Issuu on Google+







Edisi 239 „ Tahun X


Manajer PT Sipef Diadukan ke Polres SIANTAR– Pengerukan parit hingga menyebabkan badan jalan menjadi longsor membuat masyarakat marah dan merasa dirugikan. Manager PT Sipef, Bukit Maraja dilaporkan ke Mapolres Simalungun, Selasa (18/12). „) Baca Manajer ...Hal 5


CURI KABEL- Polsek Serbelawan bekuk empat tersangka spesialis pencuri kabel jaringan telepon, Selasa (18/12).


Dibekuk di Langkat dan Medan

SERBELAWAN- Polsek Serbelawan kembali menangkap tiga orang tersangka tindak pidana pencurian kabel jaringan telepon. Mereka adalah Sukandar (28) warga Sei Bilah Timur Pangkalan Brandan, Kabupeten Langkat, Simon (51) war-

ga Dusun VIII Desa Manunggal, Kelurahan Labuhan Deli, Kota Medan. Supriadi (39) warga Dusun Labuhan Deli, Medan. Ketiga tersangka diamankan dari tempat tinggal mereka „) Baca Dibekuk ...Hal 7


KIAN PARAH- Kondisi tanah longsor menuju jembatan Jalan Asahan Km 20 yang semakin parah, Selasa (18/12).


r PT Sipef saat asana gerbang Kanto KANTOR SIPEF- Su /12). ri Formapel, Selasa (18 dimasuki pendemo da

Dugaan Pencabulan Anak di Bawah Umur

Bripka AMN Tak Kunjung Ditahan SIANTAR- Berkas kasus dugaan pencabulan yang dilakukan Bripka AMN (38) salah seorang personil Polres Simalungun masih ‘mengendap’ di Polres Siantar. Setelah Bripka AMB ditetapkan menjadi tersangka, hingga kini belum dilakukan penahanan, sehingga tetap

AKSI demo yang dilakukan Formapel (Forum Masyarakat Pencinta Lingkugan) Kecamatan Gunung Malela yang dikordinatori oleh Humuttal Rajagukguk terhadap PT Sipef, Senin (10/ 12) lalu, sampai Selasa (18/12), belum terlihat

„) Baca Pernyataan ...Hal 5 FOTO: PRA EVASI HALOHO


Empat Perampok Aniaya Oknum Polisi


SIMALUNGUN– Aiptu Sathar Tampubolon, mengaku punggungnya dipukul menggunakan besi, lehernya dipiting hingga kepalanya dipijak ke tanah. Akibatnya pria yang bertugas di Polsek Serbelawan ini harus menjalani perawatan intensif hingga sepuluh hari akibat luka yang dideritanya. Hal itu disampaikan saksi korban, saat memberikan keterangan di persidangan yang digelar di Pengadilan Negeri Simalungun, Selasa (18/12) kemarin. Korban dihadirkan menjadi saksi oleh Jaksa Penuntut Umum (JPU) Josron Malau atas perkara yang menjerat empat perampok, yakni Indra Jaya Dalimunthe alias Indra alias Tulang

TERDAKWA penganiaya polisi menjalani sidang perdata.

„) Baca Empat Perampok ...Hal 5

menjadi tanda tanya besar masyarakat. Menurut Ketua Komisi Nasional Perlindungan Anak Arist Merdeka Sirait, lambatnya penanganan proses hukum oleh Polres Siantar dalam mengungkap keterlibatan tersangka Bripka AMN atas dugaan pencabulan „) Baca Bripka ...Hal 5

melakukan pengerjaan di lokasi tanah longsor. Pernyataan pihak PT Sipef, terdiri dari tiga butir. Pertama, PT Sipef akan berkordinasi de-


Harus Punya Hobi Menangkap Penjahat SIMALUNGUN- Seorang anggota polisi harus memiliki hobi menangkap pejahat, penjudi dan narkoba. Hal itu dikemukakan Kapolres Simalungun AKBP Andi Syahriful SIK MSi, dalam acara temu pisah dengan Kapolres Simalungun lama AKBP M Agus Fajar SIK di Restaurant Internasional Jalan Gereja, Kecamatan Siantar Selatan, Senin (17/12). AKBP Andi Syahriful SIK MSi menyampaikan, dalam menjabat sebagai Kapolres Simalungun, dia akan mengabdi kepada masyarakat se-Kabupaten Simalungun, mulai dari mengayomi, keamanan dan pengamanan terhadap masyarakat. ”Apa yang telah diberikan AKBP M Agus


„) Baca Harus Punya ...Hal 7

PAKAIAN ADAT- Kapolres Simalungun yang baru dan yang lama menerima penghargaan pakaian adat Simalungun.

RAPAT- Situasi rapat gabungan komisi DPRD bersama Tim Anggaran Pemerintah di Ruang rapat gabungan komisi.

DPRD Pertanyakan Status Lahan Tj Pinggir SIANTAR- Setelah rapat gabungan Komisi DPRD Kota Siantar diskor, Senin (18/12), anggota DPRD Maruahal Sinaga, mempertanyakan kepada tim anggaran pemerintah soal status lahan Tanjung Pinggir yang hingga kini belum tuntas. Maruahal heran, dalam R-APBD tahun 2013, pemko tidak meng-

anggarkan alokasi untuk pengurus lahan Tanjung Pinggir. “Saya juga ikut kemarin ke Kementrian BUMN. Kalau tidak salah, pemko dikasih tenggat waktu sampai Oktober 2013 untuk menyelesaikan status lahan Tanjung Pinggir. Tapi saya „) Baca DPRD ...Hal 7



19 Desember 2012

Beram Jalan Ancam Keselamatan Pengendara SIMALUNGUN-Infratruktur jalan mulai dari Kota Siantar menuju Parapat masih sangat minim. Mulai dari rambu-rambu jalan, pembatas jalan, hingga beram jalan yang kedalamannya mencapai setengah meter dan sangat membahayakan keselamatan pengendara. Jangankan mobil atau minibus, truk tronton sekalipun bisa amblas jika tergelincir ke beram jalan tersebut.

Bangun Pagar Pembatas an TIDAK hanya beram jal cam an ng saja yang me ra keselamatan pengenda pengguna Jalan Siantarnya Parapat, namun minim raGa a. jug s ata mb pe pagar gara tidak ada pagar terjadi pembatas, sudah sering bas ke be jun ter n raa da ken yang ya san dalam jurang. Bia alah ad ya nn rba ko menjadi dari g tan da g yan n raa da ken g yan n raa da luar kota, dan ken ) -02 ag (m n. ala ug alug rga Wa i, Am

Pemda Lakukan Lobi

Kondisi ini disebabkan tersumbatnya parit di tepi jalan tersebut. Sehingga ketika curah hujan tinggi air mengalir dari tepi jalan hingga menjadikannya mirip parit berkedalaman setengah meter. Tak jarang di lokasi ini sering terjadi kecelakaan. Sebab ketika roda kendaraannya terjebak ke beram ini maka sangat mudah terbalik. Beram jalan paling parah mulai dari Simpang Kawat sampai Parapat. (mag-02/osi)

JALAN SiantarParapat merupakan jalan lintas sumatera. Artinya anggaran yang diperuntuhkan untuk kebutuhannya menjadi tanggungjawab Pemerintah Provinsi Sumatera Utara. Pemkab Simalungun sebagai pemilik wilayah harus melakukan lobi agar dikucurkan dana untuk perbaikannya. (mag-06) Amoses Aruan Karyawan


DPRD Siantar Sering Bolos Parit Minim di Pinggir Jalan

Harus Segera Ditanggulangi Beram jalan tersebut harus segera ditanggulangi. Jika kondisi itu dibiarkan akan senantiasa memakan korban jiwa. Apalagi saat ini menjelang natal dan tahun baru, arus lalu lintas semakin dipadati kendaraan bermotor yang hendak mudik. (osi) Heny Mahasiswi

SEPANJANG Jalan Siantar-Parapat masih minim parit. Sehingga ketika hujan deras datang, air mengalir dari bahu jalan yang akhirnya terjadi beram. Setelah nanti beram diperbaiki, sepanjang jalan Siantar-Parapat harus dibangun parit agar air mengalir dari parit tersebut. (mag02). Tuti Pasaribu Warga

Lakukan Penanggulangan Sementara MENJELANG Natal dan Tahun Baru, pemerintah harus melakukan penanggulangan sementara terhadap beram jalan tersebut. Setidaknya menimbunnya dengan tanah. Karena H-7 dan H+7 jalanan Siantar-Parapat akan dipadati kendaraan yang mudik. Sebelum peristiwa yang tidak diinginkan terjadi, perlu dilakukan antisipasi sejak sekarang. (mag-02) Yolanda Ginting, Wiraswasta

DPRD Siantar terhormat, tolong lah dalam setiap rapat jangan sering bolos. Masyarakat tidak menginginkan wakil rakyatnya memakan gaji buta tanpa memperjuangkan hak-hak rakyat. 087807231xxx

Kepala SDN 095131 Gunung Malela Jarang Ngantor

BUPATI Simalungun terhormat, kami guru di SDN 095131 Nagori Bandar Malela merasa kesulitan dalam mengurus surat menyurat di sekolah karena kepala sekolahnya, Janporman Saragih jarang ngantor. Kami berharap supaya diberikan tindakan tegas kepada kepala sekolahnya. 085276252xxx

Guru Tapian Dolok Tak Pernah Masuk Tapi Gaji Lancar

BUPATI Simalungun terhormat, salah seorang guru di SD Tapian Dolok ada yang sudah bertahun-tahun tidak pernah masuk mengajar, tetapi gajinya berjalan lancar. Anehnya, sekarang guru tersebut menjadi kepala Terminal Serbelawan. Kepada orang-orang dia mengaku adalah adiknya Bupati Simalungun, makanya bebas bertindak apa saja. 081370238xxx


19 Desember 2012 “IMF sama sekali tidak demokratis karena didominasi oleh pemegang saham dari negara-negara besar dan masih menerapkan agenda-agenda neoliberal sebagai syarat penyaluran utang,” Koordinator Koalisi Anti Utang (KAU), Dani Setiawan.

“Penjara itu hanya untuk orang kriminal, bukan untuk orang yang berbeda pandangan dengan kita. Saya sampaikan itu,”

“Cara terbaik yang dapat dilakukan pemerintah Indonesia untuk menjawab pelecehan dan penghinaan sebagian masyarakat adalah dengan bekerja keras menciptakan lapangan kerja dan kesejahteraan,” Ekonom senior DR. Rizal Ramli.

BJ Habibie, mengomentari soal hinaan eks Menteri Penerangan Malaysia Zainudin Maidin.

Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter

Sikap Kami Menggantung Kursi Menteri

FIFA Plin Plan

Kita bisa bernafas lega ketika badan sepakbola dunia, FIFA, menunda sanksi kepada PSSI. FIFA masih memberi kesempatan kepada PSSI untuk menyelesaikan kekisruhan hingga Maret 2013. Namun benarkah kesempatan itu merupakan kesempatan terakhir yang diberikan dan bila dalam jangka waktu 4 bulan tidak mampu menyelesaikan masalah, sanksi benar-benar dijatuhkan?

Oleh : Ardi Winangun PENUNDAAN sanksi ini bukan yang pertama. Penundaan sanksi sudah ketiga kalinya. Pada Maret 2012 badan sepakbola yang bermarkas di Zurich, Swiss, itu juga menunda sanksi. FIFA mengharap PSSI mampu menyelesaikan masalahnya hingga Juni 2012. Namun ketika jeda waktu yang sudah ditentukan berakhir dan PSSI tidak bisa menyelesaikan masalahnya, FIFA tidak segera menjatuhkan sanksi namun masih memberi waktu hingga 10 Desember 2012. Ketika waktu yang telah ditetapkan sudah habis dan lagi-lagi PSSI tidak mampu menyelesaikan apa yang diharapkan, FIFA pun juga tidak kunjung menjatuhkan sanksi namun masih diberi waktu. Apa yang dilakukan FIFA itu menunjukkan bahwa FIFA plin plan, tidak tegas, dan sepertinya ada sesuatu dibalik diundurundurnya sanksi. Sikap ‘tidak bertanggungjawabnya’ FIFA bertambah ketika masalah PSSI dilimpahkan kepada badan sepakbola Asia, AFC. Tentu apa yang dilakukan oleh FIFA ini membuat geram sebagaian ka-

langan, sebab sebagaian kalangan menilai dengan adanya sanksi inilah yang dirasa mampu membuat intropeksi dan sadar diri bagi seluruh insan sepakbola Indonesia. Dalam masa-masa hukuman yang dijatuhkan inilah dirasa sebagai waktu yang tepat untuk membangun badan sepakbola Indonesia dan program-program yang lebih baik. Hukuman FIFA kepada anggota biasanya diberikan apabila terbukti adanya intervensi dari pemerintah negara masingmasing. FIFA mempunyai statuta bahwa badan sepakbola yang tergabung dalam FIFA harus lepas dari campur tangan pemerintah. Dengan statuta itu diharapkan badan sepakbola menjadi lebih mandiri dan tidak menjadi kepentingan politik dan kampanye penguasa. Badan sepakbola yang pernah diberi sanksi atas intervensi pemerintahannya seperti Irak, Ethiopia, Nigeria, Iran, Brunai Darussalam, Kuwait. Sanksi yang diberikan kepada anggotanya itu bervariasi, ada yang hanya hitungan hari, se-

perti 1 minggu; ada pula yang hitungan bulanan, 1 bulan, 2 bulan, 5 bulan; adapula sanksi dengan waktu yang tak jelas kapan berakhirnya. EPO, PSSInya Yunani; dan NFF, PSSI-nya Nigeria, diberi sanksi di bawah kurang lebih hanya 7 hari. Sedang FFBH, PSSI-nya BosniaHerzegovina, diberi sanksi sejak 1 April 2011 dan hingga kini sanksi itu belum dicabut. Lama tidaknya sanksi yang diberikan bisa jadi dengan pertimbangan sepakbola di negeri itu penting atau tidak di kawasannya. Sanksi yang hanya 1 mingguan bagi EPO dan NFF bisa jadi tim nasional yang dibentuk oleh badan sepakbola itu cukup mempunyai kiprah di kawasannya. Demikian pula sanksi yang hanya 1 sampai 2 bulan yang diberikan kepada Irak, Iran, dan Kuwait, karena negara itu cukup mumpuni tim nasionalnya di kawasan Timur Tengah. Sedang sanksi kepada badan sepakbola Brunai dan Bosnia-Herzegovina cukup lama karena bisa jadi tim nasionalnya tidak terlalu berarti di kawasan yang ada. Lalu mengapa FIFA plin plan kepada PSSI? Bisa jadi FIFA melihat ada potensi lain dalam dunia sepakbola Indonesia. Indonesia kalau diukur dari kapasitas tim nasional masih masuk katagori yang memprihatinkan, untuk ukuran Asia Tenggara saja sudah megap-megap apalagi kalau berlaga di Asia dan dunia, namun dengan penduduk lebih dari 250 juta jiwa, Indonesia adalah pasar yang menjanjikan bagi perkembang-

an sepakbola dunia. Potensi pasar sepakbola di Indonesia yang dilihat FIFA untuk dunia itu adalah. Pertama, liga sepak bola Indonesia adalah liga terbaik dan termeriah di Asia Tenggara. Ibarat lampu dan laron, liga sepak bola Indonesia menjadi lampu dan mampu menarik laron-laron pemain sepak bola di mana pun. Mengapa liga sepakbola Indonesia menarik bagi pemain asing? Faktor bayaran untuk pemain asing relatif tinggi membuat banyak pemain dari Eropa, Australia, Amerika Latin, dan kawasan Timur Tengah berbondong-bondong untuk bisa menjalin kontrak dengan klub yang ada di LPI atau LSI. Antusiasnya penonton di liga sepak bola Indonesia juga menjadi magnet bagi pemain asing. Pemain Tim Nasional Singapura dan Malaysia ngebet bermain di Indonesia, selain bayaran yang tinggi juga karena antusiasnya suporter klub. Meriahnya suasana di stadion dengan hadirnya puluhan ribu penonton ternyata menjadi salah satu spirit bagi pemain untuk bermain bagus. Meriahnya suasana di dalam stadion, dengan teriakan dan nyanyian suporter, hal demikian tidak ditemui di liga sepak bola Singapura dan Malaysia sehingga liga yang ada dirasa kurang memiliki greget. Kedua, Indonesia adalah negara yang sering dijadikan tempat lawatan klub-klub ternama dari Eropa dan Amerika Latin. Klub-klub kesohor yang pernah bermain di Indonesia khusus-

nya di Gelora Bung Karno adalah Bayern Munchen, Inter Milan, Santos, Sampdoria, Tim Nasional Uruguay, AC Milan, Tim Nasional Afrika Selatan U-21, LA Galaxy, Red Star Bratislava, Dynamo Moscow, Manchester United, Ajax Amsterdam, Tim Nasional Italia U-21, Arsenal, PSV Eindhoven, Queen Park Rangers, Lazio, dan di tahun 2013 disebut Barcelona FC akan datang ke Indonesia. Tentu kedatangan mereka bukan cuma-cuma namun ada sponsor. Pastinya nilai rupiah dari mendatangan klub-klub itu tidak kecil. Di sinilah FIFA melihat potensi ekonomi yang tinggi dari Indonesia untuk sepakbola dunia. Ketiga, antusias dunia sepakbola di Indonesia juga dilihat oleh klub-klub besar di Eropa. Untuk itu klub-klub besar mendirikan sekolah sepakbola. Sekolah sepakbola dari luar yang membuka cabang di Indonesia seperti SSI Arsenal, Liverpool Internasional Football Academy, FC Barcelona Escola Indonesia, dan Sekolah Sepak Bola Real Madrid. Tentu para orangtua yang menyekolahkan anaknya di sekolah sepabola itu perlu merogoh kocek yang dalam sebab sekolah sepakbola itu tentunya dalam latihan tidak seperti sekolah sepakbola di kampungkampung. Sekolah sepakbola dari luar melihat bahwa Indonesia mempunyai pasar yang bagus dan menggairahkan sehingga akan ada lagi sekolah-sekolah sepakbola yang akan membuka cabang di Indonesia.

KONSTITUSI kita secara terang benderang sudah menggariskan sistem pemerintahan kita ialah presidensial. Sistem itu di antaranya menegaskan hanya presidenlah yang memegang hak prerogatif untuk mengangkat, memberhentikan, dan mengganti para menteri. Namun, urusan yang mestinya amat mudah, benderang, dan lumrah tersebut menjadi rumit, remang-remang, bahkan terkadang genting. Urusan reshuffle kabinet pun seolah menjadi persoalan hidup mati. Celakanya, sang pemilik mandat prerogatif seperti bergeming menonton ‘drama’ tidak bermutu itu. Presiden kerap terlambat, bahkan terkesan mengulur waktu sehingga kegaduhan akibat isu reshuffle terus menggema hampir saban tahun. Dalam kasus kekosongan kursi menteri pemuda dan olahraga (menpora), misalnya, Presiden Susilo Bambang Yudhoyono memilih sikap menunggu. Padahal, sang pemilik kursi sebelumnya, Andi Alifian Mallarangeng, sudah mundur sejak delapan hari lalu. Untuk sementara, entah sampai kapan, posisi menpora diisi oleh Menko Kesra Agung Laksono sebagai pejabat sementara menpora. Agung, yang kesibukannya sebagai menko kesra kita asumsikan berjibun, harus membereskan urusan olahraga dan kepemudaan yang juga ruwet dan pelik. Baru sehari menjabat menpora saja, Agung harus dihadapkan pada tenggat menyelesaikan kisruh di PSSI. Belum lagi kerja-kerja mengoordinasikan persoalan kesejahteraan rakyat, bencana di sejumlah tempat, dan bahkan soal flu burung yang mulai bermutasi ke itik, yang amat mendesak dibereskan. Jelas, akan ada yang dikorbankan jika dua bahkan tiga urusan penting datang secara bersamaan. Karena itu, amat susah membayangkan segalanya akan berakhir efektif dan tepat waktu. Kecuali, Presiden menganggap bahwa kursi menpora tidak teramat penting untuk diisi pejabat definitif. Presiden, misalnya, menganggap urusan kepemudaan dan olahraga sudah bisa diatasi institusi yang selama ini ada, baik dengan atau tanpa kehadiran menpora. Urusan olahraga, contohnya, bisa diurus Komite Olahraga Nasional Indonesia (KONI). Hal ihwal kepemudaan boleh digarap organisasi ekstrakampus seperti HMI, GMNI, PMII, PMKRI, GMKI, atau KNPI. Sah-sah saja kalau Presiden berpikiran seperti itu. Namun, jangan diam, sembunyi-sembunyi, atau terus menimbangnimbang. Umumkan ke publik bahwa kursi menpora bisa diperankan institusi lain di negeri ini. Bahkan kalau perlu, berikan argumentasi yang sahih mengapa kursi menpora tidak dibutuhkan lagi. Bukankah meskipun ada menpora, prestasi olahraga kita sejauh ini jalan di tempat, bahkan cenderung merosot? Mengambangkan keputusan berhari-hari justru menambah dosis kegaduhan yang mestinya tidak perlu ada. Di tengah menumpuknya persoalan yang jauh lebih besar di negeri ini, menghadirkan kegaduhan yang tidak perlu seperti menyetel kaset rusak berulang-ulang. Amat menyebalkan dan membikin pusing. (*)

Kesimpulannya, apabila FIFA dan AFC memberi sanksi kepada PSSI maka secara tidak langsung FIFA dan AFC memutus ‘rantai makan’ bagi pemain sepakbola asing dan klub asing sehingga FIFA dan AFC dalam posisi bingung dan plin plain, bila tidak

diberi sanksi PSSI akan selalu dirundung konflik, namun bila diberi sanksi ‘suplai’ ekonomi sepakbola Indonesia untuk dunia terhenti. (***) Penulis adalah Penggemar Sepabola


19 Desember 2012

Lakalantas Maut, Dua Tewas, 24 Luka-luka RANTAU- Kecelakaan maut terjadi di Jalan Lintas Sumatera Desa Janji, Kecamata Bilah Barat, Kabupaten Labuhanbatu, Selasa (18/ 12) dini hari. Dua orang dinyatakan tewas dan 24 lainnya luka-luka saat bus Pinem nomor polisi BK 7599 A tabrakan dengan bus Kota Pinang Baru (KPB) bernomor polisi BK 7359. Informasi yang dihimpun, tabrakan terjadi ketika bus Pinem yang melaju dari arah Medan menuju Pekan Baru menabrak pembatas jalan yang berdiri tepat di tengah Jalinsum Desa Janji, Kecamatan Bilah Barat. Akibatnya, ban depan bus Pinem itu terangkat dan supir membanting setir ke arah kanan, bersamaan dari arah berlawanan, datang sebuah bus KPB trayek Kota PinangMedan yang sedang melaju kencang, hingga tabrakan pun tak dapat terhindarkan. “Bus Pinem melaju dari arah Kota Medan menuju Rantauprapat, sedangkan bus KPB melaju dari arah Rantauprapat menuju Kota Medan. Tabrakan terjadi ketika Bus Pinem menghantam pembatas jalan, bus Pinem terjungkal dan supir membanting setir ke arah kanan hingga menabrak bus KPB yang datang dari arah berlawanan,” kata Kasat Lantas Polres Labuhanbatu AKP Faidil didampingi Kanit Patroli Satlantas Polres Labuhanbatu Iptu H Limbong Zikri saat berada di lokasi kejadian. Dijelaskan Zikri, supir bus KPB Syaiful (40), warga Kota Pinang Kabupaten Labusel dan seorang penumpang wanita yang belum diketahui identitasnya meninggal di tempat kejadian. “Ada 2 korban tewas di tempat, seorang supir dan seorang penumpang bus KPB. Namun hingga kini identitas jenazah penumpang berjenis kelamin perempuan itu belum kita ketahui, dan masih berada di kamar jenazah RSU Rantauprapat,” terang Zikri. Sementara 24 orang lainya, yang merupakan penumpang bus Kota Pinang Baru yang mengalami luka-luka yakni Ari (17) warga Perbaungan, Sugito (35) warga Indrapura, Koko (44) warga Rantauprapat, Isma Yulia (17) warga Kota Pinang, Kartika(21)wargaMedan,Ismail(21)wargaRokan Hilir, Sri Trisnawati (26) warga Kota Pinang, Takwa (21) warga Medan, Johannes Ginting (28) warga Medan, Sri (32) warga Kota Pinang, Butet (19) warga Kota Pinang, Riosha Novita (16) warga Kota Pinang, Hilman Simanjuntak (52) warga Tebing Tinggi, Rosmaida (42) warga Tebing Tinggi, Lonaki Sembiring (34) warga Tebing Tinggi, Fransiska (17) warga Pekan Baru, Nesima (64) warga Perbaungan, Putri (26) warga Kota Pinang, Lindawati (28) warga Kota Pinang, Anita (39) warga Blok Songo Kota Pinang, Adita Peranginangin (24) warga Medan, Amrin (27) warga Asahan, Rukita (41) warga Kota Pinang, Pasha (11) warga Kota Pinang. “Mereka yang luka-luka sebagian masih dirawat di RSU Rantauprapat dan sebagian sudah kembali pulang,” kata Zikri. Sementara menurut penuturan dari masyarakat sekitar, pembatas jalan di Jalinsum Desa Janji berpotensi mengakibatkan kecelakaan lalu lintas. Pasalnya, pembatas jalan tersebut berada persis di atas puncak jalan menanjak hingga sering tidak terlihat para supir jika melaju dengan kecepatan tinggi. “Letaknya persis berada di puncak tanjakan. Wajarlah kalau bus Pinem itu menabrak benda itu, karena kalau dari bawah tidak kelihatan,” kata Tono (31), warga Desa Janji, Kecamatan Bilah Barat. Ditambahkan Tono, pihaknya berharap Pemkab Labuhanbatu segera melakukan perbaikan letak pembatas jalan agar tidak menjadi ancaman keselamatan bagi pengendara. “Dishub jangan asal-asal saja pasang pembatas tanpa ada rambu-rambu yang jelas. Kalau sudah kejadian, masyarakat juga yang menjadi korbannya,” katanya. (CR-01)


1.590 Polisi Disiagakan di 106 Pospam & 13 Posyan MEDAN- Untuk memberi pengamanan dalam perayaan Natal dan Tahun Baru 2013, Kepolisian Daerah Sumatera Utara (Poldasu) menggelar Operasi Lilin Toba 2012. Pelaksanaan Operasi itu akan dimulai 21 Desember 2012 hingga 1 Januari 2013. Dalam operasi itu, Poldasu menyiapkan 1.509 personil yang akan bertugas di 106 Pos Pengamanan (Pospam) dan 13 Pos Pelayanan (Posyan). Kabid Humas Poldasu Kombes Pol Raden Heru Prakoso mengatakan, perayaan Natal dan Tahun Baru 2013 kali ini bisa dipastikan aman. Pasalnya, sejauh ini tidak ada ancaman serangan atau kegiatan teroris yang akan mengganggu kegiatan ibadah pada malam Natal dan Tahun Baru 2013 nanti. “Hasil paparan dari Direktorat Intelejen Keamanan Poldasu menyebutkan, tidak ada ancaman bahaya teroris di wilayah Sumut. Namun begitu, kami akan tetap waspada dan akan melakukan pengamanan untuk mengantisipasinya,” ujar Heru, Selasa (18/12). Dikatakan Heru, pihak Poldasu telah mengadakan rapat koordinasi dengan beberapa lintas sektoral, yang dihadiri oleh beberapa instansi, baik dari pemerintahan daerah maupun dari TNI. “Rapat ini diselenggarakan untuk menyamakan persepsi maupun pola tindak dalam pelaksanaan Operasi Lilin Toba 2012, yang akan dilaksanakan usai gelar pasukan Jumat mendatang,” ungkapnya.

Sambungan Halaman 1 Manager PT Sipef disebut telah melakukan pelanggaran hukum, yakni Pasal 274 ayat 1 UU Nomor 22 Tahun 2009 tentang lalu-lintas dan angkutan jalan dan pasal 406 KUHPidana. Hal ini dikemukakan oleh Regen Rajaguguk (66) warga Nagori Syahkuda Bayu, Kecamatan Gunung Malela melalui kuasa hukumnya Sarbudin Panjaitan kepada METRO, Selasa (18/12). Regen menjelaskan, bencana longsor yang mengakibatkan badan jalan hancur berawal pada bulan November 2012, di mana pihak PT

Sambungan Halaman 1 ngan pihak PTPN III Bangun, pihak irigasi, Muspika untuk mengalirkan air kembali ke tempat semula mengingat debit air yang mengalir di bundar milik Sipef cukup besar untuk segera ditindaklanjuti. Kedua, selama jembatan dalam proses perbaikan, untuk mempermudah kegiatan perekonomian, pendidikan dan lain-lain, kami dapat memberikan akses jalan perkebunan untuk dilalui kendaraan dengan kapasitas kendaraan tidak melebihi dari kemampuan jembatan kami (maksimal 2 ton) dan tidak dikutip biaya. terakhir, akses jalan utama sudah kami lakukan perbaikan dengan memggunakan alat berat perusahaan, sesaat setelah kejadian. Surat pernyataan sikap dikeluarkan PT Sipef, Senin tanggal 10 Desember 2012 dan langsung ditandatangani oleh Masri Effendi selaku Estate Maneger di kebun PT Sipef. Dari hasil isi surat yang dikeluarkan, butir pertama kalimat terakhir disebutkan “Segera akan kami tindaklanjuti”. Namun sampai Selasa (18/12) pihak perkebunan PT Sipef belum ada melakukannya. Sementara dalam butir ke tiga yang disebut “Akses jalan utama sudah kami lakukan perbaikan dengan mempergunakan alat berat perusahaan”. Penyataan itu bukan hanya memperbaiki tanah longsor yang terjadi di bibir jembatan Rabu (5/12) sekira pukul 18.30 WIB, melainkan tanah longsor di sekitar jembatan

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel)

Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Sipef memerintahkan karyawannya untuk mengeruk parit jalan tepatnya di jalan umum Bukit Maraja, Kabupaten Simalungun dengan alat berat. Namun pengorekan itu disebut asal-asalan dan mengakibatkan badan jalan menjadi longsor. Bahkan longsor itu, merembes ke jembatan dan berujung ambruk. Oleh sebab itu, arus lalu-lintas Siantar Perdagangan lumpuh total. Akhirnya kendaraan terpaksa melintas dari jalan alternative, yakni dari kebun dengan kondisi jalan yang rusak. Selain jalan rusak, masyarakat yang melintas juga merasa terancam keselamatannya

disebabkan sepanjang jalan gelap dan sunyi. “Masyarakat setempat, pengguna jalan dan pemerintah telah dirugikan mencapai miliaran rupiah, baik jembatan dan badan jalan kondisinya sudah hancur. Dan ini karena ulah pihak PT Sipef,” kata Sarbudin dengan tegas. Berdasarkan hal itu, Manager PT Sipef dapat dikualifikasikan telah melanggar larangan dalam UU Nomor 22 tahun 2009 tentang lalulintas dan angkutan jalan. Dalam pasal 29 ayat (1) disebutkan, setiap orang dilarang melakukan perbuatan yang mengakibatkan kerusakan atau gangguan fungsi jalan. Melalui pengaduan ke Mapolres Simalu-

Pernyataan PT Sipef Belum Dikerjakan

Anggota SPS No: 438/2003/02/A/2007 Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba

Labuhanbatu 1, Nias 1, Pakpak Barat 1, Taput 2, Tobasa 1, dan Dairi 1 titik.” beber Heru. Dalam hasil rapat yang digelar di Poldasu, terkait pengamanan di lokasi ibadah tersebut, Kapoldasu Irjen Pol Wisjnu Amat Sastro memerintahkan personilnya agar melakukan sterilisasi di lokasi ibadah, 2 jam sebelum acara ibadah berlangsung. Selain itu, untuk mengamankan pengunjung dereja saat akan berlangsungnya ibadah Natal dan Tahun Baru, petugas akan berkordinasi dengan pemuda Gereja atau panitia Gereja untuk bersamasama menjaga dan memelihara keamanan. “Untuk mempermudah pemeriksaan saat berlangsungnya ibadah, Kapoldasu mengimbau agar para jemaat Gereja tidak membawa tas atau benda-benda lain, cukup bawa Alkitab, sehingga sewaktu dilakukan pemeriksaan tidak memakan waktu,” ucapnya. Selain jumlah personil yang akan disiagakan, Heru menambahkan, berdasarkan hasil survey yang dilakukan, jumlah titik jalan rusak yang ada di provinsi Sumut sebanyak 15 titik. Paling banyak terdapat di Wilayah Tapanuli Utara, Tanah Karo, Tobasa, Madina, dan Tapsel. Selain itu, titik rawan terjadinya longsor ada 10 titik, yakni wilayah Simalungun, Medan, Pakpak Barat, Tanah Karo, Taput, Tapteng, Madina, Dairi, Humbahas dan Sibolga. “Khusus untuk mengamankan daerah longsor ini, petugas akan disiagakan dan termasuk alat

berat akan stand by di lokasi,” kata Heru. Heru menyebutkan, hasil survey yang dilakukan juga mencatat, daerah rawan banjir terdapat di beberapa wilayah, di antaranya Medan, Deli Serdang, Langkat, Labuhanbatu, Belawan, Sergai, Madina. “Dari daerah yang rawan banjir tersebut, Kota Medan merupakan daerah yang paling rawan,” tambah Heru. Sementara itu, daerah yang paling rawan kecelakaan dan kemacetan ada 20 titik, yakni Medan, Sergai, Labuhanbatu, Tanah Karo, Deliserdang, Asahan dan Langkat. Dijelaskanya, hingga kini tidak ada kekurangan stok BBM (bahan bakar minyak) dipenghujung tahun 2012 ini. “Dalam rapat koordinasi tadi, Kapoldasu juga mengimbau, agar pihak SPBU tidak menumpuk atau menyimpan uang di kantor SPBU, karena hal itu dapat mengundang terjadinya tindak pidana curas (pencurian dengan kekerasan) dan juga curhat (pencurian dengan kejahatan),” ujarnya. Selain itu, dalam paparan Disperindag Sumut dalam rapat koordinasi tersebut, menyampaikan bahwa stok sembako cukup untuk tiga sampai lima bulan ke depan. Dalam paparannya tersebut, Heru mengimbau agar pihak PT. KAI ( Kereta Api Indonesia) untuk melakukan antisipasi jalur kereta api yang tidak memiliki plang. “Hal ini untuk menghindari terjadinya kecelakaan,” pungkasnya. (mag-12)

Manajer PT Sipef Diadukan ke Polres

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pemimpin Perusahaan Metro Asahan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Katanya, tugas pokok digelarnya Operasi Lilin Toba 2012 oleh jajaran Poldasu, instansi terkait, untuk memelihara keamanan dan kenyamanan masyarakat, dengan mengedepankan kegiatan preventif yang didukung dengan kegiatan intelejen. Heru menyebutkan, Operasi Lilin Toba 2012 ini digelar dengan melibatkan personil baik dari Satuan Tugas Poldasu maupun Satgaswil sebanyak 1.590 personil. Kemudian jumlah tersebut juga akan dibantu oleh TNI, Dinas Pemadam Kebakaran, Pekerjaan Umum (PU), Satpol PP, Pramuka, Dishub, Dinas Kesehatan yang keseluruhannya berjumlah 1.757 orang. “Jumlah personil ini akan melaksanakan tugasnya di 119 Pos, yang terdiri dari 106 pos pengamanan dan 13 pos pelayanan,” tegasnya. Disebutkan Heru, pos pengamanan tersebut akan berada di tempat-tempat yang rawan tindakan kriminaitas maupun kecelakaan lalulintas (lakalantas). Sementara itu, pos pelayanan bertujuan memberikan pelayanan terhadap masyarakat berupa informasi pengguna jalan. Selain itu, di pos pelayanan ini juga akan disediakan fasilitas umum, misalnya tempat istrahat dan juga pelayanan kesehatan. “Pos pelayanan ini ada di 13 titik di 12 wilayah kabupaten yang akan terus siaga selama 24 jam. Lokasi tersebut adalah Kabupaten Langkat, Binjai 1, Sibolga 1, Padang Sidempuan 1, Tebing Tinggi 1, Asahan 1,

Jalan Asahan kilometer 20 akibat pengerukan lubang parit. Hal tersebut disampaikan Anto (54) warga sekitar yang juga salah seorang pengurus Formapel. Ketika ditemui METRO Selasa (18/12), Anto mengatakan, pihaknya akan terus mengusut pihak perkebunan PT Sipef untuk menuntaskan bencana tanah longsor di sepanjang Jalan Asahan kilometer 20. Penyebab utama terjadianya longsor karena ulah PT Sipef sendiri. Di mana pengerukan dilakukan tanpa memperhatikan kondisi tanah yang tergolong lembek. “PT Sipef harus bertanggungjawab penuh dengan kondisi tanah longsor yang terjadi di Jalan Asahan km 20,” tegas Anto. Masih kata Anto, jika dikaji ulang, butir kedua dari surat penyataan sikap PT Sipef, yang berbunyi “Selama jembatan dalam

proses perbaikan, untuk mempermudah kegiatan perekonomian, pendidikan dan lain-lain, kami dapat memberikan akses jalan perkebunan untuk dilalui kendaraan dengan kapasitas kendaraan tidak melebihi dari kemampuan jembatan kami (maksimal 2 ton) dan tidak dikutip biaya apapun”, di sana tidak disebutkan waktu pengalihan jalur alternatif tersebut. Bukti di lapangan, areal kebun hanya dapat dilintasi pada siang hari. Sementara kalau malam, palang milik PT Sipef sudah tutup, pertanda jalur alternatip dari lahan mereka tidak dapat dilalui. “Kalau takut kehilangan buah kelapa sawit di areal perkebunan itu tidak alasan. Karena PT Sipef memiliki banyak Pam Swakarsa untuk menjaga buah kelapa sawit milik mereka,” katanya. (mag-4)

Empat Perampok Aniaya Oknum Polisi Sambungan Halaman 1 (35) warga Kecamatan Rantau Selatan, Labuhan Batu Selatan, Juniper Manurung (33) warga Jalan Glugur Desa Aek Matiu Kecamatan Aek Matiu, Labuhanbatu, Agus Irwansyah Siregar alias Agus (35) warga Serdang Bedagai dan Muchtar alias Kendoy warga Jalan Binjai, Sei Mencirim Perumahan Griya Mencirim Minimalis, Medan. Di hadapan hakim yang dipimpin David Sitorus beranggotakan Monalisa dan Siti Hajar, korban mengaku bahwa peristiwa itu berlangsung pada Jumat (24/10) sekira pukul 21.00 WIB di Afdeling IV PTPN IV Dolok Ilir, Kecamatan Dolok Batu Nanggar. Anggota Polri ini ditugaskan untuk menjaga alat berat berupa eskavator milik UD Saroha yang berada di lokasi perkebunan. “Saya memang disuruh pimpinan untuk menjaga alat berat milik UD Saroha mulai pukul 18.00 WIB hingga pukul 06.00 WIB. Setiap harinya, yang bertugas menjaga alat berat itu saya dan seorang dari pihak perkebunan,” jelasnya. Dia mengatakan, malam itu seperti biasa dia bertugas menjaga eskavator tersebut. Kebetulan di lokasi itu dia sendiri karena temannya izin untuk mengambil tikar. Saat itu gelap dan hujan, dia pun memilih merokok sambil menjaga lokasi sekitar. “Waktu aku lagi merokok, tiba-tiba ada memukul punggungku menggunakan

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Chandro Purba, Nasa Putramaylanda, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Pala MD Silaban, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Freddy Tobing, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva

besi. Saya tidak bisa melihat siapa yang memukul itu, karena lokasinya cukup gelap. Saat itu saya masih sempat berdiri dan melakukan perlawanan. Tapi para perampok itu pun mendekati saya dan mulai mengeroyok,” ungkapnya. Kata Aiptu Sathar, saat dia tergeletak di tanah, salah seorang dari terdakwa memijak kepalanya sambil menanyakan apa pekerjaannya. Selanjutnya korban mengaku bahwa dia penjaga alat berat itu. “Waktu itu saya bilang kalau saya penjaga alat berat. Tapi perampok itu bertanya apakah saya seorang polisi dan apa pangkat saya. Saya pun mengatakan kalau saya berpangkat Aiptu. Usai mendengar penjelasan saya, perampok itu berkata panggil komandan-mu, supaya kutembak mati,” ungkap Sathar menirukan ucapan salah seorang terdakwa. Menurutnya, saat itu para terdakwa juga sempatmengambilbarang-barangnyaberupa senjata, tas, handphone dan uang. Terdakwa terakhir pergi karena mendengar ada suara sepedamotor yang mendekat ke lokasi. “Setelah mendengar sepedamotor itu, para perampok pun lari dan meninggalkan saya di lokasi dengan kondisi tangan, kaki dan mulut diikat. Kemudian saya pun mencoba melepaskan ikatan itu. Setelah berhasil, saya berlari menuju kali dan datang ke lokasi pengamanan perkebunan. Setibanya di lokasi itu saya langsung tidak sadarkan diri,” ungkapnya. (mua)

Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Niko, Hotlan Doloksaribu Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: -, Staf Pengembangan: Simson Winata, Ponco, Romanis Sipayung Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

ngun, Sarbudin mengharapkan agar pihak kepolisian segera menindaklanjuti laporan mereka. “Yang membangun jalan dan jembatan itu bukan PT Sipef, melainkan uang pemerintah. Sehingga kepolisian tidak boleh tinggal diam dalam hal ini,” kata Sarbudin. Hingga saat ini, kondisi arus lalu-lintas Siantar-Perdagangan tepatnya di kilometer 20 menjadi lumpuh total. Bahkan pagi hari, pengedara dari luar kota menjadi bingung dan tidak tahu harus melalui jalan mana. Sementara itu belum ada tanda-tanda pembangunan jembatan serta perbaikan badan jalan yang longsor. (pra)

Bripka AMN Tak Kunjung Ditahan Sambungan Halaman 1 anak di bawah umur, menjadi masalah yang berlarut-larut dan terkesan menjadi boomerang bagi penegakan hukum pada perlindungan anak. “Sebagai lembaga yang independent dalam penegakan hukum perlindungan anak, Komnas Perlindungan Anak (Komnas PA) akan terus memantau proses hukum terhadap AMN yang lambat,” kata Arist Merdeka Sirait, Selasa (18/12). Ditambah Arist, keragu-raguan Polres Siantar dalam melakukan penahanan terhadap AMN adalah bentuk pelecehan terhadap korban dan pelanggaran terhadap undangundang perlindungan anak. “Demi kepentingan terbaik anak dan keadilan bagi korban, Komnas PA sebagai lembaga independent di bidang perlindungan, pernghormatan dan penegakan hak-hak anak Indonesia, besok Rabu (19/12) akan resmi menulis surat kepada Kapoldasu dan melaporkan kasus tersebut ke Komponas di Jakarta. Keragu-raguan Polresta Siantar untuk mengangkap dan menahan AMN adalah merupakan pelecehan terhadap korban dan pelanggaran terhadap UU perlindungan anak dan etika profesi penegak hukum. Komnas PA akan terus memantau dan mengawal kasus kekerasan seksual ini. Dalam kasus ini Komnas PA ingin menegakkan citra polisi,” kata Arist. Sebelumnya, Selasa (11/12) Komnas PA telah mengirimkan surat secara resmi kepada Polres Siantar yang berisi dukungan terhadap penegakan hukum atas pengaduan Ibu Duma Susiana Sitinjak pada Komisi Nasional Perlindungan Anak pada tanggal 3 November 2012, perihal dugaan penculikan dan kekerasan seksual yang dialami anak kandungnya WW (14) yang diduga dilakukan AMN dan Ferry (30). Dengan menggunakan pasal 82 UU no.23 Tahun 2002 Komnas PA memberi dukungan agar Polres Siantar melakukan penahanan terhadap para tersangka. Kapolres Siantar melalui Kanit PPA Aiptu Malon Siagian ketika dikonfirmasi mengatakan, terhadap tersangka AMN tidak dilakukan penahanan. SPDP sudah dikirim ke Kejari Siantar, Jumat (14/12) dan selanjutnya berkas perkara akan dikirim dalam minggu ini. “Saya yakin berkas ini P21”, ujarnya. (mag-05)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733




19 Desember 2012

Telkomsel Hadirkan NSP Rohani MEDAN-Telkomsel menghadirkan NSP Rohani menjelang Natal dan Tahun Baru. NSP tersebut dapat diunduh pelanggan untuk menggantikan nada sambung standar di ponsel menjadi lantunan lagu rohani yang dapat dinikmati si penelepon sambil menunggu panggilannya terjawab oleh orang yang dituju.

PANEN-Petani sedang memanen buah kakao di areal perkebunannya, baru-baru ini.

Ekspor Kakao Sumut Turun 30 Persen MEDAN - Meski Pemerintah Propinsi Sumatera Utara (Sumut) begitu optimis kinerja ekspor akan membaik di kuartal pertama tahun depan, namun kinerja ekspor sejumlah komoditas saat ini masih cukup terpuruk. Bahkan realisasinya menurun cukup tajam baik secara volume maupun nilainya. Salah satunya untuk komoditas kakao, yang menjadi salah satu komoditas penting bagi Sumut. Total nilai ekspor ini hingga November 2012, turun lebih dari 30 persen. Padahal konsumsi produk olahan komoditas ini terus meningkat di dalam maupun di luar negeri. Dinas Perindustrian dan Perdagangan Sumatera Utara mengaku hingga November 2012 lalu, nilai ekspor komoditas ini baru mencapai USD67,59 juta, menurun 31,03 persen dibandingkan November 2011 yang mencapai USD97,99 juta. ”Nilai realisasinya menurun lebih dari 30 persen. Penurunan nilai realisasi ini didorong pula oleh penurunan harga. Tercatat hingga November ini volumenya mencapai 28.121 ton dengan harga rata-rata per kilogram (kg) hanya USD2,4 per kg. Sementara hingga November

tahun lalu, volumenya mencapai 31.090 ton dengan harga rata-rata mencapai USD3,15 per kg,” terang Kepala Seksi Ekspor Hasil Pertanian dan Pertambangan Dinas Perindustrian Dan Persagangan Sumut Fitra Kurnia, Selasa (18/12). Fitra menambahkan, penurunan kinerja ekspor kakao selama setahun ini juga terjadi di November lalu. Meski bukan termasuk penurunan tertinggi sepanjang tahun, namun penurunannya sangat signifikan dibandingkan November 2011. ”Kalau di November 2012 saja, volume ekspornya mencapai 2.702 ton, dengan nilai mencapai USD5,866 juta.Sementara di November tahun lalu jumlahnya mencapai 5.578 ton dengan nilai mencapai USD15,664 juta,” paparnya. Komoditas Kakao Sumatera Utara sendiri hingga saat ini hanya di ekspor kelima negara. Yakni Amerika, China, Singapura, Malaysia dan Spanyol. Terjadinya krisis berkepanjangan yang berdampak pada penurunan produksi di Eropa dan Amerika, ikut ambil peran dalam menurunnya volume dan nilai realisasi ekspor kakao sumut. (oz/nik)

YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 / bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari YAYASAN MAHAGA SEJAHTERA: membutuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515 1742 CV SENTOSA ABADI: Perusahaan yang sedang berkembang pesat membutuhkan karyawan/ti dengan usia max. 27 tahun, pendidikan min. SMA/SMK sederajat (semua jurusan) dengan salery Rp 1.800.000,- s.d 3.000.000,- bawa lamaran langsung ke Jl. Medan KM 6 No. 58 (+ 10 M sebelum Simp. HKBP Bombongan)

• • • • • • •

PROMO MITSUBISHI BARU L300..................................................Ready Stock Colt Diesel ........................................Ready Stock T120 SS ...........................................Ready Stock FUSO ...............................................Ready Stock Pajero Sport .....................................Ready Stock Outlander Sport ...............................Ready Stock Mirage ..............................................Ready Stock Hub: SIMARMATA 0852 7775 9705

DIJUAL: Mobil toyota innova type G, tahun 2005, warna hitam metalik dan Toyota Soluna tahun 2002 XL, warna merah metalik, harga nego, hub. Toko Obat Marturia Jl. SM Raja No. 85 (Samp. Bea Cukai) Parluasan. HP 0812 769 3881 (TP) DIJUAL • Honda ZS RS Thn.2010 • Innova V Thn 2005 • Xenia Li. Thn 2009 • Honda CRV Thn 2002 • Kijang LGX Diesel Thn 2000 • Vios G Thn 2005 • Avanza S Thn 2009 • Avanza G Thn 2005 • Avanza G Thn 2007 • Kuda XCID Thn 2000 Hub: GRAND MITRA MOBIL Jl. Williem Iskandar / Jl. Pancing Medan HP 0812 6318 8876


• All New Xenia Angsuran 1,1 jt • Terios Angsuran 1,9 jt • Luxio Diskon menarik • Pick up Dp 12 jt an • Mini Bus Dp 15 % • Ayla 80-110 jt hub. SONNY SEMBIRING, HP 0812 6471890; 0811 6114 455 Proses cepat data dijemput. Menyediakan TEST DRIVE!!

Menurut Head of Sales and Customer Care Region Sumbagut Division – Filin Yulia “NSP merupakan salahsatu layanan Telkomsel yang sangat digemari. Dan biasanya saat Natal dan Tahun Baru pelanggan Telkomsel sering mengaktifkan lagu rohani sebagai NSP, hal ini dilakukan pelanggan selain menyesuaikan momen natal dan tahun baru serta sebagai penyemarak suasana dibulan Desember, pelanggan juga secara No 1. 2. 3. 4. 5. 6.

tidak langsung ikut menyemarakkan kegembiraan melalui lagu rohani dalam bentuk nada sambung saat pelanggan lainnya menunggu panggilannya terjawab oleh orang yang dituju. Untuk mengantisipasi kebutuhan tersebut, Telkomsel menyediakan berbagai pilihan lagu yang dapat digunakan oleh pelanggan sebagai NSP nya”. Untuk informasi Nada Sambung Pribadi pelanggan bisa mendapatkan informasinya de-

ngan mudah melalui website resmi telkomsel yaitu website http:/ / pilih service lalu pilih menu NSP 1212. Pelanggan dapat mengaktifkan Nada Sambung Pribadi (NSP) lagu-lagu rohani ini dengan mengirim SMS, ketik Alias lagu dan kirim ke 1212, contoh: HMBAA kirim ke 1212. NSP ini dapat dinikmati dengan tarif Rp.9.000,- untuk 30 hari dan dapat diperpanjang jika pelanggan menginginkannya. Pelanggan juga dapat mengirim NSP Rohani sebagai hadiah kepada pelanggan Telkomsel lainnya dengan mengetik RING (spasi) GIFT (spasi) KODE (spasi)NO TUJUAN kirim ke 1212. Dengan tarif yang sama. Contoh : RING GIFT HMBAA 081165XXXX. (leo)

Beberapa NSP lagu Rohani yang dapat diaktifkan pelanggan antara lain: Judul Lagu Artis Alias (Rp.9000) Hai Mari Berhimpun Maria Da Silva HMBAA White Christmas Michael Buble BARJY Malam Kudus Viktor Hutabarat MASIY Oh Holy Night Hosana Singers HYNAF Joy To The World Ruth Nelly & Daud J Pamel JTWAF Silent Night Agnes Monica SNDBO

„ Telkomsel akan hadirkan NSP Rohani terutama saat menjelang Natal dan Tahun Baru.

Tahun 2012

Produksi Kedelai Naik 40 Persen JAKARTA-Produksi kedelai nasional baru mencapai 800 ribu ton atau 40 persen dari kebutuhan nasional yang mencapai 2 juta ton tahun 2012. Menteri Pertanian Suswono mengatakan pemerintah menargetkan produksi naik 3,5 kali lipat menjadi 2,7 juta ton pada 2014. Salah satu caranya dengan menggenjot lahan perkebunan kedelai dari 700 hektar saat ini menjadi 2 juta hektar. Sebuah rencana yang tak mudah direalisasikan, memang. Tapi, tetap harus diusahakan sekuat tenaga. Sebab, kurangnya pro-

MITSUBISHI SUMATRA BERLIAN MOTOR: Pajero Sport, Outlander Sport, Mirage, Strada Triton, Lancer, (Chasis, Box, Tangki, Bus, Dump Truck Colt Diesel & Fuso, Pick Up & Minibus L300 & T120ss), Bunga Angsuran/Cicilan mulai dari "0%". Hub: BAYU - 0852 7696 8284 DAIHATSU PAKET MURAH 100% DP Angsuran • All N Xenia 24 jt 4.440.000 • Terios 24 jt 4.981.000 • Luxio 20 jt 4.902.000 • Pick up 11 jt 2.600.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0821 6308 7454. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio *PAKET AKHIR TAHUN DAIHATSU* XENIA 1,3.., CICILAN 1,2 Jt TERIOS.... CICILAN 2 Jt GRAN MAX PICK UP DP 11 Jt Proses Cepat, Ringan, Mudah & Pasti.: Info & pemesanan : RAHDY: 081361329496 082362009080

PROMO SPEKT AKULER TOYOT A SPEKTAKULER TOYOTA • All New Avanza ..Ready, Bonus Lengkap ! • All New Avanza VELOZ ...Bonus Lengkap !! • New Rush ..... Ready!! • Grand New Innova ...Ready!! • Grand New Fortuner VNTurbo ... Ready!! • Menangkan Lexus GS250, New Yaris, New iPad, Samsung Galaxy S III, dan hadiah lainnya. Hub : RICKY. M / Hp: 0812 6505 3191 – 0853 7199 9499 SALES EXECUTIVE TOYOTA SIANTAR. Data dijemput, Cash & Credit PROSES CEPAT..!! MARAGAM RAGAM BO... • Carry Pick Up 1.5 L DP 10Jtan atau Ang 2Jtan • Carry Extra Mega Pick Up 1,5 L Dp. 20Jtan atau Ang 2Jtan • APV Arena 1.5 L DP 30Jtan atau Ang 3Jtan • Ertiga 1.4 L New DP 40Jtan atau Ang 3Jtan • X Over 1.5 L DP 50Jtan atau Ang 3Jtan Data lengkap 2 hari mobil keluar, setelah survey PT Trans Sumatera Agung, Dealer Resmi Suzuki Hub: Edwardo Manik HP 0813 7583 8337


• All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya "DAIHATSU PROMO NATAL&TAHUN BARU" - Terios - Xenia - Gran Max - Luxio - Sirion Dp rendah bunga ringan,proses cepat Gratis kontrak servis 3 tahun DIJUAL: Mobil katana Rp 36 jt (nego halus), tahun 92, body kaleng, cat bodi bagus, AC dingin, kondisi ban bagus, hub. HP 0812 6438 777 (Tidak melayani agen)

duksinasionalbukanhanyamembuat produsen tahu dan tempe tergantung pada produk impor. Lebih dari itu, kondisi ini juga memboroskan devisa yang tidak sedikit. Hitung saja, setelah turun harga kedelai impor jatuhnya sekitar Rp6.500 per kilogram. Itu berarti, untuk memenuhi kebutuhan lokal dolar yang terbang ke luar negeri mencapai Rp7,8 triliun. Belumlagijikapasokan‘dimainkan’ oleh importir spekulan, yang membuat harga kedelai impor di tingkat pasar menjadi Rp8.000. Pertanyaannya,mampukahpe-

DIJUAL: Sepeda motor sport Bajaj Pulsar LS 135 cc, tahun 2010, warna merah, BK Siantar, pajak panjang, kondisi mulus, harga 7,5 jt, hub. HP 0821 2188 8872 (TP)

LESTARI MOTOR: Diskon DP 500 rb Menjual segala jenis sepeda motor Honda, Suzuki, Yamaha dan second, cash n kredit: • Honda Absolute Revo • Honda SX 125 • Scoopy, Vario Techno • Mio, Mio Soul • Jupiter Z • Satria FU, Spin, hub. 0622 - 22305; 24077; HP 0853 7070 9507; 0852 7601 5848. Jl. Merdeka No. 330 P. Siantar DISEWAKANRUKO: Ruko disewakan Jl. Kartini No. 15 B lengkap fasilitas Cafe, Ac, Meja, Kursi, 3 lantai, Sangat strategis & Cocok utk usaha apa pun khususnya coffee shop Hub. Apul Sianipar HP 081370229840 CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442.

CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442; P. Siantar CASH & CREDIT: Menyediakan rumah dan tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: 5 x 20 m, 10 x 20 m, 15 x 20 m, 20 x 20 m Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442.

merintah merealisasikan rencana mulia ini? Jawabnya, kalau diupayakandenganekstraserius,pasti bisa.Sebab,dulu,Indonesiapernah menjadi negara yang mampu memenui kebutuhan kedelainya dari kebun-kebun di dalam negeri. Ketika itu, luas kebun kedelai dalam negerimencapai1,5jutahektar.Tapi sayang, karena petani dibiarkan berjuang sendiri, produk mereka kalah oleh kedelai impor. Akibatnya, satu demi satu para petani mengganti tanaman mereka dengan tranaman lain yang lebihmenguntungkan.Itulahyang

„ Kedelai yang merupakan impor untuk meningkatkan produksi tempe. menyebabkan kebun kedelai nasional kini tinggal 700 ribu hektar. Jadi, kuncinya, kalau mau swasembada, lindungi petani dengan

harga pembelian yang pantas. Tak ada salahnya memperlakukan petani kedelai seperti beras (yang selalu dilindungi). (in/nik)

CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852 7600 0031; 08139688 9800

PASANG: Kartu Hallo Telkomsel, bagi yang berminat pilih nomor sesuai keinginan. Tersedia: • 0811 600 xxx • 0811 601 xxx • 0811 620 xxx • 0811 621 xxx • 0812 620 xxx • 0812 621 xxx (xxx) data langsung dijemput proses cepat, hub HP 0811 613 1219 (Dila)

CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

PETER REFLEKSI SINSHE ACIU / ALING: Mengobati segala penyakit •Asam lambung •Asam urat •Ambeian •Gula •Kolestrol dll Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0852 7695 4557; 0813 6017 0199 Buka : Jam 09.00 - 21.00 WIB

PASANG: Kartu Hallo Telkomsel, bagi yang berminat pilih nomor sesuai keinginan. Tersedia: • 0811 600 xxx • 0811 601 xxx • 0811 621 xxx • 0811 620 xxx • 0812 621 xxx • 0812 620 xxx (xxx) bisa ditentukan sendiri data dijemput dan langsung proses, hub HP 0811 601 189 (Zulham Siregar)

CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; 7070442 P. Siantar CASH & CREDIT: 10 x 21,8 m 20 x 22 m jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 1.908 M2 cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No. Telp. 0813 7612 2445; 0812 6207 631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar. CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar KAVLING AMELIA 2: Jual persil ukuran 7 x 22 M 50 jt, (ada 19 persil) SHM, lebar jalan 5,5 M. Jl. Asahan KM 6 Kec. Siantar, 100 M sebelum Simp. Perumnas Bt 6. hub. H Naibaho HP 0813 9781 8088; R br Purba HP 0852 7539 0076

CASH & CREDIT TANAH: 5 x 25 m, 5 x 20 m cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar HP 0813 7658 8917

KLINIK: Pusat penyembuhan Tong Chang Jhiang Tiongkok, megobati: •Diabetes • Ginjal •Lever, hub. HP 0853 5973 9523 WARUNG 165: Jl. Melanthon Siregar No. 31 A menyediakan: • Bakso • Mie Ayam • Siomay • Es dawet Ayu Mas Toni, datang dan rasakan nikmatnya. CV UTARA MULTI PROMOSINDO ADVORSING: Mengerjakan spanduk digital, neon box, plank merk, sablon, batu nisan, prasasti, baliho, stempel dll, alamat Jl. Pattimura No. 42 P. Siantar. Telp. 0622 - 27521; HP 0813 6234 7943 HORISON PHOTO: Spesial: •Pengadaan mesin photo copy, servis spare parts Fotocopy Rp 125/lbr •Pasphoto/cetak photo. Jl. Justin Sihombing (Simp. Jl. Pantai Timur) No. 7 B P. Siantar HP 0813 6100 1200 (Jhon Purba) REZEKI SAHABAT: Servis, ganti oli, pispot. Jl. Gereja No. 60 P. Siantar. Telp. 0622 29768.

FATNER GYPSUM: Menerima pemasangan: Plafon gypsum, instalasi listrik Menyediakan : Panel, profil, biding, cornice, puring dan bahan bahan gypsum lainnya. Siap dipanggil dalam dan luar kota Hub. HP 081396099231 (Bapak AJHONLY PURBA) Alamat : Jl. H Ulakma sinaga (depan Gereja RK) Rambung Merah LA ROSS SALON & FLORIST: Menerima: Make up dan sanggul, Rias pengantin, perawatan rambut, shomoting rambut. Juga menerima Roncean melati, Bunga tangan, Bunga papan, Bunga saub, Dekorasi pelaminan dan menjul mawar holan dll. Jl. SM Raja No. 324 Telp.0812 638 2759 HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti”

BUTIK OLYA: Menjual segala jenis pakaian jadi pria, wanita dan aneka ragam corak batik jenis kain katun, semua pakaian jadi dan bahan batik langsung berasal dari Solo harga terjangkau dan kelas menengah kebawah, alamat: Jl. Melanthon Siregar Gg PD P. Siantar HP 0812 6339 2197 AMANAH TOURS & TRAVEL: Tiket promo: Medan - Jakarta - Singapura - Bangkok dll, Garuda, Lion, Batavia, Sriwijaya, dll. Hotel promo domestik dan Internasional, tiket taman hiburan Universal Studio. Info: Jl. Patuan Anggi No. 159 P. Siantar. Telp. 0622 - 22115; HP 0813 6443 2665. Dan juga menerima peluang usaha agen tiket

PASANG: Halo Telkomsel, bagi yang berminat pilih nomor sesuai keinginan. Tersedia: • 0811 600 xxx • 0811 601 xxx • 0811 620 xxx • 0811 621 xxx • 0812 621 xxx • 0812 620 xxx • 0811 613 13xx • 0811 6134 0xx data langsung dijemput proses cepat, hub HP 0811 620 304 Bangun Pasaribu

CAROLINA PONSEL: Jl. Melanthon Siregar Simp. Lapangan Bola HP 0853 6111 9991. Menjual accesories HP, sparepart Nokia, HP baru, tablet, peralatan listrik, bola lampu bergaransi, terima pendaftaran deposit pulsa dan MKios CV MITRA JASA KS (Consultan Adminitration): Jasa pengrusan surat-surat Anda ingin KPR Perumahan, Pengurusan ijin usaha, butuh NPWP, pinjaman uang ke Bank, juga perlu NPWP Gratis...Wow... datang ke alamat kami: Jl. Pasar Batu No. 18. HP 0812 6044 3898 (Samping Palang Kereta Api Rambung Merah) BUTUH DANA CEPAT ???: Aguna BPKB mobil dan sepeda motor •Mobil mulai tahun 1994 •Sepeda motor mulai tahun 2003 •Melayani take over kredit. Proses paling cepat, hub. Erik Silalahi HP 0852 6074 9962; 0812 6043 7499 BUTUH DANA CEPAT: Agunan BPKB mobil/ sepeda motor, proses cepat, kendaraan anda kami asuransikan, hub. 0813 6146 0422 Rino Reynaldi BUTUH DANA TUNAI: Hanya jaminan BPKB, kendaraan anda, proses cepat dan diskon 1 x, angsuran dapatkan hadiah langsung barang elektronik, hub. Linda HP 0813 9724 7131 EXTREME DISTRO: Jl. Melanthon Siregar No. 115 depan sekolah Hotma Guna, menjual pakaian pria, sandal, sepatu, accesories, jam tangan, topi, semua barang dari Bandung. HP 0852 6254 3409

JJJ COLLETION R br MANURUNG: Menjual segala jenis pakaian, pria, wanita, accesories, bakal pengantin dan perlengkapan anak, alamat Jl. Gereja Ruko Martimbang No. 18 P. Siantar Telp. 0622 - 27669

Pasang Iklan Anda Hub. Hub.: 0622 -



19 Desember 2012

Kartini & Parningotan Diborgol Sambungan Halaman 8 diamankan dari sebuah warung tuak milik Mak Anton di Jalan Patuan Nagari, Kelurahan Sukadame, Kecamatan Siantar Utara, Senin (17/12), sekira pukul 16.15 WIB. Sementara Parningotan diamankan dari Jalan Bombongan Raya, Kelurahan Tambun Nabolon, Kecamatan Martoba pada sebuah warung tuak milik marga Hutagalung. Kini, baik Kartini, warga Jalan Rakutta Sembiring, Kelurahan Sigulang-gulang, Kecamatan Siantar Utara dan Parningotan Lumban Tobing (36), warga Jalan Medan, Simpang Karang Sari, Kelurahan Tambun Nabolon, Kecamatan Martoba, telah mendekam di sel Mapolresta Siantar. Penangkapan keduanya dilaku-

Jatuh ke Jurang, Pick Up Timpa Kandang Babi

Sambungan Halaman 8 pukul 08.00 WIB. Kejadian itu tepat di tikungan Silaban, antara Km 7 dan Km 8 Jalan Dolok Sanggul-Siborongborong. Mobil yang dikemudikan Iwan Lubis (36), terjun ke lokasi perladangan dengan kedalaman dari permukaan jalan raya sekitar 6 meter. Tak ada korban jiwa dalam insiden itu, namun mobil di jurang terlihat ringsek. Iwan sendiri dan seorang rekannya Jonrizal diketahui hanya mengalami luka memar dan lecet di lengannya. Amatan METRO di lokasi kejadian, mobil pick up tersebut menimpa kandang ternak babi milik warga setempat bermarga Silaban. Kepada METRO, Silaban (50) menyampaikan, bahwa dua ekor babi miliknya yang sebelumnya ada di dalam kandang tersebut lepas. “Dua ekor babi yang baru saya beli se-

bulan lalu lepas karena tertimpa mobil yang jatuh itu. Sampai sekarang saya belum ketemu ternak babi itu, gak tau lari kemana,” ujar Silaban. Sementara itu, Jonrizal, teman Iwan saat berada di dalam mobil mengatakan, mereka datang dari arah Siborongborong menuju Sidikalang. ”Mobil tak ada muatan. Kami mau ke Sidikalang menjemput buah durian. Tadi mobilnya kencang sebelum terjatuh. Pas baru melewati tikungan itu, mungkin teman saya kehilangan kontrol. Sehingga terbalik ke jurang,” ujarnya. Kasat Lantas Polres Humbang Hasundutan AKP P Ternalem, melalui Aipda J Simajuntak, saat berada di lokasi membenarkan. Ia mengatakan, kejadian tersebut telah mereka tangani. ���Kita sudah tangani, tapi kita evakuasi dulu mobilnya dari jurang,” singkat Simanjuntak. (juan/shl)

Kreta Karyawan Hotel Raib dari Parkiran

Sambungan Halaman 8 Informasi dihimpun, Suhendra yang tinggal di Jalan Serdang, Gang Banjar, Kelurahan Bantan, Kecamatan Siantar Barat ini, tiba di hotel, Senin (17/12), sekira jam 22.45 WIB dan memarkirkan kreta-nya di parkiran khusus karyawan hotel. Pada saat itu, Suhendra yang masuk shift malam, mengetahui kereta yang sudah diangsurnya selama 23 bulan itu hilang sesaat akan bertukar shift pada paginya, Selasa (18/12), sekira jam 07.30 WIB. Suhendra yang sudah bekerja sekitar enam bulan di hotel itu, terkejut ketika melihat kreta kesayangannya raib dari diparkiran. Melihat itu, Suhendra pun memberitahukan kepada satuan pengamanan (Satpam) hotel. Namun, tidak seorang pun satpam yang mengetahui dan melihat kreta Suhendra. Setelah mencari di sekeliling par-

Jenguk Suami Bawa Ganja IRT Nyangkut di Rutan

kan atas informasi masyarakat. Untuk mengungkapnya, polisi menyaru sebagai pembeli nomor togel. Dari kedua tersangka, polisi menemukan 3 lembar kertas berisi angka tebakan, sebuah pulpen, dan juga sebuah handphone Nokia type X1 berwarna hitam yang dijadikan sebagai alat untuk mengirim angka tebakan judi togel tersebut. Kemudian barang bukti berupa uang tunai sebesar Rp331 ribu dan 1 lembar kertas berisi angka tebakan judi togel hongkong. Kapolres Siantar AKBP Alberd Sianipar, melalui Paur Humas Ipda Restuadi membenarkan penangkapan Kartini br Simanjuntak dan Parningotan Lumban Tobing. “Keduanya diancam dikenakan pasal 303 KUHPidana tentang Perjudian,” ujarnya. (mag-05/dro)

kiran hotel dan tidak menemukannya, Suhendra pun menghubungi ibunya. Lalu, ditemani ibunya, Suhendra dan Satpam yang jaga pada malam itu mendatangi Mapolres Siantar, untuk melaporkan kasus itu. Usai membuat laporan, Suhendra mengaku sangat menyesalkan kurangnya pengamanan di hotel itu. “Hotelnya mewah, CCTV masa tidak ada,” kesal Suhendra. Selain tidak adanya CCTV, Satpam juga mengaku tidak melihat kreta Suhendra lewat dari pos pengamanan satpam. “Jalan keluarnya hanya satu, semua lewat dari pos satpam. Tapi kok bisa hilang,” kritiknya. Kapolres Siantar AKBP Alberd TB Sianipar, melalui Paur Humas Ipda Restuadi membenarkan telah menerima laporan pencurian tersebut. “Laporan pencurian tersebut sudah diterima dan masih diselidiki. Ditaksir korban mengalami kerugian materi ditaksir Rp15 juta,” katanya. (mag-05)

Foto Darwis

Susi yang ketahuan menyimpan ganja didompetnya saat digeladah petugas Rutan Tanjungpura tampak sedih

TANJUNGPURA- Petugas Lembaga Pemasyarakatan (LP) Tanjung Pura kerjasama Polsek setempat menangkap Susanti alias Susi (41), warga Jalan Tanjung Kel Pekan Tj Pura-Langkatyangmembawaganja sebanyak 70 gr ke dalam LP, Senin (17/12) pagi. Penangkapan diawali kecurigaan petugas LP kepada pelaku, menyusul adanya dugaan peredaran narkotika di kawasan tersebut. Apalagi, M Rozali alias Untut suami Susi ditahan karena terlibat kasusnarkotikajenissabu-sabusejak 4,6 tahun. “Berdasarkan kecurigaan pihak Lapas, kita (polisi) dimintai melakukan pemeriksaan didampingi petugas rutan yang wanita. Saat digeledah, petugas menemukan ganja hampir satu ons diikat di kaki pelaku,” kata Kapolsek Tj Pura AKP Abd Rahman.

Disebutkan dia, pihak rutan sebelumnya sudah mencurigai dan mengintai gerak-gerik pelaku. Tak ingin membuang-buang waktu, pihak rutan berkoordinasi dengan Polsek Tj Pura melakukan penggeledahan sampai akhirnya membuahkan hasil. “Pelaku tidak berkutik, setelah petugas (wanita) rutan melucuti pakaiannya maka didapati ganja yang diikatkan di kaki atau betis Susi dengan tali. Atas temuan itu, kita sedang memrosesnya untuk pengembangan lebih lanjut,” timpal Kasat Narkoba Polres Langkat AKP Lukmin. Namunkarenabarangbuktinyadi bawah lima kilogram, maka kasusnya di proses di polsek setempat. Terpisah Kepala Rutan Tanjungpura JauhariSitepu, melalui Kepala Pengamanan Rutan (KPR) B Manik, ketika dikonfirmasi, Selasa

(18/12), melalui telepon seluler membenarkan perihal diamankannya istri salahseorang penghuni rutan saat ingin membesuk suaminya. Saat ini, pelaku telah diamankan Polsek Tanjungpura guna menjalani proses hukum. Menurut Manik, kronologis penangkapan tersangka, berawal dari kedatangan pelaku ke rutan hendak membesuk sang suami yang juga terjerat kasus kepemilikan sabu-sabu beberapa tahun silam. Oleh Pengadilan Negeri (PN) Stabat, suami tersangka dijatuhi hukuman penjara selama 4 tahun,6 bulan penjara. Saat ini, suami Susi telah menjalani hukuman selama 3 tahun. Namun sekitar 6 bulan lalu, ia kembali tertangkap petugas rutan menyimpan barang haram. (wis/pmg)

Eks Pelayan Kafe Tenggak Racun Hingga Tewas Sambungan Halaman 8 kelonan dengan pria lain diketahui bermarga Sembiring di kamar kosnya itu. Melihat itu, Kiki mengamuk. Yuli dimaki. Keduanya pun terlibat adu mulut. Melihat situasi itu, Yuli dan kekasihnya beranjak dari kamar Kiki. Tak berselang lama, suami siri Kiki Selamat Riadi (44), warga Suka Raya, Kecamatan Pancurbatu, pulang dari tempatnya bekerja sebagai tukang jahit pakaian. Begitu suaminya pulang, Kiki mengadu. Namun ayah tiga anak itu ternyata menanggapinya dingin. Menurutnya hal itu tidak perlu dibesar-besarkan. Mendapat jawaban dari suami yang dinikahinya lima bulan lalu itu, Kiki tak terima. Selanjutnya, Kiki yang pernah bekerja sebagai pelayan di Kafe Darwin di Desa Sembahe Baru, ini langsung pergi ke Pajak Pancurbatu. Di pajak itu, korban mendatangi sebuah toko yang menyediakan

berbagai jenis racun hama dan racun rumput. Kemudian Kiki membeli rumput merk Gramatsond dan dibawanya ke kos. Tiba di kost, Kiki langsung menenggaknya hingga tinggal setengah. Kiki pun terkapar dengan mulut berbusa. Beberapa detik saja Selamat masuk kamar yang disewanya sebesar Rp2,5 juta per tahun itu. Melihat istri mudanya terkapar dengan kondisi mulut mengeluarkan aroma tak sedap, Selamat panik dan menjerit histeris, sehingga mengundang perhatian tetangganya. Lalu, oleh warga Kiki yang sudah kritis langsung dilarikan ke Puskesmas Pancurbatu. Tiba di puskesmas, petugas medis pun memberikan pertolongan dan nyawa Kiki terselamatkan. Begitu kondisinya stabil, Selamat pun membawa Kiki pulang ke kediamannya. Namun pada Selasa (18/12), sekira pukul 00.07 WIB, tiba-tiba Kiki kejang-kejang. Melihat itu, Selamat

yang berada di sampingnya terkejut. Tapi tak lama kemudian, Kiki tewas dengan kondisi telungkup, mulut mengeluarkan buih. Menyadari istrinya meninggal, Selamat memberitahukannya kepada jiran tetangga. Warga yang mengetahui tewasnya Kiki langsung mendatangi kamar kos-kosan tersebut. Pagi harinya, warga yang curiga dengan kematian korban langsung melaporkannya ke petugas kepolisian. Tak berselang lama, Tim Reskrim Polsek Pancurbatu disusul Tim Forensik Polresta Medan tiba di lokasi untuk melakukan olah TKP, dan memboyong jenazah korban ke RSUP H Adam Malik Medan untuk keperluan otopsi. Terpisah, Yuli mengatakan, antara ia dan korban memang saling kenal. “Perkenalan kami sejak kami samasama kerja di kafe. Namun sejak dia kenal sama Bang Selamat lima bulan lalu, dia pun mulai meninggalkan pekerjaan menjadi pelayan kafe, dan

dua bulan kemudian mereka menikah secara siri. Selanjutnya, mereka tinggal bersama, dan rumah kos ini,” ujar Yuli. Yuli juga mengaku bahwa dirinya juga tinggal di kos-kosan Kiki kurang lebih dua minggu. “Aku terpaksa tinggal di sana, karena tempat tinggalku sudah habis kontrak. Jadi aku numpang sama dia. Malam Minggu itu, memang kami ada ribut, karena dia memerogoki aku sama pacarku tidur di spring bed yang baru dibelinya itu. Tapi saat itu langsung aku tinggalkan dia karena dia maki-maki aku,” aku Yuli sambil berlalu. Kapolsek Pancurbatu Kompol Darwin Sitepu saat dikonfirmasi membenarkan tewasnya korban. “Saat ini masih kita selidiki motif kematian korban, namun dugaan sementara korban nekat menghabisi nyawanya karena tak terima dimarahi suaminya. Itu sebabnya dia nekat minum racun rumput,” ujar Sitepu. (roy/pmg/dro)

Supir Truk Pesakitan Sambungan Halaman 8 Jambi, Nagori Bosar Nauli, Kecamatan Hatonduan, ini didakwa melanggar Pasal 50 ayat 3 huruf h jo Pasal 78 ayat 7, UU RI Nomor 41 Tahun 1999 tentang Kehutanan jo pasal 55 1 ayat ke-1 KUHPidana. Hal itu disampaikan Jaksa Penuntut Umum (JPU) Julius Butarbutar saat membacakan dakwaannya di hadapan hakim dipimpin Samuel Ginting, beranggotakan Heriyanti, dan Adria Dwi Afanti, Selasa (18/12). Peristiwa itu berlangsung di kawasan hutan Negara RI Register 2 S/M Sibatu Loting HPHTI PT TPL di Nagori Bosar Nauli, Kecamatan Hatonduan, Jumat (39/3), sekira pukul 22.00 WIB. Ceritanya, saat itu, terdakwa baru selesai mengangkat batu, kemudian

bertemu dengan Mesdi (DPO) dan Dul Witno. Lalu Mesdi menawarkan kepada terdakwa untuk mengangkut kayu (bahan jadi) pada tengah malam. Mendengar itu, pria lajang itu menjawab; “ngeri-ngeri sedap mengangkut kayu, soalnya belum pernah aku kerja malam menyupiri atau mengendarai mobil”. Selanjutnya Dul Witno menjawab pernyataan terdakwa ‘siapa lagi kalau bukan kau Paino, kaunya yang bisa nyupir’. Kemudian, terdakwa pun akhirnya menyetujuinya. “Lalu sekitar pukul 21.00 WIB, terdakwa bersama Mesdi naik ke truk Toyota Dyna BK 8288 TC. Saat itu, Dul Witno sebagai pemilik truk masih sempat melihat mereka berangkat. Terdakwa pun membawa kendaraan tersebut memasuki Kawanan Kawasan Hutan Negara RI Register 2 S/

M Sibatu Loting HPHTI PT TPL, di Nagori Bosar Nauli, Kecamatan Hatonduan. Tak lupa juga Mesdi menuntun arah kayu yang sudah ditebanginya bersama Suwono dan Dudung,” terang Butarbutar. Setibanya di lokasi, terdakwa memutar truk menuju arah pulang. Kemudian, terdakwa mematikan kunci kontak mesin truk dan menunggu di dalam truk. Saat berada di dalam truk, Mesdi, Suwono, Dudung serta seorang lagi yang tidak dikenal melangsir dengan cara memundak kayu setiap satu batang hingga 134 batang ke dalam truk. Setelah penuh, terdakwa pun kembali menghidupkan mesin truk dan keluar dari kawasan hutan. Akan tetapi sekitar 500 meter truk melaju, tiba-tiba terdakwa melihat cahaya lampu sepedamotor dari pihak

pengamanan PT TPL. Melihat itu, terdakwa menghentikan dan mematikan mesin truk. Kemudian mereka lari berpencar ke kawasan hutan dan meninggalkan truk. “Saat itu, terdakwa memilih berjalan kaki ke rumah. Selanjutnya pada Sabtu (31/ 3), terdakwa datang ke rumah Dul Witno dan memberitahukan bahwa truknya tinggal di kawasan hutan tersebut. Mendengar itu, Dul pun berangkat bersama anaknya Suryanto untuk mengambil truk itu. “Sementara untuk mengindari pencarian polisi, terdakwa memilih melarikan diri ke Pekanbaru. Namun, karena tidak tahan di sana, terdakwa kembali ke Huta Simpang Jambi, Nagori Bosar Nauli, Kecamatan Hatonduan pada 12 Agustus 2012. Saat itu juga terdakwa berhasil diamankan polisi,” ungkap jaksa. (mua)

Sambungan Halaman Satu Dibekuk di Langkat dan Medan Sambungan Halaman 1 masing-masing, Selasa (18/12) sekira pukul 02.00 WIB atau tiga hari setelah penangkapan Sudir (21) warga Helpetia Medan, Sabtu (15/12) sekira pukul 02.00 WIB kemarin. Aparat Polsek Serbelawan yang dipimpin langsung Kapolsek AKP Gandhi Hutagaol, melakukan pengembangan penangkapan dari tiga tersangka di Kota Medan. Tiga tersangka tersebut ditangkap sangat sedang tidur di rumah yang mereka huni. Melihat posisi tempat tinggal tersangka, petugas melakukan penggerebakan. Setelah ditangkap dari lokasi berbeda, ketiganya diboyong ke Mapolsek Serbelawan untuk diproses. Menurut Simon, salah seprang tersangka, pencurian kabel jaringan telepon dilakukan

karena masalah ekonomi keluarga. Di mana pekerjaan sebagai kondektur (kernet) mobil truk tidak mencukupi biaya lima orang anaknya. Aksi pencurian digeluti baru satu bulan terakhir setelah dia ditangkap. Dalam satu bulan tersebut, dia sudah empat kali ikut mencuri kabel jaringan telepon, dua kali di Kanopan dan 2 kali di Jalan Medan, Kabupaten Simalungun. “Baru satu bulan aku ikut mencuri kabel Bang. Itu kulakukan karena masalah ekonomi keluarga. Kemudian hasil terbesar yang pernah kudapat hanya Rp200 ribu,” aku Simon sebelum ditahan di Rumah Tahanan Polisi (RTP) Polsek Serbelawan. Sementara rekannya Supriadi, mengaku selama ini istrinya bekerja sebagai tukang cuci pakaian di rumah warga. Pencurian dilakukan sedikit lebih lama dari Simon, satu bulan

setengah. Sebelum ikut menjadi sindikat spesialis pencuri kabel jaringan telepon, dia bekerja sebagai buruh bangunan yang berpenghasilan Rp50 ribu per hari. Katanya, hasil tersebut tidak cukup membiayai uang sekolah dua anaknya. Supriadi termasuk lebih senior dari beberapa tamanya yang senasib. Di mana dia sudah 7 kali mencuri di sejumlah tempat berbeda. Seperti, Pabatu dua kali, Siantar dua kali, Tanah Jawa 2 kali dan terakhir di Jalan Medan, Simalungun. “Dulu aku kerja sebagai buruh bangunan Bang, tapi rasanya tidak cukup untuk biaya anak sekolah. Kalau hasil terbesar yang pernah ku dapat Rp300 ribu,” katanya sambil tertunduk. Menurut informasi dihimpun METRO, kabel jaringan telepon hasil curian dijual tersangka kepada AS, salah seorang agen botot di

Amparan Perak, dengan harga Rp52 ribu per kilogram. Sementara alat yang digunakan mereka untuk mencuri, menggunakan gunting potong yang dibeli dari toko besi seharga Rp120 ribu. Mobil yang dipakai masih rental dengan biaya Rp300 ribu per hari. Kapolsek Serbelawan AKP Gandhi Hutagaol mengatakan, pihaknya masih melakukan penyelidikan terhadap tiga tersangka lain yang masih DPO. Mereka berinisial SR, AC, LK. Sekarang pihaknya sudah mengamankan empat terangka, beserta barang bukti hasil curian yang belum sempat dijual, 40 meter kabel jaringan telepon dan tang pemotong kabel. “Kita akan terus berupaya mengungkap kasus kriminal khusunya di wilayah hukum Polsek Serbelawan,” ujar Ghandi. (mag-4)

Harus Punya Hobi Menangkap Penjahat Sambungan Halaman 1 Fajar terhadap Kabupaten Simalungun, akan dijaga dan kita lanjutkan,” ungkapnya sembari mengaku, sebelum menjabat Kapolres Simalungun, dia adalah Kapolres Padangsidimpuan. Sementara itu, AKBP M Agus Fajar SiK, mengaku sangat bangga pernah menjabat sebagai Kapolres Simalungun selama 1 tahun 7 bulan. Di mana, ketika menjabat di wilayah hukum Simalungun, dia banyak mendapat pembelajaran yang sangat berharga. Dengan dipindahkan menjadi Kasubbag SDM di Mabes Polri, dia sangat mengharap doa dari personil Polres Simalungun dan masyarakat agar selamat dalam perjalan dalam menuju Mabes Polri. “Saya sebelumnya memang sudah pernah diletakkan di Bagian SDM Mabes Polri saat saya masih berpangkat AKP,” ungkapnya sembari mengaku, usai mengikuti acara ini dirinya akan langsung ke Medan dan selanjutnya ke Jakarta tepatnya ke Mabes Polri.

Bupati Simalungun diwakili Sekda Simalungun Gidion Purba MSi mengatakan, kebanggaannya terhadap AKBP M Agus Fajar SIK yang membantu secara maksimal dalam

memajukan Ibukota Kabupaten Simalungun yakni Pematang Raya. ”Dengan pindahnya Mapolres Simalungun ke Pematang Raya, itu jelas sangat mendu-

kung untuk perkembangan Ibukota Simalungun ini. Mantan Kapolres itu juga memang sangat membantu pembangunan Ibukota Simalungun itu,” ujarnya sembari mengharapkan kepada Kapolres Simalungun yang baru agar juga melakukan kerja sama yang baik dalam pembangunan Pematang Raya. Ketua DPRD Simalungun Binton Tindaon, perwakilan masyarakat Simalungun dalam acara itu mengatakan hal senada. Menurut dia, awalnya memang berat, Mapolres Simalungun yang awalnya berdomisili di Kota Siantar pindah ke Pematang Raya yang termasuk daerah yang belum berkembang. Namun, berkat kerja Kapolres Simalungun akhirnya mereka sudah terbiasa dan sangat maksimal membantu pembangunan di Kabupaten Simalungun. Hadir dalam acara itu, Walikota Siantar, Kejari Simalungun, Danrindam, Mewakili Darem, Bupati Simalungun yang diwakili Sekda, Ketua DPRD, Partua Maujana Simalugun (PMS) dan Para personil Polres Simalungun. (osi)

DPRD Pertanyakan Status Lahan Tj Pinggir Sambungan Halaman 1 tidak ada melihat anggarannya,” kata Maruahal. Menurutnya soal menyelesaikan lahan Tanjung Pinggir akan ada biaya ganti rugi. Pertanyaan tersebut dijawab Kepala Bapeda Heroin Sinaga. Dia menerangkan, belum ada kepastian soal ganti ruginya. “Hingga saat ini, kami belum ada menerima surat resmi soal biaya ganti rugi. Sehingga kami tidak bisa mengalokasikan anggarannya,” ujar Heroin. Heroin menambahkan, surat yang mereka terima sebelumnya adalah saol pengukuran lahan Tanjung Pinggir dan itupun belum petunjuk dari Kementrian BUMN. Pada rapat pembahasan R-APBD itu, agenda yang sudah selesai dibahas adalah rapat badan anggaran. Sedangkan rapat gabungan komisi masih diskor dan dilanjutkan Rabu (19/ 12) pukul 09.00 WIB. Sementara itu, pada pukul 14.00 WIB dilanjutkan dengan agenda terakhir yakni paripurna pengesahan R-APBD 2013. Tiga komisi telah membacakan rekomendasi yang telah dibahas sebelumnya para rapat komisi-komisi dengan SKPD. Pada umumnya, DPRD menyoroti soal pelaksanaan proyek tahun 2013 agar telaksana dengan baik. Menurut mereka, proyek tahun 2012 yang saat ini dilaksanakan menunjukkan hasil yang tidak maksimal. (pra)



19 DESEMBER 2012


Eks Pelayan Kafe Tenggak Racun Hingga Tewas PANCURBATU- Santi alias Kiki (28), mantan pelayan kafe nekat menenggak racun rumput. Wanita asal Stabat, Langkat, ini pun ditemukan tak bernyawa di sebuah koskosan di Desa Sembahe Baru, Kecamatan Pancurbatu, Selasa (18/12) dini hari. Motifnya, korban tidak terima spring bed baru miliknya dirunning Yuli, teman satu kostnya berbuat mesum.


DIAMANKAN- Kartini br Simanjuntak dan Parningotan Lumbantobing, tersangka jurtul togel diamankan di Mapolresta Siantar, Selasa (18/12).


Kartini & Parningotan Diborgol SIANTAR- Praktik judi toto gelap (togel) makin merajalela. Di Kota Pematangsiantar, seorang ibu rumah tangga (IRT) Kartini br Simanjuntak (55), jadi jurtul togel. Wanita bertubuh tambun ini ditangkap bersama seorang jurtul lainnya Parningotan Lumban Tobing (36), Senin (17/12). Keduanya diamankan dari lokasi berbeda. Kartini

„) Baca Kartini ...Hal 7

„ Suhendra

Kreta Karyawan Hotel Raib dari Parkiran SIANTAR- Suhendra (22), seorang karyawan hotel ternama di Jalan Diponegoro mengalami kejadian naas. Suzuki Satria FU BK 5065 TAF, miliknya raib dari lokasi parkir tempatnya bekerja, Selasa (18/12) sekira pukul 14.30 WIB.

„) Baca Kreta ...Hal 7

Jatuh ke Jurang Pick Up Timpa Kandang Babi LINTONG NI HUTA- Mobil pick up jenis L300, BK 8453 CP, terjun bebas ke jurang lokasi perladangan warga di Desa Silaban Margu, Kecamatan Lintongnihuta, Humbang Hasundutan, Selasa (8/12) sekitar „) Baca Jatuh ...Hal 7


Supir Truk Pesakitan SIMALUNGUN- Akibat membawa 134 batang kayu yang diambil dari Kawasan Hutan Negara RI Register 2 S/M Sibatu Loting HPHTI PT TPL, seorang supir truk Pai-

no (21), jadi pesakitan di Pengadilan Negeri Simalungun. Warga Huta Simpang

„) Baca Supir ...Hal 7

Informasi dihimpun, pada Sabtu (15/12) malam lalu, Kiki memerogoki Yuli dalam posisi

„) Baca Eks ...Hal 7


19 DESEMBER 2012

Bentuk Bangunan Tak Sesuai Izin


Penyalaan lilin oleh Pdt Petrus Pardede bersama Kepala Prodi Ekonomi dan para dosen.

Pembangunan Kios Taman Halilian Diprotes

Natal Keluarga Besar Prodi Ekonomi

SERBELWAN- Koordinator Forum Masyarakat Bersatu (Formabes) Dolok Batu Nanggar Hendra Ananta Nasution, meminta kios di Taman Halilian Serbelawan segera dibongkar. Pasalnya fungsi dan bentuk bangunan kios tidak sesuai dengan izin pemanfaatan aset tanah bernomor 970/0766/DPPKA/ 2012 yang ditandatangani Sekda Simalungun Gadion Purba.

Kasih Persaudaraan yang Tulus Ikhlas SIANTAR- Perayaan Natal Program Studi Pendidikan Ekonomi Universitas HKBP Nommensen Pematangsiantar, di Aula universitas tersebut, Selasa (18/12), penuh khidmat.

Baca Kasih Persaudaraan ...Hal 10

Baca Pembangunan ...Hal 10 FOTO REMON

TERGENANG- Jalan Ade Irma Suryani yang tergenang dan berlubang. Kondisi itu terjadi sejak adanya pengerjaan perbaikan saluran drainase di sekitar lokasi.

Drainase Diperbaiki, Jalan Tergenang & Berlubang SIANTAR- Perbaikan saluran drainase yang sedang dikerjakan di sepanjang Jalan Ade Irma Suryani, Kelurahan Melayu, Siantar Utara, disinyalir merusak badan jalan. Itu dilihat dari banyaknya lubang baru di sekitar lokasi, dan membuat pengguna jalan kesulitan melintas. Menurut warga, hal ini disebabkan air yang disumbat dari drainase mengalir ke badan jalan yang dilintasi

berbagai jenis kendaraan itu. Seperti yang diungkapkan warga sekitar Ewin (52). Dia mengatakan, banyaknya lubang baru pada badan jalan disebabkan aspal yang selalu tergenang air, berasal dari saluran drainase yang disumbat. Termasuk alat berat yang digunakan untuk menggali saluran drainase itu beberapa

Baca Drainase ...Hal 10

Seminar Pemberdayaan Masyarakat Adat

Menguak Hak Ulayat Simalungun SIANTAR- Fakultas Hukum Universitas Simalungun (USI) bekerjasama dengan Lembaga Pelayanan Pembangunan Masyarakat (Pelpem) GKPS Pematangsiantar, menggelar seminar sehari bertemakan ‘menguak hak ulayat (tanah) Simalungun’. Kegiatan dipusatkan di USI, Sabtu (15/12) yang melibatkan masyarakat di Simalungun. Ketua Panitia Seminar Herman Sipa-

yung menyebutkan, sosialiasi itu dilakukan untuk membangun pemahaman tentang partisipasi masyarakat atas adat melalui nilai luhur. “Di Simalungun ini banyak sejarah,

Pengadaan Buku di SMAN I Dolok Panribuan

Kejari Jangan Hanya Diam

DOLOK PANRIBUAN- Pihak Kejaksaan Negeri (Kejari) Simalungun diminta untuk

Baca Kejari ...Hal 10


Walikota Siantar Hulman Sitorus memberikan bantuan mesin jahit kepada warga, Selasa (18/12).

Disperindag dan NV STTC Bantu Masyarakat Serahkan 10 Mesin Jahit

Baca Menguak ...Hal 10

SIANTAR- Dinas Perindustrian dan Perdagangan (Disperindag) Kota Siantar bersama dan NV STTC, memberikan bantuan 10 unit mesin jahit sekaligus pelatihan dan keterampilan


Baca Disperindag ...Hal 10

Para pembicara memberikan penjelasan pada seminar pemberdayaan masyarakat adat.

20 Ibu-ibu Terima Alat Tenun Ulos SIANTAR- Sebanyak 20 ibu rumah tangga, masing-masing menerima bantuan satu paket alat tenun ulos

Baca 20 Ibu- Ibu...Hal 10


Kadinsosnaker Resman Panjaitan, memberikan ucapan selamat kepada penerima bantuan alat tenun.


19 DESEMBER 2012

Drainase Diperbaiki... sambungan halaman 9 waktu lalu. “Air yang disumbat dari selokan itulah yang membuat jalan rusak. Aspal itukan panas, jadi kalau terkena air terus menerus, bisa merusak kualitas aspal,” kata Ewin kepada METRO. Bukan hanya itu, material untuk memperbaiki saluran drainase itu kemudian terseret air hujan hingga ke badan jalan. Akhirnya jalanan penuh dengan becek dan lubang yang tergenang air. Sementara seorang pengendara sepedamotor Tiur (21), warga Jalan DI Panjaitan, Kelurahan Aek Nauli, Siantar Marim-

bun, mengatakan, perbaikan saluran drainase yang menghabiskan biaya ratusan juta itu berbuntut pada rusaknya jalan. “Tidak ada lagi gunanya diperbaiki saluran itu, kalau hanya merusak jalan,” kata Tiur. Sementara Tina (45) warga Jalan Ade Irma, Siantar Utara, mengungkapkan, jalan itu rusak karena selalu dilintasi kendaraan. “Ini kan jalannya selalu ramai. Kalau sudah siang, pasti banyak debu yang beterbangan, sehingga mengganggu pernapasan para pengendara,” kata Tina. Amatan METRO, sepanjang jalan itu dipenuhi dengan lubang yang digenangi air. (mag06)

Disperindag dan NV STTC Bantu Masyarakat sambungan halaman 9 menjahit kepada 10 warga yang tinggal di lingkungan pabrik rokok STTC, Selasa (18/ 12). Kepala Bidang Perindustrian Irene Ida Mawar Damanik menerangkan, bantuan yang diberikan kepada warga itu merupakan bantuan sosial dan pelatihan untuk menunjang kreatifitas warga dan menciptakan tenaga kerja. Diharapkan warga yang belum memiliki pekerjaan, bisa berkembang melalui pelatihan dan keterampilan menjahit. “Hanya ada sepuluh peserta yang mengikuti kegiatan. Namun melalui sepuluh peserta ini, diharapkan keterampilan menjahit akan berkembang di tengah-tengah masyarakat,” kata Irene kepada METRO. Dia menambahkan, bantuan yang diberikan Disperindag dan NV STTC berupa mesin jahit. Acara penyerahan berlangsung di Kantor Lurah Merdeka, Siantar Timur. Pelatihan dan keterampilan menjahit yang sudah berlangsung selama lima hari, membuat para peserta sangat antusias atas pemberian bantuan tersebut.

Menurut salah seorang peserta br Purba mengatakan, mereka yang sudah menjalani pelatihan dan keterampilan menjahit selama lima hari akan mengembangkan kreatifitas menjahit secara terampil. “Waktu pelatihan saja kurang sama kami, meskipun sudah lima hari, tapi melalui kegiatan itu, kami siap mengembangkan bakat menjahit,” kata br Purba Sedangkan Camat Siantar Timur P Sitorus mengatakan, pihaknya sudah beberapa kali memberikan bantuan berupa alat keterampilan dan bantuan lain untuk menunjang mutu perekonomian masyarakat yang tergolong rendah. Pada umumnya, masyarakat Kecamatan Siantar Timur mayoritas berwira usaha untuk memenuhi kebutuhan sehari-hari. Acara juga dihadiri Wali Kota Pematangsiantar Hulman Sitorus SE, Jupiter Sitepu dari Kelurahan Pahlawan, Renti Saragih dari Kelurahan Siopat Suhu, Agus Salam Harahap dari Disperindag. (mag06)

Pembangunan Kios Taman Halilian Diprotes sambungan halaman 9 Hendra mengatakan, dengan berdirinya kios tersebut, Taman Halilian kehilangan fungsi resapan air, ekologi, sosial budaya dan ekonomi. Sementara selama ini, Taman Halilian diperuntukkan masyarakat Serbelawan sebagai sarana olahraga, perayaan Natal, tempat rekreasi, dan fungsinya sebagai ruang terbuka hijau. “Camat mengeluarkan rekomendasi pembangunan kios tanpa melibatkan masyarakat hukum adat Serbelawan. Kemudian bentuk bangunan tersebut sangat kental dengan nuansa bisnis, padahal dalam isi surat Sekda dijelaskan, bentuk bangunan yang diizinkan bernuasa Simalungun,” kata Hendra. Masih kata Hendra, Formasbes tidak akan membiarkan bangunan kios

berjalan terus. Taman Halilian harus dikembalikan ke bentuk semula. “Kita akan laporkan pihak-pihak yang terdapat di dalamnya, jika didapati pelanggaran hukum soal pemanfaat aset negara di luar aturan,” tegas Kordinator Formasbes itu. Sejumlah pedagang yang berjualan di Pajak Inpres juga menyesalakan adanya bangunan kios di lokasi Taman Halilian. Mereka adalah Jahara br Lubis, Agustina br Saragih, Data br Ginting, Ros br Hutagaol, Darma, dan masih banyak lagi. Mereka mengatakan, sebelum bangunan kios didirikan, tempat mereka berjualan saja selalu sepi pengunjung. Konon lagi jika nantinya kios ditempati orang-orang baru yang dagangannya sama persis dengan apa yang mereka jual. “Kalaulah jadi Taman Halilian itu tempat berjualan, bagaimana nasib

para pedagang yang sudah lama berjualan di Pajak Inpres ini, seharusnya camat peduli dengan nasib warganya yang masih kekurangan. Bukan malah memberi kesempatan bagi orang-orang yang sudah serba berkecukupan,” saut para pedagang. Mengingat banyaknya kejanggalan yang terjadi terhadap bangunan kios di Taman Halilian, anggota DPRD Simalungun yang membidangi aset, Bernhard Damanik mengatakan, pihaknya sudah melakukan tinjauan langsung ke lokasi bangunan kios Taman Halilian. Hasilnya, banyak ditemukan hal yang tidak sesuai dengan izin yang diberikan Sekda. Untuk itu, pihaknya sudah berkoordinasi dengan kecamatan untuk memberhentikan pembangunan kios sementara waktu, sembari menunggu diadakannya rapat untuk membahas

Menguak Hak Ulayat Simalungun sambungan halaman 9 warisan dan budaya Simalungun yang sepantasnya tetap kita pertahankan. Sehingga kita mencetuskan untuk mengadakan seminar, dengan harapan seluruh undangan dapat mengenal nilai luhur dan warisan raja-raja Simalungun,” ungkapnya. Dia menerangkan, saat ini seluruh masyarakat Simalungun patut berbangga. Karena dalam konteks Simalungun, keberadaan masyarakat adat sangat jelas ada. Kehidupan masyarakat Simalungun saat ini masih taat terhadap nilai falsafah hidup. Salah satunya seperti ‘Habonaron do Bona (kebenaran adalah pangkal segalanya), Sapangambei Manoktok Hitei (prinsip gotong royong). “Selain itu ada juga norma yang mengatur perilaku masyarakat (adat istiadat), yakni Tolu Sahundulan Lima

Saodoran dan lembaga adat Partuha Maujana Simalungun. Keseluruhannya adalah tatanan hidup masyarakat di Simalungun yang hingga kini harus terus dipertahankan,” ungkap Sipayung. Menurutnya, Simalungun juga memiliki kebudayaan Material (Material Culture) yang membedakan dengan suku lain. Hal ini masih sangat melekat pada kehidupan masyarakat adat Simalungun. Salah satunya adalah pakaian tradisional yang sering dikenal dengan ‘Gotong’ (pakaian kebesaran laki-laki). Kemudian ‘Bulang” (untuk perempuan), beseta ulos adat dengan warna dan corak yang bervariasi yang memiliki banyak manfaat. “Setiap berbagai acara adat, Simalungun juga lebih dikhaskkan dengan makanan kehormatan, yakni dayok binatur (ayam yang diatur),” ungkapnya. Sambungnya, akan tetapi, perlu disa-

dari bahwa saat ini masih banyak permasalahan di Simalungun, terutama yang berhubungan dengan sumber daya. Banyak sumber daya yang dimiliki ataupun dikuasai Raja (marga) yang masih sangat perlu adanya kajian. Katanya, untuk lebih memperdalam pengetahuan tentang hak ulayat Simalungun, mereka telah menghadirkan berbagai pembicara. Di antaranya adalah Rosmidar Sembiring, yang akan menjelaskan tentang keberadaan hak ulayat Simalungun. Kemudian DR Syamsudin Manan Sinaga, yang menjelaskan tentang tanggung jawab pemerintah terhadap hak-hak masyarakat adat Simalungun. Lalu ada Abdon Nababan, yang akan menjelaskan tentang kekuatan hukum adat dalam konsep berbangsa dan bernegara di Negara Kesatuan Republik Indonesia (NKRI). (mua)

20 Ibu-ibu Terima Alat Tenun Ulos sambungan halaman 9 dari Pemko Siantar melalui Dinas Sosial dan Tenaga Kerja (Disosnaker), Selasa (18/12) di Kantor Dinsosnaker. Program bantuan bertujuan meningkatkan perekonomian berbasis masyarakat. Sebelumnya, masyarakat yang mendapat bantuan tersebut telah mengikuti pelatihan selama 20 hari di Dinsosnaker guna memperdalam pengetahuan serta menciptakan produk ulos yang lebih berkualitas, kratif dan inovatif. Penerima bantuan berasal dari Keluarhan Siopat Suhu, Siantar Timur, dan Pondok Sayur, Siantar Martoba. Diharapkan agar para penerima ban-

tuan benar-benar menerapkan ilmu yang telah dipelajari melalui pelatih yang sudah berpengalaman. “Program ini bukan hanya di sini saja, kami akan memonitoring dan mengevaluasi bagaimana ibu-ibu dapat memanfaatkan bantuan. Kalau berhasil, akan dibentuk lagi Kelompok Usaha Bersama (KUB). Lewat KUB ini, koperasi bisa didirikan, sehingga berkesempatan mendapat bantuan lagi,” terang Kadisosnaker Resman Panjaitan dalam pengarahannya pada acara tersebut. Resman juga menegaskan, alat tenun ulos yang telah diterima agar dapat dimanfaatkan sebaik-baiknya, sehingga dapat menjadi sumber pendapatan

bagi keluarga. Korelasinya adalah, kebutuhan biaya pendidikan tidak terkendala lagi. “Semangatlah bekerja, jangan larut terus-menerus dalam masalah. Fokus sama pekerjaan masing-masing dan tetaplah bekerja keras,” pesan Resman. Lewat bimbingan dan pelatihan yang telah berlangsung selama tiga minggu, diharapkan penerima bantuan memiliki kemampuan yang sama dengan penenun lain. Baik dari kualitas, kreativitas serta sikap dalam bermasyarakat. Dari setiap pekerjaan diharapkan agar perlu ketelitian, kehati-hatian serta kesabaran guna mendapatkan hasil yang maksimal. (pra)

Kejari Jangan Hanya Diam sambungan halaman 9 tidak diam dan segera mengambil alih persoalan kebijakan Kepala Sekolah SMAN I Dolok Panribuan Donaria br Manurung, tentang pengadaan buku yang dinilai terlalu mahal. Demikian dikatakan Ketua Lembaga Pengkajian Peningkatan Kapasitas Pemerintah (LPPKP) Sahrul Nasution SH kepada METRO. Menurut Sahrul, Kejari Simalungun harus mengambil alih persoalan, karena kebijakan yang diambil kepala sekolah sudah terindikasi mencari keuntungan dan korupsi. Dia menambahkan, praktik pengadaan

barang untuk mencari keuntungan, saat ini sangat diminati oleh banyak pelaku-pelaku korupsi. Pada umumnya, mereka telah menjalin hubungan kerjasama bisnis dengan mitra kerja, dengan tujuan mengambil keuntungan sebesar-besarnya. ”Pada dasarnya Dinas Pendidikan Simalungun harus bertanggung jawab soal ini. Sebab kebijakan yang diambil kepala sekolah tersebut, sudah jelas melanggar hukum. Tindakan itu tidak memiliki dasar yang kuat. Apalagi kebijakan itu diambil secara sepihak, tanpa melibatkan orangtua murid secara keseluruhan,” katanya. Pada masalah ini, orangtua siswa bisa dikatakan sebagai korban atas kebijakan

Sensasi Goyang Siantar





** Menyuguhkan lagu-lagu Dangdut dan Daerah **

On-Air : 05.30 - 18.00 : Lagu Dangdut & India On-Air : 18.00 - 24.00 : Lagu Daerah

Kantor & Studio : Jl. A Yani No. 2-4 Pematangsiantar Sumut Telp Kantor : 0622 - 75 500 55 Fax: 7550968 Telp Studio : 0622 - 7551799; SMS 0821 6356 3000

Website : Email :

yang diambil kepala sekolah. Dalam waktu dekat, pihaknya juga berencana akan memintai penjelasan kepala SMA Negeri I Dolok Panribuan, terkait pengadaan buku bacaan tersebut. Selanjutnya penjelasan ini nantinya akan direvisi untuk melengkapi berkas laporan ke Kejari Simalungun. ”Kita akan layangkan surat permohonan penjelasan untuk melengkapi berkas laporankitanantinyakeKejariSimalungun.Hanya saja, sebelumnya saya ingin mengetahui siapa saja yang terlibat dalam pengambilan kebijakan. Makanya pada berkas laporan kita nanti, akan dirangkum juga semua aliran dana yang masuk selama ini.” (mag-02)

bentuk bangunan yang sebenarnya. “Setahu saya, bentuk bangunan yang diijinkan Sekda adalah bentuk semi permanen dan bernuansa Simalungun. Namun yang terjadi di lapangan malah sebaliknya. Untuk itu kita meminta pihak Kecamatan Dolok Batu Nanggar, memberhentikan pembangunan, sampai diadakan rapat,” katanya. Sedangkan Camat Dolok Batu Nanggar Budiman Silalahi, membenarkan adanya imbauan dari DPRD untuk memberhentikan pembangunan kios di Taman Halilian itu. Untuk sementara waktu, mereka akan menunggu diadakannya rapat pembahasan lanjutan soal bangunan kios. “Kita sudah berkoordinasi dengan para pekerja pendiri bangunan kios di Taman Halilian untuk memberhentikan pekerjaan,” ujar Budiman. (mag-4)

Kasih... sambungan halaman 9 Natal bertemakan ‘Karena kamu telah menyucikan dirimu oleh ketaatan kepada kebenaran, sehingga kamu dapat mengamalkan kasih persaudaraan yang tulus dan ikhlas dan saling mengasihi dengan segenap hatimu’. Kepala Prodi Ekonomi Drs Wesly Nababan pada kesempatan itu menyampaikan, persaudaraan yang tulus dan ikhlas merupakan persaudaraan yang akademis, tulus dan ikhlas dalam melayani mahasiswa untuk saling memahami makna dari Natal tersebut. Seperti kegiatan mahasiswa Prodi Ekonomi yang sudah berlangsung pada November lalu. Hal itu pun mendapatkan respon positif dari dalam maupun luar kampus. Juga dapat diterima di tengah-tengah masyarakat dalam dunia akuntansi. “Marilah kita saling menjaga rasa persaudaraan yang tulus dan ikhlas antar mahasiswa. Teruslah bangkit untuk membangun bangsa dan negara dalam dunia akuntansi,” kata Nababan. Ia juga berharap agar seluruh mahasiswa Prodi Ekonomi dapat mewujudkan persaudaraan yang tulus dan ikhlas terhadap sesame, tanpa memandang perbedaan. Ketua Pelaksana Rico Wijahya Sinaga mengatakan, melalui perayaan Natal ini, seluruh mahasiswa harus tetap menjaga kekompakkan antara mahasiswa dengan dosen. “Kita harus menerapkan kasih persaudaraan yang tulus dan nyata dalam hidup kita,” ungkapnya dalam kata sambutan. Sementara Pdt Petrus Pardede dalam khotbahnya, meminta seluruh mahasiswa untuk tetap semangat mengerjakan segala sesuatu dan penuh dengan suka cita. Ia juga mengingatkan kepada para mahasiswa agar tetap mengasihi dan tidak ada rasa dendam yang terpendam. Juga merubah seluruh sifat buruk menjadi lebih baik dari yang sebelumnya. “Saya harapkan seluruh rekan-rekan mahasiswa tetap saling menjaga ketentraman antar sesama mahasiswa. Begitu juga dalam kehidupan bermasyarakat dan tetap saling mengasihi sesuai dengan tema Natal ini,” kata Petrus. Perayaan Natal juga dihadiri Osko Sijabat MPd, Lisbet M Sihombing MPd, Antonius Gultom MPd, Ganti Manihuruk MPd, Benjamin Simamora MPd dan BEM-P Frans Hutabarat. (mag-06)


RABU 19 Desember 2012

„ Prosesi perayaan Natal Raja Panjaitan, Boruna, Bere, Ibebere Kota Pematangsiantar dan sekitarnya.

„ Kordinator seksi konsumsi Timbul Panjaitan menyalakan lilin Natal, Senin (17/12).


Dalam Hidup, Dituntut Lebih Banyak Mengasihi

„ Punguan Raja Panjaitan dari sektor Simpang Dua saat lomba koor.

„ Punguan Raja Panjaitan sektor Marihat sedang mengikuti perlombaan koor.

„ Peserta koor Raja Panjaitan dari sektor Rambung Merah

„ Peserta koor Raja Panjaitan dari sektor Lapangan Bola Atas

„ Peserta koor Raja Panjaitan dari sektor Aek Nauli

„ Seluruh Raja Panjaitan, Boruna, Bere, Ibebere Kota Pematangsiantar berdiri saat beribadah.

„ Song Leader dari boru Panjaitan pada perayaan Natal Raja Panjaitan.

„ Pdt Dr HR Panjaitan didampingi seluruh pengurus dan panitia memberikan kata sambutan.

„ Ketua Umum Punguan Raja Panjaitan, Boru dan Ibebere Kota Pematangsiantar E Panjaitan.

„ Ketua pelaksana AKP Dolok Panjaitan SH hendak menyalakan lilin.

„ Pdt Dr HR Panjaitan didampingi seluruh panitia menyalakan lilin.

„ Peserta yang membawakan liturgi dari sektor Kampung Kristen.

„ Peserta koor Raja Panjaitan dari sektor Jalan Bali.

„ Peserta koor Raja Panjaitan dari sektor Kampung Kristen.

Teks dan foto : Dhev Bakkara dan Raymond Sitanggang, Lokasi: Sopo Godang HKBP Jalan Gereja Pematangsiantar, Senin (17/12)

„ Protokol, Miduk Panjaitan


SELASA 18 Desember 2012



Smart Computer Jln. Merdeka No 80 ( 0622-7072808 Fax.0622-7346080 E_mail :


Nokia 1280 Rp. 190.000

Nokia X1-01 Rp. 380.000 + MMC 2 Gb

Nokia X2-02 Rp. 700.000 + MMC 2 Gb

Nokia C1-01 Rp. 485.000 + MMC 2 Gb

Nokia C2-03 Rp. 820.000 + MMC 2 Gb

Nokia X2-01 Rp. 685.000 + MMC 2 Gb

Nokia N100 Rp. 240.000

Nokia X2.00 Rp. 890.000 + MMC 2 Gb

Nokia N101 Rp. 320.000 + MMC 2 Gb

i ans l r a G na io Nas 2 GB MC na + M erda +P

PROMO !!!! “Beruntung Beli Laptop ACER” DAPATKAN “1 buah lucky dip” (Gimmic ACER) untuk Setiap Pembelian Laptop ACER Garansi RESMI ACER Indonesia +++ DAPATKAN KALENDER 2013 !!! (Untuk setiap pembelian Laptop Merek apa saja)

NB : Selama Persediaan msh ada

Hanya di

ART COM LOWONGAN KERJA PT. Prudential Agency membuka lowongan kerja untuk menjadi Agen Asuransi Prudential. Tidak terikat waktu (Free Lance), dan hanya bagi orang yang ingin sukses dan ingin berpenghasilan uang besar. Dengan syarat: • Pria/Wanita usia 20 - 45 thn, punya KTP dan masih berlaku. • Mempunyai relasi yang luas • Bersedia mengikuti ujianAAJI, Anda akan mendapatkan: • Komisi selama 5 thn per nasabah • Bonus Tambahan Rp.1 juta • Jalan jalan Gratis kedalam/Luar negeri • Jenjang karir yang bergengsi

Segera hub. 0812

6354 0888

Prudential Manager

TERCECER Telah tercecer 1 buah surat sertifikat hak milik nomor 240 An. Sri Astuti, luas 273 M2 di Desa Balimbingan. Tercecer sekitar Jl. Pekan Sari Matondang Sidamanik Bagi yang menemukan hub: HP 0813 9781 5501 Tidak dituntut tapi diberikan imbalan yang sepantasnya

Yudea Jaket

Jl. Sibolga No. 12 depan SMPN 12 Pematangsiantar. HP 0852 7648 0231

h erianda ceria A ah M r u M ti a pas Harg Menjual berbagai:


Beli 5 jaket dan rompi

GRATIS 1 MANTEL Berlaku selamanya

Peter Refleksi

SinShe Aciu / Aling Jl. Cipto No. 22 di Wisma Pangkas Lt. 2 P. Siantar. HP 0852 7695 4557 0813 6071 0199 Melayani pengobatan

Full Body Refleksi Khaki Terapi Lilin Kop / Bekam Untuk kesembuhan penyakit • Ambeian • Kolestorel • Asam Lambung • Asam Urat • Ginjal • Gula • dll Buka : Jam 09.30 - 21.00 WIB


19 Desember 2012

SETELAH putus hubungan dengan Daniel Mananta, Marissa Nasution tak berlama-lama merasakan kesendirian. Wanita berdarah Batak itu tak butuh waktu lama untuk menemukan pacar baru. Melalui sahabatnya, Mike Lewis ia dipertemukan dengan seorang pengusaha bernama Conrad. Senyum tak pernah lepas dari wajah wanita berzodiak Aquarius itu selama ngobrol tentang pria yang kemudian menggantikan Daniel di hatinya itu. Marissa bercerita, dirinya menemukan kenyamanan dari pria keturunan AustraliaFillipina yang usianya

berselisih 3 tahun dengannya itu. ”Karena lebih berpengalaman mungkin, jadi aku nyaman sama dia sampai sekarang,” ujar Marissa. Bahkan, meski hubungannya dengan sang kekasih baru berjalan kurang lebih delapan bulan, wanita yang hobi berenang itu sudah mantap untuk melanjutkan ikatan mereka ke tahap yang lebih serius. Marissa memang sudah tak sabar untuk bisa memiliki keluarga. Selain fokus di kariernya sebagai presenter dan berbisnis di usaha sepatu, bintang film ‘Get Married 2’ itu juga ingin sukses membina rumah tangganya kelak. ”Enam tahun aku berkarier di sini, aku mau lebih realistis. Ke depannya

BACHARUDDIN Jusuf Habibie menyatakan puas dengan film MD Pictures itu. Dia mengatakan, setiap scene benar-benar mewakili kisah hidupnya. Dia menilai, Reza Rahardian dan Bunga Citra Lestari (BCL) bisa menjadi cermin Habibie dan Ainun kala muda. Tanpa ragu Habibie mengangkat dua jempol untuk Reza dan BCL. Menurut Habibie, Reza memerankan sosoknya tanpa cela. Malah, cucu Habibie yang baru berusia enam tahun mengatakan bahwa tingkah laku Reza di film tersebut sangat mirip dengan kakeknya. ”Yang menilai bukan saya, tapi cucu. Dia (Reza) berhasil melakukan mission impossible menjadi possible. Saya puas,” ucap Habibie. Lantas, bagian mana yang menjadi favorit? Habibie menyebut semua. Dengan gestur tangan seperti mengusap air mata, dia menuturkan bahwa setiap scene mengingatkan pada Ainun. Banyak kenangan yang dilihatnya kembali. ”Itu membawa sisi

aku ingin fokus sama keluarga,” urai Marissa. Segala hal yang ia inginkan dari seorang pria ia temukan pada diri kekasihnya saat ini. Meski terkadang sang pacar diakuinya amat posesif, namun ia tak merasa keberatan. Tak seperti mantan-mantannya sebelumnya, wanita yang hobi mengenakan high heels ini justru merasa menemukan sosok yang bisa diperlakukan layaknya saudara dan sahabat. ”Ketimbang aku, Conrad yang jauh lebih posesif. Tapi nggak apa-apa, aku nyaman-nyaman aja. Itu tandanya dia perhatian sama aku selama ini,” paparnya. (dtc/int)

emosional tersendiri bagi saya,” ujar Habibie. Bagi Reza dan BCL, pembuatan film itu membuat mereka lebih akrab dengan Habibie. Dua bintang tersebut kini malah menyapa Habibie dengan sebutan eyang. Maklum, pembuatan film itu diikuti Habibie secara langsung. Reza bahkan mewawancarai langsung Habibie untuk mendalami peran. Bagi Reza, proses wawancara itulah yang membuatnya bisa memerankan Habibie dengan baik. Sebenarnya, dia sempat pesimistis. ”Prosesnya hanya dua minggu. Untung, ada wawancara langsung dengan Eyang (Habibie) selama dua hari berturut-turut,” paparnya. Begitu juga BCL. Menurut dia, tidak mudah memerankan sosok Ainun. Beda dengan Reza yang bisa belajar langsung ke Habibie, BCL tidak demikian. Seperti diketahui, Ainun yang harus diperankan BCL sudah meninggal. Jadi, BCL tak punya mentor khusus seperti Reza. (jpnn/int)

PENAMPILAN Miley Cyrus menarik perhatian di perhelatan VH1 Divas di Shrine Auditorioum, Los Angeles, AS. Miley muncul diantara sederetan diva musik berkumpul untuk merayakan musik bintang pop Whitney Houston dan ratu disko Donna Summer. Beberapa di antaranya yang

hadir adalah divadiva muda seperti Miley Cyrus, Jordin Sparks, dan Demi Levato. Layaknya seorang diva, para bintang muda itu tampil dalam balutan busanabusana nan memukau. Masing-masing menampilkan sisi keglamoran seorang diva sesuai karakternya. Yang cukup menyita perhatian dari penampilan Miley Cyrus adalah dii saat bintang lainnya memilih gaya “lady-like”, bintang “Hannah Montana” itu malah menghadirkan sisi seorang diva dengan tampil agak “gahar”.

Dengan gaya rambut cepak mohawk-nya, pelantun “Can’t Be Tammed” itu membaluti tubuhnya dengan mini dress ketat hitam lengan panjang beraksen cut-out rancangan Norma Kamali. Detail cut-out atau bolonganbolongan yang berbentuk wajik itu terlihat menghiasi sisi kiri dan kanan gaun berleher kura-kura tersebut. Tampilan yang “Konservatif” sekaligus seksi secara bersamaan. (tr/int)

SELENA Gomez siap mengabaikan Justin Bieber, karena ia mau kencan dengan Niall Horan ‘One Direction’. Mengutip femalefirst, menurut Hollywoodlife, Selena ingin berkencan dengan Niall Horan karena statusnya yang masih lajang. ”Selena ingin mulai berkencan dengan pria lain untuk melihat apakah ada sesuatu yang lebih baik di luar sana soal pria, setelah tak bersama Bieber,” kata sumber. ”Bukankah sesuatu yang mengherankan saat Selena memiliki kencan dengan kekasihnya, bersama dengan Taylor Swift dan Harry Styles,” imbuh sumber. Sebagaiman diberitakan sebelumnya, Justin dan Selena putus akhir pekan ini. Selena juga murka saat mengetahui Justin bergaul dengan mantan pacarnya, Nick Jonas. (dtc/int)

Rabu, 19 Desember 2012

„ Para song leader dari boru Panjaitan tampil usai liturgi profesi pada perayaan Natal Raja Panjaitan Dohot Boruna, Bere, Ibebere Kota Siantar.

Dalam Hidup, Dituntut Lebih Banyak Mengasihi

„ Kembang api turut memeriahkan perayaan Natal Raja Panjaitan Boruna, dohot Bere/Ibebere Kota Pematangsiantar dan sekitarnya.

„ Seorang putri Panjaitan membawakan liturgi profesi artis pada perayaan Natal Raja Panjaitan Dohot Boruna, Bere, Ibebere Kota Siantar.

„ Ketua Panitia AKP Dolok Panjaitan SH memberikan hadiah kepada pemenang lucky draw.

„ Pengurus dan panitia natal foto bersama usai kebaktian Natal Raja Panjaitan Dohot Boruna, Bere, Ibebere Kota Siantar.

„ Pdt Sarbudin Panjaitan STh memberikan bingkisan kepada anak sekolah minggu.

„ Para pihak Boru Panjaitan foto bersama usai melaksanakan kebaktian natal.

„ Para peserta yang mendapatkan beasiswa di tingkat pelajar, didampingi Ketua Panitia AKP Dolok Panjaitan SH foto bersama.

„ Pengurus Raja Panjaitan memberikan bingkisan Natal kepada seluruh janda dan lansia.

„ Para pendeta meninggalkan lokasi usai kebaktian Natal Raja Panjaitan Boru Bere/ Ibebere.

„ Berbagi kasih kepada seluruh pengurus dan anggota punguan Raja Panjaitan, Boru, Bere dan Ibebere.

„ Pengurus Raja Panjaitan, Boru, Bere dan Ibebere dan panitia Natal manortor bersama atas suksesnya acara Natal.

„ Para pihak boru Raja Panjaitan menikmati makan malam bersama usai kebaktian.



RABU 19 Desember 2012













2 Man City







3 Chelsea







4 Tot Hotspur







K emenangan besar dengan skor 5-2 yang didapat Arsenal atas R eading disebut Arsene W enger sangatlah penting. Hasil tersebut menunjukkan kalau ‘Gudang Peluru ’ bisa memberi reaksi atas kondisi buruk yang baru diterima.


KLUB Swansea City

2 R van Persie

Manchester United


3 D Ba

Newcastle United


4 L Suárez



5 J Defoe

Tottenham Hotspur


6 M Fellaini




GOL 12


16 15





2 Atlético Madrid

16 12





3 Real Madrid

16 10





4 Málaga








KLUB Barcelona

GOL 25

2 R Falcao

Atlético Madrid


3 Cristiano Ronaldo

Real Madrid


4 Aduriz

Athletic Club


5 Rubén Castro

Real Betis


6 Negredo



iwarnai hat-trick Santi Cazorla, plus dua gol lainnya dari Lukas Podolski dan Theo Walcott, Arsenal memetik kemenangan mutlak dengan skor 5-2 dalam lawatan ke Reading. Kemenangan tersebut mengantar The Gunners naik ke posisi lima klasemen dengan poin 27.Terlepas dari langkah naik Arsenal ke papan atas, hal lain yang membuat Wenger sangat puas dengan raihan anak didiknya adalah terkait reaksi yang diberikan setelah mereka dapat hasil buruk pekan lalu. Melalui adu penalti, Arsenal disingkirkan Bradford City di babak perempatfinal Piala Liga Inggris. “Targetnya adalah meraih kemenangan dengan meyakinkan. Kami fokus dengan pertandingannya. Saat kedudukan 4-0 kami menjalani periode ‘melayang’. Dan dalam posisi 42, setelah apa yang terjadi pekan lalu, kami mulai tak pasti. Kami sedikit kehilangan fokus dan harus membayarnya. Tapi secara keseluruhan penting buat kami untuk bermain dan memberikan jawaban di atas lapangan,” sahut Wenger di Skysports. “Selama 16 tahun cuma sekali kamu kalah dari tim yang berasal dari divisi lebih rendah. Jika Anda membandingkan rekor tersebut dengan klub lain di Inggris, itu masih jadi yang terbaik.” “Saya setuju kalau (kekalahan) itu menyakitkan, dan sangat mengecewakan. Tapi malam itu Bradford tampil sangat baik. Saya bertanggung

jawab saat kondisinya berjalan baik dan saya menerima kritik saat kondisinya menjadi buruk,” tuntas Wenger. Cazorla Terbaik di Arsenal Santi Cazorla layak dinilai menjadi pemain yang memiliki rapor bagus saat membela Arsenal. Catatan statistik membuktikan pemain seharga 16,5 juta poundsterling itu merupakan yang terbaik. Cazorla tampil apik saat tim ‘Gudang Peluru’ menundukkan Reading dengan skor telak 5-2. Pemain yang baru didatangkan dari Malaga di awal musim 2012-2013 itu mengemas hat-trick dalam laga yang berlangsung di Madejski Stadium, Selasa (18/12) dinihari. Dengan tiga gol yang dia bikin itu, Cazorla pun menjadi top skorer sementara The Gunners dengan koleksi tujuh gol. Dengan torehan itu, dia bahkan lebih produktif dibandingkan dengan Lukas Podolski dan Theo Walcott (5 gol), serta Olivier Giroud (4 gol). Lebih detil lagi Soccernet mencatat bahwa Cazorla menjadi pemain yang paling sering melakukan tembakan ke gawang, yaitu 59 kali. Pesepakbola 29 tahun itu juga menyumbangkan empat assist bagi tim yang bermarkas di Emirates Stadium itu. Catatan Cazorla itu merupakan yang tertinggi di antara pemain Arsenal lainnya. Torehan pemain asal Spanyol itu berturut diikuti oleh Podolski dengan 3 assist dan 27 tembakan ke gawang, Giroud yang membukukan satu assist dan 47 tembakan, serta Theo Walcott yang memiliki catatan assist sama yaitu 4, tapi cuma 22 kali melakukan sepakan ke gawang. Atas performa Cazorla sejauh 17 laga di Premier League ini, manajer Arsenal, Arsene Wenger pun sudah memiliki penilaian. “Santi Cazorla adalah pemain berkualias top dan dia hanya menggambarkan bahwa dirinya merupakan pembelian yang tepat,” ucap Wenger di situs resmi Arsenal. Pujian kepada Cazorla pun juga terlontar dari mulut rekannya di lini tengah Arsenal, Jack Wilshere. “Kemampuannya sebagai pemain yang serba bisa sungguh luar biasa. Sangat berat bagi siapa saja yang berasal dari Spanyol untuk bermain di Premier League. Tapi, ia membuatnya terlihat sangat mudah,” ungkap Wilshere seperti dilansir oleh AFP. Jalan Pertandingan Pertandingan baru berjalan 13 menit saat Arsenal berhasil membuka keunggulan. Bermula dari tusukan Kieran Gibbs di sisi kanan pertahanan Reading, dia kemudian melepas umpan silang ke kotak penalti. Memanfaatkan buruknya pengawalan

pemain Reading, Podolski dengan mudah menceploskan bola ke dalam gawang. Empat menit kemudian Cazorla nyaris membuat ‘Gudang Peluru’ menggandakan keunggulan saat tendangan jarak jauhnya melenceng tipis dari sasaran. Tim tamu akhirnya bisa menggandakan keunggulan di menit 30, dengan skenario yang nyaris serupa seperti gol pertama. Kali ini Podolski yang menyisir di sisi kanan pertahanan Reading, dia kemudian melepaskan umpan crossing ke muka gawang dan dibelokkan menjadi gol oleh Cazorla menggunakan kepalanya. Dua menit berselang Cazorla kembali mencatatkan namanya di papan skor. Menyambar bola

yang sempat disundul Gibbs saat mencoba meneruskan umpan dari Podolski, Cazorla membawa Arsenal kini unggul 3-0. Enam menit babak kedua berjalan Cazorla nyaris membuat hat-trick kalau saja Adrian Mariappa tidak menghalau bola tepat di garis gawang Reading. Tapi trigol Cazorla kemudian tinggal menunggu waktu saka karena di menit 59 satu sontekan pesepakbola asal Spanyol itu membuat kedudukan berubah menjadi 4-0. Tertinggal empat gol sama sekali tak membuat Reading menyerah. Bermula dari kesalahan umpan di sektor pertahanan, Adam le Fondre dengan tenang melewai Szczesny saat dalam posisi satu lawan satu untuk kemudian menceploskan

bola ke dalam gawang. Di menit 65 Reading memperkecil ketinggalan menjadi 4-1. Kebangkitan tuan rumah seketika menyeruak setelah di menit 69 Reading berhasil mencetak gol keduanya. Kali ini Jimmy Kebbe yang menjebol gawang The Gunners. Tapi kisah dramatis comeback Reading tidak terjadi di laga ini karena di menit 80 justru Arsenal yang berhasil menambah jumlah golnya. Membangun serangan dari tengah, Cazorla yang menusuk menuju kotak penalti melepaskan umpan pada Walcott. Dengan satu gerakan, pesepakbola Inggris itu menipu bek lawan dan melanjutkan aksinya dengan melepaskan tembakan terarah yang menjadi gol. 5-2 untuk Arsenal. (int)






Rabu, 19 Desember 2012



Edisi 154 „ Tahun IX

Janda Pemilik Kafe Modali Pembelian 9 Kg Ganja KURIR DIBEKUK, BANDAR DPO TAPTENG- Berdalih untuk membayar utang, Amat Lubis (29) nekat menjadi kurir ganja. Warga Jalan Baru, Kecamatan Tukka, Tapteng, ini berutang kepada pengusaha kafe Masria br Nasution (34), yang memodali pembelian ganja sembilan kilogram tersebut. ‹ ‹ Baca

(foto: freddy)

Lakalantas Maut, Dua Tewas, 24 Luka-luka RANTAU- Kecelakaan maut terjadi di Jalinsum Desa Janji, Kecamata Bilah Barat, Kabupaten Labuhanbatu, Selasa (18/12) dini hari. Dua orang dinyatakan tewas dan 24 lainnya luka-luka saat bus Pinem nomor polisi BK 7599 A tabrakan dengan bus Kota Pinang Baru (KPB) bernomor polisi BK 7359.

Informasi yang dihimpun, tabrakan terjadi ketika bus Pinem yang melaju dari arah Medan menuju Pekanbaru menabrak pembatas jalan yang berdiri tepat di tengah Jalinsum Desa Janji, Kecamatan Bilah Barat. ‹ ‹ Baca

„ Dua tersangka pemodal dan kurir ganja bersama barang bukti saat diinterogasi di ruang penyidik Mapolres Tapteng, Selasa (18/12).

Janda..Hal 6

Pak Lurah Poligami, Istri Pertama Ngadu ke Bupati BATANG TORU- SKN, oknum PNS di Kelurahan Aek Pining, Kecamatan Batang Toru, Kabupaten Tapsel, mengadukan suaminya HH, yang menjabat sebagai lurah kepada Bupati Tapsel, Selasa (18/12). Aduan tersebut berisi keluhan SKN atas perlaku suaminya yang pergi dari rumah sejak bulan April dan melakukan poligami (praktik pernikahan lebih dari satu istri, red) dengan EEH. Bukan hanya itu, HH juga menggugatnya cerai sekaligus meninggalkan utang di salah satu bank, yang kini menjadi tanggung jawabnya dalam hal pelunasan. ‹ ‹ Baca

Pak..Hal 6

Lakalantas..Hal 7

Prins Wales Tambunan:

TAPTENG- Meski masa berlaku izinnya telah berakhir, namun Sintong Gultom tetap merambah rotan jenis sega. Itu sesuai keterangan

(foto: Aniko Rambe)

„ Bus Pinem yang hancur bagian depannya setelah bertabrakan dengan bus Kota Pinang Baru, Selasa (18/12).

„ Prins Wales Tambunan

Sintong Rambah Rotan Tak Sesuai Spesifikasi Izin saksi ahli dari Dinas Kehutanan dan Perkebunan Tapteng dalam persidangan yang digelar di PN Sibolga, Senin (17/12). Namun Sintong masih bersikukuh bahwa yang dirambahnya bukan rotan ‹ ‹ Baca

Sintong..Hal 6

Siti Kholifah, Penggagas Kelas Hamil di Pacitan, Nomine Srikandi Award 2012

Tiap Bulan Terima Murid Remaja Korban KTD Kasus kehamilan tidak diinginkan (KTD) pada remaja di Desa Ploso, Pacitan, Jawa Timur, menginspirasi Siti Kholifah. Bidan desa itu membuat kelas hamil untuk mengedukasi para remaja putri tentang pentingnya gizi sekaligus risiko hubungan seks di luar nikah.

„ Siti Kholifah

SEORANG remaja putri yang baru duduk di bangku kelas 1 SMP mendatangi rumah Siti Kholifah. Dia muntah-muntah tak keruan. Siti pun langsung menduga bahwa remaja tersebut hamil. Bahkan, dia bisa mengira-ngira usia kehamilan remaja bernama samaran Partini itu. “Saat itu, dia sudah hamil lima bulan,” kata Siti saat ditemui di Balai Kartini, Senin (17/12). Siti Kholifah datang di Jakarta setelah terpilih menjadi wakil Jawa Timur dalam kontes Srikandi Award 2012 untuk menyambut Hari Ibu tingkat nasional. Ketika Siti memberi tahu orang tua Partini, bapak Partini langsung naik darah. Dia tidak percaya anak gadisnya yang masih bau kencur itu sudah hamil.

Siti lalu meyakinkan si bapak dengan tes USG. “Hasilnya sesuai dugaan saya, dia sudah hamil lima bulan. Setelah tes itu, bapaknya baru percaya,” kenang Siti. Kasus Partini yang terjadi sekitar dua tahun lalu tersebut bukan sesuatu yang mengejutkan bagi Siti. Hampir setiap bulan dia menerima kabar adanya remaja putri yang hamil di desanya. Bidan berusia 40 tahun itu mengakui, kasus KTD di Desa Ploso, Pacitan, Jawa Timur, cukup tinggi. Selama 20 tahun menjadi bidan desa di Pondok Bersalin Desa (Polindes) Ploso, dia kenyang menangani remaja SMP atau remaja dalam rentang usia 12-15 tahun yang ‹ ‹ Baca

Tiap Bulan..Hal 7



19 Desember 2012

Keterbatasan Personel

Polairud Dukung Tugas Polres di Darat SIBOLGA- Kepolisian Air dan Udara(Polairud)SibolgaKotatidak hanya menjalankan tugas pengamanan di tengah laut, namun mereka juga turut mendukung tugas kepolisian di darat. Hal itu diakibatkan keberadaan jumlah personil Kepolisian Resort (Polres) Sibolga Kota yang masih kurang. “Kita tidak hanya tugas pengamanan di air, di darat juga personel kita sering dilibatkan untuk membantu Polres seperti pengamanan aksi unjuk rasa, pengamananBankdanlainnya,”kata Kasatpol Airud AKP J Sitopu kepada wartawan, Senin (17/12). Selain itu, pada momen Natal dan Tahun Baru, pihaknya juga turut dilibatkan dalam operasi rutin (patroli) di tengah laut. Hal ini guna meminimalisir sekaligus mencegah terjadinya kasus kriminal berupa illegal fishing, illegal logging dan tindak kejahatan lainnya. “Kita mengerti atas situasi ini, mengingat jumlah personil Polres Sibolga Kota tidak banyak. Sementara terkait operasi rutin yang kita gelar, situasi di tengah laut masih aman,” ucapnya. Disinggung mengenai pengamanan di pulau-pulau dalam rangkamencegahdanmeminimalir tindak kejahatan, Sitopu mengatakan, pihaknya, sejauh ini baru bisa melaksanakan operasi rutin di tengah laut. Sementara, untuktugaspengamanandipulaupulau mengantisipasi aktifitas illegal logging masih belum. Terkait itu, Sitopu enggan mengungkapkan apakah hal tersebut sekaitan dengan keberadaan sarana dan prasana pendukung seperti pos jaga yang belum ada ditambah personel polairud yang jumlahnya masih dianggap kurang.“Kalauuntukkesana,itutidak dapat saya katakan,” ungkap Sitopu.

Terpisah, Dewan Pimpinan Pusat (DPP) Lembaga Swadaya Masyarakat (LSM) Front Pemantau Pelaksanaan Pembangunan Indonesia (FP3i) yang berkantor pusat di Tapteng, Simon Situmorang mengakui bahwa pihak kepolisian Polres Sibolga Kota terbilang masih kekurangan personel dalam pelaksanaan seluruh tugastugas kepolisian di daerah, terutama Polairud Sibolga yang berkantor di wilayah Pelabuhan Perikanan Nusantara (PPN) Pondok Batu, Kecamatan Sarudik, Kabupaten Tapanuli Tengah (Tapteng). “Kita akui personel Polres Sibolga Kota memang masih kurang bila dilihat dari jumlah penduduk Sibolga. Jumlah personel Polres Sibolga kota ada sekitar 100-an orang, sementara penduduk kota Sibolga sudah hampir 100 ribu jiwa,” katanya. Terkait tugas Polairud, menurut Simon, aktivitas kriminal di perairanlautdiwilayahperairanpantai barat bagian Sumatera Utara sebenarnya masih terus ada. Namun, dia menyadari bahwa Polairud tidakdapatberbuatbanyak,mengingat keberadaan sarana dan prasarana mereka yang tidak mendukung dan memadai. Sementara wilayah tugas pengamanan Polairud terbilang luas berkenaan dengan perairan dan pulau-pulau. “Ini memang membutuhkan pemikirandantentunyaanggaran. Kita dari LSM LP3i sangat mendukungbilamanapemerintahdan pimpinan kepolisian bersedia mengalokasikan anggaran untuk pengadaan pertambahan sarana dan prasana armada termasuk pendirian bangunan pos-pos jaga di pulau-pulau di wilayah kerja Polairud Sibolga dalam rangka mencegah atau meminimalisir tindakkriminaldiwilayahperairan pantai barat,” tandasnya. (tob)

6 Atlet Tako Berlaga di Malaysia PANDAN- Sebanyak 6 atlet Tako Tapteng akan diutus ke Kejuaraan Internasional Karate Silent Knight IV di Kuala Lumpur Malaysia pada 29 Januari-3 Februari 2013 mendatang. Keenamnya yakni Amelia siswa SD Pandan 1, Suryani, Suci Hutabarat, Sapta Manurung, ketiganya siswa SMA Negeri Pinangsori. Lalu Dandi dan Oktaviana Sarumpaet siswa SMP Negeri 2 Pandan Nauli. “Saya berharap atlet yang akan bertanding ke Malaysia bisa mengharumkan nama Indonesia dan khusunya Tapteng di dunia internasional,” tukas Bupati Tapteng Raja Bonaran Situmeang selaku penasehat Pengcab Tako, saat melepas atlet di Aula Disdik Tapteng, Selasa (18/12). Sebelum berangkat ke Malaysia, keenam atlet yang masih berusia pelajar itu akan meng-

ikuti masa karantina dan tryout di Medan. Setelah itu mereka berangkat pada tanggl 25 Januari 2013 nanti. Di kesempatan itu, Bupati sekaligus membuka Ujian Kenaikan Tingkat sebanyak 45 dari total 115 atlet Tako Tapteng usia pelajar. “Jika nanti ada yang gagal dalam ujian naik tingkat ini, jangan frustasi. Teruslah berlatih. Sebab prestasi hanya dapat diraih dengan belajar dan

(Foto:Marihot Simamora)

TAKO- Salam Horas Tapteng! oleh Bupati Raja Bonaran Situmeang, Ketua Pengcab Tako Kemal Sianipar, Kadisdik Jonson Sihombing, Kakanpora Rastim Bondar, Kabag Humasy Iwan Sinaga dan keenam atlet. latihan tekun. Bangun mimpimu jadi kenyataan dengan berbuat. Berlatihlah dengan sungguh-sungguh dan harus percaya diri,” pesan Bupati.

TAPTENG- Bupati Tapteng Raja Bonaran Situmeang menghadiri perayaan Natal Lembaga Pemasyarakatan (Lapas) Sibolga di Tukka, Tapteng, Selasa (18/12) siang. Bonaran mengajak warga binaan untuk memperbaiki sikap dan mental serta lahir sebagai pribadi yang baru. “Penjara sudah dirubah menjadi lembaga pemasyarakatan, artinya di sini bukan lagi tempat mengkerengkeng orang, namun membinaagarkelakkeluardarisini kalian lahir baru. Saya sangat prihatin karena 40 persen warga binaan terkait kasus narkoba. Narkoba merusak raga dan iman. Makanya saat keluar nanti, jadilah manusia baru,” tukas Bonaran dalam sambutannya. Di kesempatan itu, Bonaran berjanji akan memberikan bahan

baku kayu untuk dibuat menjadi mobiler lapas kelas II B tersebut. “Saya tadi dapat informasi bahwa mobiler seperti bangku dan meja masih kurang. Nanti awal Februari tahun depan saya akan kirimkan bahan bakunya, silahkan ditukangi di sini,” tandasnya. Natal mengusung tema “LihatlahAkumenjadikansegalasesuatu menjadi baru” dari kitab Wahyu 21:5. Dan subtema “Dengan perayaan Natal, kita tingkatkan semangat insane pengayoman dalam rangka mewujudkan reformasi birokrasi dalam pembinaan warga binaan dan pelayanan masyarakat”. Hadir Wakalapas W Sinulingga, rohaniawan, segenap pegawai lapas, para warga binaan pria dan wanita serta kerbat keluarganya. (mora/tob)

SILVER HANGER: Jl. Ahmad Yani no. 48 Sibolga Square, baju Online-Tas Branded-Accessories Distro Cloth, Belanja online tidak sesuai keinginan? Pengen tas branded? Aksesoris unik? Atau ingin sablon kaos 1 pcs full warna desain bebas dan tentunya tidak luntur dan bisa disetrika harga terjangkau? Silahkan ke Outlet dan buktikan. YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 /bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari


Authorized Toyota Dealer • All new Avanza ready !!! • Veloz accesories full !!! • Grand new innova ready !!!! • Yaris bonus paling lengkap dan full discount • New Rush ready !!! Hub. David Maruhawa, HP 0813 9648 7188; 0831 9355 3180. PIN BB 26C3BF8D (Sales Executive). Data dijemput !!! proses cepat !!!. NB: Harga Siantar = Harga Medan TOKO RIOON: Menjual berbagai macam peralatan Rumah Tangga dan perkantoran seperti : Lemari Pakaian, Lemari buku, Buppet, Kasur, Sofa, Rak piring, dll. Serta Meubeler Kantor seperti: Kursi Kantor, Meja tulis, dll Segera berbelanja di tempat kami Di Perumahan Sarudik Permai/ Eks. Komp. Hock ley No. 1B Buka setiap hari kecuali minggu. TURUN / NAIK BERAT BADAN: 3-50 Kg dengan CELL NUTRITION. Efektif, cepat & aman. HUB: Lia 0852 6000 8690, 0823 6327 8346. Garansi 30 hari uang kembali.

nguji dari Pengda Tako Sumut, Kakanpora Tapteng Rastim Bondar, Kabag Humasy Iwan RM Sinaga, dan para orangtua atlet. (mora)

Samosir Pasaribu Ketua IKAPTK Tapteng


Warga Binaan Lapas Diharapkan jadi Manusia Baru

Hadir dan turut memberi arahan Ketua Umum Pengcab Tako Tapteng, Kemal Sianipar SH dan Kadisdik Tapteng Jonson Sihombing. Hadir juga Tim Pe-

„ Bupati Tapteng Raja Bonaran Situmeang didampingi Asisten Ekbang Aris Sutrisno dan Kabag Ekbang Berlin Doloksaribu memberikan atribut dan materi bintek kepada perwakilan perserta, Senin (17/12).

Pengusaha Mikro Bintek Manajemen Praktis TAPTENG- Sedikitnya 100 pelaku usaha mikro di Tapteng mengikuti bimbingan teknik (bintek) yang digelar Bagian Ekonomi dan Pembangunan (Ekbang) Pemkab Tapteng di Ball Room Hotel Bumi Asih Pandan, Senin-Selasa (17-18/12). Mereka diberi wejangan bagaimana penerapan manajemen praktis dan cara mendapatkan kredit lunak dari bank. “Pesertanya para pengusaha mikro di Tapteng, pedagang kaki lima, home industry, dan para pengrajin. Seperti tukang jahit, pandai besi, salon, fashion, kerajinan, perebusan ikan, pedagang sembako, dan bi-

TELAH HADIR DI KOTA ANDA COOL TECH (Cover jok motor anti panas) pertama dan nomor 1 di Indonesia. Rasakan berbagai mamfaat dan kenyamanan menggunakan cool tech sekarang juga. New : tersedia warna – warna baru dan motif-motif baru. Hubungi : Washington W. Jl. Marganti Sitompul No.39 Sibolga HP 0852 9782 2222. Nb: Dicari Sub agen untuk seluruh wilayah Tapanuli dan sekitarnya.

LOWONGAN KERJA: Anda sedang mencari pekerjaan, kami solusinya, perusahaan Nasional butuh tenaga pemasaran. Syarat : 1. Pendidikan SLTA sederajat 2. Mempunyai kendaraan sendiri yang bisa dipakai bekerja 3. Pengalaman tidak diutamakan 4. Bagi anda yang sudah berpengalaman kami juga butuh tenaga Sub Agen Wilayah Pemasaran Anda yang menentukan. Fasilitas : 1. Tunjangan pokok 2. Bonus Penjualan 3. Selisih Harga Penjualan. Anda berminat hubungi ke : Jl. SM Raja No.337 Kel Aek Manis Sibolga. UD. JASO MALINDO: menjual santan murni dan kelapa parut, kamipun menerima tempahan/ mengasah mata parutan. Ruko No.5 Pasar Gelugur RANTAU PRAPAT . No HP 081264552871 (IWAN) OVER KREDIT: Sepeda motor Yamaha vixion tahun 2012, warna hitam, putih dan emas, harga bisa nego yang berminat hubungi HP 0813 7003 2458 UD. FAJAR BARU: Menjual segala jenis dan bentuk: Kasur, Bantal dan Guling yang terbuat dari kapas asli Kunjungilah kami hanya di: Pasar terminal sibolga (depan terminal Hotel) Jl. P. Sidempuan, Sibuluan (di depan Foto Kasih)

dang industri kreatif lainnya,” tukas Kabag Ekbang Tapteng Berlin Doloksaribu. Bintek menghadirkan narasumber dari Bappeda Tapteng, Disperindagkopin, Ketua Dekranasda, Bank Sumut, Bank Mandiri, dan dari STIE Alwasliyah Sibolga-Tapteng. “Peserta diberikan pemahaman dan keterampilan bagaimana menerapkan manajemen praktis dan bagaimana memperoleh kredit lunak dari bank. Manajemen praktis bagaimana pembukuan dan pemasaran sederhana. Para pengusaha bisa memperoleh informasi bantuan kredit dari perbankan,” tim-


pal Berlin. Sebelumnya, Bupati Tapteng Raja Bonaran Situmeang memaparkan, Tapteng kini tengah dalam masa geliat pembangunan. Salah satunya mendukung pembangunan ekonomi kerakyatan. Karena itu Pemkab membuka peluang seluas-luasnya kepada pelaku usaha kreatif. “Saya berharap para pengusaha mikro kreatif mampu mengolah sumber daya alam lokal menjadi produk unggulan daerah,” tukas Bupati saat membuka bintek yang ditandai dengan pemberian tanda atribut dan materi pemaparan kepada perwakilan peserta. (mora/tob)

UD RUMONDANG BULAN Menjual Kosen Pintu & Jendela Menjual Peti Mati Menyewakan Taratak Menyewakan Papan Bunga / Kursi Menyewakan Mobil Pengantin (Fortuner) Menyewakan Perkakas Pesta / Meninggal Menyewakan Bunga Altar Gereja Menyewakan Tikar. Dll Hubungi Kami: Jl. Bawal Arah Laut No. 64. Sibolga HP 0813 7604 1179

Menjual beli segala jenis sepeda motor HONDA Cash & Credit Type Harga Supra 125 Thn 2011 10 Jt Blade model Baru 10 Jt Blade Bisa 8 Jt Harga bisa nego Hub Kami: Jl. Padang Sidempuan depan Hotel Pandan Cerita Pandan Hp 085358124743


LOWONGAN KERJA: Dibutuhkan segera tenaga kerja untuk rangkai bunga papan Di GRACINDO FLORIST Jl. SM Raja No.47 A depan SPBU Pandan Krisman Tumanggor (081362328010)

LOWONGAN KERJA: 1. Dibutuhkan Guru Bhs. Inggris & Mandarin 2.Administrasi Persyaratan : Bertanggung Jawab (1,2) , Rajin (1,2) , Dapat Berkomunikasi Dengan Baik Dalam bahasa Yang ditekuni (1) , Menguasai Mc.Excel + Mc. Word (2), Jujur (1,2), Pendidikan SMA Sederajat (1,2) Lamaran d antar Langsung: Jl. Junjungan Lubis No. 7 Sibolga

SUZUKI BARU PAKET PROMO OKTOBER 2012 PT. TRANS SUMATERA AGUNG. Dealer Resmi Mobil Suzuki TYPE CASH BACK Carry Pick Up 5 Jt APV Pick Up New APV Mini Bus 12 Jt Splash 12,8 Jt Swift 10 Jt Ertiga New SX4 Cross Over 10 Jt Estilo 1.0 15,3 Jt Grang Vitara 18 Jt Cash & Credit, Data di jemput by credit D/P kecil bunga rendah angsuran ringan Hub : DAVID SINAGA 081260618834 DIJUAL RUMAH: Beralamat Jl. Solo No. 3 P. Sidimpuan samping Mesjid Raya Sagumpal Bonang, ukuran tanah L = 17,5 dan P = 29 surat sertifikat. Bagi yang berminat hubungi Kunan Nst di Lopian ke. Badiri Tapteng HP 0853 7338 5246

KABAR GEMBIRA !!! Telah Hadir di kota anda Spesialis perbaikan dan suku cadang Laptop, note book, sperpat computer ber alamat Jl. SM Raja No. 2 sibolga HP 0852 6229 3344 SILVIRA GORDEN: Menerima: Tempahan segala jenis Gorden, Plus Fitrase Rumah & Kantor sampai siap pasang. Alamat : Jl. SM Raja Simpang IV Barus HP. 082366765432 DIJUAL: Inova B.8367. GD maven BK.1088.XV tahun 2006'warna biru metalik' Harga 150juta' bisa nego. Mitshubishi maven tahun 2007' warna Hitam Harga 120juta bisa nego. Hub. 0852 6150 9688; 0813 7685 9855

Pasang Iklan Anda Hub. Hub.: 0631 -


PANDAN- Bupati Tapteng Raja Bonaran Situmeang mengatakan, seluruh alumni pendidikan tinggi kepamongprajaan difungsikan di pemerintahan daerah. Bahkan, beberapa di antaranya menduduki jabatan penting, mulai dari ajudan, lurah, camat, kepala bidang, kepala bagian, kepala dinas, hingga sekretaris daerah. “Laporan yang saya terima ada 35 orang alumni pendidikan tinggi kepamongprajaan di Pemkab Tapteng. 34 di antaranya difungsikan pada posisi yang strategis di pemerintahan daerah dan 1 orang lagi sedang mengikuti pendidikan. Saya yakin kesolidan para alumni mampu menggarami Pemkab Tapteng, dan hebatnya para alumni juga tidak pernah cengeng,” tukas Bonaran saat pelantikan Dewan Pimpinan Kabupaten Ikatan Keluarga Alumni Pendidikan Tinggi Kepamongprajaan (DPK IKAPTK) Tapteng, di Gedung Bina Graha, Pandan, Jumat (14/12). Samosir Pasaribu yang kini mejabat Inspektorat Pemkab Tapteng yang dilantik sebagai ketua. Hadir langsung melantik,

Ketua DPP IKAPTK Sumut Amri Tambunan beserta istri, yang didampingi sekretarisnya Asrin Naim. DPK IKAPTK adalah para alumni APDN, IIP, STPDN, dan IPDN yang bertugas aktif di pemrintahan daerah. Dalam amanatnya, Amri berharap para alumni berperan aktif dalam pengabdian untuk pemerintah daerah., bahkan menjadi tulang punggung pememerintahan. “Kita berbeda dengan lulusan disiplin ilmu yang lain. Kita disiapkan menjadi staf dan pimpinan yang baik sekarang dan di masa depan, pada bidang apapaun. Maka dari kita lahir pimpinan yang berkualitas,” kata Amri. Amri juga berpesan, agar seluruh alumni terus mengasah ilmu dan pengalaman. Jangan hanya menunggu, tapi berbuatlah. “Wadah ini jadikan sebagai tempat berdiskusi. Memberikan masukan kepada pemerintahan daerah. Kenali dan kuasai situasi dan kondisi masyarakat. Yang paling dibutuhkan adalah bagaimana mengambil keputusan dan kebijakan yang tepat,” tukas Amri. (mora/tob)

„ Bonaran Situmeang.

UD LENNY ASSESORIES Menjual: • Jam tangan; jam dinding, jam bekker • Kaca mata, parfum, mancis • Kaligrafi dan mejual segala jenis perhiasan seperti: • Kalung, gelang, cincin, anting-anting • Dan segala assesories lainnya, luar dalam negri • Menjual lontong, pada malam hari’ Hub. Jl. Kuda Laut No. 56 Sibolga HP 0852 7544 6508-0852 6140 1366; 0812 6562 7885

TELAH HADIR DI KOTA PANDAN : New Dunia susu tersedia susu untuk anak anda dengan berbagai produk susu dan rasa, chicken brand, pewangi ruangan untuk ruangan agar nyaman terasa saat berada di dalam ruangan, menyediakan layanan pesan antar dalam jumlah yang besar sampai pukul 17.00 WIB alamat: Jl. P. Sidempuan KM 9,5 Lubuk Tukkopandan, Hub. 081370969694 (Herman) Toko buka pkl.07.30 s/d 22.00

GRACINDO: Cetak Kalender 2013 • Kalender kerja • Kalender Meja •Kalender Standard • Kalender Triwulan • Kalender Caturwulan • Kalender Poster • Juga Melayani Segala Jenis Cetakan, Papan Bunga dan Papan Digital Pesan di : GRACINDO PANDAN Jln.SM.Raja Depan SPBU Pandan Telp : 0631-371789 Hp: 0813 6232 8010 (Krisman Tumanggor)

*PAKET AKHIR TAHUN DAIHATSU* XENIA 1,3.., CICILAN 1,2 Jt TERIOS.... CICILAN 2 Jt GRAN MAX PICK UP DP 11 Jt Proses Cepat, Ringan, Mudah & Pasti.: Info & pemesanan : RAHDY: 081361329496 082362009080

SATU-SATUNYA DI INDONESIA!!! JASA PENGEBORAN SUMUR DALAM Dengan MESIN MODERN (mampu hingga 200 Meter) dan menggunakan alat Pelacak Jalur Aliran Sumber Air (Sungai) bawah tanah. Akurasi 90% SUKSES kini hadir di Sibolga Hub : 082 191 238 883; 085 2255 88838 www.

PROMO MITSUBISHI BARU • L300..................................................Ready Stock • Colt Diesel ........................................Ready Stock • T120 SS ...........................................Ready Stock • FUSO ...............................................Ready Stock • Pajero Sport .....................................Ready Stock • Outlander Sport ...............................Ready Stock • Mirage ..............................................Ready Stock Hub: SIMARMATA 0852 7775 9705

RUMAH MAKAN BERSAMA: Menyajikan berbagai masakan, Nasi Goreng, Mie Goreng, Soto. Berbagai minuman, Aneka juice, teh manis, kopisusu,ginseng.SERBAEKONOMIS. Simpang Kuala Tanjung, Indrapura, Batubara

PONDOK SATE HAJI SUBALI: Menyediakan berbagai makanan seafood, sate kambing, sate ayam, tongseng, sop, ayam bakar, ayam goreng, ikan mas bakar, ikann mas goreng, berbagai macam jus buah, silakan datang dan nikmati. alamat: Jl. P. Sidempuan KM 7,5 Sibuluan, buka pkl. 10.00 s.d 22.00 WIB,kecuali hari jumat buka pkl.18.00 WIB. Telp. 0631 - 372356 HP 0813 7594 6737

SALMA D’CAFÉ menyediakan sarapan pagi, nasi serba 7000 dengan hidangan istimewa. Nasi goring, mie goring, bakso, pangsit, siomai, Batagor, bandrek, aneka juice. Menerima nasi kotak dan rantangan. Hub: Ibu salma , 081263497777 Jl. Kula Tanjung Kebun Kopi Indrapura, Batubara. COOL TECH: Sarung jok untuk motor anda pertama di Indonesia: Mamfaat dari cool tech - Meredam panas hingga 80% - Menambah kenyamanan Kendaraan bermotor - Variasi Motor Hub: Herry HP 0811 6260 343 Jl. Albertus No.18 Sibolga. NB: Dicari Sub Agen Untuk Wilayah Sibolga dan Tapteng.

TOYOTA 2012 Promo Akhir Tahun, Banjir Hadiah • All New Avanza • Veloz • Rush • Grand new Innova • Fortuner VNT Hub: Freddy Simatupang, 0853 6207 2000, 0813 6165 1801


19 Desember 2012 “IMF sama sekali tidak demokratis karena didominasi oleh pemegang saham dari negara-negara besar dan masih menerapkan agenda-agenda neoliberal sebagai syarat penyaluran utang,” Koordinator Koalisi Anti Utang (KAU), Dani Setiawan.

“Penjara itu hanya untuk orang kriminal, bukan untuk orang yang berbeda pandangan dengan kita. Saya sampaikan itu,”

“Cara terbaik yang dapat dilakukan pemerintah Indonesia untuk menjawab pelecehan dan penghinaan sebagian masyarakat adalah dengan bekerja keras menciptakan lapangan kerja dan kesejahteraan,” Ekonom senior DR. Rizal Ramli.

BJ Habibie, mengomentari soal hinaan eks Menteri Penerangan Malaysia Zainudin Maidin.

Kirim Opini Anda ke email: metrotapanuli Maksimal tulisan 5.000 karakter

Sikap Kami Menggantung Kursi Menteri KONSTITUSI kita secara terang benderang sudah menggariskan sistem pemerintahan kita ialah presidensial. Sistem itu di antaranya menegaskan hanya presidenlah yang memegang hak prerogatif untuk mengangkat, memberhentikan, dan mengganti para menteri. Namun, urusan yang mestinya amat mudah, benderang, dan lumrah tersebut menjadi rumit, remang-remang, bahkan terkadang genting. Urusan reshuffle kabinet pun seolah menjadi persoalan hidup mati. Celakanya, sang pemilik mandat prerogatif seperti bergeming menonton ‘drama’ tidak bermutu itu. Presiden kerap terlambat, bahkan terkesan mengulur waktu sehingga kegaduhan akibat isu reshuffle terus menggema hampir saban tahun. Dalam kasus kekosongan kursi menteri pemuda dan olahraga (menpora), misalnya, Presiden Susilo Bambang Yudhoyono memilih sikap menunggu. Padahal, sang pemilik kursi sebelumnya,AndiAlifianMallarangeng,sudahmundursejakdelapanhari lalu. Untuk sementara, entah sampai kapan, posisi menpora diisi oleh Menko Kesra Agung Laksono sebagai pejabat sementara menpora. Agung, yang kesibukannya sebagai menko kesra kita asumsikan berjibun, harus membereskan urusan olahraga dan kepemudaan yang juga ruwet dan pelik. Baru sehari menjabat menpora saja, Agung harus dihadapkan pada tenggat menyelesaikan kisruh di PSSI. Belum lagi kerja-kerja mengoordinasikan persoalan kesejahteraan rakyat, bencana di sejumlah tempat, dan bahkan soal flu burung yang mulai bermutasi ke itik, yang amat mendesak dibereskan. Jelas, akan ada yang dikorbankan jika dua bahkan tiga urusan penting datang secara bersamaan. Karena itu, amat susah membayangkan segalanya akan berakhir efektif dan tepat waktu. Kecuali, Presiden menganggap bahwa kursi menpora tidak teramat penting untuk diisi pejabat definitif. Presiden, misalnya, menganggap urusan kepemudaan dan olahraga sudah bisa diatasi institusi yang selama ini ada, baik dengan atau tanpa kehadiran menpora. Urusan olahraga, contohnya, bisa diurus Komite Olahraga Nasional Indonesia (KONI). Hal ihwal kepemudaan boleh digarap organisasi ekstrakampus seperti HMI, GMNI, PMII, PMKRI, GMKI, atau KNPI. Sah-sah saja kalau Presiden berpikiran seperti itu. Namun, jangan diam, sembunyi-sembunyi, atau terus menimbang-nimbang. Umumkan ke publik bahwa kursi menpora bisa diperankan institusi lain di negeri ini. Bahkan kalau perlu, berikan argumentasi yang sahih mengapa kursi menpora tidak dibutuhkan lagi. Bukankah meskipun ada menpora, prestasi olahraga kita sejauh ini jalan di tempat, bahkan cenderung merosot? Mengambangkan keputusan berhari-hari justru menambah dosis kegaduhan yang mestinya tidak perlu ada. Di tengah menumpuknya persoalan yang jauh lebih besar di negeri ini, menghadirkan kegaduhan yang tidak perlu seperti menyetel kaset rusak berulang-ulang. Amat menyebalkan dan membikin pusing. (*)

FIFA Plin Plan

Kita bisa bernafas lega ketika badan sepakbola dunia, FIFA, menunda sanksi kepada PSSI. FIFA masih memberi kesempatan kepada PSSI untuk menyelesaikan kekisruhan hingga Maret 2013. Namun benarkah kesempatan itu merupakan kesempatan terakhir yang diberikan dan bila dalam jangka waktu 4 bulan tidak mampu menyelesaikan masalah, sanksi benar-benar dijatuhkan?

Oleh : Ardi Winangun PENUNDAAN sanksi ini bukan yang pertama. Penundaan sanksi sudah ketiga kalinya. Pada Maret 2012 badan sepakbola yang bermarkas di Zurich, Swiss, itu juga menunda sanksi. FIFA mengharap PSSI mampu menyelesaikan masalahnya hingga Juni 2012. Namun ketika jeda waktu yang sudah ditentukan berakhir dan PSSI tidak bisa menyelesaikan masalahnya, FIFA tidak segera menjatuhkan sanksi namun masih memberi waktu hingga 10 Desember 2012. Ketika waktu yang telah ditetapkan sudah habis dan lagi-lagi PSSI tidak mampu menyelesaikan apa yang diharapkan, FIFA pun juga tidak kunjung menjatuhkan sanksi namun masih diberi waktu. Apa yang dilakukan FIFA itu menunjukkan bahwa FIFA plin plan, tidak tegas, dan sepertinya ada sesuatu dibalik diundur-

undurnya sanksi. Sikap ‘tidak bertanggungjawabnya’ FIFA bertambah ketika masalah PSSI dilimpahkan kepada badan sepakbola Asia, AFC. Tentu apa yang dilakukan oleh FIFA ini membuat geram sebagaian kalangan, sebab sebagaian kalangan menilai dengan adanya sanksi inilah yang dirasa mampu membuat intropeksi dan sadar diri bagi seluruh insan sepakbola Indonesia. Dalam masa-masa hukuman yang dijatuhkan inilah dirasa sebagai waktu yang tepat untuk membangun badan sepakbola Indonesia dan program-program yang lebih baik. Hukuman FIFA kepada anggota biasanya diberikan apabila terbukti adanya intervensi dari pemerintah negara masingmasing. FIFA mempunyai statuta bahwa badan sepakbola yang tergabung dalam FIFA ha-

rus lepas dari campur tangan pemerintah. Dengan statuta itu diharapkan badan sepakbola menjadi lebih mandiri dan tidak menjadi kepentingan politik dan kampanye penguasa. Badan sepakbola yang pernah diberi sanksi atas intervensi pemerintahannya seperti Irak, Ethiopia, Nigeria, Iran, Brunai Darussalam, Kuwait. Sanksi yang diberikan kepada anggotanya itu bervariasi, ada yang hanya hitungan hari, seperti 1 minggu; ada pula yang hitungan bulanan, 1 bulan, 2 bulan, 5 bulan; adapula sanksi dengan waktu yang tak jelas kapan berakhirnya. EPO, PSSInya Yunani; dan NFF, PSSI-nya Nigeria, diberi sanksi di bawah kurang lebih hanya 7 hari. Sedang FFBH, PSSI-nya BosniaHerzegovina, diberi sanksi sejak 1 April 2011 dan hingga kini sanksi itu belum dicabut. Lama tidaknya sanksi yang diberikan bisa jadi dengan pertimbangan sepakbola di negeri itu penting atau tidak di kawasannya. Sanksi yang hanya 1 mingguan bagi EPO dan NFF bisa jadi tim nasional yang dibentuk oleh badan sepakbola itu cukup mempunyai kiprah di kawasannya. Demikian pula sanksi yang hanya 1 sampai 2 bulan yang diberikan kepada Irak, Iran, dan Kuwait, karena


SHING-CINOLING Di tangani langsung oleh: Mr. Nai HP 082194932600 Jika anda yakin berobat dijamin 100% SEMBUH di tempat kami SHING-CINOLING 1. Stroke 2. Jantung 3. Tumor 4. Hernia 5. Gondok 6. Gagal Ginjal 7. Maag 8. Lambung 9. Asma 10. Asam urat 11. Kencing manis, dll

4 minggu bebas dari kursi roda 3 minggu sembuh total 3 minggu sembuh total 4 minggu sembuh total 3 minggu sembuh total 4 minggu sembuh total 2 minggu sembuh total 2 minggu sembuh total 2 minggu sembuh total 2 minggu sembuh total 3 minggu sembuh

Alamat praktek: Jl. P. Sidempuan. Perumahan Sibuluan Nalambok Blok B. No. 2 Tapteng Buka setiap hari. Pkl: 08.00 s/d 21.00 HARI BESAR DAN HARI LIBUR LAINNYA TETAP BUKA

negara itu cukup mumpuni tim nasionalnya di kawasan Timur Tengah. Sedang sanksi kepada badan sepakbola Brunai dan Bosnia-Herzegovina cukup lama karena bisa jadi tim nasionalnya tidak terlalu berarti di kawasan yang ada. Lalu mengapa FIFA plin plan kepada PSSI? Bisa jadi FIFA melihat ada potensi lain dalam dunia sepakbola Indonesia. Indonesia kalau diukur dari kapasitas tim nasional masih masuk katagori yang memprihatinkan, untuk ukuran Asia Tenggara saja sudah megap-megap apalagi kalau berlaga di Asia dan dunia, namun dengan penduduk lebih dari 250 juta jiwa, Indonesia adalah pasar yang menjanjikan bagi perkembangan sepakbola dunia. Potensi pasar sepakbola di Indonesia yang dilihat FIFA untuk dunia itu adalah. Pertama, liga sepak bola Indonesia adalah liga terbaik dan termeriah di Asia Tenggara. Ibarat lampu dan laron, liga sepak bola Indonesia menjadi lampu dan mampu menarik laron-laron pemain sepak bola di mana pun. Mengapa liga sepakbola Indonesia menarik bagi pemain asing? Faktor bayaran untuk pemain asing relatif tinggi membuat banyak pemain dari Eropa, Australia, Amerika Latin, dan kawasan Timur Tengah berbondong-bondong untuk bisa menjalin kontrak dengan klub yang ada di LPI atau LSI. Antusiasnya penonton di liga sepak bola Indonesia juga menjadi magnet bagi pemain asing. Pemain Tim Nasional Singapura dan Malaysia ngebet bermain di Indonesia, selain bayaran yang tinggi juga karena antusiasnya suporter klub. Meriahnya suasana di stadion dengan hadirnya puluhan ribu penonton ternyata menjadi salah satu spirit bagi pemain untuk bermain bagus. Meriahnya suasana di dalam stadion, dengan teriakan dan nyanyian suporter, hal demikian tidak ditemui di liga sepak bola Singapura dan Malaysia sehingga liga yang ada dirasa kurang memiliki greget. Kedua, Indonesia adalah negara yang sering dijadikan tempat lawatan klub-klub ternama

dari Eropa dan Amerika Latin. Klub-klub kesohor yang pernah bermain di Indonesia khususnya di Gelora Bung Karno adalah Bayern Munchen, Inter Milan, Santos, Sampdoria, Tim Nasional Uruguay, AC Milan, Tim Nasional Afrika Selatan U21, LA Galaxy, Red Star Bratislava, Dynamo Moscow, Manchester United, Ajax Amsterdam, Tim Nasional Italia U-21, Arsenal, PSV Eindhoven, Queen Park Rangers, Lazio, dan di tahun 2013 disebut Barcelona FC akan datang ke Indonesia. Tentu kedatangan mereka bukan cuma-cuma namun ada sponsor. Pastinya nilai rupiah dari mendatangan klub-klub itu tidak kecil. Di sinilah FIFA melihat potensi ekonomi yang tinggi dari Indonesia untuk sepakbola dunia. Ketiga, antusias dunia sepakbola di Indonesia juga dilihat oleh klub-klub besar di Eropa. Untuk itu klub-klub besar mendirikan sekolah sepakbola. Sekolah sepakbola dari luar yang membuka cabang di Indonesia seperti SSI Arsenal, Liverpool Internasional Football Academy, FC Barcelona Escola Indonesia, dan Sekolah Sepak Bola Real Madrid. Tentu para orangtua yang menyekolahkan anaknya di sekolah sepabola itu perlu merogoh kocek yang dalam sebab sekolah sepakbola itu tentunya dalam latihan tidak seperti sekolah sepakbola di kampungkampung. Sekolah sepakbola dari luar melihat bahwa Indonesia mempunyai pasar yang bagus dan menggairahkan sehingga akan ada lagi sekolah-sekolah sepakbola yang akan membuka cabang di Indonesia. Kesimpulannya, apabila FIFA dan AFC memberi sanksi kepada PSSI maka secara tidak langsung FIFA dan AFC memutus ‘rantai makan’ bagi pemain sepakbola asing dan klub asing sehingga FIFA dan AFC dalam posisi bingung dan plin plain, bila tidak diberi sanksi PSSI akan selalu dirundung konflik, namun bila diberi sanksi ‘suplai’ ekonomi sepakbola Indonesia untuk dunia terhenti. (***) Penulis adalah Penggemar Sepabola


Jl. Hiu No.88 arah laut Sibolga

• Tes Kadar Lemak Perut • Pemeriksaan Kepadatan Tulang • Pemeriksaan Usia Sel • Pemeriksaan Kadar Air • Pemeriksaan Kepadatan Tulang • Pemeriksaan Massa Otot dan Ranting Fisik Suplemen yang terbuat dari nutrisi buah-buahan dan sayur-sayuran 100% NUTRISI LENGKAP


• Dapat Menurunkan Berat Badan 3-10kg/bulan • Dapat Menaikan Berat Badan • Menambah Nutrisi Tubuh Hubungi EFFENDY MANALU HP 0812 6307 414; 0813 7068 2243; 0852 7774 2645


Buka setiap hari SENIN s/d SABTU (Jam 08.00 - 21.00 WIB)



19 Desember 2012


Eks Pelayan Kafe Tenggak Racun Hingga Tewas


PANCURBATU- Santi alias Kiki (28), mantan pelayan kafe nekat menenggak racun rumput. Wanita asal Stabat, Langkat, ini pun ditemukan tak bernyawa di sebuah kos-kosan di Desa Sembahe Baru, Kecamatan Pancurbatu, Selasa (18/12) dini hari. Motifnya, korban tidak terima spring bed baru miliknya di-running Yuli, teman satu kostnya berbuat mesum.

KEHILANGAN-Suhendra, pemilik sepedamotor yang hilang dari parkiran salahsatu hotel di Jalan Diponegoro Pematangsiantar, Selasa (18/12).

Kreta Karyawan Hotel Raib dari Parkiran

SIANTAR- Suhendra (22), seorang karyawan hotel ternama di Jalan Diponegoro mengalami kejadian naas. Suzuki Satria FU BK 5065 TAF, miliknya raib dari lokasi parkir tempatnya bekerja, Selasa (18/ 12) sekira pukul 14.30 WIB. Informasi dihimpun, Suhendra yang tinggal di Jalan Serdang, Gang Banjar, Kelurahan Bantan, Kecamatan Siantar Barat ini, tiba di hotel, Senin (17/12), sekira jam 22.45 WIB dan memarkirkan kreta-nya di parkiran khusus karyawan hotel. Pada saat itu, Suhendra yang masuk shift malam, mengetahui kereta yang sudah diangsurnya selama 23 bulan itu hilang sesaat akan bertukar shift pada paginya, Selasa (18/12), sekira jam 07.30 WIB. Suhendra yang sudah bekerja sekitar enam bulan di hotel itu, terkejut ketika melihat kreta kesayangannya raib dari diparkiran. Melihat itu, Suhendra pun memberitahukan kepada satuan pengamanan (Satpam) hotel. Namun, tidak seorang pun satpam yang mengetahui dan

melihat kreta Suhendra. Setelah mencari di sekeliling parkiran hotel dan tidak menemukannya, Suhendra pun menghubungi ibunya. Lalu, ditemani ibunya, Suhendra dan Satpam yang jaga pada malam itu mendatangi Mapolres Siantar, untuk melaporkan kasus itu. Usai membuat laporan, Suhendra mengaku sangat menyesalkan kurangnya pengamanan di hotel itu. “Hotelnya mewah, CCTV masa tidak ada,” kesal Suhendra. Selain tidak adanya CCTV, Satpam juga mengaku tidak melihat kreta Suhendra lewat dari pos pengamanan satpam. “Jalan keluarnya hanya satu, semua lewat dari pos satpam. Tapi kok bisa hilang,” kritiknya. Kapolres Siantar AKBP Alberd TB Sianipar, melalui Paur Humas Ipda Restuadi membenarkan telah menerima laporan pencurian tersebut. “Laporan pencurian tersebut sudah diterima dan masih diselidiki. Ditaksir korban mengalami kerugian materi ditaksir Rp15 juta,” katanya. (mag-05)


„ Terdakwa Paino menjalani persidangan di PN Simalungun, Selasa (18/12).


Supir Truk Pesakitan SIMALUNGUN- Akibat membawa 134 batang kayu yang diambil dari Kawasan Hutan Negara RI Register 2 S/ M Sibatu Loting HPHTI PT TPL, seorang supir truk Paino (21), jadi pesakitan di Pengadilan Negeri Simalungun. Warga Huta Simpang Jambi, Nagori Bosar Nauli, Kecamatan Hatonduan, ini didakwa melanggar Pasal 50 ayat 3 huruf h jo Pasal 78 ayat 7, UU RI Nomor 41 Tahun 1999 tentang Kehutanan jo pasal 55 1 ayat ke-1 KUHPidana. Hal itu disampaikan Jaksa Penuntut Umum (JPU) Julius Butarbutar saat membacakan dakwaannya di hadapan hakim dipimpin Samuel Ginting, beranggotakan Heriyanti, dan Adria Dwi Afanti, Selasa (18/ 12). Peristiwa itu berlangsung di kawasan hutan Negara RI Register 2 S/M Sibatu Loting HPHTI PT TPL di Nagori Bosar Nauli, Kecamatan Hatonduan, Jumat (39/3), sekira pukul 22.00 WIB. Ceritanya, saat itu, terdakwa baru selesai mengangkat batu, kemudian bertemu dengan Mesdi (DPO) dan Dul Witno. Lalu Mesdi menawarkan kepada terdakwa untuk mengangkut kayu (bahan jadi) pada tengah malam. Mendengar itu, pria lajang itu menjawab; “ngeri-ngeri sedap mengangkut kayu, soalnya belum pernah aku kerja malam menyupiri atau mengendarai mobil”. Selanjutnya Dul Witno menjawab pernyataan terdakwa ‘siapa lagi kalau bukan kau Paino, kaunya yang bisa nyupir’. Kemudian, terdakwa pun akhirnya menyetujuinya. “Lalu sekitar pukul 21.00 WIB, terdakwa bersama Mesdi naik ke truk Toyota Dyna BK 8288 TC. Saat itu, Dul Witno sebagai pemilik truk masih sempat melihat mereka berangkat. Terdakwa pun membawa ken-

daraan tersebut memasuki Kawanan Kawasan Hutan Negara RI Register 2 S/M Sibatu Loting HPHTI PT TPL, di Nagori Bosar Nauli, Kecamatan Hatonduan. Tak lupa juga Mesdi menuntun arah kayu yang sudah ditebanginya bersama Suwono dan Dudung,” terang Butarbutar. Setibanya di lokasi, terdakwa memutar truk menuju arah pulang. Kemudian, terdakwa mematikan kunci kontak mesin truk dan menunggu di dalam truk. Saat berada di dalam truk, Mesdi, Suwono, Dudung serta seorang lagi yang tidak dikenal melangsir dengan cara memundak kayu setiap satu batang hingga 134 batang ke dalam truk. Setelah penuh, terdakwa pun kembali menghidupkan mesin truk dan keluar dari kawasan hutan. Akan tetapi sekitar 500 meter truk melaju, tiba-tiba terdakwa melihat cahaya lampu sepedamotor dari pihak pengamanan PT TPL. Melihat itu, terdakwa menghentikan dan mematikan mesin truk. Kemudian mereka lari berpencar ke kawasan hutan dan meninggalkan truk. “Saat itu, terdakwa memilih berjalan kaki ke rumah. Selanjutnya pada Sabtu (31/3), terdakwa datang ke rumah Dul Witno dan memberitahukan bahwa truknya tinggal di kawasan hutan tersebut. Mendengar itu, Dul pun berangkat bersama anaknya Suryanto untuk mengambil truk itu. “Sementara untuk mengindari pencarian polisi, terdakwa memilih melarikan diri ke Pekanbaru. Namun, karena tidak tahan di sana, terdakwa kembali ke Huta Simpang Jambi, Nagori Bosar Nauli, Kecamatan Hatonduan pada 12 Agustus 2012. Saat itu juga terdakwa berhasil diamankan polisi,” ungkap jaksa. (mua)


DIAMANKAN- Kartini br Simanjuntak dan Parningotan Lumbantobing, tersangka jurtul togel diamankan di Mapolresta Siantar, Selasa (18/12).


KARTINI & PARNINGOTAN DIBORGOL SIANTAR- Praktik judi toto gelap (togel) makin merajalela. Di Kota Pematangsiantar, seorang ibu rumah tangga (IRT) Kartini br Simanjuntak (55), jadi jurtul togel. Wanita bertubuh tambun ini ditangkap bersama seorang jurtul lainnya Parningotan Lumban Tobing (36), Senin (17/12). Keduanya diamankan dari lokasi berbeda. Kartini diamankan dari sebuah warung tuak milik Mak Anton di Jalan Patuan Nagari, Kelurahan Sukadame, Kecamatan Siantar Utara, Senin (17/12), sekira pukul 16.15 WIB. Sementara Parningotan diamankan dari Jalan Bombongan Raya, Kelurahan Tambun Nabolon, Keca-

matan Martoba pada sebuah warung tuak milik marga Hutagalung. Kini, baik Kartini, warga Jalan Rakutta Sembiring, Kelurahan Sigulang-gulang, Kecamatan Siantar Utara dan Parningotan Lumban Tobing (36), warga Jalan Medan, Simpang Karang Sari, Kelurahan Tambun Nabolon, Kecamatan Martoba, telah mendekam di sel Mapolresta Siantar. Penangkapan keduanya dilakukan atas informasi masyarakat. Untuk mengungkapnya, polisi menyaru sebagai pembeli nomor togel. Dari kedua tersangka, polisi menemukan 3 lembar kertas

berisi angka tebakan, sebuah pulpen, dan juga sebuah handphone Nokia type X1 berwarna hitam yang dijadikan sebagai alat untuk mengirim angka tebakan judi togel tersebut. Kemudian barang bukti berupa uang tunai sebesar Rp331 ribu dan 1 lembar kertas berisi angka tebakan judi togel hongkong. Kapolres Siantar AKBP Alberd Sianipar, melalui Paur Humas Ipda Restuadi membenarkan penangkapan Kartini br Simanjuntak dan Parningotan Lumban Tobing. “Keduanya diancam dikenakan pasal 303 KUHPidana tentang Perjudian,” ujarnya. (mag-05/dro)

Dua Spesial Bajing Loncat Ditangkap BELAWAN- Dua pelaku kejahatan yang kerap meresahkan para supir truk di Belawan Angga (19), warga Jalan Slebes, Gang Dua, Kecamatan Medan Belawan dan Bahri Siahaan (22), warga Perumahan Nelayan Indah, Blok DD, Kecamatan Medan Labuhan ditangkap petugas Sat Reskrim Polsek Belawan. Kedua spesialis bajing loncat ditangkap di tempat dan waktu berbeda. Dari tangan keduanya, polisi menyita barang bukti pisau, 6 zak gula, dan uang sebesar Rp50 ribu. Kini, keduanya dijebloskan ke sel tahanan Mapolsek Belawan, Selasa (18/12). Informasi diperoleh Posmetro Medan (grup Koran ini) di kantor polisi menyebutkan, Bahri Siaha-

an ditangkap di persimpangan tol Kampung Salam Belawan dengan cara menjegat mobil truk saat keluar tol. Pelaku langsung menodong supir langsung dan mengambil uang sebanyak Rp50 ribu dari kantong baju supir tersebut. Perbuatan pelaku telah diintai polisi dan langsung menangkap tangan tersangka. Sedangkan, Angga ditangkap saat beraksi terhadap truk bermuatan gula yang keluar dari Pelabuhan Belawan. Angga melakukan aksi kejahatannya bersama 8 temannya yang berhasil kabur. Para kawanan bajing loncat ini naik ke truk ketika terjebak macet di persimpangan Canang, Belawan. Aksi kawanan pelaku diketahui oleh warga dan langsung dikejar oleh masyarakat

setempat. Naas bagi Angga, dirinya tertangkap sedangkan teman-temannya berhasil kabur. Dengan barang bukti 6 zak karung gula hasil kejahatan langsung dibawa ke Mapolsek Belawan. Kedua pelaku kejahatan yang kerap meresahkan supir truk ini pun telah mendekam di sel tahanan Mapolsek Belawan. Kanit Reskrim Polsek Belawan AKP B Pakpahan mengatakan, pihaknya terus melakukan patroli di sekitaran kawasan yang kerap dijadikan aksi kejahatan terhadap para supir. “Kedua tersangka kita tangkap di lokasi berbeda, mengenai pelaku yang berhasil kabur masih kita kembangkan,” ungkapnya. (ril/pmg)

Informasi dihimpun, pada Sabtu (15/12) malam lalu, Kiki memerogoki Yuli dalam posisi kelonan dengan pria lain diketahui bermarga Sembiring di kamar kosnya itu. Melihat itu, Kiki mengamuk. Yuli dimaki. Keduanya pun terlibat adu mulut. Melihat situasi itu, Yuli dan kekasihnya beranjak dari kamar Kiki. Tak berselang lama, suami siri Kiki Selamat Riadi (44), warga Suka Raya, Kecamatan Pancurbatu, pulang dari tempatnya bekerja sebagai tukang jahit pakaian. Begitu suaminya pulang, Kiki mengadu. Namun ayah tiga anak itu ternyata menanggapinya dingin. Menurutnya hal itu tidak perlu dibesar-besarkan. Mendapat jawaban dari suami yang dinikahinya lima bulan lalu itu, Kiki tak terima. Selanjutnya, Kiki yang pernah bekerja sebagai pelayan di Kafe Darwin di Desa Sembahe Baru, ini langsung pergi ke Pajak Pancurbatu. Di pajak itu, korban mendatangi sebuah toko yang menyediakan berbagai jenis racun hama dan racun rumput. Kemudian Kiki membeli rumput merk Gramatsond dan dibawanya ke kos. Tiba di kost, Kiki langsung menenggaknya hingga tinggal setengah. Kiki pun terkapar dengan mulut berbusa. Beberapa detik saja Selamat masuk kamar yang disewanya sebesar Rp2,5 juta per tahun itu. Melihat istri mudanya terkapar dengan kondisi mulut mengeluarkan aroma tak sedap, Selamat panik dan menjerit histeris, sehingga mengundang perhatian tetangganya. Lalu, oleh warga Kiki yang sudah kritis langsung dilarikan ke Puskesmas Pancurbatu. Tiba di puskesmas, petugas medis pun memberikan pertolongan dan nyawa Kiki terselamatkan. Begitu kondisinya stabil, Selamat pun membawa Kiki pulang ke kediamannya. Namun pada Selasa (18/12), sekira pukul 00.07 WIB, tibatiba Kiki kejang-kejang. Melihat itu, Selamat yang berada di

sampingnya terkejut. Tapi tak lama kemudian, Kiki tewas dengan kondisi telungkup, mulut mengeluarkan buih. Menyadari istrinya meninggal, Selamat memberitahukannya kepada jiran tetangga. Warga yang mengetahui tewasnya Kiki langsung mendatangi kamar kos-kosan tersebut. Pagi harinya, warga yang curiga dengan kematian korban langsung melaporkannya ke petugas kepolisian. Tak berselang lama, Tim Reskrim Polsek Pancurbatu disusul Tim Forensik Polresta Medan tiba di lokasi untuk melakukan olah TKP, dan memboyong jenazah korban ke RSUP H Adam Malik Medan untuk keperluan otopsi. Terpisah, Yuli mengatakan, antara ia dan korban memang saling kenal. “Perkenalan kami sejak kami sama-sama kerja di kafe. Namun sejak dia kenal sama Bang Selamat lima bulan lalu, dia pun mulai meninggalkan pekerjaan menjadi pelayan kafe, dan dua bulan kemudian mereka menikah secara siri. Selanjutnya, mereka tinggal bersama, dan rumah kos ini,” ujar Yuli. Yuli juga mengaku bahwa dirinya juga tinggal di koskosan Kiki kurang lebih dua minggu. “Aku terpaksa tinggal di sana, karena tempat tinggalku sudah habis kontrak. Jadi aku numpang sama dia. Malam Minggu itu, memang kami ada ribut, karena dia memergoki aku sama pacarku tidur di spring bed yang baru dibelinya itu. Tapi saat itu langsung aku tinggalkan dia karena dia maki-maki aku,” aku Yuli sambil berlalu. Kapolsek Pancurbatu Kompol Darwin Sitepu saat dikonfirmasi membenarkan tewasnya korban. “Saat ini masih kita selidiki motif kematian korban, namun dugaan sementara korban nekat menghabisi nyawanya karena tak terima dimarahi suaminya. Itu sebabnya dia nekat minum racun rumput,” ujar Sitepu. (roy/pmg/dro)

„ Jenazah korban disemayamkan di rumah duka.

Foto Roy

Nasib Lelaki ‘Kurang Kerjaan’ Sebagai anak Veteran, Samsul (35), memang lelaki pemberani. Sayang, dalam keanggotaannya di sebuah organisasi kepemudaan (OKP), keberanian itu kemudian melenceng, beraninya menyelingkuhi istri orang. Akhirnya, ketika Samsul harus mati dibunuh lelaki yang istrinya dikencaninya, terpaksa dirinya disebut oknum. Kenapa, sudah punya keluarga Samsul kok masih “kurang kerjaan” juga. Dalam urusan wanita, kaum lelaki memang sering menjadi lupa akan statusnya. Bupati Garut Aceng Fikri dan Deni Ramadani anggota DPRD Tasikmalaya, posisinya bisa terancam gara-gara soal syahwat terhadap perempuan. Padahal urusan syahwat itu nikmatnya tak seberapa, tapi sengsaranya bisa merembet ke mana-ma-

na. Yang celaka bukan dirinya saja, tapi juga keluarganya. “O, itu si Anu, yang bapaknya tukang selingkuh itu kan?” pasti begitu omongan orang. Agaknya oknum anggota OKP dari Palangkaraya (Kalteng) itu tak berpikir terlalu jauh ke sana. Begitu kenal dengan wanita cantik bernama

Amita, langsung saja theng….. pendulumnya kontak. Ketika berhasil didekati, amit-amit, ternyata Amita sudah punya suami. Tapi lantaran wanita itu naga-naganga memberi peluang, Samsul merasa sayang untuk melepaskannya. “Ingat Bleh, kesempatan itu datangnya hanya sekali, jadi jangan

kamu lewatkan,” begitu kata setan menyemangati diri. Diam-diam Samsul lalu pacaran dengan Amita. Lelaki warga Jalan Kalimantan Gang Mandau, Palangkaraya ini memang pemberani. Terbukti meski tidak punya surat Kuasa Pengguna Istri, dia berani mengajak Amita berbuat sebagaimana layaknya suami istri. Amita sendiri sudah kadung kesengsem pada Samsul, sehingga aspirasi urusan bawah oknum anggota OKP ini dimanjakan juga. Barang batil pasti takkan lama. Suami Amita begitu tahu istrinya dikencani lelaki lain, tentu saja marah besar. Belum lama ini dia nekad mendatangi rumah tinggal Samsul, tapi yang bersangkutan tidak ada. Akhirnya lelaki ini hanya berpesan, “Tolong kasih tahu suami ibu, jangan sekali-kali mengganggu Amita. Bagaimana pun juga dia adalah istriku.” Sang istri sudah mengingat-

kan jangan bermain api. Namun pada kesempatan itu Samsul membantah bahwa telah menjadi lelaki senior (senang istri orang). Untuk menutup kedoknya, Samsul bilang bahwa itu orang yang hanya cari-cari masalah macam pengacara pemula. Jadi kalau sang istri ingin tenang tak termakan isu, lebih baik berdoa menurut kepercayaan masing-masing. Ny Samsul pun berdoa penolak bala. Tapi ternyata warga hari berikutnya menyaksikan, saat bininya tak di rumah terlihat Samsul dikejar-kejar lelaki begolok. Belum juga sempat memberikan pertolongan, lelaki malang ini sudah terjengkang tewas akibat dibabat golok. Sang pembacok yang diduga suami Amita, hingga kini masih dalam pencarian polisi. Adapun keluarga Samsul terpaksa mencari TPU untuk pemakamannya. Buruk muka cermin dibelah. (int)



19 DESEMBER 2012

Parbetor Culik dan Cabuli Murid TK MEDAN- Bocah lima tahun sebut saja namanya Bunga, murid taman kanak-kanak (TK) warga Jalan Kiwi Medan Sunggal, diculik dan dicabuli tukang becak mesin (parbetor) SL (35), warga Jalan Sei Seguti, Medan Petisah, Jumat (14/12). Perbuatan SL terungkap ketika korban menceritakan peristiwa yang dialami kepada orangtuanya dan langsung melapor ke Polsek Medan Baru, Rabu (18/12). Data dihimpun POSMETRO MEDAN (grup METRO), sebelum pencabulan terjadi, korban bersama temantemanya sedang bermain di halaman sekolah TK yang beralamat di Jalan Darussalam. Kala itu, pelaku melintas dari depan sekolah dan melihat korban bermainmain. Melihat itu, pelaku menghampiri korban dan langsung membekap dan memaksa korban naik ke betor BK 1057 CO milik pelaku. Dengan cepat, pelaku mengendari betor ke kediamannya di kawasan Sei Seguti. Saat itu, kondisi rumah pelaku yang telah kosong dimanfaatkan untuk mencabuli korban. Pakaian seragam TK bermotif kotak-kotak abu-abu putih yang dikenakan korban dibuka pelaku secara paksa. Korban pun digauli dengan cara meraba-raba dan menciumi sekujur tubuh bocah perempuan itu. Tangisan korban pun tak dihiraukan pelaku yang kian beringas menjalankan aksi tak senonoh itu. Usai puas melampiaskan nafsunya, menggunakan betornya korban diantarkan pelaku ke kediamannya. Datangnya Bunga yang diantar parbetor, disaksikan beberapa warga sekitar termasuk neneknya. “Aku liat dia diantar sama tukang becak, tapi kami belum tahu apa masalahnya saat itu,” kata nenek korban ketika ditemui di Polsek Medan Baru. Di dalam rumah, Bunga pun terus diam. Namun diamnya Bunga membuat ibunya curiga, ditambah lagi tingkah korban yang takut melihat lakilaki. Kepada ibunya, korban menceritakan kejadian tersebut. Di luar dugaan, Bunga mengenali pelaku termasuk di mana kediaman pelaku. “Anakku takut sama orang, makanya pas kutanya dibilang dia dibawa bapak-bapak dari sekolahnya. Di situ lah aku langsung tanya sama dia apa yang terjadi, makanya kami lapor,” kata ibu korban yang enggan namanya dikorankan dan tampak terus memeluk putrinya itu. Korban pun diminta menunjukkan rumah pelaku.

Bermula dari sekolah di mana ia diculik secara perlahan tapi pasti Bunga menunjuk ke arah mana ia dibawa. Hingga akhirnya, kediaman pelaku ditemukan pada Senin malam sekitar pukul 19.00 WIB. Tak mau konyol, keluarga korban menghubungi petugas Polsek Medan Baru guna menangkap pelaku. Saat diamankan, SL yang telah beristri itu mengelak atas tuduhan tersebut. Namun Bunga dengan yakin menunjuk pelaku yang telah mencabulinya. Akhirnya, oleh petugas ia diamankan ke Polsek Medan Baru. Tampak pula Bunga pingsan di pelukan ibunya, ketika dipertemukan dengan pelaku. “Takut kali dia kayaknya, sampai pingsan,” kata salah satu kerabat korban. Masih menurut kerabat korban (paman, red), jika tertangkapnya pelaku setelah Bunga mampu menunjukkan arah kediaman pelaku, serta jaket coklat lusuh yang dikenakan pelaku. “Dari jaket itulah dia yakin pelaku, emang pintar anak itu. Dia juga bisa menunjukkan di mana rumah si pelaku, makanya kami ke sana. Kalau dari dia katanya dia diciumi sama dibuka pakaiannya sampai bugil, terus dia nangis,” kata paman korban yang menyatakan agar identitas keponakan dan dirinya tidak dibuat dengan alasan aib. Sementara, pelaku SL bersikeras tak mengakui perbuatannya. Bahkan, ia membantah semua tuduhan yang diberikan padanya dengan alasan saat kejadian dia sedang melayat bersama keluarganya. Hal itu dikatakan abang ipar pelaku, MS (45) yang mengatakan tidak mungkin adiknya melakukan tindakan tersebut. “Tidak mungkin itu. Adikku baik-baik orangnya. Kami tak terima dituduh begini. Mana buktinya,” katanya. Kapolsek Medan Baru Kompol Jean Calvijn Simanjuntak ketika dikonfirmasi mengatakan, jika pelaku masih diperiksa seraya menunggu hasil visum. Dia juga mengimbau agar orangtua dan pihak sekolah lebih berhati-hati. “Menunggu hasil visum ya, jika terbukti korban kita jerat U n d a n g - U n d a n g Perlindungan Anak pasal 81, 82 dengan ancaman lima tahun penjara. Kita harap orangtua dan pihak sekolah lebih berhati-hati,” ujarnya. Dia menambahkan, kasus pencabulan yang dilakukan parbetor kian marak. Maka dari itu, pihaknya akan terus berupaya menuntaskan kasus itu. (wel/pmg)

Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan : Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Janda Pemilik Kafe Modali Pembelian 9 Kg Ganja Sambungan Halaman 1 Informasi dihimpun METRO dari kepolisian, Amat Lubis ditangkap anggota Satnarkoba Polres Tapteng di Jalan Baru, Batu Mardinding, Kelurahan Bona Lumban, Kecamatan Tukka, persisnya di belakang rumahnya, Senin (17/12) sekira pukul 01.00 WIB. Lalu berdasarkan keterangan Amat, polisi kemudian menciduk Masria br Nasution, Senin (17/ 12) dini hari sekira pukul 02.30 WIB. Amat ditangkap memiliki sekitar satu kilogram daun ganja kering yang dibungkus di dalam plastik asoi warna hitam saat sedang menunggu pembeli di belakang rumahnya. Ganja satu kilogram tersebut, merupakan sisa dari sembilan kilogram ganja yang dibelinya dari Panyabungan, Madina awal bulan Desember lalu. Sedangkan Masria warga Sibolga Julu ditangkap berdasarkan keterangan Amat yang mengatakan, ganja tersebut dimilikinya dari seseorang berinisial PM (DPO). Masria merupakan pemodal PM untuk membeli ganja seberat sembilan kilogram dari Madina. Selain itu, saat diinterogasi

petugas, Masria juga mengaku mengetahui tempat penyimpanan ganja tersebut. Atas petunjuk wanita pemilik salah satu kafe di Jalan Baru, Tukka, ini polisi menyita satu unit timbangan yang dibungkus dalam plastik, yang di dalamnya juga berisi daun ganja kering, serbuk dan biji ganja. Kapolres Tapteng AKBP Misnan melalui Kasat Narkoba AKP K Nababan, Selasa (18/12) menuturkan, saat diinterogasi penyidik, tersangka Amat mengaku hanya sebagai kurir. Saat tertangkap tangan, ayah dari satu anak ini sedang menunggu dua orang pembeli berinisial RB dan BY yang sebelumnya memesan ganja tersebut melalui telepon. Namun belum sempat transaksi ganja dilakukan, Amat diringkus petugas. Nababan mengatakan, tersangka Amat mengaku mendapat ganja tersebut dari PM yang merupakan teman dekat Masria br Nasution. Amat yang mendapat pesanan dari RB dan BY, kemudian menghubungi PM. Lalu PM menyuruh seorang temannya berinisial AJ mengantarkan ganja tersebut ke rumah Amat. “Untuk mengembangkan kasus ini, kita melakukan

penyelidikan kepada para orang-orang yang terlibat. Namun yang berhasil kita ringkus selain tersangka Amat adalah Masria br Nasution di rumah kediaman saudaranya di Jalan AMD, Kelurahan Kalangan, Kecamatan Pandan, hari itu juga,” terang Nababan yang mengaku Polres Tapteng di bawah kepemimpinan AKBP Misnan tetap komit memberantas peredaran narkoba di wilayah hukumnya. Perwira dengan pangkat tiga balok kuning di pundaknya itu menerangkan, saat diinterogasi, tersangka Masria mengaku sebagai pemodal untuk membeli ganja tersebut dari Panyabungan. Sedangkan yang menjemput ganja adalah Amat. Tersangka Amat diberi upah Rp500 ribu atas suruhan PM. Hal ini juga di benarkan Amat, yang mengaku sudah dua kali menjemput ganja dari Panyabungan. Pertama yakni sebanyak delapan kilogram, dan yang terakhir ini sembilan kilogram. Semua ganja tersebut diserahkan kepada PM. Selain mengaku pemodal, Masria juga mengaku mengetahui tempat penyimpanan ganja tersebut yang kemudian mengarahkan petugas untuk menjemput sisa

Sintong Rambah Rotan Tak Sesuai Spesifikasi Izin Sambungan Halaman 1 jenis tersebut. Menyikapi keterangan saksi ahli yang terkuak dalam persidangan kemarin, Ketua LSM Pijar Keadilan Sumut Prins Wales Tambunan menilai bahwa Sintong bersalah. “Artinya Sintong telah merambah jenis rotan yang tidak sesuai dengan spesifikasi dalam izinnya, yakni rotan sega. Saya percaya itu akan menjadi pertimbangan majelis hakim dalam memutus perkara ini nantinya,” tukas Prins Wales Tambunan di halaman PN Sibolga, usai mengikuti sidang lanjutan perkara tersebut. Prins akan mengikuti terus perkembangan persidangan perkara Sintong tersebut. Dia berharap, supremasi hukum dapat berjalan dan berlaku dalam perkara itu. “Saya yakin masyarakat juga ingin ada ketegasan hukum dalam perkara ini. Sebab pada hakekatnya hukum berlaku sama kepada setiap warga negara,” tandas Prins. Sebelumnya, saksi ahli dari

Dinas Kehutanan dan Perkebunan Tapteng Amran mengatakan, dirinya telah menerima laporan hasil produksi (LPH) dari UD Eko Berdikari (milik Sintong, red) sebanyak 32 kali atau sebanyak 870 ton. Itu merupakan batas volume pengambilan rotan sega sesuai yang tertera dalam surat Izin Pemungutan Hasil Hutan Bukan Kayu IPHHBK No 155 Tahun 2003 yang dimiliki UD Eko Berdikari. “Yang 870 ton rotan sega itu telah dipungut seluruhnya,” tandas Amran dalam kesaksiannya di hadapan majelis hakim kemarin (17/ 12). Lalu, masih Amran, UD Eko Berdikari memperoleh perpanjangan IPHHBK pada tanggal 28 Maret 2005 dengan jenis rotan yang bisa diambil yakni rotan manao, semambo dan cacing. Sementara jenis rotan sega tidak termasuk di dalamnya. Artinya, UD Eko Berdikari tidak bisa lagi merambah rotan sega. “Untuk izin yang kedua, yakni tahun 2005, UD Eko Berdikari sudah tak lagi bisa memungut rotan sega. Karena sesuai IPHHBK tahun 2005 itu hanya boleh mengambil rotan Manao, semambo dan cacing,” terang Amran. Senada diungkapkan saksi ahli kedua, Ir M Arsad Hasibuan, juga dari Dinas Kehutanan dan Perkebunan Tapteng. Arsad adalah pejabat yang menerbitkan Surat Perintah Pembayaran (SPP) atas Provisi Sumber Daya Hutan (PSDH). Dalam kesaksiannya, Arsad menerangkan, dirinya menerbitkan SPP untuk UD Eko Berdikari berdasarkan surat IPHHBK yang berlaku 1 Desember 2003 hingga 30 November 2004, dengan jenis rotan banau, semambo, sega, getah dan rotan cacing. “Tapi, setelah masa izin tersebut berakhir, UD Eko Berdikari kembali mendapat perpanjangan IPHHBK tanggal 28 Maret 2005 dengan jenis rotan yang bisa diambil yakni manao, semambo dan

Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana:... Kordinator Liputan Ridwan Butarbutar, Asisten Kordinator Liputan (Bonapasogit): Horden Silalahi. Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Marihot Simamora, Freddy Tobing, Milson Silalahi, Masril Rambe (koresponden barus), Jonter (Humbahas), Bernard Lumbangaol, Hengki Tobing (Taput), Hermanto Turnip. METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Pala Silaban, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Candro Purba, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina)

cacing,” tukas Arsad dalam kesaksiannya. Sementara itu saksi ahli ketiga, Pandapotan Lubis juga dari Dinas Kehutanan dan Perkebunan Tapteng menerangkan, rotan yang menjadi barang bukti dalam perkara itu adalah rotan sega. Di mana pada tahun 2006 lalu, dirinya bersama Bernat Situmorang, rekannya di Dinas Kehutanan dan Perkebunan Tapteng, diminta Polres Tapteng untuk mengukur dan menguji barang bukti rotan yang disita. “Sesuai penelitian kami pada hari Jumat, 17 Februari 2006, rotan tersebut adalah rotan sega. Hal itu kami tahu dari warna, diameter, dan juga lubang pori rotan tersebut. Rotan sega yang kami teliti saat itu sebanyak 3.543 batang. Hasil pemeriksaan kami tuangkan dalam berita acara pemeriksaan,” kata Pandapotan yang mengaku telah memiliki sertifikasi penelitian rotan. Menanggapi keterangan saksi ahli itu, terdakwa Sintong Gultom menuding bahwa saksi ahli Pandapotan Lubis berbohong. Sebab menurutnya rotan yang dipungut Kao Harefa (anak buah Sintong, red) dan menjadi barang bukti di persidangan bukanlah rotan sega. Melainkan rotan getah. Dan jumlahnya sebanyak 6.250 batang. “Dia berbohong. Yang diambil Kao Harefa itu bukan rotan sega, tapi rotan getah,” bantah Sintong dalam persidangan yang dipimpin oleh ketua majelis hakim Marper Pandiangan SH MH itu. Sidang lanjutan perkara ini akan digelar kembali besok (Kamis, 20/12), dengan agenda pemeriksaan saksi-saksi lainnya. Dalam menjalani perkara ini Sintong Gultom tidak ditahan. Namun politisi Demokrat itu dinonaktifkan sementara dari jabatannya sebagai Ketua DPRD Tapteng hingga ada keputusan yang tetap. (fred/mora)

ganja yang ditanam di Bukit Sibolga Julu persisnya di dalam tumpukan sampah. Namun sisa ganja hanya tinggal sekitar lima gram beserta satu unit timbangan yang digunakan untuk mengukur berat ganja yang akan dipasarkan. “Timbangan beserta ganja itu kemudian kita sita. Dan kedua tersangka kita amankan dan ditahan di RTP Mapolres Tapteng guna penyelidikan selanjutnya. Sedangkan PM kita tetapkan masuk daftar pencarian orang (DPO),” pungkas Nababan menerangkan. Amat yang diwawancarai di ruang penyidik mengaku hanya sebagai kurir untuk membayar utangnya kepada Masria sebesar Rp1 juta yang dipinjamnya untuk kebutuhan keluarganya. Hal itu juga dibenarkan Masria. Namun Masria mengaku tidak pernah meminta Amat sebagai kurir, justru pria yang berprofesi sebagai buruh bangunan ini

sendirilah yang memintanya. “Karena Amat minta tolong, uang tersebut saya pinjamkan. Namun untuk kegiatan sebagai kurir ini Amat sendirilah yang meminta, bukan atas permintaan saya. Nantinya uang agen tersebut akan dipotongkan langsung dengan utangnya yang Rp1 juta itu,” terang janda dari tiga anak ini saat diwawancarai bersama Amat di ruang penyidik, Selasa (18/12). Ditanya seberapa lama hal ini dilakukan, Masria mengaku baru terlibat sebagai pemodal hanya untuk dua kali pembelian ganja dari Panyabungan. Hal itu juga atas permintaan PM (yang dimodali Masria, red) yang merupakan teman dekatnya tersebut. Kepada kedua tersangka, dengan berkas terpisah, dijerat Pasal 114 ayat 1, subsider Pasal 111 ayat 1 UU RI Nomor 35 Tahun 2009 tentang Narkotika, dengan ancamat di atas lima tahun penjara. (fred)

Pak Lurah Poligami, Istri Pertama Ngadu ke Bupati Sambungan Halaman 1 SKN yang ditemui METRO di BKD Tapsel, Jalan Kenanga, Kota Padangsidimpuan (Psp), menyebutkan, surat pengaduan kepada Bupati Tapsel Syahrul Pasaribu bertujuan untuk meminta keadilan atas segala tindakan suaminya. Dalam surat pengaduan itu, terang SKN, dituliskan bahwa mulai 5 April 2012, suaminya (HH) telah pergi tanpa pemberitahuan. Dan, sejak kepergian HH, ia dan dua anaknya tidak pernah diberi nafkah. Hingga kini, komunikasinya dengan HH terputus total. Ironisnya, HH meninggalkan utang di salah satu bank, yang hingga saat ini selalu ditagih pihak bank dan dianggap menjadi tanggung jawabnya. “Atas permasalahan utang ini, saya melaporkannya kepada Camat B, selaku atasan suami saya. Lalu, camat mencoba memediasi. Hasil mediasi, suami saya berjanji akan membayar seluruh utang piutang dengan menjual sebagian harta kami. Namun, suami saya diam-diam telah menjual sebagian harta yang kami peroleh selama berumah tangga, dan hasil penjualan bukannya digunakan untuk membayar utang melainkan untuk pribadi,” bebernya kesal. SKN menambahkan, hingga saat ini ia dan HH masih resmi berstatus suami istri. Sebab, proses perceraian masih berlangsung. Pasangan yang menikah pada tahun 1987 lalu ini, telah menjalani persidangan sebanyak delapan kali. Dan, selama proses berlangsung, suaminya hanya hadir dua kali, yakni persidangan pertama tanggal 19 Juni 2012 serta mediasi tanggal 26 Juni 2012. “Anehnya pada sidang ke delapan ini, Selasa (18/12), majelis hakim menyatakan bahwa gugatan cerai sudah dicabut HH, makanya saya tambah bingung,” ujarnya berkaca-kaca. Ditambahkan SKN, sejak HH pergi, ia sudah tidak aktif lagi melaksanakan tugasnya sebagaimana seorang PNS. Hal ini dibuktikannya dengan melampirkan fotokopi absensi

METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Hotlan Doloksaribu Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani

suaminya. Namun, meski sejak April tidak pernah melihat suaminya di rumah dan kantor, HH tetap menerima gaji setiap bulan. “Selain itu, HH telah poligami dengan menikahi perempuan berinisial EEH. Atas poligami ini, saya tidak pernah memberikan dan membuat izin baik secara lisan maupun tulisan atas pernikahan mereka,” sebutnya. SKN menjelaskan, informasi yang didapatnya, pernikahan mereka dilakukan di Sumatera Barat, tepatnya di Kabupaten Sijunjung. Hal ini dikuatkan dengan penyataan dan pengakuan yang bersangkutan kepada saudara dan kerabat yang bersangkutan. “Suami saya pernah mengaku kepada GS. Lalu, kepada IS pada tanggal 20 Agustus 2012 bertepatan Hari Raya Idul Fitri. Suami saya membawa perempuan tersebut beserta enam anaknya ke rumah IS di Desa Sirongit, Kecamatan Angkola Sangkunur. Pada hari itu juga, suami saya dan EEH berkunjung ke rumah GAH di Dusun Tiga Dolok, Kelurahan Simataniari, Kecamatan Angkola Sangkunur,” bebernya. SKN menjelaskan, apa yang dilakukan suaminya telah melanggar UU Nomor 1 Tahun 1974 tentang pernikahan, PP Nomor 10 Tahun 1980 junto PP Nomor 45 Tahun 1990 tentang Izin Perkawinan dan Perceraian Pegawai Negeri Sipil. Dan, atas segala kejadian yang menimpanya, ia bermohon kepada Bupati Tapsel Syahrul Pasaribu agar menanggapi pengaduannya, sehingga permasalahan itu bisa diselesaikan sesuai dengan ketentuan yang berlaku. “Saya bersedia memberikan informasi tambahan apabila Pak Bupati membutuhkan. Saya harap persoalan ini bisa segera diselesaikan,” harapnya usai mengantarkan surat pengaduan ke Subbag Rumah Tangga Kantor Bupati Tapsel dan BKD Tapsel. Sekadar informasi, SKN juga menembuskan surat pengaduannya kepada Ketua DPRD Psp, Kepala BKD Psp, Kepala Inspektorat Psp dan Camat B. (phn)

Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli: Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon,Tamy Arfandhi (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



19 Desember 2012

Pemkab dan BI Bantu Peternak Ayam Broiler Sambungan Halaman 8 Bupati Tapteng Raja Bonaran Situmeang mengatakan, Pemkab hingga kini tetap concern melaksanakan proses pembangunan di segala bidang terutama yang menyentuh kepada kepentingan masyarakat banyak. “Tapteng saat ini terus berbenah untuk menjadi lebih baik, termasuk pembangunan yang bertujuan untuk menunjang perekonomian masyarakat juga telah dilakukan. Kita mengetahui bahwa mayoritas penduduk di Tapteng adalah masyarakat petani dan nelayan. Oleh karenanya, pembangunan di sektor ini juga tak luput dari perhatian pemerintah,” ungkap Bonaran di acara pelatihan sekaligus pemberian bantuan kepada 100 orang peternak ayam broiler, Selasa (18/12) di Graha Aulia KBI Sibolga. Pada kesempatan ini, sebut Bonaran, Pemkab baru dapat memberikan bantuan berupa bibit ayam broiler sebanyak 11.000 ekor beserta pakan ternak sebanyak 16,3 ton yang dananya ditampung melalui APBD TA 2012. Sedangkan kandang ayam sebanyak 10 unit diberikan oleh Bank Indonesia. “Mudah-mudahan pada kesempatan berikutnya, bantuan dapat kita tingkatkan lagi,” tuturnya. Bupati berharap melalui bantuan tersebut, perekonomian masyarakat peternak ayam broiler dapat meningkat menjadi lebih baik, seraya mengimbau agar serius mengikuti pelatihan menyangkut tata cara beternak ayam yang baik dalam rangka meningkatkan hasil produksi. “Kami meminta kepada para peternak ayam broiler di Tapteng, jangan menyia-nyiakan kesempatan pelatihan ini. Manfaatkan sebaik-baiknya demi mencapai keberhasilan yang pada gilirannya nanti dapat meningkatkan perekonomian warga,” imbuh Bonaran. Deputi Direktur BI Kantor Perwakilan Sibolga Yiyok T Herlambang mengatakan, kegiatan pelatihan sekaligus dirangkai pemberian bantuan kepada 100 orang peternak ayam broiler di Tapteng yang terbagi dalam 10 kelompok, merupakan salah satu bukti bahwa BI Sibolga bersama perbankan turut peduli terhadap kelangsungan usaha peternakan ayam broiler di daerah ini. “Dalam pelatihan ini, kita menghadirkan narasumber berpengalaman di bidangnya dari Charoen Pokphan Indonesia Medan, sehingga kita berharap hasil produksi ayam broiler di Tapteng pada masa mendatang terus meningkat dalam rangka melayani permintaan dan kebutuhan masyarakat akan komoditi ini,” sebut Yiyok. Menurut Yiyok, usaha peternakan ayam broiler memiliki prospek bisnis yang cerah dan cukup menjanjikan. Sebab, permintaan masyarakat setiap tahunnya terus mengalami peningkatan. Saat ini, kebutuhan ayam broiler untuk masyarakat Sibolga dan Tapteng sedikitnya mencapai 4 ton per hari, sementara hasil produksi dari peternak ayam broiler di Tapteng hanya mampu menghasilkan 1 ton per hari. “Artinya, Sibolga dan Tapteng masih kekurangan pasokan ayam broiler sebanyak 3 ton per hari yang didatangkan dari daerah luar, seperti Medan dan lainnya. Oleh karenanya, Bank Indonesia beberapa waktu lalu telah mengusulkan kepada Pemkab Tapteng untuk membangun perkampungan peternak ayam pedaging (broiler) di Tapteng,” beber Yiyok seraya mengapresiasi kepedulian Bupati Tapteng Bonaran Situmeang terhadap peternak ayam broiler. Terpisah, Kadis Pertanian dan Peternakan Tapteng Dompak Simanjuntak mengatakan, total bantuan yang diberikan kepada peternak ayam broiler tersebut mencapai Rp200 juta lebih. Dana itu digunakan untuk pengadaan bibit ayam broiler sebanyak 11.000 ekor dan pengadaan pakan ternak sebanyak 16,3 ton. Sementara itu, Konsultan BI Sibolga Sulaiman mengatakan, untuk pembangunan sebanyak 10 unit kandang ayam yang diberikan kepada 10 kelompok peternak ayam broiler di Tatpeng, BI Sibolga menggelontorkan dana sebesar Rp310 juta. (tob)

Lanal Siagakan Tiga Kapal Patroli Sambungan Halaman 8 Combat Boat Type X-8 Cataraman memiliki kecepatan jelajah maksimal 40 knot juga dilengkapi senapan mesin jenis M240 Kaliber 7,62 atau M60 Kaliber 7,62 dan dapat diganti peluncur Granat Kaliber 40 mm. Kapal cepat yang diawaki empat personel tersebut mampu mengangkut hingga 20 orang dengan persenjataan lengkap. “Ini semua akan kita siagakan dan secara rutin setiap hari melakukan patroli di lokasi keramaian sekaligus pemeriksaan terhadap kapal-kapal yang diduga akan melakukan aktivitas illegal fishing, salah satunya dengan menggunakan bahan peledak,” beber Arief. Arief menambahkan, pihaknya juga turut menyiagakan sekaligus

Akibatnya, ban depan bus Pinem itu terangkat dan supir membanting setir ke arah kanan, bersamaan dari arah berlawanan, datang sebuah bus KPB trayek Kota Pinang-Medan yang sedang melaju kencang, hingga tabrakan pun tak dapat terhindarkan. “Bus Pinem melaju dari arah Kota Medan menuju Rantauprapat, sedangkan bus KPB melaju dari arah Rantauprapat menuju Kota Medan. Tabrakan terjadi ketika bus Pinem menghantam pembatas jalan, bus Pinem terjungkal dan supir membanting setir ke arah kanan hingga menabrak bus KPB yang datang dari arah berlawanan,” kata Kasat Lantas Polres Labuhanbatu AKP Faidil didampingi Kanit Patroli Satlantas Iptu H Limbong Zikri saat berada di lokasi kejadian. Dijelaskan Zikri, supir bus KPB, Syaiful (40), warga Kota Pinang Kabupaten Labusel dan seorang penumpang wanita yang belum diketahui identitasnya meninggal di tempat kejadian. “Ada dua korban tewas di tempat, seorang supir dan seorang penumpang bus KPB. Namun hingga kini identitas jenazah penumpang berjenis kelamin perempuan itu belum kita ketahui, dan masih berada di kamar jenazah RSU Rantauprapat,” terang Zikri. Sementara 24 orang lainnya, yang merupakan penumpang bus Kota Pinang Baru yang mengalami luka-luka yakni Ari (17) warga Perbaungan, Sugito (35) warga Indrapura, Koko (44) warga Rantauprapat, Isma Yulia (17) warga Kota Pinang, Kartika (21) warga Medan, Ismail (21) warga Rokan Hilir. Selanjutnya Sri Trisnawati (26) warga

saan, pihak patroli Lanal Sibolga memberangkatkan kembali kapal tersebut, karena tidak berhasil menemukan bukti pelanggaran yang dilakukan oleh kapal ikan itu,” ungkap Arief. Sementara itu, pihak Kepolisian Air dan Udara (Pol Airud) Sibolga juga turut meningkatkan patroli di tengah laut menjelang Natal dan tahun baru ini. Tujuannya, selain meminimalisir sekaligus mencegah terjadinya kasus kriminal berupa illegal fishing, illegal logging dan tindak kejahatan lainnya, juga untuk memberikan pengamanan bagi warga yang melakukan perayaan hari besar Natal dan tahun baru. “Kita sekarang juga tengah meningkatkan operasi rutin di tengah laut,” kata Kepala Satuan (Kasat) Polairud Kapten J Sitopu. (tob)

BKKBN Operasi Tubektomi 45 Wanita

Sambungan Halaman 8

tomi ini sebanyak mungkin, namun yang mendaftar hanya 45 orang dan kepada peserta tidak dipungut biaya apapun. “Sasaran kegiatan ini adalah warga Sibolga, di mana mereka diharapkan untuk meningkatkan akseptor KB di Sibolga. Sehingga angka kelahiran di Sibolga bisa ditekan dan pertambahan penduduk bisa menurun sehingga program KB itu bisa berjalan baik,” beber Welmansen seraya mengatakan kegiatan ini akan diupayakan setiap tiga bulan sekali dilakukan. Kegiatan operasi ini, sambungnya, merupakansalahsatujeniskontrasepsi yakni MKJP (metode kontrasepsi jangkapanjang)yangterdiridariMOW, MOP untuk pria, IUD dan implant.

“Untuk kontrasepsi bagi pria juga ada yang dinamakan MOP (Medis Operasi Pria) dengan sistem kontrasepsi Mantap yang dilaksanakan setiap hari dengan cara melaporkannya pada Kader KB (PPKBD) sub PPKBD (Pembantu Pembinaan KB Desa),” tukas Welmansen seraya mengatakan operasi tubektomi ini dilayani oleh tim dokter dari Medan. Medis Operasi Wanita (MOW), sambungnya, merupakan operasi yang dilakukan pada wanita untuk mencegah terjadinya kehamilan, yaitu mengikat saluran telur agar wanita itu tidak dapat mempunyai anak lagi. “Operasi untuk mengambil rahim atau indung telur dengan tujuan memberikan perlindungan agar wanita tidak mempunyai anak lagi. Yang dicatat sebagai sterilisasi di sini hanya operasi yang ditujukan agar seorang

wanita tidak bisa mempunyai anak lagi,” terang Welmansen. Wali Kota HM Syarfi Hutauruk mengatakan KB dengan MKJP ini dapat menurunkan laju pertumbuhan penduduk dan meningkatkan derajat kesehatan ibu. “Permasalahannya, selama ini masyarakat belum memahami metode tersebut secara jelas sehingga jumlah pesertanya minim. Namun metode ini bertujuan untuk menekan laju pertumbuhan penduduk karena sifatnya jangka panjang, berbeda dengan metode hormonal,” ungkapnya lantas menambahkan pihaknya mendukung adanya revitalisasi program kependudukan dan KB serta berharap agar masyarakat terdorong untuk menerapkan metode KB MKJP sehingga laju pertumbuhan penduduk bisa ditekan. (son/tob)

Pemko Gelar Lomba Suami Menghias Istri Sambungan Halaman 8 menggelar beragam kegiatan, di antaranya lomba suami menghias istri. “Lomba suami menghias istri digelar pada puncak acara yaitu, Jumat (21/12) di Lapangan Simaremare. Usai menghias istri, acara dilanjutkan pertandingan sepak bola antar pimpinan SKPD, kabag

dan camat, mengenakan baju daster (baju istri),” ungkap Kabag Humas Pemko Srasamaluddin Nasution kepada METRO, Senin (17/12). Sebelumnya, panitia juga akan menggelar lomba tarian tortor di lapangan Simaremare, Kamis (20/ 12). Tahun ini, sambung Srasamaluddin, puncak acara peringatan Hari Ibu dan DWP Sibolga juga dirangkai dengan peringatan Hari

Nusantara yang digelar Dinas Kelautan Perikanan dan Peternakan (DKPP) Sibolga. Pada peringatan Hari Nusantara itu, Pemko Sibolga melalui DKPP akan menyerahkan bantuan alat tangkap ikan kepada sejumlah kelompok nelayan di Sibolga. Bantuan tersebut nantinya diserahkan langsung oleh Wali Kota HM Syarfi Hutauruk. (tob)

Dinkes Rayakan Natal Bersama SIBOLGA- Memperingati hari kelahiran Tuhan Yesus Kristus, seluruh pegawai Dinas Kesehatan Sibolga melaksanakan perayaan Natal bersama, bertempat di pelataran kantor Dinkes Sibolga, Jumat (14/12) lalu. Wali Kota HM Syarfi Hutauruk dalam sambutannya mengatakan,

Lakalantas Maut, Dua Tewas, 24 Luka-luka Sambungan Halaman 1

mengintensifkan seluruh personel TNI AL yang bertugas di Poskamla di bawah naungan Lanal Sibolga. Para petugas di Poskamla juga telah diinstruksikan untuk senantiasa siaga dan tetap melakukan operasi rutin selama perayaan hari besar Natal dan tahun baru. Serangkaian kegiatan operasi rutin pengamanan Natal dan tahun baru yang telah dimulai tersebut, Lanal Sibolga, Selasa (18/12) dini hari sekira pukul 05.00 WIB memeriksa satu unit kapal penangkap ikan saat akan memasuki perairan Tapteng. Pemeriksaan dilakukan untuk mengetahui apakah kapal tersebut selama kegiatan melakukan aktivitas penangkapan secara ilegal atau tidak. “Setelah dilakukan pemerik-

Kota Pinang, Takwa (21) warga Medan, Johannes Ginting (28) warga Medan, Sri (32) warga Kota Pinang, Butet (19) warga Kota Pinang, Riosha Novita (16) warga Kota Pinang, Hilman Simanjuntak (52) warga Tebing Tinggi, Rosmaida (42) warga Tebing Tinggi, Lonaki Sembiring (34) warga Tebing Tinggi. Kemudian Fransiska (17) warga Pekanbaru, Nesima (64) warga Perbaungan, Putri (26) warga Kota Pinang, Lindawati (28) warga Kota Pinang, Anita (39) warga Blok Songo Kota Pinang, Adita Peranginangin (24) warga Medan, Amrin (27) warga Asahan, Rukita (41) warga Kota Pinang, Pasha (11) warga Kota Pinang. “Mereka yang luka-luka sebagian masih dirawat di RSU Rantauprapat dan sebagian sudah kembali pulang,” kata Zikri. Sementara menurut penuturan dari masyarakat sekitar, pembatas jalan di Jalinsum Desa Janji berpotensi mengakibatkan kecelakaan lalu lintas. Pasalnya, pembatas jalan tersebut berada persis di atas puncak jalan menanjak hingga sering tidak terlihat para supir jika melaju dengan kecepatan tinggi. “Letaknya persis berada di puncak tanjakan. Wajarlah kalau bus Pinem itu menabrak benda itu, karena kalau dari bawah tidak kelihatan,” kata Tono (31), warga Desa Janji, Kecamatan Bilah Barat. Ditambahkan Tono, pihaknya berharap Pemkab Labuhanbatu segera melakukan perbaikan letak pembatas jalan agar tidak menjadi ancaman keselamatan bagi pengendara. “Dishub jangan asal-asal saja pasang pembatas tanpa ada rambu-rambu yang jelas. Kalau sudah kejadian, masyarakat juga yang menjadi

Natal mempunyai arti khusus untuk mengenang kembali kelahiran Yesus Kristus sekitar 2000 tahun yang lalu dan juga sebagai upaya pembaharuan iman, cinta kasih sesama manusia dan kesederhanaan. “Namun Natal bukan hanya untuk umat Kristiani saja, namun juga bagi

umat beragama lainnya. Artinya, semangat kelahiran baru itu tidak hanya dalam bentuk visual bayi Yesus, namun terpenting adalah dalam sikap dan perilaku kita di masyarakat, khususnya dilingkungan Dinas Kesehatan Sibolga,” ujar Syarfi. (son/tob)

FKUB Sibolga Rapat Koordinasi Sambungan Halaman 8 Rapat dibuka Wali Kota HM Syarfi Hutauruk diwakili Asisten III Sofian Nasution, dihadiri Sekretaris Umum FKUB Sumatera Utara Pdt Dr Elib Simamora, mewakili dewan penasehat, Kakan Kemenag Sibolga Ilham Pasaribu, Ketua FKUB Sibolga Sarmadan Daulay, Uskup Keuskupan Sibolga Mgr Ludovikus Simanullang, mewakili PGI Sibolga Pdt Aratua Oppusunggu, mewakili MUI Sibolga H Nurdiswar B Jambak, Ketua BKAG Sibolga Pdt Nababan, pengurus dan anggota FKUB Sibolga. Walikota HM Syarfi Hutauruk dalam sambutan tertulisnya dibacakan Sofian Nasution berharap, kondusifitas keamanan di Sibolga tetap terpelihara dengan baik. Pemko juga berharap para pemuka agama lebih mengoptimalkan perannya sebagai penyampai firman Tuhan di masjid, gereja, dan vihara kepada jamaahnya. Dia juga berharap FKUB Sibolga dapat berperan aktif melakukan dialog antar agama dalam upaya penyelesaian masalah yang berpotensi mengganggu terciptanya kerukunan antar umat beragama. Ketua FKUB Sibolga H Sarmadan Daulay mengatakan, setiap akhir tahun FKUB Si-

bolga menggelar rapat evaluasi dan dialog bersama dewan penasehat, tokoh agama, masyarakat, pemuda, dan guru-guru agama. “Tujuannya untuk mengaveluasi sejauh mana pembinaan dan program yang telah dilakukan FKUB di Sibolga, sekaligus menerima masukan dari peserta demi peningkatan pembinaan terhadap kerukunan antar umat beragama di Sibolga pada tahun mendatang,” katanya. Pembinaan yang dilakukan FKUB Sibolga selama ini, sudah sampai ke sekolah-sekolah untuk memberikan penyuluhan bahaya penggunaan narkoba. Tujuannya agar anak-anak usia sekolah terhindar dari menyalahgunakan narkoba. Mewakili dewan penasehat, Ilham Pasaribu mengatakan, dewan penasehat salut dan bangga kepada FKUB Sibolga, karena selama ini FKUB sudah banyak melakukan kegiatan dalam rangka pembinaan terhadap umat beragama di Sibolga. Sekretaris Umum FKUB Sumatera Utara Pdt Dr Elib Simamora selaku narasumber mengatakan, upaya kerukunan antar umat beragama harus tetap dilakukan, jangan saling mencurigai, tetapi harus dapat hidup rukun dan damai. (tob)

Hari Ini, ASWAL Gelar Natal Sambungan Halaman 8 hidup dalam damai di tengah masyarakat serta bersatu untuk membangun. Hal itu sesuai sub thema Natal yang kita ambil berdasarkan thema dari Yohannes 16: 33. Kita harapkan juga dengan perayaan Natal ini nantinya dapat semakin menumbuhkan keimanan dan kepercayaan bagi insan pers dan LSM Sibolga-Tapteng yang berbeda media dan lembaga semakit erat untuk ke depannya,” ungkap ketua panitia Edward Siahaan didampingi sekretaris Juan Feri Lumbangaol, bendahara Lenni F Siagian di Sibolga, Selasa (18/ 12). Pada kesempatan itu, secara keseluruhan panitia Natal ASWAL Sibolga-Tapteng mengundang dan berharap agar seluruh anggota ASWAL Sibolga-Tapteng dan juga warga untuk datang menghadiri dan memeriahkan acara Natal yang digelar. “Kita berharap anggota ASWAL Sibolga-Tapteng bersama keluarga dapat berkenan hadir. Demikian juga dengan

warga,” pungkas Edward. Senada itu, sekretaris pengurus DPD ASWAL Juliater Simaremare mengatakan, sasaran perayaan Natal ini adalah untuk membangun silaturahmi antara wartawan, LSM dan juga masyarakat. “Kita harapkan para wartawan dan LSM serta seluruh undangan yang hadir nantinya dapat semakin bersatu untuk membangun Sibolga dan Tapteng yang kita cintai ini,” tukasnya. Dia juga menyampaikan uncapan terima kasih kepada Pemko Sibolga dan juga Pemkab Tapteng yang telah turut mendukung perayaan Natal ASWAL ini. “Tidak lupa kami mengucapkan terima kasih kepada para donatur yang telah memberikan sumbangan moril dan doa. Kiranya perayaan Natal ini bisa berlangsung dengan baik dan kita semua dapat menikmati dan merasakan sukacita Natal melalui perayaan Natal ASWAL Sibolga-Tapteng ini nantinya,” tandas Lenni F Siagian. (fred)

Tiap Bulan Terima Murid Remaja Korban KTD Sambungan Halaman 1 berbadan dua. “Bukan hanya angka KTD yang tinggi, pernikahan usia dini di desa saya juga paling banyak di Jawa Timur,” paparnya. Siti mengungkapkan, di Ploso, remaja putri 12 tahun sudah lazim berpacaran. Hampir setiap hari si pacar apel ke rumah si gadis ingusan itu. Bahkan, tak jarang si pacar sampai tidur di rumah gadis idamannya. Hal seperti itu dianggap biasa oleh warga. “Ya gimana ndak hamil, wong setiap hari diapeli sampai nginep-nginep segala. Saya pernah curhat ke Pak Lurah, tapi nggak ada tindak lanjutnya,” urai Siti. Yang makin membuat Siti heran dan prihatin, orang tua pihak perempuan seperti membiarkan anaknya berpacaran kelewat batas. Akibatnya bisa ditebak, si remaja putri akhirnya hamil. “Ironis, wong sejak awal pacaran mereka (orang tua) tahu dan seolah membiarkan pacar anaknya sampai menginap segala, kok pas anaknya hamil mereka nggak percaya. Bahkan kemudian bingung dan marahmarah,” ujarnya. Lantaran budaya pacaran yang permisif tersebut, Siti jadi terbiasa menerima kabar adanya remaja putri yang hamil di desanya. Bahkan, untuk jumlah kehamilan di desanya, separo di antara mereka pasti remaja putri yang hamil baru. Dan begitu mendapat kabar adanya remaja yang hamil tersebut, Siti bergegas menuju rumah si remaja. “Biasanya orang tua dan anaknya amat malu dengan kondisi itu. Mereka lalu enggan memeriksakan kehamilan anaknya. Karena itu, saya ngalahi untuk mendatangi rumah mereka. Kalau ada

lima remaja yang hamil bersamaan, ya saya datangi satu per satu mereka,” ungkap bidan dari Nganjuk tersebut. Menurut Siti, kehamilan pada usia belia cukup berisiko. Organ reproduksi mereka belum benar-benar siap menerima janin. Tidak hanya itu, pengetahuan yang minim akan gizi ibu hamil menjadi persoalan di desa tersebut. “Masih banyak yang nggak paham soal gizi ibu hamil. Mereka umumnya kurus-kurus. Bahkan, ada yang sampai mengalami kurang energi kronis (KEK). Akibatnya, berat badan bayi waktu lahir rendah,” ujarnya. Sejumlah mitos yang berkembang di masyarakat Desa Ploso juga cukup menyulitkan penanganan perempuan hamil usia belia. Misalnya, perempuan hamil tidak boleh tidur siang. Mereka juga tidak boleh makan telur. “Katanya nanti amis, matanya jadi rabun,” ucap Siti. Selain itu, masyarakat setempat lebih percaya pada dukun daripada bidan atau dokter. Tentu saja mitosmitos tersebut merugikan para perempuan hamil belia itu. Prihatin atas kondisi masyarakat Desa Ploso yang masih ‘terbelakang’ itu, Siti menggagas kelas hamil bagi perempuan desanya. Seluruh perempuan yang hamil diajari hal-hal yang terkait dengan kesehatan janin serta persiapan persalinan yang matang. Tak seperti kelas hamil yang dianjurkan pemerintah (dengan ‘murid’ 10 ibu hamil), kelas hamil gagasan Siti mengundang semua ibu hamil di desanya. Karena itu, tak heran bila setiap pertemuan ada 25-30 ibu hamil yang datang. Di antaranya adalah para remaja korban KTD dan remaja yang nikah dini. “Peserta kelas hamil ini tidak dibatasi

usia kehamilan. Perempuan yang hamil muda semestinya ikut kelas ini biar cepat tahu cara menangani kandungannya. Apalagi bagi para remaja putri yang telanjur berbadan dua itu,” tegas Siti. Hanya, tidak mudah mengajak para remaja yang hamil untuk bergabung di kelas hamil. Ada yang malu aibnya diketahui banyak orang. Ada yang enggan dan sungkan bertemu ibu-ibu yang hamil normal. Menghadapi kondisi itu, Siti tidak tinggal diam. Dia lalu mendatangi satu per satu calon ibu belia tersebut. Dia berusaha merayu agar mereka mau mengikuti kelas hamil. Usahanya tidak percuma. Kini seluruh remaja yang hamil di desanya secara rutin mau bergabung di kelas hamil binaannya. Sebelum kelas dimulai, Siti biasanya memeriksa kehamilan setiap ‘murid’nya. Termasuk cek HB (hemoglobin) dan gizi si murid. Khusus bagi remaja hamil usia belia, Siti memberikan perhatian ekstra. Dia perlu mengedukasi mereka mulai soal makanan, persiapan persalinan, hingga pasca melahirkan. “Saya biasanya bilang kepada mereka betapa beratnya orang yang sedang hamil. Belum lagi bila anaknya lahir nanti. Tapi, saya juga mengatakan, mereka harus bisa merawat anaknya dengan baik agar kelak anaknya jadi orang sukses,” papar Siti. Di kelas hamil itu, dia juga mengajak serta para suami dan keluarga ibu hamil. Mereka mengikuti sesi khusus agar tahu cara menjaga kehamilan serta kesehatan ibu dan janinnya. “Supaya mereka paham bahwa ibu hamil itu susah. Jadi, mereka tidak boleh menyuruh istri atau anaknya yang tengah hamil untuk kerja berat,” tandasnya.

Dua tahun berjalan, kelas hamil yang digagas Siti menunjukkan perkembangan signifikan. Misalnya, kini jumlah ibu hamil KEK berkurang. Begitu juga kelahiran BBLR (berat bayi lahir rendah) yang menurun drastis. Berkat kerja keras dan perjuangannya mendidik ibu hamil di desanya tersebut, Siti menjadi nomine Srikandi Award 2012. Penghargaan itu diadakan untuk mengapresiasi para perempuan hebat pada setiap peringatan Hari Ibu. “Saya sangat bangga dikirim ke Jakarta. Semoga kalau saya menang, hadiahnya bisa bermanfaat bagi para ibu hamil di desa saya,” katanya. Siti tergerak menjadi bidan karena terdorong kondisi keluarga. Dia tumbuh dalam keluarga besar yang miskin. Saudara kandungnya tujuh orang. Dari delapan anak itu hanya dirinya yang mampu sekolah hingga SMA. Lulus SMP, Siti melanjutkan ke Sekolah Program Bidan (P2B) di Celaket, Malang. Dia memilih menjadi bidan karena melihat riwayat persalinan ibunya yang buruk. Sang ibu empat kali keguguran. Saat melahirkan anak terakhir, dia hampir meninggal. Itu semua karena minimnya pengetahuan tentang gizi dan persalinan bagi ibu hamil. Berkat tekad kuatnya untuk menjadi bidan, Siti berhasil lulus dengan nilai terbaik pada 1992. Dua bulan setelah lulus, Siti diangkat menjadi PNS (pegawai negeri sipil). Namun, dia tidak mau ditempatkan di kota asalnya. “Saya pilih Pacitan. Saya tertantang dengan kondisi masyarakat di daerah itu,” ujarnya. Awal menjadi bidan di Ploso, Pacitan, Siti sudah dihadapkan pada berbagai tantangan. Salah satunya, profesinya


19 Desember 2012

Lanal Siagakan Tiga Kapal Patroli

Amankan Natal dan Tahun Baru


o Wali Kota Sibolga HM Syarfi Hutauruk meninjau pelaksanaan operasi tubektomi di RSU Sibolga, Sabtu (15/12).

SIBOLGA- Menjelang Natal dan tahun baru 2013, pangkalan TNI Angkatan Laut (Lanal) Sibolga menyiagakan sekaligus mengoperasikan tiga unit kapal patroli. Hal tersebut untuk memberikan rasa nyaman dan aman kepada warga sekaligus mencegah tindak pelanggaran hukum di laut. Menurut Komandan Pangkalan TNI Angkatan Laut (Danlanal) Sibolga Letkol Laut (P) Ivan Gatot melalui Pasi Intel Kapten Laut (E) Arief Subaedi, salah satu dari ketiga unit kapal patrol tersebut adalah kapal patroli keamanan laut (Patkamla) jenis Combat Boat Type X-8 Catamaran (PCN) Poncan yang baru didatangkan pada Agustus 2012 lalu. “Combat Boat Type X-8 Cataraman merupakan alutista terbaru buatan Banyuwangi, memiliki spesifikasi bottom dua buah lunas dengan dua mesin Marine Diesel VGT 400PK bertenaga 220HP buatan Swedia serta dilengkapi dengan alat navigasi dan komunikasi modern,” ungkap Arief kepada wartawan, Selasa (18/12) di ruang kerjanya.

‹ ‹ Baca Lanal..Hal 7

Pemko Gelar Lomba Suami Menghias Istri


o Bupati Tapteng Raja Bonaran Situmeang menyerahkan bantuan berupa bibit ayam kepada para peternak ayam di Tapteng, Selasa (18/ 12) di Graha Aulia BI Sibolga.

Pemkab dan BI Bantu Peternak Ayam Broiler SIBOLGA- Pemkab Tapteng bersama Bank Indonesia (BI) Kantor Perwakilan Sibolga memberikan bantuan berupa 10 unit kandang ayam, berikut 11.000 ekor

bibit ayam broiler beserta 16,3 ton pakan ternak.

‹ ‹ Baca Pemkab..Hal 7

Hari Ini, ASWAL Gelar Natal (FOTO: FREDDY),

o Kabag Humas Sibolga Srasamaluddin Nasution. SIBOLGA- Memperingati Hari Ibu dan Darma Wanita Sibolga tahun 2012, Badan KB bekerja sama dengan TP PKK Sibolga, Gabungan Organisasi Wanita (GOW), dan Dharma Wanita Persatuan (DWP) akan

‹ ‹ Baca Pemko..Hal 7

o Pengurus ASWAL SibolgaTapteng saat memberikan keterangan terkait perayaan Natal yang akan digelar Rabu (19/12).

SIBOLGA- Hari ini, Rabu (19/12), Asosiasi Wartawan dan LSM (ASWAL) Sibolga-Tapteng menggelar Natal di Gedung Hermina, Jalan Padangsidim puan. Acara dimulai tepat pukul 18.00

WIB. “Melalui gema perayaan Natal ini, insan pers dan LSM Sibolga-Tapteng

‹ ‹ Baca ASWAL..Hal 7

Jelang Perayaan Natal & Tahun Baru

FKUB Sibolga Rapat Koordinasi (FOTO: FREDDY),

o Rapat koordinasi FKUB

SIBOLGA- Menyambut perayaan Natal dan Tahun Baru, Forum Kerukunan Umat Beragama (FKUB) Sibolga, Selasa (18/12) menggelar rapat koordinasi, konsultasi, evaluasi, dan dialog bersama dewan penasehat, tokoh agama, tokoh masyarakat, guru agama dan pemuda se-Sibolga di Gedung Islamic Centre.

‹ ‹ Baca FKUB..Hal 7

BKKBN Operasi Tubektomi 45 Wanita SIBOLGA- Badan Koordinasi Keluarga Berencana Nasional (BKKBN) Sibolga menggelar operasi tubektomi atau medis operatif wanita (MOW) kepada 45 wanita peserta KB, Sabtu (15/12) di RSU dr FL Tobing Sibolga. “Kegiatan medis operasi wanita atau operasi Kontap ini digelar dalam rangka kesatuan gerak PKK KB Kesehatan ta-

hun 2012. Kegiatan ini sendiri bertujuan untuk melaksanakan kegiatan keluarga berencana,” kata Kepala BKKBN Sibolga dr Welmansen Situmorang, usai pelaksanaan operasi di RSU Sibolga. Menurut Welmansen, seyogianya peserta yang diharapkan ikut dalam operasi tubek-

‹ ‹ Baca BKKBN..Hal 7



METRO BONAPASOGIT Teraktual dari Tarutung, Balige, Humbahas dan Samosir

Rabu, 19 Desember 2012


Pengadaan Alat Operasi Elektronik RSUD Diduga Mark Up HUMBAHAS- Pengadaan alat kedokteran jenis Operating Table Electric Multi Function (alat operasi elektronik) di Rumah Sakit Umum Daerah (RSUD) Dolok Sanggul, Kabupaten Humbang Hasundutan, diduga kuat telah di mark up. Pasalnya, untuk pembelian alat itu, pihak RSUD Dolok Sanggul telah mengalokasikan

total dana Rp1,2 miliar pada APBD Tahun Anggaran 2012 untuk satu unit. Padahal, hasil

penelusuran METRO dari sejumlah pihak menyebut, harga barang tersebut hanya sekitar Rp125 juta. ”Harga barang itu setelah kita telusuri hanya mencapai Rp125 juta. Itu untuk buatan negara

„) Baca Pengadaan Hal 10

Setahun, 35 Tewas Akibat Kecelakaan 165 LUKA BERAT, 178 LUKA RINGAN

TARUTUNG- Terhitung sejak Januari hingga Desember 2012, data Polres Taput menunjukkan ada sekitar 35 orang meninggal dunia, 165 luka berat, 178 luka ringan setiap tahunnya akibat

„) Baca Setahun ..Hal 10

Foto Hermanto Turnip

ANTRE: Belum rampungnya Jembatan Aek Simare, Kecamatan Laguboti, Kabupaten Toba Samosir, mengakibatkan arus lalu lintas macet setiap harinya. Kendaraan roda dua maupun empat terpaksa antre untuk menghindari kecelakaan lalulintas.


Pembangunan Jembatan Aek Simare Laguboti Belum Rampung TOBASA- Proyek pembangunan jembatan Aek Simare, Kecamatan Laguboti, Kabupaten Toba Samosir (Tobasa) telah melewati tanggal berakhir masa kontrak yakni 30 November

2012, sesuai yang tertera di papan pengumuman. Tanda-tanda penyelesaian sesuai jadwal yang tertuang dalam kontrak pekerjaan belum ada dan pengerjaannya masih sekitar 73

persen. Informasi yang diperoleh di lapangan, pelaksana proyek PT

„) Baca Pembangunan ...Hal 10

Jatuh ke Jurang, Pick Up Timpa Kandang Babi LINTONG NI HUTA- Mobil pick up jenis L300 dengan nomor polisi BK 8453 CP, terjun ke jurang lokasi perladangan warga di Desa Silaban Margu, Kecamatan Lintongnihuta, Kabupaten Humbang Hasundutan, Selasa (8/12) sekitar pukul 08.00 WIB. Kejadian, tepat di tikungan Silaban antara km 7 dan 8 Jalan Dolok Sanggul-Siborongborong.

„) Baca Jatuh ..Hal 10

Foto: Juandi Sihombing

MASUK JURANG: Mobil pick up jenis L300 yang masuk jurang di Desa Silaban Margu, Selasa (18/ 12).

Telkomsel Hadirkan NSP Rohani di Desember

„ Telkomsel akan hadirkan NSP Rohani terutama saat menjelang Natal dan Tahun Baru.

MEDAN- Untuk memenuhi kebutuhan pelanggan, Telkomsel akan menghadirkan NSP Rohani di bulan Desember guna memeriahkan Natal dan Tahun Baru. Selain itu, Telkomsel juga menyajikan berbagai pilihan lagu-lagu rohani yang dapat diunduh pelanggan untuk menggantikan nada sambung standar di handphone. Lagu-lagu tersebut diubah menjadi lantunan la-

gu-lagu rohani yang dapat dinikmati si penelpon sambil menunggu panggilannya terjawab oleh orang yang dituju. Hal ini merupakan bagian dari konsistensi Telkomsel dalam menyajikan berbagai kebutuhan pelanggan untuk menampilkan hasil karya musisi ternama dalam bentuk Nada Sambung Pribadi,

„) Baca TelkomselHal 10

„ Aipda W Baringbing

Edisi 154 „ Tahun IX

Segera! Batas Kabupaten Humbahas-Samosir Ditetapkan HUMBAHAS- Penataan batas antara Kabupaten Humbang Hasundutan dengan Kabupaten Samosir akan segera disepakati dan ditetapkan dalam sejumlah titik koordinat. Batas kedua wilayah bertetangga tersebut berada di tiga kecamatan yang ada di kedua kabupaten itu. Kepala Bagian Tata Pemerintahan Pemkab Humbang Hasundutan Makden Sihombing kepada METRO baru-baru ini mengatakan, kesepakatan untuk menetapkan tata batas kedua kabupaten itu sudah ada sejak tahun lalu. ”Tapi untuk penatabatasan, kita akan upayakan selesai bulan ini,” ujar Makden. Ia menjelaskan, batas antara kedua wilayah itu dari Kabupaten Humbahas, berada di Kecamatan Baktiraja yang berbatasan

„) Baca Segera ..Hal 10


19 Desember 2012

Segera! Batas Kabupaten Humbahas-Samosir Ditetapkan Sambungan Halaman 9 denganKecamatanSito-tiodiKabupaten Samosir.Kemudian,diKecamatanPollung yang berbatasan dengan Kecamatan HariandanKecamatanSito-tiodiKabupaten Samosir. Selanjutnya, antara Kecamatan ParlilitandenganKecamatanHarian. Saat penetapan tata batas, sambung Makden,keduaPemkabakanmenentukan sejumlahtitikkoordinatditigakecamatan masing-masing kedua daerah itu. ”Jadi, berdasarkan titik koordinat itu, nantinya akandipasangpilarbeton,”paparnya. Ataspenetapantatabatastersebut,iame-

mintaagarmasyarakatyangtinggaldiperbatasankeduawilayahtersebuttidaksalah persepsiterkaithakkepemilikantanah. ”Masyarakat jangan keliru, tata batas yang ditetapkan nantinya antara kedua pemerintah daerah, tidak adanya hubungannya dengan hak kepemilikan tanah pribadi.Itutidakberpengaruh,”imbuhnya. Ditanyakapanpenetapanbataswilayah itu akan dimulai, Makden Sihombing sejauhinibelumdapatmemastikan. ”Kita koordinasi dulu dengan Pemkab Samosir kapan jadwalnya dimulai. Yang jelas akan dilaksanakan bulan ini,” pungkasnya.(hsl)

Jatuh ke Jurang, Pick Up Timpa Kandang Babi Sambungan Halaman 9 MobilyangdikemudikanIwanLubis(36), terjun ke lokasi perladangan dengan kedalamandaripermukaan jalansekitar6 meter.Tidakadakorbanjiwadalaminsiden itu, namun mobil di dalam jurang terlihat ringsek.Iwansendiridanseorangrekannya, Jonrizal diketahui hanya mengalami luka memardanlecetdilengannya. Amatan METRO, di lokasi kejadian, mobil pick up tersebut menimpa kandang ternak babi milik warga setempat bermarga Silaban. Kepada METRO, Silaban (50) menyampaikan, bahwa dua ekor babi miliknya yang sebelumnya ada di dalam kandang tersebut lepas. “Dua ekor babi yang baru saya beli sebulan lalu lepas karena tertimpa mobil yang jatuh itu. Sampai sekarang

Warga Minta Tali Air di Lumban Silitong Dibangun Permanen

saya belum ketemu ternak babi itu, gak tau lari kemana,” ujar Silaban. Sementara itu, Jonrizal, teman Iwan saat berada di dalam mobil mengatakan, mereka datang dari arah Siborongborong menuju Sidikalang. ”Mobil tak ada muatan. Kami mau ke Sidikalang menjemput buah durian. Tadi mobilnya kencang sebelum terjatuh. Pas baru melewati tikungan itu, mungkin teman saya kehilangan kontrol. Sehingga terbalik ke jurang,” ujarnya. Kasat Lantas Polres Humbang Hasundutan AKP P Ternalem melalui Aipda J Simajuntak, saat berada di lokasi membenarkan. Ia mengatakan, kejadian tersebut telah mereka tangani. ”Kita sudah tangani, tapi kita evakuasi dulu mobilnya dari jurang,” singkat Simanjuntak. (juan/shl)

Foto Hengki Tobing

TANGGUL: Kepala Desa Lumban Silintong Rinson Simamora bersama warga menunjukkan tanggul penahan tali air yang longsor.

Mitra Perkasa Sejati, beberapa kali gontaganti sub kontraktor. Pekerjaan proyek yangbersumberdaridanaAPBNsekitarRp 5,8 miliar tersebut diperkirakan progres pekerjaanmasihsekitar70persen. Saat ini, pekerjaan di lokasi jembatan, penyelesaian coran dudukan dan tiang jembatan,penimbunantanahdisekitaran 30 meter jalan menuju dan sesudah melewati jembatan. Di samping itu, pekerjaan dyk jalan sekitar 30 meter sebelumdansesudahpekerjaanjembatan dengan pasangan batu tanpa menggunakancoranbesibetonketinggian sekitar50cm. Sampai hari kemarin, masih berjalan kegiatanpekerjaandilokasiproyek.Terlihat sekitar 6 orang tenaga tukang. Sementara jembatan pembantu sebanyak 2 lokasi beradadisisikiridankananjembatanmasih mengalami gangguan antrean panjang kepadakendaraanyanghendakmelewati jembatan.Halinimengakibatkanlalulintas di penghujung tahun dan pelaksanaan NataldanTahunBaruakanterganggu. “Tahuninitakakanselesaiituproyek,”ujar beberapa warga Laguboti di sela-sela kemacetanjalan,Selasa(18/12). Terkaitketerlambatanini,penjelasandari pihakkontraktormaupunpengawasproyekbelumdiperolehketerangan.Beberapa orangyangditemuidilokasiproyekjustru mengelakketikadimintaikomentarnya. Proyek jembatan Aek Simare mengakibatkan kemacetan sehingga meresahkan masyarakat dan pengguna jalan. Tiap kali warga Tampahan, Balige dan Laguboti bepergian ke arah Porsea atau sebaliknya, minimal 20 menit harus terjebakditengah-tengahkemacetandan antreuntukbisalewat. Bukan hanya pegawai, pedagang dan

pengusaha, anak sekolah pun turut menjadi korban kemacetan, khususnya pelajardariSigumpar,SiantarNarumonda dan Porsea yang akan pergi sekolah di Balige. “Proyek Pembangunan Jembatan Aek Simareiniuntukkepentinganmasyarakat. Tetapi setelah kami amati kelihatannya tidak. Pembangunannya justru meresahkan dan menghambat warga masyarakat melaksanakan aktivitasnya, sepertipedagangyanghendakberjualanke Poresa, PNS dan anak sekolah ke Balige akibatkemacetanyangditimbulkannya,” ujarSekretarisLSMTopan-RIKabupaten TobasaJerrySibueadiLaguboti. Menurut Jerry, setiap hari pengemudi sepedamotor, mobil dan penumpang selalumengeluhkarenaberlama-lamadi lokasi pembangunan jembatan untuk menunggugiliranlewatdarikemacetan. “Tiap hari ratusan sepedamotor dan mobil harus antre. Walaupun kelancaran arus lalu lintas sudah diatur anggota Satlantas Polres dan Dinas Perhubungan KabupatenTobasa,kemacetantidakjuga bisadielakkan.Kondisijembatanyangtak kunjung selesai dan akses jalan alternatif yang tidak memadai menjadi penyebab timbulnya kemacetan yang cukup panjang,”timpalnya. Wenty(35),wargaBaligejugamengaku hal serupa. Dia mengaku selalu kesal dan geram setiap kali lewat dari jembatan Aek SimareLaguboti. “Setiap Rabu saya berjualan ke Porsea. Kalauberangkatdarirumahjam7.30Wib, sudahdapatsayapastikansampaidiPorsea jam10.00Wib.Tentuakibatkondisiinisaya telatmembukalapak.Sementaraparakonsumensudahpadaramaimemadatipekan, padahalmenjelangNataldanTahunBaru inilahharapankitajualannyalaris,”tandas ibuempatanakinidiBalige.(cr-03)

sedang musim tanam padi. Sebab, jika tidak ditanggulangia,petaniakankesulitanmenanam padi,”kataRinsonSimamora Untuk itu, Rinson berharap kepada pemkab agar segera menanggulangi tali air tersebut dengan cara membangun tanggul penahan air secarapermanen.Karenataliairtersebut merupakan sumber air satu-satunya untuk mengairi persawahandidaerahitu. CamatPagaranAbdimpuanHutabaratdikonfirmasimelaluiteleponselulernyamembenarkan taliairdiLumbanSilintongseringlongsor.Bahkan masalahinitelahmerekasampaikankebencana alam Taput melalui surat agar dilakukan perbaikan.“KitasudahsuratiBadanPenanggulangan BencanaDaerah(BPBD)Taputuntukmeminta melalukanperbaikan,”singkatHutabarat.(cr-02)

Pengadaan Alat Operasi Elektronik.. Sambungan Halaman 9 Jerman,” sebut Ketua LSM Lembaga Masyarakat Anti Korupsi (LIMAK) Kabupaten Humbahas, Ganti Sihombing, Senin (17/12) di Dolok Sanggul. Ia menjelaskan, pihaknya menduga Direktur RSUD Dolok Sanggul selaku Pengguna Anggaran (PA), telah dengan sengaja menggelembungkan harga alat kedokteran tersebut untuk menguntungkan pribadinya dan pihak lain. ”Selain itu, kita juga menemukan adanya Pejabat Pembuat Komitmen (PPK) pengadaan alat kedokteran itu berinsial YSFE yang berstatus CPNS. Jelas itu sudah melanggar Peraturan

Presiden Nomor 70 Tahun 2012 tentang perubahan kedua Peraturan Presiden Nomor 54 Tahun 2010, tentang pengadaan barang/jasa pemerintah,” papar Ganti Sihombing seraya mengatakan, seorang CPNS belum berhak mengelola keuangan negara dan mendapat jabatan karena belum resmi Pegawai Negeri Sipil (PNS). Untuk pengadaan alat kedokteran itu, sambungnya, pihak panitia juga dinilai tidak transparan. ”Nomor surat perjanjian pekerjaan pangadaan barang itu adalah Nomor :03/PPK/SP/ VII/2012 dengan perusahaan yang mengerjakan CV Putra Karya, atas nama direktur berinisial H. Khusus

untuk proyek ini, kita menduga negara sudah sangat dirugikan,” ungkap Ganti. Sedangkan dari hasil penelusuran METRO, juga terdapat dugaan Mark Up pengadaan satu unit Stem Sterilizer (sterilisator uap) yang dianggarkan senilai Rp1,1 miliar. Padahal, salah satu penyedia barang tersebut, Kusman Slamet melalui perusahaan miliknya CV Akmal Djaya Khatulistiwa yang beralamat di Perum Manglayang Regency Blok D4 No. 17, Cileunyi-Bandung, saat dihubungi melalui ponselnya, Selasa (18/12) mengatakan, bahwa harga tertinggi untuk sterilisator uap berkapasitas 200 liter hanya sekitar Rp40 juta saja.

”Biasanya kalau untuk rumah sakit paling dipakai sterilisator uap kapasitas 50 liter. Harganya yang 50 liter itu kami jual Rp16 juta per unit. Kalau yang 200 liter paling Rp40 jutaan,” ujar Kusman. Direktur RSUD Dolok Sanggul DR Elisabeth Manalu saat ditemui METRO, Selasa (18/12) di kantornya, tidak berada di tempat. Sebelumnya, Jumat (14/12) lalu, DR Elisabeth yang ditemui di kantornya, berupaya menghindar untuk bertemu wartawan. Elisabeth tidak mau menerima kedatangan wartawan. Demikian juga saat dihubungi melalui telepon selulernya, lagi-lagi DR Elisabeth tidak menjawab. (hsl)

Setahun, 35 Tewas Akibat Kecelakaan

Pembangunan Jembatan Aek Simare Laguboti Belum Rampung Sambungan Halaman 9

TAPUT- Sering jebol, masyarakat di Desa Lumban Silintong, Kecamatan Pagaran, Kabupaten Taput, meminta tanggul tali air yang berfungsiuntukmengairipersawahandiTomburan LumbangSilintongdibangunpermanen. “Apabila perbaikan terhadap tali air itu tidak segera diperbaiki, maka sangat berpengaruh terhadappengelolaanpersawahanmasyarakat,” kata Kepala Desa Lumban Silintong Rinson Simamorakepadawartawan,Selasa(18/12). Ia mengatakan, kerusakan tanggul tali air diakibatkan tanah di sisi lereng perbukitan berpasir, sehingga mudah tergerus air. “Tali air yangmengairipersawahanmasyarakatLumban Silintongmakinrusakkarenaseringlongsor.Warga sudah bergotong-royong melakukan penanggulangansementara.KarenadidaerahTomburan

DATA KORBAN TEWAS AKIBAT KECELAKAAN LALU-LINTAS Bulan Januari February Maret April Mei Juni Juli Agustus September Oktober Nopember Desember

Kejadian 6 kali 15 kali 8 kali 25 kali 15 kali 13 kali 15 kali 19 kali 13 klai 10 kali 12 kali 6 kali

Tewas 3 orang 1 orang 1 orang 4 orang 7 orang 3 orang 1 orang 4 orang 2 orang 3 orang 2 orang 1 orang

Kerugian (Rp) Rp70.500.000 Rp29.050.000 Rp31.800.000 Rp115.000.000 Rp71.200.000 Rp23.200.000 Rp49.600.000 Rp44.500.000 Sumber Polres Taput

Sambungan Halaman 9 kecelakaan di wilayah tersebut. Penyebab kecelakaan tertinggi karena kelalaian individu dan sikap berken-

dara yang kurang baik. “Seluruh korban terbagi dalam 176 kasus. Total kerugian akibat kasus ini Rp625.950.000,” kata Kapolres Taput AKBP IKG Wijatmika SIK melalui Ka-

subag Humas Aipda W Baringbing kepada wartawan, Selasa (18/12). Penyebab kecelakaan lebih didominan para pengendara tidak mematuhi rambu-rambu lalu lintas. Seperti, kecepatan kendaraan tinggi, hilang konsentrasi, mengantuk, dan tidak menggunakan pelindung kepala atau helm serta kurangnya kewaspadaan. Januari, terang Baringbing, sebanyak 6 peristiwa laka lantas dengan jumlah korban meninggal dunia 3 orang. Nilai kerugian material Rp70.500.000, Februari 15 kali dengan jumlah korban meninggal dunia 1 orang dengan nilai kerugian Rp29.050.000. Maret 8 kali, meninggal dunia 1 orang dengan kerugian Rp31.800.000. “Sementara April jumlah laka lantas sebanyak 25 kali, tewas 4 orang. Adapun kerugian material akibat kejadian ini Rp115.000.000,” terangnya.

Selanjutnya, Mei 15 kali, 7 tewas, kerugian material Rp71.200.000. Sementara bulan Juni sebanyak 13 kali dengan jumlah korban meninggal dunia 3 orang, kerugian Rp23.200.000. Juli sebanyak 15 kali, meninggal 1 orang, kerugian Rp49.600.000. “Kemudian jumlah laka lantas yang terjadi bulan Agustus sebanyak 19 kejadian dengan jumlah korban meninggal dunia sebanyak 4 orang, kerugian Rp44.500.000. Sedangkan bulan September 13 kali, 2 meninggal dunia,” jelasnya. Sedangkan Oktober 10 kali, 3 meninggal dunia, dan Nopember 12 kali, 2 orang meninggal dunia, serta Desember sebanyak 6 kali, 1 meninggal dunia. Dari jumlah pelanggaran lantas yang terjadi selama tahun 2012 tersebut, katanya, 100 kasus berdamai, 18 kasus P-21, SP- 3 sebanyak 12 kasus dan 8 kasus masih dalam proses. (cr-01)

Telkomsel Hadirkan NSP Rohani di Desember

Sambungan Halaman 9 yang dapat dinikmati seluruh pelanggan melalui nada tunggu di handphonenya. Dengan begitu, momen Natal dan Tahun Baru lebih terasa hikmatnya akibat sajian nada tunggu yang menggugah hati. “NSP merupakan salahsatu layanan Telkomsel yang sangat digemari. Biasanya saat Natal dan Tahun Baru pelanggan Telkomsel sering mengaktifkan lagu rohani sebagai NSP, hal ini dilakukan pelanggan selain menyesuaikan momen natal dan tahun baru serta sebagai penyemarak suasana di bulan Desember. Pelanggan juga secara tidak langsung ikut menyemarakkan kegembiraan melalui lagu rohani dalam bentuk nada sam-

bung saat pelanggan lainnya menunggu panggilan terjawab oleh orang yang dituju. Untuk mengantisipasi kebutuhan tersebut, Telkomsel menyediakan berbagai pilihan lagu yang dapat digunakan oleh pelanggan sebagai NSP,” kata Head of Sales and Customer Care Region Sumbagut Division Filin Yulia. UntukinformasiNadaSambungPribadi, kata Yulia, pelanggan bisa mendapatkan informasinya dengan mudah melalui website resmi telkomsel yaitu website pilih service lalu pilih menu NSP 1212. Pelanggan dapat mengaktifkan Nada Sambung Pribadi (NSP) lagulagu rohani dengan mengirim SMS, ketik Alias lagu dan kirim ke 1212. Contoh: HMBAA kirim ke 1212. NSP


Hai Mari Berhimpun White Christmas Malam Kudus Oh Holy Night Joy To The World Silent Night

Artis Alias (Rp.9000) Maria Da Silva HMBAA Michael Buble BARJY Viktor Hutabarat MASIY Hosana Singers HYNAF Ruth Nelly & Daud J Pamel JTWAF Agnes Monica SNDBO

ini dapat dinikmati dengan tarif Rp9.000 untuk 30 hari dan dapat diperpanjang jika pelanggan menginginkannya. Pelanggan juga dapat mengirim NSP Rohani sebagai hadiah kepada

pelanggan Telkomsel lainnya dengan mengetik RING(spasi)GIFT(spasi)KODE(spasi)NO TUJUAN kirim ke 1212. Dengan tarif yang sama. Contoh: RING GIFT HMBAA 081165XXXX. (rel/leo)



19 Desember 2012



„ Bupati Tapteng Raja Bonaran Situmeang, didampingi Kaban KB & KK Budiman Ginting menyematkan tanda peserta Jambore Satuan Karya Keluarga Berencana (Saka Kencana) kepada perwakilan Pramuka, Selasa (18/12)

„ Bupati Raja Bonaran Situmeang, Kaban KB & KK Budiman Ginting, Kadisdik Jonson Sihombing, pengurus pramuka dan peserta Jambore Saka Kencana salam khas Horas Tapteng!.


Pramuka Agen Pembangunan KB & Kesehatan

„ Semangat Jambore Saka Kencana dalam menyukseskan program KB kepada generasi muda.

„ Para Pramuka dari berbagai sekolah di Tapteng peserta Jambore Saka Kencana.

Bupati Tapteng Raja Bonaran Situmeang mengatakan dengan kegiatan ini diharapkan generasi muda yang cerdas dan mandiri, terlebih paham apa dan bagiamana program KB. Sehingga kelak mereka paham bagaimana membangun sebuah keluarga kecil yang bahagia dan sejahtera, sesuai mottonya “Dua Anak Lebih Baik”. “Pramuka diharapkan jadi agen pembangunan KB dan Kesehatan,” kata Bupati ketika membuka Jambore Pramuka Saka Kencana (Satuan Karya Keluarga Berencana) di Lapangan Bola Sibuluan Raya, Kecamatan Pandan, 16-19 Desember 2012. Acara diselenggarakan oleh Badan Keluarga Berencana dan Kesejahteraan

Keluarga (KB & KK) Tapteng. Peserta Jambore 440 orang, perwakilan pramuka pria dan wanita dari sekolah tiap kecamatan. Jambore diisi kegiatan bakti sosial, lomba poster KB, pendataan keluarga, lomba kerapian tenda, teknik pramuka, pemutaran film KB, lomba kreativitas pramuka, lomba senam KB, gebyar seni, dan pencerahan tentang Krida Saka Kencana. Sedangkan pemutaran film KB di seluruh kecamatan pada 12-21 Desember 2012 guna penyebarluasan informasi dan edukasi terkait program KB kepada masyarakat, khususnya pasangan usia subur. Ada 2 tim pemutaran film, dari BKKBN Sumut dan Badan KB & KK Tapteng. Tim pemutaran film kini tengah berjalan. (mora)

„ Raja Bonaran Situmeang, Kaban KB & KK Budiman Ginting, pengurus Pramuka Tapteng dan pimpinan SKPD menuju lokasi perkemahan.

„ Bupati Tapteng Raja Bonaran Situmeang

„ Kaban KB & KK Tapteng Budiman Ginting SH

„ Raja Bonaran Situmeang menandatangani daftar kunjungan di perkemahan SMA Negeri 1 Sorkam Barat.

„ Raja Bonaran Situmeang, Kaban KB & KK Budiman Ginting, bersama Camat Kolang Rinaldy Siregar dan peserta Jambore dari kecamatan tersebut.

„ Raja Bonaran Situmeang, Budiman Ginting, Jonson Sihombing, di perkemahan putri Kecamatan Sorkam Barat.

„ Raja Bonaran Situmeang bersama jajaran pegawai dan staf Badan KB dan KK Tapteng.

„ Seluruh peserta Jambore berjoget bersama saat Raja Bonaran Situmeang dan kru bernyanyi.

„ Raja Bonaran Situmeang menyapa para pramuka putri perserta jambore.

„ Peserta Jambore putri bangga dapat menyalam Bupati Raja Bonaran Situmeang.

„ Dengan senyum khasnya, Raja Bonaran mendatangi satu per satu kemah peserta Jambore.

„ Raja Bonaran Situmeang didampingi Kaban KB & KK Budiman Ginting meninjau kemah peserta Jambore pria.

„ Peserta Jambore berebut foto bersama Bupati Tapteng Raja Bonaran Situmeang.

„ Charlie ST12-nya Tapteng mengajak pramuka bergoyang.

„ Horas Tapteng! Sukseskan program KB dua anak lebih baik.

„ Pengurus Pramuka Tapteng dan seluruh peserta Jambore berjoget.

& teks: Marihot Simamora. Tempat & waktu: Lapangan Bola Sibuluan, Pandan, Tapteng.


19 Desember 2012

Interaktif Tapanuli Oknum Kasek Jual Seng Rehab Sekolah Bapak wali kota yang terhormat, tolong ditindak oknum kasek yang menjual seng rehab sekolah. Terima kasih. Pengirim: 085373487XXX

Lampu Jalan ke Sibuluan 1 Padam

Kepada pihak Dinas Pertamanan, lampu jalan ke Desa Indah Sibuluan 1 sudah mati, padahal baru dibangun. Tolong diperhatikan Pak. Terima kasih. Pengirim: 085360650XXX

Bedah Rumah Belum Selesai Pak wali kota tolong diperhatikan pembangunan bedah rumah. Banyak yang belum selesai dan ditinggalkan begitu saja. Kami yang rumahnya sedang dibedah menjadi telantar Pak. Terima kasih. Pengirim: 081269082XXX

Tertibkan Judi

Pasar Sibolga Semrawut SIBOLGA-Kondisi Pasar Sibolga Nauli semakin hari semakin semrawut. Hal ini diakibatkan sejumlah pedagang yang berjualan di gang yang seharusnya menjadi jalan, dan juga pedangang kaki lima yang menggunakan pelataran parkir sebagai tempat berdagang. Sementara sejumlah kios di lantai satu Pasar Sibolga Nauli ini masih kosong. Ini diakibatkan kurangnya penataan dan kurangnya perhatian petugas Pasar Sibolga Nauli. Menurut sejumlah pedagang di Pasar Sibolga Nauli, keadaan yang semrawut ini diakibatkan kurang tegasnya pegawai pasar. Sehingga para pedagang sesuka hatinya berjualan di tempat yang mereka suka. Sementara petugas Pasar Sibolga Nauli tidak mampu berbuat apa-apa. “Saya bingung jadinya. Sebayak 30 meja yang dikhususkan untuk tempat penjual ikan di dalam Pasar Sibolga Nauli ini,

hanya ada empat meja yang berisi. Sementara puluhan pedagang ikan lainnya menjual ikan di gang-gang pasar ini. Ujungnya, gang yang seharusnya untuk jalan menjadi padat dan terhalang para pedagang ikan dan pedagang lainnya. Bahkan para pedangan ikan ada juga yang berjualan di Jalan Tongkol tepatnya di belakang pasar ini. Tapi petugas pasar ini hanya diam dan tak mampu berbuat apaapa,” kata P Simamora (34) seorang pedagang ikan di Pasar Sibolga Nauli, Jumat (14/12). Katanya, akibat pedagang yang tak beraturan ini membuat dagangan mereka yang

menempati kios khusus pedangan ikan tidak laku. “Bagaimanalah usaha kami bisa berjalan lancar seperti ini. Harga dan kualitas sama dengan pedagang yang berada di gang-gang itu. Sementara lokasi kami berada di dalam. Mana ada lagilah orang yang meli-

hat dagangan kami,” keluh P Simamora. Diutarakannya, kondisi seperti ini sudah berlangsung cukup lama. Akibatnya, mereka tidak mau lagi membayar pajak tahunan kios yang mereka tempati. “Sudah sekitar dua tahun saya tidak mau bayar pajak tahun-

an kios ini. Kita hanya bayar retribusi sajalah Rp1.000 per hari. Karena pedagang yang berada di gang-gang itu hanya membayar Rp1.000 per hari. Artinya berapa banyak PAD yang terabaikan dari pasar ini akibat kurangnya penataan pasar ini,” terangnya. (fred)

Pak Kapolsek Pinangsori, tolong tertibkan perjudian tengah malam di Jalan Maduma Sukarame Pinangsori. Hal ini membuat resah masyarakat. Pengirim: 081265353XXX

Perhatikan Beronjong di Jalan FL Tobing Kepada Pemkab Tapteng, kapan beronjong di Jalan FL Lumbantobing, Kecamatan Barus, diperbaiki. Mohon ditinjau Pak dan perhatikan warga yang berada di sekitar itu sebelum menjadi lautan. Sebagaimana daerah ini selalu menjadi langganan banjir. Terima kasih. Pengirim: 087891562XXX

Seharusnya UPT Pasar Sibolga Nauli beserta seluruh staf memperhatikan hal itu dan melakukan penertiban. Karena bagaimanapun juga bila memang para pedagang sudah tidak mau lagi membayar pajak kios tahunan, jelas hal ini sangat merugikan bagi PAD Sibolga. Dan bila memang UPT Pasar tidak mampu, Dinas Perindagkop bisa melakukan ambil alih demi terciptanya suasana pasar yang rapi dan tertib dan juga dapat melakukan pengolahan pasar untuk mencapai target PAD yang maksimal.


„ Sejumlah pedagang yang berjualan di gang yang diperuntukkan untuk jalan di Pasar Sibolga Nauli. Sementara puluhan meja yang dikhususkan untuk berjualan ikan masih kosong.

Lenni F br Siagian, Warga Sibolga

ANEH TAPI NYATA Kerja Hanya 6 Hari Selama 9 T ahun Tahun

Tetap Digaji BOLOGNA-Sepandai-pandainya menyembunyikan kecurangan, akhirnya akan terbongkar juga. Inilah yang dialami Silvia S (46) tahun warga Bologna, Italia, dihukum dua tahun penjara karena hanya bekerja enam hari selama 9 tahun di RSU. Dia dianggap melakukan kecurangan dengan memanfaatkan dana yang berasal dari publik. Selain itu, dia juga telah

Kakek Jepang Jadi Orang Tertua di Dunia TOKYO - Usai perempuan tertua di dunia Dina Manfredini meninggal dunia, seorang kakek berusia 115 tahun pun langsung dinobatkan sebagai orang tertua di dunia. Pria itu berasal dari Jepang. Jiroemon Kimura menyandang gelar yang dulu disandang oleh Manfredini. Kimura adalah seorang mantan pegutas pos dengan 14 cucu, 25 cicit dan 13 canggah, Selasa (18/12). Kimura tinggal bersama keluarga putranya sendiri. Meski demikian, keluarga besar Kimura menolak untuk berkomentar lebih lanjut mengenai titelnya yang baru saja dida-

patkan usai Manfredini meninggal. Walikota Kyotanggo Yasushi Nakayama langsung mengkonfirmasi Kimura sebagai seorang tertua di dunia. Nakayama cukup bangga dengan prestasi yang didapatkan Kimura. Kimura lahir pada 19 April 1897 silam, Kimura jauh lebih muda ketimbang Manfredini yang baru saja meninggal usai dinobatkan sebagai perempuan tertua di dudia, dua tahun yang lalu. Manfredini mendapatkan gelar manusia tertua di dunia usai merebut gelar itu dari Bessie Cooper. (oz/nik)

„ Jiroemon Kimura.

memberikan informasi palsu mengenai dirinya. Dia mengaku sakit sehingga tidak masuk bekerja. Selain sakit, dia juga mengaku hamil dan melahirkan. Tidak hanya satu kali, tetapi juga dua kali. Padahal, dia sama sekali tidak sakit atau hamil dan melahirkan. Selama kurun waktu tersebut, gaji yang berasal dari pembayaran pajak terus diterimanya. (oz/nik)


Bungker Mewah Untuk Persiapan Kiamat

Perempuan Tertua di Dunia Tutup Usia

„ Dina Manfredini.

DES MOINES - Dina Manfredini meninggal dunia di usianya yang ke-115 di Iowa, Amerika Serikat, setelah dua bulan dinobatkan sebagai perempuan tertua di dunia. Gelar perempuan tertua di dunia diraih Manfredini usai Bessie Cooper menghembuskan nafas terakhirnya. Manfredini tinggal di Panti Jompo Bishop Drumm di Johnston. Menurut cucunya, Lori Logli, Manfredini sempat sakit demam sebelum meninggal. Logli menceritakan pula bahwa, neneknya adalah seorang yang sangat handal dalam memasak dan sering membuat roti Italia setiap hari Minggu untuk sarapan keluarganya. Selain roti, Manfredini juga sanggup membuat pasta dengan tangannya sendiri. ”Dia (Manfredini) sangat aktif dalam hidupnya. Dia juga seorang yang suka memberi,” ujar Logli, Selasa (18/12). ”Dia tidak pernah percaya bahwa dia sudah tua. Ketika kami mengatakan kepadanya tentang usianya, dia hanya menggelengkan kepalanya,” imbuhnya. Pada usianya yang sudah lebih dari satu abad, Logli mendeskripsikan neneknya sebagai seorang yang penampilannya tidak terlihat tua. Pada saat masih berusia 110 tahun, rambut Manfredini masih terlihat kelabu. (oz/nik)


PENAMPUNGAN-Bungker mewah kreasi Ron Hubbard untuk penampungan manusia dibangun dibawah tanah untuk menghadapi kiamat.

MONTEBELLO - Ron Hubbard sadar betul dengan ramalan kiamat. Dirinya membangun tempat penampungan atau bunker di bawah tanah yang sangat mewah untuk mempersiapkan diri menghadapi kiamat. Banyak kabar yang memperkirakan dunia akan berakhir pada Jumat 21 Desember mendatang seperti yang di prediksikan kalender Maya. Kalender suku Maya yang dimulai 5.125 tahun lalu di 3113 sebelum masehi (SM) akan berakhir pada 21 Desember 2012. Kabar itu memicu kekhawatiran diantara sekelompok orang akan bencana besar yang akan terjadi. Hubbard, akhirnya membuat bisnis membangun bunker di bawah tanah yang dilengkapi dengan fasilitas

seperti sofa kulit, TV plasma, tempat tidur, dapur, toilet disiram dan bahkan perapian. Bunker yang bentuknya mirip dengan bom ini berada di Montebello, California, dan dijual dengan harga 46.000 pound sterling atau sekira Rp719 juta. Hubbard, mengatakan bahwa ia sedang membuat bunker di dua tempat yaitu di New York dan satu lagi di Indiana. ”Saya akan menghabiskan tiga hari di bungker agar aman. Jika Anda memiliki bungker, Anda mungkin juga pergi ber-

sembunyi didalamnya,” ujar Hubbard, Selasa (18/12). Bungker buatan Hubbard ini berbentuk silinder yang berukuran 500 kaki persegi dengan diameter 10 kaki dan panjang 15,24 meter. ”Saya mulai membuat tempat ini, karena saya juga ingin memiliki satu untuk diriku sendiri,” ungkap Hubbard. ”Banyak orang yang membeli bungker ini sebagai bentuk asuransi untuk kemungkinan terburuk. Sama seperti seseorang yang akan membeli asuransi rumah karena takut kalau terjadi kebakaran dirumah mereka,” tambahnya. ”Kami telah menjual bungker ini sejak satu bulan yang lalu setelah Presiden Obama terpilih ulang,” jelas pria asal Montebello, California itu. (oz/nik)


RABU 19 Desember 2012


SM AN 1 Matauli

DEW AN RED AKSI: DEWAN REDAKSI: Pembina : Murdianto SPd MM (Kepala SMA N 1 MATAULI) Penanggung jawab : Iso Suwarso MPd (Wakil Humas)

Pembimbing : 1. Drs. Sumarno MSi 2. Sadiyah SPd 3. Diyah Kusnaeni SPd MM Tim redaksi dan kreasi siswa : 1. Aprian Muliadin Harahap (XII IPA 8) 2. Okky Ardika Penjaitan (XII IPA 8) 3. Bryan Erwin Gultom (XI IPA 5) 4. Li’idil Fitri (XI IPA 7) 5. Friedly Halomoan (XI IPA 7) 6. Tim Redaksi Majalah Siswa “Matrik”.

Genggaman Ranting Senja itu, pandanganku tertunduk melihatmu Termenung aku menjemput asa tiada rindu Ditemani cahaya jingga setia menemani kita Hingga sampai tuamu tetap di sana Dimakan masa, tenggelam oleh kesibukan dunia Tak kuasa ku membeku membisu di antara daun-daunmu

Ukir Prestasi Debat Hukum Nasional SMAN I Matauli akhir November lalu menyeleksi siswa kelas 12 (angkatan 17) yang berprestasi untuk mengikuti lomba debat tingkat nasional di Fakultas Hukum Universitas Indonesia. Hasil seleksi tingkat sekolah diwakili Hiskia Efranta Sembiring (XII IPS 2), Lidya Christy F Siregar (XII IPS 3) dan Vidya Natasya Sembiring (XII IPS 3). Sebagai tahap persiapan dilakukan pembimbingan yang dilaksanakan lebih kurang sebulan. Sebagai bentuk dukungan, sekolah memfasilitasi penginapan di Mess Matauli selama bimbingan dilaksanakan. Tim yang dibimbing oleh Nasikin SPd untuk menggembleng dan mempersiapkan diri secara matang dalam menghadapi lawan dari SMA lain di seluruh Indonesia. Lomba Debat tingkat nasional ini diberi nama “Social Science in Law National Debating Competition 2012”. Lomba ini diprakarsai

oleh Fakultas Hukum Universitas Indonesia yang mempertemukan seluruh peserta dari penjuru Indonesia seperti Garut dan Bandung (Jawa Barat), Sulawesi Utara, Bali, Lampung dan Sumatera

Termenung aku menjemput asa tiada rasa Mengalir arus tangis kau termenung diam Pilihanmu itu menjemput aku dalam sumur tanpa cahaya Hingga cahaya jingga setia menemani kita Dibawah ranting kokoh di antara hijau dan biru Kini telah bersamamu terpisah namun teguh Harapanku besar di setiap pori ranting itu Yang kini abadi walau hanya berbingkai indah foto senyummu.

Biru berpadu kuning terpapar di setiap sudut Biru berpadu kuning, papan bagi segelintir mahkluk Biru berpadu kuning, sumber hidup Biru berpadu kuning, hijau… Virus adalah titik awal Virus dari orang-orang yang selalu lapar Virus dari orang-orang berhati mesin Virus dari orang-orang mati. Mengapa coklat ? Kemana hijau itu ? Kemana milyaran lembar-lembar hijau itu ? Mengapa coklatnya lumpur yang ada ? Kembalikan ! Kembalikan hijau itu Kembalikan nafas itu ! Selamatkan nyawa kita ! Karya : Roni Alexandro Lahagu Kelas : XII IPA 1

menguasai mosi yang telah ditentukan. Misalnya mosi, Larangan Demonstrasi Bagi Mahasiswa, Pembangunan PLTN di Indonesia, Pemberlakuan Hasil Ujian Nasional Sebagai Syarat Masuk Perguruan Tinggi, Legalisasi Penjualan Narkotika, Pemindahan Ibukota Negara Republik Indonesia, yang nantinya dari score 3 kali perdebatan tersebut dijumlahkan sehingga hanya 8 sekolah yang berhak maju ke babak berikutnya. Debat diawali oleh Tim Pro dengan waktu pembicara menjelaskan argumennya selama 7 menit 20 detik. Intrupsi dapat dilakukan satu menit setelah penyampaian argument dengan waktu maksimal 15 detik. Dan perdebatan ini diakhiri oleh Tim pro juga dengan penyampaian kesimpulan selama 4 menit 20 detik. Dalam berdebat sangat dilarang keras menggunakan kata yang tidak senonoh atau kata-kata yang bias mengganggu konsentrasi lawan. Debat pertama SMA

SMAN 1 Matauli Pandan

Karya : Muhammad Rafiqi Sitompul Kelas : XII IPA 1


Utara. SMA Negeri 1 Matauli merupakan perwakilan satusatunya SMA dari Sumatera Utara. Acara ini merupakan serangkaian kegiatan Lomba Debat Hukum antar Siswa SMA/MA Tingkat Nasional, dan juga Lomba Debat antar Mahasiswa Fakultas Hukum tingkatNasional. Lomba yang diselenggarakan oleh Lembaga Kajian Keilmuan UI bertema: “Menjawab Tantangan Ketahanan Nasional Indonesia dalam Menghadapi Era Globalisasi” dan bertujuan untuk mencetak generasi-generasi muda yang kritis dan berkapabilitas tinggi dalam menghasilkan ide-ide solutif bagi perkembangan bangsa. Pertandingan berlangsung tanggal 17-19 November 2012. Untuk peserta tingkat SMA terdiri dari 24 sekolah. Sistem perlombaannya adalah para siswa diberi kesempatan 3 kali berdebat. Pihak panitia telah menentukan secara acak siapakah Tim Pro dan Tim kontra yang akan berdebat dan masing-masing harus

Negeri 1Matauli lawan SMA Beo Talaud Sulawesi Utara, debat kedua SMA Negeri 1 Matauli lawan SMA Tinggi Moncong Sulawesi Selatan, debat ketiga SMA Negeri 1Matauli lawan SMA 78 Jakarta. Tim juri terdiri dari 3 orang ahli hukum, Sosial Politik dan Ekonomi yang tergabung dalam komunitas Debat Universitas Indonesia. Setelah rangkaian proses seleski tersebut yang diikuti 24 peserta seluruh Indonesia, akhirnya Tim SMA Negeri 1 Matauli masuk Final. Tim lawan yang terakhir dari SMA Negeri 1 Matauli adalah SMA BPK Penabur Bandung. Berkat upaya serta doa dan bimbingan seluruh civitas akademika SMA Negeri 1 Matauli, akhirnya kami mendapatkan satu kemenangan. Kemenangan ini sangat berarti bagi kami sebagai pemicu motivasi adekadek kami. Himkahnya adalah ketekunan, kerja keras dan disiplin adalah modal untuk meraih sukses. Kegiatan diakhiri dengan mengikuti Seminar yang bertemakan Ketahanan Pangan Nasional, “Indonesia adalah Negara agraris, masih perlukah mengimpor beras?”. Dan satu cerita menarik lagi bahwa di Universitas Indonesia (UI) banyak dijumpai alumnialumni SMA Negeri 1 Matauli yang berprestasi. Tim Debat SMA Negeri 1 Matauli sangat senang ketika bertemu dengan kakak alumni yang begitu peduli kepada adik angkatannya. Inilah salah satu bukti ikatan yang terjalin kuat antara generasi-generasi di kampus SMA Negeri 1 Matauli. Dan harapan besar agar Debat ini dipertimbangkan menjadi salah satu kegiatan Ekstrakulikuler di sekolah. Bukan hanya di SMA Negeri 1 Matauli tetapi di seluruh SMP-SMA Tapanuli Tengah, sehingga dari kegiatan ini bias dirintis lomba Debat tingkat Kabupaten. “Accept the challenge, be the agent of change”. (*)

Siapkan Generasi Unggul, Berprestasi dan Berkarakter Oleh: Oleh: Adi Kwisantho SK om SKom dan Ahmad Zufikar FFauji auji SK om SKom (Penulis adalah Koordiantor IT SMA Negeri 1 Matauli sekaligus Tim Siap PPDB 2013) SEBA GAI Rintisan Sekolah Bertaraf SEBAGAI International sejak 2006, di bawah kendali manajemen Murdianto SPd MM selaku Kepala Sekolah SMA Negeri 1 Matauli Pandan terus berbenah memantapkan langkah-langkah strategis untuk pencapaian visi dan misinya. Langkah yang telah dilakukan di antaranya mendapatkan sertifikat Sistem Manajemen Mutu ISO 9001:2008 sebagai salah satu indikator pemenuhan Sekolah Bertaraf International (SBI) dalam unsur pengelolaan/manajemen sekolah. Selain itu, juga mendapat kepercayaan dari Dirjendikmen Kementerian Pendidikan dan Kebudayaan sebagai sekolah fasilitator data berbasis ICT untuk 22 SMA di Kabupaten Tapanuli Tengah. Upaya terus dilakukan dengan tenaga pendidik lulusan S2 dan menerapkan inovasi metode pembelajaran yang berbasis IT, serta didukung dengan fasilitas serta sarana sekolah yang sangat lengkap. SMA Negeri 1 Matauli Pandan telah meluluskan ribuan alumni untuk melanjutkan pendidikan. Sampai angkatan XVI, alumni SMA Negeri 1 Matauli Pandan yang masuk ke perguruan tinggi tersebar di berbagai bidang, di antaranya perguruan tinggi kedinasan, TNI/Polri, PTN Favourit di Indonesia, serta Universitas di luar negeri (SGU Jerman, dan NTU Singapura).

Keunggulan dan PPrestasi restasi Penerapan kurikulum nasional ditambah dengan adopsi dan adaptasi kurikulum dari Cambrigde serta didukung dengan kesiapan fisik, kematangan perilaku, kedisiplinan, dan seluruh kode etik yang dibangun dalam kehidupan sehari-hari para siswa adalah satu dari sekian banyak keunggulan yang dimiliki SMA Negeri 1 Matauli Pandan. Para siswa dididik menjadi calon kader pembangunan bangsa yang berkualitas di bidang akademik, kesamaptaan jasmani, dan kepribadian yang dilandasi oleh budi pekerti luhur, sehingga mereka memiliki kesiapan dan kesigapan dalam menguasai dan menerapkan ilmu pengetahuan, serta kesiapan berkompetisi dalam berbagai ajang. Kegiatan penunjang peserta didik dalam kegiatan ekstrakurikuler telah dipilih berdasarkan minat dan potensi peserta didik yang terus dibina hingga menuju prestasi. Di antaranya bidang olahseni: seni musik tradisional dan kontemporer, teatrikal, seni tari tradisional dan kontemporer; bidang olahraga: renang, sepakbola, volyball, basketball, sepak takraw, pencak silat, karate do; bidang lain: Pidato Bahasa Inggris, Jepang dan Jerman, KIR, PASUS, Pencinta Alam, Pramuka, dan Debat. Juga kegiatan pengembangan bakat lainnya. Diberbagai kompetisi, peserta didik telah menunjukkan kualitasnya dengan meraih sejumlah prestasi, baik di tingkat nasional maupun international. Di antaranya Olimpiade Komputer, Olimpiade Kimia, Olimpiade Kebumian di Makasar,

Olimpiade Fisika di Pakanbaru, Olimpiade Matematika di Argentina dan Taiwan, Olimpiade Biologi di Turki, Olimpiade Sains Nasional bidang Fisika dan Ekonomi di Jakarta (2012), Pidato Bahasa Inggris di Propinsi Sumatera Utara (2011), menjadi Parlemen Muda Indonesia perwakilan dari Sumatera Utara (2012), finalis lomba Cerdas Cermat UUD 1945 di Jakarta (2009, dan 2010), Paskibraka tingkat Propinsi dan Nasional, dan lain-lain. SMA Negeri 1 Matauli Pandan juga pernah mengikuti pertukaran pelajar di Jepang (2009) dan Amerika Serikat (2012). Juga finalis Olimpiade Ilmu Sosial di Universitas Indonesia (2011 dan 2012), Lomba Debat tingkat Nasional sebagi Juara 1 (2012). Sejak tahun 2009, SMA Negeri 1 Matauli Pandan telah bekerja sama dengan Goethe Institut kedutaan Jerman, dan telah mengirimkan siswa-siswi dalam acara Sommer atau Winter Camp di Jerman, Jepang, juga Tailand (2009, 2010, 2011 dan 2012). SMA Negeri 1 Matauli Pandan juga memiliki tradisi prestasi akademik yang mengagumkan, yakni hampir setiap tahun menorehkan angka kelulusan 100% dalam Ujian Nasional. Pada Ujian Nasional 2011/2012, tradisi ini diteruskan oleh para siswa kelas XII angkatan XVI dengan nilai rata-rata mencapai 9,05 untuk program IPA dan 9,33 untuk IPS. Bahkan terdapat puluhan siswa berhasil memperoleh nilai sempurna (10) yaitu untuk mata pelajaran Kimia dan Matematika. Dalam rangka turut menyukseskan program Bupati Tapanuli Tengah yakni

Tapanuli Tengah sebagai Negeri Wisata Sejuta Pesona, SMA Negeri 1 Matauli Pandan mendukung program tersebut dengan menempatkan SMA Negeri 1 Matauli Pandan sebagai salah satu lokasi Eduwisata atau Wisata Pendidikan. Hal ini dikarenakan SMA Negeri 1 Matauli Pandan memiliki wahana tempat bermain sambil belajar di lahan seluas 20 Ha, dengan taman yang rindang dan asri. Akomodasi dan FFasilitas asilitas SMA Negeri 1 Matauli Pandan dilengkapi dengan berbagai sarana dan prasarana pendukung: ruang kelas reguler multimedia sebanyak 33 kelas, di mana masing-masing kelas dilengkapi dengan LCD proyektor, dan koneksi internet, ruang perpustakaan 2 buah yang dilengkapi dengan koneksi internet dan hotspot untuk pelayanan siswa. Kemudian, laboratorium Fisika, Kimia, Biologi dan ruang Pesona Fisika yang berbasis multimedia, Laboratorium Bahasa Multimedia dilengkapi 25 komputer dan papan tulis layar sentuh, LCD proyektor dan koneksi internet. Selain itu, ada juga koneksi internet dengan jaringan fiber optic dan wireless, serta hotspot, bangunan sekolah berlantai dua dengan setiap kelas untuk 25 siswa, asrama berlantai empat disertai ruang komputer, ruang aerobic, perpustakaan, dan audio visual, serta fasilitas pendukung lainnya. Adalah Optic Mark Reader (OMR), cafe siswa, poliklinik, gymnasium, stadion, masjid, lapangan apel dan upacara, sentle band, kolam renang, dapur umum, ruang cuci, ruang jaga, ristoks dan pool kendaraan. (*)




Tim penguji dari Pengda Tako Sumut yang akan menguji atlet saat ujian kenaikan tingkat, Selasa (18/12).

Bupati Tapteng, Ketua Pengcab Tako Tapteng Kemal Sianipar, Kadisdik, Kabag PO Rastim Bondar, Kabag Humas Iwan Sinaga, dan atlet yang akan diutus ke Kejuaraan Internasional Karate Silent Knight IV di Malaysia bulan Februari 2013 nanti.

Ujian Kenaikan Tingkat Atlet Tako Tapteng

Raja Bonaran Situmeang menyerahkan Bendera Merah Putih kepada perwakilan atlet yang akan berlaga di Malaysia. Para atlet Tako yang masih usia belia yang akan mengikuti ujian kenaikan tingkat.

Demo sparing yang diperagakan atlet tako Tapteng yang masih kalangan pelajar.

Bupati Tapteng Raja Bonaran Situmeang memberi arahan kepada para atlet.

Para orangtua atlet yang diutus berlaga ke Malaysia untuk mengikuti ujian naik tingkat.

Kemal Sianipar yang juga menjabat Kajari Sibolga menyerahkan bendera Tako kepada perwakilan atlet.

Foto & teks: Marihot Simamora Tempat & waktu: Aula Dinas Pendidikan Tapteng, di Pandan, Selasa (18/12)

ASEAN University Games XVI

Jorge Lorenzo:

ROSSI HANYA MAU MENANG JORGE LORENZO menyambut baik kedatanganValentinoRossikembalikeYamaha. Bahkan, Lorenzo mengatakan ini merupakan kesempatan bagus bagi Rossi untuk memperlihatkan dirinya masih bisa bersaing meraih kemenangan di musim 2013. The Doctor akan kembali ke pabrikan YZRM1 pada musim depan, setelah sebelumnya selama dua tahun bersama Ducati mengalami frustrasidankecewa.PebalapasalItaliaituhanya mampu mencetak tiga kali podium dalam 35 penampilan bersama Ducati. Sebelumnya, Rossi sudah mengatakan alasan untuk kembali ke Yamaha adalah mencoba memahami apakah pebalap 33 tahun itu masih dapat bersaing meraih kemenangan dan menambah rekor kemenangan miliknya, yang mana sejauh ini sudah mencatatkan 79 kali menang. Pebalap Yamaha mengatakan Rossi mengalami kesulitan untuk membuat motor Ducati lebih kompetitif. Tugas itu menurut Lorenzo, lebih berat bagi Rossi ketimbang memilih kembali memperkuat Yamaha musim 2013 mendatang. “Saya rasa tugas yang paling berat dalam karier Rossi adalah berada di Ducati dan tidak bisa bersaing. Saya rasa ini sudah sangat melukainya karena Rossi ingin sekali bersaing dan memenangi balapan dengan motor dari Italia,” kata Lorenzo. “Saya rasa Rossi sangat kecewa, tapi saya berpikir sekarang semua bisa membaik dengan situasi baru. Saya rasa Rossi memiliki kesempatanuntukmemperlihatkandiamasihmampu meraih kemenangan,” tandas pebalap asal Spanyol, dilaporkan MCN. (int)

Indonesia merebut dua medali emas di nomor estafet 4x200 meter gaya bebas putra putri ASEAN University Games, Senin (17/12) sore. Di bagian putera, regu Indonesia merebut medali emas dengan catatan waktu 7 menit 43.81 detik. tim Indonesia terdiri dari perenang Putra M. Randa, Triady Fauzi, Alexis Wijaya Ohmar dan Glenn Victor Susanto. Mereka mengungguli Thailand yang merebut medali perak dengan 8 menit 04.88 detik dan Malaysia yang meraih perunggu dengan 08.19.65 dalam lomba yang berlang-

sung di Aquatic Centre, National Sports Complex, Vientiane. Emas juga diraih tim estafet 4x200 meter puteri yang terdiri dari Enny Susilawati, Kathriana Mella, Ressa Kania Dewi dan Patricia Yosita yang mencatat waktu 8 menit 40.01 detik. Tim Malaysia berada di tempat kedua dengan 8 menit 45.90 detik dan Thailand meraih perunggu dengan 9 menit 03.456 detik. Dalam ASEAN University Games XVI yang berlangsung 12-20 Desember ini, kontingen Indonesia masih berada di urutan lima dengan 17 emas, 30 perak dan 42 perunggu. (int)

Taufik Hidayat

UNGGULAN UTAMA TAUFIK HIDAYAT dan Saina Nehwal menjadi unggulan pertama turnamen bulu tangkis Syed Modi International India GP Gold. Turnamen berhadiah total 120.000 dolar AS ini akan berlangsung Selasa (18/12) hingga Minggu (23/12). Di bagian putera, Taufik diikuti pemain India, Kashyap Parupalli yang merupakan perempatfinalis Olimpiade London, JuliAgustus lalu. Dua pemain Indonesia lainnya, Tommy Sugiarto dan Alamsyah Yunus diunggulkan di tempat ketiga dan kelima. Parupalli yang baru pulih dari cedera mengaku sangat antusias mengikuti turnamen ini. “Saya ingin melihat kondisi saya setelah pulih dari cedera. Ini merupakan turnamen yang sangat penting buat para pemain India. Saya sendiri berharap ini menjadi persiapan baik sebelum Malaysia Tebuka, awal Januari.” (int)

Daud Yordan

Ditantang Petinju Filipina PETINJU Filipina, Jun “Hercules” Doliguez melempar tantangan kepada juara dunia kelas bulu IBO asal Indonesia, Daud “cino” Yordan untuk suatu perebutan gelar. Doliguez dianggap sebagai petinju prospek bagus di Filipina. Petinju dengan rekor bertarung 15-0-1 (11 KO) ini memang memiliki pukulan yang keras dan dianggap sepadan menghadapi Yordan yang memiliki rekor bertarung 30-2 dengan 23 KO. Sabtu pekan lalu, Doliguez mengempaskan lawannya, Eric Rapada di ronde keenam dalam pertarungan di Angoncillo, Batangas, Filipina. “Di mana saja, kapan saja, ayo Cino, bawa gelarmu dan aku akan menyakitimu,” kata Doliguez. Promotor Yordan, Dragon Fire memang sempat menyebar poll kepada para penggemar tinju Filipina tentang siapa petinju negara tersebut yang sepadan menantang Yordan. Doliguez dipilih oleh 64 persen responden.Nama-namalainyangdisebutantaralain Rey “Boom Boom” Bautista, Marvin Sonsona dan Lorenzo Villanueva. “Sayatekankan,sayasiapmenghadapidia.Jikapara promotor sepakat, ia akan merasakan kerasnya pukulan saya,” kata Doliguez. Daud Yordan baru saja mempertahankan gelar juara dunia kelas bulu IBO dengan mengalahkan petinju Inggris, Choijiljavyn “Choi” Tseveenpurev di Marina Bay Sands, Singapura. Jika terjadi kesepkatan, maka ini merupakan kali kedua, Yordan mempertahankan gelarnya yang direbutsaatmengempaskanpetinjuFilipinaLorenzo Villanueva di ronde kedua, Mei lalu. (int)


RABU 19 Desember 2012













2 Man City







3 Chelsea







4 Tot Hotspur







K emenangan besar dengan skor 5-2 yang didapat Arsenal atas R eading disebut Arsene W enger sangatlah penting. Hasil tersebut menunjukkan kalau ‘Gudang Peluru ’ bisa memberi reaksi atas kondisi buruk yang baru diterima.



KLUB Swansea City

GOL 12

2 R van Persie

Manchester United


3 D Ba 4 L Suárez

Newcastle United Liverpool

11 10

5 J Defoe

Tottenham Hotspur


6 M Fellaini




16 15





2 Atlético Madrid

16 12





3 Real Madrid

16 10





4 Málaga








KLUB Barcelona

GOL 25

2 R Falcao

Atlético Madrid


3 Cristiano Ronaldo

Real Madrid


4 Aduriz

Athletic Club


5 Rubén Castro

Real Betis


6 Negredo



SERIA A ITALIA KLASEMEN SEMENTARA 1 Juventus 17 13 2 Internazionale 17 11 3 Napoli 17 10 4 Lazio 17 10

2 1 3 3

2 5 4 4

36-10 29-18 31-17 25-18

41 34 33 33


KLUB Milan

GOL 14

2 E Cavani



3 A Di Natale



4 M Klose



5 E Lamela



6 D Milito



3 3 6 3

1 4 3 5

44-7 33-22 35-20 33-27


KLUB Bayer Leverkusen

GOL 12

2 A Meier

Eintracht Frankfurt


3 V Ibiševiæ



4 R Lewandowski

Borussia Dortmund


5 M Mand•ukiæ

Bayern München


6 T Müller

Bayern München


ketinggalan menjadi 4-1. Kebangkitan tuan rumah seketika menyeruak setelah di menit 69 Reading berhasil mencetak gol keduanya. Kali ini Jimmy Kebbe yang menjebol gawang The Gunners.

Tapi kisah dramatis comeback Reading tidak terjadi di laga ini karena di menit 80 justru Arsenal yang berhasil menambah jumlah golnya. Membangun serangan dari tengah, Cazorla yang menusuk menuju kotak penalti

melepaskan umpan pada Walcott. Dengan satu gerakan, pesepakbola Inggris itu menipu bek lawan dan melanjutkan aksinya dengan melepaskan tembakan terarah yang menjadi gol. 5-2 untuk Arsenal. (int)

Persembahan Terakhir Duric

KLASEMEN SEMENTARA 17 13 17 10 17 8 17 9

ngan 3 assist dan 27 tembakan ke gawang, Giroud yang membukukan satu assist dan 47 tembakan, serta Theo Walcott yang memiliki catatan assist sama yaitu 4, tapi cuma 22 kali melakukan sepakan ke gawang. Atas performa Cazorla sejauh 17 laga di Premier League ini, manajer Arsenal, Arsene Wenger pun sudah memiliki penilaian. “Santi Cazorla adalah pemain berkualias top dan dia hanya menggambarkan bahwa dirinya merupakan pembelian yang tepat,” ucap Wenger di situs resmi Arsenal. Pujian kepada Cazorla pun juga terlontar dari mulut rekannya di lini tengah Arsenal, Jack Wilshere. “Kemampuannya sebagai pemain yang serba bisa sungguh luar biasa. Sangat berat bagi siapa saja yang berasal dari Spanyol untuk bermain di Premier League. Tapi, ia membuatnya terlihat sangat mudah,” ungkap Wilshere seperti dilansir oleh AFP. Jalan Pertandingan Pertandingan baru berjalan 13 menit saat Arsenal berhasil membuka keunggulan. Bermula dari tusukan Kieran Gibbs di sisi kanan pertahanan Reading, dia kemudian melepas umpan silang ke kotak penalti. Memanfaatkan buruknya pengawalan pemain Reading, Podolski dengan mudah menceploskan bola ke dalam gawang. Empat menit kemudian Cazorla nyaris membuat ‘Gudang Peluru’ menggandakan keunggulan saat tendangan jarak jauhnya melenceng tipis dari sasaran. Tim tamu akhirnya bisa menggandakan keunggulan di menit 30, dengan skenario yang nyaris serupa seperti gol pertama. Kali ini Podolski yang menyisir di sisi kanan pertahanan Reading, dia kemudian melepaskan umpan crossing ke muka gawang dan dibelokkan menjadi gol oleh Cazorla menggunakan kepalanya. Dua menit berselang Cazorla kembali mencatatkan namanya di papan skor. Menyambar bola yang sempat disundul Gibbs saat mencoba meneruskan umpan dari Podolski, Cazorla membawa Arsenal kini unggul 3-0. Enam menit babak kedua berjalan Cazorla nyaris membuat hat-trick kalau saja Adrian Mariappa tidak menghalau bola tepat di garis gawang Reading. Tapi trigol Cazorla kemudian tinggal menunggu waktu saka karena di menit 59 satu sontekan pesepakbola asal Spanyol itu membuat kedudukan berubah menjadi 4-0. Tertinggal empat gol sama sekali tak membuat Reading menyerah. Bermula dari kesalahan umpan di sektor pertahanan, Adam le Fondre dengan tenang melewai Szczesny saat dalam posisi satu lawan satu untuk kemudian menceploskan bola ke dalam gawang. Di menit 65 Reading memperkecil



1 München 2 Leverkusen 3 Dortmund 4 Frankfurt

iwarnai hat-trick Santi Cazorla, plus dua gol lainnya dari Lukas Podolski dan Theo Walcott, Arsenal memetik kemenangan mutlak dengan skor 5-2 dalam lawatan ke Reading. Kemenangan tersebut mengantar The Gunners naik ke posisi lima klasemen dengan poin 27.Terlepas dari langkah naik Arsenal ke papan atas, hal lain yang membuat Wenger sangat puas dengan raihan anak didiknya adalah terkait reaksi yang diberikan setelah mereka dapat hasil buruk pekan lalu. Melalui adu penalti, Arsenal disingkirkan Bradford City di babak perempatfinal Piala Liga Inggris. “Targetnya adalah meraih kemenangan dengan meyakinkan. Kami fokus dengan pertandingannya. Saat kedudukan 4-0 kami menjalani periode ‘melayang’. Dan dalam posisi 42, setelah apa yang terjadi pekan lalu, kami mulai tak pasti. Kami sedikit kehilangan fokus dan harus membayarnya. Tapi secara keseluruhan penting buat kami untuk bermain dan memberikan jawaban di atas lapangan,” sahut Wenger di Skysports. “Selama 16 tahun cuma sekali kamu kalah dari tim yang berasal dari divisi lebih rendah. Jika Anda membandingkan rekor tersebut dengan klub lain di Inggris, itu masih jadi yang terbaik.” “Saya setuju kalau (kekalahan) itu menyakitkan, dan sangat mengecewakan. Tapi malam itu Bradford tampil sangat baik. Saya bertanggung jawab saat kondisinya berjalan baik dan saya menerima kritik saat kondisinya menjadi buruk,” tuntas Wenger. Cazorla Terbaik di Arsenal Santi Cazorla layak dinilai menjadi pemain yang memiliki rapor bagus saat membela Arsenal. Catatan statistik membuktikan pemain seharga 16,5 juta poundsterling itu merupakan yang terbaik. Cazorla tampil apik saat tim ‘Gudang Peluru’ menundukkan Reading dengan skor telak 5-2. Pemain yang baru didatangkan dari Malaga di awal musim 2012-2013 itu mengemas hat-trick dalam laga yang berlangsung di Madejski Stadium, Selasa (18/12) dinihari. Dengan tiga gol yang dia bikin itu, Cazorla pun menjadi top skorer sementara The Gunners dengan koleksi tujuh gol. Dengan torehan itu, dia bahkan lebih produktif dibandingkan dengan Lukas Podolski dan Theo Walcott (5 gol), serta Olivier Giroud (4 gol). Lebih detil lagi Soccernet mencatat bahwa Cazorla menjadi pemain yang paling sering melakukan tembakan ke gawang, yaitu 59 kali. Pesepakbola 29 tahun itu juga menyumbangkan empat assist bagi tim yang bermarkas di Emirates Stadium itu. Catatan Cazorla itu merupakan yang tertinggi di antara pemain Arsenal lainnya. Torehan pemain asal Spanyol itu berturut diikuti oleh Podolski de-

42 33 30 30

Aleksandar Duric sudah tidak muda lagi, sudah 42 tahun. Turnamen Piala AFF kali ini pun akan menjadi yang terakhir untuknya. Oleh karenanya, wajar jika ia ingin mengakhirinya dengan sebuah trofi. Seorang pemain yang ingin mengakhiri kariernya dengan sebuah pencapaian adalah romantisme yang lazim dalam sepakbola (atau olahraga manapun). Namun demikian, tak semuanya berujung kesuksesan. Zinedine Zidane pernah punya harapan yang sama pada Piala Dunia 2006 dan kita semua tahu seperti apa ujungnya. Di sisi lain, Duric, yang sudah mengatakan ini akan menjadi Piala AFF terakhirnya, tentu tidak berharap akan berakhir seperti Zidane. Karier Duric di tim nasional tergolong tidak lazim, jika Anda menilainya demikian. Pada usia 37 tahun, ketika banyak pemain sepakbola biasanya sudah pensiun, dia baru memperkuat timnas Singapura. Debutnya melawan Tajikistan diwarnai oleh sepasang gol dan sejak saat itu dia seperti menjadi jimat

untuk The Lions, meski tidak selalu bermain. Di Piala AFF tahun ini pun juga demikian. Duric kerap memulai pertandingan dari bangku cadangan dan baru satu gol dia sumbang. Tapi, toh demikian, dia mengaku siap untuk berkontribusi untuk tim apa pun bentuknya. “Saya memang tidak mencetak gol, tapi yang terpenting berkontribusi untuk tim,” ucapnya seusai laga semifinal kedua melawan Filipina. Laga itu sendiri berakhir dengan kemenangan 1-0, di mana Khairul Amri mencetak satu-satunya gol. Singapura pun berhasil melaju ke final dan kini hanya tinggal satu langkah lagi bagi Duric untuk mencapai impiannya. “Mencapai babak final tahun ini seperti sebuah mimpi yang jadi kenyataan,” ucapnya di situs resmi Piala AFF. “Saya sudah bermain di turnamen ini pada 2008 dan 2010, jadi ini merupakan turnamen ketiga saya dan saya senang bisa bermain di final karena ini adalah kesempatan terakhir saya. Saya akan pensiun setelah

turnamen ini, saya sangat ingin mencapai final dan kami berhasil melakukannya.” “Pada saat bersamaan, kami sudah membuktikan penilaian banyak orang salah dengan melaju sampai ke final. Tak banyak orang percaya kami bisa lolos dari fase grup. Tapi, seiring berjalannya pertandingan, kami berkembang sebagai sebuah tim dan menunjukkan bahwa kami benar-benar tim yang bagus.” Duric menjadi warga negara Singapura pada 2007 dan sejak saat itu sudah memainkan laga internasional sebanyak 51 kali. Dari puluhan kesempatan itu, ia sukses mencetak 24 gol. Dengan usia yang sudah kepala empat, ia hanya bisa bersyukur atas pencapaian yang sudah didapatnya sejauh ini. “Sejujurnya, saya tidak pernah menyangka bisa bermain di final bersama tim nasional. Saya harus bersyukur karena dengan usia seperti saya, mendapatkan 50 caps untuk tim nasional adalah pencapaian yang luar biasa,” kata pria yang pernah memperkuat BosniaHerzegovina di Olimpiade 1992 di cabang dayung ini. (int)









Edisi 309 „ TTahun ahun V

Rabu, 19 Desember 2012


Murid TK Diculik Honorer Minta Uang Dik embalikan u lal Dicabuli Parbetor KISARAN-Ternyata, korban pencaloan honorer atau tenaga kerja sukarela di DPRD Asahan bukan cuma Suriadi dan Kuswandi. Tetapi, ada beberapa orang lagi yang juga masih kerabat mereka, menjadi korban dijanjikan menjadi honorer di Pemkab Asahan. Kepada METRO, Suriadi mengaku bahwa janji dirinya dan beberapa keluarganya diangkat jadi PNS tidak kunjung terealisasi, padahal selama 18 bulan menjadi honorer tidak pernah mendapatkan gaji, bahkan ketika awal menerima

MEDAN-Bocah 5 tahun sebut saja namanya Bunga, murid taman kanak (TK) warga Jalan Kiwi Medan Sunggal, diculik dan dicabuli tukang becak mesin (Parbetor,red) Sony Liston (35),warga Jalan Sei Seguti Medan Petisah, Jumat (14/12). Perbuatan Sony terungkap, ketika korban menceritakan peristiwa yang dialami kepada orangtuanya dan langsung melapor ke Polsek Medan Baru, Rabu (18/12).

‹‹ Baca Honorer...Hal 6

Pak Lurah Poligami, Istri Pertama Ngadu ke Bupati

‹‹ Baca Murid ...Hal 6

Satu Bulan, 18 Kasus Narkoba Diungkap

19 Pengedar, 8 Pemakai Ditangkap KISARAN-Dalam kurun waktu satu bulan, 18 kasus narkoba berhasil diungkap Satuan Narkoba Polres Asahan. Dari 27 tersangka yang diamankan, 19 orang diantaranya pengedar dan 8 orang pemakai narkoba. Kapolres Asahan AKBP Yustan Alpiani melalui Kasat

‹‹ Baca 19 Pengedar ...Hal 6

Nadia Vega

Ingin Punya Pasangan TAHUN akan segera berganti, begitu pula dengan rencana, termasuk untuk artis peran Nadia Vega (25). Untuk 2013 Nadia sudah memiliki keinginan mengenai karier dan kehidupan pribadinya. Dalam berkarier, Nadia ingin berkonsentrasi pada kegiatan bernyanyi. “Pingin

‹‹ Baca Ingin ...Hal 6

„ Imran Nasution, orangtua Suriadi


„ Massa dari Migrant Care melakukan aksi di Bundaran HI, Jakarta, Selasa (18/12/2012). Dalam rangka memaknai Hari Buruh Migran Sedunia yang jatuh setiap 18 Desember, mereka menuntut komitmen pemerintah Indonesia untuk perlindungan buruh migran Indonesia sebagai tanggung jawab konstitusi.

Penanganan Kasus KORUPSI GOR Bertele-tele

KISARAN-Penangananan dugaan korupsi GOR oleh Unit Tipikor Satreskrim Polres Asahan terkesan berteletele. Hingga kini, belum jelas sejauh mana pihak polisi telah menangani kasus tersebut. Ironisnya, beredar issu yang menyebutkan, oknum tertentu dari

‹‹ Baca Penanganan ...Hal 6

Siti Kholifah, Penggagas Kelas Hamil di Pacitan, Nomine Srikandi Award 2012

Tiap Bulan Terima Murid Remaja Korban KTD Kasus kehamilan tidak diinginkan (KTD) pada remaja di Desa Ploso, Pacitan, Jawa Timur, menginspirasi Siti Kholifah. Bidan desa itu membuat kelas hamil untuk mengedukasi para remaja putri tentang pentingnya gizi sekaligus risiko hubungan seks di luar nikah. Sekaring Ratri Adaninggar JAKARTA

‹‹ Baca Tiap ...Hal 6


PENGABDIAN: Nominasi Srikandi Award Bidan Siti Kholifah asal Ploso, Pacitan

Di Kantor Dinas Dukcapil Batubara BATANG TORU- SKN, oknum Pegawai Negeri Sipil (PNS) di Kelurahan Aek Pining, Kecamatan Batang Toru, Kabupaten Tapanuli Selatan (Tapsel), mengadukan suaminya, HH, yang menjabat sebagai lurah, kepada Bupati

Tapsel, Selasa (18/12). Aduan tersebut berisi keluhan SKN atas perlaku suaminya yang pergi dari rumah sejak bulan April dan melakukan poligami (praktik pernikahan lebih dari satu istri, red) dengan EEH. Bukan hanya itu, HH juga menggugatnya cerai

‹‹ Baca Pak ...Hal 6



19 Desember 2012

214 WNI Terancam Hukuman Mati

Kelelahan, Presiden Irak Dilarikan ke RS BAGHDAD- Presiden Irak Jalal Talabani dilarikan ke rumah sakit di Baghdad, Irak. Dia mengalami “masalah kesehatan” akibat kelelahan sehingga harus dirawat di RS. ”Dikarenakan kelelahan, Talabani mengalami masalah kesehatan dan diangkut ke rumah sakit di Baghdad,” demikian pernyataan di situs kepresidenan Irak seperti dilansir kantor berita AFP, Selasa (18/12). Talabani dilarikan ke RS pada Senin, 17 Desember malam waktu setempat. Namun tidak disebutkan lebih lanjut mengenai kondisinya saat ini. Talabani telah mengalami sejumlah masalah kesehatan dalam beberapa tahun terakhir. Dia menjalani operasi jantung di Amerika Serikat pada Agustus 2008 lalu. Setahun sebelumnya, Talabani harus dievakuasi ke negara tetangga Yordania untuk menjalani perawatan atas dehidrasi dan kelelahan. Talabani juga telah bepergian ke AS dan Eropa untuk menjalani perawatan atas sejumlah penyakit yang dideritanya. (dtc/int)

60 Persen Kasus Narkoba JAKARTA - Kementerian Luar Negeri (Kemlu) memberi penjelasan soal WNI yang terancam hukuman mati di luar negeri. Data di Kemlu hingga Desember tercatat ada 214 orang yang terancam hukuman mati. ”Menurut data yang dimiliki Kemlu, seluruh WNI di luar negeri, bukan TKI saja yang terancam hukuman mati berjumlah 214 orang. Dan itu bukan berarti mereka sudah selesai proses hukumnya semua, ada yang baru pengadilan pertama,

banding, kasasi dan ada yang memang sudah selesai,” kata juru bicara Kemlu, Michael Tene dalam keterangannya, Selasa (18/12). Michael memberikan keterangan itu terkait keterangan Migrant Care mengenai 420 orang

„ Juru bicara Kemlu, Michael Tene memberikan keterangan terkait TKI yang terancam hukuman mati di luar negeri. buruh migran yang terancam hukuman mati di luar negeri.

Lindungi Buruh, Menakertrans Terbitkan Surat Edaran

Sebar Isu Kiamat, 93 Orang Ditahan BEIJING-Aparat keamanan China menangkap 93 orang atas tuduhan menyebarkan desas-desus mengenai kiamat. Hal itu diungkapkan Kantor Berita Xinhua, Selasa (18/12). Pihak berwenang juga menangkap seorang pria yang melukai 23 anak di sebuah sekolah setelah ia mengalami gangguan kejiwaan akibat ramalan kiamat. Ke-93 orang yang ditangkap, yang berasal dari tujuh provinsi, mencakup anggota-anggota sekte Tuhan Yang Maha Kuasa, tulis Xinhua yang menambahkan bahwa mereka dibekuk karena membagikan selebaran mengenai wahyu dan menyebarkan desasdesus. ”Anggota-anggota sekte ini belum lama ini menyebarkan skenario kiamat suku Maya yang meramalkan Matahari tidak akan bersinar dan listrik tidak akan berfungsi selama tiga hari mulai 21 Desember,” kata kantor berita itu, mengutip biro keamanan umum Xining, ibu kota provinsi Qinghai, China baratdaya. China melakukan operasi penumpasan terhadap sekte Tuhan Yang Maha Kuasa yang juga menyerukan perang menentukan untuk membasmi Partai Komunis Naga Merah. Partai Komunis China tidak membiarkan penentangan atas kekuasaannya dan ingin menjaga stabilitas sosial. Namun, mereka terus menghadapi desas-desus yang seringkali menyebar dengan cepat di Internet. Dalam sebuah laporan terpisah Xinhua mengatakan, polisi di provinsi Henan menangkap seorang pria yang diidentifikasi sebagai Min Yongjun, setelah ia melukai 23 anak di sebuah sekolah dasar dan seorang perempuan dewasa di rumahnya dekat sekolah itu. (dtc/int)

Badai Evan Hantam Fiji AUSTRALIA- Siklon terbesar yang menyerang Fiji dalam 20 tahun mengakibatkan kerusakan parah dengan kecepatan angin 200 km/jam. Ribuan orang mengungsi di barak-barak pengungsian ketika badai kategori empat itu menerjang dan menghancurkan rumah warga, memutus aliran listrik serta memicu banjir bandang. Siklon Evan telah diturunkan kategorinya dan diperkirakan akan melemah saat mendekati perairan selatan. Tidak ada korban jiwa di Fiji. Sedangkan di Samoa pekan lalu Evan menewaskan lima orang. Negara kepulauan itu tidak menyiarkan peringatan dirni ketika badai tropis menyerang akhir pekan lalu. Otoritas Samoa mengatakan bahwa selain korban tewas, 10 orang warga masih dinyatakan hilang. Di Fiji, Pulau Viti Levu di sebelah barat Fiji menjadi daerah dengan kerusakan terparah. Kota terbesar kedua di negara itu, Lautoka, tampak seperti ‘zona perang’ pasca serangan Evan, seperti dilaporkan harian Fiji Times. Hujan deras mengakibatkan sungai-sungai meluap dan merendam jalan raya serta jembatan, sedangkan angin kencang menumbangkan tiang listrik dan menerbangkan atap bangunan. Ratusan keluarga diminta mengungsi karena struktur bangunan perumahan yang dinilai tidak aman. Lebih dari 8.000 orang menyelamatkan diri ke 137 pusat evakuasi kata Kementerian Penerangan. (dtc/int)

”Sejauh ini proses hukumnya masih dalam upaya pemerintah

untuk membebaskan mereka dari hukuman mati. Dari 214 orang itu, 60 persen lebih yaitu sekitar 135 adalah kasus narkoba,” terang Michael. Michael juga menjelaskan, sebagai gambaran, selama tahun 2012 pemerintah sudah membebaskan 110 WNI dari hukuman mati. Hal itu sebagai bentuk konkrit pemerintah untuk melindungi warga negaranya. ”Tapi yang jelas, membebaskan WNI dari hukuman mati itu bukan upaya yang mudah. Tapi pemerintah sudah membebaskan 110 orang,” tutur Michael. (dtc/int)

„ Adhyaksa Dault mendatangi kantor KPK, Selasa (18/12).


JAKARTA—Menteri Tenaga Kerja dan Transmigrasi (Menakertrans) Muhaimin Iskandar, menerbitkan Surat Edaran terkait antisipasi pelaksanaan upah minimum tahun 2013. Surat edaran nomor 248/ Men/PHIJSK-PJS/XII/2012 yang terbit tertanggal 17 Desember 2012 tersebut, ditujukan kepada 33 Gubernur di seluruh Indonesia. Kepala Pusat Humas Kemnakertrans Suhartono mengatakan, dalam surat edaran diterbitkan untuk mengantisipasi dampak kelangsungan usaha di industri padat karya akibat kenaikan upah minimum 2013. Usaha padat yang dimaksud antara lain usaha tekstil, alas kaki dan indutri mainan. “Kenaikan upah minimum yang signifikan dibandingkan tahun tahun sebelumnya memang harus

diantisipasi dengan baik. Jangan sampai mengakibatkan pengurangan jumlah pekerja atau berkurangnya kesempatan kerja,” ungkap Suhartono di Gedung Kemenakertrans, Jakarta, Selasa ( 18/12). Dijelaskannya, kenaikan upah minimum dimaksudkan untuk penyesuaian daya beli terhadap kebutuhan hidup pekerja atau buruh dalan rangka mewujudkan ketenangan bekerja dengan tetap memperhatikan kelangsungan usaha. “Maka itu, pemerintah meminta agar para Gubernur dapat lebih proaktif memberikan penjelasan dan pemahaman kepada perusahaan industri padat karya yang beorientasi ekspor. Karena, agar dapat melaksanakan kebijakan penetapan upah minimum tahun 2013,” jelasnya. (cha/jpnn)

KPK PERIKSA ADHYAKSA DAULT JAKARTA—Komisi Pemberantasan Korupsi (KPK) tak mau berlama-lama menelusuri peran mantan Menpora Andi Mallarangeng dalam dugaan korupsi di proyek Hambalang. Untuk menelusuri apa peran Andi, KPK pun memanggil mantan Menpora sebelum Andi, Adhyaksa Dault. Dia dinilai mengerti soal proyek Hambalang dan keterangannya dianggap penting. Ya, Adhyaksa diperiksa sebagai saksi dalam kasus dugaan korupsi di proyek pembangunan pusat olahraga Hambalang. Adhyaksa datang seorang diri sekitar pukul

10.00 WIB. Ia membawa sebuah map berisi surat panggilan dari KPK dan beberapa lembar surat lainnya. ”Saya datang sebagai saksi untuk mantan Menpora, Andi Mallaranggeng,” ujar Adhyaksa di depan gedung KPK, Selasa (18/12). Sebelumnya, Andi menyebut proyek pembangunan Hambalang adalah lanjutan dari kebijakan Adhyaksa. Namun, hal tersebut dibantah Adhyaksa. Menurutnya, proyek tersebut sudah melenceng jauh dari perencanaan awal yang dibuat Kementerian Pemuda dan Olahraga di era jabatannya. Adhyaksa dulunya juga

menampik bahwa saat ia menjadi Menpora proyek ini sudah berjalan. Ia mengatakan, saat menjabat, di lahan Hambalang itu memang sudah berdiri sebagian b angunan dan pagar di sekeliling proyek. Namun pembangunan ini dilakukan bukan oleh Kemenpora. Proyek itu adalah limpahan dari Kemendiknas, di mana sejak 2003 memang sudah dibangun. Namun, saat itu dihentikan oleh BPK karena belum memiliki sertifikat lahan. “Saya akan jelaskan semua yang saya ketahui di zaman saya pada KPK,” pungkas Adhyaksa. (flo/jpnn)

„ Menakertrans Muhaimin Iskandar memberikan keterang pers terkait Surat Edaran antisipasi pelaksanaan upah minimum tahun 2013.

KPK Kembali Cek Akbar Tolak Ruhut Kembali ke Golkar Fisik Simulator SIM JAKARTA - Dewan Pertimbangan Partai Golkar punya pikiran berbeda dengan DPP Partai Golkar mengenai kesediaan menampung kembali Ruhut Sitompoel bila hengkang dari PD. Sejauh ini sama sekali tidak ada rencana Partai Golkar merekrut mantan politisinya tersebut. ”Tidak ada pikiran (menerima Ruhut). Kader kami masih banyak,” ujar Ketua Dewan Pertimbangan Partai Golkar, Akbar Tandjung, usai menghadiri Silaknas ICMI di Jakarta Convention Center, Senayan, Jakarta Selatan, Selasa (18/12). Menurut Akbar, masih banyak kader muda di Golkar yang memiliki potensi karir politik yang bagus. ”Urusan Ruhut itu urusan partai Demokrat. Kan dia sudah ada disitu,” terangnya. Seperti diketahui, akhir pekan lalu DPP PD resmi mencopot Ruhut Sitompoel dari jajaran kepengurusan. Bila mantan praktisi hukum itu berniat hengkang, Partai Golkar terbuka untuk menampung mantan politisinya tersebut. ”Kembali menjadi anggota Golkar boleh. Tetapi untuk menjadi caleg ada kriterianya,” kata Ketua DPP Golkar, Hadjriyanto Y Thohari,

„ Akbar Tanjung kepada wartawan di Gedung DPR, Senayan, Jakarta, Senin (17/12). Karir Politik Ruhut di Partai Demokrat Tergantung SBY Pemecatan Ruhut Sitompul dari Dewan Pengurus Pusat Partai Demokrat belum berarti karir politik Ruhut di partai berlambang Mercy tersebut selesai. Karir politik Ruhut ada di tangan SBY sebagai Ketua Dewan Pembina. ”Dia (Ruhut) kan sudah tidak mengurus tapi masih anggota dewan. Saya melihat ini untuk 2014, semua partai menyusun calon legislatifnya, ini kan tidak terlepas dari peran pengurus, walaupun pengambil keputusannya Pak SBY. Kalau tidak menambah kualitas PD ya ditentukan akan diputus atau tidak. Dia akan dipertimbangkan secara serius,” kata

pengamat politik dari LIPI, Siti Zuhro, pada detikcom, Selasa (18/ 12). Memanasnya persoalan Ruhut yang tidak mengurus lagi, dinilai terkait dengan posisi Partai Demokrat yang dianggap mulai menurun citranya di mata masyarakat. Zuhro yakin keputusan tegas akan diambil oleh SBY. ”Demokrat ini kan Pak SBY. Ini juga masalah berat karena Pak SBY tidak mencalonkan lagi, dan siapa next leader yang leadershipnya kan dipatuhi ini memang hal yang berat di Demokrat. Kalau sangat masuk akal dan argumentatif, saya pikir Pak SBY tegas,” ujar Zuhro. Zuhro menilai vokalnya Ruhut yang meminta Anas Urbaningrum mundur dari Ketua Umum Partai Demokrat karena faktor kultur. Sedangkan Anas sendiri tidak melakukan vokal sefrontal Ruhut. ”Waktu yang akan membuktikan apakah Ruhut yang membangun? Partai ini mau dikemanakan, itu siapa? Itu akan kelihatan. Semacam disuguhi pertunjukkan seperti itu, dari kemarin ada keberangan dari kubu Anas dan lainnya yang menunjukkan jangan mensubordinasi Anas. (dtc/int)

JAKARTA- Komisi Pemberantasan Korupsi kembali melakukan pemeriksaan fisik simulator berkendaraan roda dua dan roda empat ujia surat izin mengemudi (SIM) di sejumlah tempat, Selasa (18/12). Pengecekan dilakukan untuk mencocokan spesifikasi alat dengan kondisi fisik di lapangan terkait penyidikan kasus dugaan korupsi proyek simulator SIM Korps Lalu Lintas (Korlantas) Polri. “Terkait Korlantas, hari ini KPK melakukan sejumlah kegiatan dalam rangka mengecek fisik simulator di beberapa tempat,” kata Juru Bicara KPK Johan Budi di Jakarta. Menurut Johan, tim penyidik KPK hari ini mengecek fisik simulator SIM yang ada di Depok, Serpong, Tangerang, Bekasi, dan Samsat Daan Mogot. Pengecekan ini akan dilanjutkan ke Kabupaten Bogor. Johan menambahkan, pihaknya mendapat dukungan penuh dari Kepolisian dalam pengecekan tersebut. “Perlu disampaikan bahwa kami didukung penuh oleh Polri dalam pengecekan tersebut,” katanya.

Dalam kasus ini, KPK menetapkan empat tersangka, yakni mantan Kepala Korlantas Polri Inspektur Jenderal Polisi Djoko Susilo, Mantan Wakil Kepala Korlantas, Brigadir Jenderal Polisi Didik Purnomo, Direktur Utama PT Citra Mandiri Metalindo Abadi (CMMA) Budi Susanto, serta Direktur PT Inovasi Teknologi Indonesia (ITI) Sukotjo S Bambang. Mereka diduga bersama-sama melakukan perbuatan melawan hukum dan penyalahgunaan wewenang untuk menguntungkan diri sendiri atau pihak lain namun justru merugikan keuangan negara. Diduga, timbul kerugian negara sekitar Rp 100 miliar dari proyek ini. KPK menduga ada penggelembungan harga simulator SIM roda dua dan roda empat yang tendernya dimenangkan PT CMMA. Perusahaan Budi tersebut memenangkan tender proyek simulator SIM roda dua dan roda empat senilai Rp 196,8 miliar. Dalam pelaksanaannya, PT CMMA diduga membeli barang dari PT Inovasi Teknologi Indonesia dengan harga Rp 90 miliar. (kmc/int)


19 Desember 2012 “IMF sama sekali tidak demokratis karena didominasi oleh pemegang saham dari negara-negara besar dan masih menerapkan agenda-agenda neoliberal sebagai syarat penyaluran utang,” Koordinator Koalisi Anti Utang (KAU), Dani Setiawan.

Kirim Opini Anda ke email: metroasahan Maksimal tulisan 5.000 karakter

Sikap Kami Menggantung Kursi Menteri KONSTITUSI kita secara terang benderang sudah menggariskan sistem pemerintahan kita ialah presidensial. Sistem itu di antaranya menegaskan hanya presidenlah yang memegang hak prerogatif untuk mengangkat, memberhentikan, dan mengganti para menteri. Namun, urusan yang mestinya amat mudah, benderang, dan lumrah tersebut menjadi rumit, remang-remang, bahkan terkadang genting. Urusan reshuffle kabinet pun seolah menjadi persoalan hidup mati. Celakanya, sang pemilik mandat prerogatif seperti bergeming menonton ‘drama’ tidak bermutu itu. Presiden kerap terlambat, bahkan terkesan mengulur waktu sehingga kegaduhan akibat isu reshuffle terus menggema hampir saban tahun. Dalam kasus kekosongan kursi menteri pemuda dan olahraga (menpora), misalnya, Presiden Susilo Bambang Yudhoyono memilih sikap menunggu. Padahal, sang pemilik kursi sebelumnya,AndiAlifianMallarangeng,sudahmundursejakdelapanhari lalu. Untuk sementara, entah sampai kapan, posisi menpora diisi oleh Menko Kesra Agung Laksono sebagai pejabat sementara menpora. Agung, yang kesibukannya sebagai menko kesra kita asumsikan berjibun, harus membereskan urusan olahraga dan kepemudaan yang juga ruwet dan pelik. Baru sehari menjabat menpora saja, Agung harus dihadapkan pada tenggat menyelesaikan kisruh di PSSI. Belum lagi kerja-kerja mengoordinasikan persoalan kesejahteraan rakyat, bencana di sejumlah tempat, dan bahkan soal flu burung yang mulai bermutasi ke itik, yang amat mendesak dibereskan. Jelas, akan ada yang dikorbankan jika dua bahkan tiga urusan penting datang secara bersamaan. Karena itu, amat susah membayangkan segalanya akan berakhir efektif dan tepat waktu. Kecuali, Presiden menganggap bahwa kursi menpora tidak teramat penting untuk diisi pejabat definitif. Presiden, misalnya, menganggap urusan kepemudaan dan olahraga sudah bisa diatasi institusi yang selama ini ada, baik dengan atau tanpa kehadiran menpora. Urusan olahraga, contohnya, bisa diurus Komite Olahraga Nasional Indonesia (KONI). Hal ihwal kepemudaan boleh digarap organisasi ekstrakampus seperti HMI, GMNI, PMII, PMKRI, GMKI, atau KNPI. Sah-sah saja kalau Presiden berpikiran seperti itu. Namun, jangan diam, sembunyi-sembunyi, atau terus menimbangnimbang. Umumkan ke publik bahwa kursi menpora bisa diperankan institusi lain di negeri ini. Bahkan kalau perlu, berikan argumentasi yang sahih mengapa kursi menpora tidak dibutuhkan lagi. Bukankah meskipun ada menpora, prestasi olahraga kita sejauh ini jalan di tempat, bahkan cenderung merosot? Mengambangkankeputusanberhari-harijustrumenambahdosis kegaduhanyangmestinyatidakperluada.Ditengahmenumpuknya persoalan yang jauh lebih besar di negeri ini, menghadirkan kegaduhanyangtidakperlusepertimenyetelkasetrusakberulangulang.Amatmenyebalkandanmembikinpusing.(*)

“Penjara itu hanya untuk orang kriminal, bukan untuk orang yang berbeda pandangan dengan kita. Saya sampaikan itu,”

“Cara terbaik yang dapat dilakukan pemerintah Indonesia untuk menjawab pelecehan dan penghinaan sebagian masyarakat adalah dengan bekerja keras menciptakan lapangan kerja dan kesejahteraan,” Ekonom senior DR. Rizal Ramli.

BJ Habibie, mengomentari soal hinaan eks Menteri Penerangan Malaysia Zainudin Maidin.

FIFA Plin Plan

Kita bisa bernafas lega ketika badan sepakbola dunia, FIFA, menunda sanksi kepada PSSI. FIFA masih memberi kesempatan kepada PSSI untuk menyelesaikan kekisruhan hingga Maret 2013. Namun benarkah kesempatan itu merupakan kesempatan terakhir yang diberikan dan bila dalam jangka waktu 4 bulan tidak mampu menyelesaikan masalah, sanksi benar-benar dijatuhkan?

Oleh : Ardi Winangun PENUNDAAN sanksi ini bukan yang pertama. Penundaan sanksi sudah ketiga kalinya. Pada Maret 2012 badan sepakbola yang bermarkas di Zurich, Swiss, itu juga menunda sanksi. FIFA mengharap PSSI mampu menyelesaikan masalahnya hingga Juni 2012. Namun ketika jeda waktu yang sudah ditentukan berakhir dan PSSI tidak bisa menyelesaikan masalahnya, FIFA tidak segera menjatuhkan sanksi namun masih memberi waktu hingga 10 Desember 2012. Ketika waktu yang telah ditetapkan sudah habis dan lagi-lagi PSSI tidak mampu menyelesaikan apa yang diharapkan, FIFA pun juga tidak kunjung menjatuhkan sanksi namun masih diberi waktu. Apa yang dilakukan FIFA itu menunjukkan bahwa FIFA plin plan, tidak tegas, dan sepertinya ada sesuatu dibalik diundurundurnya sanksi. Sikap ‘tidak bertanggungjawabnya’ FIFA bertambah ketika masalah PSSI dilimpahkan kepada badan sepakbola Asia, AFC. Tentu apa yang dilakukan oleh FIFA ini membuat geram sebagaian kalangan, sebab sebagaian kalangan menilai dengan adanya sanksi inilah yang dirasa mampu membuat intropeksi dan sadar diri bagi seluruh insan sepakbola Indonesia. Dalam masa-masa hukuman yang dijatuhkan inilah dirasa sebagai waktu yang tepat untuk membangun badan sepakbola Indonesia dan program-program yang lebih baik. Hukuman FIFA kepada anggota biasanya diberikan apabila terbukti adanya intervensi dari pemerintah negara masingmasing. FIFA mempunyai statuta bahwa badan sepakbola yang tergabung dalam FIFA harus lepas dari campur tangan pemerintah. Dengan statuta itu diharapkan badan sepakbola

menjadi lebih mandiri dan tidak menjadi kepentingan politik dan kampanye penguasa. Badan sepakbola yang pernah diberi sanksi atas intervensi pemerintahannya seperti Irak, Ethiopia, Nigeria, Iran, Brunai Darussalam, Kuwait. Sanksi yang diberikan kepada anggotanya itu bervariasi, ada yang hanya hitungan hari, seperti 1 minggu; ada pula yang hitungan bulanan, 1 bulan, 2 bulan, 5 bulan; adapula sanksi dengan waktu yang tak jelas kapan berakhirnya. EPO, PSSInya Yunani; dan NFF, PSSI-nya Nigeria, diberi sanksi di bawah kurang lebih hanya 7 hari. Sedang FFBH, PSSI-nya BosniaHerzegovina, diberi sanksi sejak 1 April 2011 dan hingga kini sanksi itu belum dicabut. Lama tidaknya sanksi yang diberikan bisa jadi dengan pertimbangan sepakbola di negeri itu penting atau tidak di kawasannya. Sanksi yang hanya 1 mingguan bagi EPO dan NFF bisa jadi tim nasional yang dibentuk oleh badan sepakbola itu cukup mempunyai kiprah di kawasannya. Demikian pula sanksi yang hanya 1 sampai 2 bulan yang diberikan kepada Irak, Iran, dan Kuwait, karena negara itu cukup mumpuni tim nasionalnya di kawasan Timur Tengah. Sedang sanksi kepada badan sepakbola Brunai dan Bosnia-Herzegovina cukup lama karena bisa jadi tim nasionalnya tidak terlalu berarti di kawasan yang ada. Lalu mengapa FIFA plin plan kepada PSSI? Bisa jadi FIFA melihat ada potensi lain dalam dunia sepakbola Indonesia. Indonesia kalau diukur dari kapasitas tim nasional masih masuk katagori yang memprihatinkan, untuk ukuran Asia Tenggara saja sudah megap-megap apalagi kalau berlaga di Asia dan dunia, namun dengan pen-

duduk lebih dari 250 juta jiwa, Indonesia adalah pasar yang menjanjikan bagi perkembangan sepakbola dunia. Potensi pasar sepakbola di Indonesia yang dilihat FIFA untuk dunia itu adalah. Pertama, liga sepak bola Indonesia adalah liga terbaik dan termeriah di Asia Tenggara. Ibarat lampu dan laron, liga sepak bola Indonesia menjadi lampu dan mampu menarik laron-laron pemain sepak bola di mana pun. Mengapa liga sepakbola Indonesia menarik bagi pemain asing? Faktor bayaran untuk pemain asing relatif tinggi membuat banyak pemain dari Eropa, Australia, Amerika Latin, dan kawasan Timur Tengah berbondong-bondong untuk bisa menjalin kontrak dengan klub yang ada di LPI atau LSI. Antusiasnya penonton di liga sepak bola Indonesia juga menjadi magnet bagi pemain asing. Pemain Tim Nasional Singapura dan Malaysia ngebet bermain di Indonesia, selain bayaran yang tinggi juga karena antusiasnya suporter klub. Meriahnya suasana di stadion dengan hadirnya puluhan ribu penonton ternyata menjadi salah satu spirit bagi pemain untuk bermain bagus. Meriahnya suasana di dalam stadion, dengan

teriakan dan nyanyian suporter, hal demikian tidak ditemui di liga sepak bola Singapura dan Malaysia sehingga liga yang ada dirasa kurang memiliki greget. Kedua, Indonesia adalah negara yang sering dijadikan tempat lawatan klub-klub ternama dari Eropa dan Amerika Latin. Klub-klub kesohor yang pernah bermain di Indonesia khususnya di Gelora Bung Karno adalah Bayern Munchen, Inter Milan, Santos, Sampdoria, Tim Nasional Uruguay, AC Milan, Tim Nasional Afrika Selatan U21, LA Galaxy, Red Star Bratislava, Dynamo Moscow, Manchester United, Ajax Amsterdam, Tim Nasional Italia U-21, Arsenal, PSV Eindhoven, Queen Park Rangers, Lazio, dan di tahun 2013 disebut Barcelona FC akan datang ke Indonesia. Tentu kedatangan mereka bukan cuma-cuma namun ada sponsor. Pastinya nilai rupiah dari mendatangan klub-klub itu tidak kecil. Di sinilah FIFA melihat potensi ekonomi yang tinggi dari Indonesia untuk sepakbola dunia. Ketiga, antusias dunia sepakbola di Indonesia juga dilihat oleh klub-klub besar di Eropa. Untuk itu klub-klub besar mendirikan sekolah sepakbola. Se-

kolah sepakbola dari luar yang membuka cabang di Indonesia seperti SSI Arsenal, Liverpool Internasional Football Academy, FC Barcelona Escola Indonesia, dan Sekolah Sepak Bola Real Madrid. Tentu para orangtua yang menyekolahkan anaknya di sekolah sepabola itu perlu merogoh kocek yang dalam sebab sekolah sepakbola itu tentunya dalam latihan tidak seperti sekolah sepakbola di kampung-kampung. Sekolah sepakbola dari luar melihat bahwa Indonesia mempunyai pasar yang bagus dan menggairahkan sehingga akan ada lagi sekolah-sekolah sepakbola yang akan membuka cabang di Indonesia. Kesimpulannya, apabila FIFA dan AFC memberi sanksi kepada PSSI maka secara tidak langsung FIFA dan AFC memutus ‘rantai makan’ bagi pemain sepakbola asing dan klub asing sehingga FIFA dan AFC dalam posisi bingung dan plin plain, bila tidak diberi sanksi PSSI akan selalu dirundung konflik, namun bila diberi sanksi ‘suplai’ ekonomi sepakbola Indonesia untuk dunia terhenti. (***) Penulis adalah Penggemar Sepabola



19 Desember 2012




Eks Pelayan Kafe Tenggak Racun Hingga Tewas

PANCURBATU- Santi alias Kiki (28), mantan pelayan kafe nekat menenggak racun rumput. Wanita asal Stabat, Langkat, ini pun ditemukan tak bernawa di sebuah kos-kosan di Desa Sembahe Baru, Kecamatan Pancurbatu, Selasa (18/12) dini hari. Motifnya, korban tidak terima spring bed baru miliknya dirunning Yuli, teman satu kostnya berbuat mesum.


„ Terdakwa Paino menjalani persidangan di PN Simalungun, Selasa (18/12).


Supir Truk Pesakitan SIMALUNGUN- Akibat membawa 134 batang kayu yang diambil dari Kawasan Hutan Negara RI Register 2 S/ M Sibatu Loting HPHTI PT TPL, seorang supir truk Paino (21), jadi pesakitan di Pengadilan Negeri Simalungun. Warga Huta Simpang Jambi, Nagori Bosar Nauli, Kecamatan Hatonduan, ini didakwa melanggar Pasal 50 ayat 3 huruf h jo Pasal 78 ayat 7, UU RI Nomor 41 Tahun 1999 tentang Kehutanan jo pasal 55 1 ayat ke-1 KUHPidana. Hal itu disampaikan Jaksa Penuntut Umum (JPU) Julius Butarbutar saat membacakan dakwaannya di hadapan hakim dipimpin Samuel Ginting, beranggotakan Heriyanti, dan Adria Dwi Afanti, Selasa (18/ 12). Peristiwa itu berlangsung di kawasan hutan Negara RI Register 2 S/M Sibatu Loting HPHTI PT TPL di Nagori Bosar Nauli, Kecamatan Hatonduan, Jumat (39/3), sekira pukul 22.00 WIB. Ceritanya, saat itu, terdakwa baru selesai mengangkat batu, kemudian bertemu dengan Mesdi (DPO) dan Dul Witno. Lalu Mesdi menawarkan kepada terdakwa untuk mengangkut kayu (bahan jadi) pada tengah malam. Mendengar itu, pria lajang itu menjawab; “ngeri-ngeri sedap mengangkut kayu, soalnya belum pernah aku kerja malam menyupiri atau mengendarai mobil”. Selanjutnya Dul Witno menjawab pernyataan terdakwa ‘siapa lagi kalau bukan kau Paino, kaunya yang bisa nyupir’. Kemudian, terdakwa pun akhirnya menyetujuinya. “Lalu sekitar pukul 21.00 WIB, terdakwa bersama Mesdi naik ke truk Toyota Dyna BK 8288 TC. Saat itu, Dul Witno sebagai pemilik truk masih sempat melihat mereka berangkat. Terdakwa pun membawa ken-

daraan tersebut memasuki Kawanan Kawasan Hutan Negara RI Register 2 S/M Sibatu Loting HPHTI PT TPL, di Nagori Bosar Nauli, Kecamatan Hatonduan. Tak lupa juga Mesdi menuntun arah kayu yang sudah ditebanginya bersama Suwono dan Dudung,” terang Butarbutar. Setibanya di lokasi, terdakwa memutar truk menuju arah pulang. Kemudian, terdakwa mematikan kunci kontak mesin truk dan menunggu di dalam truk. Saat berada di dalam truk, Mesdi, Suwono, Dudung serta seorang lagi yang tidak dikenal melangsir dengan cara memundak kayu setiap satu batang hingga 134 batang ke dalam truk. Setelah penuh, terdakwa pun kembali menghidupkan mesin truk dan keluar dari kawasan hutan. Akan tetapi sekitar 500 meter truk melaju, tiba-tiba terdakwa melihat cahaya lampu sepedamotor dari pihak pengamanan PT TPL. Melihat itu, terdakwa menghentikan dan mematikan mesin truk. Kemudian mereka lari berpencar ke kawasan hutan dan meninggalkan truk. “Saat itu, terdakwa memilih berjalan kaki ke rumah. Selanjutnya pada Sabtu (31/3), terdakwa datang ke rumah Dul Witno dan memberitahukan bahwa truknya tinggal di kawasan hutan tersebut. Mendengar itu, Dul pun berangkat bersama anaknya Suryanto untuk mengambil truk itu. “Sementara untuk mengindari pencarian polisi, terdakwa memilih melarikan diri ke Pekanbaru. Namun, karena tidak tahan di sana, terdakwa kembali ke Huta Simpang Jambi, Nagori Bosar Nauli, Kecamatan Hatonduan pada 12 Agustus 2012. Saat itu juga terdakwa berhasil diamankan polisi,” ungkap jaksa. (mua)


DIAMANKAN- Kartini br Simanjuntak dan Parningotan Lumbantobing, tersangka jurtul togel diamankan di Mapolresta Siantar, Selasa (18/12).


KARTINI & PARNINGOTAN DIBORGOL SIANTAR- Praktik judi toto gelap (togel) makin merajalela. Di Kota Pematangsiantar, seorang ibu rumah tangga (IRT) Kartini br Simanjuntak (55), jadi jurtul togel. Wanita bertubuh tambun ini ditangkap bersama seorang jurtul lainnya Parningotan Lumban Tobing (36), Senin (17/12). Keduanya diamankan dari lokasi berbeda. Kartini diamankan dari sebuah warung tuak milik Mak Anton di Jalan Patuan Nagari, Kelurahan Sukadame, Kecamatan Siantar Utara, Senin (17/12), sekira pukul 16.15 WIB. Sementara Parningotan diamankan dari

Jalan Bombongan Raya, Kelurahan Tambun Nabolon, Kecamatan Martoba pada sebuah warung tuak milik marga Hutagalung. Kini, baik Kartini, warga Jalan Rakutta Sembiring, Kelurahan Sigulang-gulang, Kecamatan Siantar Utara dan Parningotan Lumban Tobing (36), warga Jalan Medan, Simpang Karang Sari, Kelurahan Tambun Nabolon, Kecamatan Martoba, telah mendekam di sel Mapolresta Siantar. Penangkapan keduanya dilakukan atas informasi masyarakat. Untuk mengungkapnya, polisi menyaru sebagai pembeli nomor togel.

Dari kedua tersangka, polisi menemukan 3 lembar kertas berisi angka tebakan, sebuah pulpen, dan juga sebuah handphone Nokia type X1 berwarna hitam yang dijadikan sebagai alat untuk mengirim angka tebakan judi togel tersebut. Kemudian barang bukti berupa uang tunai sebesar Rp331 ribu dan 1 lembar kertas berisi angka tebakan judi togel hongkong. Kapolres Siantar AKBP Alberd Sianipar, melalui Paur Humas Ipda Restuadi membenarkan penangkapan Kartini br Simanjuntak dan Parningotan Lumban Tobing. “Keduanya diancam dikenakan pasal 303 KUHPidana tentang Perjudian,” ujarnya. (mag-05/dro)

Informasi dihimpun, pada Sabtu (15/12) malam lalu, Kiki memerogoki Yuli dalam posisi kelonan dengan pria lain diketahui bermarga Sembiring di kamar kosnya itu. Melihat itu, Kiki mengamuk. Yuli dimaki. Keduanya pun terlibat adu mulut. Melihat situasi itu, Yuli dan kekasihnya beranjak dari kamar Kiki. Tak berselang lama, suami siri Kiki Selamat Riadi (44), warga Suka Raya, Kecamatan Pancurbatu, pulang dari tempatnya bekerja sebagai tukang jahit pakaian. Begitu suaminya pulang, Kiki mengadu. Namun ayah tiga anak itu ternyata menanggapinya dingin. Menurutnya hal itu tidak perlu dibesar-besarkan. Mendapat jawaban dari suami yang dinikahinya lima bulan lalu itu, Kiki tak terima. Selanjutnya, Kiki yang pernah bekerja sebagai pelayan di Kafe Darwin di Desa Sembahe Baru, ini langsung pergi ke Pajak Pancurbatu. Di pajak itu, korban mendatangi sebuah toko yang menyediakan berbagai jenis racun hama dan racun rumput. Kemudian Kiki membeli rumput merk Gramatsond dan dibawanya ke kos. Tiba di kost, Kiki langsung menenggaknya hingga tinggal setengah. Kiki pun terkapar dengan mulut berbusa. Beberapa detik saja Selamat masuk kamar yang disewanya sebesar Rp2,5 juta per tahun itu. Melihat istri mudanya terkapar dengan kondisi mulut mengeluarkan aroma tak sedap, Selamat panik dan menjerit histeris, sehingga mengundang perhatian tetangganya. Lalu, oleh warga Kiki yang sudah kritis langsung dilarikan ke Puskesmas Pancurbatu. Tiba di puskesmas, petugas medis pun memberikan pertolongan dan nyawa Kiki terselamatkan. Begitu kondisinya stabil, Selamat pun membawa Kiki pulang ke kediamannya. Namun pada Selasa (18/12), sekira pukul 00.07 WIB, tibatiba Kiki kejang-kejang. Melihat itu, Selamat yang berada di

sampingnya terkejut. Tapi tak lama kemudian, Kiki tewas dengan kondisi telungkup, mulut mengeluarkan buih. Menyadari istrinya meninggal, Selamat memberitahukannya kepada jiran tetangga. Warga yang mengetahui tewasnya Kiki langsung mendatangi kamar kos-kosan tersebut. Pagi harinya, warga yang curiga dengan kematian korban langsung melaporkannya ke petugas kepolisian. Tak berselang lama, Tim Reskrim Polsek Pancurbatu disusul Tim Forensik Polresta Medan tiba di lokasi untuk melakukan olah TKP, dan memboyong jenazah korban ke RSUP H Adam Malik Medan untuk keperluan otopsi. Terpisah, Yuli mengatakan, antara ia dan korban memang saling kenal. “Perkenalan kami sejak kami sama-sama kerja di kafe. Namun sejak dia kenal sama Bang Selamat lima bulan lalu, dia pun mulai meninggalkan pekerjaan menjadi pelayan kafe, dan dua bulan kemudian mereka menikah secara siri. Selanjutnya, mereka tinggal bersama, dan rumah kos ini,” ujar Yuli. Yuli juga mengaku bahwa dirinya juga tinggal di kos-kosan Kiki kurang lebih dua minggu. “Aku terpaksa tinggal di sana, karena tempat tinggalku sudah habis kontrak. Jadi aku numpang sama dia. Malam Minggu itu, memang kami ada ribut, karena dia memergoki aku sama pacarku tidur di spring bed yang baru dibelinya itu. Tapi saat itu langsung aku tinggalkan dia karena dia maki-maki aku,” aku Yuli sambil berlalu. Kapolsek Pancurbatu Kompol Darwin Sitepu saat dikonfirmasi membenarkan tewasnya korban. “Saat ini masih kita selidiki motif kematian korban, namun dugaan sementara korban nekat menghabisi nyawanya karena tak terima dimarahi suaminya. Itu sebabnya dia nekat minum racun rumput,” ujar Sitepu. (roy/pmg/dro)



19 Desember 2012

19 Pengedar, 8 Pemakai Ditangkap Sambungan Halaman 1 Narkoba Iptu Anderson Siringoringo, Selasa (18/12) menerangkan, melihat besarnya jumlah kasus narkoba yang diungkap, membuktikan bahwa wilayah Polres Asahan rawan pengedaran narkoba. “Bulan ini saja, kita ungkap 18 kasus narkoba. Ada 19 tersangka digolongkan sebagai pengedar, dan 9 orang pemakai. Sementara, barang bukti yang disita 235,45 gram sabu-sabu, 103 gram daun ganja kering dan 3 butir pil ekstasi,” kata Siringo-ringo. Disampaikan Siringo-ringo, pihaknya tetap mengharapkan peran serta masyarakat dalam memerangi peredaran narkoba yang dapat merusak generasi bangsa. Bila masyarakat mengetahui di daerah sekitar tempat tinggalnya ada kegiatan yang menyangkut narkoba, secepatnya melapor kepada pihak berwajib dan laporan pasti akan ditindak lanjuti. Diungkapkan Siringo-ringo, setelah berhasil membekuk beberapa bandar yang namanya santer di tengah-tengah masyarakat seperti, Asan Bacok, Indra Gunawan, Maslo, J Nasution, J Sitorus, Jol Lindung, Heri serta

Gabe. Pihaknya masih terus memburu para bandar, yang nama-namanya sudah dikantongi. “Kondisinya sudah sangat memperihatinkan, sehingga peran serta masyarakat sangat diharapkan memberantas peredaran narkoba,” katanya. Terpisa, H Azhari R Lubis salah seorang pemuka agama di Kisaran ketika dimintai komentarnya mengatakan, keberhasilan Sat Narkoba Polres Asahan menangkap para bandar narkoba perlu mendapatkan acungan jempol. “Tinggal lagi, sampai di mana proses hukum bagi para pelaku kejahatan narkoba itu nantinya, apakah mendapat dukungan dari penegak hukum lainnya seperti jaksa dan hakim,” katanya. Menurut H Azhari R Lubis, pemeberantasan peredaran narkoba harus mendapat dukungan dari aparat penegak hukum lainnya, seperti jaksa dan hakim. Sebab, proses hukum terakhir bagi pelaku kejahatan narkoba ada di kejaksaan dan pengadilan. “Sangat disayangkan, bila ada para pelaku kejahatan narkoba mendapatkan hukuman ringan bila dibandingkan dengan ancaman hukumannya sesuai undang-undang yang berlaku,” tegas H Azhari. (sus)

Honorer Minta Uang Dikembalikan

Sambungan Halaman 1 tawaran itu, dia sudah memberikan uang Rp19,5 juta kepada orang yang mengaku suruhan oknum anggota DPRD Asahan. Menurut Suriadi, setelah uang yang diberikan kepada utusan salah seorang oknum anggota DPRD yang disaksikan Kapala Desa Gedangan Ponimin dan Istrinya. Beberapa hari kemudian, dia dijumpakan kepada H Wahyudi dan Sekwan DPRD Asahan Zainal Abidin SH. Kala itu, dia dipekerjakan di Sekretariat DPRD Asahan tertanggal 8 Maret 2011 dengan Surat Tugas bernomor: 800/919/ ST/Sekret-DPRD Kab AS/2011 yang ditanda tangani Zainal Abidin SH. “Sebelum masuk menjadi tenaga sukarela di bagian Staf perundang-undangan DPRD, aku dan beberapa kawankawan dibrefing oleh Johan, lalu dibawa ke klinik Azmi Simpang Empat,” katanya. Dilanjutkan Suriadi, di klinik mereka dipertemukan dengan H. Wahyudi yang meminta, agar mereka tidak menyampaikan kepada siapapun, jika nantinya dia dan beberapa orang korban mulai masuk bekerja, apalagi cerita soal uang. Tetapi setelah bekerja selama 18 bulan, dia sendiri tidak pernah mendapatkan gaji dan hanya dapat makan dan minum. Sedihnya, jika ada pejabat Pemkab Asahan datang menyambangi DPRD Asahan, dia dan rekan-rekannya diintruksikan untuk menghilang

sementara atas intruksi Robin Hut alias Wiro. Karena tidak tahan dengan pekerjaan di bagian staf Perundang-undangan DPRD Asahan yang tidak mempunyai gaji tetap, maka Suriadi mengambil keputusan untuk mengundurkan diri. “Padahal, saya harus menghidupi anak dan istri saya, memang dari rumah dianggap kawan-kawan sekampung kita mentrang memakai atribut baju pegawai. Tapi, kami tidak mempunyai gaji sama sekali,” kesalnya. Ironisnya, dilanjutkan Suriadi, untuk menjadi tenaga sukarela di DPRD Asahan, dia terpaksa menjual sepedamotor miliknya sebesar Rp4 juta dan menjual kalung istrinya. Hal senada juga disampaikan Kuswandi. Malah, dia membayar Rp25 juta untuk menjadi honorer, dan kerabatnya Irwansyah membayar Rp7 juta untuk masuk kerja di Satpol-PP. Lalu, adik kandung Kepala Desa Gedangan Poniman membayar Rp20 juta. Orangtua Suriadi, Imran Nasution (50), warga Desa Uruang Pane Kecamatan Setia Janji kepada METRO, Selasa (18/ 12) mengatakan, apabila uang anak dan kerabatnya tidak dikembalikan, maka pihaknya akan melaporkan kepada pihak berwajib. “Saya sebagai orangtua Suriadi, menyesalkan sikap oknum anggota DPRD yang tega melakukan praktek kotor dengan mengatas namakan lembaga menjerat orang masuk tenaga kerja sukarela dengan janji dijadikan PNS,” katanya. (mar)

METRO ASAHAN Anggota SPS No.: 438/2003/02/A/2007

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel ) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba

Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Kelola Tanah Sendiri Warga Buntu Pane Dipolisikan KISARAN-Puluhan warga Desa Buntu Pane Kecamatan Buntu Pane Kabupaten Asahan, yang mengelola lahannya sendiri yang kini digarap pihak PTPN III Kebun Pulai Mandi, berurusan dengan pihak Polres Asahan, atas laporan pihak perkebunan. Kades Buntu Pane,Mahadi Manurung didampingi beberapa warga di antaranya Jangga Manurung, Nasib,Dedi Sopyan Panjaitan, Adi Syahputra kepada METRO Selasa (18/12) di Kisaran menceritakan, lahan yang diklaim perkebunan adalah tanah yang telah direbut warga sejak tahun 2006 lalu, karena sebelumnya sekira Tahun 1980 PTPN III telah mengambil paksa dari warga. Dikatakan Kades Mahadi, selama dilakukan perebutan oleh

warga, pihak PTPN III mencoba menghalangi, tapi persoalan tidak sampai ke polisi. Bahkan, persoalan tidak ada mencuat. Tetapi, Senin (17/12) dua orang warga masing-masing Jangga dan Nasib dipanggil ke Mapolres Asahan untuk diminta keterangan mengenai lahan itu. “Warga kita telah penuhi panggilan, daa memberi keterangan sekiatan dengan lahan dan juga menjelaskan kronologis lahan. Informasi, akan dipanggil dua orang lagi yaitu Dedy Sopyan dan Adi Syahputra. Hanya saja belum diterima surat panggilan,” ujarnya sembari memperlihatkan salinan panggilan yang ditandatangani Kasat Reskrim Polres Asahan AKP Fahrizal SIK. Dalam surat itu, Jangga Manurung dan Nasib

diperintahkan menemui Bripka Frenky Damanik pada Unit Tipiter Sat Reskrim Polres Asahan dalam perkara tindak pidana menanami dan menguasai tanah atau lahan tanpa izin sebagiamana dimaksud dalam pasal 2 yo pasal 6 Undangundang No.51/Prp/1960 sehubungan dengan laporan pengaduan Apollo Purnadi SSos yang mewakili PTPN III dan bertugas sehari-hari sebagai Asisten Personalia Karyawan (APK) Kebun Pulau Mandi Kecamatan Buntu pane. Terkait n surat panggilan, Kades justru menyebutkan bahwa PTPN III tidak memiliki hak melaporkan warga. Sebab, lahan yang dikelola warga adalah tanahnya sendiri. “Lagi pula, masalah lahan

masih sengketa, kok polisi sudah menyebut perbuatan tindak pidana. Seharusnya, polisi mempelajari peraturan dan perundang-undangan yang berlaku mengenai sengketa tanah atau lahan dan tidak dengan mudah memanggil warga karena ada laporan pihak PTPN III. Jika hal ini yang terjadi ,Polres Asahan d i p e r t a n y a k a n keprofesionalannya dan kenapa dengan mudah memanggil warga dan menyebut melakukan tindak pidana,” tegas Mahadi. Mahadi mengunkapkan, dia tahu masalah lahan itu, karena memiliki peta PTPN III Pulau Mandi. Selain itu, ada saksi yang mengetahui bahwa lahan tersebut milikwarga yang diambil

paksa pihak kebun. “Untuk itu saya minta Polres Asahan agar lebih teliti mengenai masalah lahan di areal yang sedang diusahai. Kita harap jangan ada keberpihakan karena masyarakat menginginkan keadilan dan terlebih selama ini warga telah kehilangan lahan karena diambil paksa,” katanya. Kasat Reskrim Polres Asahan AKP Fahrizal SIK ketika dikonfirmasi melalui telepon, tidak berhasil karena telepon genggamnya tidak aktif. Sementara Jangga dan Nasib, mengaku telah diperiksa dan dipertanyakan juper kepada mereka soal siapa yang menanam tanaman di lahan serta kronolis lahan. “Kita telah beri penjelasan mengenai lahan itu,” ujar Jangga. (van)

Parbetor Culik dan Cabuli Murid TK Sambungan Halaman 1 Data dihimpun POSMETRO MEDAN (GROUP METRO), sebelum kejadian pencabulan terjadi, korban bersama temantemanya sedang bermain di halaman sekolah TK yang beralamat di Jalan Darussalam. Kala itu, pelaku melintas dari depan sekolah dan melihat korban bermainmain. Melihat itu, pelaku menghampiri korban dan langsung membekap dan memaksa korban naik ke betor BK 1057 CO milik pelaku. Dengan cepat, pelaku mengendari betor ke kediamannya di kawasan Sei Seguti. Saat itu, kondisi rumah pelaku yang telah kosong dimanfaatkan untuk mencabuli korban. Pakaian seragam TK bermotif kotak-kotak abu-abu putih yang dikenakan korban dibuka pelaku

secara paksa. Korban pun digauli dengan cara meraba-raba dan menciumi sekujur tubuh bocah perempuan itu. Tangisan korban pun tak dihiraukan pelaku yang kian bringas menjalankan aksi tak senonoh itu. Usai puas melampiaskan nafsunya, menggunakan betornya korban diantarkan pelaku ke kediamannya. Datangnya Bunga yang diantar parbetor, disaksikan beberapa warga sekitar termasuk neneknya. “Aku liat dia diantar sama tukang becak, tapi kami belum tahu apa masalahnya saat itu,” kata nenek korban ketika ditemui di Polsek Medan Baru. Di dalam rumah, Bunga pun terus diam. Namun diamnya Bunga membuat ibunya curiga, ditambah lagi tingkah korban yang takut melihat laki-laki. Kepada ibunya, korban menceritakan

kejadian tersebut. Di luar dugaan, Bunga mengenali pelaku termasuk di mana kediaman pelaku. “Anakku takut sama orang, makanya pas kutanya dibilang dia dibawa bapakbapak dari sekolahnya. Di situ lah aku langsung tanya sama dia apa yang terjadi, makanya kami lapor,”kata ibu korban yang enggan namanya dikorankan dan tampak terus memeluk putrinya itu. Korban pun diminta menunjukkan rumah pelaku. Bermula dari sekolah di mana ia diculik secara perlahan tapi pasti Bunga menunjuk ke arah mana ia dibawa. Hingga akhirnya, kediaman pelaku ditemukan pada Senin malam sekitar pukul 19.00 WIB. Tak mau konyol, keluarga korban menghubungi petugas Polsek Medan Baru guna menangkap pelaku.

Penanganan Kasus Korupsi GOR Bertele-tele Sambungan Halaman 1 kepolisian telah kong-kalikong dengan Komite Pembangunan GOR dalam persoalan yang diadukan oleh Aliansi Mahasiswa Anti Korupsi ini. Pj Kanit Tipikor Satreskrim Polres Asahan, Iptu Anderson Siringoringo yang dikonfirmasi beberapa hari lalu mengenai persoalan ini mengaku, untuk melanjutkan persoalan ini pihaknya masih menunggu hasil pemeriksaan yang dilakukan tim independen dari Universitas Sumatera Utara. Dengan kata lain, selama hasil pemeriksaan tersebut belum diperoleh, pihaknya belum dapat melanjutkan kembali penanganan perkara tersebut. “Masih menunggu hasil pemeriksaan dari tim independen Universitas Sumatera Utara,” kata Anderson. Sayangnya, Anderson belum dapat memastikan, kapan hasil pemeriksaan tersebut dapat diperoleh. Sementara itu, beredar issu yang menyebutkan, pemeriksaan yang dilakukan oleh polisi terhadap Ketua Komite GOR beberapa waktu lalu hanya formalitas belaka.

Konon, sebut seorang sumber METRO, pemanggilan Ketua Komite GOR kala itu, turuhannya hanya saut yakni untuk meningkatkan posisi tawar burgening position oknum tertentu di kepolisian yang hendak memiliki kepentingan tertentu dalam perkara itu. “Pemeriksaan itu cuma formalitas saja. Ngerti sendirilah apa maksudnya pemanggilan itu,” tukas sumber yang dikenal dekat dengan kalangan polisi, dan pemerintah Kabupaten Asahan ini. Masih menurut sumber ini, sangat dimaklumi jika pihak kepolisian setengah hati dalam menangani perkara ini. Sebab, kasus ini terbilang sangat politis, karena melibatkan sejumlah nama yang dikenal sebagai orang dekat penguasa Kabupaten Asahan. Bahkan, ketua tim pemenangan Bupati Asahan saat masa pemilukada lalu, juga terlibat, yakni sebagai ketua dan bendahara Komite GOR. “Berat lah kalau mau dituntaskan, wong yang terlibat aja orang-orang penting. Untuk kelas Asahan, saya rasa berat polisi mau menegakkan hukum dalam perkara ini,” kata sumber ini. Aroma Konspirasi Dalam perkara ini, aroma konspirasi antara Pemkab Asahan dengan dengan komite pembangunan GOR Kabupaten juga cukup kental. Ini dapat dibuktikan dari terbitnya SK Bupati Asahan No 277-porbud/ 2011, tentangp penetapan Komite Pembangunan GOR Kabupaten Asahan. Tri Purno Widodo SH, seorang praktisi hukum muda di Kabupaten Asahan, saat dimintai komentarnya kemarin mengatakan sangat tidak masuk akal, Pemkab mencampuri perkara ini, apalagi sampai menerbitkan SK. Ditemui di kantor Pengacara Tri Purno Widodo SH dan rekan, di Jalan Cokro A Minoto Kisaran, advokat penggila petualangan alam bebas ini mengatakan, sesuai dengan Undang-undang No.3 Tahun 2005, tentang sistem keolahragaan nasional, persisnya pada pasal 67 disebutkan,

Departemen Redaksi METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin PurbaEva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput)

pemerintah, pemerintah daerah, dan masyarakat bertanggung jawab atas perencanaan, pengadaan, pemanfaatan, pemeliharaan dan pengawasan prasarana olahraga. Dengan kata lain, sebuah lembaga non pemerintahan/swasta, yang tentunya memiliki badan hukum, dapat melaksanakan proses pengadaan sarana olah raga, semisal pembangunan GOR. Artinya, komite dalam hal ini sebagai perwujudan peran serta masyarakat,” sebut Dodo panggilan akrabnya. Sesuai aturan ini pula, dana yang dikelola komite, sebut Dodo, bisa berupa dana hibah seperti yang terjadi di Asahan. Artinya, komite memiliki hak mengajukan proposal kepada kementerian pemuda dan olahraga. Yang kemudian, menggelontorkan dana untuk proyek tersebut. Dalam hal ini, komite bertanggung jawab langsung kepada kementerian olahraga. Dalam hal ini, sebut Widodo, terlihat adanya keterlibatan,atau lebih tepatnya upaya melibatkan diri yang dilakukan oleh Pemkab Asahan dalam persoalan ini. Ini dapat dibuktikan, dengan adanya PPK Pembangunan Gor di Dinas PU Kabupaten Asahan, yang beranggotakan Ikhtiadi Amir, serta Jailani ST. Selain itu, SK Bupati sangat tidak berdasar. Sebab, sesuai aturan tersebut, Pemkab tidak ada hubungannya dalam kasus ini. “Yang jadi pertanyaanya, apa urusan pemkab dalam hal ini?,” tanya Dodo. Menanggapi hal ini, Ketua AMAK Halim Saragih kepada METRO mengatakan, dari analisa yang dilakukannya, terbitnya SK itu, adalah upaya membentengi diri komite pembangunan GOR dengan menciptakan sebuah perikatan dengan pemkab, yang seharusnya tidak perlu dilakukan jika memang pihak komite berniat bersih. :Patut diduga, dan dicurigai, apa tujuan pemkab menerbitkan SK itu? Sama sekali tidak berdasar menurut saya. Kecuali memang, ada agreement tersendiri, untuk meloloskan kepentingan pribadi,” katanya. (Ing)

Saat diamankan, Sony yang telah beristri itu mengelak atas tuduhan tersebut. Namun Bunga dengan yakin menunjuk pelaku yang telah mencabulinya. Akhirnya, oleh petugas ia diamankan ke Polsek Medan Baru. Saat ditanyai, Bunga mengatakan jika telinganya dikencingi oleh pelaku, “Di pipisin, dibilang ucapan kotor,” kata korban polos sembari menyampaikan jika telinganya tersembur sperma dari kemaluan pelaku. Tampak pula Bunga pingsan dipelukan ibunya, ketika dipertemukan dengan pelaku. “Takut kali dia kayaknya, sampai pingsan,” kata salah satu kerabat korban. Masih menurut kerabat korban (paman-red), jika tertangkapnya pelaku setelah Bunga mampu menunjukkan arah kediaman pelaku, serta jaket coklat lusuh yang dikenakan pelaku, “Dari jaket itulah dia yakin pelaku, emang pintar anak itu. Dia juga bisa menunjukkan di mana rumah si pelaku, makanya kami ke sana. Kalau dari dia katanya dia diciumi sama dibuka pakaiannya sampai bugil, terus dia nangis,” kata paman korban yang menyatakan agar identitas keponakan dan dirinya tidak dibuat dengan

alasan aib. Sementara, pelaku Sony Liston bersikeras tak mengakui perbuatannya. Bahkan ia membantah semua tuduhan yang diberikan padanya dengan alasan saat kejadian dia sedang melayat bersama keluarganya. Hal itu dikatakan abang ipar pelaku, M Sianturi (45) yang mengatakan tidak mungkin adiknya melakukan tindakan tersebut. “Tidak mungkin itu. Adikku baik-baik orang nya. Kami tak terima dituduh begini. Mana buktinya,”katanya. Kapolsek Medan Baru Kompol Jean Calvijn Simanjuntak ketika dikonfirmasi mengatakan, jika pelaku masih diperiksa seraya menunggu hasil visum. Dia juga mengimbau, agar orangtua dan pihak sekolah lebih berhati-hati. “Menunggu hasil visum ya, jika terbukti korban kita jerat Undang-undang Perlindungan Anak Pasal 81,82 dengan ancaman 5 tahun penjara. Kita harap orangtua dan pihak sekolah lebih berhati-hati,” ujarnya. Dia menambahkan, kasus pencabulan yang dilakukan parbetor kian marak. Maka dari itu, pihaknya akan terus berupaya menuntaskan kasus itu. (wel/ pmg)

Pak Lurah Poligami, Istri Pertama Ngadu ke Bupati Sambungan Halaman 1 sekaligus meninggalkan utang di salahsatu bank, yang kini menjadi tanggung jawabnya dalam hal pelunasan. SKN yang ditemui METRO di BKD Tapsel, Jalan Kenanga, Kota Padangsidimpuan (Psp), menyebutkan, surat pengaduan kepada Bupati Tapsel bertujuan untuk meminta keadilan atas segala tindakan suaminya. Dalam surat pengaduan itu, terang SKN, dituliskan bahwa mulai 5 April 2012, suaminya (HH) telah pergi tanpa pemberitahuan. Dan, sejak kepergian HH, ia dan dua anaknya tidak pernah diberi nafkah. Hingga kini, komunikasinya dengan HH terputus total. Ironisnya, HH meninggalkan utang di salahsatu Bank, yang hingga saat ini selalu ditagih pihak Bank dan dianggap menjadi tanggungjawabnya. SKN menambahkan, hingga saat ini ia dan HH masih resmi berstatus suami istri. Sebab, proses perceraian masih berlangsung. Pasangan yang menikah pada tahun 1987 lalu ini, telah menjalani persidangan sebanyak 8 kali. Dan, selama proses berlangsung, suaminya hanya hadir dua kali, yakni persidangan pertama tanggal 19 Juni 2012 serta mediasi tanggal 26 Juni 2012. “Anehnya pada sidang ke delapan ini, Selasa (18/12), majelis hakim menyatakan bahwa gugatan cerai sudah dicabut HH, makanya saya tambah bingung,” ujarnya berkaca-kaca. Ditambahkan SKN, sejak HH pergi, ia sudah tidak aktif lagi melaksanakan tugasnya sebagaimana seorang PNS. Hal

METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Hotlan Doloksaribu Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ardi, Roy Amarta, Ferdinan. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

ini dibuktikannya dengan melampirkan fotokopi absensi suaminya. Namun, meski sejak April tidak pernah melihat suaminya di rumah dan kantor, HH tetap menerima gaji setiap bulan. SKN menjelaskan, informasi yang didapatnya pernikahan mereka dilakukan di Sumatera Barat, tepatnya di Kabupaten Sijunjung. Hal ini dikuatkan dengan penyataan dan pengakuan yang bersangkutan kepada saudara dan kerabat yang bersangkutan. “Suami saya pernah mengaku kepada GS. Lalu, kepada IS pada tanggal 20 Agustus 2012 bertepatan Hari Raya Idul Fitri. Suami saya membawa perempuan tersebut beserta enam anaknya ke rumah IS di Desa Sirongit, Kecamatan Angkola Sangkunur. Pada hari itu juga, suami saya dan EEH berkunjung ke rumah GAH di Dusun Tiga Dolok, Kelurahan Simataniari, Kecamatan Angkola Sangkunur, bebernya. SKN menjelaskan, apa yang dilakukan suaminya telah melanggar UU nomor 1 Tahun 1974 tentang pernikahan, PP nomor 10 tahun 1980 junto PP nomor 45 tahun 1990 tentang izin Perkawinan dan Perceraian Pegawai Negeri Sipil. Dan, atas segala kejadian yang menimpanya, ia bermohon kepada Bupati Tapsel Syahrul M Pasaribu, agar menanggapi pengaduannya, sehingga permasalahan itu bisa diselesaikan sesuai dengan ketentuan yang berlaku. Sekadar informasi, SKN juga menembuskan surat pengaduannya kepada Ketua DPRD Psp, Kepala BKD Psp, Kepala Inspektorat Psp dan Camat B. (phn)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


RABU 19 Desember 2012

KM Camar Mulia Ditangkap Polairud Mabes Polri Sambungan Halaman 8

rat-surat. Dari KM Camar Mulia ditemukan 40 kasur bekas, 2 unit ranjang, dan 70 kaleng roti biskuit. Informasi diperoleh dari nelayan Bagan Asahan, Darwin (40), Selasa (18/12), para nelayan tradisional yang sedang melaut di Selat Malaka melihat KM Camar Mulia ditangkap petugas Polairud. Hanya saja setahu mereka kapal Polairud yang menangkap KM Camar Mulia bukan kapal patroli milik Polairud TanjungbalaiAsahan, melainkan kapal patroli Polairud Mabes Polri. Terpisah, Kasat Polairud Tanjung-

balai-Asahan AKP Edi Plantino mengaku pihaknya tidak ada melakukan penangkapan terhadap KM Camar Mulia. “Saya berada di kantor ini, kita tidak ada menangkap kapal. Tadi memang ada info, ada penangkapan kapal barang yang dilakukan Polairud Mabes Polri, tapi nggak ada kordinasi sama kita, sebentar ya biar kita cek dulu,” kata Edi Plantino. Sementara Kepala Bea Cukai Teluk Nibung Tanjungbalai Efenddy R Hutahaean mengaku sangat terkejut dengan kabar penangkapan itu. “Ini baru saya dengar pak, di mana dan kenapa ditangkap,” katanya. (ck3)

Sehari Dirawat, Toke Monja... Sambungan Halaman 8

lebih baik. Hanya saja dirinya menyayangkan insiden tersebut. Jika saja betor yang dikemudikan Padli tidak menyenggol betor yang ditumpanginya, dirinya pasti tidak mengalami musibah. Asiah menambahkan, selain mengalami luka-luka, akibat insiden ini dirinya juga mengalami kerugian material karena uangnya Rp15 juta hilang Sementara abang kandung korban Abdul Manap Silitonga mengatakan, dirinya bersama keluarga telah membawa pulang Asiah karena kondisinya membaik. Hanya yang menjadi pikiran modal usahanya lenyap. Seperti diberitakan sebelumnya Asiah pedagang monja di Tanjungbalai dirawat di Rumah Sakit Umum (RSU) dr Tengku Mansyur Tanjungbalai akibat terjatuh dari becak bermotor (betor). Selain mengalami luka-luka, Asiah juga harus kehilangan Rp15 juta. Abdul Manap Silitongan (40) abang kandung korban menceritakan, Asiah merupakan warga Lingkungan IV, Kelurahan Merbau, Kecamatan Teluk Nibung, Tanjungbalai. Sebelum insiden yang dialaminya, Asiah berangkat dari rumahnya sekitar pukul 08.00 WIB menuju tempatnya berjualan pakaian bekas di pasar TPO Kecamatan Tanjungbalai Utara. Dengan menumpangi betor BK 8676 ASyangdikemudikanWahidinHarahap, mereka melaju dari arah Sei Merbau menuju Tanjungbalai. Tidak jauh dari kantor Koramil Pulau Buaya, tiba-tiba satu unit betor BK 4056 VA yang dikemudikan Padli warga Sei Jawi Jawi KecamatanSeiKepayangTimurAsahanmendahului becak yang ditumpangi korban.

Saat itu bagian bak becak yang dikemudikan Padli menyenggol stang betor yang dikemudikan Wahidin. Akibatnya Wahidin kehilangan keseimbangan dan betor yang dikemudikannya terbalik. Asiah langsung terlempar keluar dari becak yang ditumpanginya. Saat bersamaan, modal usahanya Rp15 juta yang dipegangnya ikut terlempar. Warga yang menyaksikan kejadian langsung berhamburan memberikan pertolongan. Namun uang milik korban hilang. Tidak diketahui siapa orang yang mengambil modal usaha milik korban. Korban yang mengalami luka-luka dilarikan ke RSU dr Tengku Mansyur Tanjungbalai. Asiah mengalami luka di bagian kening, bibir pecah dan luka robek, tangan kanan patah. SementaraWahidinpenarikbetoryang ditumpangi korban mengatakan, peristiwa yang dialaminya terjadi begitu cepat. Wahidin mengaku ia beserta penumpangnya tercampak ke aspal setelah stang betor yang dikemudikannya disenggol oleh betor yang dikemudikan Padli. Menurut Wahidin, saat itu ia melihat Asiah terkapar di aspal, namun wahidin mengaku tidak tahu-menahu mengenaiuangmilikkorbanyanghilang. Sementara Padli pengemudi betor yang menyenggol betor yang ditumpangi Asiah belum bisa dimintai keterangannya. Karena Padli masih diperiksa polisi. Kanit Laka Lantas Tanjungbalai Aipda Khairul Bahar didampingi Brigadir Golfred Siregar membenarkan peristiwa yang dialami korban., Khairul menambahkan, sesuai keterangan dari keluarga Asiah, modal usaha yang dibawa Asiah Rp15 juta hilang. (ilu)

Material Galian C... Sambungan Halaman 8

“Pasir dan padas langka, material proyek itu tidak ada ditangkahan. Pusing dibuatnya,” ujar seorang kontrakstor/ rekanan, Rudi warga Jalan Haji Adlin, Tanjungbalai. Walau sudah “dilacak” ke sejumlah tangkahan, baik di daerah Asahan, Labuhan Batu dan Simalungun, kata dia, bebatuan itu sulit di dapat. “Saking sulitnya, bagaikan mencai emas bang,” sebutnya. Hal yang paling membuat banyak rekanan khawatir, sebutnya, takut kalaukalau pekerjaan tak selesai hingga

berakhirnya kontrak kerja. “Jika pada waktu yang ditentukan pekerjaan belum selesai, aku sendiri bingung apa jadinya proyek itu. Mungkinkan rekanan lain di kota ini mengalami hal yang sama,” ujarnya. Rudi berharap agar Pemerintah Kota Tanjungbalai bisa memaklumi kondisi yang terjadi saat ini. Sebab, katanya, bila pekerjaan tidak selesai dilaksanakan pada akhir tahun dan ditambah 50 hari kerja, maka pihak eksekutif dan legislatif dapat memakluminya. “Hal itu diatur dalam Pepres 70 Tahun 2012 tentang perubahan atas Keppres 54 Tahun 2012,” katanya. (ck3)

Kakek 71 Tahun Cabuli Siswi SMP Sambungan Halaman 8

jajan. Kepada JU, Melati mengaku dirinya tidak mau diberi uang jajan karena Anggrek telah diberi jajan Rp5 ribu dari Kek Jenggot. Mendengar itu, JU lalu memanggil Anggrek dan menanyakan perkataan Melati. Kepada JU Anggrek mengaku kalau dirinya telah diberi uang oleh tersangka. Uang tersebut diberikan agar Ang-

grek tidak menceritakan perbuatan mesum yang dilakukan tersangka kepada Anggrek. Menurut Anggrek peristiwa itu terjadi, Selasa (4/12) sekitar pukul 20.00 WIB. Saat itu tersangka Anggrek ke gubuk tempat tersangka bekerja sebagai penjaga malam di usaha galian C. Di gubuk itu tersangka lalu mencabuli korban. Setelah puas, tersangka memberi uang kepada Anggrek dan menyuruh Anggrek pulang.

AJUi serupa diulangi tersangka keesokan harinya. Namun pada hari kedua saat hendak mencabuli korban, istri tersangka datang ke gubuk tempat tersangka kerja. Melihat itu, tersangka menghentikan aJUinya dan menyuruh korban pulang. Setelah mendengar pengakuan Anggrek, JU lalu emosi dan mendatangi Polsek Sei Tualang Raso untuk membuat pengaduan. Terpisah, Kapolsek Sei Tualang

Raso AKP Ruslan Lubis melalui penyidik Bribka S Samosir membenarkan pengaduan JU. Menurut S Samosir, polisi langsung menangkap tersangka setelah JU membuat pengaduan ke polsek. Saat ini Sujiman masih menjalani pemeriksaan. Terpisah, Sujiman mengaku menyesal atas perbuatan yang dilakukannya. Sujiman mengaku khilaf saat melakukan perbuatan itu kepada Anggrek. (ilu)

Telkomsel Hadirkan NSP Rohani Dibulan Desember Sambungan Halaman 8

terutama saat menjelang Natal dan Tahun Baru, Telkomsel menyajikan berbagai pilihan lagu-lagu rohani yang dapat diunduh pelanggan untuk menggantikan nada sambung standar dihandphone yang diubah menjadi lantunan lagu-lagu rohani yang dapat dinikmati oleh si penelpon sambil menunggu panggilannya terjawab oleh orang yang dituju. Hal ini merupakan bagian dari konsistensi Telkomsel dalam menyajikan berbagai kebutuhan pelanggan untuk menampilkan hasil karya musisi ternama dalam bentuk Nada Sambung Pribadi yang dapat dinikmati oleh seluruh pelanggan melalui nada tunggu di handphonenya, sekaligus menjadikan momen natal dan tahun baru lebih terasa

hikmatnya dengan sajian nada tunggu yang menggugah hati. Menurut Head of Sales and Customer Care Region Sumbagut Division – Filin Yulia “NSP merupakan salahsatu layanan Telkomsel yang sangat digemari. Dan biasanya saat Natal dan Tahun Baru pelanggan Telkomsel sering mengaktifkan lagu rohani sebagai NSP, hal ini dilakukan pelanggan selain menyesuaikan momen natal dan tahun baru serta sebagai penyemarak suasana dibulan Desember, pelanggan juga secara tidak langsung ikut menyemarakkan kegembiraan melalui lagu rohani dalam bentuk nada sambung saat pelanggan lainnya menunggu panggilannya terjawab oleh orang yang dituju. Untuk mengantisipasi kebutuhan tersebut, Telkomsel

menyediakan berbagai pilihan lagu yang dapat digunakan oleh pelanggan sebagai NSP nya”. Untuk informasi Nada Sambung Pribadi pelanggan bisa mendapatkan informasinya dengan mudah melalui website resmi telkomsel yaitu website http:// pilih service lalu pilih menu NSP 1212. Pelanggan dapat mengaktifkan Nada Sambung Pribadi (NSP) lagu-lagu rohani inidenganmengirimSMS,ketikAliaslagu

dan kirim ke 1212, contoh: HMBAA kirim ke 1212. NSP ini dapat dinikmati dengan tarif Rp.9.000,- untuk 30 hari dan dapat diperpanjang jika pelanggan menginginkannya. Pelanggan juga dapat mengirim NSP Rohani sebagai hadiah kepada pelanggan Telkomsel lainnya dengan mengetik RING(spasi)GIFT(spasi)KODE(spasi)NO TUJUAN kirim ke 1212. Dengan tarif yang sama. Contoh : RING GIFT HMBAA 081165XXXX. (leo)

Beberapa NSP lagu Rohani yang dapat diaktifkan pelanggan antara lain: No 1 2 3 4 5 6

Judul Lagu Hai Mari Berhimpun White Christmas Malam Kudus Oh Holy Night Joy To The World Silent Night

Artis Maria Da Silva Michael Buble Viktor Hutabarat Hosana Singers Ruth Nelly & Daud J Pamel Agnes Monica


Prapid Nahkoda KM Bintang Terang Ditolak Sambungan Halaman 8

baru ini. Hal tersebut disampaikan Tekad Kawi SH didampingi Zulham Rany SH selaku kuasa hukum Kasat Polairud Tanjungbalai sebagai termohon I dan Kapolres Tanjungbalai sebagai termohon II, Selasa (18/12). Menurut Tekad Kawi, alasan PN Tanjungbalai menolak prapid yang diajukan Dirham karena berdasakan alat bukti surat yang diberikan termohon kepada kuasa hukumnya, akhirnya PN Tanjungbalai menolak permohonan tersangka Dirham. Tekad kawi menambahkan, penangkapan KM Bintang Terang yang mempergunakan pukat gandeng dilakukan oleh para nelayan, kemudian diserahkan ke pihak Sat Polairud. “Tersangka ditangkapkarenadidugakerastelahmelakukan tindak pidana pencurian perikanan. Yang mana surat penangkapannya ditanda tangani oleh Dirham selaku pemohon dan sudah diserahkan kepada pihak keluarga. Jadi menurut Tekad Kawi, tidak benar termohon I melakukan tindakan pengekangan kebebasan dan pemerkosaan hak-hak pemohon. “Untuk diketahui sesuai surat perintah pembantaran penahanan No.Pol. SP.Han/01/XII/2012/Satpolair tertanggal 1 Desemberb 2012, dilakukan perawatan inap (opname ) di RSU Tanjungbalai sejak tanggal 1 Desember sampai dengan sembuh terhadap diri pemohon. Di sini termohon I telah memberikan perlakukan yang baik tanpa mengenyampingkan hak azasi pemohon

dengan melakukan perawatan dan pengobatan secara intensif terhadap diri pemohon, sebagai mana amanah UU No.39 Tahun 1999 tentang Hak Asasi Manusia,” kata Tekad Kawi saat membeberkan salah satu bukti termohon I. Menurut Tekad Kawi, sedikitnya ada 11 orang saksi yang sudah dimintai keterangannya terkait penangkapan terhadap pemohon, di antaranya, Dahli Sirait, Hermansyah, Syahmenan Lubis, Sangkota Panjaitan, Hermansyah, Irwansyah, Edy Syahputra, Agus Salim, Nazaruddin Siagian, Khoiruddin dan Rahman Tanjung. “Dari pemeriksaan terhadap saksisaksi, diperoleh bukti yang cukup terhadap pemohon untuk dilakukan penahanan dan surat penahanan telah ditanda tangani pemohon yang salinannya dikirimkan kepada pihak keluarga,” tambah Tekad. Sekadar mengingatkan, ratusan nelayan tradisional di Tanjungbalai, Kamis (29/11) kejar-kejaran dengan awak kapal pukat gandeng yakni KM Bintang Terang GT 08 nomor:2340.PPB di perairan Selat Malaka. Setalah puluhan mil melakukan pengejaran, para nelayan berhasil menangkap awak kapal pukat gandeng. Kapal pukat gandeng beserta awaknya dan ikan hasil tangkapannya diserahkan nelayan ke Pos Pol Airud Tanjungbalai di Jalan Asahan Ujung. Khoiron (42) salah seorang nelayan mengatakan, peristiwa ini bermula saat mereka sedang melaut mencari ikan di perairan Selat Malaka. Saat itu para nelayan melihat ada 2 kapal pukat gandeng sedang menangkap ikan di wilayah tangkapan nelayan. Melihat itu puluhan

nelayan tradisional sepakat untuk menangkap kapal pukat gandeng tersebut. Namun kedatangan para nelayan diketahui para awak kapal pukat gandeng tersebut.Sebelumparanelayantradisional mendekat,paraawakkapalpukatgandeng langsungmelepaskantalipukatdanmelarikandiri.Paranelayanyangmenggunakan perahu tradisional berusaha mengejar kapal pukat gandeng tersebut. Kejar-kejaran di perairan Selat Malaka berlangsung cukup seru. Setelah melakukan pengejaran sekitar puluhan mil, paranelayanyangawalberjumlahsekitar 20 kapal mendapat bantuan dari nelayan lainnya. Setelah ratusan nelayan melakukan pengejaran, para nelayan berhasil menangkap 1 kapal pukat gandeng yakni KM Bintang Terang. Sementara kapal pukat gandeng lainnya berhasil melarikan diri. Lalu para nelayan membawa KM Bintang Terang bersama seluruh awak kapal dan ikan hasil tangkapan mereka ke Pol Airud Tanjungbalai. Selama dalam perjanan menuju Pol Airud, para nelayan tradisional lainnya yang mengetahui penangkapan terhadap kapal pukat gandeng, para nelayan tradisional lainnya ikut memberi dukungan dan membawa kapal pukat gandeng ke Pol Airud. Senada dikatakan Andi (23) nelayan tradisionallainnya.MenurutAndi,mereka menangkapkapalpukatgandengbeserta awaknya karena kesal. Selama ini kehadirankapalpukatgandengmembuat hasil tangkapan ikan nelayan tradisional menurun drastis. Itu sebabnya, para nelayan tradisional sepakat untuk menangkap kapal pukat gandeng yang mereka lihat beroperasi menangkap ikan

diwilayahtangkapannelayantradisional. Setelah berhasil menangkap kapal pukat gandeng itu, ribuan nelayan akhirnya memilih menghentikan kegiatan mereka menangkap ikan. Para nelayan memilih ikut mengantarkan kapal pukat gandeng yang berhasil ditangkap kepada Pol Airud Tanjungbalai. Sementara Ketua Asosiasi Nelayan Indonesia H Hamdan Saragih yang ikut menemani para nelayan tradisional menyerahkan kapal pukat gandeng kepada Pol Airud mengatakan, peristiwa seperti ini seharusnya tidak perlu terjadi jika petugas bertindak tegas dan menangkap kapal pukat gandeng yang menangkap ikan di wilayah tangkapan nelayan. Namunkarenaparanelayantradisional merasa pihak-pihak yang berwenang kurang peduli, akhirnya nelayan sepakat untuk menangkap sendiri kapal pukat gandeng. Menurut Hamdan, penangkapan kapal pukat gandeng yang dilakukan para nelayan ini menunjukan jika pengawasan yang dilakukan aparat penegak hukum sangat lemah dan jelek. Kedatanganparanelayaninidisambut Kasatpol Airud Tanjungbalai AKP Edi Plantino. Pantauan METRO, Edi beserta anggota Pol Airud Tanjungbalai menerimapenyerahankapalpukatgandeng yang ditangkap nelayan. Edi berjanji pihaknya akan terus melakukan pengawasan agar kapal pukat gandeng tidak beroperasi di wilayah tangkapan nelayan tradisional. Edi juga berjanji akan memanggil pemilik KM Bintang Terang untuk dimintai keterangannya. Setelah mendengar penjelasan dari Edi, para nelayan lalu membubarkan diri. (sus)

Sambungan Metro Asahan Tiap Bulan Terima Murid Remaja Korban KTD Sambungan Halaman 1 SEORANG remaja putri yang baru duduk di bangku kelas 1 SMP mendatangi rumah Siti Kholifah. Dia muntah-muntah tak keruan. Siti pun langsung menduga bahwa remaja tersebut hamil. Bahkan, dia bisa mengira-ngira usia kehamilan remaja bernama samaran Partini itu. “Saat itu, dia sudah hamil lima bulan,” kata Siti saat ditemui di Balai Kartini, Senin (17/12). Siti Kholifah datang di Jakarta setelah terpilih menjadi wakil Jawa Timur dalam kontes Srikandi Award 2012 untuk menyambut Hari Ibu tingkat nasional. Ketika Siti memberi tahu orang tua Partini, bapak Partini langsung naik darah. Dia tidak percaya anak gadisnya yang masih bau kencur itu sudah hamil. Siti lalu meyakinkan si bapak dengan tes USG. “Hasilnya sesuai dugaan saya, dia sudah hamil lima bulan. Setelah tes itu, bapaknya baru percaya,” kenang Siti. Kasus Partini yang terjadi sekitar dua tahun lalu tersebut bukan sesuatu yang mengejutkan bagi Siti. Hampir setiap bulan dia menerima kabar adanya remaja putri yang hamil di desanya. Bidan berusia 40 tahun itu mengakui, kasus KTD di Desa Ploso, Pacitan, Jawa Timur, cukup tinggi. Selama 20 tahun menjadi bidan desa di Pondok Bersalin Desa (Polindes) Ploso, dia kenyang menangani remaja SMP atau remaja dalam rentang usia 12-15 tahun yang berbadan dua. “Bukan hanya angka KTD yang tinggi, pernikahan usia dini di desa saya juga paling banyak di Jawa Timur,” paparnya. Siti mengungkapkan, di Ploso, remaja putri 12 tahun sudah lazim berpacaran. Hampir setiap hari si pacar

apel ke rumah si gadis ingusan itu. Bahkan, tak jarang si pacar sampai tidur di rumah gadis idamannya. Hal seperti itu dianggap biasa oleh warga. “Ya gimana ndak hamil, wong setiap hari diapeli sampai nginep-nginep segala. Saya pernah curhat ke Pak Lurah, tapi nggak ada tindak lanjutnya,” urai Siti. Yang makin membuat Siti heran dan prihatin, orang tua pihak perempuan seperti membiarkan anaknya berpacaran kelewat batas. Akibatnya bisa ditebak, si remaja putri akhirnya hamil. “Ironis, wong sejak awal pacaran mereka (orang tua) tahu dan seolah membiarkan pacar anaknya sampai menginap segala, kok pas anaknya hamil mereka nggak percaya. Bahkan kemudian bingung dan marahmarah,” ujarnya. Lantaran budaya pacaran yang permisif tersebut, Siti jadi terbiasa menerima kabar adanya remaja putri yang hamil di desanya. Bahkan, untuk jumlah kehamilan di desanya, separo di antara mereka pasti remaja putri yang hamil baru. Dan begitu mendapat kabar adanya remaja yang hamil tersebut, Siti bergegas menuju rumah si remaja. “Biasanya orang tua dan anaknya amat malu dengan kondisi itu. Mereka lalu enggan memeriksakan kehamilan anaknya. Karena itu, saya ngalahi untuk mendatangi rumah mereka. Kalau ada lima remaja yang hamil bersamaan, ya saya datangi satu per satu mereka,” ungkap bidan dari Nganjuk tersebut. Menurut Siti, kehamilan pada usia belia cukup berisiko. Organ reproduksi mereka belum benar-benar siap menerima janin. Tidak hanya itu, pengetahuan yang minim akan gizi ibu hamil menjadi persoalan di desa tersebut. “Masih banyak yang nggak paham

soal gizi ibu hamil. Mereka umumnya kurus-kurus. Bahkan, ada yang sampai mengalami kurang energi kronis (KEK). Akibatnya, berat badan bayi waktu lahir rendah,” ujarnya. Sejumlah mitos yang berkembang di masyarakat Desa Ploso juga cukup menyulitkan penanganan perempuan hamil usia belia. Misalnya, perempuan hamil tidak boleh tidur siang. Mereka juga tidak boleh makan telur. “Katanya nanti amis, matanya jadi rabun,” ucap Siti. Selain itu, masyarakat setempat lebih percaya pada dukun daripada bidan atau dokter. Tentu saja mitos-mitos tersebut merugikan para perempuan hamil belia itu. Prihatin atas kondisi masyarakat Desa Ploso yang masih “terbelakang” itu, Siti menggagas kelas hamil bagi perempuan desanya. Seluruh perempuan yang hamil diajari hal-hal yang terkait dengan kesehatan janin serta persiapan persalinan yang matang. Tidak seperti kelas hamil yang dianjurkan pemerintah (dengan “murid” 10 ibu hamil), kelas hamil gagasan Siti mengundang semua ibu hamil di desanya. Karena itu, tak heran bila setiap pertemuan ada 25"30 ibu hamil yang datang. Di antaranya adalah para remaja korban KTD dan remaja yang nikah dini. “Peserta kelas hamil ini tidak dibatasi usia kehamilan. Perempuan yang hamil muda semestinya ikut kelas ini biar cepat tahu cara menangani kandungannya. Apalagi bagi para remaja putri yang telanjur berbadan dua itu,” tegas Siti. Hanya, tidak mudah mengajak para remaja yang hamil untuk bergabung di kelas hamil. Ada yang malu aibnya diketahui banyak orang. Ada yang

enggan dan sungkan bertemu ibu-ibu yang hamil normal. Menghadapi kondisi itu, Siti tidak tinggal diam. Dia lalu mendatangi satu per satu calon ibu belia tersebut. Dia berusaha merayu agar mereka mau mengikuti kelas hamil. Usahanya tidak percuma. Kini seluruh remaja yang hamil di desanya secara rutin mau bergabung di kelas hamil binaannya. Sebelum kelas dimulai, Siti biasanya memeriksa kehamilan setiap “murid”-nya. Termasuk cek HB (hemoglobin) dan gizi si murid. Khusus bagi remaja hamil usia belia, Siti memberikan perhatian ekstra. Dia perlu mengedukasi mereka mulai soal makanan, persiapan persalinan, hingga pasca melahirkan. “Saya biasanya bilang kepada mereka betapa beratnya orang yang sedang hamil. Belum lagi bila anaknya lahir nanti. Tapi, saya juga mengatakan, mereka harus bisa merawat anaknya dengan baik agar kelak anaknya jadi orang sukses,” papar Siti. Di kelas hamil itu, dia juga mengajak serta para suami dan keluarga ibu hamil. Mereka mengikuti sesi khusus agar tahu cara menjaga kehamilan serta kesehatan ibu dan janinnya. “Supaya mereka paham bahwa ibu hamil itu susah. Jadi, mereka tidak boleh menyuruh istri atau anaknya yang tengah hamil untuk kerja berat.” Dua tahun berjalan, kelas hamil yang digagas Siti menunjukkan perkembangan signifikan. Misalnya, kini jumlah ibu hamil KEK berkurang. Begitu juga kelahiran BBLR (berat bayi lahir rendah) yang menurun drastis. Berkat kerja keras dan perjuangannya mendidik ibu hamil di desanya tersebut, Siti menjadi nomine Srikandi Award 2012.

Penghargaan itu diadakan untuk mengapresiasi para perempuan hebat pada setiap peringatan Hari Ibu. “Saya sangat bangga dikirim ke Jakarta. Semoga kalau saya menang, hadiahnya bisa bermanfaat bagi para ibu hamil di desa saya,” katanya. Siti tergerak menjadi bidan karena terdorong kondisi keluarga. Dia tumbuh dalam keluarga besar yang miskin. Saudara kandungnya tujuh orang. Dari delapan anak itu hanya dirinya yang mampu sekolah hingga SMA. Lulus SMP, Siti melanjutkan ke Sekolah Program Bidan (P2B) di Celaket, Malang. Dia memilih menjadi bidan karena melihat riwayat persalinan ibunya yang buruk. Sang ibu empat kali keguguran. Saat melahirkan anak terakhir, dia hampir meninggal. Itu semua karena minimnya pengetahuan tentang gizi dan persalinan bagi ibu hamil. Berkat tekad kuatnya untuk menjadi bidan, Siti berhasil lulus

dengan nilai terbaik pada 1992. Dua bulan setelah lulus, Siti diangkat menjadi PNS (pegawai negeri sipil). Namun, dia tidak mau ditempatkan di kota asalnya. “Saya pilih Pacitan. Saya tertantang dengan kondisi masyarakat di daerah itu,” ujarnya. Awal menjadi bidan di Ploso, Pacitan, Siti sudah dihadapkan pada berbagai tantangan. Salah satunya, profesinya sebagai bidan tidak diakui masyarakat setempat. Masyarakat lebih percaya kepada dukun bayi untuk proses persalinan. Sikap kepada Siti berubah ketika dia menangani seorang ibu yang hampir meninggal saat melahirkan. Siti pun bekerja keras untuk menyelamatkan bayi dan ibunya. “Alhamdulillah, keduanya selamat. Sejak itu masyarakat mulai percaya pada saya. Karena itu, sekalipun gajinya tidak besar, bahkan sering gratis, saya tidak akan meninggalkan desa itu. Saya merasa lebih ayem tinggal di sini,” tandasnya. (*/c2/ari)

Ingin Punya Pasangan Sambungan Halaman 1 nyanyi. Yang penting, lebih baik lah ya semuanya,” tutur Nadia beberapa waktu lalu di Jakarta. Untuk kehidupan pribadi, rupanya ia ingin segera memiliki kekasih. Ia mengaku sudah mulai membuka hati dan telah ada seorang pria yang dekat dengannya. Ungkap Nadia, awalnya ia menjaga jarak untuk dekat dengan pria. “Sekarang, kalau ada yang sreg, aku berusaha coba kenal lebih dalam. Kriteriaku standar lah, sama kayak

yang lain, cewek-cewek kebanyakan. Yang penting, dia bisa bikin aku nyaman dan sebaliknya juga,” paparnya. Namun, ketika ditanya lebih jauh mengenai identitas pria itu, Nadia memilih bungkam. Ia tidak mau menceritakan sebelum jalinan itu menjadi sesuatu yang lebih serius. “Enggak mau kasih tahu. Yang jelas, kenal sama yang lagi dekat sudah lama banget,” ujar perempuan yang belum lama ini mengaku lebih dari seorang sahabat bagi pemain keyboard David “NOAH” ini. (int)

RABU 19 Desember 2012

Edisi 309 thn V

Kakek 71 Tahun Cabuli Siswi SMP



KA Putri Deli

I. 06.50 WIB

11.17 WIB

KA Putri Deli

II. 12.50 WIB

17.27 WIB

KA Putri Deli III. 17.50 WIB

22.15 WIB

Sumber: Stasiun Kereta Api Tanjungbalai

TANJUNGBALAI- Sujiman alias kakek Jenggot (71) warga Air Joman Baru, Asahan yang seharihari sebagai penjaga galian C mencabuli tetangganya sendiri, sebut saja namanya Angrek (13) (nama samaran, red) siswi SMP di salah satu sekolah di kota Tanjungbalai. AJUi cabul itu dilakukan tersangka, Selasa (4/12) sekitar pukul 20.00 W I B. nformasi diperoleh dari JU (43) ayah korban, kasus pencabulan itu terungkap, Rabu (12/12) saat adik korban sebut saja namanya Melati (9) tidak mau diberi uang untuk jajan di sekolah. Pasalnya

Berangkat (Tanjung) Tiba (Medan)



Anggrek telah diberi uang jajan Rp5 ribu oleh Kek Jenggot. Melihat itu JU merasa curiga, lalu JU menanyai Melati kenapa dirinya tidak mau diberi uang

„) Baca Kakek ....Hal 7

Bawa Barang Bekas dari Malaysia

KM Camar Mulia Ditangkap Polairud Mabes Polri TANJUNGBALAI- KM Camar Mulia yang yang di nahkodai oleh Arsad S ditangkap oleh tim Polairud Mabes Polri di perairan Asahan, persisnya di Kordinat 03’05’836"N-99’52’284"E,

Selasa (18/12). Kapal tersebut ditangkap karena membawa barang bekas dari Port Klang Malaysia tanpa dilengkapi su-

„) Baca KM Camar....Hal 7


„ Aktivitas galian C di pinggiran Sungai Silau Tanjungbalai. Saat ini material galian C langka, kondisi ini membuat para rekanan khwatir pekerjaan mereka tidak akan selesai tepat waktu.

Material Galian C Langka Rekanan Mengeluh TANJUNGBALAI- Rekanan di Kota Tanjungbalai mengeluh karena khawatir pekerjaannya tidak selesai akibat material galian “C” seperti pasir dan batu padas “langka”, se-

„ Asiah toke monza yang terjatuh dari betor dirawat di RSU.

Sehari Dirawat, Toke Monza Diperbolehkan Pulang TANJUNGBALAI- Setelah sehari dirawat di ruang rawat inap Rumah Sakit dr Tengku Mansyur Tanjungbalai, toke monza Asiah (44) diperbolehkan pulang.

Asiah yang ditemui di kediamannya di Kecamatan Teluk Nibung Tanjungbalai mengatakan, saat ini kondisinya sudah

„) Baca Sehari ....Hal 7

„ Telkomsel akan hadirkan NSP Rohani terutama saat menjelang Natal dan Tahun Baru.

Telkomsel Hadirkan NSP Rohani di Bulan Desember MEDAN- Untuk memenuhi kebutuhan pelanggan Telkomsel akan hadirkan NSP Rohani

„) Baca Telkomsel ...Hal 7

„ Para nelayan yang menangkap KM Bintang Terang dan menyerahkannya ke Polairud.

Prapid Nahkoda KM Bintang Terang Ditolak TANJUNGBALAI- Pengadilan Negeri (PN) Tanjungbalai menolak permohonan Pra Peradilan (prapid) yang diajukan Dirham (43) nahkoda KM Bintang Terang, warga Kelurahan

B ak o m b u r

Wak Alang: Alamak tega bonar lah kakek ini, anak SMP pun ondak digarapnyo. Wak Uteh: Itu karono dianyo tak bisa mangandalikan hawa nafsunyo

Gading Kecamatan Datuk Bandar Kota Tanjungbalai yang tangkap para nelayan dan serahkan ke pihak Sat Polairud, baru-

„) Baca Prapid ....Hal 7

RALAT Pada penerbitan Selasa (17/12) halaman METRO Tanjungbalai, di berita TKS Pemko Tanjungbalai Antarkan Sabu ke Asahan, di teks foto disebutkan Waka Polres Tanjungbalai Kompol Budiman Bostang Panjaitan, seharusnya Waka Polres Asahan Kompol Budiman Bostang Panjaitan. Untuk itu kami mohon maaf. REDAKSI

mentara tahun anggaran hanya tinggal menghitung hari. Banyaknya aktifitas proyek pembangunan infrastruktur yang menggunakan material pasir dan batu

padas, membuat kedua jenis material galian C itu kini kian sulit diperoleh.

„) Baca Material....Hal 7

H Andre Taulany akrab disapa dengan Andre(lahirdiJakarta,17September1974; umur 38 tahun) adalah seorang penyanyi,pemainfilmdanpelawakIndonesia. Setelah bergabung dengan grup band Stinky boy, nama Andre lebih terkenal dengan Andre Stinky. Bersama Irwan (bass), Nanno (gitar), dan Edy (drum) serta Ndang (gitar); Stinky telah merilis 8 album di luar The Best Of Stinky dan Love Song Of Stinky. Album teranyar mereka bertajuk Pecinta Sejati dirilis tanggal 19 Mei 2007. Seperti album terdahulu grup band yang pernah meraih penjualan 1 juta kopi lewat hits mereka “Mungkinkah” dan “Jangan Tutup Dirimu”, dalam album tersebut mereka juga masih mengusung tema cinta.(int)

Rabu, 19 Desember 2012

Bus Pinem Kontra Bus Kota Pinang Baru



NYARIS- Pelaku jambret, Bandri (baju hijau) dan rico (baju ungu) nyaris diamuk massa.

TERKAPAR- Toha, warga Rantauprapat yang terkapar setelah ditabrak pelaku jambret di Jalan Sirandorung.

2 Tewas 24 Luka Berat


RANTAU- Dua anak bagu gede, Bandri (17) warga Bina Raga dan Riko (17) warga Desa Janji nyaris remuk diamuk massa setelah menjambret tas milik Anggita (16) warga By Pas, Selasa (18/12) di Jalan Marathon. Pelaku berhasil diringkus karena korbannya mengejar, setelah berhasil

menjambret tas Anggita siswi SMK N 2 Rantauprapat, pelaku berusaha kabur dan menambrak sepeda motor milik Toha (40) warga Rantauprapat di Jalan Sirandorung, Simpang Gelugur Anggita menjelaskan, dirinya dijambret dua remaja di Jalan Maraton usai pulang les

tambahan di sekolah pada pukul 18.00 WIB. “Setibanya di Jalan Marathon, tas ku di jambret mereka. Langsung aku berteriak jambret sambil mengejar mereka dari „) Baca Jambret .....Hal 10



OLAH TKP- Petugas Satlantas sedang melakukan olah tempat kejadian perkara tabrakan yang melibatkan bus Pinem dan bus Kota Pinang Baru.

Informasi yang dihimpun, tabrakan terjadi ketika Bus Pinem yang melaju dari arah Medan menuju Pekan Baru menabrak pembatas jalan yang berdiri tepat di tengah Jalinsum Desa Janji, Kecamatan Bilah Barat. Akibatnya, ban depan bus Pinem itu terangkat dan supir membanting setir ke arah kanan, ber-

Mahasiswa Desak Laporan Bansos Ditangani


UNJUKRASA- Puluhan mahasiswa berunjukrasa di kantor Kejaksaan Negeri Rantauprapat, Selasa (18/12).

RETRIBUSI SAMPAH LABUSEL CAPAI 100,8 PERSEN KOTAPINANG- Dinas Pasar, Kebersihan dan Pertamanan Kabupaten Labubanbatu Selatan berhasil mengumpulkan pendapatan dari retribusi sampah sebesar

Rp151,252,000 atau 100,8347 persen dari target dasar sebesar Rp150.000.000. Target PAD pada Diskebtan tahun 2012 sebesar Rp420 juta dari tiga sektor yakni retribusi sampah, retribusi pasar dan retribusi kekayaan daerah. Sekretaris Diskebtan Labusel Awaluddin Harahap SSos kepada METRO, Selasa (18/12) mengatakan hasil

RANTAU- Puluhan mahasiswa yang tergabung dalam Ikatan Mahasiswa Labuhanbatu melakukan unjukrasa di Kantor Kejaksaan Negeri Rantauprapat, Selasa (18/12). Dalam orasinya, mahasiswa mendesak Kejaksaan Negeri Rantauprapat untuk menindaklanjuti laporan dugaan korupsi bantuan sosial pendidikan dari Kementerian Pendidikan dan Kebudayaan, yang disalurkan kepada 50 Sekolah Dasar (SD) dengan jumlah total Rp23 miliar. Kordinator aksi Budi Siswandi mengatakan, pihaknya meminta kepada Kepala Kejaksaan Negeri Rantauprapat agar memanggil dan memeriksa 50 kepala sekolah yang menerima dana bansos tahun 2012. Pihaknya juga mendesak Kajari Rantauprapat menetapkan tersangka kasus korupsi di Dinas Pasar tentang penggunaan „) Baca Mahasiswa .....Hal 10 PAD sementara sebesar Rp392.097.600 atau 93.3 persen dari target PAD tahun 2012. Sektor target PAD terbesar pada Diskebtan Labusel berada pada sektor retribusi pasar sebesar Rp260.000.000. Menyusul retribusi sampah sebesar Rp150.000.000 dan target terkecil berada pada sektor „) Baca Retribusi .....Hal 10


HANCUR- Bus Pinem yang hancur bagian depannya setelah bertabrakan dengan bus Kota Pinang Baru, Selasa (18/12).

AS 2 TEW A 24 L U K 10 HAL


Laju Pertumbuhan Penduduk Tanggung Jawab Bersama AEKKANOPAN- Bupati Labuhanbatu Utara HKharuddinsyah Sitorus SE mengingatkan seluruh masyarakat Labura untuk bersama-sama menekan laju pertumbuhan penduduk. Hal tersebut disampaikan ketika membuka pencanangan kesatuan gerak PKK-KB-Kesehatan tingkat Kabupaten Labuhanbatu Utara di Aek Kota Batu, Kecamatan Na IX-X, Senin (17/12).

“Kita merasa khawatir kedepannya laju pertumbuhan penduduk (LPP) bila tidak dapat dikendalikan akan terjadi baby boming, hal ini akan berdampak keberbagai sektor kehidupan lainnya seperti bidang pendidikan, kesehatan, tenaga kerja dan lainnya,” kata Kharuddinsyah Sitorus. „) Baca Laju Pertumbuhan .....Hal 10


IMPLANBupati Labuhanbatu Utara didampingi Kakan PPAKB Labura, Kadis Kesehatan, Camat NA IX-X, ketua TP PKK Na IX-X, melihat pasien yang dipasang implan.


Mobil Ambulans PT HTI Tabrak Rumah Warga KOTAPINANG- Mobil Ambulan milik PT Hutan Tanaman Industri (HTI) menabrak rumah warga di Jalan Lintas Sumatera Kampung Mangga, Desa Asam Jawa, Kecamatan Torgamba, Labusel, Selasa (18/ 12) sekira pukul 04.30 WIB. Tidak ada korban jiwa dalam kejadian ini, karena Syarifuddin Ritonga pemilik rumah, sedang tidak berada di dalam rumahnya, tetapi bagian depan rumah terlihat hancur. Mobil Panther nomor polisi B1051 WFY milik PT HTI yang difungsikan sebagai „) Baca Mobil Ambulan .....Hal 10

RANTAU- Dua orang tewas dan 24 lukaluka dalam kecelakaan maut yang melibatkan Bus Pinem nomor polisi BK 7599 A dan Bus Kota Pinang Baru (KPB) bernomor polisi BK 7359 di Jalan Lintas Sumatera Desa Janji, Kecamata Bilah Barat, Kabupaten Labuhanbatu, Selasa (18/12) dini hari.


DITABRAK- Mobil ambulans yang menabrak rumah warga.

KOTAPINANG- Pemkab Labuhanbatu Selatan (Labusel) melalui Dinas Perindustrian, Perdagangan, Koperasi dan UMKM (Disperidagkop) menganggarkan dana sebesar Rp900 juta untuk bantuan modal kepada koperasi yang ada di Labusel.

Anggaran tahun 2012 ini mengalami kenaikan sebesar Rp300 juta dari Rp600 juta pada tahun 2011. Tujuannya, untuk memperkuat modal ko„) Baca Disperindakkop .....Hal 10

Nasib Lelaki ‘Kurang Kerjaan’ Sebagai anak Veteran, Samsul (35), memang lelaki pemberani. Sayang, dalam keanggotaannya di sebuah organisasi kepemudaan (OKP), keberanian itu kemudian melenceng, beraninya menyelingkuhi istri orang. Akhirnya, ketika Samsul harus mati dibunuh lelaki yang istrinya dikencaninya, terpaksa dirinya disebut oknum. Kenapa, sudah punya keluarga Samsul kok masih “kurang kerjaan” juga.

Dalam urusan wanita, kaum lelaki memang sering menjadi lupa akan statusnya. Bupati Garut Aceng Fikri dan Deni Ramadani anggota DPRD Tasikmalaya, posisinya bisa terancam gara-gara soal syahwat terhadap perempuan. Padahal urusan syahwat itu nikmatnya tak seberapa, tapi sengsaranya bisa merembet ke mana-mana. Yang celaka bukan dirinya saja, tapi juga keluarganya. “O, itu si Anu, yang bapaknya tukang selingkuh itu kan?” pasti begitu omongan orang. Agaknya oknum anggota OKP dari Palangkaraya (Kalteng) itu tak berpikir terlalu jauh ke sana. Begitu kenal dengan wanita cantik bernama Amita, langsung saja theng….. pendulumnya kontak. Ketika berhasil didekati, amit-amit, ternyata Amita sudah punya suami. Tapi lantaran wanita itu naga-naganga memberi peluang, Samsul merasa sayang untuk melepaskannya. “Ingat Bleh, kesempatan itu „) Baca Nasib Lelaki .....Hal 10


19 Desember 2012

Sekda Akui Kerugian PDAM Rp24 Miliar RANTAU- Pelaksana Tugas Sekdakab Labuhanbatu Ali Usman Harahap mengakui adanya kerugian mencapai 24 Miliar di tubuh PDAM Tirta Bina Labuhanbatu. Namun Ali Usman mengatakan kerugian itu merupakan akumulasi dari kerugian perusahaan pengolahan air minum itu ketika dipegang manajemen lama. “Masalah temuan (kerugian) merupakan akumulasi manajemen sebelumnya. Kita terus mendorong agar di lakukan peningkatanpeningkatan di dalam manajemen PDAM Tirta Bina,” kata Ali Usman, yang sekaligus menjabat Ketua Dewan Pengawas PDAM Tirta Bina dalam pesan singkatnya kepada METRO, Selasa (18/12). Ali Usman mengatakan saat ini, kinerja Manajemen PDAM sudah mengalami peningkatan dan perbaikan dari manajemen sebelumnya. “PDAM saat ini kinerjanya sudah ada peningkatan,” katanya. Tetapi Ali tidak merinci sejak tahun berapa kerugian di tubuh PDAM terjadi serta berapa nilai efisiensi dana operasional yang mampu di hemat PDAM saat dipimpin Amin Prasetyo, Direktur PDAM saat ini. Sementara sebelumnya diberitakan, dalam 10 tahun terakhir, Perusahaan Daerah Air Minum (PDAM) Tirta Bina Labuhanbatu mengalami kerugian Rp24 miliar lebih. Jumlah kerugian mencapai miliaran rupiah setiap tahun di PDAM Tirta Bina, disampaikan Pemkab Labuhanbatu kepada Badan Pemeriksa Keuangan (BPK) Perwakilan Sumatera Utara dalam laporan keuangan tahun 2012. Ketua Gerakan Masyarakat Anti Korupsi (GAMAK) Labuhanbatu Syahbidun Pohan ST didampingiSekretarisDhediIrwansyahSTkepada METRO, Senin (17/12) mengatakan, kerugiaan PDAMTirtaBinasebagaipenyediaairbersihuntuk 7.394 pelanggan yang mencapai miliaran rupiah perlu segera dicari akar permasalahan dan solusi. Sebab selain memungut biaya dari konsumen, PDAM Tirta Bina mendapat suntikan modal dari pemerintah pusat dan Pemkab Labuhanbatu. “Perlu dipertanyakan, kenapa kerugian sampai mencapaiRp24miliarlebih,apayangsalahdanapa solusinya. Jual air kok rugi, logikanya menjual air itu harusnya untung karena bahan bakunya tidak dibeli,” kata Syahbidun Pohan. Dijelaskan Syahbidun, pada tahun 2011, Pemkab Labuhanbatu telah melakukan penyertaan modal sebesar Rp145.600.000 ke PDAM Tirta Bina, sehingga sejak berdiri total penyertaan modal Pemkab Labuhanbatu sebesar Rp14.900.142.443. Selain itu, juga ada dana hibah dari pemerintah pusat yang dicatat sebagai tambahan modal sebesar Rp3.739.711.047. “Ada yang tidak pas di tubuh manajemen, sehingga kerugian tetap diderita setiap tahun. HarusnyaBupatiLabuhanbatusegeramengambil tindakan tegas kepada manajemen, agar kerugian segera dapat diatasi,” kata Syahbidun. Ditambahkan Syahbiddun Pohan, PDAM Tirta Bina Labuhanbatu dipastikan akan mengalami kerugian sebesar Rp2 miliar lebih setiap tahun, sebab berdasarkan data tahun 2010 yang diperoleh dari Persatuan Perusahaan Air Minum Seluruh Indonesia (Perpamsi) Sumut, biaya produksi pada PDAM Tirta Bina mencapai Rp2.773 per meter kubik, sedangkan tarif rata-rata adalah Rp 1.400 per meter kubik. “Kapan bisa menghasilkan keuntungan, kalau biayaproduksijauhlebihtinggidaripadatarifharga jual?” katanya. Diterangkan Syahbiddun, indikasi praktik korupsi di tubuh manajemen PDAM Tirta Bina dikuatkan dengan adanya laporan dana operasional Rp7.561.370.096 per tahun, termasuk penyusutan dan bunga. Sementara total penerimaan per tahun adalah Rp5.216.160.978. Artinya PDAM Tirta Bina Labuhanbatu mengalamikerugiansebesarRp2.345.209.118pertahun. Terpisah, Ketua Komisi C DPRD Labuhanbatu H Muhammad Riyadi STP mengakui pihaknya mengetahuiPDAMTirtaBinamengalamikerugian setiap tahun. Pihaknya berjanji akan segera memanggil Direktur PDAM Tirta Bina untuk mendapatlan informasi yang mendetail, untuk mencari solusi terbaik yang akan diambil. (riz)

Transaksi di Pegadaian Rantauprapat Masih Sepi RANTAU- Transaksi di Kantor Pegadaian Rantauprapat, dua minggu menjelang perayaan Natal dan Tahun Baru belum menunjukkan peningkatan. Harga buah sawit yang merosot, sebelum diperkirakan menjadi salah satu penyebab akan terjadi peningkatan jumlah pegadain barang berharga untuk kepentingan natal dan tahun baru. “Sekarang masih normal, mungkin nanti dapat dilihat pada jadwal penebusan barang gadaian mendatang,” kata Kepala Kantor Pegadaian Rantauprapat Melkian Siregar melalui Manager bisnis fidusia dan jasa lainnya Agustina, Selasa (18/ 12) di Rantauprapat. Dijelaskan Agustina, jadwal akhir penebusan barang gadaian di Pegadaian Rantauprapat pada kwartal III akan dilakukan pada Sabtu tanggal 22 Desember 2012 mendatang. Pada masa itu, akan dapat dilihat kemampuan nasabah melakukan penebusan dan disaat itu akan dilihat terkait dampak penurunan harga sawit. “Mungkin pada saat itu nanti dapat dilihat dampak penurunan harga sawit yang terjadi dan dampaknya pada grafik penebusan barang,” katanya. Meski terjadinya penurunan harga sawit, lanjut Agustina, jumlah peminjaman dan gadaian barang tidak memperlihatkan angka yang signifikan. Masyarakat saat ini lebih berhati-hati memanajemen keuangannya. SektorKeamanan Penurunan harga jual kelapa sawit diprediksi berpeluang memunculkan potensi peningkatkan jumlah tindak kriminal di tengah masyarakat. Khususnya jika kondisinya berlangsung lama. “Ya, jumlah tindak kriminal berpotensi meningkatkarenaturunnyahargaTBSSawit,”kata Kapolres Labuhanbatu AKBP Hirbak Wahyu Setiawan, Sabtu (15/12) di Mapolres Labuhanbatu.(CR-01)

2 Tewas 24 Luka Berat

Sambungan Halaman 9

samaan dari arah berlawanan, datang sebuah Bus KPB trayek Kota Pinang-Medan yang sedang melaju kencang, hingga tabrakan pun tak dapat terhindarkan. “Bus Pinem melaju dari arah Kota Medan menuju Rantauprapat, sedangkan Bus KPB melaju dari arah Rantauprapat menuju Kota Medan. Tabrakan terjadi ketika Bus Pinem menghantam road berer (pembatas jalan,red), bus Pinem terjungkal dan supir membanting setir ke arah kanan hingga menabrak Bus KPB yang datang dari arah berlawanan,” kata Kasat Lantas Polres Labuhanbatu AKP Faidil didampingi Kanit Patroli Satlantas Polres Labuhanbatu Iptu H Limbong Zikri saat berada di lokasi kejadian.

DijelaskanZikri,supirbusKPBSyaiful(40),warga Kota Pinang Kabupaten Labusel dan seorang penumpang wanita yang belum diketahui identitasnya meninggal di tempat kejadian. “Ada 2 korban tewas di tempat, seorang supir dan seorang penumpang bus KPB. Namun hingga kini identitas jenazah penumpang berjenis kelamin perempuan itu belum kita ketahui, dan masih berada di kamar jenazah RSU Rantauprapat” terang Zikri. Sementara 24 orang lainya, yang merupakan penumpang bus Kota Pinang Baru yang mengalami luka-luka yakni Ari (17) warga Perbaungan, Sugito (35) warga Indrapura, Koko (44) warga Rantauprapat, Isma Yulia (17) warga Kota Pinang, Kartika (21) warga Medan, Ismail (21) warga Rokan Hilir, Sri Trisnawati (26) warga Kota Pinang, Takwa (21) warga

Medan, Johannes Ginting (28) warga Medan, Sri (32) warga Kota Pinang, Butet (19) warga Kota Pinang, Riosha Novita (16) warga Kota Pinang, Hilman Simanjuntak (52) warga Tebing Tinggi, Rosmaida (42) warga Tebing Tinggi, Lonaki Sembiring (34) warga Tebing Tinggi, Fransiska (17) warga Pekan Baru, Nesima (64) warga Perbaungan, Putri (26) warga Kota Pinang, Lindawati (28) warga Kota Pinang, Anita (39) warga Blok Songo Kota Pinang, Adita Peranginangin (24) warga Medan, Amrin (27) warga Asahan, Rukita (41) warga Kota Pinang, Pasha (11) warga Kota Pinang. “Mereka yang luka-luka sebagian masih dirawat di RSU rantauprapat dan sebahagian lagi sudah kembali pulang,” kata Zikri. Sementara menurut penuturan dari masyarakat sekitar, pembatas jalan di Jalin-

JAMBRET SISWI SMK 2 ABG DIPUKULI Sambungan Halaman 9 belakang. Ku ikuti mereka dari belakang bang, mulai dari Jalan Marathon, sampai ke Jalan Sirandorung Simpang Glugur. Karena mereka mengebut, ditabraknya orang tua sedang naik sepada motor. Lalu mereka jatuh dan saya minta tolong dan warga pun menangkapnya,” kata Anggita sambil menangis. Sementara, Riko salah seorang pelaku

mengaku dirinya disuruh oleh seorang pemuda untuk menjambret tas. “ Ada abang-abang menyuruh kami menjambret tas itu. Abang itu mengikuti kami dari belakang. Begitu kami kecelakaan, abang itu menghilang,” kata Riko. Pantauan Metro di lokasi, dua penjambret di amankan di rumah penduduk untuk mengantisipasi amukan massa. Korban yang ditabrak oleh jambret langsung di larikan ke

RSUD Rantauprapat untuk mendapatkan pertolongan. Polisi yang tiba di lokasi langsung mengamankan pelaku beserta barang bukti satu unit sepeda motor Jupiter milik pelaku dan tas milik korban. Terpisah, Kasubag Humas Polres Labuhanbatu AKP MT Aritonang saat dikonfirmasi membenarkan kejadian tersebut. “Saat ini pelaku dan sepeda motornya sudah kami amankan,” katanya. (CR-02)

MAHASISWA DESAK LAPORAN BANSOS DITANGANI Sambungan Halaman 9 anggaran biaya rutin dan meminta Jaksa menyelidiki dan menangkap penanggung jawab asset daerah yang hilang di kantor Dinas Pekerjaan Umum. Pihaknya juga meminta Jaksa segera menetapkan tersangka kasus dana uji kelayakan bandara di Dinas Perhubungan. Usai berorasi, perwakilan pengunjuk rasa akhirnya diterima oleh pihak Kejaksaan Negeri Rantauprapat. Perwakilan pengunjuk rasa melakukan rapat dengar pendapat dengan Kepala Kejaksaan Negeri

Rantauprapat Bambang Sudrajat, Kasi Intel Paniel Silalahi, Kasubag Humas Polres Labuhanbatu AKP MT Aritonang dan Kasat Pol PP Abdul Haris Nasution. “Kami meminta kepada Pak Kajari agar menerima tuntutan kami dan segera menindak lanjuti laporan korupsi yang telah masuk dan ditangani oleh Kejaksaan Negeri Rantauprapat,” kata Ikbal, perwakilan mahasiswa. Usai mendengar aspirasi dari perwakilan pengunjuk rasa, Kepala Kejaksaan Negri Rantauprapat Bambang Sudrajat langsung menanggapi aspirasi pengunjuk rasa.

“Saya terima semua aspirasi dari Ikatan Mahasiswa Labuhanbatu. Saya sudah melimpahkan penangan laporan dugaan korupsi bansos kepada Kasi Intel Paniel Silalahi. Saat ini berkas laporan dana Bansos sedang dipelajari. Dan akan ditindak lanjuti oleh Kasi Intel. Saya harap agar kita saling mengontrol dan berkordinasi dalam mengawal kasus korupsi di Labuhanbatu,” kata Bambang kepada pengunjuk rasa. Usai mendengar tanggapan Kepala Kejaksaan Negeri Rantauprapat, akhirnya pengunjuk rasa membubarkan diri. (CR-02)

DISPERINDAKKOP SIAPKAN RP900 JUTA Sambungan Halaman 9 perasi mengembangkan usahanya dalam upaya pengentasan kemiskinan dan mengurangi angka pengangguran. Kabid Koperasi dan UKM Disperidagkop Labusel Syawaluddin Berutu kepada METRO, Senin (17/12) mengatakan realisasi program anggaran tunjangan perkuatan modal kerja dilaksanakan setiap tahun pada triwulan ke-4. Namun, hingga pertengahan bulan Desember tahun 2012 ini belum ada yang direalisasikan karena masih dalam tahap proses. “Belum ada yang direalisasikan. Jumlah koperasi yang mengajukan sebanyak 10 koperasi dengan besaran permohonan sebesar Rp200 juta hingga Rp250 juta per Koperasi. Sedangkan pinjaman maksimal se-

besar Rp200 juta per koperasi,” kata Syawal Berutu. Dijelaskan Syawal, program ditujukan untuk koperasi karena dinilai lebih efektif karena telah memiliki suatu badan hukum. Tetapi karena program ini adalah untuk pengentasan kemiskinan dan pengurangan pengangguran, program tersebut diselenggaran secara berganti-ganti. “Pada tahun 2009 dan 2010 program ditujukan pada individu dan kelompok kerja mikro sedangkan tahun 2010 ditujukan kepada Kelompok. Hanya tahun ini yang ditujukan khusus kepada Koperasi,” katanya. Menurutnya, anggaran Program Tunjangan Perkuatan Modal Kerja sejak pemekaran Pemkab Labusel tahun 2009 secara bertahap mengalami kenaikan. Pada

tahun 2009 dianggarkan sebesar Rp550 juta, pada tahun 2010 dan 2011 sebesar Rp600 juta serta tahun 2012 sebesar Rp900 juta. “Pada tahun 2009 pinjaman modal digunakan oleh dua Koperasi, dua lembaga keuangan mikro, dan 21 usaha mikro. Untuk tahun 2010 sebanyak 67 usaha mikro kecil dan tahun 2011 sebanyak 26 kelompok usaha,” jelasnya. Masih menurut Syawal Berutu, teknis pengembalian dana tunjangan perkuatan modal kerja tersebut, pengusaha modal pinjaman diberikan tengangg waktu selama 3 bulan tidak mencicil dan selanjutnya baru mencicil setiap bulannya. “Dana dipinjamkan ke masyarakat tanpa anggunan dan tanpa bunga dengan sasaran pengetasan kemiskinan dan pengurangan pengangguran,” katanya. ( mhr)

Laju Pertumbuhan Penduduk Tanggung Jawab Bersama Sambungan Halaman 9 Dijelaskan Kharudddinsyah, untuk mengendalikan laju pertumbuhan penduduk, tidak hanya kewajiban pemerintah semata, peran organisasi masyarakat, organisasi perempuan, LSM, perusahaan BUMN, Swasta dan masyarakat sangat diharapkan. Keterpadauan ini harus terus ditingkatkan sehingga seluruh masyarakat menyadari pentingnya mengendalikan lajunya pertumbuhan penduduk. Dihadapan pimpinan SKPD, Camat se Labuhanbatu Utara, Tim Penggerak PKK, Muspika Na IX-X dan ratusan masyarakat, Bupati Labura mengatakan betapa pentingnya program KB direvatilisasi karena sejak era reformasi lajunya pertumbuhan penduduk sangat tinggi, melalui program revatilisasi diharapkan LPP dapat dikendalikan. “Sepuluh program pokok PKK sejalan dengan program KB dan kesehatan, keter-

paduan ini harus terus ditingkatkan , aktifkan dan galakkan posyandu di seluruh lingkungan, berdayakan PKK di Desa dan Kelurahan untuk mendukung program KB dan kesehatan,” katanya. Sementara Ketua TP PKK Labuhanbatu Utara Hj Ely Zarwati Kharuddinsyah dalam pidato tertulis yang dibacakan wakil ketua Hj Ely Riana Minan Pasaribu mengatakan kegiatan kesatuan gerak PKK-KBKesehatan penting untuk terus dilaksanakan, karena memberikan konstribusi nyata terhadap cakupan pelayanan KB dan kesehatan. Melalui kegiatan ini diharapkan timbulnya kesadaran bagi masyarakat, pentingnya program KB dan kesehatan bagi ibu dan anak, serta keadilan gender sehingga peran serta pria ikut program KB menjadi meningkat. Sementara Kepala Kantor Pemberdayaan Perempuan, Anak dan Keluarga Berencana

Labura Dra Nursaadah Lubis MM sebagai leading sektor kegiatan ini, mengatakan, pencanangan kesatuan gerak PKK-KBKesehatan dirangkai dengan pelayanan KB gratis bagi masyarakat pra sejahtea dan KS I sebanyak 90 orang akseptor baru yakni pemasangan implan sebanyak 88 orang dan IUD sebanyak 2 orang. Tujuan kesatuan gerak PKK-KB-Kesehatan ini untuk meningkatkan cakupan pelayanan berkualitas program PKKKB-Kesehatan, meningkatkan kemitraan PKK-KB-Kesehatan dalam rangka pelayanan KB khususnya bagi masyarakat pra sejahtera dan sejahtera I. Usai acara pencanangan, Bupati meresmikan ruang rawat inap di Puskesmas Aek Kota Batu hibah dari Amarhum H Muhammad Samin Sitorus, orang tua Bupati Labuhanbatu Utara. Sekaligus meresmikan bedah warung PKK dan meninjau pelaksanaan pelayanan KB di Puskesmas Aek Kota Batu. (put)

sum Desa Janji berpotensi mengakibatkan kecelakaan lalulintas. Pasalnya, road berer tersebut berada persis di atas puncak jalan menanjak hingga sering tidak terlihat para supir jika melaju dengan kecepatan tinggi. “Letaknya persis berada di puncak tanjakan. Wajarlah kalau bus Pinem itu menabrak benda itu, karena kalau dari bawah tidak kelihatan,” kata Tono (31), warga Desa Janji, Kecamatan Bilah Barat. Ditambahkan Tono, pihaknya berharap Pemkab Labuhanbatu segera melakukan perbaikan letak pembatas jalan agar tidak menjadi ancaman keselamatan bagi pengendara. “Dishub jangan asal-asal saja pasang pembatas tanpa ada rambu - rambu yang jelas. Kalau sudah kejadian, masyarakat juga yang menjadi korbannya,” katanya. (CR-01)

RETRIBUSI SAMPAH LABUSEL CAPAI 100,8 PERSEN Sambungan Halaman 9 retribusi kekayaan daerah. “Kalau realisasi PAD sementara sebesar Rp392.097.600 yang terdiri dari retribusi sampah sebesar Rp151.252.000, retribusi pasar atau tempat Rp234.272.600 dan retribusi kekayaan daerah Rp6.573.000. Ini masih perolehan PAD sementara,” kata Awaluddin Harahap yang didampingi Bendahara Dispaskebtan M Rasid dan Kabid Pasar Burhanuddin. Menurut Burhanuddin, retribusi kekayaan daerah dipungut melalui penyewaan alat berat mini yang dimiliki oleh Pemkab Labusel di Dispaskebtan. Sedangkan aset bangunan yang ada pada Dinas Pasar yang diserahkan oleh Pemkab Labuhanbatu sebanyak 22 unit belum memiliki sumber pendapatan dikarenakan masih dipungut oleh investor dalam masa 25 tahun. “Hingga saat ini, hak guna bangunan belum ada PAD karena saat pelaksanaan pembangunannya dilakukan oleh investor. Jumah bangunan sebanyak 22 unit yakni di Jalan Jenderal Sudirman sebanyak 16 pintu dan di Jalan Prof HM Yamin sebanyak 6 pintu,” katanya. Aset bangunan Pemkab Labusel yang diserahkan oleh Pemkab Labuhanbatu di Jalan Jenderal Sudirman, lanjut Burhanuddin, sebanyak 16 unit sementara sebanyak 8 unit bangunan telah hangus terbakar diantaranya 2 unit bangunan yang digunakan oleh Bank BRI Kotapinang. Hingga saat ini, dukumen kepemilikan aset bangunan tersebut belum diserahkan oleh Pemkab Labuhanbatu. “Kalau aset sudah diserahkan, tapi surat kepemilikan masih disimpan oleh Pemkab Labuhanbatu,” katanya. Ditambahkannya M Rasid dan Burhanuddin, pihaknya optimis target akan tercapai. Sebab, hasil sementara PAD yang mereka sampaikan masih perhitungan awal bulan Desember. “Kita optimis PAD akan tercapai,” kata mereka. (mhr)

Mobil Ambulans PT HTI Tabrak Rumah Warga Sambungan Halaman 9 ambulan dikemudikan Hendrik Hasibuan (42) bersama rekannya Sihombing yang menumpang dari Perdagangan dengan tujuan Duri, Provinsi Riau. Ambulan dalam perjalanan pulang dari RS Herna Medan mengantarkan orang sakit. Samsudin Siregar, warga sekitar mengatakan, kemungkinan besar supir ambulan milik PT HTI sedang mengantuk sehingga tidak dapat mengendalikan mobil dan menabrak rumah milik Syaripuddin Ritonga. Sementara Kanit Lantas Kotapinang AKP.R Siregar didampingi anggota Satlantas Kotapinang Aiptu Tarzuki yang turun ke lokasi serta mengevakuasi mobil untuk dibawa ke Polsek Kotapinang mengatakan, tikungan patah dan jalan sempit, diduga menjadi penyebab terjadinya kecelakaan tunggal yang melibatkan mobil ambulan. (mhr)

Nasib Lelaki ‘Kurang Kerjaan’ Sambungan Halaman 9 datangnya hanya sekali, jadi jangan kamu lewatkan,” begitu kata setan menyemangati diri. Diam-diam Samsul lalu pacaran dengan Amita. Lelaki warga Jalan Kalimantan Gang Mandau, Palangkaraya ini memang pemberani. Terbukti meski tidak punya surat Kuasa Pengguna Istri, dia berani mengajak Amita berbuat sebagaimana layaknya suami

istri. Amita sendiri sudah kadung kesengsem pada Samsul, sehingga aspirasi urusan bawah oknum anggota OKP ini dimanjakan juga. Barang batil pasti takkan lama. Suami Amita begitu tahu istrinya dikencani lelaki lain, tentu saja marah besar. Belum lama ini dia nekad mendatangi rumah tinggal Samsul, tapi yang bersangkutan tidak ada. Akhirnya lelaki ini hanya berpesan, “Tolong kasih tahu suami ibu, jangan sekali-kali mengganggu Amita.

Bagaimana pun juga dia adalah istriku.” Sang istri sudah mengingatkan jangan bermain api. Namun pada kesempatan itu Samsul membantah bahwa telah menjadi lelaki senior (senang istri orang). Untuk menutup kedoknya, Samsul bilang bahwa itu orang yang hanya cari-cari masalah macam pengacara pemula. Jadi kalau sang istri ingin tenang tak termakan isu, lebih baik berdoa menurut kepercayaan masing-masing.

Ny Samsul pun berdoa penolak bala. Tapi ternyata warga hari berikutnya menyaksikan, saat bininya tak di rumah terlihat Samsul dikejar-kejar lelaki begolok. Belum juga sempat memberikan pertolongan, lelaki malang ini sudah terjengkang tewas akibat dibabat golok. Sang pembacok yang diduga suami Amita, hingga kini masih dalam pencarian polisi. Adapun keluarga Samsul terpaksa mencari TPU untuk pemakamannya. Buruk muka cermin dibelah. (int)


19 Desember 2012

Kerja Hanya 6 Hari Selama 9 Tahun, Tetap Digaji BOLOGNA-Sepandai-pandainya menyembunyikan kecurangan, akhirnya akan terbongkar juga. Inilah yang dialami Silvia S (46) tahun warga Bologna, Italia, dihukum dua tahun penjara karena hanya bekerja enam hari selama 9 tahun di RSU. Dia dianggap melakukan kecurangan dengan memanfaatkan dana yang berasal dari publik. Selain itu, dia juga

telah memberikan informasi palsu mengenai dirinya. Dia mengaku sakit sehingga tidak masuk bekerja. Selain sakit, dia juga mengaku hamil dan melahirkan. Tidak hanya satu kali, tetapi juga dua kali. Padahal, dia sama sekali tidak sakit atau hamil dan melahirkan. Selama kurun waktu tersebut, gaji yang berasal dari pembayaran pajak terus diterimanya. (oz/nik)

Dijual, Bungker Mewah untuk Persiapan Kiamat MONTEBELLO - Ron Hubbard sadar betul dengan ramalan kiamat. Dirinya membangun tempat penampungan atau bunker di bawah tanah yang sangat mewah untuk mempersiapkan diri menghadapi kiamat. Banyak kabar yang memperkirakan dunia akan berakhir pada Jumat 21 Desember mendatang seperti yang di prediksikan kalender Maya. Kalender suku Maya yang dimulai 5.125 tahun lalu di 3113 sebelum masehi (SM) akan

A LLTT O L E L A N G H O N D A SUPRA X 125 NEW R Th 10-12: lelang 1 ANlelang utk umum hrg 4 jtan tempat: halaman rumah, Jl.jend.A.Yani (dpn makam pahlawan) R.Prapat. Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang) BEAT TH 11- 12 : Lelang 1 An-lelang Utk Umumhrg 4jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan)-R.Prapat. Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang) AB.VARIO TECHNO TH 12: Lelang 1 An-lelang Utk Umum-hrg 5jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan)-R.Prapat. Hub : 081263238391, 085285380613, 087807037277 (Alto Lelang) SCOOPY TH 11-12 : Lelang 1 An-lelang Utk Umum-hrg 5jtan--tempat: Halaman Rumah, Jl.jend.a. Yani(dpn Makam Pahlawan)-R.Prapat . Hub: 081263238391, 085285380613, 087807037277 (Alto Lelang) AB. REVO/BLADE TH 08-11 : Lelang 1 Anlelang Utk Umum-hrg 3jtan--tempat: Halaman Rumah, Jl. Jend.A.Yani (dpn Makam Pahlawan)-R.Prapat. Hub: 081263238391, 085285380613, 087807037277 (Alto Lelang)


berakhir pada 21 Desember 2012. Kabar itu memicu kekhawatiran diantara sekelompok orang akan bencana besar yang akan terjadi. Hubbard, akhirnya membuat bisnis membangun bunker di bawah tanah yang dilengkapi

Dealer R esmi Suzuk i Resmi Suzuki

PT. TRANS SUMATERA AGUNG MEDAN HP : 0813 7583 8337 -Damanik P: Paket akhir tahun : -Pick UP:•Dp.10Jtaan/angs. 2Jtaan + hadiah; -PickUPMegacarryextra (Baru):Dp.20Jtaan/angs.2Jtaan+hadiah; -APV Arena:Dp.30Jtaan/angs. 3Jtaan+ hadiah; -Ertiga(Baru) Ready Stock:Dp.40Jtaan/angs.3Jtaan+hadiah; -Swift; Ex-over; Splash ; Dp.Nego+hadiah


Promo Akhir Tahun • Daihatsu Paket Ringan

• Gran Max Pick Up Dp. 11Jtan angs 2Jtan • Xenia Dp. 27Jtan angs 3Jtan • Terios Dp. 24Jtan angs 4Jtan Proses cepat, pasti oke+hadiah menarik Rudi Astra, 0813 9611 6389

Promo Desember CAPELLA

DAIHATSU KISARAN Xenia DP. 27 Jt Angsuran 2 Jt an Xerios DP. 27 Jt Angsuran 3 Jt an Luxio DP. 30 Jt Angsuran 3 Jt an Pick Up DP. 11 Jt Angsuran 2 Jt an Sirion DP. 30 Jt Angsuran 3 Jt an Proses cepat data dijemput Hub: L. Rivai Sembiring 0812 6457 0000


-Ertiga DP. 25Jt-an Ang. 5Jt-an -APV Arena DP. 19Jt-an Ang. 3Jt-an -Carry PickUp DP. 18Jt-an Ang. 2Jt-an -Mega Carry DP. 19Jt-an Ang. 3Jt-an -Swift ST DP. 36Jt-an Ang. 4Jt-an -Splash DP. 46Jt-an Ang. 3,6Jt-an Syarat Ringan&Proses Cepat. Hub: PT. Trans Sumatera Agung, Jl. SM. Raja KM. 7,3 Medan HP: 0812 6037 9028

BYSON TH11-12: lelang 1 an-lelang utk umumhrg 10 jtan. tempat di Halaman rumah, Jl.Jend. A.Yani (dpn makam pahlawan) Rantauprapat. Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (alto lelang)


XEON--TH 11-12 : Lelang 1 An-lelang Utk Umumhrg 3jtan. tempat di Halaman Rumah, Jl. Jend. A. Yani (dpn Makam Pahlawan) R.Prapat. Hub: 0812 6323 8391, 0852 85380613, 087807037277 (Alto Lelang)


MIO SOUL TH 09-12: Lelang 1 An-lelang Utk Umum-hrg 3jtan-di Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan) R.Prapat. Hub: 081263238391, 085285380613, 087807037277 (Alto Lelang) JUPITER MX NEW TH 11-12 : Lelang 1 Anlelang Utk Umum-hrg 5jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan) R.Prapat. Hub: 0812 6323 8391,0852 8538 0613 (Alto Lelang) MIO TH 09-12 : Lelang 1 An-lelang Utk Umumhrg 2jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan) R.Prapat. Hub :0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang) JUPITER Z NEW TH 10-12 : Lelang 1 An-lelang Utk Umum-hrg 4jtan--tempat: Halaman Rumah, Jl. Jend. A.Yani (dpn Makam Pahlawan) R.Prapat. Hub : 0812 6323 8391, 0852 8538 0613 (Alto Lelang) VEGA ZR TH 09-12 : Lelang 1 An-lelang Utk Umum-hrg 2jtan--tempat: Halaman Rumah, Jl. Jend. A. Yani (dpn Makam Pahlawan) R.Prapat Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang)

SUZUKI TITAN TH 10: Lelang 1 An-lelang Utk Umum-hrg 2jtan--tempat: Halaman Rumah, Jl.Jend.A. Yani(dpn Makam Pahlawan)-R. Prapat. Hub : 081263238391, 085285380613, 087807037277 (Alto Lelang)

MOBIL & MOTOR LELANG 250 MOTOR & 15 UNIT MOBlL Harga Limit 2 Jt S/D 7 Jtan Th 08-12. Lelang Satuan, Terbuka Untuk Umum, Berbagai Merek & Tipe, Cek Fisik Tgl 13 S/D 17 Desember 2012. Lelang 18 Desember 2012 Pukul 13 ; 00 Tempat: Dpn Makam Pahlawan,Jl.Jend.A.Yani-Rantau Prapat. Hub: 0812 6323 8391, 0852 8538 0613, O878 0703 7177 (alto Lelang)

penjualan sepeda motor merek Suzuki khusus yang baru secara chas n credit. Ayo buruan dapatkan sepeda motor Suzuki. Hub Koord. Sales Bpk ARIFIN Hp : 085276045145. Jl. Jalinsum simp. Kebun Kopi Kuala sepeda motor Yamaha, cash& credit terbaru, dapatkan Helm LOVENZO Cuma-cuma dengan pembelian new zupiter Z1 (kesempatan terbatas). Dialer Telp:0622-31883. Jl. Jend. Sudirman Kota Indrapura, B.Bara.

*PAKET AKHIR TAHUN DAIHATSU* XENIA 1,3.., CICILAN 1,2 Jt TERIOS.... CICILAN 2 Jt GRAN MAX PICK UP DP 11 Jt Proses Cepat, Ringan, Mudah & Pasti. Info & pemesanan : RAHDY: 081361329496 - 082362009080 CV. PARNA JAYA MOTOR: Jual

sepeda motor honda, yamaha, suzuki Viar, baru dan bekas; Cash & Credit; Tukar tambah; Urus Perpanjang STNK, BBN.•Jl. Jend. Sudirman No. 389 ABCD, Indrapura ( 0622-31788) • Jl. Acces Road, Simp. Durian, Kuala Tanjung.

dengan fasilitas seperti sofa kulit, TV plasma, tempat tidur, dapur, toilet disiram dan bahkan perapian. Bunker yang bentuknya mirip dengan bom ini berada di Montebello, California, dan dijual dengan harga 46.000 pound sterling atau sekira Rp719 juta. Hubbard, mengatakan bahwa ia sedang membuat bunker di dua tempat yaitu di New York dan satu lagi di Indiana. ”Saya akan menghabiskan tiga hari di

NAGA MAS MOTOR: Services - Ganti Oli - Spare Parts - Accessoris. Jl. Teuku Umar Ujung, Tj.Balai. Hub: AKIET - 0852 7668 8988


Solusi tepat penyembuhan alamiah, illahiah, ilmiah. Mengobati macam penyakit baru ataupun kronis. Seperti : kanker, tumor, struk, lemah syahwat, impoten, ramuan khusus bagi yg belum punya keturunan, dll. Praktek di Jl. WR. Supratman Gg.Sado no. 1 R. Prapat. Hp : 0813

6112 8555.Website: APOTIK&CLINIK


menyediakan berbagai macam obat yg bermutu dan harga terjangkau.Terima rawat inap, Periksa ibu hamil, Bersalin, Sunat, Imunisasi, EKG, USG. Tersedia, LAB, CLINIK, &ambulan.DAPAT KONSULTASI GRATIS dgn apoteker. Desa Tanjung Gading Sei Suka, Indrapura, Kab. B.Bara. Hub: 0622-632088

APOTIK KARYA: Jual berbagai obat dan

Lengkap, Harga terjangkau. Terima pasien & konsultasi kesehatan. Jalinsum Desa Tj. Gading, Simp. Kuala Tanjung, Indrapura, B.Bara. Telp: 0622-632751

"Balai Pengobatan ELLY” Izin No

: 800/3244/DINKES SOS/2008, Penanggung Jawab:

Dr. HIDAYAT, M. Kes. Sedia berbagai Jenis obat, dan mengobati penyakit untuk kesehatan anda & keluarga, bersedia datang ke rumah anda untuk panggilan pengobatan di rumah; waktu 24 Jam. Empat Negri, Kec. Lima Puluh, Kab.Batu Bara. Hub: IBU ELLY0852 7668 2236


pemeriksaan ibuhamil,sunatan,ibu bersalin,imunisasi, rawat inap, tsedia mobil ambulan. Konsultasi kesehatan, penyakit. Jl. BESAR LIMA PULUH KOTA (Dpn Mesjid besar limapuluh)Kab. B.Bara

"CV. ANUGRAH JAYA" Kontraktor,

Lepelansir, Biro Jasa, Dagang umum, Pertanian, menyediakan&menjual barang-barang serta peralatan bangunan,dll. Jl. Merdeka Pasar Mereng Desa Suka Maju Kec. Tanjung Tiram,Batubara. hub:Ibu Ani-0853 6067 1005

COLOUMBIA, CASH & CREDIT FURNITURE & ELEKTRONIK harga terjangkau, paket murah meriah (cicilan ringan). Pasar 8 Jl. Jend. Sudirman, Indrapura, Batubara


masih berjalan diberikan pelatihan & alamat Suplier bahan baku, Peminat serius Hub:0617870503 (Jam Kerja) DIJUAL CEPAT Rumah : Lebar 5, panjang 50, bangun 45, di Jl. A.Yani/Psr.Merah Simp.4 TalawiBatubara (dpn SPBU). Hub: 0821 6839 0096. DIJUAL RUMAH TIPE 54 (Cash/Over kredit)– Rumah Baru, 2 KT, Pos Satpam, PDAM, komplek H. Bahren Kampung Baru, Belakang SUZUYA, R. PRAPAT. Hub: 0813 6048 3699


Menjual berbagai macam mas dan perak dgn berbagai bentuk tempahan: cincin, kalung, gelang rante, anting2, mutu memuaskan, kunjungi kami di: Pajak Pagi Kebun Kopi, Indrapura, Batubara

Toko Batik NUR’ ALFI: Jual batik pekalongan berbagai jenis, pakaian sempit (pas-pasan), Couple, baju anak2, Blus, kemeja, dll. Murah dan terjangkau. Jl. A. Yani/ Psr Mereng Simp. 4 Talawi, B.Bara. Hub: Rosini - 0812 6002 9388


Khusus pangkas pria.Rapi, indah, bersih, trendy & memuaskan. Mode masa kini. Hub: Rahmad, 0878 1892 0095. Samping Pertamina, Parepare, Indrapura, Batubara

“KLINIK HERBAL” Ahli Penyakit Kronis tnp Operasi/Injeksi +GURAH+ Penyakit yang sdh Terbukti SEMBUH, & Mengobati brbagai penyakit lainnya. Buka Praktek Jam: 08.00-20.00WIB. Hari libur/besar tetap Buka. Jl. Jend. Sudirman No. 28/ JALINSUM, Indrapura. HP: 0812 6327 9810 0853 7066 9348 PERCETAKAN & ADVERTISING BIMA : Terima segala jenis cetakan partai besar & kecil, undangan, sablon, stempel, MMT, baliho, Neonbox, baju kaos, kop surat, dll. (Hub: HABIB SYAH: 0852 7074 7585). Jl. Jend. Sudirman No. 288, Indrapura, B.Bara

“BOMBAY SPORT”: Jual alat2 Olahraga sport, sepatu futsal/bola, kaos, baju , sandal, tas , asesori sport, dll. Barang bagusHarga Memuaskan. HUB: M Yusuf, SE - HP: 0813 7635 8395 - 0812 9436 3434. Jl. Jend. Sudirman, Indrapura (depan UGD)


Jual Pakaian wanita model terbaru, Harga Grosir & Eceran. Dijamin Murah! Jl. Gelugur (seberang Psr Gelugur) R. Prapat. Hub: 0624327863

DIKA GORDYN Menerima Segala Jenis Tempahan Gordyn, Kebaya, Seragam; menerima Bordir. Terima Anak Kustum (Wanita). Hub: Ibu Indah–0821 6432 2396, di Jl. Kopertis Lingkungan 7, Indrapura–B.Bara.

HENDY GETs Stiker & Aksessories:

Penjualan & Pema-sangan Variasi Mobil dan sepeda motor. Jl. Jend. Sudirman, Indrapura (Samping Lap. Sepakbola); HP: 0813 7644 4177; Telp. 0622 - 646 144.

SEHAT SERVIS DOORSMEER: Ganti oli, pispot, balancing ban, tubeless, angin hidrogen, cot, dan ban luar radial. Masih membutuhkan beberapa tenaga Doorsmer (Tukang Cuci Mobil). Jl. A. Yani No.6/8, Kisaran.

LKP “ U N I S M A R T C O M ” Kursus Komputer Mahir program Office 2007, Desain Grafis (Ps CS4, CorelDRAW X4), Teknisi Komputer dan Jaringan, MYOB Acc V.17, (Belajar sampai Mahir) Hub: 0877 4930 6155. Jl. Lintas Sumatera KM.137, Bangun Sari, B.Bara.

MAGIC ENERGY ION BOTOL : Menghasilkan energy air dalam 1 detik. Kaya Oksigen, bermolekul kecil mudah diserap tubuh. Tubuh lebih Fit & Konsentrasi, melancarkan peredaran darah & Detoks, cegah penuaan Dini. Cegah Penyakit Jantung, Liver, Pankreas, ginjal, usus serta kanker. Tersedia 3 ukuran ( 500 ml, 700 ml, 1000 ml ) di KISARAN. Hub. 0813 6113 2128

CASH & KREDIT PERUMAHAN MUTIARA REGENCY KISARAN Bulan promosi selama persediaan masih ada, Tersedia type 48 & 60. Harga terjangkau. Fasilitas : Listrik, Sumur Bor, PLN Prabayar, Batu Block, Satpam. Siap HUNI. Hub: Bpk. Kodimin – 0813 6113 2128. BERGEGASLAH



Menerima pemasangan design, Plafon gyfsum rumah dan Perkantoran dgn tenaga yg berpengalaman.serta menjual sgala macam keperluan gyfsum. Hubungi: 087818917066 (Bpk Anwar); 0853 5910 8633 (Ibu Ida), Jl. A. Yani/Psr. Mereng Simp. 4 Talawi - Batu Bara.

SHE NDA KING JOSS: Obat kuat & tahan lama khusus dewasa:- anti lemas - anda puas - istri semakin gemas. Untuk pemesanan: Klinik Fengshui Jl. Sempurna (Gg. Buntu) R.Prapat. Hub: 0813 2424 1415

Menerima Tempahan Kosen, Pintu, Jendela dan Menjual segala ukuran jenis Kayu. Jl. Dr. Hamka ( RSU ) R.Prapat. Hub: 0813 6159 0689

“UD MANDIRI”: Jual segala Sparepart

sepeda motor & menerima boring, pasang botol,siting klep, pasang sokar, jual accessories & sepeda anakanak, menjual secara Grosir & eceran. Access Road Kuala Tanjung, Hub: UDIN - 0813 7024 4402.

UD .ISK AND A R Jual: Barang & Alat-alat D.ISK .ISKA DA

DIJUAL: Bahan & Peralatan Chrom yang



ANDREAN GYPSUM: Profesional dalam pemasangan Plafon Gypsum, Accessories Gypsum, atap baja ringan, stainless stell & desainer. Dapat juga pertamanan, poid balkon, kanopy, dll. Jl. Diponegoro No.212/283 KISARAN. Telp:(0623)-43611; HP: 0812 6399 062. Pimpinan


Trail. Navara, Murano. Ready Stock, cash/ credit. Hub: Mili 0852 7033 7739

Melayu Modern, & TOKO D.J 2 Elektronik, Cash & Credit segala jenis elektronik. Hub: Iwan (0811 6282 272 – 0852 7599 9772), di Simpang Tiga Pahang, Talawi, B.Bara

busana muslim, pakaian pria & wanita, serta perlengkapan baby, accesoris jilbab, mukenah,dll. Jl. Merdeka No.03 Depan kantor PLN Tanjung Tiram & Jl. Rakyat No.40 (Depan PajakTanjungTiram) B.Bara. Hub:Jonni Hendra, SPd. - 0823 6269 4535

Olahraga, Sekolah, Komputer, dan Perlengkapan Sholat, HARGA GROSIR. Jl. Lintas Medan-Kisaran, Simpang Kebun Kopi, B.Bara. HP: 0852 7680 942

NEW NISSAN : Grand Livina, Juke, X-

“DINDA Keyboard” Entertainment Musik

”Banyak orang yang membeli bungker ini sebagai bentuk asuransi untuk kemungkinan terburuk. Sama seperti seseorang yang akan membeli asuransi rumah karena takut kalau terjadi kebakaran dirumah mereka,” tambahnya. ”Kami telah menjual bungker ini sejak satu bulan yang lalu setelah Presiden Obama terpilih ulang,” jelas pria asal Montebello, California itu. (oz/nik)

berbagai prabot rumah tangga, lemari, kursi, tempat tidur, terbaru dan lengkap. Furniture harga Famili, barang istimewa dan memuaskan. Simpang gallon Jl. Access Road INALUM, Kuala tanjung, HP: 0823 6986 5100

MITSUBISHI SUMA TRA BERLIAN MOTOR: SUMATRA Pajero Sport, Outlander Sport, Mirage, Strada Triton, Lancer, (Chasis, Box, Tangki, Bus, Dump Truck Colt Diesel & Fuso, Pick Up & Minibus L300 & T120ss), Bunga Angsuran/Cicilan mulai dari "0%". Hub: BAYU - 0852 7696 8284 • Pick Up Dp. 25% angsuran 2 Jtan • Xenia Dp. 25% angsuran 3 Jtan • Terios Dp. 25% angsuran 3 Jtan • Luxio Dp. 25% angsuran 3 Jtan • Sirion Dp. 25% angsuran 3 Jtan Hub: ZUL CAPELLA, 0823 6253 2633

bungker agar aman. Jika Anda memiliki bungker, Anda mungkin juga pergi bersembunyi didalamnya,” ujar Hubbard, Selasa (18/12). Bungker buatan Hubbard ini berbentuk silinder yang berukuran 500 kaki persegi dengan diameter 10 kaki dan panjang 15,24 meter. ”Saya mulai membuat tempat ini, karena saya juga ingin memiliki satu untuk diriku sendiri,” ungkap Hubbard.

UD. JANNAH: Menjual alat2 pancing, Kantor,

Bangunan, Kontraktor, Levelansir. Harga standar & terjangkau, dll. Jl. Masjid Lama No. 41 Talawi B.Bara. Hub: Hj. Ani - 0852 7508 7880


Panglong Jual segala jenis papan(papan Boat/Sampan) & alat-alat bangunan, Menerima tempahan, Khususnya ukuran panjang dari ukuran standartnya. Dusun II Jl. Merdeka Tanjung Tiram B.Bara. Hub: Bapak Irfan, HP : 0812 6456 2615

“CAHAYA PRABOT” cash & credit,

berbagai macam prabot, rak tv, meja makan, sofa, springbed, meja belajar, elektronik, kulkas, mesin cuci, tv, LCD, DVD, kompor gas, dll. Kunjungi: Jl. Access road inalum, desa pakam raya no.20 (depan pajak sore). (0622)31326/3327.


kursi, lemari dan semua jenis barang-barang perabot rumah tangga lainnya,di jual dgn harga yg murah & terjangkau. Jl. Besar Simpang Dolok, Lima Puluh, B.Bara, Serta menyediakan tempat Rekreasi pemandian “ Kolam Lima Putri “ Untuk keluarga anda, Jl.Besar Air Hitam Simpang Dolok. Hub: Bapak Agam, HP : 0812 6474 707


Aluminium, Contraktor, Partition, Swing door/Rolling Door, Serta Menyediakan Barang Seperti : Pintu Kamar Mandi, Tenda/Awning, Lemari Kaca, Rak Piring, Steling, Raill Gorden, Tangga, Jemuran Baju & Segala Jenis Kaca. Alamat: Jl. Merdeka No. 165166 Batubara, Hubungi : DICKY BUDIANTO, HP

: 0812 655 3575 - 0812 6536 6166.

TUKANG BURUNG RAHMAT KT: Menjual berbagai macam jenis burung pilihan,menerima tempahan berbagai jenis Kandang (sangkar burung). Hub: 0823 6403 5666. Jl. Simp. Kuala Tanjung, Indrapura, B.Bara M E M S Rahasia Untuk Pria Gagah &

Perkasa: Memperbaiki masalah Prostate, Menghilangkan Sakit Pinggang, Kegairahan Pria, Kualitas Sperma, menghilangkan Lemak, Mencantikan kulit tubuh, Tekanan darah, Liver, Kolestrol, Dll. HUB: 0813 6113 2128


PENLUB dari Lubri-Lab dengan kombinasi dari bahan-bahan yang sangat penting untuk membersihkan, melumasi & melindungi logam. PENLUB menembus pori-pori logam,melarutkan karat, membersihkan gemuk& kotoran, menghilangkan kelembaban, dgn kemampuan dielektriknya yang unik. HUB : 0813 6113 2128 di KISARAN

Baginda Muslim Harahap(Asien)

ANT A, GROSIR ULOS BATAK D O N G GA TA Jual Berbagai Jenis Ulos Batak, partai besar dan kecil. Hub: RAMSES TAMBUNAN, HP: 0812 6875 1155 - 0877 6864 2302. Jl. Perintis Kemerdekaan No.165 Blok 8, Lima Puluh, B.Bara "RUMAH BATIK KRISHNA" Jual batik ternama & terpopuler, pria/wanita, seragam kantor, sekolah, batik pesta, terima grosir&eceran. Hub: Pak Krisna Gunawan S - HP. 0813 6060 4990. Jalinsum Tanjung Gading, Simp. Kuala Tanjung


Perawatan rambut, wajah & tubuh terlengkap di B.Bara. Paket Hemat SPA (Masage+Lulur+ Spa:Rp.180rb) hny Rp.150rb; Paket Face To Hair Sacial+Creambath Rp.80rb hny Rp.50rb. Hub: 0852 7508 4444, Jalinsum Binjai Baru, B.Bara.

LKP “CANTIK MANIS“ belajar tata rias rambut pengantin, kecantikan kulitrambut, menjadikan tenaga kerja terampil, siap pakai wirausaha dan trend model professional, hub 0812 6374 0598, Jl. Besar Perdagangan, Lima Puluh Kota B.Bara.

“AA” Fashion: jual berbagai jenis pakaian muslim,wanita, pria, anak2, & dewasa, berbagai merek dan ternama, & terbaru. Melayani eceran & grosir. Jl. Jend. Sudirman, Indrapura, Kab. B.Bara. HP: 0813 6154 2640

JAYA KOMPUTERCash/Credit: Jual Laptop, Netbook, Camera Digital, dll. Jl. Sirandorung Ujung (Samping Happymart) R. Prapat; HP: 0853 6198 2266

BAKSO PAKDE: Sajian Bakso, Mie Ayam, Nasi/Mie Goreng, Minuman : Jus To m a t , J u s M a n g g a , J u s Wa r t e l , J u s Timun, Jus Pokat, Jus Jeruk. Hub: 0813 7645 3399–0823 6432 1148-0819 9041 4 2 2 2 . S i m p a n g K u a l a Ta n j u n g (INALUM) AN KANDU A N G: RUMAH MAKAN N NAN KANDUA Menyajikan berbagai masakan padang, Terima pesanan nasi bungkus & nasi kotak, aneka juice, Harga terjangkau. Jl. SM Raja No. 404 Kisaran. Hub : Adr Robert - HP : 0823 9070 7038 MAJESTYK: Sedia bermacam jenis roti

dan Bolu: Bika Ambon, Lapis Legit, Kue MP, Bolu Gulung, Roti Tawar, Donat dan dll. Terima pesanan untuk acara Rapat, Arisan & Ultah. Hub: 0622-646300 ; Jl. Jend. Sudirman No. 75 INDRAPURA, Kab. B.Bara

“WAR UNG MPOK A TIK” RUNG AT Menyediakan masakan : nasi Goreng, soto, mie goreng/ tiaw, aneka ikan bakar, dan menyediakan aneka juice . Jl. ACCES ROAD INALUM, Simp Durian. Hub: Ibu Atik- 0852 6546 3152.



R .P R A P AT; HP: 0853 5875 3027; 0852 PA

6155 8562. DP 15Jutaan Type 45/98 Angsuran 50rb/hari. Investasi Hunian Exclusive Super strategis, hanya 5 menit dari Pasar Glugur/Terminal. Spek: Kramik, Cat luar dalam, Gypsum, Rangka Baja, Atap Metal Sakura, Sumur gali, Kloset, Listrik, IMB, SHM, Jalan. AYO MILIKI PERUMAHAN GRIYA SEJAHTERA

YA MINANG : RUMAH MAKAN CAHA CAHAY Sedia masakan Khas Padang Pariaman, terkenal lezat, sedia ayam bakar, minuman, kopi susu, teh susu & Juice, terima pesanan nasi kotak. Jl. Jend. Sudirman No. 72 INDRAPURA - Rumah No.404. Hub : 0813 7655 6793 SALMA D’CAFÉ

Sedia sarapan pagi,serba 7000 dengan hidangan istimewa. Nasi/Mie goreing, bakso/pangsit/siomai, Batagor, bandrek, aneka juice. Terima nasi kotak dan rantangan. Hub: Ibu salma , 0812 6349 7777 Jl. Kula Tanjung Kebun Kopi Indrapura, Batubara.


menjual : Ayam Penyet, Tom Yam, Ifu Mie/ Mie Telur, Bebek Goreng, Cah kangkung, cap cai, sop Buah & aneka juice. Jl. Access Road Kuala Tanjung. Hub: Kak Lina - 0853 6058 1512

BROKOLI CERIA: sajian spaghetti sehat. Menyediakan sajian: Mie Ayam, Mie Ketela, Mie Wortel, Mie buah, Martabak sayur, Aneka Juice, Kopi Luwak, Softdrink. Harga Terjangkau. Jl. Jalinsum KM 99.5 Sei Suka, Batubara. HP: 0812 6217 910


Menyajikan berbagai masakan, Nasi Goreng, Mie Goreng, Soto. Aneka minuman, Aneka juice, teh manis, kopi susu, ginseng. SERBA EKONOMIS. Simp.Kuala Tanjung, Indrapura, B.Bara.

“RM DENAI MINANG” Jual masakan

khas padang, dengan menu istimewa: Nasi serba Rp8000, rendang, gulai pari, daging sapi, ikan mas, khas masakan rendang padang, menerima pesanan nasi kotak. Hub: Ibu AS , HP : 0817 4798 835. Jalinsum Lima Puluh B.Bara

RM.FAMILI MINANG, khas minang tersedia rendang daging sapi, kambing, ayam, cincang, ikan panggang, harga Rp.7000. Hub: Ibu Nisa - 0853 5835 6505, di Simp. Sumodang Jl. Kuala Tanjung (Inalum), Sei Suka, B.Bara. RM.Nasi SOTO: Sedia kare sapi, soto, sop, ayam goring sambal balado, gulai asam, gulai lemak, Dll. Hub: Bpk Junaidi 0852 7074 7147, di Brohol Simp. Kenangan, Kuala Tanjung, B.Bara WARK OP SANT AI (Buka 24 KOP SANTAI Jam) Sedia: Nasi Goreng, Aneka Mie, Minuman

Segar, Aneka Juice, Serta sedia Minuman Kopi Aceh, dll. Hub: Mamak Danu - 0821 6283 4324, Jalinsum, Lintas Medan-Asahan (Depan Pertamina), Pare-Pare, Indrapura-B.Bara

12 RABU 19 DESEMBER 2012

Perilaku Orangtua yang Membuat Anak Stres ANAK-anak juga bisa stress karena perlakuan orang tua. Berikut ini beberapa prilaku orang tua yang dapat membuat anak stress, seperti yang dijelaskan oleh Psikolog dari FAME, Yuvita Fandy, M.Psi: 1. Orang tua lebih banyak melarang daripada memberitahu apa yang dapat dilakukan oleh sang anak. misalnya melarang bermain diluar rumah sehingga anak merasa seperti di penjara dan tidak memiliki teman.

2. Menerapkan peraturan yang kaku tanpa memberikan penjelasan terhadap anak. Dalam hal ini mungkin orangtua ingin belajar disiplin, namun anak akan merasa sangat diatur dan tidak bisa mengembangkan diri. 4. Menuntut anak untuk memiliki prestasi yang lebih baik. Dalam kasus ini orangtua seharusnya memberikan pujian terlebih dahulu kepada anak, tanyakan pada anak begaimana usahanya

mendaptkan nilai tersebut. Lalu kemudian ortu dapat menambahkan semangat kepada anaknya untuk lebih meningkatkan prestasinya. 5. Orang tua membandingkan anak dengan Kakak, adik, saudara atau temannya. Anak memiliki keuunikannya masing-masing Kelebihan dan kekurangannya juga berbedda-beda. Jadi jangan pernah membandingkan anak lain karena mereka memiliki kelebihan tersendiri. .(int)

Sudah Tepatkan Ukuran Bra Anda ? Banyak perempuan belum sadar bahwa ukuran Bra yang tepat sesuai dengan ukuran payudara sangat penting. Karena tidak hanya berkaitan dengan fashion tapi juga kesehatan. Sorella sebagai salah satu produsesn pakaian dalam wanita sangat peduli dengan kebutuhan perempuan. Tidak sekedar membuat Bra yang cantik tapi juga sesuai dengan ukuran dan bentuk payudara perempuan. Untuk itu, Sorella meluncurkan "Sorella Contour Series" sebagai bentuk kepedulian terhadap wanita yang perduli akan kecantikan tubuhnya dan memperhatikan kesehatannya. "Sorella Contour Series" adalah, koleksi bra Sorella dengan bentuk push up yang berbeda di kelasnya. Diperuntukkan bagi wanita yang ingin lebih menonjolkan keindahan payudara tanpa merubah bentuk payudara secara permanen. Lucia Niken, Marketing Manager Sorella mengatakan semua

KEBANYAKAN pasangan menghabiskan waktunya untuk pekerjaan. Pergi pagi dan selalu pulang malam. Kalau sudah begini, kapan waktu untuk berdua? Masalahnya, kegiatan yang menyita waktu dapat menyebabkan ketidakharmonisan dalam sebuah hubungan. Jika Anda tak mau mimpi buruk ini terjadi, berikut ini beberapa saran yang bisa dicoba pasangan sibuk agar tetap bisa bercinta. Kencan makan siang. Kebanyakan orang mengalami puncak energi di siang hari. Manfaatkan kondisi ini dengan menjadwalkan kencan makan siang dengan pasangan. Tak perlu ke restauran, cukup menikmati makan siang romantis di rumah saja. Seks di siang hari memang jarang bagi pasangan sibuk, tentu saja momen ini akan terasa lebih liar dan nakan dari biasanya. Anda dan pasangan akan memiliki privasi yang lebih karena anak-anak sedang berada di sekolah. Manfaatkan di pagi hari. Menurut penelitian, wanita dan pria memiliki ritme sirkadian yang berbeda. Wanita cenderung tidur lebih cepat, sementara pria sebaliknya. Akibatnya, Anda dan pasangan susah menentukan waktu bercinta di malam hari. Manfaatkan waktu di pagi hari sebagai solusinya. Atur alarm sekitar 30 menit lebih awal dari biasanya. Ciptakan rutinitas pagi yang santai namun tetap sensual, seperti mandi bersama atau saling memeluk mesra di tempat tidur sebelum anakanak bangun. Quickie sex. Keterbatasan waktu bukan halangan untuk mendapatkan kenikmatan bercinta. Kenapa tak coba quickie sex? Karena tak mungkin Anda atau pasangan harus membendung hasrat bercinta. Jadi, carilah tempat yang aman agar tak dilihat orang. Bercinta di dalam lift apartement, di bioskop atau di dalam mobil malah memberikan sensasi untuk beraksi semakin liar. (int)

Warnai Natal dengan Lidah Kucing Rainbow NATAL tinggal menghitung hari, mari warnai Natal dengan berbagai kue-kue cantik dan enak, salah satunya Lidah Kucing Rainbow. Ingin buat sendiri di rumah, ini dia resepnya: Bahan : - 150 gr atau 1sdt margarine - 100 gr butter - 200 gr gula halus - 100 ml putih telur - 1 sdt vanilli essence - pewarna makanan : merah, jingga, kuning, hijau, biru, nila, serta ungu. - bahan (diayak menjadi satu) : - 200 gr tepung terigu protein rendah - 50 gr maizena Cara membuat : 1. Kocok margarine, mentega serta gula sampe lembut, putih serta mengembang. 2. Masukkan putih telur serta vanila sembari terus dikocok hingga menyatu. 3. Masukkan campuran tepung sembari diaduk hingga rata. untuk jadi 6 adonan sama rata sesudah itu tambahkan masing-masing pewarna. 4. Masukkan masing-masing adonan ke dalam plastik segitiga gunting ujungnya selebar 1cm. spuit diatas loyang lidah kucing cocok susunan warna pelangi. 5. Oven sehingga tepinya kering kuning kecoklatan. keluarkan dari loyang biarkan hingga dingin. simpan di toples kedap udara.(int)

produk Sorella merupakan hasil dari inovbasi dan penelitian selama bertahun-tahun akan kebutuhan perempuan untuk menjaga kesehatan dan mendukung keindangan tubuhnya. "Di penghujung tahun ini, kami meluncurkan produk Sorella Contour series dengan koleksi lebih lengkap," ujar Niken saat Relaunch Sorella Contour Series di Jakarta, Sabtu (15/12). Niken menjelaskan, koleksi Sorella Contour Series terdiri dari Body Contour dan Beauty Contour. Body Contour diperuntukkan pada wanita fashionista, trendsetter yang perduli terhadap pergerakan fashion dan tampil glamour. Sedangkan beauty Contour diperuntukkan bagi wanita aktif yang ingin tampil cantik selalu dan merasa nyaman di setiap kegiatan mereka.(int)

Tatapan Pria Cerminkan Hasrat Seksualnya TATAPAN mata pria saat menatap wanita memiliki makna tersendiri. Temuan di Journal of Sex Research mengungkapkan bahwa cara pria menatap tubuh wanita mencerminkan hasrat seksualnya. "Gerakan mata yang spontan dan sulit dicegah bisa menjadi alat pendeteksi terkuat untuk mengetahui seberapa besar hasrat seksual pria," ungkap peneliti dan psikolog Kun Guo (11/12). Sebelumnya, para peneliti dari University of Lincoln di Inggris telah melakukan pengamatan terhadap 30 pria berusia 18-25 tahun. Kemudian, peneliti meminta para relawan untuk melihat beberapa foto wanita dan anak-anak dari

berbagai usia. Hasilnya, pria lebih cenderung menatap lebih lama pada gambar wanita muda, terutama di bagian payudara dan pinggul. Dua daerah ini dianggap penting bagi pria. Payudara menunjukkan kematangan seksual wanita, sedangkan pinggul menunjukkan kemampuan wanita memberikan keturunan.(int)

5 Alasan Wanita Dilarang Cukur Rambut PERTUMBUHAN rambut di bagian tubuh tertentu menjadi tanda kedewasaan. Bagi wanita, tumbuhnya rambut di area tubuh ada hal yang mengganggu, percaya diri pun turun drastis. Banyak wanita yang melakukan waxing untuk membuat tubuh menjadi mulus. Namun, rasa sakit yang ditimbulkan membuat wanita mengambil cara instan, yaitu mencukur. Mencukur rambut dengan alat cukur memang terlihat praktis dan efisien. Tapi kalau membahas hasil akhir-nya, mungkin Anda harus mempertimbangkannya dua kali. Masalahnya, pemakaian alat tajam pada tubuh tak hanya membuat kulit mudah terluka, tapi juga membuat rambut tumbuh dengan lebat. Berikut ini adalah beberapa efek samping dari mencukur rambut, seperti yang dilansir Rambut menjadi tebal Mencukur rambut sama dengan membuat pertumbuhan rambut menjadi tebal. Seperti halnya anak bayi yang dicukur rambutnya. Tujuannya adalah agar pertumbuhan rambut bayi menjadi tebal. Ternyata, hal ini tak hanya terjadi pada bayi tapi

seperti waxing. Rambut tajam Rambut yang dihilangkan dengan cara dicukur, digunting atau waxing, memiliki kualitas rambut yang berbeda. Dengan mencukur rambut, pertumbuhan rambut akan cenderung lebih kasar dan tajam. Baik di area intim, ketiak atau kaki. Masa pertumbuhan Mencukur merupakan metode yang menghilangkan rambut tumbuh pada kulit, bukan dari akar. Inilah yang membuat kulit tumbuh bisul kecil-kecil di area permukaan kulit yang dicukur.(int)

juga pada orang dewasa. Rambut cepat tumbuh Mengapa jenggot pria tumbuh kembali dalam satu atau dua hari? Hal ini karena janggut dicukur secara teratur. Jika Anda kebiasaan mencukur rambut tubuh Anda, maka akan lebih cepat tumbuh kembali.

Nantinya, Anda harus mulai mencukur secara rutin untuk tampil mulus. Kulit kasar Jika sering mencukur rambut di area ketiak dan kaki akan membuat kulit tampak kasar. Mencukur mengurangi kelembapan kulit, tidak


19 Desember 2012

SETELAH putus hubungan dengan Daniel Mananta, Marissa Nasution tak berlama-lama merasakan kesendirian. Wanita berdarah Batak itu tak butuh waktu lama untuk menemukan pacar baru. Melalui sahabatnya, Mike Lewis ia dipertemukan dengan seorang pengusaha bernama Conrad. Senyum tak pernah lepas dari wajah wanita berzodiak Aquarius itu selama ngobrol tentang pria yang kemudian menggantikan Daniel di hatinya itu. Marissa bercerita, dirinya menemukan kenyamanan dari pria keturunan Australia-Fillipina yang

usianya berselisih 3 tahun dengannya itu. ”Karena lebih berpengalaman mungkin, jadi aku nyaman sama dia sampai sekarang,” ujar Marissa. Bahkan, meski hubungannya dengan sang kekasih baru berjalan kurang lebih delapan bulan, wanita yang hobi berenang itu sudah mantap untuk melanjutkan ikatan mereka ke tahap yang lebih serius. Marissa memang sudah tak sabar untuk bisa memiliki keluarga. Selain fokus di kariernya sebagai presenter dan berbisnis di usaha sepatu, bintang film ‘Get Married 2’ itu juga ingin sukses membina rumah tangganya kelak. ”Enam tahun aku berkarier di sini,

BACHARUDDIN Jusuf Habibie menyatakan puas dengan film MD Pictures itu. Dia mengatakan, setiap scene benar-benar mewakili kisah hidupnya. Dia menilai, Reza Rahardian dan Bunga Citra Lestari (BCL) bisa menjadi cermin Habibie dan Ainun kala muda. Tanpa ragu Habibie mengangkat dua jempol untuk Reza dan BCL. Menurut Habibie, Reza memerankan sosoknya tanpa cela. Malah, cucu Habibie yang baru berusia enam tahun mengatakan bahwa tingkah laku Reza di film tersebut sangat mirip dengan kakeknya. ”Yang menilai bukan saya, tapi cucu. Dia (Reza) berhasil melakukan mission impossible menjadi possible. Saya puas,” ucap Habibie. Lantas, bagian mana yang menjadi favorit? Habibie menyebut semua. Dengan gestur tangan seperti mengusap air mata, dia menuturkan bahwa setiap scene mengingatkan pada Ainun. Banyak kenangan yang dilihatnya kembali. ”Itu membawa sisi

HOROSKOP HARI INI CAPRICORN (21 Desember -19 Januari) Pekerjaan: Anda harus menyiapkan diri untuk menghadapi hari-hari penting. Persiapkan semuanya. Asmara: Bagi kamu sekarang, urusan asmara nomor dua.


(20 Januari - 18 Februari)

Pekerjaan: Tidak ada masalah berat. Jadi santai saja. Asmara: Sikap Anda agak membingungkan. Coba koreksi diri.


19 Februari - 20 Maret

Pekerjaan: Biarkan seseorang membantu Anda, sebelum tekanan jadi lebih besar Asmara: Kadang dia terlalu banyak menuntut, tapi itu hanya agar Anda memberi perhatian saja.


(21 Maret - 20 April)

Pekerjaan: Kesempatan bagus itu jangan Anda diamkan saja. Asmara: Tindakan juga perlu. Daripada hanya janji saja.


aku mau lebih realistis. Ke depannya aku ingin fokus sama keluarga,” urai Marissa. Segala hal yang ia inginkan dari seorang pria ia temukan pada diri kekasihnya saat ini. Meski terkadang sang pacar diakuinya amat posesif, namun ia tak merasa keberatan. Tak seperti mantan-mantannya sebelumnya, wanita yang hobi mengenakan high heels ini justru merasa menemukan sosok yang bisa diperlakukan layaknya saudara dan sahabat. ”Ketimbang aku, Conrad yang jauh lebih posesif. Tapi nggak apa-apa, aku nyaman-nyaman aja. Itu tandanya dia perhatian sama aku selama ini,” paparnya. (dtc/int)

emosional tersendiri bagi saya,” ujar Habibie. Bagi Reza dan BCL, pembuatan film itu membuat mereka lebih akrab dengan Habibie. Dua bintang tersebut kini malah menyapa Habibie dengan sebutan eyang. Maklum, pembuatan film itu diikuti Habibie secara langsung. Reza bahkan mewawancarai langsung Habibie untuk mendalami peran. Bagi Reza, proses wawancara itulah yang membuatnya bisa memerankan Habibie dengan baik. Sebenarnya, dia sempat pesimistis. ”Prosesnya hanya dua minggu. Untung, ada wawancara langsung dengan Eyang (Habibie) selama dua hari berturut-turut,” paparnya. Begitu juga BCL. Menurut dia, tidak mudah memerankan sosok Ainun. (jpnn/ int)

(21 April - 20 Mei)

Pekerjaan: Maksud Anda ingin membantu dengan memberi nasihat, tetapi sepertinya ada salah pengertian Asmara: Biarkan dahulu supaya dia lebih bisa mengenal kamu.


(21 Mei - 20 Juni)

Pekerjaan: Tetap teliti dalam berkerja Asmara: Biarkan dahulu supaya dia lebih bisa mengenal kamu.


(21 Juni- 20 Juli)

Pekerjaan: Bicarakan persoalan yang ada, jangan cuma dipendam saja. Asmara: Jangan hanya menunggu telepon dari dia, cobalah untuk menelepon lebih dahulu.


(21 Juli-21 Agustus)

Pekerjaan: Jangan berharap terlalu banyak pada sesuatu yang belum pasti, kemungkinan gagal selalu ada Asmara: Permasalahan itu terletak pada diri Anda sendiri.


(23 September - 22 Oktober)

Pekerjaan: Tim kerja Anda bisa diandalkan. Hitung-hitung ikut mengurangi beban Asmara: Urusan kemesraan agak berkurang.


(23 Agustus-22 September)


Seseorang akan mengomentari Anda dengan nada yang tidak enak. Anda harus tegas menghadapinya. Asmara: Meskipun cinta Anda buta harus realistislah.


(23 Oktober – 22 November)

Pekerjaan: Setelah semua terjadi, baru muncul kesimpulan positif. Hadapilah dengan lebih santai bikin suasana jadi nyaman Asmara: Dengan sikapmu itu, Anda sering merusak suasana.


( 23 November - 20 Desember)

Pekerjaan: Pola kerja Anda kembali seperti semula. Asmara: Jangan Anda sampai terobsesi. Biasa saja.


elena Gomez siap mengabaikan Justin Bieber, karena ia mau kencan dengan Niall Horan ‘One Direction’. Mengutip femalefirst, menurut Hollywoodlife, Selena ingin berkencan dengan Niall Horan karena statusnya yang masih lajang. ”Selena ingin mulai berkencan dengan pria lain untuk melihat apakah ada sesuatu yang lebih baik di luar sana soal pria, setelah tak bersama Bieber,” kata sumber.

”Bukankah sesuatu yang mengherankan saat Selena memiliki kencan dengan kekasihnya, bersama dengan Taylor Swift dan Harry Styles,” imbuh sumber. Sebagaiman diberitakan sebelumnya, Justin dan Selena putus akhir pekan ini. Selena juga murka saat mengetahui Justin bergaul dengan mantan pacarnya, Nick Jonas. (dtc/int)

PENAMPILAN Miley Cyrus menarik perhatian di perhelatan VH1 Divas di Shrine Auditorioum, Los Angeles, AS. Miley muncul diantara sederetan diva musik berkumpul untuk merayakan musik bintang pop Whitney Houston dan ratu disko Donna Summer. Beberapa di antaranya yang hadir adalah diva-diva muda seperti Miley Cyrus, Jordin Sparks, dan Demi Levato. Layaknya seorang diva, para bintang muda itu tampil dalam balutan busana-busana nan memukau. Masingmasing menampilkan sisi keglamoran seorang diva sesuai karakternya. Yang cukup menyita perhatian dari penampilan Miley Cyrus adalah dii saat bintang lainnya memilih gaya “ladylike”, bintang “Hannah Montana” itu malah menghadirkan sisi seorang diva dengan tampil agak “gahar”. Dengan gaya rambut cepak mohawk-nya, pelantun “Can’t Be Tammed” itu membaluti tubuhnya dengan mini dress ketat hitam lengan panjang beraksen cut-out rancangan Norma Kamali. (tr/int)



19 Desember 2012

ASEAN University Games XVI

Indonesia merebut dua medali emas di nomor estafet 4x200 meter gaya bebas putra putri ASEAN University Games, Senin (17/12) sore. Di bagian putera, regu Indonesia merebut medali emas dengan catatan waktu 7 menit 43.81 detik. tim Indonesia terdiri dari perenang Putra M. Randa, Triady Fauzi, Alexis Wijaya Ohmar dan Glenn Victor Susanto. Mereka mengungguli Thailand yang merebut medali perak dengan 8 menit 04.88 detik dan Malaysia yang meraih perunggu dengan 08.19.65 dalam lomba yang berlang-

sung di Aquatic Centre, National Sports Complex, Vientiane. Emas juga diraih tim estafet 4x200 meter puteri yang terdiri dari Enny Susilawati, Kathriana Mella, Ressa Kania Dewi dan Patricia Yosita yang mencatat waktu 8 menit 40.01 detik. Tim Malaysia berada di tempat kedua dengan 8 menit 45.90 detik dan Thailand meraih perunggu dengan 9 menit 03.456 detik. Dalam ASEAN University Games XVI yang berlangsung 12-20 Desember ini, kontingen Indonesia masih berada di urutan lima dengan 17 emas, 30 perak dan 42 perunggu. (int)

Daud Yordan

Ditantang Petinju Filipina

Taufik Hidayat

UNGGULAN UTAMA TAUFIK HIDAYAT dan Saina Nehwal menjadi unggulan pertama turnamen bulu tangkis Syed Modi International India GP Gold. Turnamen berhadiah total 120.000 dolar AS ini akan berlangsung Selasa (18/12) hingga Minggu (23/12). Di bagian putera, Taufik diikuti pemain India, Kashyap Parupalli yang merupakan perempatfinalis Olimpiade London, JuliAgustus lalu. Dua pemain Indonesia lainnya,

Tommy Sugiarto dan Alamsyah Yunus diunggulkan di tempat ketiga dan kelima. Parupalli yang baru pulih dari cedera mengaku sangat antusias mengikuti turnamen ini. “Saya ingin melihat kondisi saya setelah pulih dari cedera. Ini merupakan turnamen yang sangat penting buat para pemain India. Saya sendiri berharap ini menjadi persiapan baik sebelum Malaysia Tebuka, awal Januari.” (int)

PETINJU Filipina, Jun “Hercules” Doliguez melempar tantangan kepada juara dunia kelas bulu IBO asal Indonesia, Daud “cino” Yordan untuk suatu perebutan gelar. Doliguez dianggap sebagai petinju prospek bagus di Filipina. Petinju dengan rekor bertarung 15-0-1 (11 KO) ini memang memiliki pukulan yang keras dan dianggap sepadan menghadapi Yordan yang memiliki rekor bertarung 30-2 dengan 23 KO. Sabtu pekan lalu, Doliguez mengempaskan lawannya, Eric Rapada di ronde keenam dalam pertarungan di Angoncillo, Batangas, Filipina. “Di mana saja, kapan saja, ayo Cino, bawa gelarmu dan aku akan menyakitimu,” kata Doliguez. Promotor Yordan, Dragon Fire memang sempat menyebar poll kepada para penggemar tinju Filipina tentang siapa petinju negara tersebut yang sepadan menantang Yordan. Doliguez dipilih oleh 64 persen responden. Nama-nama lain yang disebut antara lain Rey “Boom Boom” Bautista, Marvin Sonsona dan Lorenzo Villanueva. “Saya tekankan, saya siap menghadapi dia. Jika para promotor sepakat, ia akan merasakan kerasnya pukulan saya,” kata Doliguez. Daud Yordan baru saja mempertahankan gelar juara dunia kelas bulu IBO dengan mengalahkan petinju Inggris, Choijiljavyn “Choi” Tseveenpurev di Marina Bay Sands, Singapura. Jika terjadi kesepkatan, maka ini merupakan kali kedua, Yordan mempertahankan gelarnya yang direbut saat mengempaskan petinju Filipina Lorenzo Villanueva di ronde kedua, Mei lalu. (int)

Michael Schumacher

Tak Ingin Dibandingkan Kesuksesan Michael Schumacher sebagai pebalap Formula 1 tidak diragukan. Pebalap muda Jerman, Sebastian Vettel lantas disebutsebut sebagai titisan peraih tujuh kali gelar juara dunia F1 tersebut. Schumacher meraih gelar juara dunia pertama pada musim 1994 saat memperkuat Tim Benetton. Pria yang juga asal Jerman ini sukses mempertahankan gelarnya di musim 1995. Lalu, setahun kemudian, dia hijrah ke Ferrari. Bersama Tim Kuda Jingkrak, julukan Ferrari, Schumacher mencatatkan sejarah dengan merebut gelar juara dunia selama lima musim berturut-turut, 2000 hingga 2004. Torehan tersebut belum tertandingi oleh pembalap lain. Sementara itu, Vettel baru saja menuai kesuksesan dengan meraih gelar juara dunia musim 2012. Pembalap milik Red Bull Racing ini sekaligus mempertahankan gelar yang direngkuh dua musim sebelumnya, 2010 dan 2011. Nama Vettel juga tertera dalam sejarah balap jet darat sebagai pembalap termuda yang menorehkan prestasi tersebut. Wajar saja jika pembalap 25 tahun ini disetarakan dengan seniornya yang memutuskan pensiun di akhir

Jorge Lorenzo:

Rossi Hanya MAU MENANG JORGE LORENZO menyambut baik kedatangan Valentino Rossi kembali ke Yamaha. Bahkan, Lorenzo mengatakan ini merupakan kesempatan bagus bagi Rossi untuk memperlihatkan dirinya masih bisa bersaing meraih kemenangan di musim 2013. The Doctor akan kembali ke pabrikan YZRM1 pada musim depan, setelah sebelumnya selama dua tahun bersama Ducati mengalami frustrasi dan kecewa. Pebalap asal Italia itu hanya mampu mencetak tiga kali podium dalam 35 penampilan bersama Ducati. Sebelumnya, Rossi sudah mengatakan alasan untuk kembali ke Yamaha adalah mencoba memahami apakah pebalap 33 tahun itu masih dapat bersaing meraih kemenangan dan menambah rekor kemenangan miliknya, yang mana sejauh ini sudah mencatatkan 79 kali menang. Pebalap Yamaha mengatakan Rossi mengalami kesulitan untuk membuat motor Ducati lebih kompetitif. Tugas itu menurut Lorenzo, lebih berat bagi Rossi ketimbang memilih kembali memperkuat Yamaha musim 2013 mendatang.

“Sayarasatugas yang paling berat dalamkarierRossi adalah berada di Ducatidantidak bisa bersaing. Saya rasa ini sudah sangat melukainya karena Rossi ingin sekali bersaing dan memenangi balapan dengan motor dari Italia,” kata Lorenzo. “Saya rasa Rossi sangat kecewa, tapi saya berpikir sekarang semua bisa membaik dengan situasi baru. Saya rasa Rossi memiliki kesempatan untuk memperlihatkan dia masih mampu meraih kemenangan,” tandas pebalap asal Spanyol, dilaporkan MCN. (int)

musim 2012. Namun, Schumacher menolaknya. “Anda harus menjadi spesial untuk bisa melakukannya. Tapi, kami tidak perlu dibandingkan. Dia (Vettel) melakukannya saat ini, sedangkan saya sudah lebih dulu,” ujar Schumacher seperti dilansir Autosport. Sementara itu, Vettel tidak pernah menyangka dengan apa yang diraihnya.

Pembalap yang kerap dijuluki “Baby Schumi” ini hanya memastikan tidak mudah mencapai prestasi tersebut. “Saya senang dan bangga. Tapi, saya tidak terlalu memikirkan apa yang sudah saya raih. Rasanya sangat spesial dan seperti tak seorang pun bisa merebutnya,” tutur pembalap yang sejak kecil mengidolakan Schumacher ini. (int)

Lea di Leo

Kencani Sejumlah PESEPAK BOLA ITALIA PERNYATAAN menghebohkan dilontarkan bintang porno Italia, Lea di Leo. Dalam otobiografinya yang berjudul ‘Sonia Faccio racconta Lea Di Leo’, dia mengaku telah berkencan dengan sejumlah tokoh terkenal di Italia, dari politisi, bintang panggung hingga pesepakbola ternama. Seperti dilansir giornalettismo, Lea di Leo mengungkapkan pernah berkencan dan menjalin hubungan asmara dengan mantan pejabat Italia Mario Baldassarri, wartawan Amedeo Goria,pemainrugbyDennisDallan,aktor Roberto Farnessi hingga penyanyi Conjure Fabri. Tidak hanya itu, wanita kelahiran Castelfranco Veneto itu juga mengaku menjalin hubungan asmara sesaat dengan sejumlah pesepakbola ternama Serie A. Mulai dari Vincenzo Iaquinta, Simone Inzaghi, Marco Borriello, Valeri Bojinov, Francesco Coco, Luca Toni, Fabio Galante hingga Massimo Ambrosini.

Namun semua nama yang disebutkan membantah mengenal dan pernah menjalin hubungan dengan wanita berambut pirang itu. “Mungkin terlalu buruk bagi mereka (kabar ini mencuat). Saya mengerti karena mungkin mereka semua sudah memiliki istri atau pacar. Tapi saya mengatakan yang sebenarnya,” kata Lea. Lea mengungkapkan sebagian di antaranya menjadi pelanggannya selama bertahun-tahun. Dan dia tanpa sungkan menyatakan para pesepakbola adalah temankencanterbaik.“Ditempattidur,para pemain sepakbola adalah yang terbaik, mungkin karena mereka melakukan latihan fisik sangat baik,” katanya. Namunpengungkapanwanitayangjuga berprofesi sebagai penari ini dianggap merupakan aksi pemerasan. Karena berhembus kabar jika sejumlah tokoh yang masuk dalam buku Lea sempat dimintai uang sebesar •40 ribu jika namanya tidak ingin dicantumkan di buku kontroversial tersebut. (int)


RABU 19 Desember 2012













2 Man City







3 Chelsea







4 Tot Hotspur







K emenangan besar dengan skor 5-2 yang didapat Arsenal atas R eading disebut Arsene W enger sangatlah penting. Hasil tersebut menunjukkan kalau ‘Gudang Peluru ’ bisa memberi reaksi atas kondisi buruk yang baru diterima.



KLUB Swansea City

GOL 12

2 R van Persie

Manchester United


3 D Ba 4 L Suárez

Newcastle United Liverpool

11 10

5 J Defoe

Tottenham Hotspur


6 M Fellaini




16 15





2 Atlético Madrid

16 12





3 Real Madrid

16 10





4 Málaga








KLUB Barcelona

GOL 25

2 R Falcao

Atlético Madrid


3 Cristiano Ronaldo

Real Madrid


4 Aduriz

Athletic Club


5 Rubén Castro

Real Betis


6 Negredo



SERIA A ITALIA KLASEMEN SEMENTARA 1 Juventus 17 13 2 Internazionale 17 11 3 Napoli 17 10 4 Lazio 17 10

2 1 3 3

2 5 4 4

36-10 29-18 31-17 25-18

41 34 33 33


KLUB Milan

GOL 14

2 E Cavani



3 A Di Natale



4 M Klose



5 E Lamela



6 D Milito



3 3 6 3

1 4 3 5

44-7 33-22 35-20 33-27


KLUB Bayer Leverkusen

GOL 12

2 A Meier

Eintracht Frankfurt


3 V Ibiševiæ



4 R Lewandowski

Borussia Dortmund


5 M Mand•ukiæ

Bayern München


6 T Müller

Bayern München


ketinggalan menjadi 4-1. Kebangkitan tuan rumah seketika menyeruak setelah di menit 69 Reading berhasil mencetak gol keduanya. Kali ini Jimmy Kebbe yang menjebol gawang The Gunners.

Tapi kisah dramatis comeback Reading tidak terjadi di laga ini karena di menit 80 justru Arsenal yang berhasil menambah jumlah golnya. Membangun serangan dari tengah, Cazorla yang menusuk menuju kotak penalti

melepaskan umpan pada Walcott. Dengan satu gerakan, pesepakbola Inggris itu menipu bek lawan dan melanjutkan aksinya dengan melepaskan tembakan terarah yang menjadi gol. 5-2 untuk Arsenal. (int)

Persembahan Terakhir Duric

KLASEMEN SEMENTARA 17 13 17 10 17 8 17 9

ngan 3 assist dan 27 tembakan ke gawang, Giroud yang membukukan satu assist dan 47 tembakan, serta Theo Walcott yang memiliki catatan assist sama yaitu 4, tapi cuma 22 kali melakukan sepakan ke gawang. Atas performa Cazorla sejauh 17 laga di Premier League ini, manajer Arsenal, Arsene Wenger pun sudah memiliki penilaian. “Santi Cazorla adalah pemain berkualias top dan dia hanya menggambarkan bahwa dirinya merupakan pembelian yang tepat,” ucap Wenger di situs resmi Arsenal. Pujian kepada Cazorla pun juga terlontar dari mulut rekannya di lini tengah Arsenal, Jack Wilshere. “Kemampuannya sebagai pemain yang serba bisa sungguh luar biasa. Sangat berat bagi siapa saja yang berasal dari Spanyol untuk bermain di Premier League. Tapi, ia membuatnya terlihat sangat mudah,” ungkap Wilshere seperti dilansir oleh AFP. Jalan Pertandingan Pertandingan baru berjalan 13 menit saat Arsenal berhasil membuka keunggulan. Bermula dari tusukan Kieran Gibbs di sisi kanan pertahanan Reading, dia kemudian melepas umpan silang ke kotak penalti. Memanfaatkan buruknya pengawalan pemain Reading, Podolski dengan mudah menceploskan bola ke dalam gawang. Empat menit kemudian Cazorla nyaris membuat ‘Gudang Peluru’ menggandakan keunggulan saat tendangan jarak jauhnya melenceng tipis dari sasaran. Tim tamu akhirnya bisa menggandakan keunggulan di menit 30, dengan skenario yang nyaris serupa seperti gol pertama. Kali ini Podolski yang menyisir di sisi kanan pertahanan Reading, dia kemudian melepaskan umpan crossing ke muka gawang dan dibelokkan menjadi gol oleh Cazorla menggunakan kepalanya. Dua menit berselang Cazorla kembali mencatatkan namanya di papan skor. Menyambar bola yang sempat disundul Gibbs saat mencoba meneruskan umpan dari Podolski, Cazorla membawa Arsenal kini unggul 3-0. Enam menit babak kedua berjalan Cazorla nyaris membuat hat-trick kalau saja Adrian Mariappa tidak menghalau bola tepat di garis gawang Reading. Tapi trigol Cazorla kemudian tinggal menunggu waktu saka karena di menit 59 satu sontekan pesepakbola asal Spanyol itu membuat kedudukan berubah menjadi 4-0. Tertinggal empat gol sama sekali tak membuat Reading menyerah. Bermula dari kesalahan umpan di sektor pertahanan, Adam le Fondre dengan tenang melewai Szczesny saat dalam posisi satu lawan satu untuk kemudian menceploskan bola ke dalam gawang. Di menit 65 Reading memperkecil



1 München 2 Leverkusen 3 Dortmund 4 Frankfurt

iwarnai hat-trick Santi Cazorla, plus dua gol lainnya dari Lukas Podolski dan Theo Walcott, Arsenal memetik kemenangan mutlak dengan skor 5-2 dalam lawatan ke Reading. Kemenangan tersebut mengantar The Gunners naik ke posisi lima klasemen dengan poin 27.Terlepas dari langkah naik Arsenal ke papan atas, hal lain yang membuat Wenger sangat puas dengan raihan anak didiknya adalah terkait reaksi yang diberikan setelah mereka dapat hasil buruk pekan lalu. Melalui adu penalti, Arsenal disingkirkan Bradford City di babak perempatfinal Piala Liga Inggris. “Targetnya adalah meraih kemenangan dengan meyakinkan. Kami fokus dengan pertandingannya. Saat kedudukan 4-0 kami menjalani periode ‘melayang’. Dan dalam posisi 42, setelah apa yang terjadi pekan lalu, kami mulai tak pasti. Kami sedikit kehilangan fokus dan harus membayarnya. Tapi secara keseluruhan penting buat kami untuk bermain dan memberikan jawaban di atas lapangan,” sahut Wenger di Skysports. “Selama 16 tahun cuma sekali kamu kalah dari tim yang berasal dari divisi lebih rendah. Jika Anda membandingkan rekor tersebut dengan klub lain di Inggris, itu masih jadi yang terbaik.” “Saya setuju kalau (kekalahan) itu menyakitkan, dan sangat mengecewakan. Tapi malam itu Bradford tampil sangat baik. Saya bertanggung jawab saat kondisinya berjalan baik dan saya menerima kritik saat kondisinya menjadi buruk,” tuntas Wenger. Cazorla Terbaik di Arsenal Santi Cazorla layak dinilai menjadi pemain yang memiliki rapor bagus saat membela Arsenal. Catatan statistik membuktikan pemain seharga 16,5 juta poundsterling itu merupakan yang terbaik. Cazorla tampil apik saat tim ‘Gudang Peluru’ menundukkan Reading dengan skor telak 5-2. Pemain yang baru didatangkan dari Malaga di awal musim 2012-2013 itu mengemas hat-trick dalam laga yang berlangsung di Madejski Stadium, Selasa (18/12) dinihari. Dengan tiga gol yang dia bikin itu, Cazorla pun menjadi top skorer sementara The Gunners dengan koleksi tujuh gol. Dengan torehan itu, dia bahkan lebih produktif dibandingkan dengan Lukas Podolski dan Theo Walcott (5 gol), serta Olivier Giroud (4 gol). Lebih detil lagi Soccernet mencatat bahwa Cazorla menjadi pemain yang paling sering melakukan tembakan ke gawang, yaitu 59 kali. Pesepakbola 29 tahun itu juga menyumbangkan empat assist bagi tim yang bermarkas di Emirates Stadium itu. Catatan Cazorla itu merupakan yang tertinggi di antara pemain Arsenal lainnya. Torehan pemain asal Spanyol itu berturut diikuti oleh Podolski de-

42 33 30 30

Aleksandar Duric sudah tidak muda lagi, sudah 42 tahun. Turnamen Piala AFF kali ini pun akan menjadi yang terakhir untuknya. Oleh karenanya, wajar jika ia ingin mengakhirinya dengan sebuah trofi. Seorang pemain yang ingin mengakhiri kariernya dengan sebuah pencapaian adalah romantisme yang lazim dalam sepakbola (atau olahraga manapun). Namun demikian, tak semuanya berujung kesuksesan. Zinedine Zidane pernah punya harapan yang sama pada Piala Dunia 2006 dan kita semua tahu seperti apa ujungnya. Di sisi lain, Duric, yang sudah mengatakan ini akan menjadi Piala AFF terakhirnya, tentu tidak berharap akan berakhir seperti Zidane. Karier Duric di tim nasional tergolong tidak lazim, jika Anda menilainya demikian. Pada usia 37 tahun, ketika banyak pemain sepakbola biasanya sudah pensiun, dia baru memperkuat timnas Singapura. Debutnya melawan Tajikistan diwarnai oleh sepasang gol dan sejak saat itu dia seperti menjadi jimat untuk The Lions, meski tidak selalu bermain. Di Piala AFF tahun ini pun juga demikian. Duric kerap memulai pertandingan dari bangku cadangan dan baru satu gol dia sumbang. Tapi, toh demikian, dia mengaku siap untuk berkontribusi untuk tim apa pun ben-

pada 2008 dan 2010, jadi ini merupakan turnamen ketiga saya dan saya senang bisa bermain di final karena ini adalah kesempatan terakhir saya. Saya akan pensiun setelah turnamen ini, saya sangat

„ Duric tuknya. “Saya memang tidak mencetak gol, tapi yang terpenting berkontribusi untuk tim,” ucapnya seusai laga semifinal kedua melawan Filipina. Laga itu sendiri berakhir dengan kemenangan 1-0, di mana Khairul Amri mencetak satu-satunya gol. Singapura pun berhasil melaju ke final dan kini hanya tinggal satu langkah lagi bagi Duric untuk mencapai impiannya. “Mencapai babak final tahun ini seperti sebuah mimpi yang jadi kenyataan,” ucapnya di situs resmi Piala AFF. “Saya sudah bermain di turnamen ini

ingin mencapai final dan kami berhasil melakukannya.” “Pada saat bersamaan, kami sudah membuktikan penilaian banyak orang salah dengan melaju sampai ke final. Tak banyak

orang percaya kami bisa lolos dari fase grup. Tapi, seiring berjalannya pertandingan, kami berkembang sebagai sebuah tim dan menunjukkan bahwa kami benar-benar tim yang bagus.”(int)







RABU, 19 Desember 2012

Edisi 343


Kabid Humas Poldasu: Terbukti, Diproses!

RANTAU- Kecelakaan maut terjadi di Jalan Lintas Sumatera Desa Janji, Kecamata Bilah Barat, Kabupaten Labuhanbatu, Selasa (18/12) dini hari. Dua or-

Pasalnya, Heru lebih banyak menyampaikan bahwa pihaknya akan melakukan kroscek ulang terkait kasus tersebut.


Israndi yang mengalami luka robek di pahanya saat longsor menghantam SD Negeri 199 Gunungtua, Senin (17/12) lalu. Kemarin, ketiga korban diupa-upa.

Kurir Dibekuk, Bandar DPO TAPTENG- Berdalih untuk membayar utang, Amat Lubis (29) nekat menjadi kurir ganja. Warga Jalan Baru, Kecamatan

Tukka, Tapteng, ini berutang kepada pengusaha kafe Masria Baca

Longsor Hantam SD 199, Tiga Murid Luka-luka

Korban Diupa-upa, SEKOLAH DILIBURKAN MADINA- Tiga murid yang mengalami luka-luka saat longsor menghantam SD Negeri 199 di Desa Gunungtua Simandolam, Kecamatan Kotanopan, Kabupaten Mandiling Natal (Madina), diupa-upa,

Selasa (18/12). Sejauh ini, pihak sekolah telah meliburkan kegiatan belajarmengajar. Baca

Korban ...Hal 6

Pemilik ...Hal 6


Lakalantas ...Hal 6

Tiap Bulan Terima Murid Remaja Korban KTD Kasus kehamilan tidak diinginkan (KTD) pada remaja di Desa Ploso, Pacitan, Jawa Timur, menginspirasi Siti Kholifah. Bidan desa itu membuat kelas hamil untuk mengedukasi para remaja putri tentang pentingnya gizi sekaligus risiko hubungan seks di luar nikah. SEKARING RATRI ADANINGGAR, Jakarta FOTO : SEKARING RATRI A/ JAWA POS

Nominasi Srikandi Award Bidan Siti Kholifah asal Ploso, Pacitan.

TAHUN akan segera berganti, begitu pula dengan rencana, termasuk untuk artis peran Nadia Vega (25). Untuk 2013 Nadia sudah memiliki keinginan mengenai karier dan kehidupan pribadinya. Dalam berkarier, Nadia ingin berkonsentrasi pada kegiatan bernyanyi. “Pingin nyanyi. Yang penting, lebih baik lah ya semuanya,” tutur Nadia beberapa waktu lalu di Jakarta. Untuk kehidupan pribadi, rupanya ia ingin segera memiliki kekasih. Ia mengaku sudah mulai membuka hati dan telah ada seorang pria yang dekat dengannya. Baca

Siti Kholifah, Penggagas Kelas Hamil di Pacitan, Nomine Srikandi Award 2012

SEORANG remaja putri yang baru duduk di bangku kelas 1 SMP mendatangi rumah Siti Kholifah. Dia mun-

ang dinyatakan tewas dan 24 lainnya luka-luka saat bus Pinem nomor polisi BK 7599 A

Ingin Punya Pasangan

Pemilik Kafe Modali Pembelian Sembilan Kg Ganja dari Madina

Tahun IV

Nadia Vega

Kabid ...Hal 6

Dua tersangka pemodal dan kurir ganja bersama barang bukti saat diinterogasi di ruang penyidik Mapolres Tapteng, Selasa (18/12).

Lakalantas Maut, Dua Tewas, 24 Luka-luka

Soal Rp1,7 M Dana Kas Satlantas Polres Psp Raib


Petugas Satlantas melakukan olah tempat kejadian perkara tabrakan antara bus Pinem dengan bus Kota Pinang Baru.

Pak Lurah...Hal 6


9 ○


BATANG TORU- SKN, oknum Pegawai Negeri Sipil (PNS) di Kelurahan Aek Pining, Kecamatan Batang Toru, Kabupaten Tapanuli Selatan (Tapsel), mengadukan suaminya, HH, yang menjabat sebagai lurah, kepada Bupati Tapsel, Selasa (18/12).

MEDAN- Kabid Humas Poldasu Kombes Pol Raden Heru Prakoso terkesan ‘gamang’ saat dikonfirmasi terkait raibnya Rp1,7 miliar dana kas Satlantas Polres Padangsidimpuan (Psp).


tah-muntah tak keruan. Siti pun langsung menduga bahwa remaja tersebut hamil. Bahkan, dia bisa mengirangira usia kehamilan remaja bernama samaran Partini itu. “Saat itu, dia sudah hamil lima bulan,” kata Siti saat ditemui di Balai Kartini, Senin (17/12). Siti Kholifah datang di Jakarta setelah terpilih menjadi wakil Jawa Timur dalam kontes Srikandi Award 2012 untuk menyambut Hari Ibu tingkat nasional. Ketika Siti memberi tahu orang tua Partini, bapak Partini langsung naik darah. Dia tidak percaya anak gadisnya yang masih bau kencur itu sudah hamil. Siti lalu meyakinkan si bapak dengan tes USG. “Hasilnya Baca

Tiap ...Hal 7

Ingin ...Hal 7

Membuat Mereka Bahagia SEORANG turun dari mobil mewah di depan kuburan umum. Ia berjalan menuju pos penjaga. Pria yang ternyata supir itu berkata, “Pak, tolong temui wanita yang ada di mobil itu, karena tak lama lagi ia akan meninggal!” Penjaga kuburan segera berjalan di belakangnya. Seorang wanita lemah, berwajah sedih membuka pintu mobilnya, berusaha tersenyum kepada penjaga itu dan berkata, “Saya nyonya Steven yang selama ini mengirim uang agar anda dapat membeli seikat bunga dan menaruhnya di atas makam anak saya. Saya datang untuk berterima kasih atas kesediaan dan kebaikan anda.” “Oh, jadi nyonya yang mengirim uang itu? Sebelumnya saya minta maaf, uang itu selalu saya belikan bunga tapi saya tidak pernah Baca

Membuat ...Hal 7






19 Desember 2012



“IMF sama sekali tidak demokratis karena didominasi oleh pemegang saham dari negara-negara besar dan masih menerapkan agenda-agenda neoliberal sebagai syarat penyaluran utang,” Koordinator Koalisi Anti Utang (KAU), Dani Setiawan.

Kirim Opini Anda ke email: metrotabagsel Maksimal tulisan 5.000 karakter

Sikap Kami Menggantung Kursi Menteri KONSTITUSI kita secara terang benderang sudah menggariskan sistem pemerintahan kita ialah presidensial. Sistem itu di antaranya menegaskan hanya presidenlah yang memegang hak prerogatif untuk mengangkat, memberhentikan, dan mengganti para menteri. Namun, urusan yang mestinya amat mudah, benderang, dan lumrah tersebut menjadi rumit, remang-remang, bahkan terkadang genting. Urusan reshuffle kabinet pun seolah menjadi persoalan hidup mati. Celakanya, sang pemilik mandat prerogatif seperti bergeming menonton ‘drama’ tidak bermutu itu. Presiden kerap terlambat, bahkan terkesan mengulur waktu sehingga kegaduhan akibat isu reshuffle terus menggema hampir saban tahun. Dalam kasus kekosongan kursi menteri pemuda dan olahraga (menpora), misalnya, Presiden Susilo Bambang Yudhoyono memilih sikap menunggu. Padahal, sang pemilik kursi sebelumnya,AndiAlifianMallarangeng,sudahmundursejakdelapanhari lalu. Untuk sementara, entah sampai kapan, posisi menpora diisi oleh Menko Kesra Agung Laksono sebagai pejabat sementara menpora. Agung, yang kesibukannya sebagai menko kesra kita asumsikan berjibun, harus membereskan urusan olahraga dan kepemudaan yang juga ruwet dan pelik. Baru sehari menjabat menpora saja, Agung harus dihadapkan pada tenggat menyelesaikan kisruh di PSSI. Belum lagi kerja-kerja mengoordinasikan persoalan kesejahteraan rakyat, bencana di sejumlah tempat, dan bahkan soal flu burung yang mulai bermutasi ke itik, yang amat mendesak dibereskan. Jelas, akan ada yang dikorbankan jika dua bahkan tiga urusan penting datang secara bersamaan. Karena itu, amat susah membayangkan segalanya akan berakhir efektif dan tepat waktu. Kecuali, Presiden menganggap bahwa kursi menpora tidak teramat penting untuk diisi pejabat definitif. Presiden, misalnya, menganggap urusan kepemudaan dan olahraga sudah bisa diatasi institusi yang selama ini ada, baik dengan atau tanpa kehadiran menpora. Urusan olahraga, contohnya, bisa diurus Komite Olahraga Nasional Indonesia (KONI). Hal ihwal kepemudaan boleh digarap organisasi ekstrakampus seperti HMI, GMNI, PMII, PMKRI, GMKI, atau KNPI. Sah-sah saja kalau Presiden berpikiran seperti itu. Namun, jangan diam, sembunyi-sembunyi, atau terus menimbangnimbang. Umumkan ke publik bahwa kursi menpora bisa diperankan institusi lain di negeri ini. Bahkan kalau perlu, berikan argumentasi yang sahih mengapa kursi menpora tidak dibutuhkan lagi. Bukankah meskipun ada menpora, prestasi olahraga kita sejauh ini jalan di tempat, bahkan cenderung merosot? Mengambangkankeputusanberhari-harijustrumenambahdosis kegaduhanyangmestinyatidakperluada.Ditengahmenumpuknya persoalan yang jauh lebih besar di negeri ini, menghadirkan kegaduhanyangtidakperlusepertimenyetelkasetrusakberulangulang.Amatmenyebalkandanmembikinpusing.(*)

“Penjara itu hanya untuk orang kriminal, bukan untuk orang yang berbeda pandangan dengan kita. Saya sampaikan itu,”

“Cara terbaik yang dapat dilakukan pemerintah Indonesia untuk menjawab pelecehan dan penghinaan sebagian masyarakat adalah dengan bekerja keras menciptakan lapangan kerja dan kesejahteraan,” Ekonom senior DR. Rizal Ramli.

BJ Habibie, mengomentari soal hinaan eks Menteri Penerangan Malaysia Zainudin Maidin.

FIFA Plin Plan

Kita bisa bernafas lega ketika badan sepakbola dunia, FIFA, menunda sanksi kepada PSSI. FIFA masih memberi kesempatan kepada PSSI untuk menyelesaikan kekisruhan hingga Maret 2013. Namun benarkah kesempatan itu merupakan kesempatan terakhir yang diberikan dan bila dalam jangka waktu 4 bulan tidak mampu menyelesaikan masalah, sanksi benar-benar dijatuhkan?

Oleh : Ardi Winangun PENUNDAAN sanksi ini bukan yang pertama. Penundaan sanksi sudah ketiga kalinya. Pada Maret 2012 badan sepakbola yang bermarkas di Zurich, Swiss, itu juga menunda sanksi. FIFA mengharap PSSI mampu menyelesaikan masalahnya hingga Juni 2012. Namun ketika jeda waktu yang sudah ditentukan berakhir dan PSSI tidak bisa menyelesaikan masalahnya, FIFA tidak segera menjatuhkan sanksi namun masih memberi waktu hingga 10 Desember 2012. Ketika waktu yang telah ditetapkan sudah habis dan lagi-lagi PSSI tidak mampu menyelesaikan apa yang diharapkan, FIFA pun juga tidak kunjung menjatuhkan sanksi namun masih diberi waktu. Apa yang dilakukan FIFA itu menunjukkan bahwa FIFA plin plan, tidak tegas, dan sepertinya ada sesuatu dibalik diundurundurnya sanksi. Sikap ‘tidak bertanggungjawabnya’ FIFA bertambah ketika masalah PSSI dilimpahkan kepada badan sepakbola Asia, AFC. Tentu apa yang dilakukan oleh FIFA ini membuat geram sebagaian kalangan, sebab sebagaian kalangan menilai dengan adanya sanksi inilah yang dirasa mampu membuat intropeksi dan sadar diri bagi seluruh insan sepakbola Indonesia. Dalam masa-masa hukuman yang dijatuhkan inilah dirasa sebagai waktu yang tepat untuk membangun badan sepakbola Indonesia dan program-program yang lebih baik. Hukuman FIFA kepada anggota biasanya diberikan apabila terbukti adanya intervensi dari pemerintah negara masingmasing. FIFA mempunyai statuta bahwa badan sepakbola yang tergabung dalam FIFA harus lepas dari campur tangan pemerintah. Dengan statuta itu diharapkan badan sepakbola

menjadi lebih mandiri dan tidak menjadi kepentingan politik dan kampanye penguasa. Badan sepakbola yang pernah diberi sanksi atas intervensi pemerintahannya seperti Irak, Ethiopia, Nigeria, Iran, Brunai Darussalam, Kuwait. Sanksi yang diberikan kepada anggotanya itu bervariasi, ada yang hanya hitungan hari, seperti 1 minggu; ada pula yang hitungan bulanan, 1 bulan, 2 bulan, 5 bulan; adapula sanksi dengan waktu yang tak jelas kapan berakhirnya. EPO, PSSInya Yunani; dan NFF, PSSI-nya Nigeria, diberi sanksi di bawah kurang lebih hanya 7 hari. Sedang FFBH, PSSI-nya BosniaHerzegovina, diberi sanksi sejak 1 April 2011 dan hingga kini sanksi itu belum dicabut. Lama tidaknya sanksi yang diberikan bisa jadi dengan pertimbangan sepakbola di negeri itu penting atau tidak di kawasannya. Sanksi yang hanya 1 mingguan bagi EPO dan NFF bisa jadi tim nasional yang dibentuk oleh badan sepakbola itu cukup mempunyai kiprah di kawasannya. Demikian pula sanksi yang hanya 1 sampai 2 bulan yang diberikan kepada Irak, Iran, dan Kuwait, karena negara itu cukup mumpuni tim nasionalnya di kawasan Timur Tengah. Sedang sanksi kepada badan sepakbola Brunai dan Bosnia-Herzegovina cukup lama karena bisa jadi tim nasionalnya tidak terlalu berarti di kawasan yang ada. Lalu mengapa FIFA plin plan kepada PSSI? Bisa jadi FIFA melihat ada potensi lain dalam dunia sepakbola Indonesia. Indonesia kalau diukur dari kapasitas tim nasional masih masuk katagori yang memprihatinkan, untuk ukuran Asia Tenggara saja sudah megap-megap apalagi kalau berlaga di Asia dan dunia, namun dengan pen-

duduk lebih dari 250 juta jiwa, Indonesia adalah pasar yang menjanjikan bagi perkembangan sepakbola dunia. Potensi pasar sepakbola di Indonesia yang dilihat FIFA untuk dunia itu adalah. Pertama, liga sepak bola Indonesia adalah liga terbaik dan termeriah di Asia Tenggara. Ibarat lampu dan laron, liga sepak bola Indonesia menjadi lampu dan mampu menarik laron-laron pemain sepak bola di mana pun. Mengapa liga sepakbola Indonesia menarik bagi pemain asing? Faktor bayaran untuk pemain asing relatif tinggi membuat banyak pemain dari Eropa, Australia, Amerika Latin, dan kawasan Timur Tengah berbondong-bondong untuk bisa menjalin kontrak dengan klub yang ada di LPI atau LSI. Antusiasnya penonton di liga sepak bola Indonesia juga menjadi magnet bagi pemain asing. Pemain Tim Nasional Singapura dan Malaysia ngebet bermain di Indonesia, selain bayaran yang tinggi juga karena antusiasnya suporter klub. Meriahnya suasana di stadion dengan hadirnya puluhan ribu penonton ternyata menjadi salah satu spirit bagi pemain untuk bermain bagus. Meriahnya suasana di dalam stadion, dengan

teriakan dan nyanyian suporter, hal demikian tidak ditemui di liga sepak bola Singapura dan Malaysia sehingga liga yang ada dirasa kurang memiliki greget. Kedua, Indonesia adalah negara yang sering dijadikan tempat lawatan klub-klub ternama dari Eropa dan Amerika Latin. Klub-klub kesohor yang pernah bermain di Indonesia khususnya di Gelora Bung Karno adalah Bayern Munchen, Inter Milan, Santos, Sampdoria, Tim Nasional Uruguay, AC Milan, Tim Nasional Afrika Selatan U21, LA Galaxy, Red Star Bratislava, Dynamo Moscow, Manchester United, Ajax Amsterdam, Tim Nasional Italia U-21, Arsenal, PSV Eindhoven, Queen Park Rangers, Lazio, dan di tahun 2013 disebut Barcelona FC akan datang ke Indonesia. Tentu kedatangan mereka bukan cuma-cuma namun ada sponsor. Pastinya nilai rupiah dari mendatangan klub-klub itu tidak kecil. Di sinilah FIFA melihat potensi ekonomi yang tinggi dari Indonesia untuk sepakbola dunia. Ketiga, antusias dunia sepakbola di Indonesia juga dilihat oleh klub-klub besar di Eropa. Untuk itu klub-klub besar mendirikan sekolah sepakbola. Se-

kolah sepakbola dari luar yang membuka cabang di Indonesia seperti SSI Arsenal, Liverpool Internasional Football Academy, FC Barcelona Escola Indonesia, dan Sekolah Sepak Bola Real Madrid. Tentu para orangtua yang menyekolahkan anaknya di sekolah sepabola itu perlu merogoh kocek yang dalam sebab sekolah sepakbola itu tentunya dalam latihan tidak seperti sekolah sepakbola di kampung-kampung. Sekolah sepakbola dari luar melihat bahwa Indonesia mempunyai pasar yang bagus dan menggairahkan sehingga akan ada lagi sekolah-sekolah sepakbola yang akan membuka cabang di Indonesia. Kesimpulannya, apabila FIFA dan AFC memberi sanksi kepada PSSI maka secara tidak langsung FIFA dan AFC memutus ‘rantai makan’ bagi pemain sepakbola asing dan klub asing sehingga FIFA dan AFC dalam posisi bingung dan plin plain, bila tidak diberi sanksi PSSI akan selalu dirundung konflik, namun bila diberi sanksi ‘suplai’ ekonomi sepakbola Indonesia untuk dunia terhenti. (***) Penulis adalah Penggemar Sepabola



19 Desember 2012


KEHILANGANSuhendra, pemilik sepedamotor yang hilang dari parkiran salahsatu hotel di Jalan Diponegoro Pematangsiantar, Selasa (18/ 12).

Eks Pelayan Kafe Tenggak Racun Hingga Tewas

Kreta Karyawan Hotel Raib dari Parkiran SIANTAR- Suhendra (22), seorang karyawan hotel ternama di Jalan Diponegoro mengalami kejadian naas. Suzuki Satria FU BK 5065 TAF, miliknya raib dari lokasi parkir tempatnya bekerja, Selasa (18/12) sekira pukul 14.30 WIB. Informasi dihimpun, Suhendra yang tinggal di Jalan Serdang, Gang Banjar, Kelurahan Bantan, Kecamatan Siantar Barat ini, tiba di hotel, Senin (17/12), sekira jam 22.45 WIB dan memarkirkan kreta-nya di parkiran khusus karyawan hotel. Pada saat itu, Suhendra yang masuk shift malam, mengetahui kereta yang sudah diangsurnya selama 23 bulan itu hilang sesaat akan bertukar shift pada paginya, Selasa (18/12), sekira jam 07.30 WIB. Suhendra yang sudah bekerja sekitar enam bulan di hotel itu, terkejut ketika melihat kreta kesayangannya raib dari diparkiran. Melihat itu, Suhendra pun memberitahukan kepada satuan pengamanan (Satpam) hotel. Namun, tidak seorang pun satpam yang mengetahui dan melihat

kreta Suhendra. Setelah mencari di sekeliling parkiran hotel dan tidak menemukannya, Suhendra pun menghubungi ibunya. Lalu, ditemani ibunya, Suhendra dan Satpam yang jaga pada malam itu mendatangi Mapolres Siantar, untuk melaporkan kasus itu. Usai membuat laporan, Suhendra mengaku sangat menyesalkan kurangnya pengamanan di hotel itu. “Hotelnya mewah, CCTV masa tidak ada,” kesal Suhendra. Selain tidak adanya CCTV, Satpam juga mengaku tidak melihat kreta Suhendra lewat dari pos pengamanan satpam. “Jalan keluarnya hanya satu, semua lewat dari pos satpam. Tapi kok bisa hilang,” kritiknya. Kapolres Siantar AKBP Alberd TB Sianipar, melalui Paur Humas Ipda Restuadi membenarkan telah menerima laporan pencurian tersebut. “Laporan pencurian tersebut sudah diterima dan masih diselidiki. Ditaksir korban mengalami kerugian materi ditaksir Rp15 juta,” katanya. (mag-05)


Supir Truk Pesakitan SIMALUNGUN- Akibat membawa 134 batang kayu yang diambil dari Kawasan Hutan Negara RI Register 2 S/M Sibatu Loting HPHTI PT TPL, seorang supir truk Paino (21), jadi pesakitan di Pengadilan Negeri Simalungun. Warga Huta Simpang Jambi, Nagori Bosar Nauli, Kecamatan Hatonduan, ini didakwa melanggar Pasal 50 ayat 3 huruf h jo Pasal 78 ayat 7, UU RI Nomor 41 Tahun 1999 tentang Kehutanan jo pasal 55 1 ayat ke-1 KUHPidana. Hal itu disampaikan Jaksa Penuntut Umum (JPU) Julius Butarbutar saat membacakan dakwaannyadihadapanhakimdipimpin Samuel Ginting, beranggotakan Heriyanti, dan Adria Dwi Afanti, Selasa (18/12). Peristiwa itu berlangsungdikawasanhutanNegara RI Register 2 S/M Sibatu Loting HPHTI PT TPL di Nagori Bosar Nauli, Kecamatan Hatonduan, Jumat (39/3), sekira pukul 22.00 WIB. Ceritanya, saat itu, terdakwa baru selesai mengangkat batu, kemudian bertemu dengan Mesdi (DPO) dan Dul Witno. Lalu Mesdi menawarkan kepada terdakwa untuk mengangkut kayu (bahan jadi) pada tengah malam. Mendengar itu, pria lajang itu menjawab; “ngeri-ngeri sedap mengangkut kayu, soalnya belum pernah aku kerja malam menyupiri atau mengendarai mobil”. Selanjutnya Dul Witno menjawab pernyataan terdakwa ‘siapa lagi kalau bukan kau Paino, kaunya yang bisa nyupir’. Kemudian, terdakwa pun akhirnya menyetujuinya. “Lalu sekitar pukul 21.00 WIB, terdakwa bersama Mesdi naik ke truk Toyota Dyna BK 8288 TC. Saat itu, Dul Witno sebagai pemilik truk masih sempat melihat mereka berangkat. Terdakwa pun membawa kendaraan terse-

DIJUAL Sebidang Tanah Luas,3 hektar, lokasi Sipirok 2 hektar kopiateng siap panen, Listrik rumah siap tempat, Jalan masuk mobil Berminat Hubungi: 0813 7655 5505

but memasuki Kawanan Kawasan Hutan Negara RI Register 2 S/ M Sibatu Loting HPHTI PT TPL, di Nagori Bosar Nauli, Kecamatan Hatonduan. Tak lupa juga Mesdi menuntun arah kayu yang sudah ditebanginya bersama Suwono dan Dudung,” terang Butarbutar. Setibanya di lokasi, terdakwa memutar truk menuju arah pulang. Kemudian, terdakwa mematikan kunci kontak mesin truk dan menunggu di dalam truk. Saat berada di dalam truk, Mesdi, Suwono, Dudung serta seorang lagi yang tidak dikenal melangsir dengan cara memundak kayu setiap satu batang hingga 134 batang ke dalam truk. Setelah penuh, terdakwa pun kembali menghidupkan mesin truk dan keluar dari kawasan hutan. Akan tetapi sekitar 500 meter truk melaju, tiba-tiba terdakwa melihat cahaya lampu sepedamotor dari pihak pengamanan PT TPL. Melihat itu, terdakwa menghentikan dan mematikan mesin truk. Kemudian mereka lari berpencar ke kawasan hutan dan meninggalkan truk. “Saat itu, terdakwa memilih berjalan kaki ke rumah. Selanjutnya pada Sabtu (31/3), terdakwa datang ke rumah Dul Witno dan memberitahukan bahwa truknya tinggal di kawasan hutan tersebut. Mendengar itu, Dul pun berangkat bersama anaknya Suryanto untuk mengambil truk itu. “Sementara untuk mengindari pencarian polisi, terdakwa memilih melarikan diri ke Pekanbaru. Namun, karena tidak tahan di sana, terdakwa kembali ke Huta Simpang Jambi, Nagori Bosar Nauli, Kecamatan Hatonduan pada 12 Agustus 2012. Saat itu juga terdakwa berhasil diamankan polisi,” ungkap jaksa. (mua)

PANCURBATU- Santi alias Kiki (28), mantan pelayan kafe nekat menenggak racun rumput. Wanita asal Stabat, Langkat, ini pun ditemukan tak bernyawa di sebuah kos-kosan di Desa Sembahe Baru, Kecamatan Pancurbatu, Selasa (18/12) dini hari. Motifnya, korban tidak terima spring bed baru miliknya di-running Yuli, teman satu kostnya berbuat mesum.


DIAMANKAN- Kartini br Simanjuntak dan Parningotan Lumbantobing, tersangka jurtul togel diamankan di Mapolresta Siantar, Selasa (18/12).


KARTINI & PARNINGOTAN DIBORGOL SIANTAR- Praktik judi toto gelap (togel) makin merajalela. Di Kota Pematangsiantar, seorang ibu rumah tangga (IRT) Kartini br Simanjuntak (55), jadi jurtul togel. Wanita bertubuh tambun ini ditangkap bersama seorang jurtul lainnya Parningotan Lumban Tobing (36), Senin (17/12). Keduanya diamankan dari lokasi berbeda. Kartini diamankan dari sebuah warung tuak milik Mak Anton di Jalan Patuan Nagari, Kelurahan Sukadame, Kecamatan Siantar Utara, Senin (17/12), sekira pukul 16.15 WIB. Sementara Parningotan diamankan dari Jalan Bombongan Raya, Kelurahan Tambun Nabolon, Keca-

matan Martoba pada sebuah warung tuak milik marga Hutagalung. Kini, baik Kartini, warga Jalan Rakutta Sembiring, Kelurahan Sigulang-gulang, Kecamatan Siantar Utara dan Parningotan Lumban Tobing (36), warga Jalan Medan, Simpang Karang Sari, Kelurahan Tambun Nabolon, Kecamatan Martoba, telah mendekam di sel Mapolresta Siantar. Penangkapan keduanya dilakukan atas informasi masyarakat. Untuk mengungkapnya, polisi menyaru sebagai pembeli nomor togel. Dari kedua tersangka, polisi menemukan 3 lembar kertas

berisi angka tebakan, sebuah pulpen, dan juga sebuah handphone Nokia type X1 berwarna hitam yang dijadikan sebagai alat untuk mengirim angka tebakan judi togel tersebut. Kemudian barang bukti berupa uang tunai sebesar Rp331 ribu dan 1 lembar kertas berisi angka tebakan judi togel hongkong. Kapolres Siantar AKBP Alberd Sianipar, melalui Paur Humas Ipda Restuadi membenarkan penangkapan Kartini br Simanjuntak dan Parningotan Lumban Tobing. “Keduanya diancam dikenakan pasal 303 KUHPidana tentang Perjudian,” ujarnya. (mag-05/dro)

Dua Spesial Bajing Loncat Ditangkap BELAWAN- Dua pelaku kejahatan yang kerap meresahkan para supir truk di Belawan Angga (19), warga Jalan Slebes, Gang Dua, Kecamatan Medan Belawan dan Bahri Siahaan (22), warga Perumahan Nelayan Indah, Blok DD, Kecamatan Medan Labuhan ditangkap petugas Sat Reskrim Polsek Belawan. Kedua spesialis bajing loncat ditangkap di tempat dan waktu berbeda. Dari tangan keduanya, polisi menyita barang bukti pisau, 6 zak gula, dan uang sebesar Rp50 ribu. Kini, keduanya dijebloskan ke sel tahanan Mapolsek Belawan, Selasa (18/12). Informasi diperoleh Posmetro Medan (grup Koran ini) di kantor polisi menyebutkan, Bahri Siaha-

an ditangkap di persimpangan tol Kampung Salam Belawan dengan cara menjegat mobil truk saat keluar tol. Pelaku langsung menodong supir langsung dan mengambil uang sebanyak Rp50 ribu dari kantong baju supir tersebut. Perbuatan pelaku telah diintai polisi dan langsung menangkap tangan tersangka. Sedangkan, Angga ditangkap saat beraksi terhadap truk bermuatan gula yang keluar dari Pelabuhan Belawan. Angga melakukan aksi kejahatannya bersama 8 temannya yang berhasil kabur. Para kawanan bajing loncat ini naik ke truk ketika terjebak macet di persimpangan Canang, Belawan. Aksi kawanan pelaku diketahui oleh warga dan langsung dikejar oleh masyarakat

setempat. Naas bagi Angga, dirinya tertangkap sedangkan teman-temannya berhasil kabur. Dengan barang bukti 6 zak karung gula hasil kejahatan langsung dibawa ke Mapolsek Belawan. Kedua pelaku kejahatan yang kerap meresahkan supir truk ini pun telah mendekam di sel tahanan Mapolsek Belawan. Kanit Reskrim Polsek Belawan AKP B Pakpahan mengatakan, pihaknya terus melakukan patroli di sekitaran kawasan yang kerap dijadikan aksi kejahatan terhadap para supir. “Kedua tersangka kita tangkap di lokasi berbeda, mengenai pelaku yang berhasil kabur masih kita kembangkan,” ungkapnya. (ril/pmg)

Informasi dihimpun, pada Sabtu (15/12) malam lalu, Kiki memerogoki Yuli dalam posisi kelonan dengan pria lain diketahui bermarga Sembiring di kamar kosnya itu. Melihat itu, Kiki mengamuk. Yuli dimaki. Keduanya pun terlibat adu mulut. Melihat situasi itu, Yuli dan kekasihnya beranjak dari kamar Kiki. Tak berselang lama, suami siri Kiki Selamat Riadi (44), warga Suka Raya, Kecamatan Pancurbatu, pulang dari tempatnya bekerja sebagai tukang jahit pakaian. Begitu suaminya pulang, Kiki mengadu. Namun ayah tiga anak itu ternyata menanggapinya dingin. Menurutnya hal itu tidak perlu dibesar-besarkan. Mendapat jawaban dari suami yang dinikahinya lima bulan lalu itu, Kiki tak terima. Selanjutnya, Kiki yang pernah bekerja sebagai pelayan di Kafe Darwin di Desa Sembahe Baru, ini langsung pergi ke Pajak Pancurbatu. Di pajak itu, korban mendatangi sebuah toko yang menyediakan berbagai jenis racun hama dan racun rumput. Kemudian Kiki membeli rumput merk Gramatsond dan dibawanya ke kos. Tiba di kost, Kiki langsung menenggaknya hingga tinggal setengah. Kiki pun terkapar dengan mulut berbusa. Beberapa detik saja Selamat masuk kamar yang disewanya sebesar Rp2,5 juta per tahun itu. Melihat istri mudanya terkapar dengan kondisi mulut mengeluarkan aroma tak sedap, Selamat panik dan menjerit histeris, sehingga mengundang perhatian tetangganya. Lalu, oleh warga Kiki yang sudah kritis langsung dilarikan ke Puskesmas Pancurbatu. Tiba di puskesmas, petugas medis pun memberikan pertolongan dan nyawa Kiki terselamatkan. Begitu kondisinya stabil, Selamat pun membawa Kiki pulang ke kediamannya. Namun pada Selasa (18/12), sekira pukul 00.07 WIB, tibatiba Kiki kejang-kejang. Melihat itu, Selamat yang berada di

sampingnya terkejut. Tapi tak lama kemudian, Kiki tewas dengan kondisi telungkup, mulut mengeluarkan buih. Menyadari istrinya meninggal, Selamat memberitahukannya kepada jiran tetangga. Warga yang mengetahui tewasnya Kiki langsung mendatangi kamar kos-kosan tersebut. Pagi harinya, warga yang curiga dengan kematian korban langsung melaporkannya ke petugas kepolisian. Tak berselang lama, Tim Reskrim Polsek Pancurbatu disusul Tim Forensik Polresta Medan tiba di lokasi untuk melakukan olah TKP, dan memboyong jenazah korban ke RSUP H Adam Malik Medan untuk keperluan otopsi. Terpisah, Yuli mengatakan, antara ia dan korban memang saling kenal. “Perkenalan kami sejak kami sama-sama kerja di kafe. Namun sejak dia kenal sama Bang Selamat lima bulan lalu, dia pun mulai meninggalkan pekerjaan menjadi pelayan kafe, dan dua bulan kemudian mereka menikah secara siri. Selanjutnya, mereka tinggal bersama, dan rumah kos ini,” ujar Yuli. Yuli juga mengaku bahwa dirinya juga tinggal di koskosan Kiki kurang lebih dua minggu. “Aku terpaksa tinggal di sana, karena tempat tinggalku sudah habis kontrak. Jadi aku numpang sama dia. Malam Minggu itu, memang kami ada ribut, karena dia memergoki aku sama pacarku tidur di spring bed yang baru dibelinya itu. Tapi saat itu langsung aku tinggalkan dia karena dia maki-maki aku,” aku Yuli sambil berlalu. Kapolsek Pancurbatu Kompol Darwin Sitepu saat dikonfirmasi membenarkan tewasnya korban. “Saat ini masih kita selidiki motif kematian korban, namun dugaan sementara korban nekat menghabisi nyawanya karena tak terima dimarahi suaminya. Itu sebabnya dia nekat minum racun rumput,” ujar Sitepu. (roy/pmg/dro)

Foto Roy

„ Jenazah korban disemayamkan di rumah duka.

Nasib Lelaki ‘Kurang Kerjaan’ Sebagai anak Veteran, Samsul (35), memang lelaki pemberani. Sayang, dalam keanggotaannya di sebuah organisasi kepemudaan (OKP), keberanian itu kemudian melenceng, beraninya menyelingkuhi istri orang. Akhirnya, ketika Samsul harus mati dibunuh lelaki yang istrinya dikencaninya, terpaksa dirinya disebut oknum. Kenapa, sudah punya keluarga Samsul kok masih “kurang kerjaan” juga. Dalam urusan wanita, kaum lelaki memang sering menjadi lupa akan statusnya. Bupati Garut

Aceng Fikri dan Deni Ramadani anggota DPRD Tasikmalaya, posisinya bisa terancam gara-

gara soal syahwat terhadap perempuan. Padahal urusan syahwat itu nikmatnya tak seberapa, tapi sengsaranya bisa merembet ke mana-mana. Yang celaka bukan dirinya saja, tapi juga keluarganya. “O, itu si Anu, yang bapaknya tukang selingkuh itu kan?” pasti begitu omongan orang. Agaknya oknum anggota OKP dari Palangkaraya (Kalteng) itu tak berpikir terlalu jauh ke sana. Begitu kenal dengan wanita cantik bernama Amita, langsung saja theng….. pendulumnya kontak. Ketika berhasil didekati, amit-amit, ternyata Amita sudah punya suami. Tapi lantaran wanita itu naga-naganga mem-

beri peluang, Samsul merasa sayang untuk melepaskannya. “Ingat Bleh, kesempatan itu datangnya hanya sekali, jadi jangan kamu lewatkan,” begitu kata setan menyemangati diri. Diam-diamSamsullalupacaran dengan Amita. Lelaki warga Jalan Kalimantan Gang Mandau, Palangkaraya ini memang pemberani. Terbukti meski tidak punya surat Kuasa Pengguna Istri, diaberanimengajakAmitaberbuat sebagaimana layaknya suami istri. Amita sendiri sudah kadung kesengsem pada Samsul, sehingga aspirasi urusan bawah oknum anggota OKP ini dimanjakan juga. Barang batil pasti takkan lama.

Suami Amita begitu tahu istrinya dikencani lelaki lain, tentu saja marah besar. Belum lama ini dia nekad mendatangi rumah tinggal Samsul, tapi yang bersangkutan tidak ada. Akhirnya lelaki ini hanya berpesan, “Tolong kasih tahu suami ibu, jangan sekali-kali mengganggu Amita. Bagaimana pun juga dia adalah istriku.” Sang istri sudah mengingatkan jangan bermain api. Namun pada kesempatan itu Samsul membantah bahwa telah menjadi lelaki senior (senang istri orang). Untukmenutupkedoknya,Samsul bilang bahwa itu orangyang hanya cari-cari masalah macam pengacara pemula. Jadi kalau sang istri ingin tenang tak termakan isu, lebih baik berdoa menurut kepercayaan masing-masing. Ny Samsul pun berdoa penolak bala. Tapi ternyata warga hari berikutnya menyaksikan, saat bininya tak di rumah terlihat Samsul dikejar-kejar lelaki begolok. Belum juga sempat memberikan pertolongan, lelaki malang ini sudah terjengkang tewas akibat dibabat golok. Sang pembacok yang diduga suami Amita, hingga kini masih dalam pencarian polisi. Adapun keluarga Samsul terpaksa mencari TPU untuk pemakamannya. Buruk muka cermin dibelah. (int)


19 Desember 2012

214 WNI Terancam Hukuman Mati

Kelelahan, Presiden Irak Dilarikan ke RS BAGHDAD- Presiden Irak Jalal Talabani dilarikan ke rumah sakit di Baghdad, Irak. Dia mengalami “masalah kesehatan” akibat kelelahan sehingga harus dirawat di RS. ”Dikarenakan kelelahan, Talabani mengalami masalah kesehatan dan diangkut ke rumah sakit di Baghdad,” demikian pernyataan di situs kepresidenan Irak seperti dilansir kantor berita AFP, Selasa (18/12). Talabani dilarikan ke RS pada Senin, 17 Desember malam waktu setempat. Namun tidak disebutkan lebih lanjut mengenai kondisinya saat ini. Talabani telah mengalami sejumlah masalah kesehatan dalam beberapa tahun terakhir. Dia menjalani operasi jantung di Amerika Serikat pada Agustus 2008 lalu. Setahun sebelumnya, Talabani harus dievakuasi ke negara tetangga Yordania untuk menjalani perawatan atas dehidrasi dan kelelahan. Talabani juga telah bepergian ke AS dan Eropa untuk menjalani perawatan atas sejumlah penyakit yang dideritanya. (dtc/int)

60 Persen Kasus Narkoba JAKARTA - Kementerian Luar Negeri (Kemlu) memberi penjelasan soal WNI yang terancam hukuman mati di luar negeri. Data di Kemlu hingga Desember tercatat ada 214 orang yang terancam hukuman mati. ”Menurut data yang dimiliki Kemlu, seluruh WNI di luar negeri, bukan TKI saja yang terancam hukuman mati berjumlah 214 orang. Dan itu bukan berarti mereka sudah selesai proses hukumnya semua, ada yang baru pengadilan pertama,

banding, kasasi dan ada yang memang sudah selesai,” kata juru bicara Kemlu, Michael Tene dalam keterangannya, Selasa (18/12). Michael memberikan keterangan itu terkait keterangan Migrant Care mengenai 420 orang

„ Juru bicara Kemlu, Michael Tene memberikan keterangan terkait TKI yang terancam hukuman mati di luar negeri. buruh migran yang terancam hukuman mati di luar negeri.

Lindungi Buruh, Menakertrans Terbitkan Surat Edaran

Sebar Isu Kiamat, 93 Orang Ditahan BEIJING-Aparat keamanan China menangkap 93 orang atas tuduhan menyebarkan desas-desus mengenai kiamat. Hal itu diungkapkan Kantor Berita Xinhua, Selasa (18/12). Pihak berwenang juga menangkap seorang pria yang melukai 23 anak di sebuah sekolah setelah ia mengalami gangguan kejiwaan akibat ramalan kiamat. Ke-93 orang yang ditangkap, yang berasal dari tujuh provinsi, mencakup anggota-anggota sekte Tuhan Yang Maha Kuasa, tulis Xinhua yang menambahkan bahwa mereka dibekuk karena membagikan selebaran mengenai wahyu dan menyebarkan desasdesus. ”Anggota-anggota sekte ini belum lama ini menyebarkan skenario kiamat suku Maya yang meramalkan Matahari tidak akan bersinar dan listrik tidak akan berfungsi selama tiga hari mulai 21 Desember,” kata kantor berita itu, mengutip biro keamanan umum Xining, ibu kota provinsi Qinghai, China baratdaya. China melakukan operasi penumpasan terhadap sekte Tuhan Yang Maha Kuasa yang juga menyerukan perang menentukan untuk membasmi Partai Komunis Naga Merah. Partai Komunis China tidak membiarkan penentangan atas kekuasaannya dan ingin menjaga stabilitas sosial. Namun, mereka terus menghadapi desas-desus yang seringkali menyebar dengan cepat di Internet. Dalam sebuah laporan terpisah Xinhua mengatakan, polisi di provinsi Henan menangkap seorang pria yang diidentifikasi sebagai Min Yongjun, setelah ia melukai 23 anak di sebuah sekolah dasar dan seorang perempuan dewasa di rumahnya dekat sekolah itu. (dtc/int)

”Sejauh ini proses hukumnya masih dalam upaya pemerintah

untuk membebaskan mereka dari hukuman mati. Dari 214 orang itu, 60 persen lebih yaitu sekitar 135 adalah kasus narkoba,” terang Michael. Michael juga menjelaskan, sebagai gambaran, selama tahun 2012 pemerintah sudah membebaskan 110 WNI dari hukuman mati. Hal itu sebagai bentuk konkrit pemerintah untuk melindungi warga negaranya. ”Tapi yang jelas, membebaskan WNI dari hukuman mati itu bukan upaya yang mudah. Tapi pemerintah sudah membebaskan 110 orang,” tutur Michael. (dtc/int)

„ Adhyaksa Dault mendatangi kantor KPK, Selasa (18/12).


JAKARTA—Menteri Tenaga Kerja dan Transmigrasi (Menakertrans) Muhaimin Iskandar, menerbitkan Surat Edaran terkait antisipasi pelaksanaan upah minimum tahun 2013. Surat edaran nomor 248/ Men/PHIJSK-PJS/XII/2012 yang terbit tertanggal 17 Desember 2012 tersebut, ditujukan kepada 33 Gubernur di seluruh Indonesia. Kepala Pusat Humas Kemnakertrans Suhartono mengatakan, dalam surat edaran diterbitkan untuk mengantisipasi dampak kelangsungan usaha di industri padat karya akibat kenaikan upah minimum 2013. Usaha padat yang dimaksud antara lain usaha tekstil, alas kaki dan indutri mainan. “Kenaikan upah minimum yang signifikan dibandingkan tahun tahun sebelumnya memang harus

diantisipasi dengan baik. Jangan sampai mengakibatkan pengurangan jumlah pekerja atau berkurangnya kesempatan kerja,” ungkap Suhartono di Gedung Kemenakertrans, Jakarta, Selasa ( 18/12). Dijelaskannya, kenaikan upah minimum dimaksudkan untuk penyesuaian daya beli terhadap kebutuhan hidup pekerja atau buruh dalan rangka mewujudkan ketenangan bekerja dengan tetap memperhatikan kelangsungan usaha. “Maka itu, pemerintah meminta agar para Gubernur dapat lebih proaktif memberikan penjelasan dan pemahaman kepada perusahaan industri padat karya yang beorientasi ekspor. Karena, agar dapat melaksanakan kebijakan penetapan upah minimum tahun 2013,” jelasnya. (cha/jpnn)

KPK PERIKSA ADHYAKSA DAULT JAKARTA—Komisi Pemberantasan Korupsi (KPK) tak mau berlama-lama menelusuri peran mantan Menpora Andi Mallarangeng dalam dugaan korupsi di proyek Hambalang. Untuk menelusuri apa peran Andi, KPK pun memanggil mantan Menpora sebelum Andi, Adhyaksa Dault. Dia dinilai mengerti soal proyek Hambalang dan keterangannya dianggap penting. Ya, Adhyaksa diperiksa sebagai saksi dalam kasus dugaan korupsi di proyek pembangunan pusat olahraga Hambalang. Adhyaksa datang seorang diri sekitar pukul

10.00 WIB. Ia membawa sebuah map berisi surat panggilan dari KPK dan beberapa lembar surat lainnya. ”Saya datang sebagai saksi untuk mantan Menpora, Andi Mallaranggeng,” ujar Adhyaksa di depan gedung KPK, Selasa (18/12). Sebelumnya, Andi menyebut proyek pembangunan Hambalang adalah lanjutan dari kebijakan Adhyaksa. Namun, hal tersebut dibantah Adhyaksa. Menurutnya, proyek tersebut sudah melenceng jauh dari perencanaan awal yang dibuat Kementerian Pemuda dan Olahraga di era jabatannya. Adhyaksa dulunya juga

menampik bahwa saat ia menjadi Menpora proyek ini sudah berjalan. Ia mengatakan, saat menjabat, di lahan Hambalang itu memang sudah berdiri sebagian b angunan dan pagar di sekeliling proyek. Namun pembangunan ini dilakukan bukan oleh Kemenpora. Proyek itu adalah limpahan dari Kemendiknas, di mana sejak 2003 memang sudah dibangun. Namun, saat itu dihentikan oleh BPK karena belum memiliki sertifikat lahan. “Saya akan jelaskan semua yang saya ketahui di zaman saya pada KPK,” pungkas Adhyaksa. (flo/jpnn)

„ Menakertrans Muhaimin Iskandar memberikan keterang pers terkait Surat Edaran antisipasi pelaksanaan upah minimum tahun 2013.

KPK Kembali Cek Akbar Tolak Ruhut Kembali ke Golkar Fisik Simulator SIM Badai Evan Hantam Fiji AUSTRALIA- Siklon terbesar yang menyerang Fiji dalam 20 tahun mengakibatkan kerusakan parah dengan kecepatan angin 200 km/jam. Ribuan orang mengungsi di barak-barak pengungsian ketika badai kategori empat itu menerjang dan menghancurkan rumah warga, memutus aliran listrik serta memicu banjir bandang. Siklon Evan telah diturunkan kategorinya dan diperkirakan akan melemah saat mendekati perairan selatan. Tidak ada korban jiwa di Fiji. Sedangkan di Samoa pekan lalu Evan menewaskan lima orang. Negara kepulauan itu tidak menyiarkan peringatan dirni ketika badai tropis menyerang akhir pekan lalu. Otoritas Samoa mengatakan bahwa selain korban tewas, 10 orang warga masih dinyatakan hilang. Di Fiji, Pulau Viti Levu di sebelah barat Fiji menjadi daerah dengan kerusakan terparah. Kota terbesar kedua di negara itu, Lautoka, tampak seperti ‘zona perang’ pasca serangan Evan, seperti dilaporkan harian Fiji Times. Hujan deras mengakibatkan sungai-sungai meluap dan merendam jalan raya serta jembatan, sedangkan angin kencang menumbangkan tiang listrik dan menerbangkan atap bangunan. Ratusan keluarga diminta mengungsi karena struktur bangunan perumahan yang dinilai tidak aman. Lebih dari 8.000 orang menyelamatkan diri ke 137 pusat evakuasi kata Kementerian Penerangan. Ribuan wisatawan juga dilaporkan mengungsi dari pulau-pulau di sekitar Viti Levu dan menunggu badai berlalu. Penerbangan dari dan ke Fiji dibatalkan. Polisi membatasi pergerakan warga keluar dan masuk kotakota utama untuk melindungi pusat-pusat bisnis dari penjarah. (dtc/int)

JAKARTA - Dewan Pertimbangan Partai Golkar punya pikiran berbeda dengan DPP Partai Golkar mengenai kesediaan menampung kembali Ruhut Sitompoel bila hengkang dari PD. Sejauh ini sama sekali tidak ada rencana Partai Golkar merekrut mantan politisinya tersebut. ”Tidak ada pikiran (menerima Ruhut). Kader kami masih banyak,” ujar Ketua Dewan Pertimbangan Partai Golkar, Akbar Tandjung, usai menghadiri Silaknas ICMI di Jakarta Convention Center, Senayan, Jakarta Selatan, Selasa (18/12). Menurut Akbar, masih banyak kader muda di Golkar yang memiliki potensi karir politik yang bagus. ”Urusan Ruhut itu urusan partai Demokrat. Kan dia sudah ada disitu,” terangnya. Seperti diketahui, akhir pekan lalu DPP PD resmi mencopot Ruhut Sitompoel dari jajaran kepengurusan. Bila mantan praktisi hukum itu berniat hengkang, Partai Golkar terbuka untuk menampung mantan politisinya tersebut. ”Kembali menjadi anggota Golkar boleh. Tetapi untuk menjadi caleg ada kriterianya,” kata Ketua DPP Golkar, Hadjriyanto Y Thohari, kepada wartawan di Gedung DPR, Senayan, Jakarta, Senin (17/ 12). Karir Politik Ruhut di Partai Demokrat Tergantung SBY Pemecatan Ruhut Sitompul dari Dewan Pengurus Pusat Partai Demokrat belum berarti karir politik Ruhut di partai berlambang Mercy tersebut selesai. Karir politik Ruhut ada di tangan SBY sebagai Ketua Dewan Pembina. ”Dia (Ruhut) kan sudah tidak mengurus tapi masih anggota dewan. Saya melihat ini untuk 2014, semua partai menyusun calon legis-

„ Akbar Tanjung latifnya, ini kan tidak terlepas dari peran pengurus, walaupun pengambil keputusannya Pak SBY. Kalau tidak menambah kualitas PD ya ditentukan akan diputus atau tidak. Dia akan dipertimbangkan secara serius,” kata pengamat politik dari LIPI, Siti Zuhro, pada detikcom, Selasa (18/12). Memanasnya persoalan Ruhut yang tidak mengurus lagi, dinilai terkait dengan posisi Partai Demokrat yang dianggap mulai menurun citranya di mata masyarakat. Zuhro yakin keputusan tegas akan diambil oleh SBY. ”Demokrat ini kan Pak SBY. Ini juga masalah berat karena Pak SBY tidak mencalonkan lagi, dan siapa next leader yang leadershipnya kan dipatuhi ini memang hal yang berat di Demokrat. Kalau sangat masuk akal dan argumentatif, saya pikir Pak SBY tegas,” ujar Zuhro. Zuhro menilai vokalnya Ruhut yang meminta Anas Urbaningrum mundur dari Ketua Umum Partai Demokrat karena faktor kultur. Se-

dangkan Anas sendiri tidak melakukan vokal sefrontal Ruhut. ”Waktu yang akan membuktikan apakah Ruhut yang membangun? Partai ini mau dikemanakan, itu siapa? Itu akan kelihatan. Semacam disuguhi pertunjukkan seperti itu, dari kemarin ada keberangan dari kubu Anas dan lainnya yang menunjukkan jangan mensubordinasi Anas. Sebetulnya ingin mengatakan jangan memaksa orang mundur, kalau kamu nggak bisa stop berarti out,” ujar Zuhro menganalisis. Zuhro menambahkan dalam berpolitik pernyataan perang harus juga disertakan pernyataan damai. Yang terpenting adalah bagaimana memenangkan suatu dinamika faksionisme dengan cara elegan. ”Dalam politik itu ketika siap perang, maka saat itu juga siap damai. Ketika ada damai, kita juga harus siap perang. Dalam politik juga, strategi bagaimana memenangkan secara elegan dan berargumen itu penting. Siapa yang bisa bermain cantik,” tutup Zuhro. (dtc/int)

JAKARTA- Komisi Pemberantasan Korupsi kembali melakukan pemeriksaan fisik simulator berkendaraan roda dua dan roda empat ujia surat izin mengemudi (SIM) di sejumlah tempat, Selasa (18/12). Pengecekan dilakukan untuk mencocokan spesifikasi alat dengan kondisi fisik di lapangan terkait penyidikan kasus dugaan korupsi proyek simulator SIM Korps Lalu Lintas (Korlantas) Polri. “Terkait Korlantas, hari ini KPK melakukan sejumlah kegiatan dalam rangka mengecek fisik simulator di beberapa tempat,” kata Juru Bicara KPK Johan Budi di Jakarta. Menurut Johan, tim penyidik KPK hari ini mengecek fisik simulator SIM yang ada di Depok, Serpong, Tangerang, Bekasi, dan Samsat Daan Mogot. Pengecekan ini akan dilanjutkan ke Kabupaten Bogor. Johan menambahkan, pihaknya mendapat dukungan penuh dari Kepolisian dalam pengecekan tersebut. “Perlu disampaikan bahwa kami didukung penuh oleh Polri dalam pengecekan tersebut,” katanya. Dalam kasus ini, KPK menetapkan empat tersangka, yakni mantan Kepala Korlantas Polri Inspektur Jenderal Polisi Djoko Susilo, Mantan Wakil Kepala Korlantas, Brigadir Jenderal Polisi Didik Purnomo, Direktur Utama PT Citra Mandiri Metalindo Abadi (CMMA) Budi Susanto, serta Direktur PT Inovasi Teknologi Indonesia (ITI) Sukotjo S Bambang. Mereka diduga bersama-sama melakukan perbuatan melawan hukum dan penyalahgunaan wewenang untuk menguntungkan diri sendiri atau pihak lain namun justru merugikan keuangan negara. Diduga, timbul kerugian negara sekitar Rp 100 miliar dari proyek ini. KPK menduga ada penggelembungan harga simulator SIM roda dua dan roda empat yang tendernya dimenangkan PT CMMA. Perusahaan Budi tersebut memenangkan tender proyek simulator SIM roda dua dan roda empat senilai Rp 196,8 miliar. Dalam pelaksanaannya, PT CMMA diduga membeli barang dari PT Inovasi Teknologi Indonesia dengan harga yang jauh lebih murah, yakni sekitar Rp 90 miliar. (kmc/int)

„ Juru bicara KPK Johan Budi memberikan keterangan penanganan kasus Simulator SIM.


19 Desember 2012

Parbetor Culik & Cabuli Murid TK

Lakalantas Maut, Dua Tewas, 24 Luka-luka Sambungan Halaman 1 tabrakan dengan bus Kota Pinang Baru(KPB)bernomorpolisiBK7359. Informasi yang dihimpun, tabrakan terjadi ketika bus Pinem yangmelajudariarahMedanmenujuPekanBarumenabrakpembatas jalan yang berdiri tepat di tengah JalinsumDesaJanji,KecamatanBilah Barat. Akibatnya, ban depan bus Pinem itu terangkat dan supir membanting setir ke arah kanan, bersamaan dari arah berlawanan, datangsebuahbusKPBtrayekKota Pinang-Medanyangsedangmelaju kencang, hingga tabrakan pun tak dapatterhindarkan. “BusPinemmelajudariarahKota Medan menuju Rantauprapat, sedangkanbusKPBmelajudariarah RantauprapatmenujuKotaMedan. Tabrakan terjadi ketika Bus Pinem menghantam pembatas jalan, bus Pinem terjungkal dan supir membanting setir ke arah kanan hingga menabrak bus KPB yang datangdariarahberlawanan,”kata Kasat Lantas Polres Labuhanbatu AKPFaidildidampingiKanitPatroli SatlantasPolresLabuhanbatuIptuH Limbong Zikri saat berada di lokasi kejadian. DijelaskanZikri,supirbus KPBSyaiful(40),wargaKotaPinang Kabupaten Labusel dan seorang penumpang wanita yang belum diketahuiidentitasnyameninggaldi tempatkejadian.“Ada2korbantewas ditempat,seorangsupirdanseorang penumpangbusKPB.Namunhinggakiniidentitasjenazahpenumpang berjeniskelaminperempuanitubelumkitaketahui,danmasihberadadi kamarjenazahRSURantauprapat,” terangZikri. Sementara 24 orang lainya, yang merupakan penumpang bus Kota PinangBaruyangmengalamilukalukayakniAri(17)wargaPerbaungan, Sugito (35) warga Indrapura, Koko

(44)wargaRantauprapat,IsmaYulia (17)wargaKotaPinang,Kartika(21) warga Medan, Ismail (21) warga RokanHilir,SriTrisnawati(26)warga Kota Pinang, Takwa (21) warga Medan,JohannesGinting(28)warga Medan, Sri (32) warga Kota Pinang, Butet(19)wargaKotaPinang,Riosha Novita (16) warga Kota Pinang, Hilman Simanjuntak (52) warga TebingTinggi,Rosmaida(42)warga TebingTinggi,LonakiSembiring(34) wargaTebingTinggi,Fransiska(17) wargaPekanBaru,Nesima(64)warga Perbaungan, Putri (26) warga Kota Pinang, Lindawati (28) warga Kota Pinang,Anita(39)wargaBlokSongo Kota Pinang, Adita Peranginangin (24)wargaMedan,Amrin(27)warga Asahan, Rukita (41) warga Kota Pinang, Pasha (11) warga Kota Pinang. “Mereka yang luka-luka sebagian masih dirawat di RSU Rantauprapat dan sebagian sudah kembalipulang,”kataZikri. Sementara menurut penuturan dari masyarakat sekitar, pembatas jalandiJalinsumDesaJanjiberpotensi mengakibatkan kecelakaan lalu lintas. Pasalnya,pembatasjalantersebut berada persis di atas puncak jalan menanjakhinggaseringtidakterlihat para supir jika melaju dengan kecepatan tinggi. “Letaknya persis beradadipuncaktanjakan.Wajarlah kalaubusPinemitumenabrakbenda itu, karena kalau dari bawah tidak kelihatan,” kata Tono (31), warga DesaJanji,KecamatanBilahBarat. Ditambahkan Tono, pihaknya berharap Pemkab Labuhanbatu segera melakukan perbaikan letak pembatas jalan agar tidak menjadi ancamankeselamatanbagipengendara. “Dishub jangan asal-asal saja pasangpembatastanpaadaramburambuyangjelas.Kalausudahkejadian,masyarakatjugayangmenjadi korbannya,”katanya.(CR-01)

Korban Diupa-upa, Sekolah Diliburkan Sambungan Halaman 1 “Untuk sementara sekolah kita liburkan.Inimelihatsituasibukityang mengitari desa dan dekat sekolah, sehingga dikhawatirkan longsor susulan.Kitalihatdulubeberapahari ini,kalausudahmemungkinkanmaka kita akan ajak masyarakat gotongroyong membersihkan material longsor agar para murid bisa belajar kembali,”ujarKepalaSDNegeri199 GunungtuaImronNasution,kepada METRO,Selasa(18/12). Dikatakannya, pihak sekolah belumberanimenyuruhmuridyang berjumlah 80-an orang datang ke sekolah, apalagi pasca kejadian itu banyakanak-anakyangtrauma,dan lokasisekolahmasihdalamsituasilabil danrawanlongsor.“Apalagiwilayah inimasihterusdiguyurhujandanmaterial longsor belum dibersihkan,” ucapnya. Imron menambahkan, pihaksekolahtelahmenemuikeluarga tigamuridyangmengalamiluka-luka. Pihaknyabersamawargasekitarjuga telahmelakukanupa-upabagimurid yang menjadi korban, untuk mengembalikansemangatmereka. “Tadi sore (kemarin) kami sudah menemuidanmelihatkondisimurid yangluka.Alhamdulilahkondisiketiga siswa itu sudah berangsur pulih,”

tambahnya.Sementaraitu,Kadisdik Madina Imron Lubis SPd MM yang dikonfirmasimelaluiKabidPendidikan Dasar Asmara Hadi Lubis, membenarkanjadwalliburdiSDNegeri199 Gunungtua Kotanopan yang tertimpa longsor. “Kita sudah koordinasidenganKepalaUPTDisdik Kotanopan. Hasilnya saat ini tidak memungkinkan dilangsungkan prosesbelajar-mengajar.Selainsatu ruangan sudah tertimpa material longsor,kondisidancuacadisanajuga masih dikhawatirkan karena masih terushujan.Danmengenairuangan yangrusakdalamwaktudekatDinas Pendidikanakanmelakukanperbaikandanpembangunan,”sebutnya. Berjaga-jaga Kepala Desa (Kades) Gunungtua SimandolamAbdulHakimNasution mengatakan, hingga kemarin masyarakat masih berjaga-jaga di rumahdanwarungyangadadidesa itu. Alasannya, warga takut longsor susulan. Sebab, sejak belasan tahun lamanyabarukaliadalongsorterjadidi desaitu,apalagisempatmelukaitiga anak-anakmereka.Sejauhini,masyarakatsudahsepakatakanmelakukan gotong-royonguntukmembersihkan danmemperbaikibangunansekolah satu-satunya di desa itu, yang rusak tertimpalongsor.(wan)

MEDAN-Bocah5tahunsebutsajanamanya Bunga,muridtamankanak(TK)wargaJalan Kiwi Medan Sunggal, diculik dan dicabuli tukangbecakmesin(Parbetor,red)SonyListon (35),warga Jalan Sei Seguti Medan Petisah, Jumat (14/12). Perbuatan Sony terungkap, ketika korban menceritakan peristiwa yang dialami kepada orangtuanya dan langsung melaporkePolsekMedanBaru,Rabu(18/12). Data dihimpun POSMETRO MEDAN (GROUP METRO), sebelum kejadian pencabulanterjadi,korbanbersamatemantemanyasedangbermaindihalamansekolah TKyangberalamatdiJalanDarussalam.Kala itu, pelaku melintas dari depan sekolah dan melihat korban bermain-main. Melihat itu, pelaku menghampiri korban dan langsung membekapdanmemaksakorbannaikkebetor BK1057COmilikpelaku.Dengancepat,pelaku mengendari betor ke kediamannya di kawasan Sei Seguti. Saat itu, kondisi rumah pelakuyangtelahkosongdimanfaatkanuntuk mencabulikorban. PakaianseragamTKbermotifkotak-kotak abu-abuputihyangdikenakankorbandibuka pelaku secara paksa. Korban pun digauli dengan cara meraba-raba dan menciumi sekujurtubuhbocahperempuanitu.Tangisan

korban pun tak dihiraukan pelaku yang kian bringasmenjalankanaksitaksenonohitu.Usai puasmelampiaskannafsunya,menggunakan betornya korban diantarkan pelaku ke kediamannya.DatangnyaBungayangdiantar parbetor, disaksikan beberapa warga sekitar termasukneneknya.“Akuliatdiadiantarsama tukang becak, tapi kami belum tahu apa masalahnyasaatitu,”katanenekkorbanketika ditemuidiPolsekMedanBaru. Di dalam rumah, Bunga pun terus diam. Namun diamnya Bunga membuat ibunya curiga,ditambahlagitingkahkorbanyangtakut melihat laki-laki. Kepada ibunya, korban menceritakankejadiantersebut. Di luar dugaan, Bunga mengenali pelaku termasukdimanakediamanpelaku.“Anakku takut sama orang, makanya pas kutanya dibilang dia dibawa bapak-bapak dari sekolahnya. Di situ lah aku langsung tanya sama dia apa yang terjadi, makanya kami lapor,”kataibukorbanyangenggannamanya dikorankan dan tampak terus memeluk putrinyaitu. Korbanpundimintamenunjukkanrumah pelaku.Bermuladarisekolahdimanaiadiculik secaraperlahantapipastiBungamenunjukke arah mana ia dibawa. Hingga akhirnya,

kediaman pelaku ditemukan pada Senin malamsekitarpukul19.00WIB. Tak mau konyol, keluarga korban menghubungi petugas Polsek Medan Baru gunamenangkappelaku. Saatdiamankan,Sonyyangtelahberistriitu mengelak atas tuduhan tersebut. Namun Bungadenganyakinmenunjukpelakuyang telahmencabulinya.Akhirnya,olehpetugasia diamankankePolsekMedanBaru. Saat ditanyai, Bunga mengatakan jika telinganyadikencingiolehpelaku,“Dipipisin, dibilang ucapan kotor,” kata korban polos sembari menyampaikan jika telinganya tersemburspermadarikemaluanpelaku. Tampak pula Bunga pingsan dipelukan ibunya,ketikadipertemukandenganpelaku. “Takutkalidiakayaknya,sampaipingsan,”kata salahsatukerabatkorban. Masih menurut kerabat korban (pamanred),jikatertangkapnyapelakusetelahBunga mampumenunjukkanarahkediamanpelaku, sertajaketcoklatlusuhyangdikenakanpelaku, “Darijaketitulahdiayakinpelaku,emangpintar anakitu.Diajugabisamenunjukkandimana rumahsipelaku,makanyakamikesana.Kalau dari dia katanya dia diciumi sama dibuka pakaiannya sampai bugil, terus dia nangis,”

kata paman korban yang menyatakan agar identitaskeponakandandirinyatidakdibuat denganalasanaib. Sementara,pelakuSonyListonbersikeras tak mengakui perbuatannya. Bahkan ia membantahsemuatuduhanyangdiberikan padanya dengan alasan saat kejadian dia sedangmelayatbersamakeluarganya. Hal itu dikatakan abang ipar pelaku, M Sianturi(45)yangmengatakantidakmungkin adiknyamelakukantindakantersebut.“Tidak mungkinitu.Adikkubaik-baikorangnya.Kami tak terima dituduh begini. Mana buktinya,”katanya. KapolsekMedanBaruKompolJeanCalvijn Simanjuntakketikadikonfirmasimengatakan, jikapelakumasihdiperiksaserayamenunggu hasil visum. Dia juga mengimbau, agar orangtuadanpihaksekolahlebihberhati-hati. “Menungguhasilvisumya,jikaterbuktikorban kitajeratUndang-undangPerlindunganAnak Pasal81,82denganancaman5tahunpenjara. Kita harap orangtua dan pihak sekolah lebih berhati-hati,”ujarnya. Dia menambahkan, kasus pencabulan yangdilakukanparbetorkianmarak.Makadari itu, pihaknya akan terus berupaya menuntaskankasusitu.(wel/pmg)

Pak Lurah Poligami, Istri Pertama Ngadu ke Bupati Sambungan Halaman 1 Aduan tersebut berisi keluhan SKN atas perlaku suaminya yang pergi dari rumah sejak bulan April dan melakukan poligami (praktik pernikahan lebih dari satu istri, red) dengan EEH. Bukan hanya itu, HH juga menggugatnya cerai sekaligus meninggalkan utang di salahsatu bank, yang kini menjadi tanggung jawabnya dalam hal pelunasan. SKN yang ditemui METRO di BKD Tapsel, Jalan Kenanga, Kota Padangsidimpuan (Psp), menyebutkan, surat pengaduan kepada Bupati Tapsel bertujuan untuk meminta keadilan atas segala tindakan suaminya. Dalam surat pengaduan itu, terang SKN, dituliskan bahwa mulai 5 April 2012, suaminya (HH) telah pergi tanpa pemberitahuan. Dan, sejak kepergian HH, ia dan dua anaknya tidak pernah diberi nafkah. Hingga kini, komunikasinya dengan HH terputus total. Ironisnya, HH meninggalkan utang di salahsatu Bank, yang hingga saat ini selalu ditagih pihak Bank dan dianggap menjadi

tanggungjawabnya. “Atas permasalahan utang ini, saya melaporkannya kepada Camat B, selaku atasan suami saya. Lalu, camat mencoba memediasi. Hasil mediasi, suami saya berjanji akan membayar seluruh utang piutang dengan menjual sebagian harta kami. Namun, suami saya diam-diam telah menjual sebagian harta yang kami peroleh selama berumah tangga, dan hasil penjualan bukannya digunakan untuk membayar utang melainkan untuk pribadi,” bebernya kesal. SKNmenambahkan,hinggasaatiniiadan HHmasihresmiberstatussuamiistri.Sebab, proses perceraian masih berlangsung. Pasangan yang menikah pada tahun 1987 lalu ini, telah menjalani persidangan sebanyak 8 kali. Dan, selama proses berlangsung, suaminya hanya hadir dua kali, yakni persidangan pertama tanggal 19 Juni 2012 serta mediasi tanggal 26 Juni 2012. “Anehnya pada sidang ke delapan ini, Selasa (18/12), majelis hakim menyatakan bahwa gugatan cerai sudah dicabut HH, makanya saya tambah bingung,” ujarnya

berkaca-kaca. Ditambahkan SKN, sejak HH pergi, ia sudah tidak aktif lagi melaksanakan tugasnya sebagaimana seorang PNS. Hal ini dibuktikannya dengan melampirkan fotokopi absensi suaminya. Namun, meski sejak April tidak pernah melihat suaminya di rumah dan kantor, HH tetap menerima gaji setiap bulan. “Selain itu, HH telah poligami dengan menikahi perempuan berinisial EEH. Atas poligamiini,sayatidakpernahmemberikan danmembuatizinbaiksecaralisanmaupun tulisan atas pernikahan mereka,” sebutnya. SKN menjelaskan, informasi yang didapatnya pernikahan mereka dilakukan di Sumatera Barat, tepatnya di Kabupaten Sijunjung. Hal ini dikuatkan dengan penyataan dan pengakuan yang bersangkutan kepada saudara dan kerabat yang bersangkutan. “SuamisayapernahmengakukepadaGS. Lalu,kepadaISpadatanggal20Agustus2012 bertepatan Hari Raya Idul Fitri. Suami saya membawa perempuan tersebut beserta enam anaknya ke rumah IS di Desa Sirongit,

Kecamatan Angkola Sangkunur. Pada hari itu juga, suami saya dan EEH berkunjung ke rumah GAH di Dusun Tiga Dolok, Kelurahan Simataniari, Kecamatan Angkola Sangkunur, bebernya. SKN menjelaskan, apa yang dilakukan suaminya telah melanggar UU nomor 1 Tahun 1974 tentang pernikahan, PP nomor 10tahun1980juntoPPnomor45tahun1990 tentang izin Perkawinan dan Perceraian Pegawai Negeri Sipil. Dan, atas segala kejadian yang menimpanya, ia bermohon kepada Bupati Tapsel Syahrul M Pasaribu, agar menanggapi pengaduannya, sehingga permasalahan itu bisa diselesaikan sesuai dengan ketentuan yang berlaku. “Saya bersedia memberikan informasi tambahan apabila pak bupati membutuhkan. Saya harap persoalan ini bisa segera diselesaikan,” harapnya usai mengantarkan surat pengaduan ke Subbag Rumah Tangga Kantor Bupati Tapsel dan BKD Tapsel. Sekadar informasi, SKN juga menembuskan surat pengaduannya kepada Ketua DPRD Psp, Kepala BKD Psp, Kepala Inspektorat Psp dan Camat B.(phn)

Kabid Humas Poldasu: Terbukti, Diproses! Sambungan Halaman 1 Dan bila terbukti akan diproses. Heru bahkan belum bisa memastikan apakah uang itu benar dibawa kabur atau masih ada. Padahal oknum polisi yang diduga melarikan uang tersebut hingga saat ini diketahui masih juga belum masuk kantor untuk bertugas. “Saya hanya mau meluruskan, memang ada informasi di Polres Padangsidimpuan yang menyebutkan salah satu oknum personil yang bertugas di Satlantas membawa lari uang yang ada pada kas pajak kendaraan bermotor. Oknum petugas tersebut tidak ada di tempat, namun apakah dia lari atau ada suatu keperluan, belum pasti. Tapi terhadap oknum tersebut, masih bisa dilakukan komunikasi,” ujar Heru, Selasa (18/12).

Menurut Heru, tersangka ini bukan lari dan tak masuk bertugas selama dua bulan, melainkan baru-baru saja yakni, kurang lebih 1 bulan tak bertugas. “Sebelumnya tersangka masih berada di tempat,” terang Heru. Heru mengaku, atas kasus tersebut hingga saat ini belum ada laporannya yang berarti karena orang yang dirugikan belum melapor. Dia mengaku pihaknya masih akan mengecek. “Mungkin ini hanya keterlambatan pembayaran terhadap materil yang ada,” kilahnya. Dijelaskan Heru, uang yang diduga raib tersebut, merupakan uang yang seharusnya dibayarkan untuk pembayaran pajak Bea Balik Nama (BBN) untuk kendaraan baru saja. “Masih kami dalami dan telusuri. Kami belum bisa menyampaikan secara detail. Nanti kalau dikatakan menggelapkan, tiba-tiba

tersangka nongol dengan membawa uangnya kan lain ceritanya,” ucap Heru. Ditegaskanya, pihaknya akan mendalami mengapa hilangnya uang tersebut belum diproses. “Kemungkinan saja oknum tersebut sedang menghadapi masalah lain, sehingga tidak berada di tempat yang tidak ada kaitannya dengan masalah pajak ini. Sehingga yang bersangkutan tidak melakukan tugas sebagaimana mestinya,” tambahnya. Begitupun, Heru tetap konsisten, bahwa bila nanti oknum petugas tersebut terbukti menggelapkan atau melarikan uang tersebut, tetap akan diproses. “Saat ini telah dilakukan interogasi dari rekanrekan anggota tersebut,” tandas Heru mengakhiri. Sebelumnya diberitakan, dana kas di Satuan Lalulintas (Satlantas) Kepolisian Resort (Polres) Padangsidimpuan raib.

Hilangnya anggaran senilai Rp1,7 Miliar yang dipegang seorang personil Satlantas Polres Padangsidimpuan berpangkat Aiptu itu, dibenarkan mantan Kapolres Padangsidimpuan AKBP Andy Syahriful Taufik SiK MH. Informasi yang dikumpulkan, anggaran kas itu di bawah pengawasan bagian Registrasi dan Identifikasi (Regident) Satantas Polres Padangsidimpuan. Dana anggaran Rp1,7 miliar itu raib sekitar dua bulan yang lalu. Raibnya dana kas Satlantas Polres Padangsidimpuan itu diketahui saat rapat Satuan Wilayah (Satwil) yang dipimpin Kapoldasu Irjen Pol Wisjnu Amat Sastro di lantai 4 Gedung Utama Mapoldasu beberapa waktu lalu. Jenderal bintang dua itu sempat berang dan mengancam akan mencopot Kasat Lantas Polres Padangsidimpuan. (mag-12)

Pemilik Kafe Modali Pembelian Sembilan Kg Ganja dari Madina Sambungan Halaman 1 brNasution(34),yangmemodalipembelianganja sembilankilogramtersebut. Informasi dihimpun METRO dari kepolisian, AmatLubisditangkapanggotaSatnarkobaPolres TaptengdiJalanBaru,BatuMardinding,Kelurahan Bona Lumban, Kecamatan Tukka, persisnya di belakang rumahnya, Senin (17/12) sekira pukul 01.00 WIB. Lalu berdasarkan keterangan Amat, polisi kemudian menciduk Masria br Nasution, Senin(17/12)diniharisekirapukul02.30WIB. Amatditangkapmemilikisekitarsatukilogram daunganjakeringyangdibungkusdidalamplastik asoiwarnahitamsaatsedangmenunggupembeli di belakang rumahnya. Ganja satu kilogram tersebut,merupakansisadarisembilankilogram ganjayangdibelinyadariPanyabungan,Madina awalbulanDesemberlalu. SedangkanMasriawargaSibolgaJuluditangkap berdasarkanketeranganAmatyangmengatakan, ganjatersebutdimilikinyadariseseorangberinisial PM (DPO). Masria merupakan pemodal PM untukmembeliganjaseberatsembilankilogram dariMadina.

Selainitu,saatdiinterogasipetugas,Masriajuga mengaku mengetahui tempat penyimpanan ganjatersebut.Ataspetunjukwanitapemiliksalah satukafediJalanBaru,Tukka,inipolisimenyitasatu unit timbangan yang dibungkus dalam plastik, yang di dalamnya juga berisi daun ganja kering, serbukdanbijiganja. KapolresTaptengAKBPMisnanmelaluiKasat Narkoba AKP K Nababan, Selasa (18/12) menuturkan,saatdiinterogasipenyidik,tersangka Amat mengaku hanya sebagai kurir. Saat tertangkaptangan,ayahdarisatuanakinisedang menungguduaorangpembeliberinisialRBdan BY yang sebelumnya memesan ganja tersebut melaluitelepon.Namunbelumsempattransaksi ganjadilakukan,Amatdiringkuspetugas. Nababan mengatakan, tersangka Amat mengakumendapatganjatersebutdariPMyang merupakantemandekatMasriabrNasution.Amat yangmendapatpesanandariRBdanBY,kemudian menghubungiPM.LaluPMmenyuruhseorang temannya berinisial AJ mengantarkan ganja tersebutkerumahAmat. “Untuk mengembangkan kasus ini, kita melakukanpenyelidikankepadaparaorang-or-

METRO TABAGSEL Koran Kebanggaan Orang Tabagsel

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel ) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh : Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tabagsel : Pj. Pimred Metro Tapanuli : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba

Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Muhiddin Hasibuan Pandapotan MT Siallagan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

angyangterlibat.Namunyangberhasilkitaringkus selaintersangkaAmatadalahMasriabrNasution di rumah kediaman saudaranya di Jalan AMD, KelurahanKalangan,KecamatanPandan,hariitu juga,” terang Nababan yang mengaku Polres TaptengdibawahkepemimpinanAKBPMisnan tetapkomitmemberantasperedarannarkobadi wilayahhukumnya. Perwira dengan pangkat tiga balok kuning di pundaknya itu menerangkan, saat diinterogasi, tersangka Masria mengaku sebagai pemodal untukmembeliganjatersebutdariPanyabungan. SedangkanyangmenjemputganjaadalahAmat. Tersangka Amat diberi upah Rp500 ribu atas suruhanPM. HalinijugadibenarkanAmat,yang mengaku sudah dua kali menjemput ganja dari Panyabungan.Pertamayaknisebanyakdelapan kilogram,danyangterakhirinisembilankilogram. SemuaganjatersebutdiserahkankepadaPM. Selain mengaku pemodal, Masria juga mengaku mengetahui tempat penyimpanan ganja tersebut yang kemudian mengarahkan petugas untuk menjemput sisa ganja yang ditanam di Bukit Sibolga Julu persisnya di dalam tumpukan sampah. (fred)

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN

Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Hotland Dolok Saribu Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


19 DESEMBER 2012

2 ABG Dipukuli... Sambungan halaman 8 belakang. Begitu kami kecelakaan, abang itu menghilang,” kata Riko. Pantauan Metro di lokasi, dua penjambret di amankan di rumah penduduk untuk mengantisipasi amukan massa. Korban yang ditabrak oleh jambret langsung di larikan ke RSUD Rantauprapat untuk mendapatkan pertolongan. Polisi yang tiba di lokasi langsung mengamankan pelaku beserta barang bukti satu unit sepeda motor Jupiter milik pelaku dan tas milik korban. Terpisah, Kasubag Humas Polres Labuhanbatu AKP MT Aritonang saat dikonfirmasi membenarkan kejadian tersebut. “Saat ini pelaku dan sepeda motornya sudah kami amankan,” katanya. (CR-02)

Pemko Harus... Sambungan halaman 8 juga memprioritaskan perpustakaan daerah dalam upaya peningkatan mutu pendidikan. Kota Padangsidimpuan (Psp) dalam visinya jelas mendekrasaikan diri sebagai Kota Pendidikan sesuai dengan rencana strategis dan UU Nomor 4 Tahun 2001 tentang Pembentukan Kota Psp sebagai kota pendidikan dan jasa. Namun dalam upaya menciptakan kota pendidikan yang berkwalitas, masihlah jauh dari harapan. Untuk perpustakaan daerah, Pemko Psp hanya memiliki lembaga UPTD, bukan kantor yang menaungi perpustakaan. Selain itu gedung dan ketersediaan buku dengan jumlah siswa dan mahasiswa di Pemko Psp yang mencapai 90 ribu orang, Pemko Psp hanya menganggarkan Rp100 juta untuk pengadaan buku. Ketua LSM Padangsidimpuan Isntitut (PIN), Amir Hamzah Harahap mengatakan, bahwa tahun depan Pemko Psp harus instropeksi diri dengan visinya. “Keadaan gedung perpustakaan daerah sebenarnya tidak layak jika disesuaikan dengan visi Walikota menjadikan Kota Psp sebagai kota pendidikan, ditambahlah lagi ketersediaan buku yang ada juga sangat tidak layak untuk 90 ribu orang siswa dan mahasiswa. Pada tahun 2011, Pemko Psp hanya menganggarkan dana pengadaan buku dari APBD senilai kurang lebih Rp100 juta, padahal sudah kita ketahui bersama pentingnya buku untuk menumbuhkan minat baca. Menurut kami itu sungguh tidak layak,” ucap amir. Amir menambahkan, seharusnya Pemko Psp sudah mendirikan lembaga/kantor yang menaungi persoalan perpustakaan seperti daerah lain, seperti Tapsel, Medan, Deli Serdang dan kabupaten/kota lainnya. “Saya harap Pemko Psp untuk tahun 2013 sudah merencanakan tentang gedung baru dan menjadikan perpustakaan daerah sebagai kantor bukan UPTD seperti saat ini, agar kedepan lebih terurus. Selain itu Pemko Psp juga harus membangun gedung kantor yang layak sebagai bukti ingin memajukan serta menarik minat baca warga dan siswa,” tegasnya. Untuk pengadaan buku bacaan, Amir juga sangat prihatin dengan sikap pemerintah yang perhatiannya sangat minim terhadap pengadaan buku bacaan. “Kita sangat miris ketika melihat jumlah buku bacaan serta ketersediaan buku terbaru, kita lihat saja untuk pengadaan buku bacaan Pemko Psp hanya menganggarkan Rp100 juta. Padahal buku yang diperlukan dalam mengembangkan pendidikan sangatlah banyak,” imbuhnya. Di tahun 2013 nanti, Walikota serta DPRD Kota Psp Dinas Pendidikan harus sama-sama memperhatikan dan berpikir rasional dalam upaya menyebarkan imlu dan pengetahuan untuk pendidikan bagi seluruh warga di Kota Psp. (phn)

Walikota Pernah Diwarning Terkait Temuan-temuan BPK Sambungan halaman 8 Drs Zulkarnaen Nasution MM gagal membangun Kota Psp adalah tidak salah. Namun kegagalan ini, kata keduanya tidak lebih dari ketidakmampuan para pembantu Walikota Psp dalam menjabarkan perintah dan program yang dicanangkan oleh Walikota Psp. Kesalahan ini, katanya, kemudian juga berpulang pada Walikota Psp sendiri dan khususnya Baperjakat yang dipimpin Sekda Psp, Sarmadan Hasibuan dalam memilih orang-orang yang ditempatkan memimpin SKPD, hingga akhirnya yang terjadilah adalah selama 5 tahun hampir secara keseluruhan program yang dilaksanakan gagal dan tidak membuahkan hasil dan bisa dinikmati rakyat Psp.

“Walikota gagal karena para pembantunya tidak mampu. Lantas kenapa pembantu yang tidak memiliki kecakapan dipilih, karena Baperjakatnya salah pilih dan salah tempatkan orang. Ya wajarlah jika program Walikota Psp gagal dilaksanakan, karena dari dasarnya saja salah. Yang kita sayangkan Walikota Psp selama ini terlalu mendengarkan dan terlalu percaya terhadap masukan Baperjakat yang diketuai Sekda, Sarmadan Hasibuan dalam memberikan nama-nama yang akan diangkat menjadi pimpinan SKPD atau perpanjangan tangan Walikota dalam melaksanakan programnya,” tutur keduanya. Kemudian dikatakan mereka, pihak legislatif hanyalah lembaga yang menerima atau menampung hasil usulan eksekutif

sedang eksekutif terkesan lebih memprioritaskan rutinitas mereka (keinginan penguasa) ketimbang kebutuhan yang sifatnya pro rakyat. “Jadi artinya eksekutiflah dalam hal ini Walikota yang gagal dan kita ulangi lagi kegagalannya karena para pembantunya tidak mampu melaksanakan program walikota itu juga,” tutur keduanya. Visi menjadikan Kota Psp sebagai kota pendidikan, perdagangan barang dan jasa sama sekali tidak mengena. Dicontohkannya, Pasar Sangkumpal Bonang sampai dengan saat ini hanya persoalannya belum selesai. Persoalan sertifikasi guru dan angka kelulusan siswa ke PTN sangat minim dan juga tidak ada tindaklanjut eksekutif

Pembangunan Jembatan Belum Rampung Sambungan halaman 8 menuju dan sesudah melewati jembatan. Di samping itu, pekerjaan dyk jalan sekitar 30 meter sebelum dan sesudah pekerjaan jembatan dengan pasangan batu tanpa menggunakan coran besi beton ketinggian sekitar 50 cm. Sampai hari kemarin, masih berjalan kegiatan pekerjaan di lokasi proyek. Terlihat sekitar 6 orang tenaga tukang. Sementara jembatan pembantu sebanyak 2 lokasi berada disisi kiri dan kanan jembatan masih mengalami gangguan antrean panjang kepada kendaraan yang hendak melewati jembatan. Hal ini mengakibatkan lalu lintas di penghujung tahun dan pelaksanaan Natal dan Tahun Baru akan terganggu. “Tahun ini tak akan selesai itu proyek,” ujar beberapa warga Laguboti di sela-sela kemacetan jalan, Selasa (18/12). Terkait keterlambatan ini, penjelasan dari pihak kontraktor maupun pengawas proyek belum diperoleh keterangan. Beberapa orang yang ditemui di lokasi proyek justru mengelak

ketika dimintai komentarnya. Proyek jembatan Aek Simare mengakibatkan kemacetan sehingga meresahkan masyarakat dan pengguna jalan. Tiap kali warga Tampahan, Balige dan Laguboti bepergian ke arah Porsea atau sebaliknya, minimal 20 menit harus terjebak di tengah-tengah kemacetan dan antre untuk bisa lewat. Bukan hanya pegawai, pedagang dan pengusaha, anak sekolah pun turut menjadi korban kemacetan, khususnya pelajar dari Sigumpar, Siantar Narumonda dan Porsea yang akan pergi sekolah di Balige. “Proyek Pembangunan Jembatan Aek Simare ini untuk kepentingan masyarakat. Tetapi setelah kami amati kelihatannya tidak. Pembangunannya justru meresahkan dan menghambat warga masyarakat melaksanakan aktivitasnya, seperti pedagang yang hendak berjualan ke Poresa, PNS dan anak sekolah ke Balige akibat kemacetan yang ditimbulkannya,” ujar Sekretaris LSM TopanRI Kabupaten Tobasa Jerry Sibuea di Laguboti. Menurut Jerry, setiap hari pengemudi sepedamotor, mobil dan penumpang selalu

mengeluh karena berlama-lama di lokasi pembangunan jembatan untuk menunggu giliran lewat dari kemacetan. “Tiap hari ratusan sepedamotor dan mobil harus antre. Walaupun kelancaran arus lalu lintas sudah diatur anggota Satlantas Polres dan Dinas Perhubungan Kabupaten Tobasa, kemacetan tidak juga bisa dielakkan. Kondisi jembatan yang tak kunjung selesai dan akses jalan alternatif yang tidak memadai menjadi penyebab timbulnya kemacetan yang cukup panjang,” timpalnya. Wenty (35), warga Balige juga mengaku hal serupa. Dia mengaku selalu kesal dan geram setiap kali lewat dari jembatan Aek Simare Laguboti. “Setiap Rabu saya berjualan ke Porsea. Kalau berangkat dari rumah jam 7.30 Wib, sudah dapat saya pastikan sampai di Porsea jam 10.00 Wib. Tentu akibat kondisi ini saya telat membuka lapak. Sementara para konsumen sudah pada ramai memadati pekan, padahal menjelang Natal dan Tahun Baru inilah harapan kita jualannya laris,” tandas ibu empat anak ini di Balige. (cr-03)

pun biasa saja. Paling laku 10-15 pasang per harinya,” ujar Halomoan. Sementara, Hilman (25) pengunjung pasar menuturkan, kedatangannya ke pasar bukan semata karena ingin membeli barang jelang akhir tahun, namun karena ingin mencari sesuatu barang. Ia sudah biasa ke Pasar Sangkumpal Bonang bila ada sesuatu barang yang hendak dibeli. Di tempat lain, salah satu abang becak yang sering mangkal di sisi Barat Pasar

Sangkumpal Bonang juga menuturkan hal yang sama. Kondisi sewa yang relatif normal tidak berpengaruh terhadap pendapatan pada akhir tahun ini. Walaupun toh nantinya pada tahun baru katanya banyak sewa yang didapat karena pengunjung biasanya datang membludak. Pantauan METRO di setiap sisi pasar terlihat beberapa pengunjung hanya berlalu-lalang, sedangkan kendaraan yang terparkir juga terlihat seperti biasanya. (tan)

Pengunjung Pasar Sangkumpal Bonang Normal

Sambungan halaman 8 semakin dekat. Halomoan Harahap, sebagai salah seorang pedagang sepatu di Pasar Sangkumpal Bonang kepada METRO, Selasa (18/12) mengatakan, untuk jelang tahun ini warga yang berbelanja tidak terlalu antusias. Sebab, biasanya pasar akan padat jika sudah dekat Natal dan Tahun Baru. “Biasa saja keadaan pasar, penghasilan

mengatasi persoalan ini. Kemudian persoalan limbah dan jenis penyakit masih sangat rentan dengan masyarakat, sedangkan eksekutif selalu mencari kambing hitam. “Begitu kompleksnya persoalan selama lima tahun ini yang tidak terselesaikan oleh eksekutif. Sementara hasrat penguasa hanya ingin menyenangkan segelintir saja tanpa memikirkan penderitaan rakyat. Makanya kita sepakat selama lima tahun dibawah kepemimpinan Zulkarnaen-Mara Gunung, Kota Psp ini gagal dibangun dan pemerintahannya juga gagal. Kita harapkan pemerintahan yang akan datang segera menyiapkan diri dengan utang yang ditinggalkan penguasa yang lama untuk dicarikan solusinya untuk kesejahteraan masyarakat Psp,” pungkas keduanya. (phn)

Telkomsel Hadirkan NSP Rohani di Desember Sambungan halaman 8 sering mengaktifkan lagu rohani sebagai NSP, hal ini dilakukan pelanggan selain menyesuaikan momen natal dan tahun baru serta sebagai penyemarak suasana di bulan Desember. Pelanggan juga secara tidak langsung ikut menyemarakkan kegembiraan melalui lagu rohani dalam bentuk nada sambung saat pelanggan lainnya menunggu panggilan terjawab oleh orang yang dituju. Untuk mengantisipasi kebutuhan tersebut, Telkomsel menyediakan berbagai pilihan lagu yang dapat digunakan oleh pelanggan sebagai NSP,” kata Head of Sales and Customer Care Region Sumbagut Division Filin Yulia. Untuk informasi Nada Sambung Pribadi, kata Yulia, pelanggan bisa mendapatkan informasinya dengan mudah melalui website resmi telkomsel yaitu website http:/ / pilih service lalu pilih menu NSP 1212. Pelanggan dapat mengaktifkan Nada Sambung Pribadi (NSP) lagu-lagu rohani dengan mengirim SMS, ketik Alias lagu dan kirim ke 1212. Contoh: HMBAA kirim ke 1212. NSP ini dapat dinikmati dengan tarif Rp9.000 untuk 30 hari dan dapat diperpanjang jika pelanggan menginginkannya. Pelanggan juga dapat mengirim NSP Rohani sebagai hadiah kepada pelanggan Telkomsel lainnya dengan mengetik RING(spasi)GIFT(spasi)KODE(spasi)NO TUJUAN kirim ke 1212. Dengan tarif yang sama. Contoh: RING GIFT HMBAA 081165XXXX. (rel/leo)

Hari Ini, PWI Tabagsel Seminar Sehari Sambungan halaman 8 langsung Walikota Psp, Drs Zulkarnaen Nasution MM, akan diikuti ratusan peserta dari kalangan pelajar dan mahasiswa seKota Psp. “Semoga seminar ini dapat membuka cakrawala berpikir dan menambah pengetahuan peserta dalam memaknai fungsi pers dalam pembangunan Kota Psp,“ terang Nimrot. Kemudian, untuk lomba karya tulis ilmiah, ucap Yusuf Siregar, bertajuk ‘Opti-

malisasi Sumber Daya Alam dalam Percepatan Pembangunan Tapanuli Selatan (Tapsel)’. Untuk langkah awal telah dibentuk kepanitian yang di Ketuai Sukri Falah Harahap, Sekretaris, Hairul Iman Hasibuan, Bendahara, Kodir Pohan dibantu sejumlah unsur bidang. “Panitia nantinya akan merumuskan jadwal dan berbagai hal dalam mewujudkan lomba karya tulis yang bekerjasama dengan Pemkab Tapsel ini,“ sebutnya. Dia mengharapkan, penyelenggaraan

seminar sehari dan lomba karya tulis ini dapat berjalan lancar dan bermanfaat bagi masyarakat Kota Psp dan Kabupaten Tapsel. Terpisah, Ketua lomba karya tulis PWI Tabagsel, Sukri Falah Harahap menyampaikan, persiapan panitia sudah 80 persen mencakup tahapan lomba karya tulis. “Karya tulis sudah dapat diserahkan ke pihak panitia di Sekretariat PWI Perwakilan Tabagsel di Jalan SM Raja Nomor 50A, Kota Psp dan Humas Pemkab Tapsel mulai hari

ini. Batas waktu 30 Desember 2012 mendatang. Lomba karya tulis ini dibagi dua kategori yaitu umum dan wartawan. Syarat dan mekanisme penulisan dapat menghubungi panitia,“ ungkapnya. Dijelaskan, tim penilai dalam lomba karya tulis yang berhadiah total Rp12 juta plus sertifikat dan cenderamata itu berasal dari kalangan akademisi, pengamat dan pers. “Kita berharap, hasil tulis nanti dapat menjadi input bagi percepatan pembangunan Tapsel,“ pungkasnya. (neo)


Tiap Bulan Terima Murid Remaja Korban KTD Sambungan Halaman 1 sesuai dugaan saya, dia sudah hamil lima bulan. Setelah tes itu, bapaknya baru percaya,” kenang Siti. Kasus Partini yang terjadi sekitar dua tahun lalu tersebut bukan sesuatu yang mengejutkan bagi Siti. Hampir setiap bulan dia menerima kabar adanya remaja putri yang hamil di desanya. Bidan berusia 40 tahun itu mengakui, kasus KTD di Desa Ploso, Pacitan, Jawa Timur, cukup tinggi. Selama 20 tahun menjadi bidan desa di Pondok Bersalin Desa (Polindes) Ploso, dia kenyang menangani remaja SMP atau remaja dalam rentang usia 12-15 tahun yang berbadan dua. “Bukan hanya angka KTD yang tinggi, pernikahan usia dini di desa saya juga paling banyak di Jawa Timur,” paparnya. Siti mengungkapkan, di Ploso, remaja putri 12 tahun sudah lazim berpacaran. Hampir setiap hari si pacar apel ke rumah si gadis ingusan itu. Bahkan, tak jarang si pacar sampai tidur di rumah gadis idamannya. Hal seperti itu dianggap biasa oleh warga. “Ya gimana ndak hamil, wong setiap hari diapeli sampai nginep-nginep segala. Saya pernah curhat ke Pak Lurah, tapi nggak ada tindak lanjutnya,” urai Siti. Yang makin membuat Siti heran dan prihatin, orang tua pihak perempuan seperti membiarkan anaknya berpacaran kelewat batas. Akibatnya bisa ditebak, si remaja putri akhirnya hamil. “Ironis, wong sejak awal pacaran mereka (orang tua) tahu dan seolah membiarkan pacar anaknya sampai menginap segala, kok pas anaknya hamil mereka nggak percaya. Bahkan kemudian bingung dan marah-marah,” ujarnya. Lantaran budaya pacaran yang permisif tersebut, Siti jadi terbiasa menerima kabar adanya remaja putri yang hamil di desanya. Bahkan, untuk jumlah kehamilan di desanya, separo di antara mereka pasti remaja putri yang hamil baru. Dan begitu mendapat kabar adanya remaja yang hamil tersebut, Siti bergegas menuju rumah si remaja. “Biasanya orang tua dan anaknya amat malu dengan kondisi itu. Mereka lalu enggan memeriksakan kehamilan anaknya. Karena itu,

saya ngalahi untuk mendatangi rumah mereka. Kalau ada lima remaja yang hamil bersamaan, ya saya datangi satu per satu mereka,” ungkap bidan dari Nganjuk tersebut. Menurut Siti, kehamilan pada usia belia cukup berisiko. Organ reproduksi mereka belum benarbenar siap menerima janin. Tidak hanya itu, pengetahuan yang minim akan gizi ibu hamil menjadi persoalan di desa tersebut. “Masih banyak yang nggak paham soal gizi ibu hamil. Mereka umumnya kurus-kurus. Bahkan, ada yang sampai mengalami kurang energi kronis (KEK). Akibatnya, berat badan bayi waktu lahir rendah,” ujarnya. Sejumlah mitos yang berkembang di masyarakat Desa Ploso juga cukup menyulitkan penanganan perempuan hamil usia belia. Misalnya, perempuan hamil tidak boleh tidur siang. Mereka juga tidak boleh makan telur. “Katanya nanti amis, matanya jadi rabun,” ucap Siti. Selain itu, masyarakat setempat lebih percaya pada dukun daripada bidan atau dokter. Tentu saja mitos-mitos tersebut merugikan para perempuan hamil belia itu. Prihatin atas kondisi masyarakat Desa Ploso yang masih “terbelakang” itu, Siti menggagas kelas hamil bagi perempuan desanya. Seluruh perempuan yang hamil diajari hal-hal yang terkait dengan kesehatan janin serta persiapan persalinan yang matang. Tidak seperti kelas hamil yang dianjurkan pemerintah (dengan “murid” 10 ibu hamil), kelas hamil gagasan Siti mengundang semua ibu hamil di desanya. Karena itu, tak heran bila setiap pertemuan ada 25"30 ibu hamil yang datang. Di antaranya adalah para remaja korban KTD dan remaja yang nikah dini. “Peserta kelas hamil ini tidak dibatasi usia kehamilan. Perempuan yang hamil muda semestinya ikut kelas ini biar cepat tahu cara menangani kandungannya. Apalagi bagi para remaja putri yang telanjur berbadan dua itu,” tegas Siti. Hanya, tidak mudah mengajak para remaja yang hamil untuk bergabung di kelas hamil. Ada yang malu aibnya diketahui banyak orang. Ada yang enggan dan sungkan bertemu ibu-ibu yang

hamil normal. Menghadapi kondisi itu, Siti tidak tinggal diam. Dia lalu mendatangi satu per satu calon ibu belia tersebut. Dia berusaha merayu agar mereka mau mengikuti kelas hamil. Usahanya tidak percuma. Kini seluruh remaja yang hamil di desanya secara rutin mau bergabung di kelas hamil binaannya. Sebelum kelas dimulai, Siti biasanya memeriksa kehamilan setiap “murid”-nya. Termasuk cek HB (hemoglobin) dan gizi si murid. Khusus bagi remaja hamil usia belia, Siti memberikan perhatian ekstra. Dia perlu mengedukasi mereka mulai soal makanan, persiapan persalinan, hingga pasca melahirkan. “Saya biasanya bilang kepada mereka betapa beratnya orang yang sedang hamil. Belum lagi bila anaknya lahir nanti. Tapi, saya juga mengatakan, mereka harus bisa merawat anaknya dengan baik agar kelak anaknya jadi orang sukses,” papar Siti. Di kelas hamil itu, dia juga mengajak serta para suami dan keluarga ibu hamil. Mereka mengikuti sesi khusus agar tahu cara menjaga kehamilan serta kesehatan ibu dan janinnya. “Supaya mereka paham bahwa ibu hamil itu susah. Jadi, mereka tidak boleh menyuruh istri atau anaknya yang tengah hamil untuk kerja berat.” Dua tahun berjalan, kelas hamil yang digagas Siti menunjukkan perkembangan signifikan. Misalnya, kini jumlah ibu hamil KEK berkurang. Begitu juga kelahiran BBLR (berat bayi lahir rendah) yang menurun drastis. Berkat kerja keras dan perjuangannya mendidik ibu hamil di desanya tersebut, Siti menjadi nomine Srikandi Award 2012. Penghargaan itu diadakan untuk mengapresiasi para perempuan hebat pada setiap peringatan Hari Ibu. “Saya sangat bangga dikirim ke Jakarta. Semoga kalau saya menang, hadiahnya bisa bermanfaat bagi para ibu hamil di desa saya,” katanya. Siti tergerak menjadi bidan karena terdorong kondisi keluarga. Dia tumbuh dalam keluarga besar yang miskin. Saudara kandungnya tujuh orang. Dari delapan anak itu hanya dirinya yang mampu sekolah hingga SMA. Lulus SMP, Siti melanjutkan ke Sekolah Program Bidan (P2B) di Celaket, Malang. Dia

memilih menjadi bidan karena melihat riwayat persalinan ibunya yang buruk. Sang ibu empat kali keguguran. Saat melahirkan anak terakhir, dia hampir meninggal. Itu semua karena minimnya pengetahuan tentang gizi dan persalinan bagi ibu hamil. Berkat tekad kuatnya untuk menjadi bidan, Siti berhasil lulus dengan nilai terbaik pada 1992. Dua bulan setelah lulus, Siti diangkat menjadi PNS (pegawai negeri sipil). Namun, dia tidak mau ditempatkan di kota asalnya. “Saya pilih Pacitan. Saya tertantang dengan kondisi masyarakat di daerah itu,” ujarnya. Awal menjadi bidan di Ploso, Pacitan, Siti sudah dihadapkan pada berbagai tantangan. Salah satunya, profesinya sebagai bidan tidak diakui masyarakat setempat. Masyarakat lebih percaya kepada dukun bayi untuk proses persalinan. Sikap kepada Siti berubah ketika dia menangani seorang ibu yang hampir meninggal saat melahirkan. Siti pun bekerja keras untuk menyelamatkan bayi dan ibunya. “Alhamdulillah, keduanya selamat. Sejak itu masyarakat mulai percaya pada saya. Karena itu, sekalipun gajinya tidak besar, bahkan sering gratis, saya tidak akan meninggalkan desa itu. Saya merasa lebih ayem tinggal di sini,” tandasnya. (*/c2/ari)

Ingin Punya Pasangan Sambungan Halaman 1 Ungkap Nadia, awalnya ia menjaga jarak untuk dekat dengan pria. “Sekarang, kalau ada yang sreg, aku berusaha coba kenal lebih dalam. Kriteriaku standar lah, sama kayak yang lain, cewek-cewek kebanyakan. Yang penting, dia bisa bikin aku nyaman dan sebaliknya juga,” paparnya. Namun, ketika ditanya lebih jauh mengenai identitas pria itu, Nadia memilih bungkam. Ia tidak mau menceritakan sebelum jalinan itu menjadi sesuatu yang lebih serius. “Enggak mau kasih tahu. Yang jelas, kenal sama yang lagi dekat sudah lama banget,” ujar perempuan yang belum lama ini mengaku lebih dari seorang sahabat bagi pemain keyboard David “NOAH” ini. (int)

Membuat Mereka Bahagia Sambungan Halaman 1 menaruh bunga itu di pusara anak nyonya,” jawab pria itu. “Apa?” tanya wanita itu dengan gusar. “Ya, karena orang mati tidak akan pernah melihat keindahan bunga. Karenanya saya berikan kepada mereka yang ada di rumah sakit, orang miskin yang saya jumpai, mereka yang sedang bersedih. Orang hiduplah yang dapat menikmati keindahan dan keharuman bunga-bunga itu, nyonya,” jawab pria itu. Wanita itu terdiam, kemudian ia dan supirnya pun pergi. Tiga bulan kemudian, seorang wanita cantik turun dari mobilnya dan berjalan dengan anggun ke arah pos penjaga kuburan. “Selamat pagi, apakah masih ingat saya? Saya nyonya Steven. Saya datang untuk berterimakasih atas nasehat yang anda berikan dulu. Anda benar, bahwa memperhatikan dan membahagiakan yang masih hidup jauh lebih berguna daripada meratapi yang sudah meninggal. Ketika saya langsung mengantarkan bunga-bunga itu ke rumah sakit atau panti jompo, bunga-bunga itu tidak hanya membuat mereka bahagia, tapi saya turut bahagia. Sampai saat ini dokter tidak tahu mengapa saya bisa sembuh, tapi saya benar-benar yakin bahwa sukacita adalah obat yang memulihkan saya!” (int)


19 DESEMBER 2012

Walikota Pernah Diwarning Terkait Temuan-temuan BPK SIDIMPUAN-Setiap tahunnya DPRD Kota Padangsidimpuan (Psp) selalu menyoroti masalah LKPj tahunan Walikota Psp. Kemudian penilaian bahwa Walikota Psp tidak mampu mewujudkan visi misi Kota Psp yang sejahtera, bukanlah sebuah penilaian yang tiba-tiba saja dilontarkan oleh DPRD Psp. “Setiap LKPj tahunan kita selalu meluruskan dan mengingatkan Walikota lewat rekomendasi LKPj. Ketika saya Ketua Panja rekomendasi LKPj tahun 2009 yang dibahas pada Juli 2010 lalu, juga telah memberi warning kepada Walikota tentang banyaknya temuan-temuan BPK dan banyaknya anggaran yang tidak terarah pada

visi misi walikota. Silahkan saja dicek dokumen-dokumen bagaimana rekomendasi tahunan sejak kepemimpinan walikota diperiode keduanya, juga pandangan-pandangan fraksi yang selalu kritis terhadap kinerja Pemko Psp selama ini. Jadi rekomendasi LKPj 5 tahun itu adalah akumulasi dari rekomendasi-rekomendasi

sebelumnya. Kita sebenarnya sudah capek mengingatkan Pemko Psp,” ungkap Ketua Fraksi Partai Demokrat (FPD) DPRD Psp, H Khoiruddin Nasution menyikapi statement sejumlah pihak yang juga menyalahkan DPRD Psp atas kegagalan Walikota Psp melaksanakan program pembangunan yang tertuang dalam rekomendasi LKPj 5 tahunan. Dikatakan Ketua Komisi III DPRD Psp ini, berdasarkan indikator yang ada, yakni Rencana Pembangunan Jangka Menengah Daerah (RPJMD) yang merupakan bentuk program kerja dari visi misi walikota (yang disusun oleh Pemko Psp sendiri) diuji

kerealisasi APBD, ternyata konsep mereka tidak bisa mereka wujudkan. ”DPRD Psp siap diuji dan siap membuktikan bahwa apabila dibandingkan dengan draft R-APBD pun juga R-APBD perubahan, setelah dilakukan pembahasanpembahasan didalam rapat-rapat komisi maupun rapat-rapat di badan anggaran DPRD, pasti setelah hasil pembahasan di dewan akan kelihatan kemajuan perubahan anggaran yang sangat signifikan dengan meningkatnya alokasi anggaran untuk pelayanan publik dan pembangunan sarana prasarana untuk kemajuan perekonomian dan kerakyatan. Kita harapkan masyarakat

paham dan memahami bagaiman sebenarnya mekanismenya,” jelasnya. Sementara itu kegagalan Walikota Psp dalam menjalankan program pembangunan di Kota Psp ini menurut analisa para aktivisi dari pekerja social, penyebab utamanya adalah karena ketidakmampuan para pembantunya yakni para pimpinan SKPD. Aktivis pekerja sosial, Hendra Gunawan Daulay dan Irvan Harahap menuturkan, jika semua mengatakan bahwa Walikota Psp,

„ Baca Walikota ... Hal 7

Jelang Natal dan Tahun Baru

Pengunjung PPasar asar Sangkumpal Bonang Normal SIDIMPUAN-Pengunjung pasar di Pasar Sangkumpal Bonang Padangsidimpuan (Psp) sebagai pusat perbelanjaan terbesar di Kota Psp ini masih seperti hari biasa alias normal meskipun perayaan Natal dan Tahun Baru

„ Baca Pengunjung ...Hal 7

Pemko Harus Bangun Perpustakaan Layak SIDIMPUAN-Perpustakaan yang kurang layak dianggap kurang memotivasi masyarakat untuk membaca. Perpustakaan, sebagai wahana transformasi ilmu dianggap kurang memotivasi masyarakat untuk mau membaca. Kondisi perpustakaan dengan fasilitas buku bacaan serta alat peraga lainnya dianggap tidak mendukung minat baca serta program nasional pendidikan. Padahal dalam amanat Undang-Undang (UU) sangat jelas menerangkan, bahwa mengembangkan sistem nasional perpustakaan mendukung upaya sistem nasional pendidikan. Sesuai dengan UU Nomor 43 Tahun 2007 tentang perpustakaan dan Keputusan Presiden (Kepres) Nomor 67 Tahun 2000 tentang perpustakaan bahwa jelas menerangkan pemerintah

„ Baca Pemko ... Hal 7

Masa Kontrak Berakhir

Pembangunan Jembatan Belum Rampung TOBASA- Proyek pembangunan jembatan Aek Simare, Kecamatan Laguboti, Kabupaten Toba Samosir (Tobasa) telah melewati tanggal berakhir masa kontrak yakni 30 November 2012, sesuai yang tertera di papan pengumuman. Tanda-tanda penyelesaian sesuai jadwal yang tertuang dalam kontrak pekerjaan belum ada dan pengerjaannya masih sekitar 73 persen. Informasi yang diperoleh di lapangan, pelaksana proyek PT Mitra Perkasa Sejati, beberapa kali gontaganti sub kontraktor. Pekerjaan proyek yang bersumber dari dana APBN sekitar Rp 5,8 miliar tersebut diperkirakan progres pekerjaan masih sekitar 70 persen. Saat ini, pekerjaan di lokasi jembatan, penyelesaian coran dudukan dan tiang jembatan, penimbunan tanah di sekitaran 30 meter jalan

„ Baca Pembangunan ... Hal 7



Judul Lagu Hai Mari Berhimpun White Christmas Malam Kudus Oh Holy Night Joy To The World Silent Night

Artis Maria Da Silva Michael Buble Viktor Hutabarat Hosana Singers Ruth Nelly & Daud J P Agnes Monica


Telkomsel Hadirkan NSP Rohani di Desember MEDAN- Untuk memenuhi kebutuhan pelanggan, Telkomsel akan menghadirkan NSP Rohani di bulan Desember guna memeriahkan Natal dan Tahun Baru. Selain itu, Telkomsel juga menyajikan berbagai pilihan lagu-lagu rohani yang dapat diunduh pelanggan untuk menggantikan nada sambung standar di handphone. Lagu-lagu tersebut diubah menjadi lantunan lagu-lagu rohani yang dapat dinikmati si penelpon sambil menunggu panggilannya terjawab oleh orang yang dituju. Hal ini merupakan bagian dari konsistensi Telkomsel dalam menyajikan berbagai kebutuhan pelanggan untuk menampilkan hasil karya musisi ternama dalam bentuk Nada Sambung Pribadi, yang dapat dinikmati seluruh pelanggan melalui nada tunggu di handphonenya. Dengan begitu, momen Natal dan Tahun Baru lebih terasa hikmatnya akibat sajian nada tunggu yang menggugah hati. “NSP merupakan salahsatu layanan Telkomsel yang sangat digemari. Biasanya saat Natal dan Tahun Baru pelanggan Telkomsel

„ Baca Telkomsel ... Hal 7

„ Ketua dan Sekretaris PWI Perwakilan Tabagsel, Yusuf Siregar (baju hitam) dan Nimrot Siregar (kemeja abu-abu) memimpin rapat persiapan Seminar Sehari dan Lomba Karya Tulis Ilmiah, Selasa (18/12) kemarin.

Hari Ini, PWI Tabagsel Seminar Sehari Juga Lomba Karya Tulis Ilmiah SIDIMPUAN-Persatuan Wartawan Indonesia (PWI) Cabang Sumut Perwakilan Tapanuli Bagian Selatan (Tabagsel) mengagendakan hari ini Rabu (19/12), menggelar seminar sehari bertajuk ‘Peranan Pers dalam Pembangunan Kota Padangsidimpuan (Psp)’, bertempat di aula SMKN 1 Psp. “Untuk seminar sehari di Ketuai Nimrot Siregar, Sekretaris, Ahmad Cerem Neha dan Bendahara, Laidin Pohan. Seminar yang bekerjasama dengan Pemko Psp ini digelar Rabu (19/12) dengan menghadirkan nara sumber dari kalangan pemerintah, kepolisian serta pers,“ ujar Ketua PWI Tabagsel, M

Yusuf Siregar dalam konferensi persnya, di Sekretariat Perwakilan PWI Tabagsel, di Jalan SM Raja Kota Psp, Selasa (18/12). Ditambahkan Ketua Panitia Seminar Sehari, Nimrot Siregar, seminar rencananya akan dibuka

„ Baca Hari Ini... Hal 7


„ Toha, warga Rantauprapat yang terkapar setelah ditabrak pelaku jambret di Jalan Sirandorung.

Jambret Siswi SMK

2 ABG Dipukili Warga RANTAU-Dua anak bagu gede, Bandri (17) warga Bina Raga dan Riko (17) warga Desa Janji nyaris remuk diamuk massa setelah menjambret tas milik Anggita (16) warga By Pas, Selasa (18/12) di Jalan Marathon. Pelaku berhasil diringkus karena korbannya mengejar, setelah berhasil menjambret tas Anggita siswi SMK N 2 Rantauprapat, pelaku berusaha kabur dan menambrak sepeda motor milik Toha (40) warga Rantauprapat di Jalan Sirandorung, Simpang Gelugur Anggita menjelaskan, dirinya dijambret dua remaja di Jalan Maraton usai pulang les tambahan di sekolah pada pukul 18.00 WIB.

“Setibanya di Jalan Marathon, tas ku di jambret mereka. Langsung aku berteriak jambret sambil mengejar mereka dari belakang. Ku ikuti mereka dari belakang bang, mulai dari Jalan Marathon, sampai ke Jalan Sirandorung Simpang Glugur. Karena mereka mengebut, ditabraknya orang tua sedang naik sepada motor. Lalu mereka jatuh dan saya minta tolong dan warga pun menangkapnya,” kata Anggita sambil menangis. Sementara, Riko salah seorang pelaku mengaku dirinya disuruh oleh seorang pemuda untuk menjambret tas. “ Ada abang-abang menyuruh kami menjambret tas itu. Abang itu mengikuti kami dari

„ Baca 2 ABG ... Hal 7


19 Desember2012


„ Bupati, Hidayat Batubara memberikan pengarahan kepada siswa SMAN Plus Panyabungan.

Pemkab Madina Galakkan Gerakan Menanam 1 Miliar Pohon (FOTO:IST)

„ Salah satu titik longsor di jalur Muara Sipongi-Pakantan yang belum dibersihkan dari badan jalan membuat sulit dilalui kendaraan terutama roda empat keatas.

Jalan Menuju Pakantan TERTIMBUN LONGSOR MADINA-Jalan lintas penghubung Kecamatan Muara Sipongi menuju Kecamatan Pakantan, Kabupaten Mandailing Natal tertimpa longsor, Minggu (16/12) lalu. Akibatnya, jalan tersebut tidak bisa dilalui oleh kendaraan, dan yang bisa melewatinya hanya untuk kendaraa roda dua saja, itupun harus dibantu dorong oleh masyarakat setempat.

Mansyur (35) warga Pakantan kepada METRO, Selasa (18/12) di Panyabungan bercerita, longsor ini terjadi pada hari Minggu (16/12) lalu akibat hujan lebat yang mengguyur di daerah itu. Hujan lebat mulai turun sejak Sabtu dan tak henti-hentinya sampai esok

harinya (Minggu 16/12, red), sehingga jalan penghubung itu tertimpa longsor. Karena, di sepanjang jalan yang mencapai kurang lebih 10 kilometer itu dari Muara Sipongi-Pakantan sebalah ka-

‹‹ Baca Jalan ...Hal 10

suk penghasil oksigen, rekreaMADINA-Pemerintah Kabusi dan konservasi keanekapaten (Pemkab) Mandailing ragaman hayati. Natal (Madina) menggalakkan ”Kita sangat prihatin karena gerakan penanaman satu mipada kenyataannya masih terliar pohon sebagai amanat dari dapat kawasan hutan yang Presiden RI, Susilo Bambang belum kita lakukan upaya reYudhoyono (SBY) melalui pehabilitasi dan reforestasi waringatan Hari Menanam Polaupun tingkat kerusakan huhon Indonesia (HMPI) dan tan atau deforestasi dari tahun Bulan Menanam Nasional ke tahun mengalami penu(BMN) yang berlangsung di runan. Ini tercapai berkat kerlokasi SMAN Plus Panyabungjasama bersama termasuk peran, di Jalan STAIM Kelurahan an pemerintah daerah dalam Dalan Lidang, Kecamatan Paketekunannya melaksanakan nyabungan, Senin (17/12). program rehabilitasi hutan Dalam sambutannya, Bupati dan lahan nasional, penanamHM Hidayat Batubara mean 1 miliar pohon, pembanyampaikan bahwa, hutan ngunan hutan rakyat, hutan berperan sebagai penyangga tanaman rakyat, upaya penekehidupan dan sekaligus megakan hukum serta adanya nyediakan hasil hutan kayu, kebijakan daerah yang menhasil hutan bukan kayu, dan dukung budaya menanam,” kebutuhan pangan, ketersediaan air, sumber energi dan jasa lingkungan lainnya terma- ‹‹ Baca Pemkab ...Hal 10

Gebyar Bulan Muharram Digelar di Kotanopan MADINA-Bupati Mandailing Natal (Madina), HM Hidayat Batubara mengatakan, peran seluruh elemen masya-

‹‹ Baca Gebyar ...Hal 10


„ Bupati, Hidayat Batubara memukul bas drumband tanda dimulainya Gebyar Muharram 1434 H, Selasa (18/12).


19 Desember2012

RS Pendidikan USU Siap Terima Pasien MEDAN-Rumah Sakit Pendidikan Universitas Sumatera Utara siap menerima pasien yang membutuhkan layanan kesehatan, seiring dengan akan diresmikannya rumah sakit tersebut, pada Kamis (20/12). “Menurut rencana, peresmian Rumah Sakit Pendidikan USU akan dilakukan Mendikbud M. Nuh, bertepatan dengan perayaan Dies Natalis ke 60 USU. Sesudah itu, masyarakat yang membutuhkan layanan kesehatan sudah bisa berobat,” kata Kabag Humas Universitas Sumatera Utara (USU) Bisru Hafi di Medan Selasa. Rumah sakit itu diproyeksikan menjadi unggulan dalam tiga layanan medis, yakni ginjal, penyakit tropik dan “Traumatic Centre”. Untuk ketiga bidang ini, rumah sakit telah memiliki sumber daya manusia yang cukup dari Fakultas Kedokteran USU. Pelayanan ketiga penyakit itu ke depan dinilai sangat dibutuhkan oleh masyarakat. Untuk itu, dengan adanya spesifikasi unggulan ini diharapkan mampu melayani masyarakat di Sumut, maupun di luar Sumut

dengan baik. Rumah Sakit Pendidikan USU memiliki fasilitas 28 klinik spesialis/ sub spesialis, rawat inap dengan kapasitas 474 tempat tidur, ditambah instalasi gawat darurat dengan pelayanan 24 jam, 12 kamar bedah, 18 ruang persalinan, 42 bed perawatan intensif, dan 25 unit “bed hemodialise”. Untuk mendukung kelancaran pelayanan medis, berbagai tenaga spesialis dan subspesialis di bawah 18 departemen medik yang ada di USU akan menyelenggarakan fungsi-fungsi pelayanan, pendidikan dan riset. Dia mengatakan, selain menjadi rumah sakit pendidikan, juga diharapkan dapat berperan sebagai rumah sakit pelayanan rujukan utama, dan riset klinik di wilayah Indonesia Barat, khususnya daerah Sumut. “Karena termasuk rumah sakit pemerintah, RS Pendidikan USU akan tetap menyediakan porsi untuk pasien miskin dengan layanan asuransi kesehatan, hal ini sesuai dengan UU Kesehatan tahun 2009, tentang penyedian untuk pasien miskin,” katanya. (ant/int)

Setahun, 35 Tewas Akibat Kecelakaan

165 Luka Berat, 178 Luka Ringan

TARUTUNG- Terhitung sejak Januari hingga Desember 2012, data Polres Taput menunjukkan ada sekitar 35 orang meninggal dunia, 165 luka berat, 178 luka ringan setiap tahunnya akibat kecelakaan di wilayah tersebut. Penyebab kecelakaan tertinggi karena kelalaian individu dan sikap berkendara yang kurang baik. “Seluruh korban terbagi dalam 176 kasus. Total kerugian akibat kasus ini Rp625.950.000,” kata Kapolres Taput AKBP IKG Wijatmika SIK melalui Kasubag Humas Aipda W Baringbing kepada wartawan, Selasa (18/12). Penyebab kecelakaan lebih didominan para pengendara tidak mematuhi rambu-rambu lalu lintas. Seperti, kecepatan kendaraan tinggi, hilang konsentrasi, mengantuk, dan tidak menggunakan pelindung kepala atau helm serta kurangnya kewaspadaan. Januari, terang Baringbing, sebanyak 6 peristiwa laka lantas dengan jumlah korban meninggal dunia 3 orang. Nilai kerugian material Rp70.500.000, Februari 15 kali dengan jumlah korban meninggal

dunia 1 orang dengan nilai kerugian Rp29.050.000. Maret 8 kali, meninggal dunia 1 orang dengan kerugian Rp31.800.000. “Sementara April jumlah laka lantas sebanyak 25 kali, tewas 4 orang. Adapun kerugian material akibat kejadian ini Rp115.000.000,” terangnya. Selanjutnya, Mei 15 kali, 7 tewas, kerugian material Rp71.200.000. Sementara bulan Juni sebanyak 13 kali dengan jumlah korban meninggal dunia 3 orang, kerugian Rp23.200.000. Juli sebanyak 15 kali, meninggal 1 orang, kerugian Rp49.600.000. “Kemudian jumlah laka lantas yang terjadi bulan Agustus sebanyak 19 kejadian dengan jumlah korban meninggal dunia sebanyak 4 orang, kerugian Rp44.500.000. Sedangkan bulan September 13 kali, 2 meninggal dunia,” jelasnya. Sedangkan Oktober 10 kali, 3 meninggal dunia, dan Nopember 12 kali, 2 orang meninggal dunia, serta Desember sebanyak 6 kali, 1 meninggal dunia. Dari jumlah pelanggaran lantas yang terjadi selama tahun 2012 tersebut, katanya, 100 kasus berdamai, 18 kasus P-21, SP- 3 sebanyak 12 kasus dan 8 kasus masih dalam proses. (cr-01)


„ Ketua DPC Hanura Paluta, H Ahmad Faisal Siregar (tengah duduk pakai jas Hanura) diapit para pimpinan parpol pengusung pasangan Gatot-Erry foto bersama usai pertemuan, Selasa (18/12).

Fokus Menangkan Ganteng PALUTA-DPC Partai Hanura Kabupaten Paluta dan partai-partai koalisi pendukung pasangan Gatot Pujo Nugroho-Tengku Erry Nuradi duduk bersama membahas suksesi dan pemenangan pasangan yang dikenal dengan Ganteng pada Pemilihan Gubernur dan Wakil Gubernur Sumatera Utara (Pilgubsu) 7 Maret 2013 mendatang di bumi Balakka, Paluta. Dewan Pimpinan Cabang (DPC) Partai Hati Nurani Rakyat (Hanura) Kabupaten Padang Lawas Utara (Paluta) dan para koalisi partai pendukung Ganteng berkumpul menyatukan kekuatan dan menyamakan persepsi dalam rangka menyatakan kebulatan tekad mensukseskan dan memenang-

kan Ganteng, Selasa (18/12) di ruang pertemuan kantor sekretariat DPC Hanura Paluta, Jalan Lintas Gunung Tua-Psp, Kelurahan Pasar Gunung Tua. Para pimpinan parpol yang hadir dalam kesempatan tersebut diantaranya, Ketua DPC Hanura Paluta, H Ahmad Faisal Siregar SH didampingi Sekretaris Supriandi Harahap dan unsur pengurus DPC Hanura lainnya, Ketua DPD PKS Paluta, H Irwan Assehat Siregar Lc didampingi Sekretaris Riswan Saleh Siregar MSi, Ketua DPD Partai Nasdem, Ismail Hasibuan, Ketua Partai Persatuan Nasional (PPN) Paluta, Abdul Gafur Harahap dan Sekretaris Partai Patriot Paluta, Satria Utama Siregar. “Pertemuan ini adalah langkah awal

dalam rangka suksesi pemenangan Ganteng di wilayah Paluta, sekaligus konsolidasi persiapan dalam rangka menyamakan persepsi untuk memenangkan Ganteng di wilayah Paluta,” ujar Ketua DPC Hanura Paluta, H Ahmad Faisal Siregar SH diamini para pimpinan parpol lainnya. Faisal yang juga merupakan Ketua KNPI Kota Psp ini mengungkapkan, pertemuan dan konsolidasi antara jajaran DPC Hanura dan koalisi partai pendukung Ganteng di wilayah Paluta diharapkan akan fokus bagaimana untuk memenangkan pasangan Ganteng ini di Pilgubsu 2013 nanti. “Hal inilah sehingga Hanura dan jajaran koalisi partai lainnya menyusun

strategi kemenanganya di wilayah Paluta,” ucapnya. Menurutnya, secara garis partai, tidak ada alasan bagi kader dan simpatisan Hanura untuk tidak memenangkan Ganteng di Pilgubsu 7 Maret 2013 nanti. “Bagi kader dan pengurus Hanura Paluta, apabila ada yang tidak mendukung pasangan Gatot, maka akan dievaluasi dan dipecat,” tegasnya. Dalam pertemuan tersebut, seluruh pimpinan parpol koalisi pendukung menancapkan tekad untuk memenangkan pasangan Ganteng. Saat itu, satu persatu ketua parpol memberikan pernyataan terkait komitmen teguh mereka mendukung pasangan Gatot-Erry. (phn)

Pick Up Jatuh ke Jurang LINTONG NI HUTA- Mobil pick up jenis L300 dengan nomor polisi BK 8453 CP, terjun ke jurang lokasi perladangan warga di Desa Silaban Margu, Kecamatan Lintongnihuta, Kabupaten Humbang Hasundutan, Selasa (8/12) sekitar pukul 08.00 WIB. Kejadian, tepat di tikungan Silaban antara km 7 dan 8 Jalan Dolok SanggulSiborongborong. Mobil yang dikemudikan Iwan Lubis (36), terjun ke lokasi perladangan dengan kedalaman dari atas jalan sekitar 6 meter. Tidak ada korban jiwa dalam insiden itu, namun mobil di dalam jurang terlihat ringsek. Iwan sendiri dan seorang rekannya, Jonrizal diketahui hanya mengalami luka memar dan lecet di lengannya. Amatan METRO, di lokasi kejadian, mobil pick up tersebut menimpa kandang ternak babi milik warga setempat bermarga Silaban. Kepada METRO, Silaban (50) menyampaikan, bahwa dua ekor babi miliknya yang sebelumnya ada di dalam

kandang tersebut lepas. “Dua ekor babi yang baru saya beli sebulan lalu lepas karena tertimpa mobil yang jatuh itu. Sampai sekarang saya belum ketemu ternak babi itu, gak tau lari kemana,” ujar Silaban. Sementara itu, Jonrizal, teman Iwan saat berada di dalam mobil mengatakan, mereka datang dari arah Siborongborong menuju Sidikalang. ”Mobil tak ada muatan. Kami mau ke Sidikalang menjemput buah durian. Tadi mobilnya kencang sebelum terjatuh. Pas baru melewati tikungan itu, mungkin teman saya kehilangan kontrol. Sehingga terbalik ke jurang,” ujarnya. Kasat Lantas Polres Humbang Hasundutan AKP P Ternalem melalui Aipda J Simajuntak, saat berada di lokasi membenarkan. Ia mengatakan, kejadian tersebut telah mereka tangani. ”Kita sudah tangani, tapi kita evakuasi dulu mobilnya dari jurang,” singkat Simanjuntak. (juan/shl)


MASUK JURANG: Mobil pick up jenis L300 yang masuk jurang di Desa Silaban Margu, Selasa (18/12).

Jalan Menuju Pakantan Tertimbun Longsor Sambungan Halaman 9 nan dan kiri badan jalan adalah perbukitan. Kata Mansyur, jalan lintas ini sudah beberapa kali tertimpa longsor dan kali ini saja longsor tidak hanya pada satu titik saja, tetapi ada beberapa titik di sepanjang jalan. ”Tahun ini saja sudah terjadi beberapa kali longsor, karena memang jalan ini berada di antara dua bukit dan gunung. Dan sejak terjadi longsor Minggu (16/12) (FOTO:RIDWAN LUBIS)

„ Bupati, Hidayat Batubara menanam pohon di lingkungan SMAN Plus Panyabungan.

Pemkab Madina Galakkan Gerakan Menanam 1 Miliar Pohon Sambungan Halaman 9 kata Hidayat. Disampaikan Hidayat, gerakan penanaman satu miliar pohon merupakan gerakan nasional dan upaya nyata seluruh komponen bangsa untuk menanam sedikitnya 1 miliar pohon setiap tahun. Tujuannya, untuk merehabilitasi hutan dan lahan yang terdegrasi atau kritis, guna mengembalikan fungsi hutan dan lahan. Selain itu tujuannya adalah, konservasi keaneka ragaman hayati baik flora dan fauna termasuk ketahanan pangan. ”Sesuai Keputusan Presiden RI bernomor 24 tahun 2008

ditetapkannya tanggal 28 November sebagai HMPI dan bulan Desember sebagai bulan menanam. Momentum ini diharpakan mampu menggalang dan membangkitkan semangat, motivasi dan budaya masyarakat Indonesia untuk menanam dan memelihara pohon lebih giat dan lebih banyak demi kepentingan generasi penerus bangsa di masa yang akan datang,” ucapnya. Kegiatan tersebut dihadiri Kapolres Madina, Dandim 0212/TS, anggota dewan, Kepala Dishubtun dan sejumlah pimpinan SKPD di lingkungan Pemkab Madina, serta diikuti ratusan siswa SMAN Plus Panyabungan. (wan)

kemarin, masyarakat di Kecamatan Pakantan sudah sulit menuju Muara Sipongi. Apalagi anak-anak di sini (Pakantan) banyak yang sekolah di sana (Muara Sipongi). Akhirnya, banyak anak-anak sekolah yang tidak bisa berangkat sekolah karena tidak ada angkutan. Adapun yang mau mengantar, seragam dan peralatan sekolah mereka terkena lumpur,” ucapnya. Begitu juga dengan masyarakat yang setiap hari bekerja di wilayah

Kecamatan Muara Sipongi juga terganggu arus transportasi. ”Warga Pakantan kan banyak yang bekerja di Muara Sipongi, misalnya jualan dan bekerja bangunan. Karena kondisi jalan saat ini terpaksalah mereka dalam beberapa hari ini tidak bisa bekerja. Belum lagi bagi pekerja kebun dan sebagainya. Sebab jalan ini adalah satu-satunya jalur menuju Muara Sipongi dan kecamatan lainnya di jalur tersebut,” tambahnya. Harapan masyarakat, pemerintah

agar bisa menurukan alat berat untuk membersihkan material longsor berupa tanah lumpur dengan kedalaman hampir 20-30 cetimeter, agar bisa dilalui oleh kendaraan roda dua dan roda empat. Karena, transportasi masyarakat sebagian besar di Kecamatan Pakantan adalah angkutan umum. ”Hingga Selasa (18/12) tidak ada lagi angkutan ke sana, sepedamotor saja susah untuk melewatinya,” pungkasnya. (wan)

Gebyar Bulan Muharram Digelar di Kotanopan Sambungan Halaman 9 rakat terutama tokoh agama, adat sangat penting dan sangat dibutuhkan dalam membina generasi muda yang normatif, beretika, kreatif dan mewujudkan pemuda yang memiliki nilai-nilai moral. Karena, dengan pemuda seperti itu akan terwujud akselerasi proses pembangunan di dalam suatu daerah. Disampaikan Bupati, Pemkab Madina sangat mendukung kegiatan yang memiliki nilai positif, apalagi bernilai agamais seperti ini. Sebab, kegiatan ini telah memberikan kontribusi dalam membantu Pemkab Madina mewujudkan masyarakat yang religius, yang merupakan salah satu visi-misi Pemkab Madina. Melalui kegiatan ini diharapkan akan mampu menambah nilai-nilai aqidah dan kecintaan mendalami budaya agama, memberikan pengenalan

agama mulai sejak dini sangat diperlukan melalui kegiatankegiatan seperti ini. ”Melalui kegiatan ini, selain menambah silaturrahmi di antara peserta, juga anak akan mampu mengamalkan nilai-nilai agama dalam kehidupan sehari-hari. Pengamalan nilai-nilai agama ini diharapkan menjadi benteng untuk mengatasi masalah-masalah kehidupan yang serba komplek khususnya persoalan moral dan etika yang disebabkan kurangnya pemahaman dan pengamalan ajaran agama itu,“ ujar Bupati pada pembukaan Gebyar Muharram 1434 H yang berlangsung di Lapangan Volli Desa Sawahan, Kecamatan Kotanopan, Selasa (18/12). Saat ini sebut Hidayat, partisifasi dan peran aktif masyarakat beserta tokoh agama dan tokoh masyarakat lainnya sangat dibutuhkan dalam membina generasi muda, dalam

mewujudkan generasi yang beriman dan berakhlakul karimah. ”Karena pemerintah tidak akan bisa bekerja sendiri tanpa dukungan dari seluruh unsur masyarakat. Semoga kegiatan ini dapat memotivasi generasi muda kita untuk meningkatkan ketrampilan dan kemampuan dalam bidang keagamaan,” harapnya. Ketua Panitia Pelaksana, Lokot Husda Lubis SAg menyebutkan, acara kegiatan Gebyar Muharram 1434 ini akan berlangsung selama tiga hari mulai tanggal 18–20 Desember. Pesertanya terdiri dari siswa Madrasah Diniyah Awaliyah (MDA) dan siswa dari tingkat SMP se-Kotanopan. Sedangkan jenis perlombaannya berupa Musabaah Tilawatil Qur’an (MTQ), lomba pidato, cerdas cermat tentang agama Islam, shalat jenazah dan lomba adzan dan beberapa bentuk lomba lainnya.

”Kami atas nama panitia berterima kasih banyak terhadap semua sponsor dan donatur yang telah membantu terlaksananya kegiatan ini. Tujuan kegiatan ini hanyalah untuk menanamkan nilainilai budaya beragama terhadap anak-anak sekolah sebagai generasi muda kita. Semoga kegiatan ini menambah keimanan dan rasa kecintaan terhadap budaya dan ajaran agama kita,” kata Lokot. Acara ini juga dimeriahkan dengan penampilan marching band dan drum band dari sekolahsekolah mulau dari tingkat SD, SMP, SMA se-Kecamatan Kotanopan beserta pawai akbar, yang dibuka langsung Bupati Madina ditandai dengan pemukulan bas drumband. Turut hadir sejumlah pimpinan SKPD, perwakilan DPRD Madina, tokoh masyarakat, Muspika Kotanopan, ulama dan para pelajar se-Kecamatan Kotanopan. (wan)


Perilaku Orangtua yang Membuat Anak Stres ANAK-anak juga bisa stress karena perlakuan orang tua. Berikut ini beberapa prilaku orang tua yang dapat membuat anak stress, seperti yang dijelaskan oleh Psikolog dari FAME, Yuvita Fandy, M.Psi: 1. Orang tua lebih banyak melarang daripada memberitahu apa yang dapat dilakukan oleh sang anak. misalnya melarang bermain diluar rumah sehingga anak merasa seperti di penjara dan tidak memiliki teman.

KEBANYAKAN pasangan menghabiskan waktunya untuk pekerjaan. Pergi pagi dan selalu pulang malam. Kalau sudah begini, kapan waktu untuk berdua? Masalahnya, kegiatan yang menyita waktu dapat menyebabkan ketidakharmonisan dalam sebuah hubungan. Jika Anda tak mau mimpi buruk ini terjadi, berikut ini beberapa saran yang bisa dicoba pasangan sibuk agar tetap bisa bercinta. Kencan makan siang. Kebanyakan orang mengalami puncak energi di siang hari. Manfaatkan kondisi ini dengan menjadwalkan kencan makan siang dengan pasangan. Tak perlu ke restauran, cukup menikmati makan siang romantis di rumah saja. Seks di siang hari memang jarang bagi pasangan sibuk, tentu saja momen ini akan terasa lebih liar dan nakan dari biasanya. Anda dan pasangan akan memiliki privasi yang lebih karena anak-anak sedang berada di sekolah. Manfaatkan di pagi hari.

Menurut penelitian, wanita dan pria memiliki ritme sirkadian yang berbeda. Wanita cenderung tidur lebih cepat, sementara pria sebaliknya. Akibatnya, Anda dan pasangan susah menentukan waktu bercinta di malam hari. Manfaatkan waktu di pagi hari sebagai solusinya. Atur alarm sekitar 30 menit lebih awal dari biasanya. Ciptakan rutinitas pagi yang santai namun tetap sensual, seperti mandi bersama atau saling memeluk mesra di tempat tidur sebelum anak-anak bangun. Quickie sex. Keterbatasan waktu bukan halangan untuk mendapatkan kenikmatan bercinta. Kenapa tak coba quickie sex? Karena tak mungkin Anda atau pasangan harus membendung hasrat bercinta. Jadi, carilah tempat yang aman agar tak dilihat orang. Bercinta di dalam lift apartement, di bioskop atau di dalam mobil malah memberikan sensasi untuk beraksi semakin liar. (int)

2. Menerapkan peraturan yang kaku tanpa memberikan penjelasan terhadap anak. Dalam hal ini mungkin orangtua ingin belajar disiplin, namun anak akan merasa sangat diatur dan tidak bisa mengembangkan diri. 4. Menuntut anak untuk memiliki prestasi yang lebih baik. Dalam kasus ini orangtua seharusnya memberikan pujian terlebih dahulu kepada anak, tanyakan pada anak begaimana usahanya

mendaptkan nilai tersebut. Lalu kemudian ortu dapat menambahkan semangat kepada anaknya untuk lebih meningkatkan prestasinya. 5. Orang tua membandingkan anak dengan Kakak, adik, saudara atau temannya. Anak memiliki keuunikannya masing-masing Kelebihan dan kekurangannya juga berbedda-beda. Jadi jangan pernah membandingkan anak lain karena mereka memiliki kelebihan tersendiri. .(int)

Sudah Tepatkan Ukuran BRA Anda ? Banyak perempuan belum sadar bahwa ukuran Bra yang tepat sesuai dengan ukuran payudara sangat penting. Karena tidak hanya berkaitan dengan fashion tapi juga kesehatan. Sorella sebagai salah satu produsesn pakaian dalam wanita sangat peduli dengan kebutuhan perempuan. Tidak sekedar membuat Bra yang cantik tapi juga sesuai dengan ukuran dan bentuk payudara perempuan. Untuk itu, Sorella meluncurkan "Sorella Contour Series" sebagai bentuk kepedulian terhadap wanita yang perduli akan kecantikan tubuhnya dan memperhatikan kesehatannya. "Sorella Contour Series" adalah, koleksi bra Sorella dengan bentuk push up yang berbeda di kelasnya. Diperuntukkan bagi wanita yang ingin lebih menonjolkan keindahan payudara tanpa merubah bentuk payudara secara permanen. Lucia Niken, Marketing Manager

Sorella mengatakan semua produk Sorella merupakan hasil dari inovbasi dan penelitian selama bertahun-tahun akan kebutuhan perempuan untuk menjaga kesehatan dan mendukung keindangan tubuhnya. "Di penghujung tahun ini, kami meluncurkan produk Sorella Contour series dengan koleksi lebih lengkap," ujar Niken saat Relaunch Sorella Contour Series di Jakarta, Sabtu (15/12). Niken menjelaskan, koleksi Sorella Contour Series terdiri dari Body Contour dan Beauty Contour. Body Contour diperuntukkan pada wanita fashionista, trendsetter yang perduli terhadap pergerakan fashion dan tampil glamour. (int)

5 Alasan Wanita Dilarang Cukur Rambut PERTUMBUHAN rambut di bagian tubuh tertentu menjadi tanda kedewasaan. Bagi wanita, tumbuhnya rambut di area tubuh ada hal yang mengganggu, percaya diri pun turun drastis. Banyak wanita yang melakukan waxing untuk membuat tubuh menjadi mulus. Namun, rasa sakit yang ditimbulkan membuat wanita mengambil cara instan, yaitu mencukur. Mencukur rambut dengan alat cukur memang terlihat praktis dan efisien. Tapi kalau membahas hasil akhirnya, mungkin Anda harus mempertimbangkannya dua kali. Masalahnya, pemakaian alat tajam pada tubuh tak hanya membuat kulit mudah terluka, tapi juga membuat rambut tumbuh dengan lebat. Berikut ini adalah beberapa efek samping dari mencukur rambut, seperti yang dilansir Rambut menjadi tebal Mencukur rambut sama dengan membuat pertumbuhan rambut menjadi tebal. Seperti halnya anak bayi yang dicukur rambutnya. Tujuannya adalah agar pertumbuhan rambut bayi menjadi tebal. Ternyata, hal ini tak hanya

terjadi pada bayi tapi juga pada orang dewasa. Rambut cepat tumbuh Mengapa jenggot pria tumbuh kembali dalam satu atau dua hari? Hal ini karena j a n g g u t dicukur secara teratur. Jika Anda kebiasaan mencukur rambut tubuh Anda, maka akan lebih cepat tumbuh kembali. Nantinya, Anda harus mulai mencukur secara rutin untuk tampil mulus. Kulit kasar Jika sering mencukur rambut di area ketiak dan kaki akan membuat kulit tampak kasar. Mencukur mengurangi kelembapan kulit, tidak seperti waxing. Rambut tajam Rambut yang dihilangkan dengan cara dicukur, digunting atau waxing, memiliki kualitas rambut yang berbeda. Dengan mencukur rambut, pertumbuhan rambut akan cenderung lebih kasar dan tajam. Baik di area intim, ketiak atau kaki. Masa pertumbuhan Mencukur merupakan metode yang menghilangkan rambut tumbuh pada kulit, bukan dari akar. Inilah yang membuat kulit tumbuh bisul kecil-kecil di area permukaan kulit yang dicukur.(int)


19 Desember 2012

SETELAH putus hubungan dengan Daniel Mananta, Marissa Nasution tak berlama-lama merasakan kesendirian. Wanita berdarah Batak itu tak butuh waktu lama untuk menemukan pacar baru. Melalui sahabatnya, Mike Lewis ia dipertemukan dengan seorang pengusaha bernama Conrad. Senyum tak pernah lepas dari wajah wanita berzodiak Aquarius itu selama ngobrol tentang pria yang kemudian menggantikan Daniel di hatinya itu. Marissa bercerita, dirinya menemukan kenyamanan dari pria keturunan Australia-Fillipina yang

usianya berselisih 3 tahun dengannya itu. ”Karena lebih berpengalaman mungkin, jadi aku nyaman sama dia sampai sekarang,” ujar Marissa. Bahkan, meski hubungannya dengan sang kekasih baru berjalan kurang lebih delapan bulan, wanita yang hobi berenang itu sudah mantap untuk melanjutkan ikatan mereka ke tahap yang lebih serius. Marissa memang sudah tak sabar untuk bisa memiliki keluarga. Selain fokus di kariernya sebagai presenter dan berbisnis di usaha sepatu, bintang film ‘Get Married 2’ itu juga ingin sukses membina rumah tangganya kelak. ”Enam tahun aku berkarier di sini,

BACHARUDDIN Jusuf Habibie menyatakan puas dengan film MD Pictures itu. Dia mengatakan, setiap scene benar-benar mewakili kisah hidupnya. Dia menilai, Reza Rahardian dan Bunga Citra Lestari (BCL) bisa menjadi cermin Habibie dan Ainun kala muda. Tanpa ragu Habibie mengangkat dua jempol untuk Reza dan BCL. Menurut Habibie, Reza memerankan sosoknya tanpa cela. Malah, cucu Habibie yang baru berusia enam tahun mengatakan bahwa tingkah laku Reza di film tersebut sangat mirip dengan kakeknya. ”Yang menilai bukan saya, tapi cucu. Dia (Reza) berhasil melakukan mission impossible menjadi possible. Saya puas,” ucap Habibie. Lantas, bagian mana yang menjadi favorit? Habibie menyebut semua. Dengan gestur tangan seperti mengusap air mata, dia menuturkan bahwa setiap scene mengingatkan pada Ainun. Banyak kenangan yang dilihatnya kembali. ”Itu membawa sisi

HOROSKOP HARI INI CAPRICORN (21 Desember -19 Januari) Pekerjaan: Anda harus menyiapkan diri untuk menghadapi hari-hari penting. Persiapkan semuanya. Asmara: Bagi kamu sekarang, urusan asmara nomor dua.


(20 Januari - 18 Februari)

Pekerjaan: Tidak ada masalah berat. Jadi santai saja. Asmara: Sikap Anda agak membingungkan. Coba koreksi diri.


19 Februari - 20 Maret

Pekerjaan: Biarkan seseorang membantu Anda, sebelum tekanan jadi lebih besar Asmara: Kadang dia terlalu banyak menuntut, tapi itu hanya agar Anda memberi perhatian saja.


(21 Maret - 20 April)

Pekerjaan: Kesempatan bagus itu jangan Anda diamkan saja. Asmara: Tindakan juga perlu. Daripada hanya janji saja.


aku mau lebih realistis. Ke depannya aku ingin fokus sama keluarga,” urai Marissa. Segala hal yang ia inginkan dari seorang pria ia temukan pada diri kekasihnya saat ini. Meski terkadang sang pacar diakuinya amat posesif, namun ia tak merasa keberatan. Tak seperti mantan-mantannya sebelumnya, wanita yang hobi mengenakan high heels ini justru merasa menemukan sosok yang bisa diperlakukan layaknya saudara dan sahabat. ”Ketimbang aku, Conrad yang jauh lebih posesif. Tapi nggak apa-apa, aku nyaman-nyaman aja. Itu tandanya dia perhatian sama aku selama ini,” paparnya. (dtc/int)

emosional tersendiri bagi saya,” ujar Habibie. Bagi Reza dan BCL, pembuatan film itu membuat mereka lebih akrab dengan Habibie. Dua bintang tersebut kini malah menyapa Habibie dengan sebutan eyang. Maklum, pembuatan film itu diikuti Habibie secara langsung. Reza bahkan mewawancarai langsung Habibie untuk mendalami peran. Bagi Reza, proses wawancara itulah yang membuatnya bisa memerankan Habibie dengan baik. Sebenarnya, dia sempat pesimistis. ”Prosesnya hanya dua minggu. Untung, ada wawancara langsung dengan Eyang (Habibie) selama dua hari berturut-turut,” paparnya. Begitu juga BCL. Menurut dia, tidak mudah memerankan sosok Ainun. (jpnn/ int)

(21 April - 20 Mei)

Pekerjaan: Maksud Anda ingin membantu dengan memberi nasihat, tetapi sepertinya ada salah pengertian Asmara: Biarkan dahulu supaya dia lebih bisa mengenal kamu.


(21 Mei - 20 Juni)

Pekerjaan: Tetap teliti dalam berkerja Asmara: Biarkan dahulu supaya dia lebih bisa mengenal kamu.


(21 Juni- 20 Juli)

Pekerjaan: Bicarakan persoalan yang ada, jangan cuma dipendam saja. Asmara: Jangan hanya menunggu telepon dari dia, cobalah untuk menelepon lebih dahulu.


(21 Juli-21 Agustus)

Pekerjaan: Jangan berharap terlalu banyak pada sesuatu yang belum pasti, kemungkinan gagal selalu ada Asmara: Permasalahan itu terletak pada diri Anda sendiri.


(23 September - 22 Oktober)

Pekerjaan: Tim kerja Anda bisa diandalkan. Hitung-hitung ikut mengurangi beban Asmara: Urusan kemesraan agak berkurang.


(23 Agustus-22 September)


Seseorang akan mengomentari Anda dengan nada yang tidak enak. Anda harus tegas menghadapinya. Asmara: Meskipun cinta Anda buta harus realistislah.


(23 Oktober – 22 November)

Pekerjaan: Setelah semua terjadi, baru muncul kesimpulan positif. Hadapilah dengan lebih santai bikin suasana jadi nyaman Asmara: Dengan sikapmu itu, Anda sering merusak suasana.


( 23 November - 20 Desember)

Pekerjaan: Pola kerja Anda kembali seperti semula. Asmara: Jangan Anda sampai terobsesi. Biasa saja.


elena Gomez siap mengabaikan Justin Bieber, karena ia mau kencan dengan Niall Horan ‘One Direction’. Mengutip femalefirst, menurut Hollywoodlife, Selena ingin berkencan dengan Niall Horan karena statusnya yang masih lajang. ”Selena ingin mulai berkencan dengan pria lain untuk melihat apakah ada sesuatu yang lebih baik di luar sana soal pria, setelah tak bersama Bieber,” kata sumber.

”Bukankah sesuatu yang mengherankan saat Selena memiliki kencan dengan kekasihnya, bersama dengan Taylor Swift dan Harry Styles,” imbuh sumber. Sebagaiman diberitakan sebelumnya, Justin dan Selena putus akhir pekan ini. Selena juga murka saat mengetahui Justin bergaul dengan mantan pacarnya, Nick Jonas. (dtc/int)

PENAMPILAN Miley Cyrus menarik perhatian di perhelatan VH1 Divas di Shrine Auditorioum, Los Angeles, AS. Miley muncul diantara sederetan diva musik berkumpul untuk merayakan musik bintang pop Whitney Houston dan ratu disko Donna Summer. Beberapa di antaranya yang hadir adalah diva-diva muda seperti Miley Cyrus, Jordin Sparks, dan Demi Levato. Layaknya seorang diva, para bintang muda itu tampil dalam balutan busana-busana nan memukau. Masingmasing menampilkan sisi keglamoran seorang diva sesuai karakternya. Yang cukup menyita perhatian dari penampilan Miley Cyrus adalah dii saat bintang lainnya memilih gaya “ladylike”, bintang “Hannah Montana” itu malah menghadirkan sisi seorang diva dengan tampil agak “gahar”. Dengan gaya rambut cepak mohawk-nya, pelantun “Can’t Be Tammed” itu membaluti tubuhnya dengan mini dress ketat hitam lengan panjang beraksen cut-out rancangan Norma Kamali. (tr/int)


19 Desember 2012

Dijual, Bungker Mewah untuk Persiapan Kiamat MONTEBELLO - Ron Hubbard sadar betul dengan ramalan kiamat. Dirinya membangun tempat penampungan atau bunker di bawah tanah yang sangat mewah untuk mempersiapkan diri menghadapi kiamat. Banyak kabar yang memperkirakan dunia akan berakhir pada Jumat 21 Desember mendatang seperti yang di prediksikan kalender Maya. Kalender suku Maya yang dimulai 5.125 tahun lalu di 3113 sebelum masehi (SM) akan

berakhir pada 21 Desember 2012. Kabar itu memicu kekhawatiran diantara sekelompok orang akan bencana besar yang akan terjadi. Hubbard, akhirnya membuat bisnis membangun bunker di bawah tanah yang dilengkapi

dengan fasilitas seperti sofa kulit, TV plasma, tempat tidur, dapur, toilet disiram dan bahkan perapian. Bunker yang bentuknya mirip dengan bom ini berada di Montebello, California, dan dijual dengan harga 46.000 pound sterling atau sekira Rp719 juta. Hubbard, mengatakan bahwa ia sedang membuat bunker di dua tempat yaitu di New York dan satu lagi di Indiana. ”Saya akan menghabiskan tiga hari di

bungker agar aman. Jika Anda memiliki bungker, Anda mungkin juga pergi bersembunyi didalamnya,” ujar Hubbard, Selasa (18/12). Bungker buatan Hubbard ini berbentuk silinder yang berukuran 500 kaki persegi dengan diameter 10 kaki dan panjang 15,24 meter. ”Saya mulai membuat tempat ini, karena saya juga ingin memiliki satu untuk diriku sendiri,” ungkap Hubbard.

”Banyak orang yang membeli bungker ini sebagai bentuk asuransi untuk kemungkinan terburuk. Sama seperti seseorang yang akan membeli asuransi rumah karena takut kalau terjadi kebakaran dirumah mereka,” tambahnya. ”Kami telah menjual bungker ini sejak satu bulan yang lalu setelah Presiden Obama terpilih ulang,” jelas pria asal Montebello, California itu. (oz/nik)

Kakek Jepang Jadi Orang Tertua di Dunia TOKYO - Usai perempuan tertua di dunia Dina Manfredini meninggal dunia, seorang kakek berusia 115 tahun pun langsung dinobatkan sebagai orang tertua di dunia. Pria itu berasal dari Jepang. Jiroemon Kimura menyandang gelar yang dulu disandang oleh Manfredini. Kimura adalah seorang mantan pegutas pos dengan 14 cucu, 25 cicit dan 13 canggah, Selasa (18/12). Kimura tinggal bersama keluarga putranya sendiri. Meski demikian, keluarga besar Kimura menolak untuk berkomentar lebih lanjut mengenai

„ Jiroemon Kimura

titelnya yang baru saja didapatkan usai Manfredini meninggal. Walikota Kyotanggo Yasushi Nakayama langsung mengkonfirmasi Kimura sebagai seorang tertua di dunia. Nakayama cukup bangga dengan prestasi yang didapatkan Kimura.Kimura lahir pada 19 April 1897 silam, Kimura jauh lebih muda ketimbang Manfredini yang baru saja meninggal usai dinobatkan sebagai perempuan tertua di dudia, dua tahun yang lalu. Manfredini mendapatkan gelar manusia tertua di dunia usai merebut gelar itu dari Bessie Cooper.(oz/nik)

Perempuan Tertua di Dunia Tutup Usia Kerja Hanya 6 Hari Selama 9 Tahun, Tetap Digaji BOLOGNA-Sepandai-pandainya menyembunyikan kecurangan, akhirnya akan terbongkar juga. Inilah yang dialami Silvia S (46) tahun warga Bologna, Italia, dihukum dua tahun penjara karena hanya bekerja enam hari selama 9 tahun di RSU Dia dianggap melakukan kecurangan dengan memanfaatkan dana yang berasal dari publik. Selain itu, dia juga

telah memberikan informasi palsu mengenai dirinya. Dia mengaku sakit sehingga tidak masuk bekerja. Selain sakit, dia juga mengaku hamil dan melahirkan. Tidak hanya satu kali, tetapi juga dua kali. Padahal, dia sama sekali tidak sakit atau hamil dan melahirkan. Selama kurun waktu tersebut, gaji yang berasal dari pembayaran pajak terus diterimanya. (oz/nik)


P A K E T P R O M O NOVEMBER 2 0 1 2 PT. TRANS SUMATERA AGUNG. Dealer Resmi Mobil Suzuki.

TYPE CASH BACK Carry Pick Up 5 Jt APV Pick Up New APV Mini Bus 12 Jt Splash 12,8 Jt Swift 10 Jt Ertiga New SX4 Cross Over 10 Jt Estilo 1.0 15,3 Jt Grang Vitara 18 Jt Cash & Credit. Data di jemput by credit DP kecil bunga rendah angsuran ringan. Hubungi: D AV I D S I N A G A - 0 8 1 2 6 0 6 1 8 8 3 4

DES MOINES - Dina Manfredini meninggal dunia di usianya yang ke-115 di Iowa, Amerika Serikat, setelah dua bulan dinobatkan sebagai perempuan tertua di dunia. Gelar perempuan tertua di dunia diraih Manfredini usai Bessie Cooper menghembuskan nafas terakhirnya. Manfredini tinggal di Panti Jompo Bishop Drumm di Johnston. Menurut cucunya, Lori Logli, Manfredini sempat sakit demam sebelum meninggal. Logli menceritakan pula bahwa, neneknya adalah seorang yang sangat handal dalam memasak dan sering membuat roti Italia setiap hari Minggu untuk sarapan keluarganya. Selain roti, Manfredini juga sanggup membuat pasta dengan tangannya sendiri.

SUZUKI BARU 100% •Carry 1.5L Flat Deek Pick Up (bonus Tape CD) DP17,86Jt-an; Angs 2,43Jt-an •Mega Carry APV Pick Up DP 22,26Jt-an; Angs 2,478Jt-an •Ertiga DP 39,62Jt-an; Angs 4,101Jt-an •Carry Real Van GX DP 36,489Jt-an; Angs 3,614Jt-an •APV GL DP 36,79Jt-an; Angs 3,325Jt-an Proses Cepat Data di Jemput HUB:

ARDI-0812 6582 0292

”Dia (Manfredini) sangat aktif dalam hidupnya. Dia juga seorang yang suka memberi,” ujar Logli, Selasa (18/12). ”Dia tidak pernah percaya bahwa dia sudah tua. Ketika kami mengatakan kepadanya tentang usianya, dia hanya menggelengkan kepalanya,” imbuhnya. Pada usianya yang sudah lebih dari satu abad, Logli mendeskripsikan neneknya sebagai seorang yang penampilannya tidak terlihat tua. Pada saat masih berusia 110 tahun, rambut Manfredini masih terlihat kelabu. Perempuan itu lahir pada 4 April 1897 di Italia, sebelum akhirnya pindah ke Des Moines, Iowa, pada 1920. Manfredini memiliki empat anak, tujuh cucu dan lebih dari puluhan cicit.(oz/nik)

DICARI : Agen/Pangkalan LPG 12 kg dan 3 kg untuk Wilayah Tapanuli Selatan, Palas, Paluta, Madina. Melayani pembelian eceran LPG 12 kg dan 3 kg, juga untuk Rumah Makan , Hotel, Akper/Akbid, Pondok Pesanteren. Kami antar ditempat. Hub: (0634) 21673, HP: 0813 7716 3667, 0853 6281 1877 , Jl. WR. Supratman No.17, Kota Padangsidimpuan.

*PAKET AKHIR TAHUN DAIHATSU* XENIA 1,3.., CICILAN 1,2 Jt TERIOS.... CICILAN 2 Jt GRAN MAX PICK UP DP 11 Jt Proses Cepat, Ringan, Mudah & Pasti. Info & pemesanan : RAHDY: 081361329496 - 082362009080

T O Y O TA 2012

Promo Akhir Tahun Banjir Hadiah • All New Avanza • Veloz • Rush • Grand new Innova • Fortuner VNT. Hub: Freddy Simatupang 0853 6207 2000, 0813 6165 1801


Aktifitasi Pintu Ilmu Ilahiah Aktifitasi kecerdasan, lathaif qalbu, (+) thingking, kreatifitas, intuisi, high focus, DNA crystal. Inf: 500rb. Hub: 0813 9679 3688 (Aris). MEDAN: RM. Wong Solo; TAPSEL: Hotel Istana 6.

„ Dina Manfredini

CENTRAL PROPER TY R .P R A P AT; HP: PROPERTY R. PA 0853 5875 3027; 0852 6155 8562. DP 15Jutaan

Type 45/98 Angsuran 50rb/hari. Investasi Hunian Exclusive Super strategis, hanya 5 menit dari Pasar Glugur/ Terminal. Spek: Kramik, Cat luar dalam, Gypsum, Rangka Baja, Atap Metal Sakura, Sumur gali, Kloset, Listrik, IMB, SHM, Jalan. AYO MILIKI PERUMAHAN GRIYA SEJAHTERA


-Ertiga DP. 25Jt-an Ang. 5Jt-an -APV Arena DP. 19Jt-an Ang. 3Jt-an -Carry PickUp DP. 18Jt-an Ang. 2Jt-an -Mega Carry DP. 19Jt-an Ang. 3Jt-an -Swift ST DP. 36Jt-an Ang. 4Jt-an -Splash DP. 46Jt-an Ang. 3,6Jt-an Syarat Ringan&Proses Cepat. Hub: PT. Trans Sumatera Agung, Jl. SM. Raja KM. 7,3 Medan HP: 0812 6037 9028



19 Desember 2012

ASEAN University Games XVI

Indonesia merebut dua medali emas di nomor estafet 4x200 meter gaya bebas putra putri ASEAN University Games, Senin (17/12) sore. Di bagian putera, regu Indonesia merebut medali emas dengan catatan waktu 7 menit 43.81 detik. tim Indonesia terdiri dari perenang Putra M. Randa, Triady Fauzi, Alexis Wijaya Ohmar dan Glenn Victor Susanto. Mereka mengungguli Thailand yang merebut medali perak dengan 8 menit 04.88 detik dan Malaysia yang meraih perunggu dengan 08.19.65 dalam lomba yang berlang-

sung di Aquatic Centre, National Sports Complex, Vientiane. Emas juga diraih tim estafet 4x200 meter puteri yang terdiri dari Enny Susilawati, Kathriana Mella, Ressa Kania Dewi dan Patricia Yosita yang mencatat waktu 8 menit 40.01 detik. Tim Malaysia berada di tempat kedua dengan 8 menit 45.90 detik dan Thailand meraih perunggu dengan 9 menit 03.456 detik. Dalam ASEAN University Games XVI yang berlangsung 12-20 Desember ini, kontingen Indonesia masih berada di urutan lima dengan 17 emas, 30 perak dan 42 perunggu. (int)

Daud Yordan

Ditantang Petinju Filipina

Taufik Hidayat

UNGGULAN UTAMA TAUFIK HIDAYAT dan Saina Nehwal menjadi unggulan pertama turnamen bulu tangkis Syed Modi International India GP Gold. Turnamen berhadiah total 120.000 dolar AS ini akan berlangsung Selasa (18/12) hingga Minggu (23/12). Di bagian putera, Taufik diikuti pemain India, Kashyap Parupalli yang merupakan perempatfinalis Olimpiade London, JuliAgustus lalu. Dua pemain Indonesia lainnya,

Tommy Sugiarto dan Alamsyah Yunus diunggulkan di tempat ketiga dan kelima. Parupalli yang baru pulih dari cedera mengaku sangat antusias mengikuti turnamen ini. “Saya ingin melihat kondisi saya setelah pulih dari cedera. Ini merupakan turnamen yang sangat penting buat para pemain India. Saya sendiri berharap ini menjadi persiapan baik sebelum Malaysia Tebuka, awal Januari.” (int)

PETINJU Filipina, Jun “Hercules” Doliguez melempar tantangan kepada juara dunia kelas bulu IBO asal Indonesia, Daud “cino” Yordan untuk suatu perebutan gelar. Doliguez dianggap sebagai petinju prospek bagus di Filipina. Petinju dengan rekor bertarung 15-0-1 (11 KO) ini memang memiliki pukulan yang keras dan dianggap sepadan menghadapi Yordan yang memiliki rekor bertarung 30-2 dengan 23 KO. Sabtu pekan lalu, Doliguez mengempaskan lawannya, Eric Rapada di ronde keenam dalam pertarungan di Angoncillo, Batangas, Filipina. “Di mana saja, kapan saja, ayo Cino, bawa gelarmu dan aku akan menyakitimu,” kata Doliguez. Promotor Yordan, Dragon Fire memang sempat menyebar poll kepada para penggemar tinju Filipina tentang siapa petinju negara tersebut yang sepadan menantang Yordan. Doliguez dipilih oleh 64 persen responden. Nama-nama lain yang disebut antara lain Rey “Boom Boom” Bautista, Marvin Sonsona dan Lorenzo Villanueva. “Saya tekankan, saya siap menghadapi dia. Jika para promotor sepakat, ia akan merasakan kerasnya pukulan saya,” kata Doliguez. Daud Yordan baru saja mempertahankan gelar juara dunia kelas bulu IBO dengan mengalahkan petinju Inggris, Choijiljavyn “Choi” Tseveenpurev di Marina Bay Sands, Singapura. Jika terjadi kesepkatan, maka ini merupakan kali kedua, Yordan mempertahankan gelarnya yang direbut saat mengempaskan petinju Filipina Lorenzo Villanueva di ronde kedua, Mei lalu. (int)

Michael Schumacher

Tak Ingin Dibandingkan Kesuksesan Michael Schumacher sebagai pebalap Formula 1 tidak diragukan. Pebalap muda Jerman, Sebastian Vettel lantas disebutsebut sebagai titisan peraih tujuh kali gelar juara dunia F1 tersebut. Schumacher meraih gelar juara dunia pertama pada musim 1994 saat memperkuat Tim Benetton. Pria yang juga asal Jerman ini sukses mempertahankan gelarnya di musim 1995. Lalu, setahun kemudian, dia hijrah ke Ferrari. Bersama Tim Kuda Jingkrak, julukan Ferrari, Schumacher mencatatkan sejarah dengan merebut gelar juara dunia selama lima musim berturut-turut, 2000 hingga 2004. Torehan tersebut belum tertandingi oleh pembalap lain. Sementara itu, Vettel baru saja menuai kesuksesan dengan meraih gelar juara dunia musim 2012. Pembalap milik Red Bull Racing ini sekaligus mempertahankan gelar yang direngkuh dua musim sebelumnya, 2010 dan 2011. Nama Vettel juga tertera dalam sejarah balap jet darat sebagai pembalap termuda yang menorehkan prestasi tersebut. Wajar saja jika pembalap 25 tahun ini disetarakan dengan seniornya yang memutuskan pensiun di akhir

Jorge Lorenzo:

Rossi Hanya MAU MENANG JORGE LORENZO menyambut baik kedatangan Valentino Rossi kembali ke Yamaha. Bahkan, Lorenzo mengatakan ini merupakan kesempatan bagus bagi Rossi untuk memperlihatkan dirinya masih bisa bersaing meraih kemenangan di musim 2013. The Doctor akan kembali ke pabrikan YZRM1 pada musim depan, setelah sebelumnya selama dua tahun bersama Ducati mengalami frustrasi dan kecewa. Pebalap asal Italia itu hanya mampu mencetak tiga kali podium dalam 35 penampilan bersama Ducati. Sebelumnya, Rossi sudah mengatakan alasan untuk kembali ke Yamaha adalah mencoba memahami apakah pebalap 33 tahun itu masih dapat bersaing meraih kemenangan dan menambah rekor kemenangan miliknya, yang mana sejauh ini sudah mencatatkan 79 kali menang. Pebalap Yamaha mengatakan Rossi mengalami kesulitan untuk membuat motor Ducati lebih kompetitif. Tugas itu menurut Lorenzo, lebih berat bagi Rossi ketimbang memilih kembali memperkuat Yamaha musim 2013 mendatang.

“Sayarasatugas yang paling berat dalamkarierRossi adalah berada di Ducatidantidak bisa bersaing. Saya rasa ini sudah sangat melukainya karena Rossi ingin sekali bersaing dan memenangi balapan dengan motor dari Italia,” kata Lorenzo. “Saya rasa Rossi sangat kecewa, tapi saya berpikir sekarang semua bisa membaik dengan situasi baru. Saya rasa Rossi memiliki kesempatan untuk memperlihatkan dia masih mampu meraih kemenangan,” tandas pebalap asal Spanyol, dilaporkan MCN. (int)

musim 2012. Namun, Schumacher menolaknya. “Anda harus menjadi spesial untuk bisa melakukannya. Tapi, kami tidak perlu dibandingkan. Dia (Vettel) melakukannya saat ini, sedangkan saya sudah lebih dulu,” ujar Schumacher seperti dilansir Autosport. Sementara itu, Vettel tidak pernah menyangka dengan apa yang diraihnya.

Pembalap yang kerap dijuluki “Baby Schumi” ini hanya memastikan tidak mudah mencapai prestasi tersebut. “Saya senang dan bangga. Tapi, saya tidak terlalu memikirkan apa yang sudah saya raih. Rasanya sangat spesial dan seperti tak seorang pun bisa merebutnya,” tutur pembalap yang sejak kecil mengidolakan Schumacher ini. (int)

Lea di Leo

Kencani Sejumlah PESEPAK BOLA ITALIA PERNYATAAN menghebohkan dilontarkan bintang porno Italia, Lea di Leo. Dalam otobiografinya yang berjudul ‘Sonia Faccio racconta Lea Di Leo’, dia mengaku telah berkencan dengan sejumlah tokoh terkenal di Italia, dari politisi, bintang panggung hingga pesepakbola ternama. Seperti dilansir giornalettismo, Lea di Leo mengungkapkan pernah berkencan dan menjalin hubungan asmara dengan mantan pejabat Italia Mario Baldassarri, wartawan Amedeo Goria,pemainrugbyDennisDallan,aktor Roberto Farnessi hingga penyanyi Conjure Fabri. Tidak hanya itu, wanita kelahiran Castelfranco Veneto itu juga mengaku menjalin hubungan asmara sesaat dengan sejumlah pesepakbola ternama Serie A. Mulai dari Vincenzo Iaquinta, Simone Inzaghi, Marco Borriello, Valeri Bojinov, Francesco Coco, Luca Toni, Fabio Galante hingga Massimo Ambrosini.

Namun semua nama yang disebutkan membantah mengenal dan pernah menjalin hubungan dengan wanita berambut pirang itu. “Mungkin terlalu buruk bagi mereka (kabar ini mencuat). Saya mengerti karena mungkin mereka semua sudah memiliki istri atau pacar. Tapi saya mengatakan yang sebenarnya,” kata Lea. Lea mengungkapkan sebagian di antaranya menjadi pelanggannya selama bertahun-tahun. Dan dia tanpa sungkan menyatakan para pesepakbola adalah temankencanterbaik.“Ditempattidur,para pemain sepakbola adalah yang terbaik, mungkin karena mereka melakukan latihan fisik sangat baik,” katanya. Namunpengungkapanwanitayangjuga berprofesi sebagai penari ini dianggap merupakan aksi pemerasan. Karena berhembus kabar jika sejumlah tokoh yang masuk dalam buku Lea sempat dimintai uang sebesar •40 ribu jika namanya tidak ingin dicantumkan di buku kontroversial tersebut. (int)


RABU 19 Desember 2012













2 Man City







3 Chelsea







4 Tot Hotspur







K emenangan besar dengan skor 5-2 yang didapat Arsenal atas R eading disebut Arsene W enger sangatlah penting. Hasil tersebut menunjukkan kalau ‘Gudang Peluru ’ bisa memberi reaksi atas kondisi buruk yang baru diterima.



KLUB Swansea City

GOL 12

2 R van Persie

Manchester United


3 D Ba 4 L Suárez

Newcastle United Liverpool

11 10

5 J Defoe

Tottenham Hotspur


6 M Fellaini




16 15





2 Atlético Madrid

16 12





3 Real Madrid

16 10





4 Málaga








KLUB Barcelona

GOL 25

2 R Falcao

Atlético Madrid


3 Cristiano Ronaldo

Real Madrid


4 Aduriz

Athletic Club


5 Rubén Castro

Real Betis


6 Negredo



SERIA A ITALIA KLASEMEN SEMENTARA 1 Juventus 17 13 2 Internazionale 17 11 3 Napoli 17 10 4 Lazio 17 10

2 1 3 3

2 5 4 4

36-10 29-18 31-17 25-18

41 34 33 33


KLUB Milan

GOL 14

2 E Cavani



3 A Di Natale



4 M Klose



5 E Lamela



6 D Milito



3 3 6 3

1 4 3 5

44-7 33-22 35-20 33-27


KLUB Bayer Leverkusen

GOL 12

2 A Meier

Eintracht Frankfurt


3 V Ibiševiæ



4 R Lewandowski

Borussia Dortmund


5 M Mand•ukiæ

Bayern München


6 T Müller

Bayern München


ketinggalan menjadi 4-1. Kebangkitan tuan rumah seketika menyeruak setelah di menit 69 Reading berhasil mencetak gol keduanya. Kali ini Jimmy Kebbe yang menjebol gawang The Gunners.

Tapi kisah dramatis comeback Reading tidak terjadi di laga ini karena di menit 80 justru Arsenal yang berhasil menambah jumlah golnya. Membangun serangan dari tengah, Cazorla yang menusuk menuju kotak penalti

melepaskan umpan pada Walcott. Dengan satu gerakan, pesepakbola Inggris itu menipu bek lawan dan melanjutkan aksinya dengan melepaskan tembakan terarah yang menjadi gol. 5-2 untuk Arsenal. (int)

Persembahan Terakhir Duric

KLASEMEN SEMENTARA 17 13 17 10 17 8 17 9

ngan 3 assist dan 27 tembakan ke gawang, Giroud yang membukukan satu assist dan 47 tembakan, serta Theo Walcott yang memiliki catatan assist sama yaitu 4, tapi cuma 22 kali melakukan sepakan ke gawang. Atas performa Cazorla sejauh 17 laga di Premier League ini, manajer Arsenal, Arsene Wenger pun sudah memiliki penilaian. “Santi Cazorla adalah pemain berkualias top dan dia hanya menggambarkan bahwa dirinya merupakan pembelian yang tepat,” ucap Wenger di situs resmi Arsenal. Pujian kepada Cazorla pun juga terlontar dari mulut rekannya di lini tengah Arsenal, Jack Wilshere. “Kemampuannya sebagai pemain yang serba bisa sungguh luar biasa. Sangat berat bagi siapa saja yang berasal dari Spanyol untuk bermain di Premier League. Tapi, ia membuatnya terlihat sangat mudah,” ungkap Wilshere seperti dilansir oleh AFP. Jalan Pertandingan Pertandingan baru berjalan 13 menit saat Arsenal berhasil membuka keunggulan. Bermula dari tusukan Kieran Gibbs di sisi kanan pertahanan Reading, dia kemudian melepas umpan silang ke kotak penalti. Memanfaatkan buruknya pengawalan pemain Reading, Podolski dengan mudah menceploskan bola ke dalam gawang. Empat menit kemudian Cazorla nyaris membuat ‘Gudang Peluru’ menggandakan keunggulan saat tendangan jarak jauhnya melenceng tipis dari sasaran. Tim tamu akhirnya bisa menggandakan keunggulan di menit 30, dengan skenario yang nyaris serupa seperti gol pertama. Kali ini Podolski yang menyisir di sisi kanan pertahanan Reading, dia kemudian melepaskan umpan crossing ke muka gawang dan dibelokkan menjadi gol oleh Cazorla menggunakan kepalanya. Dua menit berselang Cazorla kembali mencatatkan namanya di papan skor. Menyambar bola yang sempat disundul Gibbs saat mencoba meneruskan umpan dari Podolski, Cazorla membawa Arsenal kini unggul 3-0. Enam menit babak kedua berjalan Cazorla nyaris membuat hat-trick kalau saja Adrian Mariappa tidak menghalau bola tepat di garis gawang Reading. Tapi trigol Cazorla kemudian tinggal menunggu waktu saka karena di menit 59 satu sontekan pesepakbola asal Spanyol itu membuat kedudukan berubah menjadi 4-0. Tertinggal empat gol sama sekali tak membuat Reading menyerah. Bermula dari kesalahan umpan di sektor pertahanan, Adam le Fondre dengan tenang melewai Szczesny saat dalam posisi satu lawan satu untuk kemudian menceploskan bola ke dalam gawang. Di menit 65 Reading memperkecil



1 München 2 Leverkusen 3 Dortmund 4 Frankfurt

iwarnai hat-trick Santi Cazorla, plus dua gol lainnya dari Lukas Podolski dan Theo Walcott, Arsenal memetik kemenangan mutlak dengan skor 5-2 dalam lawatan ke Reading. Kemenangan tersebut mengantar The Gunners naik ke posisi lima klasemen dengan poin 27.Terlepas dari langkah naik Arsenal ke papan atas, hal lain yang membuat Wenger sangat puas dengan raihan anak didiknya adalah terkait reaksi yang diberikan setelah mereka dapat hasil buruk pekan lalu. Melalui adu penalti, Arsenal disingkirkan Bradford City di babak perempatfinal Piala Liga Inggris. “Targetnya adalah meraih kemenangan dengan meyakinkan. Kami fokus dengan pertandingannya. Saat kedudukan 4-0 kami menjalani periode ‘melayang’. Dan dalam posisi 42, setelah apa yang terjadi pekan lalu, kami mulai tak pasti. Kami sedikit kehilangan fokus dan harus membayarnya. Tapi secara keseluruhan penting buat kami untuk bermain dan memberikan jawaban di atas lapangan,” sahut Wenger di Skysports. “Selama 16 tahun cuma sekali kamu kalah dari tim yang berasal dari divisi lebih rendah. Jika Anda membandingkan rekor tersebut dengan klub lain di Inggris, itu masih jadi yang terbaik.” “Saya setuju kalau (kekalahan) itu menyakitkan, dan sangat mengecewakan. Tapi malam itu Bradford tampil sangat baik. Saya bertanggung jawab saat kondisinya berjalan baik dan saya menerima kritik saat kondisinya menjadi buruk,” tuntas Wenger. Cazorla Terbaik di Arsenal Santi Cazorla layak dinilai menjadi pemain yang memiliki rapor bagus saat membela Arsenal. Catatan statistik membuktikan pemain seharga 16,5 juta poundsterling itu merupakan yang terbaik. Cazorla tampil apik saat tim ‘Gudang Peluru’ menundukkan Reading dengan skor telak 5-2. Pemain yang baru didatangkan dari Malaga di awal musim 2012-2013 itu mengemas hat-trick dalam laga yang berlangsung di Madejski Stadium, Selasa (18/12) dinihari. Dengan tiga gol yang dia bikin itu, Cazorla pun menjadi top skorer sementara The Gunners dengan koleksi tujuh gol. Dengan torehan itu, dia bahkan lebih produktif dibandingkan dengan Lukas Podolski dan Theo Walcott (5 gol), serta Olivier Giroud (4 gol). Lebih detil lagi Soccernet mencatat bahwa Cazorla menjadi pemain yang paling sering melakukan tembakan ke gawang, yaitu 59 kali. Pesepakbola 29 tahun itu juga menyumbangkan empat assist bagi tim yang bermarkas di Emirates Stadium itu. Catatan Cazorla itu merupakan yang tertinggi di antara pemain Arsenal lainnya. Torehan pemain asal Spanyol itu berturut diikuti oleh Podolski de-

42 33 30 30

Aleksandar Duric sudah tidak muda lagi, sudah 42 tahun. Turnamen Piala AFF kali ini pun akan menjadi yang terakhir untuknya. Oleh karenanya, wajar jika ia ingin mengakhirinya dengan sebuah trofi. Seorang pemain yang ingin mengakhiri kariernya dengan sebuah pencapaian adalah romantisme yang lazim dalam sepakbola (atau olahraga manapun). Namun demikian, tak semuanya berujung kesuksesan. Zinedine Zidane pernah punya harapan yang sama pada Piala Dunia 2006 dan kita semua tahu seperti apa ujungnya. Di sisi lain, Duric, yang sudah mengatakan ini akan menjadi Piala AFF terakhirnya, tentu tidak berharap akan berakhir seperti Zidane. Karier Duric di tim nasional tergolong tidak lazim, jika Anda menilainya demikian. Pada usia 37 tahun, ketika banyak pemain sepakbola biasanya sudah pensiun, dia baru memperkuat timnas Singapura. Debutnya melawan Tajikistan diwarnai oleh sepasang gol dan sejak saat itu dia seperti menjadi jimat

untuk The Lions, meski tidak selalu bermain. Di Piala AFF tahun ini pun juga demikian. Duric kerap memulai pertandingan dari bangku cadangan dan baru satu gol dia sumbang. Tapi, toh demikian, dia mengaku siap untuk berkontribusi untuk tim apa pun bentuknya. “Saya memang tidak mencetak gol, tapi yang terpenting berkontribusi untuk tim,” ucapnya seusai laga semifinal kedua melawan Filipina. Laga itu sendiri berakhir dengan kemenangan 1-0, di mana Khairul Amri mencetak satu-satunya gol. Singapura pun berhasil melaju ke final dan kini hanya tinggal satu langkah lagi bagi Duric untuk mencapai impiannya. “Mencapai babak final tahun ini seperti sebuah mimpi yang jadi kenyataan,” ucapnya di situs resmi Piala AFF. “Saya sudah bermain di turnamen ini pada 2008 dan 2010, jadi ini merupakan turnamen ketiga saya dan saya senang bisa bermain di final karena ini adalah kesempatan terakhir saya. Saya akan pensiun setelah

turnamen ini, saya sangat ingin mencapai final dan kami berhasil melakukannya.” “Pada saat bersamaan, kami sudah membuktikan penilaian banyak orang salah dengan melaju sampai ke final. Tak banyak orang percaya kami bisa lolos dari fase grup. Tapi, seiring berjalannya pertandingan, kami berkembang sebagai sebuah tim dan menunjukkan bahwa kami benar-benar tim yang bagus.” Duric menjadi warga negara Singapura pada 2007 dan sejak saat itu sudah memainkan laga internasional sebanyak 51 kali. Dari puluhan kesempatan itu, ia sukses mencetak 24 gol. Dengan usia yang sudah kepala empat, ia hanya bisa bersyukur atas pencapaian yang sudah didapatnya sejauh ini. “Sejujurnya, saya tidak pernah menyangka bisa bermain di final bersama tim nasional. Saya harus bersyukur karena dengan usia seperti saya, mendapatkan 50 caps untuk tim nasional adalah pencapaian yang luar biasa,” kata pria yang pernah memperkuat BosniaHerzegovina di Olimpiade 1992 di cabang dayung ini. (int)