibu Ida), Jl. A. Yani/Psr. Mereng Simp. 4 Talawi - Batu Bara.


Aluminium, Contraktor, Partition, Swing door/Rolling Door, Serta Menyediakan Barang Seperti : Pintu Kamar Mandi, Tenda/Awning, Lemari Kaca, Rak Piring, Steling, Raill Gorden, Tangga, Jemuran Baju & Segala Jenis Kaca. Alamat: Jl. Merdeka No. 165166 Batubara, Hubungi : DICKY BUDIANTO, HP

: 0812 655 3575 - 0812 6536 6166.



Menjual: Besi Hollow, Plat, Besi Nako, Dll. Menjual Hollow Aluminium, Plat Aluminium, Dll. Terima Pembuatan Partisi, Prabot Aluminium & Steling. Diantar sampai tempat, Jl. Access Road Pakam Raya, Kuala Tanjung, BATU BARA. Hub: Mulyono – 0821 6430 3494 PERCETAKAN & ADVERTISING BIMA : Menerima segala jenis cetakan partai besar & kecil, undangan, sablon, stempel, MMT, baliho, Neonbox, baju kaos, kop surat, dll. (Hub: HABIB SYAH: 0852 7074 7585). Jl. Jend. Sudirman No. 288, Indrapura, Batubara.

TUKANG BURUNG RAHMAT KT: Menjual berbagai macam jenis burung pilihan,menerima tempahan berbagai jenis Kandang (sangkar burung). Hub: 0823 6403 5666. Jl. Simp. Kuala Tanjung, Indrapura, B.Bara


pembelian tiket pesawat, Batavia, Garuda, Merpati, Lion,City Link, Sriwijaya, Wing air, dengan tujuan wilayah dalam dan luar negeri, Hub: Rini-0821 6564 4472 – 0877 4929 0081 ; DEDY : 0823 6441 6766. Jl. Medan Lima Puluh Kota NO. 11, Batubara


Service: Komputer, Printer, monitor, laptop, handphone, TV, DVD, Dll. Terima: Fhoto Copy, Cetak Photo Digital, Scaner, Laminating, ketikan & Print Out. Hub: 0813 7070 4106; di Jl. ACCESS ROAD INALUM, SP.GALON.

USAHA TERNAK: Jual makanan ayam,

ikan, burung, bibit ayam, itik. Sedia, obat-obatan unggas serba lengkap. Hub: 0812 6590 2828. Jl. Besar Indrapura Dusun 2 Titi Payung (dkt kantor Gerai Samsat), Indrapura

Dicari: Agen Kelapa Santan utk wilayah Medan, P.Siantar, Simalungun. Daging tebal, santan banyak. Cocok untuk Es dawet, dll. Harga Rp5.000/ gandeng diantar sampai tempat. Harga bisa naik/ turun sewaktu-waktu tergantung permintaan pasar. Kelapa dari Batubara. Berminat, Wilayah P.Siantar hub: 081260623215. Medan hub: 081264745666 a/n Heri

SHE NDA KING JOSS: Obat kuat & tahan lama khusus dewasa:- anti lemas - anda puas - istri semakin gemas. Untuk pemesanan: Klinik Fengshui Jl. Sempurna (Gg. Buntu) R.Prapat. Hub: 0813 2424 1415


Melayani antarjemput AQUA galon 19Ltr, Gas Elpigi 3&12 kg, dan Dagang umum. HUB: Telp 0623

44713; HP 085262020121. Jl. A. Yani No. 63 Simp. Katarina, Kisaran.


GROSIR ULOS BATAK , Menjual Berbagai Jenis Ulos Batak, partai besar dan kecil. Hub: RAMSES TAMBUNAN, HP: 0812 6875 1155 - 0877 6864 2302. Jl. Perintis Kemerdekaan No.165 Blok 8, Lima Puluh, B.Bara "RUMAH BATIK KRISHNA" Jual batik ternama & terpopuler, pria/wanita, seragam kantor, sekolah, batik pesta, terima grosir&eceran. Hub: Pak Krisna Gunawan S - HP. 0813 6060 4990. Jalinsum Tanjung Gading, Simp. Kuala Tanjung


Perawatan rambut, wajah & tubuh terlengkap di Batubara. Paket Hemat SPA (Masage+Lulur+ Spa:Rp.180rb) hny Rp.150rb; Paket Face To Hair Sacial+Creambath Rp.80rb hny Rp.50rb. Hub: 0852 7508 4444, Jalinsum Binjai Baru, B.Bara.

Institute for Evolutionary Anthropology di Leipzig. Natasha dinobatkan sebagai simpanse ‘genius’ setelah melalui beberapa tes. Beberapa tes yang dilalui antara lain tes pengetahuan spasial, menghindari jebakan, mencari makanan serta mengenali warna, ukuran dan bentuk. Esther Herrmann dan Josep Call, para peneliti, mengidentifikasi kecerdasan hewan dengan cara melihat perilakunya. Di antaranya, apakah simpanse menggunakan peralatan untuk tujuan tertentu, pemahaman kuantitas serta kemampuan mengambil kesimpulan. Contoh simpanse cerdas yang pernah dijumpai adalah simpanse yang menggunakan peralatan untuk mendapatkan rayap. Simpanse mencabut batang pohon, membersihkannya dari daun dan membaginya menjadi dua sehingga salah satu ujungnya menjadi berserabut. (kps/nik)

ORIGINAL PENLUB. Formula unik PENLUB dari Lubri-Lab dengan kombinasi dari bahan-bahan yang sangat penting untuk membersihkan, melumasi & melindungi logam. PENLUB menembus pori-pori logam,melarutkan karat,membersihkan gemuk&kotoran, menghilangkan kelembaban, dgn kemampuan dielektriknya yang unik. HUB : 0813 6113 2128 di KISARAN



RANTAUPRAPAT; HP: 0853 5875 3027;

0852 6155 8562. DP 15Jutaan Type 45/98 Angsuran 50rb/hari. Investasi Hunian Exclusive Super strategis, hanya 5 menit dari Pasar Glugur/ Terminal. Spek: Kramik, Cat luar dalam, Gypsum, Rangka Baja, Atap Metal Sakura, Sumur gali, Kloset, Listrik, IMB, SHM, Jalan. AYO MILIKI PERUMAHAN GRIYA SEJAHTERA

YA MINANG : CAHAY RUMAH MAKAN CAHA Sedia masakan Khas Padang Pariaman, terkenal lezat, sedia ayam bakar, minuman, kopi susu, teh susu & Juice, terima pesanan nasi kotak. Jl. Jend. Sudirman No. 72 INDRAPURA - Rumah No.404. Hub : 0813 7655 6793 SALMA D’CAFÉ

Sedia sarapan pagi,serba 7000 dengan hidangan istimewa. Nasi/Mie goreing, bakso/pangsit/siomai, Batagor, bandrek, aneka juice. Terima nasi kotak dan rantangan. Hub: Ibu salma , 0812 6349 7777 Jl. Kula Tanjung Kebun Kopi Indrapura, Batubara.

“WARUNG BAMBU AYAM PENYET” menjual : Ayam Penyet, Tom Yam, Ifu Mie/ Mie Telur, Bebek Goreng, Cah kangkung, cap cai, sop Buah & aneka juice. Jl. Access Road Kuala Tanjung. Hub: Kak Lina - 0853 6058 1512

“AA” Fashion: Menjual berbagai jenis pakaian

BROKOLI CERIA: sajian spaghetti

LKP “CANTIK MANIS“ belajar tata rias rambut pengantin, kecantikan kulit- rambut, menjadikan tenaga kerja terampil, siap pakai wirausaha dan trend model professional, hub 0812 6374 0598, Jl. Besar Perdagangan, Lima Puluh Kota B.Bara.


muslim, wanita, pria, anak2, dan dewasa, berbagai merek dan ternama, dan terbaru. Melayani eceran dan grosir. Jl. Jend. Sudirman, Kota Indrapura, Kab. B.Bara. HP: 0813 6154 2640

LKP “UNI SMART COM” Kursus Komputer Mahir program Office 2007, Desain Grafis (Ps CS4, CorelDRAW X4), Teknisi Komputer dan Jaringan, MYOB Acc V.17, (Belajar sampai Mahir) Hub: 0877 4930 6155. Jl. Lintas Sumatera KM.137, Bangun Sari, Batubara.

“BANDUNG COLLECTION” SARAH GORDYN: Sedia Plits, Gordyn, Virtage, spanyol,

vertical blind, Venetian Blind, Roman Shades, Dll. Terima segala jenis gordyn pintu, jendela, pintu kantor, teratak. Jl. Acces Road Inalum (simp.Galon) Kuala Tanjung. Hub: SUBHAN RASYID - 0811 6289 449; 0852 6199 8814.

DIKA GORDYN Menerima Segala Jenis

Tempahan Gordyn, Kebaya, Seragam;menerima Bordir. Terima Anak Kustum(Wanita). Hub: Ibu Indah–0821 6432 2396, di Jl. Kopertis Lingkungan 7, Indrapura–B.Bara.

HENDY GETs Stiker & Aksessories: Penjualan & Pema-sangan Variasi Mobil dan sepeda motor. Jl. Jend. Sudirman, Indrapura (Samping Lap. Sepakbola); HP: 0813 7644 4177; Telp. 0622 - 646 144. SEHAT SERVIS DOORSMEER:

Ganti oli, pispot, balancing ban, tubeless, angin hidrogen, cot, dan ban luar radial. Masih membutuhkan beberapa tenaga Doorsmer (Tukang Cuci Mobil). Jl. A. Yani No.6/8, Kisaran.

BAKSO PAKDE: Sajian Bakso, Mie Ayam,

Nasi/Mie Goreng, Minuman : Jus Tomat, Jus Mangga, Jus Wartel, Jus Timun, Jus Pokat, Jus Jeruk. Hub: 081376453399 – 082364321148 - 081990414222. Simpang Kuala Tanjung (INALUM)

RUMAH MAKAN NAN KANDUANG: Menyajikan berbagai masakan padang, Terima pesanan nasi bungkus & nasi kotak, aneka juice, Harga terjangkau. Jl. SM Raja No. 404 Kisaran. Hub : Adr Robert - HP : 0823 9070 7038

sehat. Menyediakan sajian: Mie Ayam, Mie Ketela, Mie Wortel, Mie buah, Martabak sayur, Aneka Juice, Kopi Luwak, Softdrink. Harga Terjangkau. Jl. Jalinsum KM 99.5 Sei Suka, Batubara. HP: 0812 6217 910

Menyajikan berbagai masakan, Nasi Goreng, Mie Goreng, Soto. Aneka minuman, Aneka juice, teh manis, kopi susu, ginseng. SERBA EKONOMIS. Simp.Kuala Tanjung, Indrapura, B.Bara.


masakan khas padang, dengan menu istimewa: Nasi serba Rp8000, rendang, gulai pari, daging sapi, ikan mas, khas masakan rendang padang, menerima pesanan nasi kotak. Hub: Ibu AS , HP : 0817 4798 835. Jalinsum LimaPuluh BatuBara

RM. (TB) TELAGA BIRU: Khas Minang, terkenal lezat. Tersedia kopi susu, teh susu, & Juice. Terima pesan nasi kotak. Jl. Jend. Sudirman No. 72, Indrapura, B.Bara. Hub: 0813 9782 3094

RM.FAMILI MINANG, khas minang tersedia rendang daging sapi, kambing, ayam, cincang, ikan panggang, harga Rp.7000. Hub: Ibu Nisa - 0853 5835 6505, di Simp. Sumodang Jl. Kuala Tanjung (Inalum), Sei Suka, B.Bara.

RM.Nasi SOTO: Sedia kare sapi, soto,

sop, ayam goring sambal balado, gulai asam, gulai lemak, Dll. Hub: Bpk Junaidi 0852 7074 7147, di Brohol Simp. Kenangan, Kuala Tanjung, B.Bara


Menyediakan masakan : nasi Goreng, soto, mie goreng/ tiaw, aneka ikan bakar, dan menyediakan aneka juice . Jl. ACCES ROAD INALUM, Simp Durian. Hub: Ibu Atik- 0852 6546 3152.


Sedia: Nasi Goreng, Aneka Mie, Minuman Segar, Aneka Juice, Serta sedia Minuman Kopi Aceh, dll. Hub: Mamak Danu - 0821 6283 4324, Jalinsum, Lintas Medan-Asahan (Depan Pertamina), Pare-Pare, Indrapura-B.Bara

MAJESTYK: Sedia bermacam jenis roti

dan Bolu: Bika Ambon, Lapis Legit, Kue MP, Bolu Gulung, Roti Tawar, Donat dan dll. Terima pesanan untuk acara Rapat, Arisan & Ultah. Hub: 0622-646300 ; Jl. Jend. Sudirman No. 75 INDRAPURA, Kab. B.Bara “NANANG JOK”, Spesialis : Lapis Jok, Alas Dasar, Door Tream, Flafon, Tenda Cafe. Jl. Jend. Sudirman Simp. Sipare-pare, B.Bara. Hub: NANANG - 0821 6206 4560 - 0852 6263 4508

12 RABU 21 NOVEMBER 2012

WALAH ! Perempuan Alami Depresi Setelah Bercinta TIDAK semua wanita usai melalukan hubungan seks merasakan kenikmatan dan kebahagiaan. Satu dari tiga perempuan justru malah terbukti mengalami depresi usai aktivitas tersebut. Mengapa? Survei yang dilakukan terhadap 200 wanita di Australia menyebutkan sekitar 33% responden menjawab mereka pernah merasa depresi setelah bercinta. Oleh para ahli perasaan itu disebut dengan 'post-sex blues' atau rasa murung seusai bercinta. "Dalam situasi normal, sesudah berhubungan seks seseorang akan merasa nyaman, bahagia dan juga rileksasi psikologi dan fisik. Namun ternyata ada sebagian wanita yang justru merasa melankolis, cemas, menangis dan

gelisah," kata ketua peneliti Robert Schweitzer dari Queensland Institute of Technology. Hasil survei itu mengejutkan karena bertentangan dengan anggapan banyak orang akan aktivitas seksual sebagai kegiatan menyenangkan dan menguatkan hubungan emosional dengan pasangan. Schweitzer mengatakan belum mengetahui apa yang memicu timbulnya perasaan murung usai bercinta. "Penyebanya biasanya tidak diketahui. Ada seorang wanita yang mengatakan ia merasa lebih melankolis setelah bercinta, tetapi hal itu tidak ada kaitannya dengan perasaannya pada pasangannya," katanya. Ada beberapa hal yang bisa menyebabkan rasa bersalah, malu, dan tak berminat pada hubungan seksual, misalnya saja trauma akibat kekerasan seksual di masa lalu. Namun para responden dalam survei itu umumnya tidak mengetahui darimana datangnya rasa murung dan depresi mereka. Untuk mengungkap pemicu perasaan tersebut Schweitzer sedang melakukan penelitian lanjutan. "Mungkin memang ada kecenderungan bilogis yang berpengaruh," katanya.(int)

Sebagian wanita yang tinggal di kota-kota besar cenderung memiliki beragam aktivitas dan mengesampingkan olahraga. Padahal olahraga merupakan hal sangat penting terlebih dalam kaitanya dengan kesehatan tubuh. Dengan olahraga, kita dapat menjaga kesehatan tubuh dan mencegah datangnya berbagai macam penyakit. Karena itu, diperlukanlah cara tersendiri untuk dapat berolahraga di sela-sela kesibukan tersebut dan tips mengenai olahraga untuk orang sibuk ini akan sangat membantu. Berikut beberapa jenis olahraga yang dianjurkan bagi perempuan super sibuk, seperti dilansir Prevention Lompat tali Latihan ini bisa membakar 340 kalori hanya dalam 30 menit saja. Hal ini sebanding dengan stationery bicycle selama 30 menit. Keunggulannya, kita tak perlu bersusah payah meluangkan waktu ke gym, hemat biaya, hemat tempat, dan jelas hemat biaya. Satu lagi, kita bahkan tak perlu khawatir jika tak punya skipping rope. Pasalnya, gerakan melompat tetap efektif tanpa tali sekalipun. Agar hasilnya maksimal, bukalah sedikit kedua kaki saat melompat. Usahakan agar lompatanlompatan yang dibuat tak jauh dari tanah. Yoga Lakukan yoga selama 20 menit di meja Anda. Hal ini bisa berfungsi menenangkan pikiran tentang pekerjaan yang menumpuk. Berjalan Kurangi telefon untuk memerintah seseorang. Akan lebih baik jika menemuinya langsung. Dengan begitu, mau tidak mau Anda harus berjalan. Paling tidak ini sangat bermanfaat sebagai latihan kardio. Jika biasanya Anda memilih jalan yang tercepat menuju kantor, mulai sekarang pilihlah jalan yang memutar. Hal itu akan memaksa Anda untuk berjalan kaki. Usahakan setiap hari berjalan kaki selama 20-30 menit atau sekitar 3000 - 5000 langkah. Kalori Anda akan banyak terbakar. Otomatis tubuh menjadi lebih sehat. Gerakan-gerakan otot ringan Di sela-sela waktu rehat juga dapat dimanfaatkan untuk berolahraga ringan seperti melakukan gerakan pengencangan pada otot-otot perut dan lengan selama beberapa menit dan diulangi beberapa kali. Atau dapat juga melakukan gerakan-gerakan pengencangan dengan menggunakan barbell yang paling kecil yang mudah dibawa kemana-mana dan mudah disimpan. Tak hanya itu, sejumlah peregangan atau stretching pada waktu istirahat atau sesaat sebelum mulai bekerja pada beberapa anggota tubuh seperti tangan, kaki, leher, punggung dan anggota tubuh yang lain. Hal ini dapat dilakukan dengan menahan posisi peregangan setidaknya dalam hitungan 2 x 8 atau bisa juga dalam waktu tiga menit. Olahraga untuk wanita sibuk itu memang terkesan simple dan seakan tidak mampu memberikan efek yang signifikan bagi tubuh, namun jika dilakukan secara rutin, akan dapat memberikan hasil yang tidak kalah memuaskannya dengan olahraga biasa. Sehingga kesehatan dan kualitas hidup pun akan tetap terjaga walaupun kesibukan melanda. (int)

Waspada, Penderita Insomnia

Lebih Cepat Meninggal

SEBUAH penelitian baru di Finlandia menunjukkan bahwa kasus sulit tidur bisa jadi menurun dan penderita insomnia lebih mungkin untuk meninggal lebih cepat dibandingkan orang dengan pola tidur yang sehat. Menurut laporan media Finlandia, Senin (4/7/ 2011), penelitian tersebut adalah yang pertama yang mengaitkan insomnia dengan risiko kematian. Penelitian tersebut dilakukan oleh Institute of Occupational Health melalui kerja sama dengan University of Helsinski dan Finnish National Institute for Health and Welfare. Dalam studi terhadap orang kembar yang berskala luas, para peneliti Finlandia mengikuti status kesehatan 12.500 pasangan kembar dewasa selama 1990 sampai 2009, demikian laporan Xinhua, Selasa. Sebanyak 20 persen peserta menderita gejala kurang tidur, termasuk kesulitan untuk mulai tidur, terbangun pada larut malam dan tidur yang tidak mengembalikan stamina tubuh. Dibandingkan dengan orang kembali yang tidak identik, orang kembar identik lebih mungkin untuk menderita gejala insomnia yang sama. Temuan tersebut menunjukkan faktor genetika memainkan peran dalam

pembentukan insomnia. Selain itu, para peserta tersebut dibagi jadi tiga kelompok, menurut kualitas tidur mereka. Di antara semua peserta, 48 persen adalah orang yang tidur dengan baik, 40 persen tidur rata-rata dan 12 persen orang yang tidur dengan buruk. Hasil penelitian itu memperlihatkan gejala yang berkaitan dengan insomnia mungkin meningkatkan risiko kematian. Sementara itu dibandingkan dengan orang yang tidur dengan baik, tujuh persen perempuan dan 22 persen lelaki yang tidur rata lebih mungkin untuk meninggal lebih cepat; dan orang tidur dengan buruk 1,5 kali lebih mungkin untuk meninggal lebih cepat. Menurut para peneliti tersebut, kekurangan tidur adalah masalah kesehatan umum di kalangan kelompok usia kerja. Kekurangan tidur kronis meningkatkan risiko banyak kecelakaan dan penyakit, sehingga memperlemah kualitas hidup orang dan kemampuan untuk bekerja secara layak. Para ahli tersebut menyatakan penderita insomnia mesti berusaha memperoleh perawatan medis tepat pada waktunya, dan pasien insomnia kronis mesti dirawat dengan cara lebih baik dengan terapi tanpa obat.(int)


21 November 2012

Zaskia Sungkar

Gagal menikah dengan aktor muda Iko Uwais tak membuat Jane Shalimar larut dalam nestapa. Ia malah mendapatkan calon suami bukan sembarangan orang. Jane Shalimar segera naik pelaminan pertengahan Desember 2012. Ibu satu anak ini kabarnya akan disunting oleh Mahardika Soekarno Putra atau Didi, anak Rachmawati Sukarno Putri. Pasangan ini juga akan

Ketagihan Jalan di Catwalk

Berlenggak lenggok di atas catwalk bukan hal baru bagi Zaskia Sungkar. Tak heran, ketika diajak untuk memamerkan busana rancangan istri Indra Bekti, Adila Jelita, Zaskia tak bisa menolaknya. ”Ini bukan yang pertama aku jalan di catwalk. Kemarin sempat ikutan di Jakarta Fashion Show, itu baru pertama di event besar,” ujar Zaskia saat ditemui di acara fashion show, Indra Indri & Dilla Albis, Plaza FX, Jakarta, Selasa (20/ 11). Zaskia ketagihan saat menjajal catwalk di event besar JFW. “Pas ngerasain di JFW kemarin jadi ketagihan, enak juga, seru ternyata jalan di catwalk, deg-degan soalnya,” ujarnya malu-malu. Diungkapkan Zaskia, ia nyaris tak bisa menahan tawa saat tampil bersama Nycta Gina dalam fashion show kali ini. “Aku menahan ketawa, habis ada Gina, kocak, tapi seru sih,” tawanya. (nov/int)

SCORPIO (23 Oktober – 22 November) Karier: Cobalah lebih terbuka dalam menghadapi masalah Anda. Komunikasikan dengan atasan dan rekan kerja Anda. Asmara: Patah hati tidak membuat Anda menjadi tak bergairah. Dari sejumlah ‘fans’ Anda, ada yang berniat serius.

Paramitha Rusady akhirnya resmi bercerai dengan suaminya Nenad Bago. Setelah berbulan-bulan menjalani proses persidangan di Pengadilan Agama Jakarta Selatan, Mitha dan Nenad Bago diputus cerai oleh hakim. “Hari ini agendanya keputusan. Permohonan talak dikabulkan,” kata kuasa hukum Nenad Bago, Anthony Alexander SH saat dijumpai di Pengadilan Agama Jakarta Selatan, Selasa (20/11). Selain bercerai, ketua majelis hakim sudah mengabulkan

(20 Januari - 18 Februari)

Karier: Janganlah memaksakan diri menerima semua tawaran kerja di kantor. Mintalah waktu istirahat, sebelum kondisi Anda bertambah buruk. Asmara: Semakin hangat.


19 Februari - 20 Maret

Karier: Perkembangan karier Anda sangat cerah dan cukup menjanjikan di masa yang akan datang. Asmara: Sulit-sulit dahulu, bersenangsenang kemudian alias Anda harus berusaha lebih keras lagi untuk merebut hatinya.


dibahas oleh keluarga masingmasing. Lewat akun twitternya, Jane sempat mencetuskan tanggal pernikahannya dengan Didi, yaitu 12-12-2012. Wah, tanggal cantik dong? Mantan kekasih Iko Uwais ini sudah memesan kebaya pengantin dari desainer Anne Avantie. Dari pernikahan sebelumnya, Jane dikaruniai satu anak bernama Muhammad Zarno. (tr/int)

mengumpulkan buku yang ia baca sejak kuliah. Setahun belakangan, ia mulai tertarik dengan buku digital. Dan suaminya, Reza Gunawan, lah yang berjasa menginisiasi Dee. Bahkan ia sering membeli buku digital, jika tak ada buku yang ia maksud, barulah membeli buku konvensional. Sekarang, ia telah merasakan manfaat membaca buku digital. Ia tak “dijajah” oleh koleksi bukunya. Mau tak mau, penulis pun akan memasuki sebuah transisi. Dari buku konvensional ke teknologi buku digital. Penulis Supernova dan Madre ini mengatakan bahwa tiga tahun silam, dirinya belum melirik buku digital. Dengan membeli, lalu membaca buku konvensional, ia merasa ada kenyamanan dan romantisme tersendiri. Didukung pula, ia berkecimpung di dunia tulis menulis. Buku menjadi bagian dari pekerjaannya. (tr/int)

(21 Desember -19 Januari)

Karier: Perubahan jam kerja di kantor, membuat Anda repot membagi waktu untuk urusan kantor dan keluarga. Asmara: Tidak ada masalah, bahkan bisa dibilang semakin dekat.


Anto. Sebagai asisten, Anto juga tak tahu sejak kapan keduanya berkenalan dan resmi berpacaran. Rencana pernikahan itu dibenarkan Sunan Kalijaga, pengacara yang juga sahabat dekat Didi. Ia mengaku sudah mendapat kabar bahagia itu langsung dari yang bersangkutan. “Sebagai sahabat Didi dan Jane, saya menyambut positif kabar bahagia itu,” kata Sunan, Selasa (20/11). Menurut Sunan, rencana pernikahan mereka itu masih

Kegemarannya membaca dan profesinya sebagai penulis membuat Dewi Lestari menjadi kolektor buku. Namun, buku simpanannya seolah menjajahnya. Banyak ruangan habis karena bukunya yang jumlahnya sudah sangat banyak. “Buku menjadi bagian dunia pustaka, tapi lamalama saya dijajah sama buku. Perpustakaan saya menghabiskan space dari ruangan manapun,” ujar Dee, sapaan akrabnya di Jakarta. Maklum, sebagai seorang penulis, Dewi Lestari sangat gemar membaca buku. Ia rutin



menggelar prosesi lamaran. “Lamarannya mungkin akhir bulan ini (November),” ujar Anto, asisten Didi melalui sambungan telepon, Selasa (20/ 11). Namun Anto enggan menjelaskan lebih jauh soal tanggal serta tempat lamaran itu. Yang pasti, Jane sudah mulai mencari model kebaya di sebuah butik milik desainer ternama. ”Belum fitting tapi masih caricari (model) aja. Saya ikut nemenin Jane juga kok. Jadi memang belum fitting,” jelas

(21 Maret - 20 April)

beberapa keputusan yang sempat diajukan oleh kedua belah pihak. “Kesepakatan lain dikabulkan juga. Kita diminta untuk melakukan sesuai kesepakatan. Perjanjian untuk anak, nafkah, dan hak asuh,” jelas Anthony. (nov/int)

Karier: Berkat usaha Anda yang cukup gigih, maka hasilnya sudah mulai terlihat bagus. Asmara: Hari-hari bersamanya terasa manis dan sangat menyenangkan.


(21 April - 20 Mei)

Karier: Urusan pekerjaan Anda di kantor adem ayem dan tidak terlalu sibuk. Asmara: Pertemuan manis dengan seseorang membuat hidup Anda terasa lebih bersemangat.


(21 Mei - 20 Juni)

Karier: Banyak kejadian yang menyenangkan maupun yang menyebalkan. Hal itu akan membuat konsentrasi kerja Anda sedikit terganggu. Asmara: Semakin bersemi. Waspada, hal ini bisa membuat Anda lupa diri.


(21 Juni- 20 Juli)

Karier: Ada kesibukan baru yang akan segera menyita waktu Anda. Proyek ini kelak akan menjadi tambahan pemasukan bagi Anda. Asmara: Teman baru bertambah, ada yang ingin mendekati Anda. Tetapi jangan terlalu berbesar hati dulu.


(21 Juli-21 Agustus)

Karier: Beberapa pekerjaan yang tengah Anda lakukan dapat menimbulkan risiko. Berhati-hatilah dalam mengambil keputusan. Asmara: Berjalan lancar. Hanya saja, Anda harus bersikap sedikit lebih romantis.


(23 Agustus-22 September)

.Karier: Banyak dukungan dari teman

dan anggota keluarga. Kondisi itu harus dipertahankan, supaya Anda tidak membuat kesalahan yang sama dua kali. Asmara: Siap-siap akan ada kejuatan dari pasangan Anda, yang selama ini ditunggu-tunggu.


(23 September - 22 Oktober)

Karier: Ada pekerjaan baru yang lebih menantang. Jika berhasil, promosi jabatan menanti Anda Asmara: Hampir tidak ada konflik. Tetapi jangan menurunkan perhatian Anda.


( 23 November - 20 Desember)

Karier: Kesibukan kerja semakin bertambah. Cari waktu untuk beristirahat. Asmara: Bertemu teman lama yang mengajak bernostalgia.

SETELAH menikah pada 29 September, pasangan Hollywood Anne Hathaway dan Adam Shulman ingin segera membangun sebuah keluarga. Anne pun berharap dirinya bisa hamil secepatnya. ”Aku ingin sekali punya bayi,” ujarnya seperti dilansir The Hollywood Reporter, Selasa (20/11). Bintang film ‘The Dark Knight Rises’ itu memang cukup lama memendam impiannya menjadi seorang ibu. Salah satu temannya mengungkapkan, Anne adalah perempuan tradisional. Ia hanya mau punya anak setelah resmi menikah. Anne dan Adam menikah setelah empat tahun berpacaran. Anne berhubungan dengan Adam setelah putus dari kekasih lamanya, Raffaello Follieri pada 2008 lalu. Mereka menggelar pernikahan secara tertutup di Big Sur, California. Kabarnya hanya ratusan orang saja yang menghadiri acara tersebut. (dtc/int)

ORANGTUA khawatir Gisel ‘Idol’ dilamar Gading Marten. Mengapa? ”Orangtuaku malah khawatir, aku kan, anak tunggal dan perempuan. Masih umur segini (21 tahun), dianggap masih kecil, jadi kekhawatiran banyak. Mereka kasih izin sih, tapi kasih wejangan banyak banget, selalu diingetin,” ungkapnya di Kebon Jeruk, Jakarta Barat, Selasa (20/ 11). Namun, bukan berarti Gisel tak boleh menikah dengan Gading.

Malahan, kedua orangtuanya ingin Gisel mandiri bersama Gading. ”Malah mama yang ngomong, dari dulu sebelum aku niat menikah. ‘Mama mending tinggal sendiri, pusing lihat kamu sama suami kamu’,” kata Giselle menirukan ucapan mamanya. Sengaja Bikin Gading Cemburu Ingin diperhatikan, Gisel ‘Idol’ sengaja membuat Gading Marten cemburu. ”Dia (Gading) susah cemburunya, kadang aku pancing-pancing biar dia cemburu,” ujar Gisel di RCTI, Kebon Jeruk, Jakarta Barat, Selasa (20/11). ”Aku senang kalau dia cemburu. Habis aku cemburuan dia nggak pernah cemburu,” imbuhnya. Namun, karena seprofesi, Gisel tak pernah marah karena cemburu berlebihan. (idc/int)



21 Nopember 2012

Pemain Bulutangkis Indonesia


Dari empat wakil Indonesia di tiga nomor yang mesti melalui babak kualifikasi Hong Kong Open, dua tiket sudah digenggam Belaetrix Manuputty dan Andre Kurniawan Tedjono. Sementara satu tiket yang melayang gagal disabet duet ganda campuran. Pasangan ganda campuran Alvent Yulianto Chandra/Rizki Amelia Pradipta,

sudah lebih dulu gugur di fase perdana babak kualifikasi. Keduanya tumbang dari duet China, Qiu Zihan/Luo Yu setelah dinyatakan

kalah WO alias Walk-Over. Tetapi harapan masih ada di pundak Belaetrix di nomor tunggal putri serta Andre, yang tampil di tunggal putra. Sebelumnya pagi tadi, baik Belaetrix maupun Andre, sukses melewati babak pertama kualifikasi atas lawannya masing-masing. Belaetrix menang straight set, 21-18 dan 2118, atas pebulutangkis tuan rumah, Cheung Ngan Yi. Sementara Andre juga menang lewat dua set langsung, 21-13 dan 21-9, dari wakil Rusia, Ivan Sozonov. Babak kedua pun mesti dimainkan

Apalagi, Sharapova sudah cukup terbiasa dengan akting saat ia didapuk sebagai Belaetrix dan Andre, beberapa setelah model jam beberapa produk, termasuk model fase awal, atau tepatnya Petang ini. Belaetrix baju renang di sebuah majalah olahraga harus melewati rubber set,terkemuka 6-21 21-16 dan 21- tahun lalu. beberapa 18, dari wakil Jepang, Nozomi Okuhara. “Untuk sekarang, terlalu banyak yang Adapun Andre yangterjadi dibabak kedua dalam hidupku. Aku terikat dengan bersua Tanongsak Saensomboonsuk, juga pertandingan-pertandinganku, brand asdipaksa main tiga set sebelum menamatkan sociations dan beberapa komitmen pebulutangkis Thailandlainnya,” itu dengan kemekata Sharapova saat berada di nangan, 19-21 21-10 dan 21-14. New DelhiDengan untuk menghadiri acara sebuah begitu, Belaetrix dan Andre dipastikanreal maju perusahaan estate di mana ia jadi brand ke putaran final, menyusul sejumlah ambassador-nya. rekannya yang sudah otomatis masuk ke jika diberi kesempatan “Tapi suatu hari, putaran final. (int) aku sangat ingin berakting di sebuah film Hollywood, ungkap dia seperti yang JORGE Lorenzo akan fokus membalap untuk Yamaha dalam kurun waktu dua tahun ke depan. Setelah itu, Lorenzo akan mempertimbangkan masa depannya di dunia MotoGP. Lorenzo baru saja sukses merebut gelar juara dunianya yang kedua pada tahun ini. Dia tampil sangat baik sepanjang musim, finis pertama atau kedua hampir di semua seri. Rider yang kini berusia 25 tahun itu cuma gagal di Assen dan Valencia karena mengalami kecelakaan. Lorenzo sebenarnya punya peluang untuk pindah ke Honda karena dia ditawari jadi pengganti Casey Stoner yang pensiun. Tapi, dia menolak dan memilih untuk meneken kontrak baru berdurasi dua tahun dengan Yamaha. “Saya akan membalap untuk dua tahun ke depan. Setelah itu, kita lihat saja,” tuturnya yang dikutip Autosport. “Saat masih 15 tahun, segalanya menyenangkan, tapi kemudian olahraga ini bisa jadi rutinitas,” kata Lorenzo. Selain itu, kecelakaan fatal yang dialami Marco Simoncelli tahun lalu juga jadi bahan pertimbangan Lorenzo sebelum memutuskan kelanjutan kiprah di ajang balap motor paling bergengsi ini. “Kematian Marco Simoncelli merupakan sebuah pukulan untuk kita semua, dan membuat kita berpikir bahwa itu bisa terjadi ke siapa saja. Tapi, kami tahu Ronaldo ketika itu sudah tak lagi rapi di bahwa risiko adalah bagian dari olahraga,” ujarnya.(int) tengah pertandingan. Sementara yang lain menganggapnya dengan berbeda. Yang jelas, Ronaldo adalah salah satu pencetak gol kemenangan 2-1 El Real dalam laga itu. (int)

Jorge Lorenzo

Pertimbangkan Pensiun Setelah 2014

Heboh Tulisan Allah di Kepala CR7 Di tengah ramai pemberitaan cedera pelipis Cristiano Ronaldo saat menghadapi Levante, ada kisah lain yang tak kalah heboh. Itu terkait dengan pola rambut CR7 yang terlihat membentuk tulisan Allah. Pelipis kiri Ronaldo mengeluarkan darah segar saat Real Madrid bertamu ke Levante dalam lanjutan Liga Spanyol, Senin (12/11) dinihari WIB. Kepala CR7 berbeturan dengan sikut David Navarro dalam sebuah perebutan bola di udara, yang membuat pesepakbola asal Portugal itu mengalami masalah pengelihatan dan kemudian ditarik keluar. Saat mendapatkan perawatan di pinggir lapangan akibat cedera tersebut, salah satu kamera televisi menyorot Ronaldo dari arah belakang. Pada momen itulah terlihat tulisan Allah terbentuk akibat pola rambut Ronaldo. Video tersebut kemudian di-upload di Youtube dengan judul “Allah written in Arabic on Cristiano Ronaldo’s head?” dan mengundang banyak komentar. Ada yang meragukan keaslian potongan gambar tersebut dan menganggapnya sebagai hasil olah digital. Namun pada beberapa video lain yang menampilkan

momenperistiwayangsama,tulisandikepala Ronaldo tersebut masih terlihat. Karena Ronaldo selama ini dikenal suka berganti-ganti gaya rambut, ada yang beranggapan lafaz Allah tersebut hanya kebetulan semata. Apalagi rambut

Dengan usianya baru 25 tahun, Maria Sharapova memiliki banyak keinginan untuk dilakukan. Petenis rangking dua dunia itu mengungkapkan keinginannya untuk membintangi film Hollywood pada suatu saat nanti. Dengan parasnya yang c a n t i k , keinginan itu bisa saja terwujud.

Apalagi, Sharapova sudah cukup terbiasa dengan akting saat ia didapuk sebagai model beberapa produk, termasuk model baju renang di sebuah majalah olahraga terkemuka beberapa tahun lalu. “Untuk sekarang, terlalu banyak yang terjadi dalam hidupku. Aku terikat dengan pertandingan-pertandinganku, brand associations dan beberapa komitmen lainnya,” kata Sharapova saat berada di New Delhi untuk menghadiri acara sebuah perusahaan real estate di mana ia jadi brand ambassador-nya. “Tapi suatu hari, jika diberi kesempatan aku sangat ingin berakting di sebuah film Hollywood, ungkap dia seperti yang

dilansir Larry Brown Sports. Selain beraksi di lapangan tenis, Sharapova juga menjadi model sejumlah ambassador sejumlah brand ternama di dunia. Belum lama ini, petenis ranking dua dunia itu memasarkan produk permen premium “Sugarpova”. Sharapova juga mengomentari rivalitasnya dengan Serena Williams. Sepanjang sejarah keduanya sudah bertemu 12 kali namun Sharapova hanya bisa menang dua kali saja melawan ratu tenis Amerika Serikat itu. “Selalu bagus memiliki rival-rival hebat. Itu membuat kompetisi semakin baik,” ujar dia singkat. (int)

Pukul Wasit, Petinju Didiskualifikasi SEMUA orang tahu tinju adalah olahraga keras. Namun, semua orang tahu meski keras bertinju di atas ring dibatasi banyak aturan. Salah satu aturan yang tak boleh dilanggar adalah meninju wasit. Kejadian wasit menerima bogem mentah petinju memang jarang terjadi. Kalaupun terjadi biasanya itu adalah kejadian yang tak disengaja. Namun, apa yang terjadi di sebuah laga tinju amatir di Slovenia nampaknya berbeda. Dalam sebuah pertarungan antara

petinju Kroasia, Kristen Radan dan petinju Slovenia, Blaz Sedej berjalan sangat ketat. Kedua petinju yang bertarung rapat kerap terlibat saling memeluk atau istilah tinjunya adalah clinch. Nah, biasanya bila clinch terjadi maka wasit akan memisahkan petinju agar bisa kembali bertarung. Itu juga yang dilakukan wasit yang memimpin pertandingan ini. Namun, setelah upaya wasit ini tak disukai Radan. Bukannya mundur untuk mengambil jarak dengan

lawannya, petinju Kroasia itu malah memilih meluncurkan pukulan hook kiri ke arah si pengadil. Kontan saja pukulan Radan masuk telak ke wajah wasit. Hebatnya, sang wasit tidak KO akibat pukulan itu. Dia tetap berdiri meski terlihat agak terhuyung. Tak lama setelah wasit kembali sadar, dia langsung membalas. Balasannya sudah pasti bukan pukulan namun sang wasit langsung mendiskualifikasi Radan dan menyatakan Sedej sebagai pemenang laga. (int)

Ferrari Tetap Yakin Alonso Juara Dunia FERRARI tetap yakin bisa menjadikan Fernando Alonso juara dunia F1 untuk kali ketiga di GP Brasil, akhir pekan ini. Presiden Ferrari, Luca di Montezemolo, berjanji timnya akan berjuang hingga lap terakhir agar Alonso bisa mengalahkan Sebastian Vettel. Balapan F1 2012 seri terakhir di GP Brasil, akan menentukan juara dunia. Pebalap Red Bull Racing, Sebastian Vettel, lebih difavoritkan untuk mencetak hattrick juara dunia setelah unggul 13 poin atas Alonso di puncak klasemen. Namun, Montezemolo menegaskan pihaknya belum menyerah. Montezemolo menegaskan Ferrari tetap yakin bisa menjadikan Alonso juara dunia F1 untuk kali ketiga di GP Brasil. “Sekarang kami akan ke Sao Paulo, Brasil, dengan keinginan untuk menang. Kami harus berjuang hingga kilometer terakhir di lap terakhir di Sirkuit Interlagos. Saya tahu itu akan sulit, tapi saya dan tim yakin bisa melakukannya,” ujar Montezemolo seperti dilansir situs resmi Ferrari. Beberapa skenario balapan di Interlagos bisa membuat Alonso juara dunia F1 2012. Salah satunya adalah pebalap asal Spanyol tersebut harus memenangi balapan dengan Vettel terlempar dari posisi empat besar. Kalaupun Vettel gagal menyelesaikan balapan, maka Alonso tetap harus meraih podium di Brasil untuk menjadi juara dunia. Sebelumnya Alonso menjadi juara dunia F1 pada 2005 dan 2006 ketika masih memperkuat Renault. (int)


RABU 21 November 2012

„ El Shaarawy

„ van Baukering

Timnas Siap Menjajal Laos DI PARTAI PEMBUKA PIALA AFF PREDIKSISKOR Anderlecht 2-2 AC Milan BURSAMETRO Anderlecht 0:0 AC Milan


ANDALKAN EL SHAARAWY Harian Italia Tuttosport, pernah memberi judul berita headline-nya “Stephan El Shaarawy: Heart and Soul”. Sangat jarang ada media Italia yang memberikan tempat utama untuk pemain muda di halaman depan.


emua itu dilakukan hanya untuk El Shaarawy, penyelamatACMilanmusim ini. Termutakhir, lesakan dua gol pemain Italia berdarah Mesir itu menyelamatkan “I Rossoneri” dari pahitnya kekalahan di kandang Napoli. Skor kedua tim pun berakhir 2-2. Koleksi 10 gol dari 13 pertandingan Serie-A membuktikan bakat besar El Shaarawy. Jumlah tersebut berarti setengah gol Milan musim ini adalah berkat bantuan eks pemain Genoa dan Padova itu. Sebuah fakta menunjukkan bahwa klub asuhan Massimiliano Allegri tersebut begitu bergantung kepada El Shaarawy. Jika tak ada gol-gol dari El Shaarawy, posisi Milan di klasemen sementara Serie-A Liga Italia adalah juru kunci!

Beruntung, El Shaarawy mampu tampil trengginas dan dapat menjaga Milan jauh dari zona merahdegradasi.Padausiabaru20 tahun, El Shaarawy sudah mengambil tugas berat menolong Milan tetap bernapas musim ini. Pada awal musim, tak ada yang mengiraElShaarawybakalmenjadi juru selamat Milan. Pasalnya, musim pertama El Shaarawy di San Siro hanya mengoleksi empat gol dari 28 pertandingan. Semua itu tak terlepas dari keberadaan Zlatan Ibrahimovic yang tidak tersentuh di Milan. Setelah Ibrahimovic pergi ke Paris SaintGermain, mau tak mau Milan memaksimalkan kemampuan pemain berjuluk “Firaun Kecil” itu. Untungnya, El Shaarawy bisa membayar kepercayaan yang

PRAKIRAAN PEMAIN AC MILAN (4-3-1-2): Abbiati- De Sciglio - Bonera - Acerbi - Antonini- Montolivo - Ambrosini - NocerinoBoateng-Pazzini - El Shaarawy ANDERLECHT (4-2-3-1): Proto-Gillet - Wasilewski - Kouyate - Deschacht-Biglia - Kljestan-Bruno - Kanu - Iakovenko-Jovanovic

HEAD TO HEAD : 19 Sep 2012: AC Milan 2 Nov 2006 : AC Milan 18 Okt 2006 : Anderlecht

0-0 4-1 0-1

Anderlecht Anderlecht AC Milan

(Liga Champion) (Liga Champion) (Liga Champion)

LIMA PERTANDINGAN TERAKHIR ANDERLECHT 11 Nov 2012 Anderlecht 6-1 Bruges (LJB) 7 Nov 2012 Anderlecht 1-0 Zenit st Petersburg (UCL) 4 Nov 2012 KV Mechelen 1-4 Anderlecht (LJB) 31 Okt 2012 Anderlecht 5-0 KAA Gent (LJB) 28 Okt 2012 Royal Charleroi 2-0 Anderlecht (LJB) LIMA PERTANDINGAN TERAKHIR AC MILAN 11 Nov 2012 AC Milan 1-3 Fiorentina 7 Nov 2012 AC Milan 1-1 Malaga 4 Nov 2012 AC Milan 5-1 Chievo 31 Okt 2012 Palermo 2-2 AC Milan 28 Okt 2012 AC Milan 1-0 Genoa

(SA) (UCL) (SA) (SA) (SA)

DATADAN FAKTA: - AC Milan sejauh ini baru bertemu 3 kali menghadapi Anderlecht, dari pertandingan tersebut, AC Milan memenangkan dua pertandingan dan 1 kali seri. - AC Milan tampil kurang konsisten dari pertandingan terakhirnya. - Anderlecht sendiri baru meraih 1 kemenangan dari 5 pertandingan terakhir. Mereka meraih 1 kemenangan, 3x seri, dan 1x kalah. Pertandingan terakhir mereka berakhir dengan skor 1-1 ketika menghadapi Lierse. - Ini adalah kali pertama bagi Anderlecht mengikuti fase grup Liga Champion, terakhir mereka dapat lolos dari kualifikasi pada tahun 2006/2007. - Rekor AC Milan ketika menghadapi tim asal Belgia ada memenangkan 5 pertandingan, 3x seri, dan 2x kalah. Tim terakhir asal Belgia yang berhasil mengalahkan AC Milan adalah Club Brugge, dengan skor 0-1. - Anderlecht memiliki catatan yang buruk ketika menghadapi tim Italia, mereka belum pernah menang melawan tim asal Italia, mereka mencatat 6 kali seri, dan 9 kali kalah. - AC Milan berada diposisi ke-12 di Liga Italia saat ini. - Sedangkan Anderlecht berada diposisi ke-2 Liga Belgia dengan point 13 dari 7 pertandingan, mendapatkan 3 kemenangan, dan 4x seri.

diberikan Milan. Jika terus tampil konsisten dan berkontribusi lebih untukMilan,julukan“FiraunKecil” sepertinya sudah tak cocok lagi untuknya. Mungkin saja, julukan ElShaarawynantimenjadi“Firaun kota Milan”. Dinihari nanti, AC Milan akan bertandang ke Belgia untuk melawan Anderlecht. Meski sejauh catatanyangmerekapunya,dalam tiga kali pertemuan, AC Milan unggul dua kali dan sekali seri. Namun performa Milan yang mengendur belakangan membuat fanskhawatir.BisakanElShaarawy dan kawan-kawan pulang dengan membawa tiga poin. Usai menahan imbang Napoli

beberapa hari lalu, pelatih Massimiliano Allegri merasa terpuaskan. Tapi, karena saat itu Rossoneri masih membuat terlalu banyakkesalahan,Allegrimeminta timnya berbenah. “Kami menghadapi sejumlah situasi yang sebenarnya bisa dihindari dan disebabkan kesalahan-kesalahan kami,” ungkap Allegri di Football Italia. “Kami harus berkembang karena kami masih membuat terlalu banyak kesalahan pada level individu. Ini adalah tim yang harus dewasa dan belajar dari kesalahan-kesalahan dan juga posisinyadiklasemen,”ujarAllegri. (int)

5 Tim yang Menang “Hoki” KANSAS- Dalam dunia sepakbola, giat berlatih, penerapan strategi yang matang, fokus saat bertanding, serta kerjasama yang baik antar pemain adalah syarat mutlak menjadi pemenang atau juara. Namun, terlepas dari faktor teknis, faktor ‘luck’ atau keberuntungan juga sedikit banyak dapat menjadi faktor yang tidak bisa dilupakan. Berikut adalah lima tim yang memenangkan pertandingan atau sebuah kejuaraan dengan cara yang bisa dibilang “menang hoki”. 1.ManchesterUnited (Juara Liga Champions 1999) Partai final yang digelar di Stadion Camp Nou ini menjadi partai final yang luar biasa. Sang wakil Jerman, Bayern Munchen unggul lebihdulusaatlagaberjalan6menit melalui gol Mario Basler. Keunggulan yang diraih Bayern bertahan sampaimenitke90laga.Tapimimpi

buruk mendatangianak-anakasuhan Ottmar Hitzfeld. Karena United berhasil mencetak dua gol pada menit 91’ dan 93’ lewat gol Teddy Sheringham dan Ole Gunnar Solskjaer. 2-1 untuk Manchester United 2. Porto (Juara Liga Champions 2004) Porto disebut tim yang beruntungsebagaijuaraLigaChampions karena Porto bukanlah tim yang samasekalitidakunggulkan.Diatas kertas, lawan-lawan yang mereka hadapijugabukantimyanglemah. Tercatat lawan seperti Manchester United, Lyon, dan Deportivo La Coruna berhasil mereka taklukan. Keberuntungan mereka terletak saat menghadapi Manchester United pada leg kedua semifinal di Old Trafford. Dimana saat itu pemain Porto, Costinha berhasil mencetak gol di menit ke 90 dan memastikan FC Porto menang aggregate3-2danloloskebabakfinal.

3. Liverpool (Juara Liga Champions 2005) Kemenanganinisangatistimewa karena melalui proses yang sangat dramatis.Lawanmerekasaatitu,AC Milansudahunggul3gollebihdulu di babak pertama melalui gol dari Paolo Maldini dan sepasang gol HernanCrespo.Namun,TheReds secara mengesankan dapat menyamakan kedudukan di babak kedualewatgolyangdicetakSteven Gerrard, Vladimir Smicer dan Xabi Alonso.Skor3-3punberakhirsampai waktu normal dan babak perpanjangan waktu. Liverpool memastikangelarjuaramelaluidrama adupenalti,6-5untukLiverpool. 4. Manchester City (JuaraLigaInggris2012) Bisa dibilang Barclays Premier League musim 2011/2012 adalah musim paling menegangkan, karena sampai pertandingan pamungkas saat itu, belum ada tim yang memastikan diri sebagai jua-

ra. Duo Manchester terus berjuang sampai laga terakhir untuk keluar sebagai juara. Namun, City lebih beruntung karena berhasil menjuarai Liga Inggris hanya denganselisihgoldanpoinyangsama dengan rival sekota mereka. 5. Chelsea (Juara Liga Champions 2012) Laga final Champions League mempertemukan dua tim besar, Bayern Munich dan Chelsea. FC Hollywood bisa memecah kebuntuan dengan mencetak gol pada menit 83 melalui Thomas Muller. Selang 7 menit laga berakhir, penyerang Chelsea Didier Drogba dapatmenyamakankedudukandi menit88.PestayangdisiapkanThe Bavarian pun tertunda. Sampai babak tambahan waktu digelar, skor tak berubah dan drama adu penalti pun terpaksa dilakukan. Di babak adu penalti, The Blues menang dengan skor 3-4. total The Bluesungguldenganskor4-5.(int)

JAKARTA- Tim nasional (Timnas) bakal melakoni laga perdana menghadapi Laos, di stadion Bukit Jalil Malaysia, Minggu (25/11) mendatang. Menurut pelatih Nilmaizar, melawan Laos pada partai perdana merupakan keinginan dari skuad Garuda. Tentunya Laos sebagai tim yanglolosdarikualifikasibakal menjadilahanTimnasGaruda untuk meraih poin penuh. Sebab dua lawan Bambang ‘Bepe’ Pamungkas cs berikutnyamemilikiperingkatFIFAdi atas Indonesia, yaitu Singapura (28/11) dan melawan tuan rumah Malaysia pada 1 Desember 2012. “Menghadapi Laos, memang itulah keinginan kami. Karena inilah titik kombinasi kita dalam dua pertandingan ke depan,” ucap Nil, usai latihan di SUGBk tadi pagi. Selainitu,Niljugamenegaskan kepada para pemain untuk bisa menjaga kondisinya. Terkait dengan itu, dua punggawa yang mengalami cedera pada uji coba melawan Kamerun,Sabtu(17/11)kemarin, Handi Ramdan dan Endra Prasetya, Nil mengaku tidak menemui masalah yang berarti. “KhususuntukHandi,kami tidakmenemuimasalah,kami masih punya penggantinya, yaitu Fachrudin (yang juga menggantikan Handi saat lawan Kamerun),” tegasnya. PatenkanFormasi4-4-2 Timnas menjalani latihan terakhir mereka sebelum berangkatkeMalaysia,Selasa(20/ 11). Terlihat dalam dua tim yang dibagi, Nil menggunakan formasi 4-4-2 yang disinyalir bakal digunakan di babak penyisihan grup B. Tonnie Cusell, Bambang Pamungkas, Irfan Bachdim,

dan Oktovianus Maniani berada dalam satu tim memakai rompi hijau. Sementara di tim Oranye, pelatih Timnas Nilmaizar menempatkan Arthur Irawan, Jhonny van beukering, serta Ellie Eiboy ke dalam satu tim. Pada latih tanding tersebut, Nilmaizar menegaskan kepada anak asuhnya untuk tidak berlama-lama dengan bola. Kemudian mantan pelatih Semen Padang itu juga menginstruksikan untuk memaksimalkan permainan. “Latihan terakhir tadi merupakantaktikaldalammenghadapiketigalawanyangakan kami hadapi nanti. Saya juga menekankan untuk sering melakukan komunikasi dan siapa yang naik membantu serangan, juga siapa yang turun,”ucapNil,usailatihandi SUGBK,Selasa(20/11). Namununtukmenghadapi masalah komunikasi terkait ada tiga pemain naturalisasi, Nil mengaku tak menjadi hambatan buat timnya. Karena menurutnya sepakbola tak hanya mengandalkan komunikasi bahasa, tetapi juga body language. Selain itu dari kedua tim tersebut, Nil menggunakan formasi 4-4-2 di mana formasi tersebut akan digunakannya pada saat di Malaysia nanti. “Formasi, saya sudah paten akan menggunakan formasi 4-4-2 untuk bertanding di Malaysia,” pungkasnya. Terlihat juga ada Ketua UmumPSSI,DjoharArifinHusein yang berada di sisi lapangan latihan Timnas kali ini. Djohar memberikan semangat serta beberapa wejangan kepada para pemain. Van Beukering Bidik Kemenangan Lima hari jelang mengha-

dapi Laos, pemain naturalisasi asal Belanda, Jhonny van Beukering mengaku belum mengetahui kekuatan calon lawannya. Meski begitu dia tetap menargetkan tiga poin pada partai pertama Indonesia di penysihan grup B, di Malaysia Minggu (25/11) mendatang. Lawan Laos menjadi pertandingan resmi pertama van Beukering di tim nasional Indonesia. Tapi dia yakin bisa menyatu dengan tim, meski dia baru bergabung dalam hitungan hari. “Pertandingan pertama lawan Laos pastinya akan berat karena itu adalah pertandingan pertama kami. Saya juga tidak tahu kekuatan Laos sejauh apa karena saya tidak terlalu memperhatikan mereka. Namun saya yakin, kami bisa menang dan kami harus meraih tiga poin,” jelas van Beukering, kepada wartawan Selasa. “Kami harus waspada jangan sekali-kali meremehkan lawan. Ini sepakbola yang tidak bisa didapat secara pasti dan mudah untuk diperhitungkan hasilnya. Kami di sini semua sudah siap tempur untuk menghadapi Laos dan menargetkan kemenangan,” tegas pemain bertubuh tambun tersebut. Pemain 29 tahun tersebut juga mengakui merasa nyaman dengan seluruh skuad Garuda asuhan Nilmaizar tersebut. Padahal belum ada sebulan dia bersama Bambang Pamungkas cs. “Saya sudah 13 hari di sini. Berlatih bersama timnas dan mencoba beradaptasi secara maksimal. Saya pikir saya mampu melakukan proses ini,” ungkap van Beukering menutup percakapan. (int)

Iniesta Tak Bermimpi Raih Ballon d’Or BARCELONA- Gelandang Barcelona Andres Iniesta Lujan tidak pernah bermimpi mendapatkan Ballon d’Or 2012. Iniesta berpikir, lebih cocok gelar itu disematkan kepada Lionel Messi rekan satu tim Iniesta di Barcelona. Gelandang kreatif Barcelona dan Timnas Spanyol ini menegaskan tidak pernah memiliki ambisi untuk memenangi trofi Ballon d’Or. Musim panas tahun ini dia telah berhasil memenangkanpenghargaanPemainTerbaik Eropa. Namun, pemain berusia 28 tahun itu menjelaskan sudah

sangat senang dapat bermain di level yang sekarang. “Saya berusaha memainkan gaya sendiri dan yang terpenting orang-orang menyadari kemampuan saya, tetapi saya tidak menganggap itu hal yang penting untuk dipikirkan. Saya tidak pernah memikirkan Ballon d’Or dan saya menganggap hal yang tidak penting jika fokus terhadap penghargaan individu. Namun, bila saya memenanginya tentu sangat senang,” kata Iniesta kepada RMC. “Saya merasa sangat senang dapat bermain dengan tim ter-

baik saat ini. Barcelona dan Timnas Spanyol adalah tempat di mana saya ingin bermain setiap hari dan menjadi baik setiap harinya,” pungkas gelandang Spanyol ini. Iniesta langsung mengalihkan pembicaraan menyinggung tentang teman satu timnya Lionel Messi.”Messi adalah pemain terbaik dunia,” tambah Iniesta. “Dia melakukan banyak hal dengan alami dan jika bermain dengan dia(Messi) sangat mudah, sama seperti semua pemain yang bermain dengan saya,” ujar Iniesta. (int)








2 Man United







3 Chelsea







4 West Bromwich A 12






Jadwal Liga Champions Matchday 5 Kamis (22/11) Pukul 01.45 WIB: Porto vs Dinamo Zagreb Grup A Dynamo Kyiv vs PSG Grup A Arsenal vs Montpellier Grup B Schalke 04 vs Olympiacos Grup B Zenit St. Petersburg vs Málaga Grup C Anderlecht vs AC Milan Grup C Ajax vs Borussia Dortmund Grup D Manchester City vs Real Madrid Grup D

PENCETAK GOL NAMA 1 L Suárez 2 D Ba 3 R van Persie 4 Michu 5 E Džeko 6 M Fellaini

KLUB Liverpool Newcastle United Manchester United Swansea City Manchester City Everton

GOL 10 8 8 7 6 6

PREDIKSI SKOR Arsenal 2-0 Montpellier BURSA METRO Arsenal 0 : 1 ¼ Montpellier




12 11




2 Atlético Madrid







3 Real Madrid







4 Málaga








Winger Arsenal Aaron Ramsey mengatakan, timnya harus menang menghadapi Montpellier pada laga lanjutan Champions League di Emirates Stadium, Kamis (22/11) dinihari.


PENCETAK GOL NAMA 1 L Messi 2 Cristiano Ronaldo 3 R Falcao 4 Aduriz 5 G Higuaín 6 Negredo

KLUB Barcelona Real Madrid Atlético Madrid Athletic Club Real Madrid Sevilla

GOL 17 12 10 8 7 7

SERIA A ITALIA KLASEMEN SEMENTARA 1 Juventus 2 Internazionale 3 Napoli 4 Fiorentina

13 10 12 9 13 8 12 7

2 0 3 3

1 3 2 2

29-9 24-13 22-11 19-9

32 27 27 24

PENCETAK GOL NAMA 1 S El Shaarawy 2 E Cavani 3 E Lamela 4 A Di Natale 5 M Klose 6 D Milito

KLUB Milan Napoli Roma Udinese Lazio Internazionale

GOL 10 8 8 7 7 7

BUNDESLIGA KLASEMEN SEMENTARA 1 München 2 Schalke 04 3 Frankfurt 4 Dortmund

12 10 12 7 12 7 12 6

1 2 2 4

1 3 3 2

33-5 22-14 25-18 26-13

PENCETAK GOL NAMA 1 M Mandžukiæ 2 A Meier 3 S Kießling 4 Á Szalai 5 R Lewandowski 6 T Müller

KLUB Bayern München Eintracht Frankfurt Bayer Leverkusen Mainz 05 Borussia Dortmund Bayern München

GOL 9 9 8 8 7 7


31 23 23 22

osisi Arsenal masih belum aman, mereka berada pada posisi kedua dengan poin 7 terpaut1angkadariSchalkedanunggul 1 angka atas Olympiakos di klasemen sementara grup B. “Grup ini cukup ketat, jadi kami harus menang pada pertandingan itu. Kami berada di rumah, mudahmudahankamimeraihkemenangan untuk memantapkan posisi kami agarbisalolos.KetikabermaindiPerancis, kami dalam tekanan selama pertandingan dan kami mendapatkan hasil yang baik,” ujar Ramsey. Montpellier cuma mendapatkan 1 poin hingga saat ini, artinya Mapou Yanga-Mbiwa dan kawan-kawan dipastikan gagal lolos ke babak selanjutnya. “Mereka telah bersaing menghadapi setiap tim di grup ini dan mereka bisa menciptakan ancaman, tentumerekatanpabeban.Merekaakan membuktikan sesuatu, jadi kami harusmewaspadaiitu,”jelasRamsey mengenai calon lawannya itu. Pemain tim nasional Wales berusia 21tahunitusangatberharapagarThe Gunners dapat lolos sebagai juara grup demi menghindari tim unggulan lainnya, seperti Barcelona, pada babak knock out. “Kami finis kedua di grup pada beberapa musim lalu dan bertanding menghadapi Barcelona. Tapi yang terpenting kami harus lolos. Jika berhasilmakakamiakan percaya diri untuk menghadapi tim manapun di kompetisi ini,” tutup mantan pemain Cardiff City itu. Sementara striker Arsenal Olivier Giroudengganmemandangsebelah matamantantimnyaitukalaberjumpa tengah pekan ini.

The Gunners butuh kemenangan atas juara Prancis itu di Emirates, Kamis(22/11)dinihari.Dengantambahan tiga poin, Arsenal akan dipastikan akan menempati satu slot di babak 16 Besar. Sebaliknya kekalahan akan sangat berisiko bagi Arsenal. Apabila Olimpiakos bisa mengalahkan Schalke maka peluang lolos Giroud cs akan mengecil dan harus ditentukan di laga grup pamungkas. Setelahgagalmenangditigalagasebelumnya,moralArsenalkiniterdongrak usai memenangi derby London Utara versus Tottenham Hotspur pada akhir pekan lalu. Sedangkan Montpellier, yang dipastikan tak mungkin lagi lolos tengah terpuruk di kompetisi lokal dengan menduduki peringkat 14 klasemen Ligue 1. Melihat situasi ini, sepertinya skuad Ars e n e Wenger akan mudah

DATADAN FAKTA -Pertemuan pertama kedua tim terjadi pada September 2012 di Liga Champions, dimana Arsenal sukses menekuk Montpellier dengan skor 12. Saat itu Montpellier unggul lebih awal melalui gol Y Belhanda, namun terbalaskan dua gol oleh L Podolski dan Y Gervinho untuk kemenangan Arsenal. -Arsenal meraih dua kemenangan, dua kali imbang dan satu kali kalah dari lima laga terakhirnya. Liga Inggris pekan lalu mereka sukses meraih poin penuh saat berhadapan Tottenham Hotspur, dengan skor akhir 5-2. -Sementara Montpellier hanya memperoleh satu kemenangan, tiga kali seri dan kalah satu kali dari lima laga terakhir mereka. Terakhir kali Montpellier hanya berakhir imbang saat melawan Valenciennes di Ligue 1, dengan skor akhir 1-1. -Arsenal memiliki kinerja yang baik jika bermain di kandang, mereka meraih tiga kemenangan, satu kali seri dan satu kali menelan kekalahan dari lima laga kandang terakhirnya. -Sedangkan Montpellier memiliki performa yang cukup buruk jika bertandang ke markas lawan. Mereka belum pernah menang dari lima laga kandang terakhirnya, hanya menahan imbang tiga kali dan dua kali kalah. -Arsenal sementara di peringkat ke-2 klasemen Grup B dengan perolehan 7 poin dari empat pertandingan, selisih satu poin dari Schalke 04 di puncak klasemen. Sedangkan Montpellier di posisi ke-4 klasemen yang hanya mengoleksi 1 poin.

saja melewati hadangan Montpellier. Giroud, yang sudah mencetak tujuh gol sejak hijrah ke London, menolak meremehkan bekas klubnya itu. “Iniadalahlagawajibmenangbuat kami karena Arsenal harus lolos ke faseberikutnyadikompetisiini,”seru strikerinternasionalPrancisitudiThe Sun. “Montpellier tak punya apapun untukdipertaruhkanseakrangmereka sudah tersingkir tapi kami tetap harus berhati-hati karena saat itulah biasanya yang paling berbahaya.” “Mereka tidak tampil sebagai juara Prancis dengan tidak memiliki kualitas. Kami tidak boleh jemawa saat mereka menyambangi Emirates,” sahutGiroudsembarimemperingatkan. Montpellier Takut Kalah Gelandang Montpellier Younes Belhanda takut jika klub Perancis tersebut dapat kebobolan delapan gol saat menghadapi Arsenal di Liga Champions mendatang. Juara bertahan Ligue 1 itu hanya mendapatkan empat poin dari lima pertandingan di musim ini dan mendapatk a n kekalahan ketiga mereka di musim ini denganskor3-0 oleh tim yang baru mendapat promosi ke liga utama Reims hari Jumat lalu. Arsenal menaklukan Southampton dengan skor 6-1 di Premier League Sabtu lalu, dan Belhanda percaya Montpellier harus kembali ke performamerekasecepatnyadanmemperkuat mental mereka jika mereka ingin terhindar dari kekalahan di Stade de la Mosson. “Jikakamibermainsepertiini,kami akan kebobolan delapan gol,” ujar Belhanda. “Kamiharusmenunjukkansecepat mungkin bahwa kami seorang pria, karenakamiterlihatsepertianakkecil di lapangan. Kami tidak berbahaya, juga tidak cukup tajam.” Pelatih Montpellier Rene Girard mengatakan bahwa ia tidak menyadari timnya saat ini yang telah me-

KLASEMEN SEMENTARA LIGA CHAMPIONS Grup A No Team M 1 Porto 4 2 Paris Saint Germain 4 3 Dynamo Kyiv 4 4 Dinamo Zagreb 4

M 3 3 1 0

S 1 0 1 0

K 0 1 2 4

SG 6-2 10-2 5-7 0-10

Nilai 10 9 4 0

Grup B No Team 1 Schalke 04 2 Arsenal 3 Olympiacos 4 Montpellier

M 4 4 4 4

M 2 2 2 0

S 2 1 0 1

K 0 1 2 3

SG 8-5 7-6 7-7 5-9

Nilai 8 7 6 1

Grup C No Team 1 Málaga 2 Milan 3 Anderlecht 4 Zenit

M 4 4 4 4

M 3 1 1 1

S 1 2 1 0

K 0 1 2 3

SG 8-1 4-4 1-4 3-7

Nilai 10 5 4 3

Grup D No Team 1 Borussia Dortmund 2 Real Madrid 3 Ajax 4 Manchester City

M 4 4 4 4

M 2 2 1 0

S 2 1 1 2

K 0 1 2 2

SG 6-4 10-7 6-8 6-9

Nilai 8 7 4 2

Grup E No Team 1 Chelsea 2 Shakhtar Donetsk 3 Juventus 4 Nordsjælland

M 4 4 4 4

M 2 2 1 0

S 1 1 3 1

K 1 1 0 3

SG 10-6 7-5 8-4 1-11

Nilai 7 7 6 1

Grup F No Team 1 Valencia 2 Bayern München 3 BATE Borisov 4 Lille

M 4 4 4 4

M 3 3 2 0

S 0 0 0 0

K 1 1 2 4

SG 10-4 10-5 8-9 2-12

Nilai 9 9 6 0

Grup G No Team 1 Barcelona 2 Glasgow Celtic 3 Benfica 4 Spartak Moscow

M 4 4 4 4

M 3 2 1 1

S 0 1 1 0

K 1 1 2 3

SG 8-5 6-5 3-4 6-9

Nilai 9 7 4 3

Grup H No Team 1 Manchester United 2 CFR 1907 Cluj 3 Galatasaray 4 Braga

M 4 4 4 4

M 4 1 1 1

S 0 1 1 0

K 0 2 2 3

SG 9-4 5-6 4-5 5-8

Nilai 12 4 4 3

menangkan gelar juara pada musim lalu dan yakin timnya mungkin terlalu percaya diri sebelum dimulainya musim ini. “Kami seharusnya malu pada diri kami sendiri,” ujarnya usai kalah dari Reims. “Untuk pertama kali, saya menanyakan banyak pertanyaanpadadirisayasendiri.Merekatelahmelupakan beberapa nilai.” (int)

HEAD TO HEAD 18 September 2012 : Montpellier 1 – 2 Arsenal, Liga Champions 5 PERTANDINGAN TERAKHIR ARSENAL : 17/11/2012 : 10/11/2012 : 06/11/2012 : 03/11/2012 : 30/10/2012 :

Arsenal Arsenal Schalke 04 Man United Reading

5–2 3–3 2–2 2–1 5–7

Tottenham Hotspur, Fulham, Arsenal, Arsenal, Arsenal,

Liga Inggris Liga Inggris Liga Champions Liga Inggris Piala Liga

5 PERTANDINGAN TERAKHIR MONTPELLIER : 17/11/2012 : 11/11/2012 : 06/11/2012 : 03/11/2012 : 31/10/2012 :

Valenciennes Montpellier Olympiakos Troyes Montpellier

1–1 1–1 3–1 1–1 1–0

Montpellier, PSG, Montpellier, Montpellier, Bordeaux,

Ligue 1 Ligue 1 Liga Champions Ligue 1 Coupe de la Ligue







RABU, 21 November 2012 Edisi 317

Tahun IV

Curi HP, Warga Gunungtua Ditembak KOTAPINANG- Kawanan pencuri yang menyatroni rumah H Syahmolek Siregar (37) dan istrinya Hj Anisa (35) di Dusun Padangri, Desa Simatahari, Kecamatan Kotapinang, Labusel, digulung polisi, Selasa (20/11). Dua diberondong peluru setelah mencoba kabur dari kejaran petugas. Dan, satu di antaranya adalah warga Gunungtua, Paluta.


DIGIRING: Ketiga tersangka curanmor saat digiring ke Mapolres Taput, Selasa (20/11).

Informasi yang dihimpun menyebutkan, kejadian bermula sekitar pukul 02.00 dini hari. Saat itu, H Syahmolek dan istrinya sedang tidur. Mendengar suara berisik, Hj Anisa terbangun. Ternyata, dua pria sudah berada di lantai dua rumahnya FOTO: FOTO: MAHRA HARAHAP

Tersangka pelaku pencurian sedang menjalani perawatan di RSU Kotapinang, Selasa (20/11).

Pramuka Ditetapkan Jadi Eskul Wajib JAKARTA- Kegiatan pramuka di semua jenjang pendidikan akhir-akhir ini mulai luntur. Gejalanya, tepuk pramuka sudah jarang bergemuruh di sekolah-sekolah. Selain itu, ada sejumlah sekolah yang tidak menggunakan seragam pramuka sebagai salah satu seragam wajib. Supaya pramuka tidak semakin tenggelam, akhirnya diputuskan menjadi ekstra kurikuler (eskul) wajib dalam kurikulum baru tahun depan. “Pramuka menjadi eskul wajib terutama di SD dan SMP. Selain itu juga akan Baca

Pramuka ...Hal 6


Curi HP...Hal 6

PNS Bisa Diturunkan Pangkat atau Dipecat

Jika Ketahuan Dukung Mendukung Cagubsu

MEDAN- Pegawai Negeri Sipil (PNS) di semua jajaran, baik provinsi maupun kabupaten/kota serta pejabat di lingkungan Badan Usaha Milik Negara (BUMN) atau Badan Usaha Milik Daerah

(BUMD), dilarang untuk memberi dukungan kepada pasangan calon (paslon) kepala dan wakil kepala daerah di Pemilihan Gubernur Sumatera Utara (Pilgubsu) 2013 mendatang. Tidak hanya itu, PNS juga dilarang keras terlibat dalam kegiatan kampanye untuk dukungan terhadap para calon kepala daerah/wakil kepala daerah.

Polisi Nyaris Dimassa

Gara-gara Diteriaki Pelaku Curanmor Perampok

TARUTUNG- Diteriaki perampok oleh pelaku curanmor, petugas Polsek Adiankoting, Kabupaten

Taput, nyaris menjadi bulan-bulanan warga saat berusaha meringkus IC (25) di rumahnya Kampung Batak Sibolga, Selasa (20/11) sekira pukul 05.00 Wib. IC sendiri merupakan salahsatu sindikat pencurian

Polisi ...Hal 6


Karena, pada prinsipnya jabatan PNS harus mengedapankan netralitas dan harus senantiasa menjunjung tinggi kehormatan negara, pemerintah dan martabat PNS, serta senantiasa mengutamakan kepentingan negara diatas kepentingan pribadi, seseorang atau golongan. Baca

PNS ...Hal 6 FOTO: IST

Ketua Himmpada Tabagsel Abdul Gani Lingga (pakai peci) bersama pengurus lainnya memperingati Tahun Baru Islam 1434 H.

Himmapada Rayakan Tahun Baru Islam

Mari Bergandeng Tangan dengan Nilai-nilai Islam MANCHESTER- Mission impossible. Itulah gambaran sulitnya Manchester City untuk melaju ke babak 16 besar Liga Champions musim ini. Mereka bukan hanya membutuhkan dua kemenangan di dua laga sisa, juga berharap pesaingnya tergelincir. Ya, saat ini City baru mengemas dua poin. Dengan begitu, agar bisa lolos ke babak 16 besar, mereka harus berharap para pesaingnya seperti Real Madrid (7 poin) tergelincir di dua laga sisa dan dan Ajax Amsterdam kalah dari Borussia Dortmund, dini hari nanti. Berbeda dengan Real yang hanya butuh satu kemenangan atau seri dan Ajax kalah dari Dortmund. Jadi, bentrok melawan Real pada matchday kelima dini hari nanti akan menjadi Baca

Ambisi...Hal 6

SIDIMPUAN- Himpunan Muslim Pakpak-Dairi (Himmpada) Tapanuli Bagian Selatan (Tabagsel) memperingati Tahun baru Islam 1434 H di Sekretariat Himmpada Tabagsel,

Jalan Panca Budi Komplek BI, Losung Batu, Kota Padangsidimpuan (Psp), Minggu (18/11) lalu. Baca

Mari ...Hal 6

Pria Bertompel Culik dan Perkosa Anak SD

Pelaku Ditangkap, Keluarga Korban Ngamuk RANTAU- Pria bertompel di bagian wajah berinisal DD (35) warga Simpang Mangga Rantauprapat, atau pelaku penculik dan pemerkosa murid SD sebut saja Bunga (13), Senin (19/11) diringkus polisi.

Mengetahui pelaku telah ditangkap, keluarga korban mengamuk. Mereka meneriaki pelaku agar dihukum setimpal dengan perbuatannya. Baca

Pelaku ...Hal 6

Asran Hasibuan, Sepuluh Tahun jadi Tukang Parkir dengan Kaki Cacat

Pegang Prinsip Tak Mau Minta-minta, Bahagia Didukung Istri Kasih Sayang Ayah (1) SIDIMPUAN- Cacat fisik bukan halangan untuk mencari nafkah demi kebutuhan keluarga. Hal ini dibuktikan Asran Hasibuan (37), pria yang mengalami cacat kedua kakinya sejak lahir. Pria ini hampir sepuluh tahun menjadi tukang parkir. Selasa (20/11) siang, pelataran ruko di Jalan MH Thamrin Kota Padangsidimpuan (Psp), dipenuhi sejumlah kendaraan roda dua yang berbaris rapi. Namun, siapa


Asran Hasibuan sedang memarkirkan kendaraan di parkiran Jalan Thamrin, Psp, kemarin.

sangka kalau seluruh sepedamotor yang terparkir itu adalah hasil ‘jerih payah’ Asran Hasibuan. Betapa tidak, untuk memar-

kirkan kendaraan-kendaraan itu, Asran Baca

Pegang ...Hal 7

Bila semua teman-temanku bernyanyi, aku hanya bisa terdiam. Aku tidak pernah tau harus bagaimana mengatakan pada dunia bertapa aku sangat ingin seperti mereka, bisa mendengar dan bernyanyi layaknya kehidupan normal. Sayangnya aku terlahir dengan keadaan tuli, lebih sadisnya terkadang mereka orang-orang yang tidak pernah mengerti perasaanku berkata kalau aku “budek” dan itu dituliskan di kertas untukkku tepat di meja belajarku di kelas. Tapi aku tidak pernah merasa ingin membalas semuanya, karena aku sadar inilah hidupku dan inilah takdirku. Baca

Kasih ...Hal 7



Metro Tabagsel RABU, 21 NOVEMBER 2012



21 November 2012



“Apabila berhasil dan MK sepakat juga dengan kesimpulan DPR atas dugaan keterlibatan Boediono dalam skandal bailout Century, maka DPR bisa melanjutkannya dengan impeachment,” Anggota Timwas Century DPR, Bambang Soesatyo.

“Kita mendesak sebelum masa timwas century berakhir agar KPK menyerahkan surat pernyataan yang seperti dikatakan Pak Abraham tadi, bahwa Pak Boediono sebagai Wapres, tidak bisa melakukan penyelidikan dan menyerahkan kasus ini Anggota Timwas Century DPR, kepada DPR,” Akbar Faisal.

Etika Politik dan Perilaku Politisi Kode etik penyelenggara pemilihan umum akhirakhir ini menjadi perbincangan yang menarik di kalangan praktisi hukum, politisi, dan akademisi. Bahkan, publik dari berbagai elemen juga menaruh perhatian terhadap tema ini. Etika yang selama ini tidak dilihat sebagai norma sosial bagi para aktor politik dan politisi, justru kini bagaikan monster yang mulai ’’memakan mangsa’’. Di manakah letak moralitas yang selalu menggerus etika politik para politisi kita? DKPP juga menolak gugatan sekaligus merehabilitasi nama baik tergugat kepada anggota Panwaslu Sulawesi Tenggara, ketuaKPULampungBarat,ketuadan anggota KPU Kota Batu, serta ketua KPU Banggai Kepulauan. Sedangkan di Kabupaten Talaud, DKPP memberikan putusan berupa penetapan pencabutan kepada tergugat ketua KPU daerah setempat (lihat tabel). Munculnya para komisioner yang tersandung kasus pelanggarankodeetikmeneguhkankeyakinan kita betapa para aktor politik bersama politisi bergerak liar melabrak keluhuran politik. Sementara rakyat yang seharusnya mendapat pendidikan politik luhur jauh terbuang ke ruang-ruang ketidakpercayaan politik. Inilah wajah perpolitikan kita akhir-akhir ini. Politik yang hampa dari etika. Jargon siap kalah siap menang yang selalu diikrarkan menjelang pemilihan kepala daerah (pilkada) oleh kontestan, ternyata hanya sebatas basa-basi belaka. Kenyataannya, politisi kita hanya siap menang tetapi tidak mau kalah. Karenanya, langkah culas pun ditempuh dengan berkolusi dengan penyelenggara pemilu. Keberpihakan inilah yang kemudian menjadi malapetaka bagi para komisioner yang akhirnya DKPP menjatuhkan putusan atas pelanggaran kode etik. Yaitu pelanggaran terhadap etika penyelenggara pemilu yang berpedoman-

Skandal Century di Puncak Hierarki

kan sumpah dan/atau janji sebelum menjalankan tugas sebagai penyelenggara pemilu (Pasal 251 UU No. 8/2012 tentang Pemilu). Dengan kata lain, penyelenggara pemilutermakansumpahatasjanji saat dilantik menjadi penyelenggara pemilu. Putusan DKPP yang diproses melalui semi peradilan sesungguhnya berbeda secara prosedural dengan Dewan Kehormatan KPU/Bawaslu sebelum terbentuknya DKPP. Jika Dewan Kehormatan melakukan peradilan tertutup, DKPP secara terbuka. Hal ini tentu dimaknai sebagai bentuk transparansi atas kasus yang digelar agar tidak timbul fitnah dan kasak-kusuk dengan pihak yang bermasalah. Sebuah terobosan yang cukup mengobati rasa keadilan DKPP, yang konon hanya satu-satunya di dunia. DaftarPutusanSidang PelanggaranKodeEtikDKPP No Daerah Putusan Komisioner 1. SulawesiTenggara Pemberhentian tetap Ketua dan anggota KPU 2. Depok Pemberhentian te-

Promosikan Usaha Anda di METRO TABAGSEL hub: 0634-22991

SEKARANGSAYATIDAKTAKUTMAKANDANMINUMYANGMANIS Gula Aren adalah jenis palma yang tidak hanya manis rasanya, namun juga kaya manfaat bagi kesehatan. Tidak percaya? Gentong Mas yang salah satu bahan dasarnya Gula Aren, telah terbukti menurunkan kadar gula banyak penderita diabetes. Salah seorang yang telah membuktikan manfaatnya adalah Siti Rosnih (53 thn). PNS ini menceritakan, sudah 2 tahun lamanya menderita penyakit berbahaya ini, "Karena pola makan yang kurang terjaga, saya menderita diabetes. Akibatnya, badan sering kali terasa lemas, pusing, dan mudah lapar," papar ibu 5 orang anak tersebut. Diabetes adalah peningkatan kadar glukosa darah akibat kekurangan insulin baik yang sifatnya absolut maupun relatif atau resistensi reseptor insulin. Diabetes melitus sangat erat kaitannya dengan mekanisme pengaturan gula normal. Tapi sekarang setelah rutin minum Gentong Mas, kesehatannya sudah mulai membaik, "Sekarang keluhan saya sudah hilang dan tidak takut lagi makan yang manis." Ungkap warga Desa Tegalsari, Kec. Medan Denai, Medan tersebut penuh syukur. Karena telah merasakan

manfaatnya, Siti Rosnih ingin sekali membagi pengalaman baiknya itu dengan orang lain, "Mudah-mudahan pengalaman saya ini dapat bermanfaat untuk orang lain." Pungkasnya. Obat apapun, memang belum dapat melakukan pencegahan terhadap diabetes tipe 1, dimana ketidakmampuan pankreas memproduksi insulin sejak lahir. Berbeda dengan tipe 2, yang sering dicetuskan oleh faktor genetik, obesitas, kurang olahraga, serta pola makan yang tidak sehat, sesungguhnya diabetes dapat dicegah, salah satunya dengan terapi Gentong Mas. Gentong Mas adalah minuman kesehatan herbal alami dengan bahan utama Gula Aren dan Nigella Sativa (Habbatussauda) yang terbukti manfaatnya bagi penderita dari berbagai penyakit, termasuk diabetes. Habbatussauda dipercaya dapat meningkatkan fungsi insulin dan mengurangi resistensi reseptor insulin, sedangkan Gula Aren berperan dalam optimalisasi kerja reseptor insulin. Gentong Mas juga mengandung Chromium yang efektif memperlancar metabolisme gula darah dan mengatur kepekaan sel terhadap insulin sehingga meringankan kerja pankreas. Selain itu, indeks glisemik dalam

Kirim Opini Anda ke email: metrotabagsel Maksimal tulisan 5.000 karakter

Sikap Kami

Oleh : Yusrizal Karana ANDAIsajaNiccoloMachiavelli (1469-1527)masihhidup,iamungkin akan datang ke Indonesia untukmelihatbagaimanateorieigentum-nya yang kian beroleh humus dari sejumlah politik ’’menghalalkan segala cara’’ dan sekaligus memberi support atas perilaku politisinya. Saking semrawutnya wajah politik kekinian di negeri ini, hingga kita makin sulit menyentuh pucuk perenungan demokrasi yang sesungguhnya. Bagaimana tidak, Dewan Kehormatan Penyelenggara Pemilu (DKPP) memberhentikan ketua Panwaslu DKI Jakarta karena terbukti melanggar kode etik penyelenggara pemilu. Ini adalah putusan pelanggaran berat yang kelima sejak DKPP dibentuk, setelah sebelumnyamemecatketuadantiga anggota Komisi Independen Pemilihan(KIP)danlimakomisioner anggota Komisi Pemilihan Umum (KPU) Tulangbawang. Sedangkan yang jadi korban pertama atas putusan DKPP adalah lima anggota KPU Provinsi Sulawesi Tenggara dan disusul pemecatan ketua KPU Kota Depok dengan tuduhan yang sama. Selain memutuskan pemberhentian secara tetap, DKPP juga memberi sanksi berupa teguran tertulis kepada ketua KPU DKI Jakarta dan peringatan keras kepada ketua dan satu anggota KPU Pati, Jawa Timur, serta ketua dan seluruh anggota KPU Timor Tengah Utara, NTT.

Ketua Komisi Hukum DPR, Gede Pasek Suardika.

“Ini adalah kemajuan yang sangat berarti dari janji KPK sebelumnya. Kan KPK berjanji sampai akhir tahun dan terbukti sebelum akhir tahun sudah ada kemajuan,”

Gentong Mas yang sangat aman bagi kesehatan yaitu hanya 35 (aman jika indeks glisemik dibawah 50), mampu menjaga dan merawat pankreas agar tetap berfungsi dengan baik. Meski demikian, untuk mendapatkan hasil maksimal, disarankan untuk mengatur pola makan, olahraga, pengaturan berat badan seideal mungkin, diet rendah lemak, kontrol stress, dan menghindari rokok serta alkohol. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan silahkan hubungi:0813 8477 7787 Medan, Sidikalang, Gunungtua, Batubara, Tobasa, Nias Madina, Tapsel : 081384777787, Dolok Sanggul : 082129284752, Tebing Tinggi/ Siantar : 081322099495, Binjai/ pakam : 081398666166, Langkat/ karo : 082167538828, Kisaran : 06237014362, Tanjung balai : 081263495563, Labura : 081370590972, Labuhan batu : 082365222011, Sibolga: 081376252569 Taput : 081263243034 Depkes:P-IRT:812.3205.01.114

tap Ketua KPU 3. Tulangbawang Pemberhentian tetap Ketua, anggota, sekretaris KPU 4. Aceh Tenggara Pemberhentiantetap Ketuadan3anggota KIP 5. DKIJakarta Pemberhentian tetap Ketua panwaslukada 6. DKIJakarta Tegurantertulis Ketua KPU 7. Pati,Jatim Peringatankeras Ketua dan 1 anggota KPU 8. Timor Tengah Utara, NTT Peringatan keras Ketua dan anggota KPU 9. SulawesiTenggara Ditolak/ direhabilitasi Anggota panwaslu 10. Lampung Barat Ditolak/ direhabilitasi Ketua KPU 11. Kota Batu Ditolak/direhabilitasi Ketua dan anggota KPU 12. Banggai Kepulauan Ditolak/direhabilitasi Ketua KPU 13. Talaud Penetapan pencabutan Ketua KPU Sumber: Diolah dari informasi DKPP BarangLangka Ternyata selain satwa langka, konon etika juga perlu mendapat ’’suaka’’. Sebab, selain tergolong ’’barang’’ yang harus dilindungi, juga sulit ditemui di ranah politik, hukum, ekonomi, sosial, dan lainnya. Politik seakan berjalan tanpa arah.Sementarahukummakinliar dengan segala keputusan yang serbaabsurd.Ekonomipunmakin termehek-mehek dengan segala modusuntukmemiskinkanrakyat, sedangkan kehidupan sosial makin compang-camping dengan segala stigma yang negatif. Pendek kata, etika dari semua lini makin termarjinalisasi karena terdesak oleh hiruk-pikuk kekuasaan dan hedonisme para politisi. Secara faktual, etika sudah lama ditinggalkan dan tidak menjadi tuntunan bagi para aktor politik dan politisi kita. Jika diukur, syahwat politik jauh meninggalkan norma-norma etika untuk mengejar kekuasaan. Mereka seakan tenggelam dengan strategi pemenangan agar segera duduk di kursi kekuasaan. Baik pada legislatif

maupun eksekutif. Akan halnya dengan penyelenggara pemilu, sejatinya setali tiga uang: larut dalam praktik kolusi, terkooptasi, nepotisme, dan nyaman dalam suasanapolitikpragmatismebersama lakon para politisi busuk. Etika,menurutparaahli,sesungguhnya tidak lain adalah aturan perilaku, adat kebiasaan manusia dalam pergaulan antarsesama untuk menegaskan mana yang benardanmanayangsalah.Secara khusus, dikaitkan dengan seni pergaulan manusia, etika ini dijelaskandalambentukaturan(code) tertulis yang secara sistematik sengaja dibuat berdasarkan prinsipprinsip moral, dan pada saat dibutuhkan bisa difungsikan untuk menghakimi segala macam tindakan yang secara logikarasional umum (common sense) dinilai menyimpang dari kode etik. Jadi,etikaadalahrefleksidariapa yang disebut dengan ’’self control’’. Sebab, segala sesuatunya dibuat dan diterapkan dari dan untuk kepentingan profesi itu. Oleh karenanya,sebuahprofesidapatmemperoleh kepercayaan dari masyarakat bilamana dalam diri para elite profesional tersebut ada kesadaran kuat untuk mengindahkan etikaprofesipadasaatmerekaingin memberikan jasa keahlian profesi kepada masyarakat yang memerlukannya. Etikasebagaisistemnilaiberkaitan dengan kebiasaan yang baik, tata cara hidup yang baik. Etika sebagai sistem nilai dipahami sebagai nilai yang dipergunakan sebagai pedoman, petunjuk, arah bagaimana manusia harus bersikap dan berperilaku baik, karena etika tersebut memuat berbagai perintah yang harus dipatuhi serta larangan yang tidak boleh dilanggar. Semoga tidak ada lagi komisioner yang diberhentikan oleh DKPP karena mengabaikan kode etik. (*) Penulis adalah Pemerhati Etika Politik/Dosen FISIP Universitas Muhammadiyah Lampung

KOMISI Pemberantasan Korupsi (KPK) gemar menebar janji. Berulang kali pimpinan KPK berjanji menaikkan status kasus pemberian dana talangan Rp6,7 triliun ke Bank Century ke penyidikan dan menetapkan tersangka. Tim Pengawas Century DPR pun nyaris kehabisan energi mengawasi kasus itu. Berulang kali pula tim pengawas menggelar rapat dengan KPK, tetapi belum ada tanda-tanda KPK segera menetapkan tersangka, minimal anak tangga pertama untuk menguak misteri penyaluran dana ke bank sakit itu. Padahal, Pansus Bank Century DPR pada awal Maret 2010 telah terang benderang merekomendasikan sejumlah nama petinggi negara yang mesti diproses secara hukum karena terindikasi melakukan penyimpangan dalam bailout Century. Ada nama Wakil Presiden Boediono yang kala itu menjabat Gubernur Bank Indonesia. Bank Indonesia (BI) diduga tidak memberikan informasi dan data akurat perihal indikator keuangan Bank Century. Selain Boediono, masih ada sejumlah nama lain dalam gerbong BI yang harus diperiksa. Ada pula nama Sri Mulyani Indrawati yang saat itu menteri keuangan. Direktur Pelaksana Bank Dunia itu terindikasi melakukan penyimpangan karena Bank Century sebenarnya tidak berdampak sistemis. Sri Mulyani kemudian kepada Wakil Presiden Jusuf Kalla mengaku dikibuli BI. Pemberian dana talangan ke Bank Century sungguh misterius. Dana sebesar Rp6,7 triliun bisa dengan mudah mengalir ke bank sakit, tanpa ada pejabat tinggi yang bertanggung jawab. Kalla terang-terangan menyebut bailout Century merupakan operasi senyap. Kini setelah dua tahun berlalu, KPK pun membidik dua pejabat BI, yakni BM dan SF, menjadi tersangka. Kabar itu dibocorkan anggota tim pengawas Century DPR Akbar Faisal (Hanura). Hasil audit investigasi Badan Pemeriksa Keuangan (BPK) menyebutkan BM menerima aliran dana Rp1 miliar yang belakangan diketahui sebagai pinjaman yang akan dikembalikan. SF memberikan disposisi pemberian dana talangan ke Century meski bank itu tidak layak. Bagi Akbar Faisal, jika benar BM dan SF ditetapkan sebagai tersangka, itu bukanlah prestasi KPK. Sejak 2010 Pansus Century telah jelas merekomendasikan sejumlah nama itu diproses secara hukum. Lagi pula BM dan SF bukanlah pejabat paling tinggi dalam hierarki di Bank Indonesia. Karena itu, tidak semestinya hanya mereka yang menjadi korban. Setiap kebijakan selalu melekat dan taat pada hierarki. Karena itu, tanggung jawab pun melekat secara hierarkis. Dalam bahasa serdadu, tidak ada prajurit yang salah; yang salah ialah panglima. Keputusan pengucuran dana talangan Rp6,7 triliun ke Bank Century pasti tidak di tangan BM dan SF. Secara hierarkis, mereka berdua tidak mempunyai kekuasaan yang amat perkasa untuk bisa menetapkan aliran dana sebesar itu. Kebijakan itu merupakan keputusan di puncak hierarki. Karena itu, di mana tanggung jawab Gubernur BI kala itu? Di manakah pula tanggung jawab Dewan Gubernur BI? Kalau menjadi tersangka, tentu BM dan SF hanyalah anak tangga pertama. Bukan anak tangga terakhir. Lalu kapan KPK menetapkan anak tangga berikutnya? Jangan seperti kasus Hambalang yang tertahan di anak tangga pertama. (*)


Hub: Bp. ARI

Telp. 061 - 77064774; HP 0813 7729 4474



21 November 2012

HamiliPacar,Subio DilaporKePolisi SIMALUNGUN-Sungguh malang nasib gadis yang masih tergolong belia ini, sebut saja namanya Bunga (17) warga Nagori Nagasaribu, Kecamatan Silimakuta, Simalungun, dalam kondisinya hamil 4 bulan malah ditinggal pacarnya, Subio (26). Pacarnya yang juga masih sekampung dengannya, tidak mau bertanggungjawab untuk menikahi Bunga. Informasi dihimpun, Selasa (20/11), bahwa antara Bunga dan Subio sudah bertahun menjalin hubungan pacaran. Bahkan Subio pun sudah sering membawa Bunga ke rumahnya. Singkatnya, pada bulan Mei, saat Subio hanya seorang diri di rumahnya, Bunga dipanggil untuk datang ke rumah tersebut. Bunga yang tidak menduga ada niat jahat Subio, dia pun datang seorang diri. Sesampainya di sana, Subio langsung mengajak Bunga melakukan hubungan suami istri yang seharusnya belum pantas mereka lakukan. Beberapa kali diajak, Bunga tetap menolaknya. Meski ajakannya terus ditolak, ternyata tidak membuat Subio berhenti sampai disitu saja. Bujuk rayu Subio yang berjanji akan menikahinya, akhirnya berhasil membuat Bunga bersedia melayani nafsu Subio. “Aku mau melakukan itu karena dia berjanji akan

menikahi aku,” terang Bunga saat diperiksa di Polres Simalungun. Bahkan hubungan suami istri yang seharusnya belum layak mereka lakukan sudah terjadi di rumah Subio. Namun setelah diketahui Bunga tengah hamil 4 bulan, Subio malah tidak mau bertanggungjawab. Berkali-kali Bunga meminta pertanggungjawaban dari Subio agar dia dinikahi, Subio mengelak dan mengatakan tidak mau menikah Bunga. Jawaban yang dilontarkan Subio, pun membuat Bunga geram, lantas menceritakan kehamilannya itu kepada orangtuanya. Setelah mengetahui Bunga hamil, orangtua Bunga mendatangi Subio meminta pertanggungjawaban atas kehamilan Bunga. Saat itu pun, orangtua Bunga mendapata jawaban yang tidak memuaskan. Subio tidak mau menikahi Bunga, namun tanpa memberikan alasan yang jelas. Kesal bercampur malu, saat itu juga, Bunga bersama orangtuanya langsung membuat laporan pengaduan ke Polres Simalungun. Kapolres Simalungun, AKBP M Agus Fajar SIK saat dikonfirmasi melalui Kabag Humas, AKP H Panggabaen SH membenarkan telah menerima laporan pengaduan dari korban pencabulan warga Nagori Nagasaribu dengan tersangka Subio. (osi)

Duda Cabuli Siswi SMA SIMALUNGUN-Dengan bujuk rayu janji akan menikahi, Suyadi (36) duda anak 2 ini berhasil merenggut keperawanan Melati (16) siswi kelas 2 SMA warga Jalan Bah Kapul, Kelurahan Sigulang-gulang, Kecamatan Siantar Martoba. Namun setelah 6 kali melakukan hubungan suami istri, Suyadi malah lepas tanggungjawab.

„ Melati saat dimintai keterangan di ruang PPA Polres Simalungun.

Foto:Tonggo Sibarani

WARUNGKOPIDIGASAKMALING SIMALUNGUN-Warung kopi milik Julonggo br Naibaho (45) di Simpang Laut Simbah, Jalan Ulakma Sinaga, Nagori Rambung Merah, Kecamatan Siantar, digasak maling, Selasa (20/11) pukul 03.00 WIB. Akibatnya warung milik orangtua anggota Brimob Ipda Daniel Arta Sasta Tambunan ini mengalami kerugian Rp5 juta. Julonggo br Naibaho mengaku, kedai kopi itu sudah berdiri sejak

sebelas tahun silam lalu disewakan kepada Simaremare, Pangulu disana. Dan Bulan Mei kemarin, setelah habis kontrak, korban memilih membuka usaha sendiri. Setelah warung kopi diusahai Julonggo, dia merubah sedikit tampilan bangunan serta memperluas lokasi karena mau dijadikan tempat nonton bola bareng. Setelah selesai, dia membeli televisi ukuran 42 inci seharga Rp5 juta, untuk ditaruh dalam kedai. Sekitar Juli kemarin, warung kopi milik Julonggo nyaris kebongkaran. Dimana pagi hari, saat karyawannya ingin membuka pintu warung, terlihat bekas congkelan benda keras tepat di bagian engsel gembok. Diduga pencuri mengalami kesulitan, lalu mereka pergi tanpa membawa hasil apapun. Saat kejadian itu korban mulai resah, dan menganggap lingkungan sekitar rumah dan warung kopi sudah tidak aman lagi. Alhasil pintu kedai bagian samping depan, selain di gembok dari luar, korban juga membuat palang besi dari bagian dalam, untuk menjaga keamanan. Usai berjualan, kedai tidak ada yang menjaga. Dua orang karyawannya, Risma br Siagian (20) dan Rosmaida br Siagian (25) kakak beradik, tinggal bersama Julonggo dirumah yang hanya berjarak sekitar 20 meter dari warung. Memang lagi apes, Selasa (20/ 11) pukul 03.00 WIB, salah seorang tetangga korban yang bekerja di sebuah perusaahan coca cola, melihat pagi itu pintu kedai samping bagian belakang dalam keadaan terbuka. Dia mengira, pintu tersebut sengaja dibuka oleh pemiliknya. Setelah dicek ternyata tidak ada orang, pemuda yang baru saja

pulang bekerja itu langsung memberitahu kepada pemilik kedai bahwasannya pintu kedai kopi miliknya sudah terbuka. Mendapat kabar, Jolunggo selaku pemilik warung sontak terkejut dan langsung mengecek bersama kedua karyawan yang tinggal bersamanya. Setelah dicek, ternyata televisi berukuran 45 inci sudah tidak lagi berada di tempatnya. Untungnya, uang beserta rokok yang ditaruh dalam steling dibawa masuk dalam rumah, sehingga pelaku pencurian yang telihat bekas mengacak steling tidak menemukan apa-apa. Atas kejadian tersebut, Jolunggo mencoba memberitahu kepada putranya Ipda Daniel Arta Sasta Tambunan yang kebutalan dinas di Kelapa Dua Depok, Jakarta. Saran perwira kepada ibunya, agar membuat laporan resmi kepada pihak kepolisian di wilayah hukum tersebut. Selasa (20/11) pukul 10.00 WIB, Julonggo mendatangi Polsek Bangun guna membuat laporan kehilanga atas kasus pembongkaran warung kopi. Mendapat laporan itu, tiga personil Polsek Bangun terjun ke lokasi guna melakukan olah tempat kejadian perkara (TKP). Rosmaida, penjaga warung menyebutkan, malam sebelum kejadian, warung terlihat sepi, sehingga warung tutup lebih awal dari biasanya. Biasanya tutup sekira pukul 23.00 WIB sampai 24.00 WIB, malam itu warung tutup pukul 22.00 WIB. Kapolsek Bangun AKP Hitler Sihombing membenarkan adanya laporan kasus pencurian tersebut, untuk saat ini pihaknya sedang melakukan penyelidikan lebih lanjut. (eko/osi)

Melati yang tidak berterima atas perbuatan pacarnya itu, akhirnya Melati memberanikan diri bercerita kepada orangtuanya atas apa yang dialaminya. Mendengar cerita Melati, orangtuanya pun langsung mendatangi Suyadi ke rumahnya di Jalan Sutomo, Kampung Jawa, Pematang Raya, Simalungun meminta pertanggungjawaban. Saat diminta bertanggungjawab atas perbuatannya, Suyadi malah menolak tidak mau menikahi Melati. Setelah mendengar jawaban dari Suyadi itu, orangtua Melati langsung berbalik pulang dan menuju Polres Simalungun membuat laporan pengaduan. Saat pemeriksaan, Melati mengatakan bahwa Suyadi mengajaknya melakukan hubungan suami istri di rumahnya dengan janji akan dinikahi. Selama 6 kali melakukan hubungan terlarang itu, semuanya berlokasi di rumah Suyadi. Anak kelima dari 7 bersaudara ini menceritakan, perkenalan pertama kalinya dengan Suyadi melalui telepon seluler (HP). Dimana, seorang temannya bernama Rendi Tampubolon selaku kernek mobil angkutan umum memberikan nomor HPnya kepada Suyadi. Setelah ada komunikasi melalui HP, Suyadi pun menghubungi Melati dan mengajak untuk bertemu di Jalan Sisingamangaraja tepatnya di depan salah satu rumah ibadah. “Setelah kami bertemu pertama kali bulan Juni lalu, dia mengajak saya ke Siantar Plaza, untuk membeli jajanan. Sepulang dari Siantar Plaza, kemudian dia mengajak saya ke

Rajawali untuk makan malam. Usai makan malam, dia beranjak pulang ke raya,” terang Bunga. Menurut Bunga, setelah pertemuan pertama itu, dua hari kemudian Suyadi kembali menghubungginya dan untuk ketemu ditempat yang sama. Saat itu, Suyadi datang dengan menumpangi sepedamotor. Dengan sepedamotor itu, mereka berboncengan keliling pusat Kota Siantar. “Kami keliling Kota Siantar sampai larut malam. Karena sudah malam, saya takut pulang ke rumah. Lalu dia mengajak saya ke rumahnya di Pematang Raya. Setiba di rumahnya sekitar pukul 22.00 WIB, dia menyuruh saya supaya tidur. Tepatnya jam 24.30 WIB, dia membangunkan saya dan mengajak ke salah satu kios di samping rumahnya. Dikios itulah terjadi pertama kali hubungan suami istri itu,”paparnya. Bukan hanya sekali itu, sambung Melati, selama 6 kali melakukan hubungan intim, dia berjanji akan bertanggungjawab. “Sewaktu melakukan hubungan itu, dia berjanji akan menikahi saya. Tapi, saat ditanya keluarga saya dia mengelak dan tidak mau bertanggungjawab,”kesalnya. Kapolres Simalungun AKBP M Agus Fajar SIK saat dikonfirmasi melalui Kabag Humas AKP H Panggabean SH mengatakan telah memeriksa 3 orang saksi. Setelah pemeriksaan saksi dan berkasnya dinyatakan lengkap, kasus tersebut segera dilimpahkan ke Kejaksaan Simalungun untuk diproses lebih lanjut. (osi)

PetaniNyambiJurtulTogel SIANTAR – Mesron Siahaan (48) warga Jalan Manunggal Karya, Kelurahan Pematang Marihat, Kecamatan Siantar, diciduk dari salah satu warung di seputaran rumahnya. Pria yang sehari-harinya bertani padi ini ditangkap tangan sedang menulis angka tebakan togel, Senin (19/11) pukul 15.00 WIB. Informasi dihimpun, bahwa Mesron merupakan target operasional sat reskrim Polres Siantar. Sebab masyarakat di sana sudah sangat resah, akibat perbuatan Mesron yang setiap hari menulis angka tebakan jenis togel dan KIM. Untuk menangkap Mesron, polisi menyaruh sebagai pem-

beli togel. Saat Mesron mengeluarkan kertas dan pulpen untuk menulis angka tebakan polisi yang sedang menyaruh, polisi langsung menangkapnya. Ketika digeledah, dari kantong Mesron diamankan 2 unit Handphone berisi angka tebakan, serta uang ratusan ribu rupiah hasil penjualan togel. Kapolres Siantar AKBP Albert TB Sianipar SIK ketika dikonfirmasi melalui Kasat Reskrim AKP Daniel Marunduri mengatakan bahwa Mesron dan barang bukti 2 unit Handphone dan uang ratusan ribu rupiah telah diamankan. Saat ini Mesron masih dimintai keterangan untuk dilakukan pengembangan. (mag-05/osi)


21 November 2012

Menakertrans Minta TKI di Malaysia Mogok Kerja JAKARTA Menakertrans Muhaimin Iskandar mendorong seluruh TKI di Malaysia untuk mogok kerja.


Tewaskan 112 Warga GAZA - Korban jiwa terus bertambah akibat serangan-serangan Israel di wilayah Jalur Gaza. Tiga warga Palestina tewas dalam dua serangan terpisah di Gaza pada Selasa pagi tadi waktu setempat. Sejak hari pertama serangan Israel hingga hari ke 10 sudah 112 warga Palestina yang menjadi korban. ”Dua warga negara menjadi martir dalam dua serangan di daerah Mughraqa, di bagian selatan Gaza City, dan yang ketiga tewas di Beit Lahiya,” kata juru bicara dinas ambulans Palestina, Adham Abu Selmiya seperti dilansir kantor berita AFP, Selasa (20/11). Dengan tiga korban jiwa tersebut berarti sejauh ini sudah 112 orang yang tewas akibat serangan-serangan Israel di Gaza dalam sepekan terakhir. Sementara jumlah korban luka-luka mencapai lebih dari 920 orang. Menurut militer Israel, mereka telah menyerang sekitar 100 target di wilayah Jalur Gaza sepanjang Senin, 19 November malam dengan menggunakan pesawat, kapal-kapal perang dan artileri. Dinas emergensi Palestina menyatakan, serangan-serangan itu menimbulkan kerusakan parah pada gedung National Islamic Bank di Gaza City milik Hamas. ”Sebuah institusi keuangan yang digunakan Hamas untuk memotori aktivitas terornya, ditargetkan di bagian utara Jalur Gaza,” demikian statemen militer Israel. Serangan-serangan Israel itu juga mengenai rumah-rumah sejumlah pemimpin pejuang Palestina, termasuk Raed Aatar, komandan senior sayap bersenjata Hamas, Brigade Ezzedine al-Qassam. Selain itu, kediaman Abu Anza, pejabat Qassam di Khan Yunis serta kantor-kantor Jihad Islam juga tak luput dari gempuran Israel. (dtc/int)

Staf Keamanan Kedubes AS di Tel Aviv

DISERANG ISRAEL- Para petugas keamanan Kedutaan Besar Amerika Serikat di Tel Aviv, Israel, melepaskan tembakan pada seorang pria yang menyerang mereka dengan sebilah pisau dan kapak, kata juru bicara kepolisian Israel, Selasa (20/11). ”Tersangka tiba di Kedubes AS pada pukul 11.00 dengan sebuah pisau dan kapak lalu menyerang seorang petugas keamanan,” kata Luba Samri, juru bicara kepolisian. Menurut Samri, petugas tersebut terluka di kaki. “Petugas keamanan lainnya menembak pelaku,” jelasnya. ”Pelaku itu tidak terluka,” ujar Samri, yang menambahkan bahwa si penyerang yang telah ditangkap “bukan orang Arab.” Samri tidak memberi penjelasan lebih lanjut tentang identitas pelaku, kecuali mengungkap bahwa dia berasal dari kota Bat Yam, yang terletak di selatan Tel Aviv. Tidak ada keterangan apakah insiden itu terkait dengan serangan Israel terhadap Jalur Gaza. (dtc/int)


„ Dirut PT Merpati Nusantara Airlines (MNA) Rudy Setyopurnomo, usai dimintai keterangan oleh Badan Kehormatan (BK) DPR RI, Selasa (21/11) di Gedung Parlemen di Jakarta.

Diperiksa, Dirut PT PAL Akui Oknum Anggota DPR Memeras JAKARTA – Tidak sampai satu jam Direktur PT PAL Firmansyah Arifin keluar dari ruang Badan Kehormatan DPR pada Selasa (20/11) siang ini. Ia lalu berjalan keluar dengan dikelilingi para stafnya yang berusaha menjauhi pimpinannya itu dari sorot kamera wartawan. Tidak satu pun kata yang keluar dari mulut Firmansyah kendati puluhan wartawan menghujaninya dengan berbagai macam pertanyaan. Firmansyah merupakan salah satu direksi yang dipanggil Badan Kehormatan hari ini terkait kasus dugaan pemerasan anggota dewan terhadap BUMN. Firmansyah langsung bergegas menuruni tangga dan berjalan cepat hingga mencapai lobi. Sambil menunggu mobilnya, mulut Firmansyah masih terkunci rapat. Setelah didesak terus-menerus, Firmansyah akhirnya mau buka mulut juga. Secara tidak langsung, Firmansyah membenarkan adanya upaya pemerasan yang dilakukan anggota DPR. Namun, ia enggan menyebutkan modus dan nilai yang diminta anggota dewan itu. Ia menyatakan hanya ada satu orang anggota dewan yang berupaya memerasnya. “Yang saya tahu hanya satu orang. Kalian sudah tahulah. Ini terkait penyertaan modal negara (PMN), kan kalian juga sudah tahu. Saya sudah bicara semua di sana (Badan Kehormatan),” kata Firmansyah lagi. Sikap menghindar Firmanysah ini jauh berbeda dengan sikap Dirut PT Garam Yulian Lintang yang menjelaskan secara terbuka modus yang dilakukan anggota dewan. Hal yang sama juga dilakukan Dirut PT Merpati Rudy Setyopurnomo. Kendati bersikap tertutup, Ketua Badan Kehormatan M Prakosa menyatakan tidak menemui kendala dalam meminta konfirmasi dari seluruh direksi yang hadir. “Yang jelas kami sudah temukan ada pertemuan-pertemuan lebih dari dua kali yang dilakukan di luar kantor DPR yang patut dicurigai,” ucap Prakosa. BK DPR: Ada Indikasi Pemerasan BUMN Badan Kehormatan DPR telah mengklarifikasi Dirut PT Merpati Nusantara Airlines, PT Garam, dan PT PAL hari ini. BK DPR mengambil sejumlah kesimpulan, adanya indikasi pelanggaran kode etik yang dilakukan anggota dewan terkait permintaan jatah kepada BUMN. ”Sanksinya bisa berat, bisa sedang, kalau yang berat bisa diberhentikan sementara, bisa diberhentikan tetap. Kalau dianggap sedang, ya bisa dicopot dari alat ke-

lengkapan. Itu tergantung proses konfrontasinya besok,” kata Ketua BK DPR, M Prakosa, kepada wartawan usai mengklarifikasi 3 Dirut BUMN, di Gedung DPR, Senayan, Jakarta, Selasa (20/11). Menurut Prakosa, para direksi BUMN memang tak memberikan bukti yang autentik. Namun BK DPR melihat adanya indikasi pelanggaran kode etik oleh sejumlah anggota DPR. ”Kalau di dalam etika ini kan tidak dibutuhkan bukti autentik. Kalau ini kan pelanggaran etika, ini tidak dibutuhkan bukti autentik hukum, tapi pertemuan berkalikali dengan direksi BUMN ini kan kita menengarai pelanggaran,” ungkap Prakosa. Anggota DPR, lanjut Prakosa, seharusnya tak menemui direksi BUMN selain dalam rapat resmi. Prakosa akan menggunakan bukti SMS dari anggota DPR ke Dirut BUMN terkait ajakan pertemuan-pertemuan ini. ”Seorang anggota dewan bertemu rekan kerja di suatu tempat itu yang patut diduga ada sesuatu di luar kewajaran. Mungkin SMS-nya masih bisa dicari. Itu saja sudah ada indikasi pelanggaran kode etik, lebih dari dua kali itu membicarakan apanya, itu kan patut diduga,” katanya. Karena itu pemeriksaan anggota DPR yang disinyalir memeras BUMN dikonfrontir dengan para Direksi BUMN Rabu (21/11) besok menjadi sangat penting. “Kalau menyangkal, tetap kita konfrontir, patut diduga, mungkin pelanggaran ringan, itu ditetapkan adanya indikasi pelanggaran,” tegasnya. Sebelumnya diberitakan Dirut PT PAL dan Dirut PT Garam menambahkan dua nama anggota DPR pemeras BUMN. Sementara di depan BK, Dirut PT Merpati Nusantara Alirlines (MNA) menjelaskan dua nama yang dicabut Dahlan Iskan dari laporannya ke BK DPR yakni Andi Timo Pangerang (FPD) dan M Ikhlas El Qudsi (PAN) lantaran tidak hadir di rapat tentang Penyertaan Modal Negara (PMN) pada 1 Oktober 2012 lalu. Dalam rapat inilah sejumlah anggota DPR meminta jatah ke Direksi BUMN. BK DPR pun berencana memeriksa semua anggota DPR yang telah dilaporkan Dahlan dan direksi-direksi BUMN ini ke BK. Rencananya para anggota DPR akan dikonfrontir dengan Direksi BUMN tersebut esok Rabu selepas pukul 12.00 WIB, saat ini BK sedang menyusun undangannya. (dtc/int)


14 Tewas Terinjak-injak INDIA- Sedikitnya 14 orang tewas dan banyak lainnya cedera, Senin (19/11) waktu setempat, terinjak-injak saat sebuah jembatan runtuh selama festival Hindu di Kota Patna, India. Korban, yang banyak di antaranya adalah wanita dan anak-anak, datang ke tepi Sungai Gangga di Bihar untuk mengikuti Chhath, festival terbesar Hindu di negara bagian di India timur itu. Polisi mengatakan sejumlah orang masih belum diketahui nasibnya. ”Kami sejauh ini mengidentifikasi 14 mayat dan kami khawatir jumlah korban akan meningkat,” kata seorang pejabat kepolisian kepada wartawan. Ia mengatakan, kekacauan berdesakan terjadi akibat runtuhnya sebuah jembatan bambu yang dibuat di pinggiran sungai itu. Umat Hindu berkumpul di sungai itu untuk berdoa bagi matahari yang terbenam. Korban-korban cedera, yang beberapa di antaranya dalam kondisi kritis dibawa ke rumah sakit di Patna. (dtc/int)


„ Pimpinan KPK Abraham Samad mengaku pihaknya sudah melayangkan surat permohonan perpanjangan masa tugas 7 penyidik ke Polri.

”Moratorium pengiriman TKI ke Malaysia dulu sudah berhasil membuat Malaysia tunduk dan menandatangani seluruh aturan baru. Namun jalur-jalur ke Malaysia begitu mudah sehingga begitu banyak saudara kita di Malaysia lebih dari 1,2 juta warga Indonesia tinggal dan bekerja di Malaysia,” kata Muhaimin dalam paparan terkait perlindungan TKI di Malaysia di Komisi IX DPR, Senayan, Jakarta, Selasa (20/11). Menurut Muhaimin, harus ada langkah konkret untuk membuat Malaysia menghormati jasa-jasa TKI. Kalau perlu, TKI menggelar demonstrasi besar-besaran. ”Mungkin bila perlu kita menyerukan warga kita di Malaysia bersatupadu satu komando agar kita dihargai. Kalau perlu satu hari mogok kerja untuk menghormati saudara kita yang menjadi korban pelanggaran, yang menyangkut hubungan kerja maupun peristiwa kriminal di luar hubungan kerja,” kata Muhaimin. Muhaimin lantas memaparkan persoalan-persoalan TKI akhir-akhir ini. Muhaimin men-

„ Menakertrans Muhaimin Iskandar dalam temu pers meminta kepada seluruh TKI di Malaysia untuk mogok kerja.

474 Pejabat Daerah Terlibat Kasus Korupsi JAKARTA - Ternyata banyak pejabat daerah di seluruh Indonesia yang terlibat kasus hukum yakni kasus dugaan korupsi. Menteri Dalam Negeri Gamawan Fauzi menyebutkan ada 474 pejabat daerah yang terlibat kasus hukum. ”474 Pejabat daerah yang terlibat hukum. Tersangka 96, terdakwa 49, dan terpidana 330,” ujar Gamawan. Hal itu dikatakan dalam diskusi bertema ‘Menegaskan Pemberantasan Korupsi: Larangan Menjabat bagi Mantan Terpidana Korupsi’ di Kemenkum HAM, Jalan HR Rasuna Said, Jakarta, Selasa (20/11). Menurut Gamawan, angka tersebut dapat terus bertambah. Senin (26/11) pekan depan seluruh Sekretaris Daerah di Indonesia akan dipanggil untuk melaporkan perkembangannya. ”Saya Senin panggil seluruh sekda untuk melaporkan,” katanya. Gamawan juga bercerita soal kasus terpidana korupsi Rp 20 miliar, Gubernur Bengkulu

KPK Ajukan Permohonan Perpanjangan Masa Tugas 7 Penyidik Polri JAKARTA- Komisi Pemberantasan Korupsi (KPK) mengajukan permohonan perpanjangan tujuh penyidik Polri yang habis masa tugas di komisi tersebut. Namun, hingga saat ini, Polri belum memutuskan akan memperpanjang ketujuh penyidik tersebut atau tidak. ”Biasanya habis dulu (masa tugasnya), nanti baru ada jawaban,” ujar

Kepala Biro Penerangan Masyarakat Divisi Humas Polri Brigjen Boy Rafli Amar di Mabes Polri, Selasa (20/11). Menurut dia, Bagian Sumber Daya Manusia Polri tengah menggodok hal tersebut. “Sedang dalam penyiapan staf SDM Polri,” kata dia. Sebelumnya, ada 14 penyidik Polri yang habis masa tugas di KPK. Enam di antaranya penyidik yang telah dia-

lihstatuskan KPK menjadi pegawai tetapnya. Satu orang atas keinginan pribadi memilih tidak memperpanjang tugasnya di KPK. Tujuh penyidik lagi belum jelas status masa tugas mereka. KPK menginginkan agar masa tugas ketujuh penyidik itu diperpanjang. Keinginan itu telah disampaikan melalui surat ke Polri. (dtc/int)

gaku prihatin menyangkut kasus penembakan, pemerkosaan, hingga pemutusan hubungan kerja sepihak TKI. Muhaimin menilai pemerintah Malaysia telah melanggar MoU yang disepakati dengan Indonesia. ”Ada pemerkosaan oleh tiga polisi Malaysia yang diproses dan kita terus melakukan pendampingan hukum melalui lawyer tepatnya yang ada di KBRI kita. Kasus lain ada TKI on sale, ada cara-cara tidak manusiawi dalam memasukkan TKI. Ini sudah melanggar MoU,” katanya. Dalam kesempatan ini Muhaimin juga menyampaikan banyak masukan terkait RUU tengan Perlindungan Tenaga Kerja Indonesia di luar negeri. Menurut Muhaimin, pemerintah terus berupaya memperluas komunikasi dengan sejumlah negara yang menjadi sasaran penempatan TKI. ”Kita juga memperhatikan perlindungan TKI di Trinidad. 163 pelaut Indonesia pernah terdampar di sana. Penanganan selama ini sudah kita pulangkan, namun masih ada proses terus untuk kita pulangkan semuanya. Perlu kita perhatikan karena di sana mayoritas pelaut, atase kita di sana tidak ada, saya juga tidak tahu di mana Trinidad tapi kita terus berusaha apa yang bisa dilakukan,” tegasnya. (dtc/int)

„ Gamawan Fauzi

Agusrin Najamudin yang menggugat Pemerintah ke Pengadilan Tata Usaha Negara (PTUN) Jakarta, terkait penerbitan Keputusan Presiden tentang pemberhentian tetap dirinya sebagai Gubernur Bengkulu, pasca-putusan kasasi Mahkamah Agung (MA). Agusrin juga menggugat Keputusan Presiden tentang pengangkatan Gubernur definitif Bengkulu yang menggantikannya. Alasan gugatan adalah perkara korupsi yang menjeratnya kini sedang dalam proses PK ”Itu kan sudah incracht (tingkat pertama), sehingga dapat diberhentikan. Saya usul ke Presiden diberhentikan dan ditandatangani oleh Presiden. Saat hari akan dilantik penggantinya, sudah ada kue, bunga, tamu sudah datang. Pukul 09.00 WIB saya fax ke sana, pelantikan ditunda karena ada putusan sela di PTUN. Saya tanya saya harus patuh itu atau UU? Kementerian sering menghadapi kasus seperti ini,” ungkap Gamawan. (dtc/int)


21 November 2012

Curi HP, Warga Gunungtua Ditembak

Polisi Nyaris Dimassa Sambungan Halaman 1 sepedamotor di wilayah Taput. Kapolsek Adiankoting AKP Viktor Simanjuntak kepada METRO, Selasa (20/11) di Mapolres Taput mengatakan, selain IC, dua rekannya terlebih dahulu dibekuk polisi. Adalah ABD (27) dan EP (27), keduanya warga Sibolga. “Tersangka mengaku baru sekali mencuri. Namun, kita tetap melakukan penyelidikan untuk mengungkap kebenarannya,” ujar Viktor Simanjuntak. Dikatakan, terkuaknya kasus ini berkat pengaduan salah seorang warga yang kehilangan satu unit kreta Supra X 125 BK 4223 AAG milik Joni Panggabean, Minggu (18/11) malam. Ironisnya, sehari sebelum para tersangka ditangkap, ketiganya baru saja beraksi di Desa Sibalangan, Kecamatan Adiankoting, Kabupaten Tapanuli Utara, Senin (19/11). “Penangkapan ini dilakukan setelah Polsek Adiankoting menyelidiki kasus hilangnya kreta Supra X 125 dengan nomor polisi BK 4223 AAG milik Joni Panggabean yang hilang Minggu (18/ 11) malam,” ujarnya. Didampingi Kasubag Humas Polres Taput Aipda W Baringbing, Viktor menjelaskan, dari hasil penelusuran, petugas mencurigai tersangka lari menuju Sibolga dan langsung memburunya. Tepatnya di Desa Sitahuis, Tapteng perbatasan Sibolga-Adiankoting, masyarakat menggelar razia. “Saat itu, warga Sitahuis menggelar razia karena sering kehilangan ternak dari daerah itu. Mereka curiga kepada ABD dan EP, lalu menginterogasi keduanya. Kemudian warga menghubungi polisi. Sedangkan tersangka IC berhasil lari dengan sepedamotor hasil curian tersebut. ABD dan EP, saat itu juga langsung kita bawa ke kantor polisi untuk penyelidikan lebih lanjut,” ungkapnya. Kepada polisi, ABD dan EP mengaku baru saja mencuri kreta. Namun, kreta tersebut dibawa lari oleh IC. Berdasarkan keterangan kedua tersangka, petugas langsung melacak keberadaan IC di rumahnya. Ternyata benar, Selasa (20/11) subuh sekitar pukul 05.00 WIB, petugas berhasil menangkap dari rumahnya di Kampung Batak Sibolga. Hanya saja, saat penangkapan, petugas nyaris dimassa wargga karena diteriaki IC sebagai perampok. “Saat penangkapan IC, kita diteriaki rampok oleh IC dan melakukan perlawanan. Mendengar itu, warga setempat datang berduyun duyun. Beruntung kita cepat menunjukkan identitas, kalau tidak, kita bisa saja jadi korban amukan massa,” terangnya. Berdasarkan hasil pemeriksaan, tersangka menyimpan sepedamotor hasil curian tersebut di rumah temannya di Sibolga Kota. “Spedamotor curian itu kita sita dari salahsatu rumah teman tersangka,” ujarnya. Disela-sela pemeriksaan polisi, tersangka mengaku mencuri sepedamotor dengan menggunakan kunci palsu. “Kami mencurinya pakai kunci palsu. Rencananya, hasil curian ini akan kami bagi rata,” terang IC kepada METRO. Ditanya sudah berapa kali menjalankan aksi serupa, IC mengaku baru sekali. “Baru sekali bang. Rencananya, sepedamotor itu akan kami jual dan hasil penjualan dibagi rata,” akunya. IC juga mengaku, melakoni pekerjaan itu berkat ajakan teman-temanya. “Ada sejumlah pemuda yang selama ini menjalankan kegiatan yang sama. Tetapi saya tidak tahu nama mereka,” ucapnya singkat. Untuk mempertanggungjawakan perbuatannya, para tersangka kini ditahan di sel tahanan Mapolres Taput. Mereka akan dijerat Pasal 363 ke3e KUHPidana dengan ancamana maksimal 7 tahun penjara. (cr-01/des)

Mari Bergandeng Tangan dengan Nilai-nilai Islam Sambungan Halaman 1

Sambungan Halaman 1

dansedangmengambilhandphoneNokiaC3yang diletakkandikamar. SelanjutnyaHjAnisaberteriakmaling,sehingga mengejutkankeduapelakudanlangsungmelompat dari lantai dua ke halaman rumah. Sementara di depan rumah, telah menunggu mobil yang telah dinyalakandankeduapriabersamamobillangsung tancapgas. WargayangmendengarteriakanHjAnisalangsung mendatangirumahkorban,selangbeberapamenit duapengendarasepedamotorjenisSupratanpaplat

Sambungan Halaman 1 “PelaranganterhadapPNSitu,dalam rangka upaya pencegahan terjadinya pelanggaran Pemilu pada Pemilihan UmumKepalaDaerahdanWakilKepala Daerah(PemiluKada),tanpaterkecualidi Pilgubsu2013, khususnyapolitisasiPNS sebelum mulai tahap pendaftaran dan penetapanCalonGubernur(Cagub)dan Wakil Gubernur Sumatera Utara (Wagubsu)2013,”ungkapKetuaPanitia PengawasPemilihanUmum(Panwaslu) ProvinsiSumateraUtara(Provsu),David Susanto,Selasa(20/11). Maka dari itu, sambung David, Panwaslu telah mengeluarkan surat tertanggal 1 November 2012, No:/ PANWASLU-SU/XI/2012, tentang instruksipengawasanterhadapnetralitas PNSdanpejabatdiBUMN/BUMDpada Pilgubsu2013,yangditembuskankepada Panwaslukabupaten/kotase-Sumut. “Panwaslu Kabupaten/Kota SeSumut untuk memperhatikan banyak, pertamadalamUUNo.43/1999tentang perubahan atas UU No.8/1974 tentang pokok-pokok kepegawaian, yang mengaturpasal3,1)ayat(1),dimanaPNS berkedudukan sebagai unsur aparatur negarayangbertugasuntukmemberikan pelayanankepadamasyarakatsecaraprofessional, jujur, adil dan merata dalam penyelenggaraan tugas negara, pemerintahdanpembangunan.Kemudian,2) ayat (2), dalam kedudukan dan tugas sebagaimanadimaksudpadaayat(1),PNS harus netral dari semua pengaruh golongan dan partai politik serta tidak diskriminatif dalam memberikan pelayanan kepadamasyarakat”.Dan3)ayat(3),untuk menjaminnetralitasPNSdilarangmenjadi anggotadan/atauanggotapartaipolitik,” rinciDavid. Lebihlanjut,Davidmenerangkan,pada pasal 26, ayat (2) disebutkan, PNS bersumpah/janji akan senantiasa menjunjung tinggi kehormatan negara, pemerintahdanmartabatPNS,sertaakan senantiasamengutamakankepentingan negara dari pada kepentingan pribadi, seseorangataugolongan. Untuksanksiyangmestinyadiberikan bagiPNSyangtetapbersikukuh,danlarut serta memberi dukungan kepada pasangan calon yang bersaing, disesuaikan dengan pasal 4, angka 15 PeraturanPemerintah(PP) No.53/2010 tentang disiplin PNS, yang mengatur antara lain PNS dilarang memberikan dukungankepadacalonkepaladaerah/ wakilkepaladaerah,dengancara,terlibat dalam kegiatan kampanye untuk

penentuan buat City. “Kami harus menang. Tidak ada pilihan lain. Kami menyadari sangat berisiko, tapi itulah yang terjadi,” kata DavidSilva,gelandangserangCitykepada AS. Meskipeluangnyatipis,Citymenolak menyerah. “Kami hanya harus lebih percayadiri.Kamisemuainginmerasakan sukses di Eropa, bukan hanya (Roberto) Mancini,”lanjutnya. Masalahnya,tantanganCitysungguh berat.Saatmenghadapitekanansebegitu besar, mereka tidak bisa turun dengan pasukanterbaiknya.ManajerCityRoberto Mancinitidakbisamenggunakantenaga GaelClichy,JoleonLescott,JamesMilner, MicahRichards,danJackRodwell. Untungnya, performa City sedang mantap. Setelah kekalahan dari Ajax Amsterdam 1-3 (24/10), mereka tidak pernahtersentuhkekalahan.Dalamlima pertandingan terakhir, tim berjuluk The Citizensitumenangtigakalidanduakali seri. Performa hebat City itulah yang membuat bek Real Sergio Ramos agak heran mengapa mereka terseok-seok di Liga Champions. “Bagi saya agak mengejutkanmerekanyaristersingkirdari LigaChampions,”bilangRamos,seperti dikutipDailyMail.

Koran Kebanggaan Orang Tabagsel

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel ) : : : : : : : : : : : : : : :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Muhiddin Hasibuan Pandapotan MT Siallagan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

mendukungcalon,menggunakanfasilitas yang terkait dengan jabatan dalam kegiatankampanye,membuatkeputusan dan/atautindakanyangmenguntungkan ataumerugikansalahsatupasangancalon selamamasakampanye;dan/atau. Selanjutnya, dilarang mengadakan kegiatan yang mengarah kepada keberpihakanterhadappasangancalon yang menjadi peserta pemilu sebelum, selama, dan sesudah masa kampanye meliputi pertemuan, ajakan, imbauan, seruan, atau pemberian barang kepada PNS dalam lingkungan unit kerjanya, anggotakeluarga,danmasyarakat. HumasPanwasluProvsu,Fakhruddin menambahkan,PNSyangtidakmenaati ketentuan tersebut dijatuhi hukuman disiplin dengan tingkatan hukuman disiplinsebagaiberikut,hukumandisiplin ringan,yakniteguranlisan,tegurantertulis danpernyataantidakpuassecaratertulis. Selanjutnya, lanjut Fakhruddin, hukuman disiplin sedang, yakni penundaaankenaikangajiberkalaselama satu tahun dan penurunan pangkat setingkatlebihrendahselamasatutahun. Danhukumandisiplinberat,yaknipenurunan pangkat setingkat lebih rendah selama tiga tahun, pemindahan dalam rangkapenurunanjabatansetingkatlebih rendah,pembebasandarijabatan,pemberhentian dengan hormat tidak atas permintaansendirisebagaiPNSdanpemberhentiantidakdenganhormatsebagai PNS. “Hukumandisiplinsedangdijatuhkan bagi pelanggaran terhadap larangan memberikan dukungan kepada calon kepala daerah/wakil kepala daerah dengan cara terlibat dalam kegiatan kampanye untuk mendukung calon kepaladaerah/wakilkepaladaerahserta mengadakan kegiatan yang mengarah kepadakeberpihakanterhadappasangan calonyangmenjadipesertaPemilusebelum,selama,dansesudahmasakampanyemeliputipertemuan,ajakan,imbauan, seruan, atau pemberian barang kepada PNS dalam lingkungan unit kerjanya, anggota keluarga, dan masyarakat sebagaimana dimaksud dalam Pasal 4 angka 15 huruf a dan huruf d,” jelas Fakhruddin. Lebih lanjut, Fakhruddin menerangkan,untukhukumandisiplin berat dijatuhkan bagi pelanggaran terhadap larangan antara lain, memberikan dukungan kepada calon kepala daerah/wakil kepala daerah, dengancaramenggunakanfasilitasyang terkait dengan jabatan dalam kegiatan kampanyedan/ataumembuatkeputusan

dan/atautindakanyangmenguntungkan ataumerugikansalahsatupasangancalon selama masa kampanye sebagaimana dimaksuddalamPasal4angka15hurufb danhurufc. Selainitu,tambahFakhruddinlagi,juga dilarangmelakukanpenggunaanfasilitas dan anggaran pemerintah dan pemerintah daerah, yang antara lain penggunaan fasilitas pemerintah dan pemerintah daerah berupa sarana mobilitas sepertikendaraandinasmeliputikendaraanpejabatnegaradankendaraandinas pegawai, serta alat transportasi dinas lainnya. Sama halnya dengan gedung kantor, rumah dinas, rumah jabatan milik pemerintah, milik pemerintah provinsi, milikpemerintahkabupaten/kota,kecuali daerah terpencil yang pelaksanaannya harusdilakukandenganmemperhatikan prinsipkeadilan. Dansaranaperkantoran,radiodaerah dan sandi/telekomunikasi milik pemerintahdaerahprovinsi/kabupaten/kota, danperalatanlainnya,sertabahan-bahan. Hal yang sama juga adalah dilarang menggunakandan/ataumemanfaatkan dana yang bersumber dari keuangan pemerintahdanpemerintahdaerahbaik secaralangsungmaupuntidaklangsung. “Dalam mengawasi netralisasi PNS dalamrangkaPilkada,sertapenggunaan fasilitas dan anggaran pemerntah dan pemerintah daerah tersebut, menggunakan strategi pencegahan pelanggaran yaitu strategi pencegaha pelanggaran administrasi dan pidana dilakukan dengan tindakan, langkahlangkah, dan upaya optimal mencegah secara dini terhadap kemungkinan timbulnyapotensipelanggarandan/atau indikasi awal timbulnya pelanggaran tersebut,”terangnyalagi. Dikemukakan Fakhruddin lagi, PanwasluProvsujugamengimbauatau mengingatkanmelaluisuratresmikepada Bupati/Walikota di wilayah masingmasing,agarmelarangPNSterlibatdalam Pilkada sesuai peraturan perundangundangan, dan melarang PNS menggunakan fasilitas dan anggaran pemerintahdanpemerintahdaerahuntuk kepentingan calon kepala daerah dan wakil kepala daerah. Serta mempublikasikan(konferensipers,press release, red) imbauan dan peringatan tersebutuntukmeresponisuspesifikyang muncul.Mensosialisasikanimbauandan peringatantersebut,secarahirarkiskepada Panwasludiwilayahnyamasing-masing agardipahamidanmendapatperhatian khusus.(ari)

Ambisi Habisi City

METRO TABAGSEL Chairman Komisaris Utama Komisaris Direktur Utama Direktur Pengasuh Pemimpin Umum/Penjab/GM Wakil PU/Pimpinan Perusahaan Wakil Pimpinan Perusahaan Pimred Metro Siantar Pimred Metro Tabagsel Pj. Pimred Metro Tapanuli Pimred Metro Asahan Wapimred Metro Tapanuli Tim Ombudsman

warga.Kepadawarga,Wahidmengakuminyakyang dibawauntukmobilAvanzaB8907HJyangkehabisan minyak. SementaraKapolsekKotapinang,KompolJanner Panjaitanmenjelaskan,setelahmendapatinformasi dariwargapihaknyamelakukanpengembangandi dualokasitempatkejadianperkara,yaknidiSimpang Dusun Padangri Kecamatan Kotapinang hingga DesaSiancimun,KecamatanHolongan,Kabupaten Paluta. “Anggota sempat kejar-kejaran dengan kedua tersangka. Dua tersangka yakni Memet (29) alias BolotwargaKarangSariDesaSabungan,SeiKanan

PNS Bisa Diturunkan Pangkat atau Dipecat

Sambungan Halaman 1

Dalam perayaan itu, Penasehat Himmpada Tabagsel H Ridwan Sigalingging menuturkan, nilainilai Islam dalam kehidupan sehari-hari perlu diterapkan dalam dimensi aneka budaya dan harmonisasi antar agama. “Tahun baru Islam 1434 H yang jatuh pada 15 November kemarin suatu hidayah bagi kita semua dapatbertatapmukahinggahariini.Kedepannilainilai Islam harus kita junjung dengan beragamnya aneka suku dan agama. Mari kita bergandeng tangan demi kemajuan bangsa serta mempertahankan nilai budaya Etnis Pakpak di perantauan. Kita juga ingin menunjukkan eksistensi suku Pakpak sebagai bagian dari sejumlah suku yang ada di Kota Psp dan Tabagsel ini,” ujar H Ridwan didampingi Ketua Umum (Ketum) Himmpada Tabagsel Abdul Gani Lingga, Sekjen Nizamuddin Lingga dan Humas AC Meha. Syukuran memperingati Tahun Baru Islam itu dihadiri puluhan keluarga etnis Pakpak muslim si Lima suak (bagian), berasal dari suak Pakpak Simsim, Boang, Keppas, Pegagan dan Pakpak Kelasen yang berdomisili di wilayah Tabagsel yang diisidenganpembacaanayat-ayatsuciAlqurandan Shalawat kepada Nabi Muhammad SAW. Pada pertemuan itu makanan khas Pakpak berupa nakan pelleng (nasi kuning khas Pakpak) disajikan bersama lauk pauknya ayam jago yang sudah digulai dengan kuahnya berwarna merah cabaipedas(kuahmbaracinasincor)sebagaitanda mempertahankan adat Pakpak dan keberadaan dua tahun berjalan kepengurusan Himmpada Tabagsel. (phn)

mendatangi kerumunan warga dan bertanya apa yangsedangterjadi. Keduanyamembawajerigenberisibensinlimaliter. Hj Anisa mengenali keduanya sebagai pelaku yangbarumencuridarirumahnya,daribajukotakkotakyangdipakaisalahsatupriaitu.Melihatgelagat dicurigai,keduanyalangsungpergi. Curiga,wargalangsungmengejarkeduanyayang melarikan diri menuju Kabupaten Padang Lawas Utara (Paluta). Di perempatan jalan, mobil warga berhasil mencegat sepedamotor, salah satu di antaranyaberhasilmelarikandiri.Sementarasalah satupencuribernamaWahid(30),berhasilditangkap

“City merupakan tim hebat, bukan hanyasekadarsecaraindividu.Tetapi,hal sepertiitumemangtidakmenjaminsukses diLigaChampions.Iniadalahgrupyang berat dan semuanya punya kapasitas untuklolos,”jelasbektimnasSpanyolitu. Berangkat ke Etihad Stadium, Real hanya butuh setidaknya seri untuk bisa lolos, asalkan Borussia Dortmund menangatasAjax.Tetapiitutidakmenjadi alasanuntukbermainaman.“Realtidak pernah bermain bertahan. Itu bukan kebiasaan kami. Kami datang untuk menang,”kataRamos. SenadadenganRamos,gelandangasal JermanSamiKhedirajugamenilaimereka harus menyerang melawan City. “Dortmund menunjukkan cara yang tepat mengalahkan mereka. Bermain kompak,berjuanguntuksetiapbola,dan tetap bertahan pada gaya permainan

sendiri,”katanya. Realpunyabekalbagusuntukpulang dengankemenanganataupalingtidakseri. Entrenador Jose Mourinho hanya kehilangan Gonzalo Higuain dan Marcelo.Keduapemainbisadigantikan dengan baik oleh Karim Benzema dan FabioCoentrao. “Kami harus fokus melawan mereka. Kamiinginsegeramemastikantiketlolos kebabak16besar.Kamiakanmemainkan gayakamidanmenghabisimereka.Tidak boleh membiarkan mereka menekan kami,”ujarKhedira. KalauCitypenasaranloloskebabak16 besar,makaRealmemilikitargetyangjauh lebih besar musim ini. Mereka menginginkan gelar kesepuluh Liga Champions.KaliterakhirRealmenjuarai Liga Champions pada 2001-2002 lalu. (ham)

PERKIRAAN PEMAIN MAN CITY V REAL MADRID Man City (4-4-2) Pemain : 1-Hart (g); 5-Zabaleta, 4-Kompany, 33-Nastasic, 13-Kolarov; 8-Nasri, 42-Y Toure, 18-Barry, 21-Silva; 32-Tevez, 16-Aguero Pelatih: Roberto Mancini Real Madrid (4-2-3-1) Pemain : 1-Casillas (g); 17-Arbeloa, 4-Ramos, 3-Pepe, 5-Coentrao; 6-Khedira, 14-Alonso; 22-Di Maria, 10-Oezil, 7-Ronaldo; 9-Benzema Pelatih : Jose Mourinho Stadion : Etihad Stadium Wasit : Gianluca Rocchi (Italia)

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN

bersama rekannya Parju (22) warga Gunung Tua ditangkapdiDesaSiancimunKecamatanHolongan KabupatenPaluta,”katanya. Dijelaskannya, kedua tersangka sempat mau melarikandiridanmelakukanperlawanan,akhirnya petugas pun melakukan penembakkan kepada keduatersangka. “Adaempattersangka,yangtertangkapadatiga, sedangkan temannya berinisal S masih daftar pencarianorang(DPO).Barangbuktiberupalinggis, handphone, senjata api, senjata mainan mirip mancis, pisau cutter, dan mobil Daihatsu Avanza diamankan,”katanya.(mhr)

Bikin Tas dari Sampah DI TANGAN artis peran Olivia Zalianty, sisa potongan kain batik yang biasanya terbuang begitu saja justru bisa menjadi sebuah benda yangmemilikinilaiekonomis. Yup,sisapotongankainbatikyang takterpakaiolehOliviabisadirancang menjadi sebuah tas modis. “Ini bahannya dari sisa potongan batik yang mungkin selama ini dianggap sampah,” kata Olivia dalam jumpa persPekanProdukKreatifIndonesia (PPKI), di Epicentrum Walk, Kuningan, Jakarta Selatan, belum lamaini. Olivia menganggap ini bisa menjadi peluang usaha bagi masyarakatIndonesia.Dirinyapun sengaja mendatangi sekolahsekolah di daerah terpencil untuk mengajarkan siswa setempat

membuat tas dari sisa kain batik. “Sampai masuk ke pedalaman ngajarinmurid-muriddisana,”kata adik kandung artis peran Marcella Zaliantyini. Oliviamemangtakasalberbicara soal peluang bisnis ini. Buktinya, belum lama ini dia kebanjiran pesanandariluarnegeri.“Beberapa tas kami foto dan posting di sosial media, ternyata banyak yang suka, dan Singapura memesan 700 tas,” ceritaOlivia. Sayangnya, Olivia justru tak bisa meladenipesananitukarenaterbatas sumber daya manusia. “Ini bukan masalahgimanacaramasarin-nya, marketselaluada.Tapiyangenggak adaitutenaganya,tasinikandibuat sama yang benar-benar bisa membuatnya,”kataOlivia.(int)

Pramuka Ditetapkan Jadi Eskul Wajib Sambungan Halaman 1 didorong menjadi eskul wajib di SMA,”paparMenteriPendidikandan Kebudayaan (Mendikbud) MohammadNuhdiJakartakemarin(21/ 11).Sementaradipendidikantinggi, pramukamenjadikegiatanpilihan. MenurutmenteridariSurabayaitu, sangat sayang sekali jika pramuka sampai hilang atau mati dari pendidikan di Indonesia. Sebab dia meyakinijikapramukamemilikibanyak sekali muatan karakter. Mulai dari kepemimpinan, kedisiplinan, kejujuran, gotong royong, dan sejenisnya. Nuh menegaskan, jika menghidupkankembalipramukainitidak berwujud pada menjadikan pramukasebagaisatumatapelajaran. “Jadiinihanyaeskulyangwajib,”ucap mantanMenkominfoitu. Sifatpramukayangakanmenjadi eskul wajib ini diharapkan tidak mengganggupelajaranumum.Nuh mengatakanjikasekolahtidakperlu mempertentangkanantarapelajaran umumdenganeskul.Diameminta antara pelajaran umum dan eskul harus berjalan bareng untuk

kepentingansiswa. Redupnyaaktivitaspramukabarubaruinitidakhanyadisebabkankarena peminatnya sepi. Tetapi juga dipicu urusan pendanaan. Nuh mengatakanpihaksekolahtidakperlu khawatir dengan diwajibkannya pramuka. Dia mengatakan pendanaan eskul pramuka ini bisa menggunakandanaBantuanOperasional Siswa(BOS). Pembiayaaneskulpramukadiantaranya meliputi gaji instruktur dan pengadaanperlengkapanpramuka. Selain itu, Kemendikbud juga akan memintaKementerianPemudadan OlahRaga(Kemenpora)ikutmengalokasikan anggarannya untuk mendanaipramuka.“Sistemsharingnya nanti akan dibahas lintas kementerian,”katadia. Nuh mengingatkan jika menghidupkanlagipramukamelaluieskul wajibinitidakterjebakpadaurusan symbol-simbol saja. Misalnya dengancaramewajibkanlagipenggunaanseragampramukadansebagainya. “Simbol pramuka itu tetap harusada.Tetapiyanglebihpenting adalah internalisasi nilai-nilai pramuka.”(wan/jpnn)

Pelaku Ditangkap, Keluarga Korban Ngamuk Sambungan Halaman 1 Kapolres Labuhanbatu AKPB Hirbak Wahyu Setiawan melalui KasubagHumasAKPMTAritonang menjelaskan,DD priayangmemiliki ciri-cirisepertiyangdituturkanBunga ditangkap polisi bersama keluarga korbansetelahmendatangirumahnya. Informasi dihimpun METRO, pelaku penculikan sekaligus perkosaan terhadap Bunga, sebelumnya pernah ditahan atas tuduhan kasus pelecehan seksual terhadapanakdibawahumur. Keluarga Bunga, setelah mendapatlaporandariBungalangsung menduga bahwa pria yang disebutkan telah dua kali menikah dan memilikitigaoranganakinisebagai pelakunya. Setelah dipastikan, ternyataDDmemangbenarpriayang menculikBunga. Sebelumnya diberitakan, Bunga diculikdantersadardalamkeadaan tubuh telanjang bersama pria bertompeldiwajahnya.Bungabaru pulang sekolah setelah mengikuti ujiantryoutsekiraPukul09.30WIB. Ketika itu, pelaku mendatanginya serta berpesan untuk menyampaikan surat anaknya karena tidak bisahadirkesekolah.Lokasikejadian itusendirihanyaberjaraksekitar500 meterdarisekolahkorban. Merasa tidak kenal dan aneh, Bunga berlari meninggalkan pria tersebut,tetapiBungadikejar,dijegal hingga terjatuh. Kemudian pelaku membekap Bunga dengan saputangan, sehingga Bunga lemas dan

Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Hotland Dolok Saribu Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

pingsan,tersadarsetelah2jamkemudiandandalamkeadaantelanjangdi lokasi yang sepi di Jalan By.Pass Rantauprapat. Pelaku menyuruh Bunga untuk memakai pakaiannya, sebelum diantarkankeJalanAhmadDahlan Rantauprapat. Bunga kemudian melaporkePosLantasyangberada diJalanAhmadDahlan. Mengamuk Mengetahui pelaku penculikan telahditangkap,orangtuaBungadan keluarganyamengamukdiluarruanganunitPPAPolresLabuhanbatu. KL (47) ayah korban, MI (41) ibu korban, Nenek dan Paman korban berteriak-teriakmemakipelakuyang periksadalamruangantertutup. “Saya minta kepada polisi agar menghukum pelaku dengan seberat-beratnya,”kataSR(50),nenek korban. Sementara paman Bunga, JN mengatakan,pihaknyamengetahui pelakutelahditangkaptadi(kemarin) malam. Pelaku merupakan warga sekampungJNdiSimpangMangga. Ciri wajah tompel, mengingatkan dirinya kepada warga sekampungnya setelah mendapat informasidarikeponakannya. “DD memang dikabarkan memiliki kelainan seks, saya ceritakan kepada petugas dan ternyata memang benar sesuai ciri-cirinya,” katanya. Dijelaskan JN, beberapa bulan lalu, pelaku juga pernah dilaporkankepolisidengankejadian yang serupa. Namun, entah mengapapelakudilepaskan.(cr-2)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


21 NOVEMBER 2012

Perbaiki Jalan ke Luat Harangan! Sambungan halaman 8

kiri kanan badan jalan ada jurang. Namun kesungguhan masyarakat untuk mengembangkan tanaman kakao sangat giat, pasalnya sepanjang jalan dipenuhi tanaman kakao yang telah menghasilkan. Namun, melihat kondisi jalan yang begitu parah, sudah sepantasnya pemerintah daerah memprioritaskan pembangunan jalan menuju wilayah tersebut. Kepala Desa Panaungan, Mara Deman

Siregar dan Kepala Desa Pargarutan serta tokoh masyarakat lainnya kepada METRO kemerin mengatakan, banyak hasil bumi dari wilayah itu, namun karena faktor sarana tranportasi yang kurang mendukung, berdampak perekonomi masyarakat. “Karena kurang baiknya sarana transportasi ini, akibat masyarakat kesulitan menjual hasil bumi mereka, akibatnya harganya jauh berkurang. Bahkan, banyak hasil bumi yang tak sempat dipasarkan dan menjadi busuk karena tak ada angkutan.

Anak Punk...

Kami sangat membutuhkan perhatian masyarakat agar jalan ke Luat Larangan segera diperbaiki,” harap mereka. Seorang tokoh masyarakat Desa Paragutan, Muhammad Rohim (50) kepada METRO mengatakan, dengan kondisi jalan yang sebagian besar berupa jalan tanah, membuat masyarakat yang berjumlah 100 KK terpaksa terus mengandalkan kuda sebagai sarana pengangkutan hasil bumi seperti getah karet, kakao, kopi dan hasil hutan lainnya ke pasar.Demikian juga ketika

membawa kebutuhan hidup dari pasar. “Memang ada mobil hartop ke sana, tapi jika hujan tak mungkin bisa ke luar masuk desa. Apalagi pemilik mobil hanya mengangkut barang dagangannnya saja, terpaksalah masyarakat tetap mengandalkan kuda hingga Desa Pangaribuan. Adapun ongkos barang bawaan dengan kuda tergantung berat beban yang dibawa,” katanya. Ditambahkan Muhammad Rohim, jarak Pargarutan-Pangaribuan sepanjang 12 km harus ditempuh selama 3 jam perjalanan,

dan rata rata seekor kuda bisa membawa beban sekitar 60-80 kg dengan ongkos Rp1.500 per kilonya. Setiap kilonya sekitar Rp3.000-Rp3.500,” tuturnya. “Itulah akibat dari kondisi jalan yang masih sangat buruk menuju wilayah kami. Hasil bumi banyak yang dibiarkan membusuk, seperti pepaya, cabai, tomat, petai dan juga durian, karena harga angkutnya tak sesuai lagi dengan harga pasaran,” kata Baginda Banuana (65) warga Salese. (ran/ mer)

PT AR Genjot Program Perbaikan Infrastruktur

Sambungan halaman 8

Sambungan halaman 8

di Sibolga dikembalikan kepada orang tuanya,” jelasnya. Tujuan lain operasi rutin ini, sebut Sijabat, agar dapat mengarahkan anak-anak ke arah masa depannya, bukan justru menjadi anak punk yang dinilainya tak punya masa depan. “Kita minta dukungan dan partisipasi warga agar tidak dibiarkan anak-anak seperti itu. Jika memang anak ingin pengembangan di bidang seni, kan ada tempat dan jalurnya,” lanjutnya. Sijabat menambahkan, dalam pertumbuhan anak,paraorangtuajugahendaknyaberperanserta mengawasi anak-anak, dan tidak membiarkan mereka minum-minuman keras malam hari di sekitar jalan-jalan yang ada di Sibolga. “Kita ingin agar anak-anak jangan minumminuman keras di tengah jalan, sebab selain merusak kesehatan merekaanak, juga akan mengganggu para pengguna jalan. Hingga saat ini, sejauh yang kita ketahui mengenai anak punk, keberadaan mereka belum terorganisir di Sibolga,” pungkasnya. (son)

Rencana... Sambungan halaman 8 pasar tidak dilakukan secara maksimal dan hanya terkesan asal jadi. “Selain apresiasi kepada Pemko Psp, juga sangat menyayangkan pembangunan pot bunga dan parit permanen tanpa lubang pengkorekan. Dikhawatirkan, jika parit nantinya penuh dengan sampah dan lumpur akan menyebabkan wilayah pasar banjir,” tegasnya. Menurutnya, dalam pembangunan parit selalu dibuat sistem tutup buka. Hal ini bertujuan sebagai antisipasi, mana tahu sewaktu-waktu terjadi penumpukan sampah dan lumpur, pintu parit dapat dibuka dan dikorek. “Setahu saya, parit itu harus bisa dibuka, bukan permanen seperti ini tanpa ada lubang. Bahkan di atasnya dibangun pot bunga permanen. Saya menilai Pemko Psp mengerjqakannya asal jadi, yang berarti tidak merencanakan jangka panjang bangunan parit,” katanya. Jika melihat keadaan ini, diperkiraan keberadaan parit hanya bertahan paling lama 3 tahun. Setelah itu ini parit akan dibongkar lagi, karena sudah penuh dengan sampah dan Lumpur, dan kemudian diganti lagi pembanugnannya dengan anggaran yang baru. Kami setiap hari melihat pelaksanaan proyek itu. Jika proyek tersebut tidak dikerjakan sesuai dengan ketentuan, maka dikhawatirkan akan cepat rusak. ”Daerah ini nantinya adalah daerah rawan sampah dan lumpur. Jadi kalau proyek itu nantinya dikerjakan asal jadi, maka bangunan itu akan cepat hancur,” sebut Horizon. ”Pembangunannya sudah lama kami nantinantikan. Jadi, wajar kalau kami turut mengawasi kualitas proyek itu,” ujarnya. (tan/mer)

dan rehabilitasi jalan di Desa Wek II menuju Sisoma Kecamatan Batangtoru, Tapsel. Hal ini dikatakan Communications Manager PT AR Katarina Siburian, Senin (19/11). Katanya, seminggu terakhir PT AR telah menjalankan program kepedulian dan tanggung jawab sosial dengan menyalurkan bantuan untuk perbaikan infrastruktur yang saat ini sedang dalam tahap pelaksanaan di lapangan. “Program ini merupakan bagian dari komitmen PTAR untuk bersama-sama dengan masyarakat untuk membangun daerah. Salah satunya, dengan perbaikan

infrastruktur yang memberikan peluang kesempatan kerja yang dilakukan langsung pemuda setempat,” katanya. Adapun ke-3 kegiatan yang sedang berlangsung sambung Katarina, diharapkan dapat membantu masyarakat setempat. Seperti pembangunan sarana air bersih di Taman Sari, Desa Hapesong Baru dengan kegiatan inti pembangunan bak distribusi, bak penampung dan pembangunan tempat wudhu Masjid Taman Sari serta Pipanisasi sepanjang 1.700 meter. Perbaikan drainase di Desa Napa, karena kondisi yang ada selama ini ketika hujan turun, maka ruas Jalinsum akan tergenang air dan menyebabkan kemacetan kendaraan

serta semakin rusaknya kondisi jalan. “Kegiatan inti merehabilitasi drainase di sekitar jalan tersebut agar air sisa hujan lancar dan tidak masuk ke badan saat hujan. Kegiatan ini melibatkan 15 pemuda setempat untuk mengerjakannya,” sambung Katarina. Kegiatan lainnya adalah, merehabilitasi jalan di Wek II serta perbaikan jalan tanah wakaf Sisoma. Kegitan intinya adalah pembersihan saluran air, perbaikan jalan, lapis penetrasi, pengerjaan tembok penahan tanah, pemasangan bata, dan lain-lain. “Selain kegiatan ini, saat ini PTAR tengah mematangkan perencanaan beberapa program pengembangan kemasyarakatan yang akan direalisasikan dalam waktu dekat. Dan

Awasi Pengerjaan Proyek di Musim Hujan Sambungan halaman 8 itu, harus membuat Kota Psp semakin maju dan berkembang dan manfaatnya dirasakan masyarakat. Politisi muda dari Partai RepublikaN ini, saat ini sedang musim hujan, sehingga jika pengerjaan proyek terus dipaksanakan maka hasilnya tidak akan maksimal. “Kita minta Dinas PU Psp untuk mengawasi pekerjaan proyek yang tetap dipaksanakan dikerjakan saat sedang hujan. Pasalnya, hasilnya atau mutu pekerjaan bisa saja jelek. Kita minta pelaksanaan proyek itu diawasi dan jika ada rekanan yang membuat kesalahan, agar ditegur dan jangan diberikan lagi pekerjakan tahun mendatang,” tuturnya. Sopian Harahap juga berharap, kalau nantinya hasilnya menjadi jelek dengan memaksakan

pekerjaan tetap dikerjakan disaat musim hujan seperti ini, agar jangan waktu jatuh tempo pelaksanaan kerja dijadikan sebagai alasan. “Memang umumnya kesalahan pengerjaan proyek selalu murni dengan alasan karena factor cuaca. Kendati demikian, kita berharap agar Dinas PU Psp tetap mengawasi pelaksanaan proyek dengan baik. Jangan karena mengejar waktu jatuh tempo, hasilnya menjadi buruk. Uuntuk apa begitu,” sarannya. Kata Harap, sampai hari ini rata-rata kegiatan pelaksanaan proyek fisik sudah mencapai sekitar 80 persen, sekarang ini bulan November dimana kegiatan proyek itu pada 15 Desember itu harus selesai semuanya atau 100 persen. Diharapkannya, seluruh kontraktor masyarakat jasa konstruksi yang melaksanakan kegiatan proyek di Kota psp, agar tidak ada satupun proyek yang tidak bisa diselesaikan dalam

tahun anggaran 2012 ini. “Kepada seluruh kontraktor yang sudah memenangkan tender proyek, maka harus cepat menyelesaikannya. Apabila melihat kondisi waktu yang tersisa saat ini hanya tinggal 1 bulan, bila tidak bisa selesai maka harus berpacu dengan mengerjakannya pada malam hari. Tapi ingat, jangan jadikan faktor cuaca sebagai alasan hasilnya tidak maksimal,” tukas Sopian. Diingatkannya lagi, bila kontraktor mengerjakan proyek pada malam hari maka mereka harus membuat surat kepada PPK-nya tentang kegiatan malam hari ini, jangan sampai kegiatan malam hari ini membuat kualitas proyek itu menjadi menurun, jadi tidak ada alasannya. “Dengan kegiatan malam itu tidak boleh membuat kualitas proyek menjadi menurun, harus tetap seperti kontrak yang ditawarkan,” tegasnya. (phn/mer)

Biarkan Warga Kelola Dana CSR! Sambungan halaman 8 dana CSR tersebut. Hal ini ditegaskan tokoh pemuda Batang Toru, Irwansyah Pulungan, Selasa (20/11), “Saya melihat, dana CSR dikelola pemerintah tidak pernah sampai ke masyarakat Batang Toru, baik secara langsung berupa pembangunan atau lainnya. Bahkan, penggunannya juga tidak diketahui masyarakat Batang Toru yang jelas-jelas paling berhak atas dana CSR tersebut,” katanya. Seharusnya, tambah Irwansyah, yang paling berhak merasakan dana CSR adalah masyarakat sekitar tambang atau di Batang Toru. “Bukannya maksud kita mengkotakkotakkan, tetapi wajarlah jika yang menerima dan merasakan dana CSR itu adalah masyarakat Batang Toru. Kenapa dana itu digunakan untuk membangun wilayah lain, bukan di Batang Toru. Jadi, apa untungnya untuk masyarakat Batang Toru,” tanyanya.

Dana CRS yang dikelola pemerintah, penggunannya atas keinginan pemerintah tanpa memikirkan keinginan warga di sekitaran Batang Toru. Akibanya, penggunaan dana CSR dari perusahaan PT AR tidak jelas untuk apa. “Beginilah kalau pemerintah juga ikut mencampuri masalah CRS. Masa dana CSR yang seharusnya warga berhak mendapatkannya, malah tidak tahu ke mana dana itu dipergunakan. Anehkan,” tuturnya. Pria yang aktif di organisasi kepemudaan ini dan akrab dipanggil Romel ini menambahkan, ke depan seharusnya pengelolaan CSR dikelola langsung warga Batang Toru yang dikumpulkan dalam suatu wadah atau lembaga resmi. Nantinya, susunan kepengurusan lembaga itu adalah para tokoh masyarakat yang dipercayai masyarakat. Nantinya, penggunaannya harus sesuai keinginan masyarakat, pemerintahan hanyalah sebagai pembina atau pengarah saja. “Yang kita mau, harusnya masyarakatlah

yang mengelola dana CRS itu. Bukan seperti sekarang pemerintah yang mengelolanya. Akibatnya, arah penggunaan dana tidak jelas dan tidak dirasakan masyarakat Batang Toru. Saya sebagai warga asli Batang Toru meminta pemerintah untuk tidak lagi mencampuri urusan CSR, dan menyerahkan pengelolaannya kepada masyarakat melalui lembaga resmi yang dibentuk masyarakat dan pemerintah hanyalah sebagai pengarah saja,” tegasnya. Lembaga ini nantinya bukan hanya mengurus masalah CRS saja, tetapi juga menjadi jembatan antara masyarakat dengan perusahaan. Lembaga ini juga berfungsi sebagai audit public, pengawasan pekerjaan hingga ikut memperogramkan dana CSR perusahaan. “Pemerintah sifatnya hanya mengawasi saja, sedangkan yang menjadi aktor utamanya adalah lembaga independent, sehingga rakyat benar-benar mendapatkan manfaat dari keberadaan perusahaan,” harapnya. (phn/mer)

warga menyambut baik kegiatan kemasyarakatan PT AR Tambang Martabe di wilayah itu, dan berharap program kemasyarakatan ini tetap dijalankan secara berkesinambungan dan berkelanjutan,” harapnya. “Awalnya kita musyawarah di Desa dan mengusulkan agar dibantu pendanaan kegiatan kemasyarakatan di Desa itu,” kata Rajab Pulungan Sekretaris Desa Napa pada METRO melalui telepon selulernya. Hal senada dikatakan Kepala Desa Hapesong Baru, yang mengaku jenis kegiatan itu sangat baik denga pola pemberdayaan dan partisipatif. “Sangat baguslah, dan menyediakan lapangan kerja bagi warga kami,” katanya. (ran/mer)

Kegiatan Olahraga... Sambungan halaman 8 reformasi birokrasi di tempat kerja masingmasing,” tegasnya. Menurutnya, hal itu sangat penting guna meningkatkan jalinan kerjasama produktif dengan semua pemangku kepentinga pembangunan, melanjutkan kerja keras dan kerja cerdas sebagai Abdi Negara, Abdi Masyarakat, Abdi Pemerintah. Sebelumnya, ketua panitia hut Korpri ke 41 di Kota Sibolga Juneidi Tanjung dalam laporannya menyampaikan, sejumlah cabang lomba yang di pertandingkan dalam memeriakan hut Korpri ke41 di Kota sibolga, yang di ikuti seluruh SKPD di lingkungan Pemerintah Kota Sibolga. “Di puncak acara, akan diberikan bingkisan kepada 72 purna bhakti PNS ,” tandasnya. (tob)

Dianggarkan Rp1 Miliar... Sambungan halaman 8 legislatif (DPRD) Sibolga,” ungkap Kadis Perindagkop dan UKM Sibolga Ichwan Simatupang kepada METRO, Selasa (20/11) di ruang kerjanya. Ichwan mengatakan, Pemko Sibolga terus berupaya memberikan pelayanan terbaik kepada masyarakat. Salah satunya melalui upaya pembenahan lokasi pusat pasar tradisional yang menjadi tempat kebanggaan warga untuk berbelanja. “Selama ini, kita banyak menerima keluhan dari warga baik pedagang maupun masyarakat umum yang berbelanja di Pasar Sibolga Nauli, bahwa kondisi pasar tersebut semakin tidak representative. Maka itu, kita terus berjuang dan mengusulkan anggarannya supaya dapat ditampung melalui APBD Kota Sibolga TA 2013,” ujar Ichwan seraya berharap, dengan alokasi dana sebesar Rp1 miliar tersebut, Pasar Sibolga Nauli menjadi pasar yang bersih dan tertata dengan baik. Beberapa waktu lalu, sambung Ichwan, sejumlah anggota DPRD Sibolga dari Komisi II Jimmy Ronald Hutajulu, Pantas Lumbantobing, Hj Syurianty Sidabutar, Herri Yon Marbun di dampingi Wakil Ketua DPRD Imran Simorangkir, sudah melakukan peninjauan ke Pasar Sibolga Nauli. (tob)

SAMBUNGAN METRO TABAGSEL Kasih Sayang Ayah (1) Sambungan Halaman 1 Dulu semasa kecil mungkin aku tidak pernahmerasabebaninibegitubesardalam hidupku, ketika menyadari aku beranjak remaja dan melihat aku berbeda diantara sahabat-sahabatku. Di depan mading sekolahku tertulis sebuah pengumuman pembentukan tim musik sekolah, aku ingin ikut dalam tim itu tapi sayangnya aku hanya bisa meratapi nasibku. Aku pun pulang untuk bertemu dengan ayah, aku terduduk dengan wajah penuh kesedihan, Dalam duniaku, hanya ayah yang bisa mengerti apa yang aku katakan. Walaupun itu harus dengan bahasa tangan yang ia pelajari dengan susah payah. Aku mengetuk pintu untuk memberi tandaakuadadikamaruntukbicaradengan ayah, ia melihatku dan melempar senyum. “Angel, ayo masuk. Silakan duduk di sini nak, ada apa? Bagaimana pelajaran kelas kamu hari ini?” Aku tertunduk, lalu ayah mulai bisa membaca wajahku. “ Apa yang terjadi nak, ceritakan pada ayah?” “Ayahmengapaakuberbedadaritemantemanku?” “ Dalam hal?” tanya ayah padaku, Aku menangis dan usiaku saat itu hanya 12 tahun dan duduk di sekolah menengah pertama. “ Aku tidak bisa bernyanyi, tidak bisa mendengar.. Mengapa ayah?” Ayah melihatku sambil tersenyum, “ Apakah kamu merasa bersedih karena itu?” “Ya,akusangatbersedih..Akuinginseperti mereka..Bisabernyanyidanmendengarkan indahnya musik..” “ Mengapa kamu ingin menjadi seperti mereka?” “ Karena aku ingin menjadi tim musik sekolah, aku ingin ayah..” “ Kalau begitu lakukan..” Aku terdiam tidak bisa membalas

pertanyaan ayah kemudian ia bangkit dan mengajakkukeruangangudangdibelakang rumahku, ia mulai membersihkan debudebu di sebuah meja panjang yang tadinya kupikir adalah meja makan. Ternyata itu adalah piano klasik. Aku memperhatikanya dengan heran, “ Ini adalah peninggalan ibumu sebelum iameninggalsetelahmelahirkankamu,ayah sudahtidakpernahmendengarkannyasejak kamu terlahir..” “ Lalu..?” tanyaku. “ kamu mungkin terlahir tanpa bisa mendengar dan bernyanyi. Tapi kamu terlahirdarirahimseorangibuyangberjuang agarkamuadadiduniainidanayahpercaya, Tuhan memberikan kamu dalam kehidupan karena kamu memang layak untuk itu.” “ Tapi aku cacat, tidak normal dan tidak akan pernah bisa mendengar musik? Bagaimana caranya aku bisa seperti temantemanku.” “ Sayang kamu memang tidak bisa mendengarkan musik, tapi kamu bisa memainkan musik?” “ Bagaimana caranya?” “ Ayah ada disini untuk kamu dan percayalah, musik itu akan terasa indah bila kamu merasakannya dari hati kamu. “ “ Walaupun aku tidak bisa mendengar..” Ayah duduk dikursi dan menyuruhku memperhatikannya bermain piano, Ia menutupmatanyalalumemainkanarunan toth piano itu. “Anakku,rasakanlahmusikitudalamhati dan kamu akan tau bertapa Tuhan sangat mencintai siapapun makluk yang ia ciptakan. Walaupun kamu terlahir dengan keadaancacatdantidakbisamendengarkan suaramusikitudaritelingakamu..Kamubisa dengarkan lewatkan hati kamu..” Ayah mengajakku untuk menyentuh setiap toth piano dan kami bermain bersama,akumemangtidakbisamerasakan apa suara music itu tapi aku bisa merasakan nada dari jari yang ketekan dan itu

membuatku bersemangat untuk berlatih piano klasik, aku tau ibuku adalah seorang pemain piano sebelum ia meninggal saat melahirkanku. Aku pun berjuang untuk bermain musik dan perlahan aku mampu membuat sedikit alunan music yang indah. Semua itu kurasakan dalam hatiku, semua itu kurasakan dalam jiwaku. Beberapa minggu kemudian, aku mulai berani mendaftar dalam tim musik sekolahku dan guruku menerimaku walaupun ia tau aku cacat tapi setelah aku mainkan piano dan ia terkesan. Aku tau semua orang melihatku dengan aneh, seorang teman bernama Agnes datang padaku. “ Hai orang cacat, apa yang bisa kamu lakukan dengan telingamu yang tertutup kotoran?” Yanglaintertawadanmenambahkalimat yang melukai hatiku, “ Dia mungkin mau jadi badut diantara tim kita, biarkan saja..” Ejekan itu berakhir saat guruku datang, mereka semua kembali ke posisi mereka masing dalam alat music yang mereka kuasai. Ibu guru pembimbing kelas musik bersikap hangat padaku, ia memperkenalkanku pada semuanya. “ Anak-anak mulai hari ini Angel akan bergabung dalam tim kita, semoga kalian bisa berkerja sama dengan Angel ya..” “Ibuapayangbisalakukanuntuktimkita, dia kan budek?” ejek Agnes. “ Agnes!! ibu tidak pernah mengajarkan kamuuntukmenghinaoranglain,jagasikap kamu. Walaupun Angel cacat secara fisik ia juga memiliki perasaan, tolong kendalikan kata-kata kamu.” Akusenangibumembelakutapiitumalah membuat semua membenciku, ibu mempersilakan aku memainkan piano, dengan gugup aku bisa bermain dengan baik. Tidak ada satupun tepuk tangan dari teman-temanku, hanya ibu guru seorang. Ketika kelas bubar aku mendekat pada ibu guru, aku menuliskan apa yang ingin aku katakan kepadanya, Ia membacanya. “ Ibu , aku mundur saja dari tim, aku tidak mungkin bisa menjadi bagian dari mereka. Karena aku ini cacat. Mereka tidak akan

menerimaku?” “ Tidak sayang, jangan berkata demikian, kamuspecial,kamuberbakat,merekahanya belum terbiasa, percayalah kalau kamu sudah sering bermain dengan mereka. Kamu akan diterima dengan suka cita. Jadi ibutidakmaumendengarkankalimatkamu ingin mundur..” “ Tapi bu, aku takut bila membuat semua jadi kacau.” “ Anakku, beberapa minggu lagi, sekolah iniakanmerayakanhariulangtahunnya,ibu percaya kamulah satu-satunya orang yang layakmengisitempatdibagianpiano,karena temankamuRika(pianissebelumnya)telah mundur karena sakit cacar” Akupulangkerumahdanmemberikabar kalauakuditerimadalamtimmusiksekolah, ayah begitu gembira menunggu saat-saat aku akan berada dipanggung, ia terus melatih permainan pianoku. Aku tidak pernah cerita bertapa aku sangat diremehkan oleh teman-teman se-timku yang hanya menganggap aku sampah yang tidak layak disamping mereka. Mereka seringmemarahiakudengankata-katakasar lalumerekamenghinakusebagaigadiscaca, hal itu terus terjadi disaat kami berlatih persiapanuntukpanggungsekolah.Mereka tidakpernahpeduliapayangkumainkanbila benar, mereka selalu bilang salah. Padahal aku yakin aku benar-benar memainkan musik piano ini, sedihnya saat aku bertanya dimana letak kesalahanku yang mereka jawab lebih menyakitkan. “Kamuinitulidanbudek,bagaimanabisa kamutaualunanmusikyangkamumainkan itu benar atau salah? Kamu membuat aku muak dengan sikap kamu yang sok pintar dan mencari muka di depan bu guru.” Kata Agnes padaku. Akumenangismendengarkankalimatitu, aku berlari pulang ke rumah dan satusatunya kalimat yang kudengar hanya satu. “ Pergi kamu gadis cacat, jangan pernah kembali ke tim kami, kami tidak sudi menerima kamu dalam kelompok ini.” (bersambung)

Pegang Prinsip Tak Mau Minta-minta, Bahagia Didukung Istri Sambungan Halaman 1 harus merangkak atau berjalan di atas tangan sambil menyeret kaki dan anggota tubuhnya. Salut! Asran, panggilan akrabnya, hanya tersenyum ketika METRO mencoba mewawancarainya. Di awal wawancara, pria yang baru menikah sekitar tiga minggu lalu ini mengaku, hampir sepuluh tahun sudah mengabdikan hidupnya sebagai tukang parkir. Pekerjaan itu selalu dilakukannya setiap hari tanpa mengeluh. Hujan atau panas tak jadi penghalang baginya untuk tetap menjalankan tugas menjaga sepedamotor yang dititipkan pemiliknya kepadanya. Menurut Asran, prinsip hidup ‘tidak mau memintaminta’ yang dianutnya adalah modal kuat yang mendasarinya untuk tidak canggung dan giat menjadi tukang parkir hingga kini. “Saya tidak mau memintaminta,” ungkapnya seraya menunjukkan kartu nama tukang parkir miliknya. Asran menambahkan, bekerja sebagai tukang parkir dimulainya sejak pukul 09.00 Wib. Atau, saat pemilik toko mulai berdagang. Pekerjaan itu dilakoninya hingga pukul 18.00 WIB. Sebab, saat toko tutup lahan parkir akan digunakan pedagang nasi malam. Selama menjadi tukang parkir,

Asran lebih menjaga dan meningkatkan kesabaran. Sebab, di pelataran ruko berukuran 15 meter itu, setiap harinya ia harus mengatur dan menjaga puluhan sepedamotor yang parkir di sana. Namun, ia tetap bersyukur atas kondisi tersebut. Sebab, selama menjadi tukang parkir ia tak pernah mendapat ejekan dari orang di sekitarnya. Maka tanpa memandang siapa yang memarkir kendaraan, ia tetap ramah. Yang terpenting adalah membantu memarkirkan dan menata kendaraan pemarkir agar suasana lahan parkir terlihat rapi. Tidak hanya itu, ia juga menandai sepedamotor dengan karton bekas di atas jok kreta. Disinggung soal penghasilan, Asran tersenyum simpul. Menurutnya, rata-rata penghasilan per hari berkisar antara Rp70 ribu hingga Rp100 ribu. Namun, ia masih harus menyetor kepada pengontrak lahan sebesar Rp200 ribu per bulan. Asran menyadari kalau penghasilanyangdidapatnyahanya bisadimanfaatkanuntukmenafkahi keluarga sehari-hari, namun ia tak pataharang.Untukitusetiapbekerja, ia akan berusaha lebih giat dan meminta doa dari keluarganya. Perlu diketahui, Asran bukan hanya menyandang kekurangan fisikpadabagiankakinya.Iajugatak mampuberbicarajelassepertiorang kebanyakan. Kini, Asran dan istri menetap di Jalan SM Raja Gang KeluargaNomor13,Siborang.(tan)


21 NOVEMBER 2012


BUTUH PERHA TIAN PERHATIAN Kondisi sarana tranportasi di Luat Harangan yang sangat membutuh perhatian pemerintah untuk segera memperbaikinya sebagai upaya meningkatkan kesejahteraan warga.

Perbaiki Jalan ke Luat Harangan! Perekonomian jadi Merosot SIPIROK-Untuk meningkatkan perekonomi masyarakat, harus didukung berbagai sektor, salahsatunya sarana parasara transportasi (jalan). Sarana ini sangat berperan besar untuk menentukan harga jual berbagai komoditi sebagai sumber pendapatan masyarakat. Sayanganya, harapan untuk meningkatkanya taraf perekonomian dan kesejahteraan itu, masih sangat jauh bagi

masyarakat yang berdomisili di beberapa desa tertinggal di wilayah Luat Harangan, Kecamatan Sipirok, Kabupaten Tapanuli

Selatan (Tapsel). Sudah bertahun-tahun masyarakat Luat Harangan sangat berharap perhatian pemerintah untuk pembangunan sarana jalan yang lebih layak ke daerah mereka. Jumlah masyarakat yang tinggal di seberang Sungai Batang Ilung sekitar 250 KK yang terdiri dari empat dusun dari dua desa, yakni Desa Panaungan dan Desa Pargarutan. Amatan METRO ketika digelar bakti sosial bersama NNBS dan Polsek Sipirok beberapa

waktu lalu, jika berangkat dari Pasar Sipirok sekitar pukul 9.00 WIB dengan kenderaan gardang 2, sampai di jembatan gantung atau Rambing Aek Batang Ilung sekitar pukul 11.30 WIB. Jarak tempuh yang sekitar 30 km, hanya 7 km berupa jalan hotmix, sekitar 5 km jalan lapen dengan kualitas tidak rusak parah, dan selebihnya merupakan jalan yang rusak parah dan sulit dilalui. Bahkan di beberapa titik, yang seharusnya ada jembatan, hanya

dibuat dengan batang kayu. Belum lagi jurang di sisi kiri dan kanan jalan, tanjakan dan turunan yang curam serta tikungan patah berliku-liku. Memang perjalanan menuju Luat Larangan membutuhkan mental dan nyali petualang. Sesampai di Desa Pangaribuan hingga Dusun Salese atau sekitar 6 km. Sekalipun di

Baca Perbaiki ...Hal 7

Awasi Pengerjaan Proyek di Musim Hujan SIDIMPUAN- Dinas Pekerjaan Umum Kota Padasidimpuan (Psp) di bidang Pengairan dan Bina Marga harus mengawasi pelaksanaan proyek dari APBD Kota Psp TA 2012. Dikhawatirkan saat pengerjaan proyek ini, rekanan bisa saja berbuat nakal, misalnya terus mengerjakan proyeknya meski

sedang hujan. Demikian diingatkan anggota DPRD Psp dari Komisi II, Sopian Harahap, Selasa (20/ 11). Saat ini, katanya, banyak di Kota Psp terlihat pengerjaan berbagai proyek APBD pengerjaan fisik. Karena, hasil pengerjaan

Baca Awasi ...Hal 7

Biarkan Warga Kelola Dana CSR! BATANG TORU-Pengelolaan dana tanggung jawab sosial perusahaan atau corporate social responsibility (CSR) dari perusahaan tambang emas PT Agincourt Resources (AR) di Batang Toru seharusnya tidak diserahkan kepada pemerintah, tetapi melalui sebuah lembaga resmi yang dikelola oleh masyarakat.

Ketika dana CSR dikelola pemerintah, tidak pernah sampai secara langsung kepada masyarakat, baik berupa pembangunan atau lainnya. Bahkan penggunan dana tersebut, selama ini juga tidak diketahui masyarakat Batang Toru, yang jelas-jelas paling berhak atas

Baca Biarkan ...Hal 7


ASAL JADI- Pembangunan pot bunga dan parit permanen di Pasar Batu yang permanen tanpa lubang pengkorekan. Perencanaan pembangunannya dinilai InSos asal jadi.

Rencana Pembangunan Parit Dinilai Asal Jadi SIDIMPUAN- Pusat Study dan Kajian Indefenden Sosial (InSos) Kota Padangsidimpuan (Psp) mengapresiasi Pemko Psp dalam membangun los di Pasar Pajak Batu. Dengan adanya bangunan tersebut, nantinya pedagang dan pembeli semakin ramai di pajak batu. Saat ini, bangunan pasar yang telah

berumur puluhan tahun tersebut terlihat semakin indah dan baik. Selain sebagai tempat traksaksi perekonomian masyarakat, pasar ini juga nantinya sebagai penambah Pendapatan Asli Daerah (PAD) kota Psp. Hal itu disampaikan Pengurus Harian InSos, Horizon Syaputra kepada Metro,

Rehab Pasar Sibolga Nauli

Dianggarkan Rp1 Miliar di 2013 SIBOLGA-Pada tahun anggaran 2013 mendatang, Pemko Sibolga akan mengalokasikan dana sebesar Rp 1 miliar lebih untuk rehabilitasi pusat pasar tradisional yaitu Pasar Sibolga Nauli. Dana tersebut dikhususkan untuk perbaikan seluruh lantai yang mengalami kerusakan, termasuk atap pasar yang bocor-bocor. “Alokasi dana sebesar Rp1 miliar lebih tersebut sudah kita usulkan untuk ditampung di APBD Kota Sibolga TA 2013, mudah-mudahan mendapat persetujuan dari Badan Anggaran (Banggar) eksekutif (Pemko) dan

Selasa (20/11). Namun satu hal yang sangat disayangnya tambah Horizon, pembangunan pot bunga dan parit permanen di pasar tersebut tanpa lubang pengkorekan. Sepertinya, perencanaan pembangunan

Baca Rencana ...Hal 7

PT AR Genjot Program Perbaikan Infrastruktur BATANGTORU-Untuk mewujudkan komitmen dan tanggung jawab, perusahaan tambang emas PT Agincourt Resources (AR) menggenjot kegiatan perbaikan infrastruktur di beberapa desa sekitar tambang. Kegiatan ini bagian awal program percepatan dana tanggung jawab sosial perusahaan atau corporate social responsibility (CSR) Tambang Emas Martabe.

Seminggu terakhir sejumlah program sosial kemasyarakatan mulai giat dijalankan PT Aryang bergerak dibidang pertambangan emas, perak dan lainnnya yang beroperasi di Batangtoru, Kabupaten Tapsel. Di antaranya, pembangunan sarana air bersih di Desa Hapesong Baru, perbaikan drainase di Desa Napa,

Baca PT AR ...Hal 7

Baca Dianggarkan ...Hal 7

Kegiatan Olahraga Meriahkan HUT Korpri SIBOLGA-Berbagai kegiatan olahraga, di antaranya tennis meja, lari goni, futsal, dan lainnya meriahkan rangkaian peringatan hari ulang tahun Korps Pegawai Republik Indonesia (Korpri) ke 41 di Kota Sibolga. Acara itu sendiri di buka Sekda Kota Sibolga Mochamad Sugeng yang mewakili Wali Kota Sibolga HM Syarfi Hutauruk, Selasa (20/11) di lapangan Simaremare Kota Sibolga. Dalam sambutannya yang di bacakan Sekda, Wali Kota Sibolga mengatakan Hut Korpri ke 41 tahun 2012 senagaj mengambil tema Pemantapan Jiwa Korps Pegawai Republik Indonesia Guna Mempercepat Reformasi Birokrasi. “Sehingga diharapkan melalui tema itu, seluruh korps pegawai di Pemerintahan Kota Sibolga dapat menuntaskan pelaksanaan

Baca Kegiatan ...Hal 7


DITERTIBKAN-Tujuh anak punk yang ditertibkan oleh aparat Satpol PP Sibolga.

Anak Punk Ditertibkan SIBOLGA- Personel Satpol PP Sibolga menertibkan tujuh anak punk yang berkeliaran di sekitar pasar malam Sibolga Square dalam razia rutin, Sabtu (17/11). Ketujuh anak punk tersebut, tiga orang dari Medan yakni IK (21), SM (22) dan Man (21). Satu dari Dumai yaitu Fe (25), satu dari Kabupaten Tapteng, De (17), dan dua dari Kota Sibolga masingmasing Os (25) dan Bu (19). Kepala Satpol PP Sibolga Singkat

Sijabat, Senin (19/11) mengatakan, dari tujuh anak punk tersebut, beberapa di antaranya sudah beberapa kali pernah diamankan namun masih kembali berkeliaran. “Operasi rutin yang kita laksanakan bertujuan agar anak-anak punk tidak ada lagi di Sibolga, dan yang berasal dari luar kota dapat kembali ke daerahnya masing-masing. Sedangkan yang tinggal

Baca Anak ...Hal 7


21 Nopember 2012


Iskandar: Jangan Saling Menyalahkan MADINA-Ketua Komisi 1 DPRD Kabupaten Mandailing Natal (Madina) Iskandar Hasibuan mengimbau kepada masyarakat agar tidak saling menyalahkan dan merasa benar terkait kepemimpinan Hidayat-Dahlan, apalagi membangun kekuatan kubu atau terkotak-kotak. Masyarakat seharusnya memberikan kepercayaan kepada keduanya untuk melanjutkan program pembangunan yang masih banyak terkendala.

“Saya pikir sesungguhnya tidak merusak stabilitas ada yang benar, baik pemerintah, di tengah-tengah DPRD, serta elemen lainnya, masyarakat. karena semuanya pasti memiliki Lebih baik kita kelebihan dan kekurangan, memberikan apalagi dalam menjalankan masukan tugas yang diemban. Namun pemikiran dan menurut saya, siapapun dan segala potensi dari pihak manapun, tidak yang dimiliki usahlah melakukan aksi-aksi demi yang merugikan kepentingan kepentingan rakyat. rakyat,” ujar Bukankah HidayatIskandar Dahlan itu pilihan Hasibuan kepada rakyat Madina. wartawan, Saya berharap Selasa agar tidak „ Iskandar Hasibuan ( 20/ ada yang

11) di ruang kerjanya di Gedung DPRD menjawab pertanyaan sekitar adanya tudingan kepada Bupati yang tidak mampu dan menyuruhnya mundur dari jabatannya. Menurut politisi PDI Perjuangan Madina itu, apabila ada kelompok atau komunitas masyarakat yang menilai Bupati Hidayat Batubara– Dahlan Hasan Nasution belum berbuat untuk pembangunan di Madina, lebih bagus dinyatakan secara resmi sesuai peraturan undang-undang yang ada. “Bukan dengan menyebarluaskan tudingan-tudingan. Karena kita tau pemerintahan yang baru berusia 1,4 tahun dan tentu sesuai dengan visi

dan misi-nya belum bisa dijalankan. Sebaiknya kita duduk bersama dengan DPRD, serta instansi dan pemangku kepentingan lainnya untuk menentukan arah pembangunan yang lebih baik lagi demi mensejahterakan masyarakat,” ajaknya. Banyak sekali program yang sudah ditemukan dari hasil study banding ke sejumlah daerah kabupaten/kota, dan sangat tepat untuk diterapkan di Madina. Misalnya, kata Iskandar, belum lama ini komisi 1 melakukan stduy banding ke Kabupaten Bandung Jawa Barat dan menemukan program P4 (Program Peningkatan Pembangunan Pedesaan). Tentunya program ha-

rus dibuat pada APBD tahun 2013 untuk ditampung anggarannya. Sebab program itu sangat menyentuh kepentingan masyarakat di desa-desa secara langsung. ”Apabila stabilitas pemerintahan rusak, kondusifitas masyarakat terganggu, bagaimana nantinya nasib pembangunan di Madina. Ini harus menjadi pemikiran kita bersama yang mengaku cinta terhadap bumi Gordang Sambilan ini. Selain program P4, kita juga bakal menerapkan program dinas kesehatan berupa pelayanan kesehatan di Puskesmas dibuka selama 24 jam. Berbagai pro-

‹ Baca Iskandar ...Hal 10

30 Tahun Air Masam Rusak Pertanian Warga MADINA-Sudah hampir 30 tahun, air masam ( acid drainage ) sudah merusak areal pertanian masyarakat di beberapa desa di kecamatan Lembah Sorik Merapi Kabupaten Mandailing Natal (Madina). Selain cost (biaya) perawatan padi yang bertambah, hasil panen petani juga jauh berkurang. Hingga kini permasalahan air masam ini belum juga dituntaskan pemerintah. Kepala Desa Aek Marian, Bahsanuddin SPd kepada METRO, Selasa (20/11) menerangkan, air masam ini sudah terjadi sejak tahun 1983 dan sudah merusak sejumlah sarana pertanian seperti irigasi dan sebagainya, belum lagi hasil panen yang jauh menurun. Sehingga apabila dikalkulasikan secara ekonomi,

masyarakat pada dasarnya rugi mengerjakan lahan pertanian mereka. Mengingat bertani satu-satunya usaha masyarakat, mereka tetap meneruskan dengan harapan hasil taninya masih bisa membaik. ”Air masam ini sudah merugikan masyarakat petani sejak hampir 30 tahun terakhir. Akibat air masam ini, sarana pendukung pertanian sudah banyak yang rusak karena zat belerang air masam ini bisa merusak,” ungkap Bahsan. Dijelaskannya, petani sudah rugi dari jumlah pemupukan yang bertambah dari biasanya. Sebab sebelum adanya air masam ini, petani hanya melakukan pemupukan 1

‹ Baca 30 Tahun ...Hal 10


„ Wabup, Kadis Kesehatan, Ketua komisi 1 DPRD Madina, Ketua PN Wendra Rais dan undangan lainnya foto bersama dokter cilik.

Peringatan HKN ke-48

9 Dokter Cilik Ajak Masyarakat Jaga Kesehatan MADINA-Kegiatan peringatan Hari Kesehatan Nasional (HKN) ke48 di kabupaten Mandailing Natal (Madina) bertema “Indonesia Sehat, Ibu Selamat, dan Anak Sehat” berjalan khidmat. Kegiatan HKN ini dirangkai dengan Kalakarya Penanggulangan Daerah Bermasalah Kesehatan (PDBK). Tujuannya utamanya adalah untuk peningkatan Indeks Pembangunan Kesehatan Manusia

sebagai bentuk penghargaan kantor Imigrasi terhadap siswa yang telah 5 bulan mengikuti pelatihan.

di Madina. Juga bertujuan untuk mengadvokasi lintas program dan lintas sektoral terhadap penanggulangan masalah kesehatan. Demikian disampaikan Kepala Dinas Kesehatan Madina, dr Tengku Amri Fadli pada acara peringatan HKN di Gedung Serbaguna desa Parbangunan kecamatan Panyabungan, Selasa (20/11). Hadir pada kesempatan itu Wakil

Bupati Drs H Dahlan Hasan Nasution, Ketua Komisi 1 DPRD Madina Iskandar Hasibuan, Ketua Pengadilan Negeri Wendra Rais SH, Kepala Puskesmas se-Madina, dan ratusan undangan lainnya. Kegiatan ini juga dimeriahkan dengan penampilan 9 orang dokter kecil yang mengajak agar semua masyarakat peduli kesehatan mulai dari hal yang kecil.

Di Gedung Serbaguna

„ Riduan Manurung

Siswa SMK Terima Sertifikat dari Imigrasi

‹ Baca Siswa ...Hal 10

‹ Baca 9 Dokter ...Hal 10

25 November, 184 Calon Panwascam Ikuti Tes Tertulis

Kepala Imigrasi Tanjungbalai

TANJUNGBALAI- Puluhan siswa Sekolah Menengah Kejuruan (SMK) Negeri Tanjungbalai mendapatkan sertifikat dari Kepala kantor Imigrasi Tanjungbalai, Selasa (20/11). Sertifikasi ini diberikan setelah mereka menyelesaikan masa pelatihan sejak 7 Juli hingga 20 November. Agustina S salahseorang siswi SMK yang menerima sertifikat dari kantor Imigrasi mengatakan, ada 10 orang siswa yang mengikuti pelatihan selama 5 bulan di kantor Imigrasi Tanjungbalai. Menurutnya pengalaman yang mereka peroleh selama mengikuti pelatihan menjadikan mereka bisa mengetahui administrasi pembukuan. “Selama di lingkungan kantor Imigrasi kami dapat beradaptasi sesama pejabat di kantor Imigrasi. Sementara itu kepala Imigrasi Tanjungbalai Riduan Manurung melalui Dhanu mengatakan, pemberian sertifikat terhadap para siswa itu perlu dilakukan. Itu sebagai bentuk penghargaan kantor Imigrasi terhadap siswa yang telah 5 bulan mengikuti pelatihan.

Amri menyampaikan kegiatan HKN ini sangat penting untuk meningkatkan kepedulian masyarakat terhadap masalah kesehatan ibu, anak dan gizi masyarakat sebagai upaya mendorong percepatan pencapaian target MDGs. Lalu tujuannya juga untuk menyebarluaskan informasi tentang gaya hidup sehat

„ Ketua Panwas Hendri SSos (tengah) didampingi anggota usai rapat pleno, Selasa (20/11).

MADINA- Sesuai dengan surat keputusan rapat pleno Panitia Pengawasan Pemilihan Umum (Panwaslu) Kabupaten Mandailing Natal (Madina) bernomor 033/PanwasluMN/II/2012, Panwaslu Madina menetapkan pada hari Minggu (25/11) depan akan melangsungkan test tertulis bagi 184 orang calon Panwaslu kecamatan. Proses ujian tertulis ini berlangsung di gedung Serbaguna Pemkab Madina di desa Parbangunan kecamatan Panyabungan. Demikian disampaikan Ketua Panwaslu Madina Hendri SSos didampingi dua anggota yaitu Aswin Hasibuan SP dan Ahmad Husein SHI kepada METRO, Selasa (20/11) di sekretariat sementara Panwaslu

‹ Baca 25 November ...Hal 10

„ Petani yang sedang membajak sawah. Sementara petani di Kecamatan Lembah Sorik Merapi, Madina mengeluh karena lahan mereka rusak akibat air massam.

Pulang Main Bola, Pelajar SMA Tewas BONATUA LUNASI- Ebenezer Sitorus (17), pelajar SMA Negeri Pardinggaran tewas setelah sepedamotor jenis Honda Revo BB 6446 EC yang ditumpanginya bersama rekannya Parsaoran Nainggolan (14), siswa SMPN Lumban Julu, laga kambing dengan truk fuso BB 9053 FA di Jalan Lintas Sumatera, Desa Lumban Lobu, Kecamatan Bonatua Lunasi, Kabupaten Toba Samosir, Senin (19/ 11) sekira pukul 18.00 Wib. Almarhum Ebenezer Sitorus sendiri telah dimakamkan, Selasa (20/ 11) di Desa Silamosik, Kecamatan Porsea, Toba Samosir. Sedangkan rekannya, Parsaoran Nainggolan masih kritis akibat mengalami luka

Hama Burung Resahkan Petani TOBASA- Puluhan petani padi di Tobasa dibuat kewalahan akibat serangan hama burung yang memakan bulir padi yang sedang menguning. Serangan burung terjadi di beberapa desa dan kecamatan. Petani mengaku serangan hama burung ini tidak bisa dikendalikan karena jumlahnya tidak sedikit dan bergerombolan. Berbagai cara telah dilakukan oleh petani seperti layaknya kebiasaan membuat orang-orangan di lahan, mendinding dengan plastik sampai membuat jaring agar burung tak bisa masuk. Namun upaya itu belum sepenuhnya berhasil. Karman Hutagaol, warga Dusun Sosor Dolok, Desa Hutagaol,

‹ Baca Hama ...Hal 10


„ Lahan pertanian masyarakat sengaja dilengkapi pernak pernik bertujuan untuk mengusir hama burung yang melanda beberapa desa di Tobasa. Foto dijepret Selasa (20/11)

dalam di bagian dada, masih dirawat di salahsatu rumah sakit di Kota Pematangsiantar. Informasi dihimpun METRO dari sejumlah pihak menyebut, bahwa kedua korban baru pulang bermain sepakbola dari sekolah mereka. Tepat di Jalinsum Desa Lumban Lobu, kecelakaan pun terjadi. Namun, sejauh ini, belum diketahui siapa saksi mata atas kejadian tersebut. Pantauan METRO, Selasa (20/11) di rumah duka almarhum Ebenezer, teman satu sekolahnya didampingi sejumlah guru datang melayat. Teman korban tampak sedih dan

‹ Baca Pulang ...Hal 10


21 Nopember 2012

Iskandar: Jangan Saling Menyalahkan Sambungan Halaman 9 gram ini tentunya harus didukung oleh semua pihak, baik eksekutif, legislatif, yudikatif dan terutama seluruh masyarakat. Kita semua harus sama-sama mendukung program pembangunan pemerintah yang sangat banyak bakal diterapkan di tahun-tahun mendatang. Yang tidak kita sepakati adalah program kepentingan. Saya berharap agar jangan ada yang mengatasnamakan masyarakat, apabila itu berujung rusaknya stabilitas dan kondusifitas. Saya yakin endingnya nanti program pembangunan itu tidak jalan,”

ungkapnya. Terkait pengakuan Wakil Bupati Dahlan Hasan Nasution menyatakan pemerintahan gagal, Iskandar dengan senyum lebarnya mengatakan sesuai dengan faktanya belum gagal. ”Saya juga heran dari aspek mana kegagalannya itu. Soal janji dan sumpahnya, sejatinya dia sampaikan secara resmi di DPRD agar samasama dibicarakan. Kalau soal tidak ada kewenangan dan sakit hati atau apapun namanya, janganlah dulu disampaikan ke masyarakat, tapi marilah bincangkan bersama untuk mencari yang terbaik. Ini untuk

pembangunan daerah kita. Dan saya sangat optimis sekali dengan kepemimpinan Hidayat-Dahlan akan mampu melakukan perubahan. Sebab dari visi dan misi yang telah dituangkan dalam RPJMD, jelas kita baca bahwa arah pembangunan semakin nyata. Marilah kita rumuskan dan

kita bahas bersama sesuai dengan tuntutan visi dan misi pemerintah. Kita harus ingat bahwa itu bukan lagi visi-misi Hidayat-Dahlan, tetapi itu adalah visi-misi Pemerintahan Madina,” ujarnya. Karena itu, sambung Iskandar, semua masyarakat Madina diharapkan agar

jangan terprovokasi atas aksi dan tindakan apapun dan oleh siapapun yang ujungnya masyarakat bisa saja terpancing emosi. ”Dan sekedar pedoman, sebelum melontarkan tudingan apapun, seharusnya kita berpikir apa sih yang sudah kita perbuat untuk

pembangunan di Madina. Dan ketika ada oknum yang mengaku merasa benar, pintar, kuat dan menganggap orang lain itu salah dan lemah, maka sesungguhnya dia itulah yang semestinya dikatakan “bodoh”. Untuk itu saya berharap kepada seluruh masyarakat agar jangan mau

terprovokasi, apalagi melakukan tindakan yang merusak stabilitas dan kondusifitas di Madina. Marilah kita tanamkan niat yang ikhlas dan memberikan sumbangsih pemikiran dan segala potensi demi Madina yang sejahtera,” pungkasnya. (wan)

Gedung GOR Mini Ditelantarkan Anggaran Rp700 Juta Sia-sia TANJUNGBAL AIBangunan Gedung Olahraga Mini yang dibangun dengan biaya sekitar Rp700 juta di Kelurahan Sei Raja Kecamatan Sei Tualang Raso Kota Tanjungbalai hingga saat ini telantar dan tidak difungsikan. Padahal, bangunan itu sudah selesai dikerjakan sejak akhir tahun 2003. Data dihimpun METRO, tidak difungsikannya bangunan itu karena Pemko Tanjungbalai hingga sekarang belum menetapkan siapa pengelola bangunan, apakah Disporabudpar, Dinas PU, atau KONI. Kepala Dinas Pemuda Olah Raga, Kebudayaan dan Pariwisata (Kadisporabudpar) Tanjungbalai Hafifi, Selasa (20/ 11) mengatakan, gedung itu belum difungsikan karena belum ada serah terima dari pihak rekanan kepada Disporabudpar. Bahkan menurut Hafifi, Pemko Tanjungbalai juga belum ada menetapkan apakah banguna tersebut dikelola Disporabudpar, KONI atau Dinas PU. “Bagaimana mau dikelola atau dimanfaatkan. Sampai sekarang kami saja tak tahu siapa yang mengelola,” katanya. Hafifi menyebutkan, jika dilihat dari peruntukannya, maka gedung yang dibangun dengan biaya ratusan juta itu

merupakan kewenangan KONI untuk mengelolah. “Kalau melihat dari peruntukannya, bangunan itu mungkin untuk KONI. Bangunan itu dibangun masa Wali Kota dr Sutrisno Hadi. Jadi, saat ini kami tidak tahu siapa yang mengelola bangunan GOR Mini. Bahkan dibangun untuk apa kami juga nggak tahu. Yang tahu menahu masalah ini adalah wali kota yang lama,” katanya sembari menambahkan, soal angaran biaya pembangunan pun dirinya sama sekali tidak tahu. Terpisah, Ketua KONI Tanjungbalai M Nur didampingi Asmuni Sinaga mengatakan, bangunan GOR dibangun sejak tahun 2003 dan dananya bersumber dari Kementerian Pemuda dan Olahraga semasa di Zaman Mahadi Sinambela. “KONI pernah turun ke lokasi bangunan GOR Mini untuk memantau kondisi bangunan. Dari pengamatan, arus listrik, air, dan bangku untuk penonton belum ada,” terang M Nur. M Nur membenarkan, jika belum ada serah terima GOR Mini tersebut dari Pemko Tanjungbalai ke KONI. “Kalau misalnya berita acara serah terima dari pemko telah kami dapat, KONI sendiri menyatakan kesiapannya untuk mengelola,” tambahnya. (ck3)

Hama Burung Resahkan Petani Sambungan Halaman 9 Kecamatan Balige mengaku, jaring yang dia pasang bertujuan agar burung tidak masuk dan memakan padi. Selain itu, penggunaan jaring bisa juga agar burung tidak bersarang di lokasi itu. Dasar memiliki naluri mencari makan, burung justru datang secara gerombolan dan hingga di atas jaring. Dari atas jaring itulah dengan bebas burung memakan padi yang siap panen. “Jumlahnya bisa mencapai ratusan ekor hinggap dijaring, ada juga yang lolos masuk melalui celah-celah jaring,” ungkap Karman, Selasa (20/ 11) di Sosor Dolok. Hama burung, katanya, juga menyerang tanaman padi petani di Desa Sianipar Sihailhail, Kecamatan Balige. Sama halnya di desa lain, warga juga sudah melakukan berbagai upaya untuk menghalau. “Sebulan ini rutin dijaga jangan habis total,” ujar T Tumanggor, petani di Desa Sianipar Sihailhail. Dia perkirakan, akibat serangan hama burung tersebut, hasil panen miliknya mengalami penurunan. Kepala Dinas Pertanian Kabupaten Toba Samosir Parlindungan Simanjuntak saat dikonfirmasi membenarkan hama burung melanda beberapa daerah pertanian di Tobasa. Kata Parlindungan,

gelombang serangan hama burung tersebut dikarenakan daerah Kecamatan Laguboti, Porsea, Ajibata sudah selesai melakukan panen. Diperkirakan, burung burung ini hijrah ke tempat lain untuk mencari tempat persediaan makanan yang baru. Perkembangan hama burung ini dipengaruhi oleh faktor, di antaranya, kelangsungan ketersediaan makanan bagi burung selalu ada karena menyangkut pola tanam. “Di satu desa sudah panen, tetapi di desa tetangga baru menguning. Karena ketersediaan makanan selalu tercukupi maka burung berkembang pesat. Itu lah kami selalu menyarankan agar pola tanam serempak dapat diterapkan diseluruh daerah di Kabupaten Toba Samosir,” kata Parlindungan seraya mengatakan keuntungan pola tanam serempak juga dapat meminimalisir serangan penyakit dan hama. Parlindungan juga menyampaikan, bahwa musim tanam di Desa Sianipar Sihailhail sempat mengalami keterlambatan, disebutkannya keterlambatan tersebut dikarenakan adanya pembangunan beberapa saluran irigasi seperti jitut dan jides. ”Setelah peningkatan saluran irigasi tersebut, saya yakin, kedepan masyarakat petani disana sudah dapat mengikuti pola tanam serempak,” tambahnya. (cr-03)

Siswa SMK Terima Sertifikat dari Imigrasi Sambungan Halaman 9 Menurutnya, selama mengikuti pelatihan di kantor imigrasi, para siswa diajarkan tentang tata cara penyusunan buku administrasi dan pengetahuan lainnya.

Ada pun para siswa yang menerima sertifikat penghargaan dari kantor imigrasi yakni Agustina Simanjuntak, Muliana Marbun, Murni, Yeni, Fauzi Tumbun, Ema Yanti, Fuspita, Muhayar, Ijo. (ilu)


RUMAH DUKA: Suasana haru di rumah duka almarhum Ebenezer Sitorus, Selasa (20/11).

Pulang Main Bola, Pelajar SMA Tewas Sambungan Halaman 9 menangis terisak, demikian juga kedua orangtua korban dan keluarga. Evi J Manurung, salahsatu teman satu sekolah korban, saat melayat ke rumah duka mengatakan, korban merupakan seorang siswa yang baik dan tidak pernah mendapat surat penggilan dari guru. “Saya terkejut mendengar

berita ini, padahal pukul 16.00 Wib sampai pukul 17.30 Wib saya masih menonton mereka main bola di sekolah. Dia (almarhum Ebenezer-red) siswa yang baik, tidak pernah dapat surat panggilan dari guru,” ujar Evi dengan raut wajah sedih. Salah seorang petugas medis di Rumah Sakit Umum Daerah (RSUD) Porsea membenarkan almarhum

sempat dibawa ke rumah sakit tersebut. Hanya saja, saat berada di rumah sakit, almarhum sudah meninggal. “Saat dibawa ke rumah sakit, almarhum sudah meninggal dunia, sementara rekannya sedang kritis. Kemudian keluarga yang kritis itu membawanya ke salahsatu rumah sakit di Pematangsiantar,” kata petugas medis yang enggan

disebutkan namanya. Sementara itu, Kapos Lantas Porsea Iptu D Aritonang membenarkan peristiwa lakalantas itu. Hanya saja, hingga Selasa (20/11), pihaknya belum tahu penyebab kecelakaan tersebut. Katanya, pihaknya masih melakukan penyelidikan dan olah Tempat Kejadian Perkara (TKP). ”Sejauh ini, penyebab kecelakaan belum dapat disimpulkan, petugas sudah mengamankan truk dan

sepedamotor korban. Sedangkan sopir truk melarikan diri. Jadi, kita masih melakukan penyelidikan,” ujar Aritonang. Ia menambahkan, selain melakukan olah TKP, pihaknya kini sedang mengumpulkan keterangan dari sejumlah saksi terkait kasus kecelakaan itu. ”Kasus ini masih dalam penyelidikan dan pengembangan. Supir truk sedang kita kejar,” ucapnya. (jantro/hsl)

25 November, 184 Calon Panwascam Ikuti Tes Tertulis 30 Tahun Air Masam Sambungan Halaman 9 Madina di jalan Willem Iskandar Dalan Lidang kecamatan Panyabungan, tepatnya di kator Kesbanglinmas Pemkab Madina. Dikatakan Hendri, selama proses pendaftaran yang dilakukan pada tanggal 6 sampai 20 November, jumlah pendaftar 194 orang, namun setelah dilakukan proses seleksi berkas yang lulus hanya 184 orang. Artinya yang gugur dalam proses seleksi sebanyak 10 orang. ”Penyebab keguguran semuanya adalah di faktor usia yang belum mencukupi 25 tahun,” sebutnya. Diceritakan Hendri, sejatinya proses pendaftaran ini ditutup pada tanggal 14 November kemarin. Namun akibat adanya bencana alam di tiga kecamatan wilayah pantai barat, maka jadwal pendaftaran diperpanjang sampai hari Selasa (20/11).

”Pelaksanaan ujian ini sebenarnya terlambat kita laksanakan, itu disebabkan karena waktu pendaftaran yang diperpanjang karena ada tiga kecamatan yang mengalami bencana alam. Mengenai jadwal ujian tertulis ini sudah diinformasikan kepada seluruh peserta yang sudah lulus pada proses seleksi berkas melalui nomor kontak telepon peserta dan juga melalui media massa. Ini agar semua calon peserta ujian mengetahui jadwal, ujian tertulis dilaksanakan selama seharian penuh. Untuk itu, bagi calon peserta yang berada jauh dari lokasi ujian, khususnya yang berada di pantai barat agar datang lebih awal ke Panyabungan. Sebab sebelum mengikuti ujian, terlebih dahulu akan dilakukan registerasi peserta,” bebernya. Pengumuman hasil ujian, sambung Hendri, juga akan diumumkan melalui media massa, baik cetak maupun

elektronik berupa radio. Selain itu Panwaslu Madina juga akan menyampaikan jadwal ujian dan pengumuman hasil ke semua kantor kecamatan di Madina agar peserta lebih mudah mengetahui informasi. Kata Hendri, ujian tertulis ini merupakan seleksi untuk mengikuti test berikutnya berupa wawancara. Setiap peserta dari setiap kecamatan akan mengikuti test wawancara sebanyak 6 orang yaitu bagi yang lulus pada ujian tertulis, lalu hasil ujian akhir berupa wawancara itulah nantinya akan diputuskan 3 orang terbaik menjadi Panwaslu kecamatan. ”Pendaftar tahun ini cukup banyak dan membludak dari setiap kecamatan, khususnya dari kecamatan Kotanopan, Panyabungan dan Siabu. Ini membuktikan bahwa partisifatif dan animo masyarakat kita tinggi dalam pengawasan Pemilu,” tambah Hendri diamini dua anggota yang lain. (wan)

Rusak Pertanian Warga

Sambungan Halaman 9 sampai 2 kali saja, tetapi sekarang mereka harus mengeluarkan biaya untuk 35 kali pemupukan. Selain itu air masam ini juga mengurangi mata pencaharian warga yang memiliki kolam ikan. Karena air masam ini menyebabkan tidak ada lagi ikan yang bertahan hidup, sehingga kolam-kolam ikan masyarakat sekarang tidak bisa lagi difungsikan. ”Dan bagi masyarakat sendiri, apabila mandi di irigasi di sekitar sawah mereka, mata terasa perih akibat air yang sudah bercampur air masam atau air yang telah bercampur dengan belerang itu. Selain itu warga tidak bisa menggunakan air di daerah persawahan untuk mencuci, karena kain akan menjadi lapuk dan mudah sobek apabila sudah kering,”

ucapnya. Seluruh warga tujuh desa di kecamatan itu berharap agar Pemerintah segera memberikan perhatian khusus dalam menuntaskan permasalahan air masam itu. Sebab hampir semua desa mengalami air masam, bahkan akibatnya banyak petani yang beralih profesi menjadi pedagang. ”Sebenarnya kami sudah beberapa kali menyampaikan ini kepada Pemerintah, namun sejauh ini belum ada tindaklanjutnya. Harapan kami pemerintah segera turun tangan dan memberikan penanganan khusus atas persoalan yang dihadapi warga, jika tidak saya yakin masyarakat akan terus terhimpit di bidang ekonomi karena rata-rata masyarakat di kecamatan Lembah Sorik Merapi adalah petani,” harapnya. (wan)

9 Dokter Cilik Ajak Masyarakat Jaga Kesehatan Sambungan Halaman 9 dan bersih sebagai upaya meningkatkan status kesehatan dan mencegah faktor resiko serta menggalang komitmen pemangku kepentingan pemerintah, dunia usaha, organisasi kemasyarakatan untuk pencapaian pembangunan bidang kesehatan. ”Untuk mendukung berbagai tujuan kegiatan HKN ini, Dinas Kesehatan disamping melakukan kalakarya PDBK, juga telah menggelar lomba memasak menu bagi ibu hamil dan balita oleh kelompok gizi

masyarakat. Tujuan lomba ini adalah untuk melatih para ibu agar mengelola makanan dengan baik dan memperhatikan nilai gizinya, dan juga lomba penyuluhan kesehatan berthema Ayo Ke Posyandu oleh kader-kader kesehatan dari 16 Posyandu yang ada di Madina, yang bertujuan untuk mengajak masyarakat terutama ibu, bayi dan balita agar berkunjung ke Posyandu memantau perkembangan kesehatan ibu, bayi, dan balita,” jelas Amri. Puncak kegiatan HKN ini, sambung Amri adalah Kalakarya PDBK melalui seminar dan nara sumbernya hadir

dari Direktorat Jenderal Bina Upaya Kesehatan Kementerian Kesehatan RI. ”Harapan kami kepada semua tamu undangan yang hadir mulai dari tingkat desa, perwakilan dari Perguruan Tinggi, LSM, organisasi profesi, hingga anggota dewan dan SKPD yang turut hadir, agar dapat ikut serta berperan aktif sehingga permasalahan kesehatan di Madina dapat diatasi dan mutunya semakin meningkat,” tambahnya. Wakil Bupati Madina Dahlan Hasan Nasution mengatakan, HKN ini diperingati setiap tahun bertujuan meningkatkan komitmen seluruh

pemangku kepentingan dalam pembangunan kesehatan, Indonesia Cinta Sehat merupakan refleksi dari sikap dan prilaku setiap insan Indonesia, khususnya masyarakat Madina demi menjadikan kesehatan sebagai dasar tindakan dan motivasi dalam kehidupan di tengah-tengah masyarakat. ”Namun dalam hal ini ada tantangan dan masalah kesehatan yang harus disikapi bersama, seperti masalah kesehatan yang disebabkan oleh sumber penyakit maupun yang disebabkan oleh pola konsumsi dan gaya hidup masyarakat itu sendiri. Untuk itulah diperlukan kordinasi,

dukugan, kerjasama dan keterlibatan lintas program dan lintas sektor yang akhirnya merupakan tanggung jawab bersama, sehingga diperoleh hasil masyarakat Madina yang mandiri dalam menjaga kesehatannya,” ucap Dahlan. Kegiatan HKN ditutup dengan Kalakarya PDBK yang diikuti ratusan masyarakat, mahasiswa dan PNS di lingkungan Pemkab Madina. Dan sebelumnya juga anakanak usia TK tampil menunjukkan tari kreasi, dan 9 dokter kecil melakukan peragaan untuk mengajak masyarakat menjaga kesehatan. (wan)


WALAH ! Perempuan Alami Depresi Setelah Bercinta TIDAK semua wanita usai melalukan hubungan seks merasakan kenikmatan dan kebahagiaan. Satu dari tiga perempuan justru malah terbukti mengalami depresi usai aktivitas tersebut. Mengapa? Survei yang dilakukan terhadap 200 wanita di Australia menyebutkan sekitar 33% responden menjawab mereka pernah merasa depresi setelah bercinta. Oleh para ahli perasaan itu disebut dengan 'post-sex blues' atau rasa murung seusai bercinta. "Dalam situasi normal, sesudah berhubungan seks seseorang akan merasa nyaman, bahagia dan juga rileksasi psikologi dan fisik. Namun ternyata ada sebagian wanita yang justru merasa melankolis, cemas, menangis dan

gelisah," kata ketua peneliti Robert Schweitzer dari Queensland Institute of Technology. Hasil survei itu mengejutkan karena bertentangan dengan anggapan banyak orang akan aktivitas seksual sebagai kegiatan menyenangkan dan menguatkan hubungan emosional dengan pasangan. Schweitzer mengatakan belum mengetahui apa yang memicu timbulnya perasaan murung usai bercinta. "Penyebanya biasanya tidak diketahui. Ada seorang wanita yang mengatakan ia merasa lebih melankolis setelah bercinta, tetapi hal itu tidak ada kaitannya dengan perasaannya pada pasangannya," katanya. Ada beberapa hal yang bisa menyebabkan rasa bersalah, malu, dan tak berminat pada hubungan seksual, misalnya saja trauma akibat kekerasan seksual di masa lalu. Namun para responden dalam survei itu umumnya tidak mengetahui darimana datangnya rasa murung dan depresi mereka. Untuk mengungkap pemicu perasaan tersebut Schweitzer sedang melakukan penelitian lanjutan. "Mungkin memang ada kecenderungan bilogis yang berpengaruh," katanya.(int)

Sebagian wanita yang tinggal di kota-kota besar cenderung memiliki beragam aktivitas dan mengesampingkan olahraga. Padahal olahraga merupakan hal sangat penting terlebih dalam kaitanya dengan kesehatan tubuh. Dengan olahraga, kita dapat menjaga kesehatan tubuh dan mencegah datangnya berbagai macam penyakit. Karena itu, diperlukanlah cara tersendiri untuk dapat berolahraga di sela-sela kesibukan tersebut dan tips mengenai olahraga untuk orang sibuk ini akan sangat membantu. Berikut beberapa jenis olahraga yang dianjurkan bagi perempuan super sibuk, seperti dilansir Prevention Lompat tali Latihan ini bisa membakar 340 kalori hanya dalam 30 menit saja. Hal ini sebanding dengan stationery bicycle selama 30 menit. Keunggulannya, kita tak perlu bersusah payah meluangkan waktu ke gym, hemat biaya, hemat tempat, dan jelas hemat biaya. Satu lagi, kita bahkan tak perlu khawatir jika tak punya skipping rope. Pasalnya, gerakan melompat tetap efektif tanpa tali sekalipun. Agar hasilnya maksimal, bukalah sedikit kedua kaki saat melompat. Usahakan agar lompatanlompatan yang dibuat tak jauh dari tanah. Yoga Lakukan yoga selama 20 menit di meja Anda. Hal ini bisa berfungsi menenangkan pikiran tentang pekerjaan yang menumpuk. Berjalan Kurangi telefon untuk memerintah seseorang. Akan lebih baik jika menemuinya langsung. Dengan begitu, mau tidak mau Anda harus berjalan. Paling tidak ini sangat bermanfaat sebagai latihan kardio. Jika biasanya Anda memilih jalan yang tercepat menuju kantor, mulai sekarang pilihlah jalan yang memutar. Hal itu akan memaksa Anda untuk berjalan kaki. Usahakan setiap hari berjalan kaki selama 20-30 menit atau sekitar 3000 - 5000 langkah. Kalori Anda akan banyak terbakar. Otomatis tubuh menjadi lebih sehat. Gerakan-gerakan otot ringan Di sela-sela waktu rehat juga dapat dimanfaatkan untuk berolahraga ringan seperti melakukan gerakan pengencangan pada otot-otot perut dan lengan selama beberapa menit dan diulangi beberapa kali. Atau dapat juga melakukan gerakan-gerakan pengencangan dengan menggunakan barbell yang paling kecil yang mudah dibawa kemana-mana dan mudah disimpan. Tak hanya itu, sejumlah peregangan atau stretching pada waktu istirahat atau sesaat sebelum mulai bekerja pada beberapa anggota tubuh seperti tangan, kaki, leher, punggung dan anggota tubuh yang lain. Hal ini dapat dilakukan dengan menahan posisi peregangan setidaknya dalam hitungan 2 x 8 atau bisa juga dalam waktu tiga menit. Olahraga untuk wanita sibuk itu memang terkesan simple dan seakan tidak mampu memberikan efek yang signifikan bagi tubuh, namun jika dilakukan secara rutin, akan dapat memberikan hasil yang tidak kalah memuaskannya dengan olahraga biasa. Sehingga kesehatan dan kualitas hidup pun akan tetap terjaga walaupun kesibukan melanda. (int)

Waspada, Penderita Insomnia

Lebih Cepat Meninggal

SEBUAH penelitian baru di Finlandia menunjukkan bahwa kasus sulit tidur bisa jadi menurun dan penderita insomnia lebih mungkin untuk meninggal lebih cepat dibandingkan orang dengan pola tidur yang sehat. Menurut laporan media Finlandia, Senin (4/7/ 2011), penelitian tersebut adalah yang pertama yang mengaitkan insomnia dengan risiko kematian. Penelitian tersebut dilakukan oleh Institute of Occupational Health melalui kerja sama dengan University of Helsinski dan Finnish National Institute for Health and Welfare. Dalam studi terhadap orang kembar yang berskala luas, para peneliti Finlandia mengikuti status kesehatan 12.500 pasangan kembar dewasa selama 1990 sampai 2009, demikian laporan Xinhua, Selasa. Sebanyak 20 persen peserta menderita gejala kurang tidur, termasuk kesulitan untuk mulai tidur, terbangun pada larut malam dan tidur yang tidak mengembalikan stamina tubuh. Dibandingkan dengan orang kembali yang tidak identik, orang kembar identik lebih mungkin untuk menderita gejala insomnia yang sama. Temuan tersebut menunjukkan faktor genetika memainkan peran dalam

pembentukan insomnia. Selain itu, para peserta tersebut dibagi jadi tiga kelompok, menurut kualitas tidur mereka. Di antara semua peserta, 48 persen adalah orang yang tidur dengan baik, 40 persen tidur rata-rata dan 12 persen orang yang tidur dengan buruk. Hasil penelitian itu memperlihatkan gejala yang berkaitan dengan insomnia mungkin meningkatkan risiko kematian. Sementara itu dibandingkan dengan orang yang tidur dengan baik, tujuh persen perempuan dan 22 persen lelaki yang tidur rata lebih mungkin untuk meninggal lebih cepat; dan orang tidur dengan buruk 1,5 kali lebih mungkin untuk meninggal lebih cepat. Menurut para peneliti tersebut, kekurangan tidur adalah masalah kesehatan umum di kalangan kelompok usia kerja. Kekurangan tidur kronis meningkatkan risiko banyak kecelakaan dan penyakit, sehingga memperlemah kualitas hidup orang dan kemampuan untuk bekerja secara layak. Para ahli tersebut menyatakan penderita insomnia mesti berusaha memperoleh perawatan medis tepat pada waktunya, dan pasien insomnia kronis mesti dirawat dengan cara lebih baik dengan terapi tanpa obat.(int)


20 November 2012

Zaskia Sungkar

Gagal menikah dengan aktor muda Iko Uwais tak membuat Jane Shalimar larut dalam nestapa. Ia malah mendapatkan calon suami bukan sembarangan orang. Jane Shalimar segera naik pelaminan pertengahan Desember 2012. Ibu satu anak ini kabarnya akan disunting oleh Mahardika Soekarno Putra atau Didi, anak Rachmawati Sukarno Putri. Pasangan ini juga akan

Ketagihan Jalan di Catwalk

Berlenggak lenggok di atas catwalk bukan hal baru bagi Zaskia Sungkar. Tak heran, ketika diajak untuk memamerkan busana rancangan istri Indra Bekti, Adila Jelita, Zaskia tak bisa menolaknya. ”Ini bukan yang pertama aku jalan di catwalk. Kemarin sempat ikutan di Jakarta Fashion Show, itu baru pertama di event besar,” ujar Zaskia saat ditemui di acara fashion show, Indra Indri & Dilla Albis, Plaza FX, Jakarta, Selasa (20/ 11). Zaskia ketagihan saat menjajal catwalk di event besar JFW. “Pas ngerasain di JFW kemarin jadi ketagihan, enak juga, seru ternyata jalan di catwalk, deg-degan soalnya,” ujarnya malu-malu. Diungkapkan Zaskia, ia nyaris tak bisa menahan tawa saat tampil bersama Nycta Gina dalam fashion show kali ini. “Aku menahan ketawa, habis ada Gina, kocak, tapi seru sih,” tawanya. (nov/int)

SCORPIO (23 Oktober – 22 November) Karier: Cobalah lebih terbuka dalam menghadapi masalah Anda. Komunikasikan dengan atasan dan rekan kerja Anda. Asmara: Patah hati tidak membuat Anda menjadi tak bergairah. Dari sejumlah ‘fans’ Anda, ada yang berniat serius.

Paramitha Rusady akhirnya resmi bercerai dengan suaminya Nenad Bago. Setelah berbulan-bulan menjalani proses persidangan di Pengadilan Agama Jakarta Selatan, Mitha dan Nenad Bago diputus cerai oleh hakim. “Hari ini agendanya keputusan. Permohonan talak dikabulkan,” kata kuasa hukum Nenad Bago, Anthony Alexander SH saat dijumpai di Pengadilan Agama Jakarta Selatan, Selasa (20/11). Selain bercerai, ketua majelis hakim sudah mengabulkan

(20 Januari - 18 Februari)

Karier: Janganlah memaksakan diri menerima semua tawaran kerja di kantor. Mintalah waktu istirahat, sebelum kondisi Anda bertambah buruk. Asmara: Semakin hangat.


19 Februari - 20 Maret

Karier: Perkembangan karier Anda sangat cerah dan cukup menjanjikan di masa yang akan datang. Asmara: Sulit-sulit dahulu, bersenangsenang kemudian alias Anda harus berusaha lebih keras lagi untuk merebut hatinya.


dibahas oleh keluarga masingmasing. Lewat akun twitternya, Jane sempat mencetuskan tanggal pernikahannya dengan Didi, yaitu 12-12-2012. Wah, tanggal cantik dong? Mantan kekasih Iko Uwais ini sudah memesan kebaya pengantin dari desainer Anne Avantie. Dari pernikahan sebelumnya, Jane dikaruniai satu anak bernama Muhammad Zarno. (tr/int)

mengumpulkan buku yang ia baca sejak kuliah. Setahun belakangan, ia mulai tertarik dengan buku digital. Dan suaminya, Reza Gunawan, lah yang berjasa menginisiasi Dee. Bahkan ia sering membeli buku digital, jika tak ada buku yang ia maksud, barulah membeli buku konvensional. Sekarang, ia telah merasakan manfaat membaca buku digital. Ia tak “dijajah” oleh koleksi bukunya. Mau tak mau, penulis pun akan memasuki sebuah transisi. Dari buku konvensional ke teknologi buku digital. Penulis Supernova dan Madre ini mengatakan bahwa tiga tahun silam, dirinya belum melirik buku digital. Dengan membeli, lalu membaca buku konvensional, ia merasa ada kenyamanan dan romantisme tersendiri. Didukung pula, ia berkecimpung di dunia tulis menulis. Buku menjadi bagian dari pekerjaannya. (tr/int)

(21 Desember -19 Januari)

Karier: Perubahan jam kerja di kantor, membuat Anda repot membagi waktu untuk urusan kantor dan keluarga. Asmara: Tidak ada masalah, bahkan bisa dibilang semakin dekat.


Anto. Sebagai asisten, Anto juga tak tahu sejak kapan keduanya berkenalan dan resmi berpacaran. Rencana pernikahan itu dibenarkan Sunan Kalijaga, pengacara yang juga sahabat dekat Didi. Ia mengaku sudah mendapat kabar bahagia itu langsung dari yang bersangkutan. “Sebagai sahabat Didi dan Jane, saya menyambut positif kabar bahagia itu,” kata Sunan, Selasa (20/11). Menurut Sunan, rencana pernikahan mereka itu masih

Kegemarannya membaca dan profesinya sebagai penulis membuat Dewi Lestari menjadi kolektor buku. Namun, buku simpanannya seolah menjajahnya. Banyak ruangan habis karena bukunya yang jumlahnya sudah sangat banyak. “Buku menjadi bagian dunia pustaka, tapi lamalama saya dijajah sama buku. Perpustakaan saya menghabiskan space dari ruangan manapun,” ujar Dee, sapaan akrabnya di Jakarta. Maklum, sebagai seorang penulis, Dewi Lestari sangat gemar membaca buku. Ia rutin



menggelar prosesi lamaran. “Lamarannya mungkin akhir bulan ini (November),” ujar Anto, asisten Didi melalui sambungan telepon, Selasa (20/ 11). Namun Anto enggan menjelaskan lebih jauh soal tanggal serta tempat lamaran itu. Yang pasti, Jane sudah mulai mencari model kebaya di sebuah butik milik desainer ternama. ”Belum fitting tapi masih caricari (model) aja. Saya ikut nemenin Jane juga kok. Jadi memang belum fitting,” jelas

(21 Maret - 20 April)

beberapa keputusan yang sempat diajukan oleh kedua belah pihak. “Kesepakatan lain dikabulkan juga. Kita diminta untuk melakukan sesuai kesepakatan. Perjanjian untuk anak, nafkah, dan hak asuh,” jelas Anthony. (nov/int)

Karier: Berkat usaha Anda yang cukup gigih, maka hasilnya sudah mulai terlihat bagus. Asmara: Hari-hari bersamanya terasa manis dan sangat menyenangkan.


(21 April - 20 Mei)

Karier: Urusan pekerjaan Anda di kantor adem ayem dan tidak terlalu sibuk. Asmara: Pertemuan manis dengan seseorang membuat hidup Anda terasa lebih bersemangat.


(21 Mei - 20 Juni)

Karier: Banyak kejadian yang menyenangkan maupun yang menyebalkan. Hal itu akan membuat konsentrasi kerja Anda sedikit terganggu. Asmara: Semakin bersemi. Waspada, hal ini bisa membuat Anda lupa diri.


(21 Juni- 20 Juli)

Karier: Ada kesibukan baru yang akan segera menyita waktu Anda. Proyek ini kelak akan menjadi tambahan pemasukan bagi Anda. Asmara: Teman baru bertambah, ada yang ingin mendekati Anda. Tetapi jangan terlalu berbesar hati dulu.


(21 Juli-21 Agustus)

Karier: Beberapa pekerjaan yang tengah Anda lakukan dapat menimbulkan risiko. Berhati-hatilah dalam mengambil keputusan. Asmara: Berjalan lancar. Hanya saja, Anda harus bersikap sedikit lebih romantis.


(23 Agustus-22 September)

.Karier: Banyak dukungan dari teman

dan anggota keluarga. Kondisi itu harus dipertahankan, supaya Anda tidak membuat kesalahan yang sama dua kali. Asmara: Siap-siap akan ada kejuatan dari pasangan Anda, yang selama ini ditunggu-tunggu.


(23 September - 22 Oktober)

Karier: Ada pekerjaan baru yang lebih menantang. Jika berhasil, promosi jabatan menanti Anda Asmara: Hampir tidak ada konflik. Tetapi jangan menurunkan perhatian Anda.


( 23 November - 20 Desember)

Karier: Kesibukan kerja semakin bertambah. Cari waktu untuk beristirahat. Asmara: Bertemu teman lama yang mengajak bernostalgia.

SETELAH menikah pada 29 September, pasangan Hollywood Anne Hathaway dan Adam Shulman ingin segera membangun sebuah keluarga. Anne pun berharap dirinya bisa hamil secepatnya. ”Aku ingin sekali punya bayi,” ujarnya seperti dilansir The Hollywood Reporter, Selasa (20/11). Bintang film ‘The Dark Knight Rises’ itu memang cukup lama memendam impiannya menjadi seorang ibu. Salah satu temannya mengungkapkan, Anne adalah perempuan tradisional. Ia hanya mau punya anak setelah resmi menikah. Anne dan Adam menikah setelah empat tahun berpacaran. Anne berhubungan dengan Adam setelah putus dari kekasih lamanya, Raffaello Follieri pada 2008 lalu. Mereka menggelar pernikahan secara tertutup di Big Sur, California. Kabarnya hanya ratusan orang saja yang menghadiri acara tersebut. (dtc/int)

ORANGTUA khawatir Gisel ‘Idol’ dilamar Gading Marten. Mengapa? ”Orangtuaku malah khawatir, aku kan, anak tunggal dan perempuan. Masih umur segini (21 tahun), dianggap masih kecil, jadi kekhawatiran banyak. Mereka kasih izin sih, tapi kasih wejangan banyak banget, selalu diingetin,” ungkapnya di Kebon Jeruk, Jakarta Barat, Selasa (20/ 11). Namun, bukan berarti Gisel tak boleh menikah dengan Gading.

Malahan, kedua orangtuanya ingin Gisel mandiri bersama Gading. ”Malah mama yang ngomong, dari dulu sebelum aku niat menikah. ‘Mama mending tinggal sendiri, pusing lihat kamu sama suami kamu’,” kata Giselle menirukan ucapan mamanya. Sengaja Bikin Gading Cemburu Ingin diperhatikan, Gisel ‘Idol’ sengaja membuat Gading Marten cemburu. ”Dia (Gading) susah cemburunya, kadang aku pancing-pancing biar dia cemburu,” ujar Gisel di RCTI, Kebon Jeruk, Jakarta Barat, Selasa (20/11). ”Aku senang kalau dia cemburu. Habis aku cemburuan dia nggak pernah cemburu,” imbuhnya. Namun, karena seprofesi, Gisel tak pernah marah karena cemburu berlebihan. (idc/int)


21 November 2012


PEMILIK Rumah Bordil

Setinggi 9 Meter MANCHESTER - Sebuah pohon natal unik dibangun di Manchester, Inggris. Pohon natal itu memiliki tinggi 9 meter dan disertai 108 cabang pohon serta 450 pernak-pernik. Pohon natal terbuat dari 350.000 buah lego ini dipamerkan di Manchester Trafford Centre pada awal bulan ini. Menjelang Natal lazimnya banyak ulah unik yang dilakukan untuk merayakannya. Selain 108 cabang yang dihiasi dengan pernak-pernik 450 Lego dan

Jadi Kepala Daerah NEVADA - Lance Gilman, pengusaha rumah bordil yang sudah menyediakan lapangan pekerjaan kepada 80 orang pekerja seks komersil (PSK) terpilih sebagai Kepada Daerah Storey, Negara Bagian Nevada, Amerika Serikat (AS). Gilman menjadi pengusaha rumah bordil pertama yang terpilih sebagai kepala daerah.

Lance Gilman

Pemilik rumah bordil The Mustang Ranch itu menjadi kepala daerah pertama yang memiliki latarbelakang sebagai pengusaha di sektor prostitusi. Nevada sendiri sudah melegalkan praktik prostitusi sejak 1971 silam. Pria berusia 68 tahun itu merupakan seorang politisi Partai Republik yang mengaku cinta dengan Amerika. Saat berkampanye di wilayah yang dihuni 4 ribu jiwa, Gilman berhasil meraih 62 persen suara. ”Dia merupakan seorang yang langka, tentu saja itu karena prostitusi merupakan bisnis ilegal di seluruh wilayah AS, kecuali di wilayah pedalaman Nevada,” ujar sejarahwan Guy Rocha, Selasa (20/11). Gilman adalah seorang ayah dari empat orang anak dan kakek dari sembilan cucu. Salah satu putrinya bekerja di sektor usaha keluarganya. Sekira 20 rumah bordil dioperasikan secara legal di 10 wilayah pedalaman Nevada. Selain wilayah-wilayah itu, Las Vegas dan Reno juga menjadi wilayah yang menghalalkan praktik bisnis seks. Rumah bordil yang dikelola Gilman terletak di sepanjang jalan antar-negara bagian dari wilayah timur Reno. Selama ini, rumah bordil Gilman sudah memberikan kontribusi sebesar USD5 juta atau sekira Rp48 miliar (Rp9643 per USD1) terhadap anggaran daerah. The Mustang Ranch juga mempekerjakan 44 orang karyawan tetap dan 80 orang PSK. Gilman menegaskan bahwa, 99 orang warga memandang rumah bordil itu bak bisnis pada umumnya. Namun Gilman mengaku, bisnis pelacuran adalah bisnis yang dapat membantu kesejahteraan AS. (oz/nik)



„ Sia Ka Tian (70) mengembalikan uang sebesar lebih dari Rp 8 miliar milik penumpang yang tertinggal di dalam taksinya.


Kembalikan Uang Rp8 Miliar SINGAPURA-Apa yang akan Anda lakukan jika menemukan uang sebesar 900.000 dollar AS atau sekitar Rp8,6 miliar? Bagi seorang pengemudi taksi asal Singapura, Sia Ka Tian (70), jawaban dari pertanyaan tadi adalah mengembalikan uang itu ke pemiliknya. Sia Ka Tian sangat terkejut saat menemukan kantung hitam berisi uang di kursi belakang taksinya, setelah dia mengantar penumpangnya ke sebuah pusat perbelanjaan di Singapura. “Saat saya melihat uang itu, saya berfikir, saya akan kena masalah. Saya yakin sedikitnya ada 200.000 dollar AS di dalam kantung itu,” kata lelaki yang sudah 31 tahun

mengemudikan taksi itu seperti dikutip harian The Strait Times. Namun, saat dia membawa kantung berisi uang itu ke bagian barang hilang perusahaan taksinya Comfort DelGro, betapa terkejutnya Tian dan kawannya setelah tahu jumlah uang itu.”Uang itu tidak penting bagi saya. Itu bukan milik saya, jadi bagaimana bisa saya menggunakannya?” ujar Tian. Pasangan wisatawan asal Thailand kemudian melaporkan kehilangan mereka ke perusahaan itu. Tian menunggu mereka saat wisatawan itu datang untuk mengambil uangnya yang sempat hilang itu.

Sebagai tanda terima kasih Sia Ka Tian menerima sejumlah uang dari kedua turis itu yang tak ingin disebutkan namanya. Perusahaan juga berencana memberi penghargaan untuk Sia Ka Tian atas pelayanannya yang sangat baik itu. ”Menemukan hampir satu juta dollar AS tunai tak mungkin terjadi setiap hari dan kami bertanya-tanya berapa banyak orang yang tergoda untuk memilikinya,” kata juru bicara perusahaan taksi Comfort DelGro, Tammy Tan. ”Kami sangat bangga kepadanya dan senang penumpang kami akhirnya menemukan uang mereka,” lanjut Tammy.(kps/nik)


PAMERAN-Pohon Natal sebagai pameran yang terbuat dari Lego dibangun di Manchenster, Inggris.

PRIMATA JUGA ALAMI KRISIS PARUH BAYA LONDON- Penelitian tentang primata menunjukkan hewan ini kemungkinan mengalami krisis paruh baya seperti halnya pada manusia. Para ilmuwan melakukan penelitian atas 500 simpanse dan orangutan di seluruh dunia.Para petugas dan sukarelawan diminta untuk menilai sikap primata yang mereka jaga, termasuk interaksi sosial.Sejumlah penelitian dalam sepuluh tahun terakhir menunjukkan kebahagian manusia cukup tinggi pada masa muda dan turun pada usia paruh baya kemudian naik lagi dalam usia tua. Hasil penelitian yang diterbitkan dalam jurnal Proceedings of the National Academy of Sciences menyebutkan pola yang sama terjadi pada simpanse dan orangutan yang tinggal di kebun binatang dan pusat penelitian di seluruh dunia.Andrew Oswald,

TOYOTA 100% BARU Dealer Resmi

•Carry 1.5L Flat Deek Pick Up (bonus Tape CD) DP17,86Jt-an; Angs 2,43Jt-an •Mega Carry APV Pick Up DP 22,26Jt-an; Angs 2,478Jt-an •Ertiga DP 39,62Jt-an; Angs 4,101Jt-an •Carry Real Van GX DP 36,489Jt-an; Angs 3,614Jt-an •APV GL DP 36,79Jt-an; Angs 3,325Jt-an Proses Cepat Data di Jemput HUB:

Ready Stock: All New Avanza, Vioz, Innova, Yaris, Fortuner, Dyna. Dapatkan Diskon Special + Hadiah langsung (Kaca Film, Car Wash & Alas Dasar). Proses cepat, angsuran ringan, dan data siap dijemput. Hub: RICCA - 0852 7601 8718; 0821 6436 9189

“NANANG JOK”, Spesialis : Lapis Jok, Alas Dasar, Door Tream, Flafon, Tenda Cafe. Jl. Jend. Sudirman Simp. Sipare-pare, B.Bara. Hub: NANANG - 0821 6206 4560 - 0852 6263 4508

ikan, burung, bibit ayam, itik. Sedia, obat-obatan unggas serba lengkap. Hub: 0812 6590 2828. Jl. Besar Indrapura Dusun 2 Titi Payung (dkt kantor Gerai Samsat), Indrapura

ARDI - 0812 6582 0292

lampu-lampu berkelap-kelip, pengunjung juga bisa melihat ke Lego Harry Potter tokoh yang dibuat untuk menjaga pohon, Selasa (20/11). Sebelumnya pada tahun 2011, sebuah perusahaan mainan membangun pohon natal dengan tinggi 12 meter. Pohon natal itu terbuat dari 600.000 batu bata Lego di St Pancras International di London. Pohon itu juga dilengkapi 172 cabang dan lebih dari 1.000 pernakpernik didalamnya. (oz/nik)

USAHA TERNAK: Jual makanan ayam,

„ Simpanse peneliti dari Universitas Warwick, Inggris, mengatakan krisis paruh baya ini kemungkinan terjadi karena lingkungan primata serupa dengan interaksi sosial pada manusia. Masalah Biologi Oswald mengatakan kemungkinan primata juga merasa kecewa bila misalnya


Agen Kelapa Santan utk wilayah Medan, P.Siantar, Simalungun. Daging tebal, santan banyak. Cocok untuk pembuatan es dawet dll. Harga Rp5.000/gandeng diantar sampai tempat. Harga bisa naik/turun sewaktu-waktu tergantung permintaan pasar. Kelapa dari Batubara. Berminat, Wilayah P.Siantar hub: 081260623215. Medan hub: 081264745666 a/n Heri

BAKSO PAKDE: Sajian Bakso, Mie

Ayam, Nasi Goreng, Mie Goreng, Minuman : Jus Tomat, Jus Mangga, Jus Wartel, Jus Timun, Jus Pokat, Jus Jeruk. Hub: 081376453399 – 082364321148 - 081990414222. Simpang Kuala Tanjung (INALUM)

mereka tidak menjadi jagoan di dalam kelompoknya.Sementara peneliti lain, Profesor Alexander Weiss dari Universitas Edinburgh mengatakan hasil itu menunjukkan krisis paruh baya dapat diterangkan secara biologi dan fisiologi.”Di satu sisi kemungkinan ada faktor sosial yang memicu

DICARI: Agen / Pangkalan LPG 12 Kg Untuk Wilayah Tapanuli Selatan, Palas, Paluta, Madina. Juga melayani pembelian Eceran LPG 12 Kg, diantar ketempat. HUBUNGI: Telp: (0634) 21673; Hp: 0813 7716 3667; Jl. Wr. Supratman No. 17 Kota Padangsidimpuan


Rahasia Untuk Pria Gagah & Perkasa: Memperbaiki masalah Prostate, Menghilangkan Sakit Pinggang, Kegairahan Pria, Kualitas Sperma, menghilangkan Lemak, Mencantikan kulit tubuh, Tekanan darah, Liver, Kolestrol, Dll. HUB: 0823 6597 9555

(kriris paruh baya) namun ada sesuatu yang lebih dalam pada penelitian ini dan mencakup sejarah evolusi manusia yang serupa dengan simpanse dan orangutan. Jadi, apa yang terjadi adalah masalah biologi,” kata Weiss. Primata yang diteliti termasuk 155 simpanse di kebun binatang Jepang, 181 ekor di Amerika dan Australia serta 172 orangutan di kebun binatang sejumlah negara termasuk Kanada dan Singapura.Tiga kelompok primata yang diteliti menunjukkan binatang ini mengalami krisis paruh baya dengan titik nadir pada usia 28 dan 35 tahun sementara manusia pada umur antara 45 sampai 50 tahun. PALING CERDAS Simpanse betina berumur 20 tahun dari kawasan konservasi di Pulau Ngamba, Uganda, dinyatakan sebagai simpanse paling cerdas berdasarkan riset Max Planck

ORIGINAL PENLUB. Formula unik PENLUB dari Lubri-Lab dengan kombinasi dari bahan-bahan yang sangat penting untuk membersihkan, melumasi & melindungi logam. PENLUB menembus pori-pori logam,melarutkan karat,membersihkan gemuk&kotoran, menghilangkan kelembaban, dgn kemampuan dielektriknya yang unik. HUB : 0813 6113 2128 di KISARAN

MAJESTYK: Menyediakan berbagai macam jenis roti dan Bolu seperti : Bika Ambon, Lapis Legit, Kue MP, Bolu Gulung, Roti Tawar, Donat dan Berbagai macam Kue Lainnya, juga menyediakan pesanan untuk acara Rapat, Arisan & Ulang Tahun. Hub: 0622-646300 ; Jl. Jend. Sudirman No. 75 INDRAPURA, Kab. Batubara.

Institute for Evolutionary Anthropology di Leipzig. Natasha dinobatkan sebagai simpanse ‘genius’ setelah melalui beberapa tes. Beberapa tes yang dilalui antara lain tes pengetahuan spasial, menghindari jebakan, mencari makanan serta mengenali warna, ukuran dan bentuk. Esther Herrmann dan Josep Call, para peneliti, mengidentifikasi kecerdasan hewan dengan cara melihat perilakunya. Di antaranya, apakah simpanse menggunakan peralatan untuk tujuan tertentu, pemahaman kuantitas serta kemampuan mengambil kesimpulan. Contoh simpanse cerdas yang pernah dijumpai adalah simpanse yang menggunakan peralatan untuk mendapatkan rayap. Simpanse mencabut batang pohon, membersihkannya dari daun dan membaginya menjadi dua sehingga salah satu ujungnya menjadi berserabut. (kps/nik)



21 Nopember 2012

Pemain Bulutangkis Indonesia


Dari empat wakil Indonesia di tiga nomor yang mesti melalui babak kualifikasi Hong Kong Open, dua tiket sudah digenggam Belaetrix Manuputty dan Andre Kurniawan Tedjono. Sementara satu tiket yang melayang gagal disabet duet ganda campuran.

Pasangan ganda campuran Alvent Yulianto Chandra/Rizki Amelia Pradipta,

sudah lebih dulu gugur di fase perdana babak kualifikasi. Keduanya tumbang dari duet China, Qiu Zihan/Luo Yu setelah dinyatakan

kalah WO alias Walk-Over. Tetapi harapan masih ada di pundak Belaetrix di nomor tunggal putri serta Andre, yang tampil di tunggal putra. Sebelumnya pagi tadi, baik Belaetrix maupun Andre, sukses melewati babak pertama kualifikasi atas lawannya masing-masing. Belaetrix menang straight set, 21-18 dan 2118, atas pebulutangkis tuan rumah, Cheung Ngan Yi. Sementara Andre juga menang lewat dua set langsung, 21-13 dan 21-9, dari wakil Rusia, Ivan Sozonov. Babak kedua pun mesti dimainkan

Belaetrix dan Andre, beberapa jam setelah fase awal, atau tepatnya Petang ini. Belaetrix harus melewati rubber set, 6-21 21-16 dan 2118, dari wakil Jepang, Nozomi Okuhara. Adapun Andre yang dibabak kedua bersua Tanongsak Saensomboonsuk, juga dipaksa main tiga set sebelum menamatkan pebulutangkis Thailand itu dengan kemenangan, 19-21 21-10 dan 21-14. Dengan begitu, Belaetrix dan Andre dipastikan maju ke putaran final, menyusul sejumlah rekannya yang sudah otomatis masuk ke putaran final. (int)

Heboh Tulisan Allah di Kepala CR7 Di tengah ramai pemberitaan cedera pelipis Cristiano Ronaldo saat menghadapi Levante, ada kisah lain yang tak kalah heboh. Itu terkait dengan pola rambut CR7 yang terlihat membentuk tulisan Allah. Pelipis kiri Ronaldo mengeluarkan darah segar saat Real Madrid bertamu ke Levante dalam lanjutan Liga Spanyol, Senin (12/11) dinihari WIB. Kepala CR7 berbeturan dengan sikut David Navarro dalam sebuah perebutan bola di udara, yang membuat pesepakbola asal Portugal itu mengalami masalah pengelihatan dan kemudian ditarik keluar. Saat mendapatkan perawatan di pinggir lapangan akibat cedera tersebut, salah satu kamera televisi menyorot Ronaldo dari arah belakang. Pada momen itulah terlihat tulisan Allah terbentuk akibat pola rambut Ronaldo. Video tersebut kemudian di-upload di Youtube dengan judul “Allah written in Arabic on Cristiano Ronaldo’s head?” dan mengundang banyak komentar. Ada yang meragukan keaslian potongan gambar tersebut dan menganggapnya sebagai hasil olah digital. Namun pada beberapa video lain yang menampilkan

momenperistiwayangsama,tulisandikepala Ronaldo tersebut masih terlihat. Karena Ronaldo selama ini dikenal suka berganti-ganti gaya rambut, ada yang beranggapan lafaz Allah tersebut hanya kebetulan semata. Apalagi rambut

Dengan usianya baru 25 tahun, Maria Sharapova memiliki banyak keinginan untuk dilakukan. Petenis rangking dua dunia itu mengungkapkan keinginannya untuk membintangi film Hollywood pada suatu saat nanti. Dengan parasnya yang c a n t i k , keinginan itu bisa saja terwujud.

Ronaldo ketika itu sudah tak lagi rapi di tengah pertandingan. Sementara yang lain menganggapnya dengan berbeda. Yang jelas, Ronaldo adalah salah satu pencetak gol kemenangan 2-1 El Real dalam laga itu. (int)

Jorge Lorenzo

Pertimbangkan Pensiun Setelah 2014 JORGE Lorenzo akan fokus membalap untuk Yamaha dalam kurun waktu dua tahun ke depan. Setelah itu, Lorenzo akan mempertimbangkan masa depannya di dunia MotoGP. Lorenzo baru saja sukses merebut gelar juara dunianya yang kedua pada tahun ini. Dia tampil sangat baik sepanjang musim, finis pertama atau kedua hampir di semua seri. Rider yang kini berusia 25 tahun itu cuma gagal di Assen dan Valencia karena mengalami kecelakaan. Lorenzo sebenarnya punya peluang untuk pindah ke Honda karena dia ditawari jadi pengganti Casey Stoner yang pensiun. Tapi, dia menolak dan memilih untuk meneken kontrak baru berdurasi dua tahun dengan Yamaha. “Saya akan membalap untuk dua tahun ke depan. Setelah itu, kita lihat saja,” tuturnya yang dikutip Autosport. “Saat masih 15 tahun, segalanya menyenangkan, tapi kemudian olahraga ini bisa jadi rutinitas,” kata Lorenzo. Selain itu, kecelakaan fatal yang dialami Marco Simoncelli tahun lalu juga jadi bahan pertimbangan Lorenzo sebelum memutuskan kelanjutan kiprah di ajang balap motor paling bergengsi ini. “Kematian Marco Simoncelli merupakan sebuah pukulan untuk kita semua, dan membuat kita berpikir bahwa itu bisa terjadi ke siapa saja. Tapi, kami tahu bahwa risiko adalah bagian dari olahraga,” ujarnya.(int)

dilansir Larry Brown Sports. Selain beraksi di lapangan tenis, Sharapova juga menjadi model sejumlah ambassador sejumlah brand ternama di dunia. Belum lama ini, petenis ranking dua dunia itu memasarkan produk permen premium “Sugarpova”. Sharapova juga mengomentari rivalitasnya dengan Serena Williams. Sepanjang sejarah keduanya sudah bertemu 12 kali namun Sharapova hanya bisa menang dua kali saja melawan ratu tenis Amerika Serikat itu. “Selalu bagus memiliki rival-rival hebat. Itu membuat kompetisi semakin baik,” ujar dia singkat. (int)

Pukul Wasit, Petinju Didiskualifikasi SEMUA orang tahu tinju adalah olahraga keras. Namun, semua orang tahu meski keras bertinju di atas ring dibatasi banyak aturan. Salah satu aturan yang tak boleh dilanggar adalah meninju wasit. Kejadian wasit menerima bogem mentah petinju memang jarang terjadi. Kalaupun terjadi biasanya itu adalah kejadian yang tak disengaja. Namun, apa yang terjadi di sebuah laga tinju amatir di Slovenia nampaknya berbeda. Dalam sebuah pertarungan antara

petinju Kroasia, Kristen Radan dan petinju Slovenia, Blaz Sedej berjalan sangat ketat. Kedua petinju yang bertarung rapat kerap terlibat saling memeluk atau istilah tinjunya adalah clinch. Nah, biasanya bila clinch terjadi maka wasit akan memisahkan petinju agar bisa kembali bertarung. Itu juga yang dilakukan wasit yang memimpin pertandingan ini. Namun, setelah upaya wasit ini tak disukai Radan. Bukannya mundur untuk mengambil jarak dengan

lawannya, petinju Kroasia itu malah memilih meluncurkan pukulan hook kiri ke arah si pengadil. Kontan saja pukulan Radan masuk telak ke wajah wasit. Hebatnya, sang wasit tidak KO akibat pukulan itu. Dia tetap berdiri meski terlihat agak terhuyung. Tak lama setelah wasit kembali sadar, dia langsung membalas. Balasannya sudah pasti bukan pukulan namun sang wasit langsung mendiskualifikasi Radan dan menyatakan Sedej sebagai pemenang laga. (int)

Ferrari Tetap Yakin Alonso Juara Dunia FERRARI tetap yakin bisa menjadikan Fernando Alonso juara dunia F1 untuk kali ketiga di GP Brasil, akhir pekan ini. Presiden Ferrari, Luca di Montezemolo, berjanji timnya akan berjuang hingga lap terakhir agar Alonso bisa mengalahkan Sebastian Vettel. Balapan F1 2012 seri terakhir di GP Brasil, akan menentukan juara dunia. Pebalap Red Bull Racing, Sebastian Vettel, lebih difavoritkan untuk mencetak hattrick juara dunia setelah unggul 13 poin atas Alonso di puncak klasemen. Namun, Montezemolo menegaskan pihaknya belum menyerah. Montezemolo menegaskan Ferrari tetap yakin bisa menjadikan Alonso juara dunia F1 untuk kali ketiga di GP Brasil. “Sekarang kami akan ke Sao Paulo, Brasil, dengan keinginan untuk menang. Kami harus berjuang hingga kilometer terakhir di lap terakhir di Sirkuit Interlagos. Saya tahu itu akan sulit, tapi saya dan tim yakin bisa melakukannya,” ujar Montezemolo seperti dilansir situs resmi Ferrari. Beberapa skenario balapan di Interlagos bisa membuat Alonso juara dunia F1 2012. Salah satunya adalah pebalap asal Spanyol tersebut harus memenangi balapan dengan Vettel terlempar dari posisi empat besar. Kalaupun Vettel gagal menyelesaikan balapan, maka Alonso tetap harus meraih podium di Brasil untuk menjadi juara dunia. Sebelumnya Alonso menjadi juara dunia F1 pada 2005 dan 2006 ketika masih memperkuat Renault. (int)









2 Man United







3 Chelsea







4 West Bromwich A 12






Jadwal Liga Champions Matchday 5 Kamis (22/11) Pukul 01.45 WIB: Porto vs Dinamo Zagreb Grup A Dynamo Kyiv vs PSG Grup A Arsenal vs Montpellier Grup B Schalke 04 vs Olympiacos Grup B Zenit St. Petersburg vs Málaga Grup C Anderlecht vs AC Milan Grup C Ajax vs Borussia Dortmund Grup D Manchester City vs Real Madrid Grup D

PENCETAK GOL NAMA 1 L Suárez 2 D Ba 3 R van Persie 4 Michu 5 E Džeko 6 M Fellaini

KLUB Liverpool Newcastle United Manchester United Swansea City Manchester City Everton

GOL 10 8 8 7 6 6

PREDIKSI SKOR Arsenal 2-0 Montpellier BURSA METRO Arsenal 0 : 1 ¼ Montpellier




12 11




2 Atlético Madrid







3 Real Madrid







4 Málaga








Winger Arsenal Aaron Ramsey mengatakan, timnya harus menang menghadapi Montpellier pada laga lanjutan Champions League di Emirates Stadium, Kamis (22/11) dinihari.


PENCETAK GOL NAMA 1 L Messi 2 Cristiano Ronaldo 3 R Falcao 4 Aduriz 5 G Higuaín 6 Negredo

KLUB Barcelona Real Madrid Atlético Madrid Athletic Club Real Madrid Sevilla

GOL 17 12 10 8 7 7

SERIA A ITALIA KLASEMEN SEMENTARA 1 Juventus 2 Internazionale 3 Napoli 4 Fiorentina

13 10 12 9 13 8 12 7

2 0 3 3

1 3 2 2

29-9 24-13 22-11 19-9

32 27 27 24

PENCETAK GOL NAMA 1 S El Shaarawy 2 E Cavani 3 E Lamela 4 A Di Natale 5 M Klose 6 D Milito

KLUB Milan Napoli Roma Udinese Lazio Internazionale

GOL 10 8 8 7 7 7

BUNDESLIGA KLASEMEN SEMENTARA 1 München 2 Schalke 04 3 Frankfurt 4 Dortmund

12 10 12 7 12 7 12 6

1 2 2 4

1 3 3 2

33-5 22-14 25-18 26-13

PENCETAK GOL NAMA 1 M Mandžukiæ 2 A Meier 3 S Kießling 4 Á Szalai 5 R Lewandowski 6 T Müller

KLUB Bayern München Eintracht Frankfurt Bayer Leverkusen Mainz 05 Borussia Dortmund Bayern München

GOL 9 9 8 8 7 7


31 23 23 22

osisi Arsenal masih belum aman, mereka berada pada posisi kedua dengan poin 7 terpaut1angkadariSchalkedanunggul 1 angka atas Olympiakos di klasemen sementara grup B. “Grup ini cukup ketat, jadi kami harus menang pada pertandingan itu. Kami berada di rumah, mudahmudahankamimeraihkemenangan untuk memantapkan posisi kami agarbisalolos.KetikabermaindiPerancis, kami dalam tekanan selama pertandingan dan kami mendapatkan hasil yang baik,” ujar Ramsey. Montpellier cuma mendapatkan 1 poin hingga saat ini, artinya Mapou Yanga-Mbiwa dan kawan-kawan dipastikan gagal lolos ke babak selanjutnya. “Mereka telah bersaing menghadapi setiap tim di grup ini dan mereka bisa menciptakan ancaman, tentumerekatanpabeban.Merekaakan membuktikan sesuatu, jadi kami harusmewaspadaiitu,”jelasRamsey mengenai calon lawannya itu. Pemain tim nasional Wales berusia 21tahunitusangatberharapagarThe Gunners dapat lolos sebagai juara grup demi menghindari tim unggulan lainnya, seperti Barcelona, pada babak knock out. “Kami finis kedua di grup pada beberapa musim lalu dan bertanding menghadapi Barcelona. Tapi yang terpenting kami harus lolos. Jika berhasilmakakamiakan percaya diri untuk menghadapi tim manapun di kompetisi ini,” tutup mantan pemain Cardiff City itu. Sementara striker Arsenal Olivier Giroudengganmemandangsebelah matamantantimnyaitukalaberjumpa tengah pekan ini.

The Gunners butuh kemenangan atas juara Prancis itu di Emirates, Kamis(22/11)dinihari.Dengantambahan tiga poin, Arsenal akan dipastikan akan menempati satu slot di babak 16 Besar. Sebaliknya kekalahan akan sangat berisiko bagi Arsenal. Apabila Olimpiakos bisa mengalahkan Schalke maka peluang lolos Giroud cs akan mengecil dan harus ditentukan di laga grup pamungkas. Setelahgagalmenangditigalagasebelumnya,moralArsenalkiniterdongrak usai memenangi derby London Utara versus Tottenham Hotspur pada akhir pekan lalu. Sedangkan Montpellier, yang dipastikan tak mungkin lagi lolos tengah terpuruk di kompetisi lokal dengan menduduki peringkat 14 klasemen Ligue 1. Melihat situasi ini, sepertinya skuad Ars e n e Wenger akan mudah

DATADAN FAKTA -Pertemuan pertama kedua tim terjadi pada September 2012 di Liga Champions, dimana Arsenal sukses menekuk Montpellier dengan skor 12. Saat itu Montpellier unggul lebih awal melalui gol Y Belhanda, namun terbalaskan dua gol oleh L Podolski dan Y Gervinho untuk kemenangan Arsenal. -Arsenal meraih dua kemenangan, dua kali imbang dan satu kali kalah dari lima laga terakhirnya. Liga Inggris pekan lalu mereka sukses meraih poin penuh saat berhadapan Tottenham Hotspur, dengan skor akhir 5-2. -Sementara Montpellier hanya memperoleh satu kemenangan, tiga kali seri dan kalah satu kali dari lima laga terakhir mereka. Terakhir kali Montpellier hanya berakhir imbang saat melawan Valenciennes di Ligue 1, dengan skor akhir 1-1. -Arsenal memiliki kinerja yang baik jika bermain di kandang, mereka meraih tiga kemenangan, satu kali seri dan satu kali menelan kekalahan dari lima laga kandang terakhirnya. -Sedangkan Montpellier memiliki performa yang cukup buruk jika bertandang ke markas lawan. Mereka belum pernah menang dari lima laga kandang terakhirnya, hanya menahan imbang tiga kali dan dua kali kalah. -Arsenal sementara di peringkat ke-2 klasemen Grup B dengan perolehan 7 poin dari empat pertandingan, selisih satu poin dari Schalke 04 di puncak klasemen. Sedangkan Montpellier di posisi ke-4 klasemen yang hanya mengoleksi 1 poin.

saja melewati hadangan Montpellier. Giroud, yang sudah mencetak tujuh gol sejak hijrah ke London, menolak meremehkan bekas klubnya itu. “Iniadalahlagawajibmenangbuat kami karena Arsenal harus lolos ke faseberikutnyadikompetisiini,”seru strikerinternasionalPrancisitudiThe Sun. “Montpellier tak punya apapun untukdipertaruhkanseakrangmereka sudah tersingkir tapi kami tetap harus berhati-hati karena saat itulah biasanya yang paling berbahaya.” “Mereka tidak tampil sebagai juara Prancis dengan tidak memiliki kualitas. Kami tidak boleh jemawa saat mereka menyambangi Emirates,” sahutGiroudsembarimemperingatkan. Montpellier Takut Kalah Gelandang Montpellier Younes Belhanda takut jika klub Perancis tersebut dapat kebobolan delapan gol saat menghadapi Arsenal di Liga Champions mendatang. Juara bertahan Ligue 1 itu hanya mendapatkan empat poin dari lima pertandingan di musim ini dan mendapatk a n kekalahan ketiga mereka di musim ini denganskor3-0 oleh tim yang baru mendapat promosi ke liga utama Reims hari Jumat lalu. Arsenal menaklukan Southampton dengan skor 6-1 di Premier League Sabtu lalu, dan Belhanda percaya Montpellier harus kembali ke performamerekasecepatnyadanmemperkuat mental mereka jika mereka ingin terhindar dari kekalahan di Stade de la Mosson. “Jikakamibermainsepertiini,kami akan kebobolan delapan gol,” ujar Belhanda. “Kamiharusmenunjukkansecepat mungkin bahwa kami seorang pria, karenakamiterlihatsepertianakkecil di lapangan. Kami tidak berbahaya, juga tidak cukup tajam.” Pelatih Montpellier Rene Girard mengatakan bahwa ia tidak menyadari timnya saat ini yang telah me-

KLASEMEN SEMENTARA LIGA CHAMPIONS Grup A No Team M 1 Porto 4 2 Paris Saint Germain 4 3 Dynamo Kyiv 4 4 Dinamo Zagreb 4

M 3 3 1 0

S 1 0 1 0

K 0 1 2 4

SG 6-2 10-2 5-7 0-10

Nilai 10 9 4 0

Grup B No Team 1 Schalke 04 2 Arsenal 3 Olympiacos 4 Montpellier

M 4 4 4 4

M 2 2 2 0

S 2 1 0 1

K 0 1 2 3

SG 8-5 7-6 7-7 5-9

Nilai 8 7 6 1

Grup C No Team 1 Málaga 2 Milan 3 Anderlecht 4 Zenit

M 4 4 4 4

M 3 1 1 1

S 1 2 1 0

K 0 1 2 3

SG 8-1 4-4 1-4 3-7

Nilai 10 5 4 3

Grup D No Team 1 Borussia Dortmund 2 Real Madrid 3 Ajax 4 Manchester City

M 4 4 4 4

M 2 2 1 0

S 2 1 1 2

K 0 1 2 2

SG 6-4 10-7 6-8 6-9

Nilai 8 7 4 2

Grup E No Team 1 Chelsea 2 Shakhtar Donetsk 3 Juventus 4 Nordsjælland

M 4 4 4 4

M 2 2 1 0

S 1 1 3 1

K 1 1 0 3

SG 10-6 7-5 8-4 1-11

Nilai 7 7 6 1

Grup F No Team 1 Valencia 2 Bayern München 3 BATE Borisov 4 Lille

M 4 4 4 4

M 3 3 2 0

S 0 0 0 0

K 1 1 2 4

SG 10-4 10-5 8-9 2-12

Nilai 9 9 6 0

Grup G No Team 1 Barcelona 2 Glasgow Celtic 3 Benfica 4 Spartak Moscow

M 4 4 4 4

M 3 2 1 1

S 0 1 1 0

K 1 1 2 3

SG 8-5 6-5 3-4 6-9

Nilai 9 7 4 3

Grup H No Team 1 Manchester United 2 CFR 1907 Cluj 3 Galatasaray 4 Braga

M 4 4 4 4

M 4 1 1 1

S 0 1 1 0

K 0 2 2 3

SG 9-4 5-6 4-5 5-8

Nilai 12 4 4 3

menangkan gelar juara pada musim lalu dan yakin timnya mungkin terlalu percaya diri sebelum dimulainya musim ini. “Kami seharusnya malu pada diri kami sendiri,” ujarnya usai kalah dari Reims. “Untuk pertama kali, saya menanyakan banyak pertanyaanpadadirisayasendiri.Merekatelahmelupakan beberapa nilai.” (int)

HEAD TO HEAD 18 September 2012 : Montpellier 1 – 2 Arsenal, Liga Champions 5 PERTANDINGAN TERAKHIR ARSENAL : 17/11/2012 : 10/11/2012 : 06/11/2012 : 03/11/2012 : 30/10/2012 :

Arsenal Arsenal Schalke 04 Man United Reading

5–2 3–3 2–2 2–1 5–7

Tottenham Hotspur, Fulham, Arsenal, Arsenal, Arsenal,

Liga Inggris Liga Inggris Liga Champions Liga Inggris Piala Liga

5 PERTANDINGAN TERAKHIR MONTPELLIER : 17/11/2012 : 11/11/2012 : 06/11/2012 : 03/11/2012 : 31/10/2012 :

Valenciennes Montpellier Olympiakos Troyes Montpellier

1–1 1–1 3–1 1–1 1–0

Montpellier, PSG, Montpellier, Montpellier, Bordeaux,

Ligue 1 Ligue 1 Liga Champions Ligue 1 Coupe de la Ligue


RABU 21 November 2012

„ El Shaarawy

„ van Baukering

Timnas Siap Menjajal Laos DI PARTAI PEMBUKA PIALA AFF PREDIKSISKOR Anderlecht 2-2 AC Milan BURSAMETRO Anderlecht 0:0 AC Milan


ANDALKAN EL SHAARAWY Harian Italia Tuttosport, pernah memberi judul berita headline-nya “Stephan El Shaarawy: Heart and Soul”. Sangat jarang ada media Italia yang memberikan tempat utama untuk pemain muda di halaman depan.


emua itu dilakukan hanya untuk El Shaarawy, penyelamatACMilanmusim ini. Termutakhir, lesakan dua gol pemain Italia berdarah Mesir itu menyelamatkan “I Rossoneri” dari pahitnya kekalahan di kandang Napoli. Skor kedua tim pun berakhir 2-2. Koleksi 10 gol dari 13 pertandingan Serie-A membuktikan bakat besar El Shaarawy. Jumlah tersebut berarti setengah gol Milan musim ini adalah berkat bantuan eks pemain Genoa dan Padova itu. Sebuah fakta menunjukkan bahwa klub asuhan Massimiliano Allegri tersebut begitu bergantung kepada El Shaarawy. Jika tak ada gol-gol dari El Shaarawy, posisi Milan di klasemen sementara Serie-A Liga Italia adalah juru kunci!

Beruntung, El Shaarawy mampu tampil trengginas dan dapat menjaga Milan jauh dari zona merahdegradasi.Padausiabaru20 tahun, El Shaarawy sudah mengambil tugas berat menolong Milan tetap bernapas musim ini. Pada awal musim, tak ada yang mengiraElShaarawybakalmenjadi juru selamat Milan. Pasalnya, musim pertama El Shaarawy di San Siro hanya mengoleksi empat gol dari 28 pertandingan. Semua itu tak terlepas dari keberadaan Zlatan Ibrahimovic yang tidak tersentuh di Milan. Setelah Ibrahimovic pergi ke Paris SaintGermain, mau tak mau Milan memaksimalkan kemampuan pemain berjuluk “Firaun Kecil” itu. Untungnya, El Shaarawy bisa membayar kepercayaan yang

PRAKIRAAN PEMAIN AC MILAN (4-3-1-2): Abbiati- De Sciglio - Bonera - Acerbi - Antonini- Montolivo - Ambrosini - NocerinoBoateng-Pazzini - El Shaarawy ANDERLECHT (4-2-3-1): Proto-Gillet - Wasilewski - Kouyate - Deschacht-Biglia - Kljestan-Bruno - Kanu - Iakovenko-Jovanovic

HEAD TO HEAD : 19 Sep 2012: AC Milan 2 Nov 2006 : AC Milan 18 Okt 2006 : Anderlecht

0-0 4-1 0-1

Anderlecht Anderlecht AC Milan

(Liga Champion) (Liga Champion) (Liga Champion)

LIMA PERTANDINGAN TERAKHIR ANDERLECHT 11 Nov 2012 Anderlecht 6-1 Bruges (LJB) 7 Nov 2012 Anderlecht 1-0 Zenit st Petersburg (UCL) 4 Nov 2012 KV Mechelen 1-4 Anderlecht (LJB) 31 Okt 2012 Anderlecht 5-0 KAA Gent (LJB) 28 Okt 2012 Royal Charleroi 2-0 Anderlecht (LJB) LIMA PERTANDINGAN TERAKHIR AC MILAN 11 Nov 2012 AC Milan 1-3 Fiorentina 7 Nov 2012 AC Milan 1-1 Malaga 4 Nov 2012 AC Milan 5-1 Chievo 31 Okt 2012 Palermo 2-2 AC Milan 28 Okt 2012 AC Milan 1-0 Genoa

(SA) (UCL) (SA) (SA) (SA)

dan Oktovianus Maniani berada dalam satu tim memakai rompi hijau. Sementara di tim Oranye, pelatih Timnas Nilmaizar menempatkan Arthur Irawan, Jhonny van beukering, serta Ellie Eiboy ke dalam satu tim. Pada latih tanding tersebut, Nilmaizar menegaskan kepada anak asuhnya untuk tidak berlama-lama dengan bola. Kemudian mantan pelatih Semen Padang itu juga menginstruksikan untuk memaksimalkan permainan. “Latihan terakhir tadi merupakantaktikaldalammenghadapiketigalawanyangakan kami hadapi nanti. Saya juga menekankan untuk sering melakukan komunikasi dan siapa yang naik membantu serangan, juga siapa yang turun,”ucapNil,usailatihandi SUGBK,Selasa(20/11). Namununtukmenghadapi masalah komunikasi terkait ada tiga pemain naturalisasi, Nil mengaku tak menjadi hambatan buat timnya. Karena menurutnya sepakbola tak hanya mengandalkan komunikasi bahasa, tetapi juga body language. Selain itu dari kedua tim tersebut, Nil menggunakan formasi 4-4-2 di mana formasi tersebut akan digunakannya pada saat di Malaysia nanti. “Formasi, saya sudah paten akan menggunakan formasi 4-4-2 untuk bertanding di Malaysia,” pungkasnya. Terlihat juga ada Ketua UmumPSSI,DjoharArifinHusein yang berada di sisi lapangan latihan Timnas kali ini. Djohar memberikan semangat serta beberapa wejangan kepada para pemain. Van Beukering Bidik Kemenangan Lima hari jelang mengha-

dapi Laos, pemain naturalisasi asal Belanda, Jhonny van Beukering mengaku belum mengetahui kekuatan calon lawannya. Meski begitu dia tetap menargetkan tiga poin pada partai pertama Indonesia di penysihan grup B, di Malaysia Minggu (25/11) mendatang. Lawan Laos menjadi pertandingan resmi pertama van Beukering di tim nasional Indonesia. Tapi dia yakin bisa menyatu dengan tim, meski dia baru bergabung dalam hitungan hari. “Pertandingan pertama lawan Laos pastinya akan berat karena itu adalah pertandingan pertama kami. Saya juga tidak tahu kekuatan Laos sejauh apa karena saya tidak terlalu memperhatikan mereka. Namun saya yakin, kami bisa menang dan kami harus meraih tiga poin,” jelas van Beukering, kepada wartawan Selasa. “Kami harus waspada jangan sekali-kali meremehkan lawan. Ini sepakbola yang tidak bisa didapat secara pasti dan mudah untuk diperhitungkan hasilnya. Kami di sini semua sudah siap tempur untuk menghadapi Laos dan menargetkan kemenangan,” tegas pemain bertubuh tambun tersebut. Pemain 29 tahun tersebut juga mengakui merasa nyaman dengan seluruh skuad Garuda asuhan Nilmaizar tersebut. Padahal belum ada sebulan dia bersama Bambang Pamungkas cs. “Saya sudah 13 hari di sini. Berlatih bersama timnas dan mencoba beradaptasi secara maksimal. Saya pikir saya mampu melakukan proses ini,” ungkap van Beukering menutup percakapan. (int)

„ Iniesta

DATADAN FAKTA: - AC Milan sejauh ini baru bertemu 3 kali menghadapi Anderlecht, dari pertandingan tersebut, AC Milan memenangkan dua pertandingan dan 1 kali seri. - AC Milan tampil kurang konsisten dari pertandingan terakhirnya. - Anderlecht sendiri baru meraih 1 kemenangan dari 5 pertandingan terakhir. Mereka meraih 1 kemenangan, 3x seri, dan 1x kalah. Pertandingan terakhir mereka berakhir dengan skor 1-1 ketika menghadapi Lierse. - Ini adalah kali pertama bagi Anderlecht mengikuti fase grup Liga Champion, terakhir mereka dapat lolos dari kualifikasi pada tahun 2006/2007. - Rekor AC Milan ketika menghadapi tim asal Belgia ada memenangkan 5 pertandingan, 3x seri, dan 2x kalah. Tim terakhir asal Belgia yang berhasil mengalahkan AC Milan adalah Club Brugge, dengan skor 0-1. - Anderlecht memiliki catatan yang buruk ketika menghadapi tim Italia, mereka belum pernah menang melawan tim asal Italia, mereka mencatat 6 kali seri, dan 9 kali kalah. - AC Milan berada diposisi ke-12 di Liga Italia saat ini. - Sedangkan Anderlecht berada diposisi ke-2 Liga Belgia dengan point 13 dari 7 pertandingan, mendapatkan 3 kemenangan, dan 4x seri.

JAKARTA- Tim nasional (Timnas) bakal melakoni laga perdana menghadapi Laos, di stadion Bukit Jalil Malaysia, Minggu (25/11) mendatang. Menurut pelatih Nilmaizar, melawan Laos pada partai perdana merupakan keinginan dari skuad Garuda. Tentunya Laos sebagai tim yanglolosdarikualifikasibakal menjadilahanTimnasGaruda untuk meraih poin penuh. Sebab dua lawan Bambang ‘Bepe’ Pamungkas cs berikutnyamemilikiperingkatFIFAdi atas Indonesia, yaitu Singapura (28/11) dan melawan tuan rumah Malaysia pada 1 Desember 2012. “Menghadapi Laos, memang itulah keinginan kami. Karena inilah titik kombinasi kita dalam dua pertandingan ke depan,” ucap Nil, usai latihan di SUGBk tadi pagi. Selainitu,Niljugamenegaskan kepada para pemain untuk bisa menjaga kondisinya. Terkait dengan itu, dua punggawa yang mengalami cedera pada uji coba melawan Kamerun,Sabtu(17/11)kemarin, Handi Ramdan dan Endra Prasetya, Nil mengaku tidak menemui masalah yang berarti. “KhususuntukHandi,kami tidakmenemuimasalah,kami masih punya penggantinya, yaitu Fachrudin (yang juga menggantikan Handi saat lawan Kamerun),” tegasnya. PatenkanFormasi4-4-2 Timnas menjalani latihan terakhir mereka sebelum berangkatkeMalaysia,Selasa(20/ 11). Terlihat dalam dua tim yang dibagi, Nil menggunakan formasi 4-4-2 yang disinyalir bakal digunakan di babak penyisihan grup B. Tonnie Cusell, Bambang Pamungkas, Irfan Bachdim,

diberikan Milan. Jika terus tampil konsisten dan berkontribusi lebih untukMilan,julukan“FiraunKecil” sepertinya sudah tak cocok lagi untuknya. Mungkin saja, julukan ElShaarawynantimenjadi“Firaun kota Milan”. Dinihari nanti, AC Milan akan bertandang ke Belgia untuk melawan Anderlecht. Meski sejauh catatanyangmerekapunya,dalam tiga kali pertemuan, AC Milan unggul dua kali dan sekali seri. Namun performa Milan yang mengendur belakangan membuat fanskhawatir.BisakanElShaarawy dan kawan-kawan pulang dengan membawa tiga poin. Usai menahan imbang Napoli

beberapa hari lalu, pelatih Massimiliano Allegri merasa terpuaskan. Tapi, karena saat itu Rossoneri masih membuat terlalu banyakkesalahan,Allegrimeminta timnya berbenah. “Kami menghadapi sejumlah situasi yang sebenarnya bisa dihindari dan disebabkan kesalahan-kesalahan kami,” ungkap Allegri di Football Italia. “Kami harus berkembang karena kami masih membuat terlalu banyak kesalahan pada level individu. Ini adalah tim yang harus dewasa dan belajar dari kesalahan-kesalahan dan juga posisinyadiklasemen,”ujarAllegri. (int)

5 Tim yang Menang “Hoki” KANSAS- Dalam dunia sepakbola, giat berlatih, penerapan strategi yang matang, fokus saat bertanding, serta kerjasama yang baik antar pemain adalah syarat mutlak menjadi pemenang atau juara. Namun, terlepas dari faktor teknis, faktor ‘luck’ atau keberuntungan juga sedikit banyak dapat menjadi faktor yang tidak bisa dilupakan. Berikut adalah lima tim yang memenangkan pertandingan atau sebuah kejuaraan dengan cara yang bisa dibilang “menang hoki”. 1.ManchesterUnited (Juara Liga Champions 1999) Partai final yang digelar di Stadion Camp Nou ini menjadi partai final yang luar biasa. Sang wakil Jerman, Bayern Munchen unggul lebihdulusaatlagaberjalan6menit melalui gol Mario Basler. Keunggulan yang diraih Bayern bertahan sampaimenitke90laga.Tapimimpi

buruk mendatangianak-anakasuhan Ottmar Hitzfeld. Karena United berhasil mencetak dua gol pada menit 91’ dan 93’ lewat gol Teddy Sheringham dan Ole Gunnar Solskjaer. 2-1 untuk Manchester United 2. Porto (Juara Liga Champions 2004) Porto disebut tim yang beruntungsebagaijuaraLigaChampions karena Porto bukanlah tim yang samasekalitidakunggulkan.Diatas kertas, lawan-lawan yang mereka hadapijugabukantimyanglemah. Tercatat lawan seperti Manchester United, Lyon, dan Deportivo La Coruna berhasil mereka taklukan. Keberuntungan mereka terletak saat menghadapi Manchester United pada leg kedua semifinal di Old Trafford. Dimana saat itu pemain Porto, Costinha berhasil mencetak gol di menit ke 90 dan memastikan FC Porto menang aggregate3-2danloloskebabakfinal.

3. Liverpool (Juara Liga Champions 2005) Kemenanganinisangatistimewa karena melalui proses yang sangat dramatis.Lawanmerekasaatitu,AC Milansudahunggul3gollebihdulu di babak pertama melalui gol dari Paolo Maldini dan sepasang gol HernanCrespo.Namun,TheReds secara mengesankan dapat menyamakan kedudukan di babak kedualewatgolyangdicetakSteven Gerrard, Vladimir Smicer dan Xabi Alonso.Skor3-3punberakhirsampai waktu normal dan babak perpanjangan waktu. Liverpool memastikangelarjuaramelaluidrama adupenalti,6-5untukLiverpool. 4. Manchester City (JuaraLigaInggris2012) Bisa dibilang Barclays Premier League musim 2011/2012 adalah musim paling menegangkan, karena sampai pertandingan pamungkas saat itu, belum ada tim yang memastikan diri sebagai jua-

ra. Duo Manchester terus berjuang sampai laga terakhir untuk keluar sebagai juara. Namun, City lebih beruntung karena berhasil menjuarai Liga Inggris hanya denganselisihgoldanpoinyangsama dengan rival sekota mereka. 5. Chelsea (Juara Liga Champions 2012) Laga final Champions League mempertemukan dua tim besar, Bayern Munich dan Chelsea. FC Hollywood bisa memecah kebuntuan dengan mencetak gol pada menit 83 melalui Thomas Muller. Selang 7 menit laga berakhir, penyerang Chelsea Didier Drogba dapatmenyamakankedudukandi menit88.PestayangdisiapkanThe Bavarian pun tertunda. Sampai babak tambahan waktu digelar, skor tak berubah dan drama adu penalti pun terpaksa dilakukan. Di babak adu penalti, The Blues menang dengan skor 3-4. total The Bluesungguldenganskor4-5.(int)

Iniesta Tak Bermimpi Raih Ballon d’Or BARCELONA- Gelandang Barcelona Andres Iniesta Lujan tidak pernah bermimpi mendapatkan Ballon d’Or 2012. Iniesta berpikir, lebih cocok gelar itu disematkan kepada Lionel Messi rekan satu tim Iniesta di Barcelona. Gelandang kreatif Barcelona dan Timnas Spanyol ini menegaskan tidak pernah memiliki ambisi untuk memenangi trofi Ballon d’Or. Musim panas tahun ini dia telah berhasil memenangkanpenghargaanPemainTerbaik Eropa. Namun, pemain berusia 28 tahun itu menjelaskan sudah

sangat senang dapat bermain di level yang sekarang. “Saya berusaha memainkan gaya sendiri dan yang terpenting orang-orang menyadari kemampuan saya, tetapi saya tidak menganggap itu hal yang penting untuk dipikirkan. Saya tidak pernah memikirkan Ballon d’Or dan saya menganggap hal yang tidak penting jika fokus terhadap penghargaan individu. Namun, bila saya memenanginya tentu sangat senang,” kata Iniesta kepada RMC. “Saya merasa sangat senang dapat bermain dengan tim ter-

baik saat ini. Barcelona dan Timnas Spanyol adalah tempat di mana saya ingin bermain setiap hari dan menjadi baik setiap harinya,” pungkas gelandang Spanyol ini. Iniesta langsung mengalihkan pembicaraan menyinggung tentang teman satu timnya Lionel Messi.”Messi adalah pemain terbaik dunia,” tambah Iniesta. “Dia melakukan banyak hal dengan alami dan jika bermain dengan dia(Messi) sangat mudah, sama seperti semua pemain yang bermain dengan saya,” ujar Iniesta. (int)



Read more
Read more
Similar to
Popular now
Just for you