Page 1

Rabu, 2 Mei 2012

Edisi 22 „ Tahun X

Bosan Minum Obat Tidur Gadis Cantik Minum Racun SIANTAR– Diduga bosan terus-terusan mengonsumsi obat, Retno br Sianipar (19) gadis cantik warga Kelurahan Kerasahan 1, Kecamatan Pematang Bandar, Simalungun, nekat menenggak racun rumput. Akibatnya, korban lemas tak berdaya dan kini mendapat perawatan di RS Tiara Siantar.


Ditemui di ruangan pasien rumah sakit yang beralamat di Jalan Manambin Siantar tersebut, Retno br Sianipar terlihat terkejut. Dia hanya mendengar dan melihat awak koran ini berbincang dengan ibunya br Pangaribuan, Selasa (1/5) Menurut ibu Retno, peristiwa tersebut diketahui pada hari Minggu (29/4)

Parkir Dikutip Tanpa Karcis SETORAN PARKIR SUTOMO MENGUAP SIANTAR- Jutaan rupiah penhhasilan parkir diduga menguap atau tidak masuk ke kas daerah. Sebab, hampir seluruh lahan objek parkir tidak dikutip berdasarkan karcis sebagaimana di atur Perda. Di Jalan

„) Baca Bosan ...Hal 2

Tengkorak Kepala Halomoan Retak


„ Halomoan Silalahi, korban pemukulan satpam menanyakan ronsennya.

„) Baca Parkir ..Hal 2


SIANTAR- Halomoan Silalahi (19) warga Jalan Sondi Raya, Keluaraha Siopat Suhu Siantar Timur yang menjadi korban pemukulan oknum satpam, Julistar Ambarita (23), mengalami retak di bagian tengkoran kepalanya. Hal itu diketahui Halomoan Silalahi setelah, memeriksakan bagian kepalanya ke RS Djasamen Saragih Kota Sianta, Senin (30/4) kemarin. Hal itu setelah dilihat hasil ronsen di rumah sakit milik Pemko Siantar tersebut. Keretakan di tengkorak belakang bagian belakang akibat pukulan dan tendangan yang dilakukan, Julistar Ambarita, Minggu (29/04) lalu di lapangan Pariwisata, Mapolsek Siantar Timur, halaman belakang Mapolresta Siantar,

SIANTAR- Kawasan Megaland dikutip uang parkir sejak 1 Mei 2012. Kebijakan ini memicu protes keras dari para pemilik dan penyewa ruko di kawasan bisnis terbesar di Kota Siantar ini. Selama ini biaya keamanan dan kebersihan telah diberikan Rp300 ribu per bulan. Masing-masing kantor juga memiliki petu„) Baca Megaland ...Hal 2

„) Baca Tengkorak ...Hal 2

Buruh Datangi Walikota & DPRD Siantar

Tuntut 1 Mei Libur Nasional SIANTAR- Ratusan buruh yang tergabung dalam Serikat Buruh Sejahtera Indonesia (SBSI) Kota Siantar dan Kabupaten Simalungun melakukan aksi unjuk rasa ke kantor Walikota Siantar, DPRD dan Dinas Tenaga Kerja, Selasa (1/5) pukul 10.30 WIB. Mereka menuntut hari buruh sedunia 1 Mei dijadikan hari libur nasional. Anggota afiliasi SBSI Kota Siantar dan Simalungun berkumpul di kantor SBSI Jalan Ahmad Yani sekira pukul 10.00 WIB. Dengan mengendarai

Mbah Surip Lokal untuk Garuda (2/Habis) TENTU saya mengharapkan keajaiban. Saya tahu bahwa ‘tokoh membawa berita’ adalah salah satu doktrin jurnalistik. Karena tiga tokoh telah menyatakan minat membeli 10 persen saham Garuda yang ada di tiga sekuritas itu, berita di sekitar saham Garuda menjadi hangat. Tiba-tiba saja harga saham Garuda di lantai bursa seperti digoreng: melonjak menjadi Rp650-an dan terus terbang

„) Baca Tuntut 1 Mei ...Hal 2

Cucu Jadi Budak Seks Kakek

Dapat Pelecehan Seks Sejak SMP

KERASAAN- Melati (nama samaran) cucu yang dijadikan budak seks oleh kakeknya sendiri, Jaitan Nainggolan (55) menurut warga sekitar, kerap mendapat pelecehan seksual oleh oppungnya sejak SMP. Ironisnya, kelakuan pelaku berlanjut ketika korban bekerja di pabrik minuman hingga melahirkan seorang anak. Namun hingga kini pelaku masih bebas berkeliaran. Menurut L Nenggolan, oppung Melati, warga Tebing Tinggi yang merupakan abang pelaku „) Baca Dapat ...Hal 7


MAY DAY: Ratusan buruh berpawai dengan mengendarai sepedamotor untuk memperingari hari buruh sedunia, Selasa (1/5). Massa gelar aksi di kantor Walikota menutut agar pemerintah menghapus sistem out sourcing.

Jatuh dari Lantai II Kuli Bangunan Kritis


„ Arifin korban yang terjatuh dari bangunan di kompleks ruko Sitorus Permai, Selasa (1/5).

SIANTAR– Arifin (28) warga Karang Sari, Siantar Martoba salah seorang pekerja bangunan ritis setelah jatuh dari lantai dua ketika sedang bekerja di pengerjaan pembangunan perumahan Griya Sitorus Jalan MH Sitorus, Kelurahan Teladan, Siantar Utara, Selasa (1/5) pukul 10.15 WIB. Informasi yang dihimpun, kejadian tersebut bermula ketika korban sedang berada di lantai 2 sedang bekerja untuk membuat motif dan mencor. Namun tiba-tiba korban diduga kurang hati-hati, sehingga ia tidak memperhatikan tempat „) Baca Jatuh ...Hal 2

„) Baca Mbah Surip ...Hal 7

Anda punya keluhan terhadap pelayanan publik di Siantar-Simalungun? kirim SMS ke nomor:

082164546471 Keluarkan Kertas Parkir Dengan Resmi Pak Bapak Walikota Siantar yang terhormat, saya sebagai masayarakat Siantar tidak masalah dipungut uang parkir sebesar Rp2.000 jika itu diperuntukkan demi pembangunan fasilitas kota ini. Untuk antisipasi korupsi bagi oknum di dinas tertentu, dimohon kertas parkir dikeluarkan dengan resmi. Pengirim: 08527012xxxx


2 Mei 2012

Bosan Minum Obat Tidur, Gadis Cantik Minum Racun Sambungan Halaman 1 sekitar pukul 20.00 WIB. Saat itu ibunya baru pulang dari Siantar mengantar adik Retno yang sekolah di Siantar. Tiba di rumah, br Pangaribuan melihat di rumahnya sudah banyak muntahan di lantai. Sementara Retno dia lihat sudah tidak berdaya dan susah berdiri. Saat itu juga Retno dibawa ke Puskesmas Kerasahaan untuk mendapatkan perawatan. Awalnya Retno tidak mau menceritakan kenapa dia muntah-

muntah. Namun setelah dibujuk, esok harinya Retno menceritakan bahwa ia telah meminum racun rumput. Alangkah terkejut orangtuanya mendengar penjelasan putri pertamanya itu. Saat itu juga ia dibawa ke RS Tiara untuk dirawat lebih intensif. Beruntung setelah mendapat penanganan dokter, racun yang sudah ditelannya berhasil dikeluarkan dengan cara memasukkan selang dari hidungnya. Hingga kemudian kondisi Retno mulai membaik dan perutnya tak lagi mulas,

Tuntut 1 Mei Libur Nasional Sambungan Halaman 1 sepedamotor, puluhan anggota SBSI ini bergerak menuju kantor walikota di Jalan Merdeka. Sebagian membawa spanduk bertuliskan ‘Bebaskan Buruh dari Penindasan Pengusaha, SBSI Wadah Aspirasi Buruh, Buruh Bersatu Tidak Bisa Dikalahkan’ dan berbagai poster lain. Beberapa perwakilan buruh berorasi meminta tanggal 1 Mei dijadikan hari libur nasional. Sekitar 15 menit berorasi, Koordinator Aksi, Sahrul membacakan tuntutan dan aspirasi buruh. Ada delapan poin yang menjadi tuntutan para buruh ini. Selain menjadikan 1 Mei sebagai hari libur nasional, para buruh ini juga meminta gaji honorer pemko dan pemkab diperhatikan, gaji para buruh yang bekerja di Siantar dan Simalungun disesuaikan dengan Upah Minimum Regional (UMR) dan Upah Minimum Provinsi (UMP). “SBSI juga meminta pemko melarang pendirian Indomaret yang telah menjamur di berbagai lokasi di Siantar. Pendirian Indomaret akan mematikan usaha-usaha kecil milik masyarakat. Kita minta agar ini dilarang pemko,” jelas Syahrul. Tuntutan diberikan secara tertulis kepada Asisten I Pemko, Jumadi. Dalam kesempatan itu, Jumadi mengatakan akan menyampaikan aspirasi buruh ini kepada Walikota Siantar, Hulman Sitorus. Katanya lagi, hasil atau tanggapan walikota akan diberikan kepada perwakilan buruh yang melakukan aksi ini. Setelah aspirasinya diterima, massa bergerak menuju gedung DPRD Kota Siantar. Di Gedung DPRD, tuntutan dan orasi yang sama kembali disampaikan perwakilan buruh. Ikut memberikan orasi, Syahrul, Tobasan Siregar dan Suryati Simanjuntak. Syahrul menyebutkan, mereka kecewa terhadap sikap Ketua DPRD dan beberapa anggota DPRD lain yang tidak hadir. Pemberitahuan aksi telah dilayangkan SBSI sekitar tiga hari sebelum aksi dilaksanakan. “Kita menuntut 1 Mei agar dijadikan hari libur nasional, ternyata para anggota dewan di Kota Siantar telah meliburkan diri terlebih dahulu. Kepada kawan-kawan, ini menjadi catatan bagi kita, tidak usah lagi kita pilih mereka nanti,” tegas Tobasan Siregar. Setelah berorasi sekitar 30 menit, dua anggota DPRD, Thomas Hardi dan Asbol Sidabalok menemui pengunjuk rasa dan menerima aspirasi pengunjuk rasa. Tidak banyak yang disampaikan kedua anggota DPRD ini. Mereka berjanji akan menyampaikan dan menindaklanjuti aspirasi tertulis yang disampaikan SBSI kepada ketua dan anggota DPRD yang lain. Selanjutnya, pengunjuk rasa bergerak menuju Kantor Dinas Tenaga Kerja di Jalan Dahlia. Di lokasi ini, aksi juga berjalan tertib dan pengunjuk rasa memberikan aspirasi mereka kepada Disnaker. Kepala Dinas Tenaga Kerja, Resman Panjaitan menyambut puluhan buruh ini dan mengadakan dialog dengan beberapa perwakilan SBSI. Resman sempat adu argumentasi dengan Tobasan Siregar disebabkan Resman mengatakan, ada buruh yang nyaman dan tidak protes dengan gaji yang mereka terima, meski gaji yang mereka terima itu sedikit, sehingga buruh seperti ini jangan diganggu lagi. Tobasan Siregar tidak setuju dan mengatakan, undang-undang tentang buruh yang harus dipatuhi oleh siapapun, termasuk pemerintah dan pemilik perusahaan. Perjuangan SBSI menuntut gaji buruh sesuai dengan UMP dan UMR, berarti perjuangan menegakkan undang-undang. “Itu yang harus dilakukan oleh siapapun, kalau seperti itu persepsi kita, untuk apa undang-undang itu dibuat pemerintah,” ujarnya. (ral)

begitu juga rasa pening di kepalanya mulai berkurang. Di samping putrinya berbaring, ibunya Br Pangaribuan mulai bercerita, bahwa Retno dulunya sekolah di salah satu SMEA swasta di Perdagangan. Namun saat kelas III, Retno sering kesurupan dan setelah diobati, akhirnya dia sembuh dan tak lagi pernah kesurupan. Namun sejak itu, ia mengalami perubahan yaitu sulit tidur. Sehingga ia terpaksa dibawa berobat dan oleh dokter ia dianjurkan minum obat untuk meng-

Jatuh dari Lantai II Kuli Bangunan Kritis Sambungan Halaman 1 pijakan kakinya. Akhirnya korban jatuh ke bawah, dan tubuhnya sempat mengenai peranca dinding tersebut. Tembok kanopinya yang ditimpa korban retak dan pecah dan kemudian mengenai lengan kanannya saat berada di bawah. Melihat rekannya sudah sekarat, para pekerja lainnya langsung berusaha memberikan pertolongan dengan membawa korban ke RS Tiara di Jalan Manambin. Kondisi kepala yang sudah luka dan lengan kanan diduga patah, korban terlebih dahulu ditangani di ruang IGD. Namun karena lukanya di kepala cukup parah termasuk juga lengan kanannya diduga patah, korban akhirnya menjalani operasi kecil untuk menutup lukanya berikut juga lengannya. Usai ditangani medis, korban selanjutnya dibawa ke ruang ICU karena kondisi korban masih kritis. Pihak keluarganya yang sudah datang termasuk istri dan anak-anaknya belum melihat korban. Menurut koordinator pekerjaan di sana, Ape (40), mengatakan bahwa korban sudah tiga minggu bekerja dengan upah Rp70 ribu per hari, ia juga tidak menyangka korban bisa terjatuh. Menurutnya korban yang memiliki dua orang anak yang paling besar masih berusia 5 tahun akan tetap dibantu dalam biaya perobatannya. Demikian juga halnya sang developer proyek pembangunan tersebut, Ayen, mengatakan bahwa jatuhnya korban adalah sesuatu peristiwa naas yang tidak dari unsur kesengajaan. Sedangkan untuk biaya pengobatannya pihak pengusaha tetap memberikan bantuan kepada korban. (pra)

atasi kendala sulit tidur yang dialaminya. “Dari dulu,dia selalu makan obat, sehingga ia terkadang suntuk dan sedih karena harus makan obat terus. Sehingga ia sering murung,” ucap Br Pangaribuan seraya memberi makan putrinya. Ibunya menyebutkan, sejak tamat SMA tahun 2010, Retno hanya di rumah karena masih sakit. Dia terpaksa menunda niatnya untuk kuliah ataupun bekerja. Anak pertama dari empat bersaudara itu terkadang duduk terdiam di tempat tidurnya. Namun wajahnya masih terli-

Keluhan maag masih mengganggu aktifitas A n d a ? Saatnya A n d a menyimak pengalaman Risman Heri S yang kini memilih susu kambing untuk mengatasi maag yang dulu mengganggu aktifitasnya, "Untuk mengatasi sakit maag yang mengganggu, sekarang saya pilih minum Milkuma." Terang kakek 4 orang cucu tersebut. Jika dulu ia kerap merasakan tidak nyaman ketika maagnya kambuh, maka sekarang tidak lagi. Manfaat Milkuma telah dirasakan oleh pria berusia 62 tahun ini, "Setelah minum Milkuma selama 1 bulan, sekarang maag jarang kambuh, badan terasa segar, stamina dan vitalitas meningkat. Padahal dulu, saya sering serba salah ketika maag kambuh." Terang warga Desa Saeintis, Kec. Percut, Sei Tuan, Deli Serdang, Sumatera Utara tersebut. Maag atau radang lambung atau tukak lambung adalah gejala penyakit yang menyerang lambung dikarenakan terjadi luka atau peradangan pada lambung yang menyebabkan sakit,

mulas, dan perih pada perut. Penyebabnya bisa karena penderita makannya tidak teratur, terdapat mikroorganisme yang merugikan, mengonsumsi obatobatan tertentu, atau sebab-sebab lainnya seperti mengonsumsi alkohol, pola tidur yang tidak teratur dan stress. Karena kesehatan begitu berharga, Risman tak segan-segan mengajak orang lain untuk mencoba manfaat susu kambing, "Mari kita sehat bersama Milkuma." Ajak pensiunan kepala sekolah tersebut. Sebenarnya, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu kambing. Berbeda dengan susu sapi, sesungguhnya susu kambing memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Kini, hadir Milkuma yang bermanfaat untuk menjaga daya tahan tubuh dan meningkatkan vitalitas. Selain mengandung Riboflavin, vitamin B yang penting untuk produksi energi, susu kambing pun jarang menyebabkan alergi. Satu gelas susu kambing memasok 20,0% dari nilai harian Riboflavin. Fluorine yang terdapat dalam susu

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Pandapotan MT Siallagan Alvin Nasution Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

kambing bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan menetralisir asam lambung. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Ditambah dengan kandungan Gula Aren bermutu tinggi sebagai pemanisnya, menjadikan Milkuma sebagai pilihan bijak untuk kesehatan. Untuk memperoleh hasil yang maksimal, terapkan pola hidup sehat seperti disiplin dalam pola makan, rutin berolahraga dan mengkonsumsi air putih paling sedikit 8 gelas/ hari. Dapatkan informasi lengkap tentang Milkuma di Saat ini, Milkuma sudah tersedia di apotek2 juga toko obat terdekat dikota anda, atau hubungi, Sumut : 085314072195 / 06191128785. Kota Pematang Siantar : 085360106966, Apt Sehat, Apt. Dear farma, Tebing tinggi : Apt. Tangan mas, Apt. Bulian, Apt. Saudara Baru. Depkes dengan no PIRT. 6.09.3328.01.395.

Menurutnya, sejak tamat SMA, puntrinya masih bisa dipantau. Bahkan putrinya itutidaksukakeluarmalamdanbergabung dengan teman-temannya. “Kalau memang ada pacarnya, pasti aku tau. Dia ituhanyasuntukajakarenapenyakitnyatak sembuh-sembuh. Mungkin dia sudah jenuh minum obat terus, sehingga dia berpikirkalauminumracunrumputmaka sakitnya sembuh. Soal dia mau bunuh diri, tidak mungkin itu. Mungkin hanya dia tidak tau racun yang diminumnya itu bisa berbahaya,” tambahnya. (pra)

TENGKORAK KEPALA HALOMOAN RETAK Sambungan Halaman 1 dan Pos Pantoan dekat Ramayana. Namun melihat hasil ronsen dari RS Djasamen, halomoan masih sedikit ragu dan kurang yakin. Akhirnya dia kembali memeriksakan kepalanya di RS Vita Insani Siantar. Benar saja, hasil yang diterimanya berbeda dengan hasil ronsen di RSD Djasamen Saragih. Dari hasil scaning yang diterima dari

RS Vita Insani, Halomoan dinyatakan tidak mengalami retak di bagian kepala. Kedua hasil tersebut membuat Halomoan semakin bingung. Selanjutnya, Senin (1/5) sekira pukul 11.00 WIB, dia kembali ke RSD Djasamen Saragih guna memastikan kondisi yang sebenarnya. Amatan METRO di RSD Djasamen Saragih, saat Halomoan mempertanyakan hasil ronsen tersebut, dr Guntur Paranginangin spesialis

bedah di sana mengatakan, saat ini keadaannya tidak terlalu parah, namun tetap waspada. Dokter menganjurkan, untuk saat ini, Halomoan tidak diperbolehkan melakukan pekerjaan berat. Diharapakan kepada pihak keluarga untuk selalu memantau perkembangna Halomoan. “Jika Halomoan mengalami sakit di bagian kepala, kami minta keluarga segera memeriksakan ke RS terdekat,” ujar dr Guntur. (mag-4)

PARKIR DIKUTIP TANPA KARCIS Sambungan Halaman 1 Sutomo dan Merdeka, hampir seluruh parkir dikutip tanpa karcis. Setoran parkir Jalan Sutomo Kota Siantar misalnya, diduga ‘menguap’ ratusan ribu nahkan jutaan rupiah setiap hari. Delapan titik parkir di Jalan Sutomo menghasilkan Rp1.990.000 per hari. Pengakuan Kepala UPTD Parkir Kota Siantar, AS Sitorus, empat titik parkir ditaksir sekitar Rp1.010.000 saja. Ironisnya, parkir Jalan Sutomo juga dipungut tanpa karcis parkir. Penelusuran METRO, Selasa (1/5) siang, terdapat delapan titik pembagian parkir di Jalan Sutomo. Titik parkir itu, antara lain Jalan Pattimura- Taksi Paradep Rp200 ribu, Taksi Paradep- Jalan HOS Cokroaminoto Rp100 ribu, Jalan HOS Cokroaminoto-RSUD Djasamen Saragih Rp100 ribu. Selanjutnya, depan RSUD Djasamen Saragih Rp120 ribu, antara jembatan penyeberangan Pasar Horas-Jalan Wahidin Rp200 ribu, Jalan Wahidin-Jalan Bandung Rp100 ribu, Jalan Bandung-Jalan Surabaya Rp270 ribu, Jalan Surabaya-Jalan Diponegoro menghasilkan Rp900 ribu. Simpang Jalan Pattimura hingga Paradep Taksi terdapat tiga petugas parkir. Di lokasi ini muat sekitar 25 kenderaan roda empat. Pengakuan petugas parkir bermarga Siahaan, mereka harus menyetor Rp100 ribu setiap hari kepada Ginting di Jalan Mual Nauli. “Sama Pak Ginting kami setor Rp100 ribu setiap hari. Kadang dapat, kadang enggak. Kalau enggak dapat Rp100 ribu, nomboki lah kami, pinjam sama koperasi. Susah dapat parkir Rp100 ribu sekarang Bang, uangnya kami kumpul dari kami berdua,” jelasnya. Dia mengatakan, untuk kawasan Taksi Paradep, bukan wilayah mereka lagi. Menurut Siahaan, khusus Taksi Paradep

ditangani satu orang petugas parkir. Setoran yang harus diberikan setiap hari juga Rp100 ribu dari sekitar lokasi ini. Selanjutnya, antara Taksi Paradep ke Jalan HOS Cokroaminoto, muat sekitar 30 mobil. Setoran parkir dari lokasi ini Rp100 ribu dan dikendalikan satu petugas parkir. Petugas parkir di lokasi ini menghindar saat diwawancarai METRO. Kemudian, Jalan HOS Cokroaminoto hingga RSUD Djasamen Saragih, terdapat dua petugas parkir. Didepan RSUD Djasamen Saragih, setoran parkir Rp120 ribu per hari. Di lokasi ini muat sekitar 40 unit mobil. Setoran diserahkan kepada petugas Dishub yang juga bermarga Tambunan. Mulai Jembatan Penyeberangan hingga Jalan Wahidin, muat lebih 50 mobil, di lokasi ini terdapat tiga petugas parkir. Jumlah setoran yang harus mereka bayarkan setiap hari sebanyak Rp200 ribu. Setoran dibayarkan kepada petugas Dishub bermarga Hutapea. “Kami ada dua orang untuk lokasi dari bawah jembatan ke tiang itu, setoran Rp100 ribu setiap hari. Kami setor sama petugas Dishub bermarga Hutapea. Kalau yang sebelah sana, Pak Girsang yang jaga, dia nyetor Rp100 ribu juga setiap hari,” jelasnya. Sementara Jalan Wahidin hingga Jalan Bandung muat sekitar 30 unit mobil. Petugas parkir satu orang dan jumlah setoran parkir setiap hari tidak mau dijelaskan petugas parkir yang ada di sana. Diperkirakan dari lokasi ini juga wajib setor Rp100 ribu per hari. Lain lagi Jalan Bandung hingga Jalan Surabaya, di sana terdapat dua petugas parkir. Satu lokasi dikelola boru Pandiangan dan satu lokasi dikelola Siahaan. Setiap hari, br Pandiangan harus menyetor Rp135 ribu kepada petugas dari Dishub bermarga Hutapea. Begitu juga Siahaan harus

menyetor Rp135 ribu kepada petugas Dishub tersebut. “Sama Hutapea kami kasih uang itu. Kalau saya Rp135 ribu, begitu juga Siahaan. Kalau gaji kami dari sisa yang kami dapat. Kadang satu hari tidak ada gaji kami, capeknya aja yang kami dapat. Kadang terpaksa minjam sama koperasi kalau setoran kurang. Sudah dua tahun ini sejak Hulman jadi walikota, honor kami dari pemko tidak ada lagi,” katanya. Sekitaran Jalan Surabaya hingga Jalan Diponegoro, termasuk toko Roti Ganda merupakan ‘lahan basah’ setoran parkir terbesar. Pengakuan petugas parkir M Tanjung, ada enam petugas parkir yang bertugas di lokasi ini. Setoran mereka satu hari Rp900 ribu dari kenderaan roda empat saja. Lain lagi dari kenderaan roda dua. “Kalau tidak cukup ya, terpaksa kami minjam ke koperasi untuk menomboki. Gaji kami dari sisa yang kami dapat, kadang satu hari kami tak bergaji,” jelasnya. Empat Lokasi Parkir Kepala UPTD Parkir Kota Sianta, AS Sitorus ditemui di ruangannya, Senin (1/5) menyebutkan, berdasarkan data yang dia ingat, Jalan Sutomo dihitung empat titik lokasi parkir. Rata-rata setoran dari lokasi ini Rp60 ribu hingga Rp70 ribu setiap hari. “Kalau dari Jalan Sutomo ada empat lokasi, sama dengan Jalan Merdeka. Kalau Jalan Sutomo itu setoran terbesar dari depan toko roti Ganda, mulai Surabaya hingga Diponegoro. Setoran dari sana Rp800 ribu setiap hari,” jelasnya. Disinggung info berkembang selama ini, pengelolaan parkir di Kota Siantar, sebagian dikuasai organisiasi kepemudaan atau organisiasi kemasyarakatan, Sitorus pun membela diri dan membantah info itu. (ral)



hat pucat. “Orangnya memang agak sulit ngomong, apalagi dilihatnya masih baru. Inilah dia sudah minta pulang karena bosan katanya. Tapi kan dia masih lemas dan belum tentu dokter mengizinkan pulang,” ujar ibunda Retno. Masih kata br Pangaribuan, Retno biasanya membantunya di rumah untuk berjualan. Disinggung kemungkinan Retno nekat minum racun karena bertengkar dengan pacarnya, Br Pangaribuan langsung membantah dan mengatakan, putrinya belum punya pacar.

gas keamanan sendiri. Selasa (1/5) pagi, suasana di Megaland berubah dari hari biasa. Dua petugas parkir dengan identitas Megaland terlihat beraktivitas memungut dan meminta uang parkir kepada pemilik kenderaan. Dari tangan mereka terlihat karcis parkir yang juga dikeluarkan Megaland. “Kami disuruh memungut parkir di sini, kalau tak disuruh mana berani, Bang. Kami setoran sama Coki Pardede, dia Humas di Megaland ini,” jelas petugas parkir, Mangatas Sihombing. Tanda pengenal sebagai petugas parkir memang mereka miliki, namun bukan dikeluarkan Dinas Perhubungan atau Dinas Pendapatan Kota Siantar. Tanda pengenal ini dikeluarkan manajemen Megaland. Kepada pemilik kendaraan roda dua dikenakan parkir Rp1.000 dan kenderaan roda empat Rp2.000. “Kami ada empat orang yang ditugaskan memungut parkir di kawasan Megaland, dua lagi kawan saya di sebelah sana. Hari ini kami mulai bekerja,” tambah Ramot Sipayung. Menyikapi ini, para pelaku ekonomi di kawasan Megaland melakukan protes. Dua pengelola warnet, Poltak Net dan Matahari Net, menyatakan tidak setuju atas pengutipan yang dilakukan terhadap konsumennya. “Kalau parkir dikutip, tentu akan berpengaruh terhadap omzet kami. Pelanggan warnet yang datang kemari biasanya mahasiswa dan anak muda, kalau sempat uang parkir dikutip Rp1.000 sama mereka,

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta) Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Alvin Nasution, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: Syafruddin Yusuf, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus),Aristo Linghten Panjaitan (Tobasa), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina)

tentu mereka akan mikir datang ke warnet. Kadang sekali main saja mereka hanya Rp2.000, bayar parkir sudah Rp1.000 mana mungkin ada yang mau datang,” ungkap pemilik Poltak Net, br Sinaga. Dikatakan, selama ini, para penyewa toko juga telah membayar maintanance fee Rp300 ribu setiap bulan untuk biaya keamanan dan kebersihan. Untuk tanggung jawab keamanan kenderaan juga diserahkan sepenuhnya kepada penyewa atau pemilik toko di Megaland. Selain pemilik warnet, Asli Yamaha Motor juga menyatakan protes. Menurut pemilik Asli Yamaha Motor, Dinansah, kawasan Megaland merupakan kawasan bisnis terbesar di Kota Siantar dan di kawasan ini beragam kegiatan ekonomi dijalankan. “Ini kawasan bisnis, setiap hari konsumen berdatangan mengurus keperluannya. Masing-masing kantor beda konsumennya. Kalau itu yang mau dikutip, konsumen mungkin akan mengeluh,” tegasnya. Menurutnya, jika alasan keamanan kendaraan, setiap penyewa toko di Megaland, semisal bank, lembaga keuangan dan lainnya telah memiliki Satpam masing-masing. Satpaminilahyangmenjagasetiapkenderaan roda dua dan empat yang datang dan berkunjung ke Megaland. “Undangan dari Megaland dan Dispenda untuk membicarakan ini pertama kali juga tidak ada sama kita. Hanya sebagian kecil saja yang diundang. Harusnya dari awal, hal ini harus kita bicarakan. Disosialisasikan dan dimusyawarahkan dulu baik-baik,” ujarnya. Surat pemberitahuan pengutipan parkir diberikan kepada penyewa dan pemilik Megaland sejak 25 April lalu. Surat itu

METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Eva Wahyuni, Hermanto Sipayung, Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

ditandatangani Humas Megaland Choki Pardede dengan tembusan kepada Walikota Siantar, Dinas Perhubungan, Pimpinan Megaland dan Kakan Satpol PP Kota Siantar. Kepala UPTD Parkir Kota Siantar AS Sitorus ditemui, Senin (30/4) menyebutkan, sesuai Perda Nomor 5 Tahun 2011 tentang Pengelolaan Parkir, daerah yang termasuk parkir yang ditangani Dishub yaitu parkir di pinggir jalan umum yang memakai bahu jalan. “Kalau parkir di depan bank, Ramayana, Megaland dan kawasan bisnis lain, bukan kita yang menangani. Kalau yang seperti itu, pimpinan perusahaan atau bank itu yang langsung berhubungan dengan Dispenda,” jelasnya. Sementara Humas Megaland Choki Pardede ketika dihubungi kemarin menyebutkan, pengutipan parkir yang dilaksanakan di MegalandberdasarkanPerdaNomor6Tahun 2011 tentang pajak daerah, khususnya pajak parkir dan wajib parkir. “Badan atau orang yang menyediakan lahan parkir dikenakan pajak parkir. Namun sesuai Perda ini, pemilik dan karyawan tidak dipungut, hanya konsumen saja yang dipungut,” jelasnya. Menurutnya, sosialisasi tentang rencana ini juga telah dilakukan kepada 20 pengusaha di kawasan Megaland beberapa bulan lalu, termasuk juga kepada BCA, Asli Yamaha Motor, Adira dan lainnya. Dia menjelaskan, pihaknya hanya menjalankan Perda yang telah disepakati Pemko dan DPRD Siantar. Jika ada yang keberatan dan tidak bisa dijalankan, mereka siap saja tidak menjalankan itu dengan syarat hal itu dikomunikasikan lagi dengan Pemko dan DPRD. (ral)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



2 Mei 2012

Tangkap Pariaman Silaen Pak Kapolres Siantar dan Kejaksaan Negeri Siantar, tangkap Pariaman Silaen kepala BKD Siantar yang melakukan peyiksaan pegawai honorer di Pemko Siantar dengan melakukan berbagai pengutipan liar. 087807187xxx

„ Lahan Parkir di Jalan Merdeka

Lahan Parkir Rawan Korupsi Pak Walikota Siantar, lahan parkir di Siantar rawan korupsi, karena juru parkir tidak memberikan karcis kepada pengendara saat memiinta uang restribusi parkir. Demi peningkatan PAD untuk pembangunan kota ini, tolong Pak supaya diawasi ketat. 085270126xxx

Tangkap Bandar Togel di Jalan DI Panjaitan

SIANTAR-Jalan Jhon Horailam, Kelurahan Pamatang Raya, Kecamatan Raya tepatnya menuju kantor Bupati Simalungun longsor.

Perketat Pengawasan Pembangunan di Simalungun Kejadian di Jalan Jhon Horailam harus menjadi pelajaran bagi Pemkab Simalungun, bangunan yang baru siap dikerjakan sudah longsor. Bupati harus memperketat pengawasan pembangunan di Simalungun supaya hasilnya sesuai perencanaan. (Mag-02) Anggela Sinaga, warga

Kondisi jalan yang baru 1 tahun diperbaiki itu pun saat ini tidak bisa dilalui pengendara bermotor. Longsor mengikis setengah badan jalan sepanjang 50 meter. Di simpang masuk kantor Bupati Simalungun tepatnya di Gapura dipalang bambu dan dipasang permoden berlambang dilarang masuk. (Osi)


LONGSOR: Jalan Jhon Horailam, Kelurahan Pamatang Raya, Kecamatan Raya yang nyaris putus karena dihantam longsor:

Pak Kapolres Siantar terhormat, kenapa bandar Togel tidak pernah ditangkap termasuk bandar Togel di Jalan DI Panjaitan. Selama ini Polres Siantar hanya menangkapi penulisnya saja. 082169872xxx

Telepon Penting PMI (Palang Merah Indonesia) 118, 0622-433911 Alamat Jl Sutomo No. 248, Pematangsiantar Kantor Imigrasi Alamat: Jl. Raya Medan Km. 11,5 Pematang Siantar Telepon : (0622)465018, 465014 Samsat Dipendasu Jln Sangnawaluh No 37A 0622 7552345.

RS dr Djasamen Saragih Jln Sutomo No 230. 0622 (23824) Hotel Sapadia Jl.Diponegoro No.21 A P.Siantar Telp:0622-435922 Nice Trans Siantar-Medan Medan. (061) 4558844 Siantar (0622)7000200 085275144777

Harus Segera Diperbaiki Jalan longsor tersebut harus segera diperbaiki. Kalau dibiarkan seperti itu saja, kondisinya akan semakin parah. Selain itu, perbaikan pun jangan asal jadi karena dipakai untuk kepentingan umum. (Mua) Fransisko Karyawan swasta

Proyek Asal Jadi . ITULAH dam pak pro yek asal jadi h suda an rjak Masih 2-3 tahun siap dike gerlangsung rusak. Rekanan yang men kah jakan proyek itu harus diperiksa apa ispes dan ek best gan sudah sesuai den i) (Os si. fika Ramson Sinaga LSM

BPBD Harus Bertindak Cepat JALAN Jhon Rohailam yang longsor termasuk kategori bencana alam. Itu artinya Badan Penanggulangan Bencana Daerah (BPBD) Simalungun harus bertindak cepat menanggulangi longsor tanpa menunggu pembahasan APBD-Perubahan. (Mag-01) Lina Girsang dkk Mahasiswi FKIP UHN

PELAJAR SD MENGATASI BATUK DENGAN YANG ALAMI B e t a pa t i d a k nyamannya j ka batuk s u d a h menyerang. Penyakit yang salah satunya d i s ebabkan oleh infeksi s a l u r a n pernapasan atas seperti flu dan pilek ini seringkali membuat penderitanya merasa terganggu dan sangat tidak nyaman. Di sisi lain, tak dapat dipungkiri bahwa batuk tidak memilih usia baik tua atau pun muda. Kondisi ini pernah dialami oleh seorang anak yang tinggal di Kisaran Timur, Asahan, Sumatera Utara, "Kurang lebih 6 bulan terakhir ini saya suka batuk terus-terusan sampai pernah dua hari berturutturut." Papar Riska Utami mengawali percakapan. Sebenarnya, batuk bukanlah sebuah penyakit, namun ia merupakan gejala yang dapat disebabkan oleh beberapa penyakit. Batuk merupakan mekanisme pertahanan tubuh yang sangat penting guna membuang benda asing di tenggorokan dan saluran pernapasan. Tetapi, bila batuk terjadi secara terus menerus maka itu berarti terdapat suatu masalah atau penyakit pada tubuh kita. Mengetahui kondisinya menurun, ibunya pun akhirnya memberi Riska

Gentong Mas, "Ibu saya mengatakan Gentong Mas itu bagus untuk kesehatan, apalagi terbuat dari bahan yang alami. Alhamdulillah setelah saya minum dengan teratur, sekarang sudah ada perubahan, saya tidak pernah batuk lagi." Ungkap Riska yang kini telah mengkonsumsi Gentong Mas kurang lebih 6 bulan. Dengan kondisi yang baik, ia pun dapat menjalani aktifitas sehari-hari dengannya aman. Setelah membuktikan manfaatnya, anak perempuan berusia 7 tahun ini tak sungkan-sungkan untuk membagi pengalaman baiknya dengan orang lain, "Mudahmudahan pengalaman saya ini bermanfaat." Pungkasnya. Meracik suatu ramuan memerlukan pengetahuan, pengalaman dan keterampilan tinggi. Tidak semua komposisi yang sama jika dicampur akan menghasilkan manfaat yang sama. Kualitas bahan baku, perbandingan komposisi dari masing-masing komponen serta pengolahan yang benar akan menentukan hasil kualitas manfaatnya. Gentong Mas sebagai minuman herbal yang mengandung Gula Aren dan Nigella Sativa (Habbatussauda), bahan baku utamanya telah terbukti manfaatnya dari berbagai penelitian ilmiah dan bukti empirik di berbagai negara. Gula Aren dalam Gentong Mas banyak mengandung nutrisi yang dibutuhkan

tubuh diantaranya Riboflavin yang membantu pembentu kan antibodi. Sementara Habbatus sauda bermanfaat sebagai antihistamin (anti alergi, anti radang dan peningkatan daya tahan tubuh melawan virus dan bakteri. Kandungan minyak atsiri dalam Kapulaga bermanfaat sebagai pengencer dahak atau ekspektoran.Untuk pengobatan dalam, kapulaga dapat mengatasi gangguan tenggorokan. Sementara Cengkeh dalam Gentong Mas berfungsi sebagai antiseptik. Manfaat yang hebat bagi kesehatan dan rasa yang lezat membuat semakin banyak masyarakat mengkonsumsi Gentong Mas. Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/ toko obat terdekat atau hubungi: Medan : 081384777787 Sidikalang : 081384777787 Dolok Sanggul : 081384777787 Gunung tua : 081384777787 Batubara : 081384777787 Tobasa : 0813 8477 7787 Nias : 0813 8477 7787 Tebing Tinggi : 0813 2209 9495 Siantar : 082167538848 Binjai : 0813 9866 6166 Lbk Pakam : 082164659699 Karo : 0821 6753 8828 Langkat : 0812 6321 7797 Kisaran : 0623 7014 362 Tj. Balai : 0812 6349 5563 Labura : 0813 7059 0972 Labuhan batu: 0852 7707 1977 P. Sidimpuan : 0821 6346 6597 Sibolga : 0852 9685 5211 Taput : 081263243034

Hub: Bagian Iklan Kami


2 Mei 2012


Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter.

Penerapan sistem kerja outsourcing di perusahaan BUMN membuat karyawan jadi malas, karena pekerjaan mereka banyak diserahkan kepada karyawan kontrak. Tidak etis jika pekerjaan yang seharusnya dikerjakan oleh pegawai BUMN, itu diserahkan kepada pekerja outsourcing. Ini kan keterlaluan.

Sikap Kami Angelina Sondakh dan Justice Collaborator KOMISI Pemberantasan Korupsi (KPK) memiliki banyak cara untuk mengungkapkan perkara. Salah satunya menawarkan kerja sama dengan penjahat korupsi untuk membuka tabir yang membelit kasusnya. Dalam bahasa hukum disebut justice collaborator. Tawaran kerja sama itulah yang disuguhkan KPK kepada Angelina Sondakh alias Angie. Tentu saja tawaran itu tidak gratis. Politikus Partai Demokrat itu dijanjikaninsentifjikamaubekerjasamadenganKPK membuka orang-orang yang terlibat dalam perkara yang menjeratnya. Angie, anggota Komisi X DPR, sejak Jumat (27/4) ditahan KPK. Mantan Wakil Sekjen Partai Demokrat itu diduga menerima sogok dalam pembahasan anggaran di Kementerian Pemuda dan Olahraga (Kemenpora) terkait proyek Wisma Atlet serta di Kementerian Pendidikan dan Kebudayaan. Namun, KPK belum mengungkapkan jumlah duit yang mengalir ke kantong Angie. Tawaran kerja sama pernah diberikan KPK kepada Yulianis, Wakil Direktur Keuangan Grup Permai. Yulianis diduga mengetahui banyak hal mengenai aliranuangGrupPermai,perusahaanmilikterpidana kasusWismaAtletMuhammadNazaruddin.Yulianis, misalnya,mendapatperlakuankhususdiperiksaKPK di hotel ataupun di apartemen mewah. SelainYulianis,adapulamantananggotaDPRAgus Condro yang membuka kasus bagi-bagi cek pelawat kepada anggota DPR periode 1999-2004 dalam pemilihan Deputi Senior Gubernur Bank Indonesia Miranda Goeltom.Jaksa KPK menuntut Agus paling ringan dengan 1,5 tahun penjara. Setelah divonis 1 tahun 3 bulan bui, permintaan Agus untuk menjalani hukuman di Pemalang, Jawa Tengah, kampung halamannya, dipenuhi. Tawaran KPK kepada Angie agar Puteri Indonesia 2001 itu kooperatif dan mau membeberkan perkara Wisma Atlet dan kasus di Kemendikbud. Angie yang pernah menjadi ikon Partai Demokrat dengan semboyan ‘katakan tidak pada korupsi’, mestinya malu bila tidak mau membuka keterlibatan para penerima aliran dana dari proyek di dua kementerian itu. Lagi pula, mengapa ia mesti memikul sendiri beban yang mestinya bisa dibagi? SebagaianggotaDPR,apalagidaripartaipenguasa, Angie dituntut jujur mengatakan hal yang sebenarnya. Kebenaran jangan ditutup-tutupi. Sebaliknya juga tidak boleh berbohong hanya untuk mengejar hadiah sebagai justice collaborator seperti ditawarkan KPK. Jangan pula menjadi justice collaborator dengan memfitnah. Jangan menjadi pahlawan dengan mengorbankan orang lain. KitayakinKPKmemilikicukupbuktihinggamenahan Angie. Kita juga yakin KPK memiliki cukup informasi mengenaidugaanketerlibatansejumlahnamalaindalam perkaradiduakementerianitu.TawaranjusticecollaboratorkepadaAngiemestinyahanyauntuklebihmemperkuatinformasiyangtelahdimilikiKPK. PublikmasihingatpercakapanBlackberryMessenger antara Angie dan Mindo Rosalina Manulang, terpidana2,5tahunkasusWismaAtlet,yangmenyebut ‘ketua besar’, ‘bos besar’, ‘apel malang’ dan ‘apel washington’.Sandi‘apelmalang’dan‘apelwashington’ diakuimerujukpadauangrupiahdandolarAmerika. Mudah-mudahan setelah ada tawaran justice collaborator, Angie mau mengungkapkan misteri ‘bos besar’ dan ‘ketua besar’ itu. (***)

PemekaranSimalungun hanya Sebuah Mimpi Ketika seseorang bermimpi sepanjang malam, maka itu hanyalah sebuah mimpi, tetapi ketika semua orang bermimpi yang sama sepanjang malam, bisa jadi mimpi tersebut akan menjadi menjadi kenyataan.

Salman Abror SH SimalungunHataranditundahingga2014inilah judulberitayangditerbitkansuratkabarharianlokal MetroSiantarSabtu28April2012. Setelah membaca berita tersebut saya tertarik untukmenyampaikantulisanini,karenaakhir-akhir inipembicaraanpemekaranKabupatenSimalungun kembali hangat diperbincangkan hampir semua elemenmasyarakat,ditandaidenganaksidemonstrasidamaiyangdilakukanKomiteNasionalPemuda Indonesia (KNPI) Kabupaten Simalungun barubaru ini. Di mana, dalam aksi yang dilakukan pertama serentak di kecamatan melalui PK KNPI di kecamatan yang berada di kawasan Simalungun Hataran,kemudiandilanjutkandenganaksikedua yangdilakukandikantorDPRDKabupatenSimalungundanKantorBupatiSimalungundiPematang Raya.Karenamenurutorganisasiyangmerupakan indukorganisasikepemudaandiKabupatenSimalunguniniPemekaranMerupakanHargaMati. Silihbergantipemberitaantentangpemekaran KabupatenSimalungunterusbermunculandimedialokal,adajugaelementmasyarakatyangmenamakan dirinya Komite Nasional Pemuda SimalungunIndonesia(KNPSI)melaluiKetuaUmumnya Jan Wiserdo Saragih dirilis beritanya di Harian Simantab tanggal 28 april 2012 yaitu KNPSI ikut menolakPemekaranSimalungunkarenadianggap tidakmenjaminkesejahteraanrakyatdanbahkan dinilaihanyauntukkepentinganpolitisyangdapat mengenyangkanpejabat-pejabatitusendiri. Sekedar mengingatkan kita bersama tentang perjuanganpemekaranKabupatenSimalungun, Badan Persiapan Pemekaran Kabupaten Simalungun(BP2S),pernahmengemukakankronologis

singkatperjuanganpemekaranKabupatenSimalungun,dimulaitanggal08April2002denganagenda penyampaian berkas tentang usulan pemekaran Kabupaten Simalungun dari masyarakat yang ditandatanganioleh5.470wargadanyangmewakili elemen-elemenmasyarakatantaralalain:1.Partuha Maujana Simalungun. 2. Organisasi-organisasi kemasyarakatan,3.OKP,4.Maujana-maujanaNagori danlain-lainkepadaKetuaDPRDSimalungundan BupatiSimalungunketikaitu.Tanggal10April2002 penyampaian berkas usulan pemekaran Simalungunbersamalampirannyadisampaikankepada 1.GubernurProvinsiSumateraUtara,2.KetuaDPRD ProvinsiSumateraUtara,selanjutnyatanggal22April 2002 penyampaian berkas usulan pemekaran Kabupaten Simalungun bersama lampirannya kepadaKetuaDPR-RIdanMendagri. Upayayangdilakukanpanitiapemekarandiketuai DrsH.MaknurSinagadanSekretarisIrH.Tugiman Suprapto ini terus mereka lakukan dari tahun ke tahun, hingga 15 maret 2011 Pertemuan BP2S bersamadenganketua-ketuapartaipolitikdengan KOMISIIIDPR-RIdiruangKOMISIIIdipimpinoleh H A Wahab Dalimunte SH menyerahkan kelengkapanpersyaratanadministrasisesuaiPP78-2007. Pertemuan dengan bapak Ganjar Pramono (PanjaPemekaran)diruangkerjanyadenganserupa dengan KOMISI II juga hadir Bapak Ali Wongso Sinaga, SH, Pertemuan dengan DPD-RI yang diterima oleh Bapak Dr Rahmadsyah, Bapak Parlindungan Purba SH, Ibu Prof Darmayanti dan pertemuandenganbapakCapt.AntonSihombing. PembentukandaerahotonomibaruKabupaten Simalungun Hataran sebagai pemekaran KabupatenSimalungunsesuaidengankeputusanDPRD SimalungunNo.20/DPRD/2007tanggal07November2007.KabupatenSimalungun(INDUK)ibukota SondiRayaterdiridari:1.KecamatanRaya,2.Silimakuta,3.PematangSilimahuta,4.Purba,5.Haranggaol Horisan,6.DolokPardamaean,7.Sidamanik,8.PamatangSidamanik,9.GirsangSipanganBolon,10. Dolok Panribuan, 11.Jorlang Hataran, 12. Panei, PanombeanPanei,13.DolokSilau,14.SilauKahean dan15.kecamatanRayaKahean. SementaraituKabupatenSimalungunHataran ibu kota Perdagangan terdiri dari 1.Kecamatan

Siantar, 2.Gunung Maligas, 3.Gunung Malela, 4.DolokBatuNanggar,5.PematangBandar,6.Bandar Huluan, 7.Bandar Masilam, 8.Bandar, 9.Ujung Padang, 10.Bosar Maligas, 11.Huta Bayu Raja, 12.JawaMarajaBahjambi,13.TapianDolok,14.TanahJawadan15.KecamatanHatonduhan.Artinya, wacanapemekaranKabupatenSimalungunsebenarnya sudah sejak lama ada selain sejarah diatas buktisejarahlainnyabangunanfisikKantorBupati Simalungun,KantorDPRDdanKantorSKPDpun dipindahkandiKecamatanRaya.DanuntukkesekiankalinyaBupatiSimalungunmenyatakanmendukungPemekaranKabupatenSimalungun. Yangmenjadipertanyaanadalah,jikasudahsedemikian rupa perjuangan pemekaran Kabupaten Simalungun, Sebenarnya apa yang menjadi faktor penghambat sehingga sampai hari ini pemekaran KabupatenSimalungunbelumjuaterealisasidanhanya menjadisebuahmimpi?Danbenarkahmasyarakat Simalungun semua sudah terlalu lama menunggu realisasipemekarantersebut?,marikitarenungkanNias saja sekarang bisa mekar menjadi empat (4) yaitu KabupatenNias,KabupatenNiasUtara,Kabupaten NiasBaratdanKotaGunungsitolidansekarangmereka menginginkanmenjadiprovinsisendiri. Menurut hemat penulis, mari kita jadikan keinginanPemekaranKabupatenSimalungunmenjadi mimpi bersama, mimpi kita semua elemen masyarakat, wartawan, LSM, pers, tokoh agama, tokoh pemuda, tokoh pendidik, tokoh adat dan segenap pemangku kepentingan di Tanah HabonaronDoBonaini,baikituPemerintahdalamhalini Bupati,DPRDbesertasemuapihak. Jika kita semua punya mimpi yang sama untuk mewujudkan pemekaran Simalungun, apapun kendalanya(Pendanaan,Berkasyangkuranglengkap, Lobi-lobi ke DPRI,dan lain-lain), siapapun lawankitayangmencobamenghambatpastidengan mudah akan teratasi dan pemekaran akan segera terealiasasi. Tapikekhawatiransayayangterjadihari iniadalahkitaberadadalamsatutempattiduryang samatetapimimpikitabeda,jikaituyangterjadimaka PemekaranHanyaTinggalSebuahMimpi.(***) PenulisadalahPeminatHukum,Sosial danPolitik,AlumnusFH-UMSU

Menteri BUMN Dahlan Iskan, Selasa (1/5)

Kondisi Indonesia yang karut marut dengan tingginya tindak pidana korupsi oleh wakil rakyat dan aparatur negara, membuat warga semakin menangis dan kepercayaan terhadap pemerintah luntur.

Ketua Dewan Pakar Partai NasDem Hary Tanoesoedibjo, Selasa (1/5)

Penyerapan tenaga kerja yang adil dan bermartabat harus semakin ditingkatkan dengan cara semakin banyak lapangan pekerjaan dibuka, kewiraswastaan, peningkatan skill difasilitiasi oleh pemerintah.

Anggota Komisi IX DPR Nova Riyanti, Selasa (1/5)


2 Mei 2012

KPK Yakin Anas Terlibat Proyek Hambalang di Bogor

JAKARTA- Komisi Pemberantasan Korupsi yakin Ketua Umum Partai Demokrat Anas Urbaningrum terlibat dalam proyek pembangunan kompleks olahraga terpadu di Hambalang, Bogor, Jawa Barat. Komisi Pemberantasan Korupsi (KPK) masih dalam tahap menyelidiki proyek bernilai Rp 1,5 triliun yang diduga dikorupsi tersebut. Ihwal keyakinan KPK atas keterlibatan Anas di proyek Hambalang ini diungkapkan Wakil Ketua KPK Bambang Widjojanto. Menurut Bambang, KPK telah mendapatkan pengakuan dari anggota Komisi II DPR dari Fraksi Partai Demokrat, Ignatius Mulyono, bahwa dia diperintah Anas ikut membereskan sertifikat tanah untuk proyek Hambalang. “Kan, sudah ada keterangan kalau Ignatius Mulyono disuruh Anas menyelesaikan sertifikat tanah untuk Hambalang,” kata Bambang.

KPKkemudianmenelisikbagaimana akhirnya Badan Pertanahan Nasional (BPN) mengeluarkan sertifikat tanah tersebut. Peran Ignatius muncul pertama kali dalam berita acara pemeriksaan (BAP) KPK terhadap mantan Bendahara Umum Partai Demokrat Muhammad Nazaruddin. Dalam BAP, Nazaruddin mengungkapkan, karena berada di Komisi II DPR, Ignatius diminta bertemu Kepala BPN Joyo Winoto. Salah satu mitra kerja Komisi II DPR memang BPN. Masih menurut Nazaruddin, sebelumnya dia ditanya Anas siapa yang bisa membereskan masalah sertifikasi tanah untuk proyek Hambalang. Nazaruddin yang

„ Anas Urbaningrum saat itu masih menjabat sebagai bendahara umum partai dan FraksiPartaiDemokratdiDPRpun menyodorkan nama Ignatius kepada Anas. Nazaruddin juga menuding ada uang yang mengalir dari PT Adhi Karya kepada Anas, yang

digunakan untuk pemenangan pemilihan ketua umum partai dalam Kongres Partai Demokrat di Bandung. Pengacara Anas, Patra M Zen, mengatakan yakin kliennya sama sekali tak bersalah. Dia pun meminta media hati-hati mengutip kronologi setiap keja-

dian yang melibatkan Anas. Dia mencontohkan, Nazaruddin menuding ada kaitan suap proyek wisma atlet dengan pemenangan Anas di DPR. “Nyatanya Kongres Partai Demokrat itu tahun 2010 dan aliran uang dari suap wisma atlet itu terjadi tahun 2011. Saya yakin Mas Anas dan Ibu enggak ada masalah secara hukum,” kata Patra. Demokrat: Silahkan KPK JeratAnas Partai Demokrat mempersilakan Komisi Pemberantasan Korupsi (KPK) menjerat Anas Urbaningrum, jika ia benar terlibat dan terbukti dalam kasus dugaan korupsi proyek Hambalang. Hal ini diungkapkan oleh Ketua Divisi Komunikasi Publik Partai Demokrat, Andi Nurpati, usai menghadiri diskusi di Warung Daun, Jakarta Pusat, Selasa (1/5/ 2012). “Siapapun yang terlibat dalam

kasus Wisma Atlet maupun Hambalang, Partai Demokrat mempersilakan menindak lebih lanjut dan dituntaskan. Ketua Umum partai (Anas Urbaningrum) sekali pun,” kata Andi. Ia mengatakan, Ketua Dewan Pembina sekaligus Presiden Susilo Bambang Yudhoyono tidak akan melakukan intervensi, jika ada petinggi partai yang terseret kasus korupsi. “Silakan dilakukan proses penegakan hukum, seadil-adilnya. Harus berdasarkan bukti-bukti yang bisa ditunjukkan oleh penegak hukum kalau benar terlibat,” tegasnya. Sebelumnya diberitakan, KPK meyakini Ketua Umum Partai DemokratAnasUrbaningrumterlibat dalam proyek pembangunan kompleks olahraga terpadu di Hambalang, Bogor, Jawa Barat. Ihwal keyakinan KPK atas keterlibatan Anas di proyek Hambalang

itu diungkapkan Wakil Ketua KPK, Bambang Widjojanto. Menurut Bambang, KPK telah mendapatkan pengakuan dari anggota Komisi II DPR dari Fraksi Partai Demokrat, Ignatius Mulyono, bahwa dia diperintah Anas ikut membereskan sertifikat tanah untuk proyek Hambalang. Peran Ignatius muncul pertama kali dalam berita acara pemeriksaan (BAP) KPK terhadap mantan Bendahara Umum Partai Demokrat Muhammad Nazaruddin. Dalam BAP, Nazaruddin mengungkapkan, Anas menanyakan siapa orang yang bisa membereskan masalah sertifikasi tanah untuk proyek Hambalang. Nazaruddin, yang saat itu masih menjabat sebagai bendahara umum partai dan Fraksi Partai Demokrat di DPR, pun menyodorkan nama Ignatius kepada Anas. (*)

KPK Fokus di Sertifikat Pengadaan Proyek Hambalang JAKARTA- KPK masih mengusut kasus dugaan suap proyek pembangunan komplek olah raga di Hambalang, Bogor. Lembaga antikorupsi itu fokus pada dua aspek utama dalam kasus ini, yaitu sertifikat dan pengadaan lahan proyeknya. ”Kita di Hambalang itu menelusuri dua hal, soal sertifikat dan proses pengadaan proyek multiyears(tahunjamak),”kataJuruBicara KPK Johan Budi di kantornya, Jl RasunaSaid,Jaksel,Selasa(1/5). Akan tetapi, Johan belum dapat menjelaskan keterlibatan pihakpihak dalam proyek senilai Rp 1,7 triliun ini. Akan tetapi Ia menyatakan KPK masih menelusuri indikasi penyelewengan proyek Hambalang.”Yainikitalaginyaridi dua ini, kita lagi nyari indikasi tindak pidananya. Kita sedang menyelidiki,” ungkap Johan KPKsendiritengahmengusutpada proses tender, penyelesaian sertifikattanahdanpengerjaandipro-

yekini.Untukpenyelesaiansertifkat tanah, politisi Demokrat Ignatius Mulyono yang pernah diperiksa KPK,menyebutadaperanAnas. Ignatius menyebut Ketua UmumPDitumengontaknyaagar bisa melobi Ketua Badan Pertanahan Nasional (BPN) Joyo Winoto. “Saya ditanya soal dimintai tolong oleh pak Anas, soal tanah Menpora kok nggak selesaiselesai,” tutur Ignatius usai menjalani pemeriksaan di kantor KPK, Jl Rasuna Said, Jaksel, Senin (26/3). Ignatius mengatakan, dirinya dimintaitolongAnasuntukmenelpon Joyo pada akhir tahun 2009, pada saat Anas masih menjabat sebagai ketua fraksi. Dia menyebut itu merupakan permintaan tolong Anas, bukan suatu perintah. ”Nggak perintah itu minta tolong. Dia bilang tolong tanyain tanah Menpora belum selesai-selesai. Setelah itu saya hubungi Mas Joyo tapi nggak bisa-bisa, lalu saya telepon Sestama,” tutur anggota

Komisi II ini. Ignatius menyatakan, dirinya tak pernah bertemu dengan Joyo. Dia hanya bisa berkomunikasi via telepon. ”Telepon. Saya bisanya telpon Sestama. Dia bilang, surat tanah Menpora masih dalam proses. Nanti kalau selesai saya beritahu,” ujarnya Kasus ini berawal dari penyelidikanKPKterkaitkasusWismaAtlet yang melibatkan mantan BendaharaUmumPartaiDemokrat Muhammad Nazaruddin. Proyek senilaiRp1,2triliunmenuaibanyak kontroversi setelah Nazaruddin menyebutfeeproyektersebutuntuk mendanai pemenangan Anas UrbaningrumdalamKongresPartai Demokrattahun2010. Nazaruddin,yangjugaterdakwa kasus suap Wisma Atlet juga menyebutkan adanya keterlibatan Anas dalam kasus Hambalang, antaralainmemintadirinyamelobi sejumlahpihakagarsertifikatHambalang selesai diurus. (dtc/int)


TIBA DI KPK:Tersangka kasus dugaan korupsi pembahasan anggaran Kementerian Pemuda dan Olahraga Angelina Sondakh (tengah) seusai menjalani pemeriksaan kesehatan di rumah sakit Perhati, Jakarta, Selasa (1/5). Angelina Sondakh dibawa ke RS karena penyakit sinusitisnya yang dideritanya.

Angie Akan Diberi KERINGANAN HUKUMAN Bila Menjadi Justice Collaborator JAKARTA- Lembaga Perlindungan Saksi dan Korban (LPSK) membuka diri untuk Angelina Sondakh atau Angie. LPSK siap melindungai Angie, bila politisi Partai Demokrat itu ingin menjadi justice collaborator. ”LPSK siap memberikan perlindukan terhadap Angie,” kata Ketua LPSK Abdul Haris Semendawai dalam siaran pers, Selasa (1/5). Abdul Haris menjelaskan, penetapan justice collaborator

bisa dilakukan berdasarkan rekomendasi KPK. Lembaga antikorupsi itu dinilai yang mengetahui peran dan informasi penting apa saja yang dimiliki Angie. ”KPK yang mengetahui apakah Angie mau bekerjasama dengan penyidik atau tidak. Kerjasama tersebut terkait pengungkapan pihak-pihak lainnya yang terlibat dalam kasus korupsi yang lebih besar,” tuturnya. Syarat penetapan seorang justice collaborator adalah tindak pidana yang diungkap merupakan tindak pidana

serius atau terorganisir. Saksi pelaku yang bekerjasama, mau memberikan keterangan yang signifikan, relevan, dan andal untuk mengungkap suatu tindak pidana, bukan pelaku utama, dan kesediaan mengembalikan aset yang diperolehnya. Juga adanya ancaman yang nyata atau kekhawatiran adanya ancaman tekanan fisik dan psikis terhadap saksi pelaku atau keluarganya. ”Saksi pelaku yang bekerjasama bisa mengajukan permohonan apabila memenuhi syarat di atas. Yang





dapat diberikan LPSK terhadap justice collaborator berupa perlindungan fisik dan psikis, perlindungan hukum, penanganan secara khusus, dan penghargaan. Bentuk penghargaan berupa keringanan tuntutan hukuman dan remisi tambahan sesuai ketentuan perundang-undangan yang berlaku,” jelas Abdul Haris. ”Peran justice collaborator sangat signifikan guna menangkap otak pelaku yang lebih besar sehingga tindak pidana dapat tuntas dan tidak berhenti pada di pelaku teri,” tambahnya lagi. (dtc/int)

Kesehatan Endang Rahayu Menurun JAKARTA- Menteri Kesehatan Endang Rahayu Sedyaningsih masih menjalani perawatan akibat serangan kanker di RSCM. Belum ada tanda-tanda perbaikan dalam kesehatannya, bahkan kondisinya cenderung menurun. ”Masih sakit,” kata Wakil Menkes, Ali Ghufron, saat dihubungi wartawan, Selasa (1/5). Ali membenarkan kondisi kesehatan Endang terus menurun. Belum ada perkembangan yang cukup signifikan sejak menjalani perawatan beberapa waktu yang lalu. ”Iya agak menurun, menurun,” sambungnya. Seperti diberitakan sebelumnya, Endang divonis mengidap kanker stadium empat. Karena kondisi kesehatan inilah, Endang mengajukan pengunduran diri pada Presiden SBY. Permohonan tersebut secara prinsip sudah Presiden SBY setujui. Hingga ada keputusan yang definitif, untuk sementara tugas-tugas Menkes untuk sementara diserahkan kepada Wamenkes Ali Ghufron.(kmc/int)


2 Mei 2012

Diminta Pemkab Simalungun Lantik Pangulu Nagori Purba Sari SIMALUNGUN-Warga Nagori Purba Sari, Kecamatan Tapian Dolok Simalungun meminta kepada Pemkab Simalungun dan DPRD supaya melantik Pangulu Nagori Marsal Saragih yang terpilih pada pemilahan pangulu nagori pada Mei 2011 lalu. Alasannya, menurut warga, Marshal Saragih tidak tersangkut masalah hukum pada pemilihan pangulu nagori maupun pribadi. Dia (pangulu) terpilih benar-benar murni berdasarkan hati nurani masyarakat.“Kami sudah menyampaikannya kepada camat,dan instansi terkait, namun tak ada tanggapan yang jelas, sementara tombak desa itu di masyarakat adalah pangulu nagori,”kata warga pada reses anggota DPRD Simalungun Rajisten Sitorus SH MM di daerah tersebut, Selasa (2/5). Selain itu, beberapa warga juga mengusulkan perbaikan jalan, pemasangan tiang listrik dan pembagunan gedung SD di daerahnya. Serta meminta tanah eks PT Good Year(Brigestone) seluas 200 ha agar di kelola masyarakat setempat yang secara langsung meningkatkan pendapatan warga. Keempat usulan tersebut penting demi kepentingan masyarakat di daerah ini.Paling prioritaskan adalah pembangunan gedung SD, karena selama ini anak-anak warga berangkat ke sekolah harus jarak tempuh 2 km. SD berada di luar Nagori Purba Sari. “Jarak tempuh inipun melintasi perkebunan,” keluh warga. Rajisten Sitorus mengatakan, reses ini menjadi momen bagi kita untuk menjaring aspirasi masyarakat dan mengetahui lebih dekat apa keinginan warga. Mereka memohonkan agar apa yang diusulkan dapat segera terealisasi. ‘’Kita akan perjuangkan permhonan warga itu supaya masyarakat nantinya bisa merasakannya dan secara tak langsung dapat meningkatkan kesejahteraan,”ujar Komisi I DPRD itu. Jumlah warga yang mengikuti reses sebanyak 150 orang dan dihadiri Kasi Pemberdayaan Masyarakat Nagori (PMN) pada Camat Tapian Dolok Tarifar Sinaga.(nik)

Volkswagen Polo R-Line Muali Diperkenalkan Setelah resmi diperkenalkan kepada publik di ajang Frankfurt Motor Show, September 2011 lalu, pabrikan mobil asal Jerman, Volkswagen (VW) kembali mengumumkan hatchback mungilnya resmi diluncurkan di Inggris dengan harga 15.195 Poundsterling atau setara Rp226 jutaan. VW Polo R-Line yang di pasarkan di Inggris dibekali mesin bensin 1.2-liter TSI Turbocharged yang dapat menyemburkan daya 103 BHP yang dikawinkan dengan transmisi manual enam percepatan. Mesin ini mampu berakselerasi mulai 0 hingga 62 mph dalam waktu 9,7 detik sebelum mencapai kecepatan maksimum 118 mph. Lebih lanjut, dari segi tampilan, bumper depan Polo R-Line ini mengalami ubahan yang cukup besar, garis-garisnya terlihat lebih tegas, grill depan yang dicat warna hitam dan velg berukuran 16 inci. Sementara untuk interiornya menawarkan tempat duduk yang sporty dengan balutan kulit, dan dipadukan dengan lapisan atap dan bawah. Logo R-Line dan balutan krom juga tersedia dalam paket tersebut. Nantinya, VW Polo R-Line tersedia dalam dua pilihan yakni R-Line Exterior dan R-Line Plus. Perbedaan kedua model tersebut ada pada bagian eksterior dan interior.(int)

Program Loyalti Untuk Pelanggan dan Mitra Outlet

Telkomsel Siapkan Hadiah Mobil Bagi Pelanggan MEDAN-Telkomsel kembali memberikan apresiasi kepada pelanggan prabayar dan mitra outlet yang ada di Sumatera melalui program REJEKI ISI ULANG dan JUTAWAN OUTLET SUMATERA. Masing-masing program ini memungkinkan pelanggan dan outlet mendapatkan hadiah utama berupa 1 Unit Mobil KIA Sportage M/T dan hadiah menarik lainnya. Menurut Head Of Telkomsel Sumatera Group – Gilang Prasetya program REJEKI ISI ULANG dan JUTAWAN OUTLET SUMATERA merupakan salahsatu bentuk perhatian kami kepada pelanggan yang tetap loyal menggunakan Telkomsel, serta mitra outlet yang juga memiliki peranan sangat penting dalam menjaga loyalitas pelanggan Telkomsel melalui ketersediaan produk di outlet hingga membantu Telkomsel dalam melakukan edukasi keunggulan produk Telkomsel kepada pelanggan di outletnya”. Program Rejeki Isi Ulang adalah program yang dikhususkan untuk pelanggan prabayar Telkomsel di Sumatera (kecuali nomor HLR Aceh), baik pelanggan baru maupun pelanggan yang sudah lama menggunakan kartu simPATI, Kartu AS dan Kartu Facebook. Untuk mengikuti program ini tidak diperlukan registrasi khusus, caranya pelangganprabayarcukupmelakukan isi ulang pulsa pada periode program yang berlaku mulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. Jika selama periode program telah mencapai total isi ulang minimal Rp.60ribu, secara otomatis pelanggan tersebut akan berpeluang mendapatkan salahsatu hadiah yang akan diundi pada bulan September 2012. Bagi pelanggan yang melakukan isi ulang pulsa selama periode pro-

gram, mencapai total isi ulang pulsa minimum Rp.300.000, secara otomatis berpeluang mendapatkan salahsatu dari seluruh hadiah yang disediakan berupa 30 (tiga puluh) HP Android, 30 (tiga puluh) Tas Trolley, 9 (sembilan) unit Samsung Galaxy Tab 8.9”, 9 (sembilan) unit Sepeda Motor Honda Vario, dan hadiah utama undian berupa 1 (satu) Mobil KIA Sportage M/T. Melengkapi program Rejeki Isi Ulang, Telkomsel juga menyelenggarakan program JUTAWAN OUTLET SUMATERA (JUARA). Program apresiasi ini dikhususkan bagi seluruh mitra outlet yang juga berada diwilayah Sumatera. Program ini juga menyediakan hadiah undian berupa 1 (satu) unit Mobil KIA Sportage M/T, Honda Vario, Tablet Cyrus TV Pad, Blackberry Apollo. Program yang diperuntukkan khusus untuk mitra outlet diseluruh willayah Sumatera ini, dimulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. Bagi mitra outlet yang ingin mengikuti program JUARA, akan mendapatkan informasi lengkap tentang mekanisme program melalui petugas Sales Force yang berada dimasing-masing wilayah cluster mitra outlet. Sama halnya dengan program Rejeki isi Ulang, pengundian pemenang program JUTAWAN

TVS Apache RTR ABS Hanya Rp14 Jutaan Pabrikan sepedamotor asal India TVS resmi meluncurkan varian sport Apache RTR 2012. TVS memberikan perubahan pada desain Apache ini dengan tema desain perubahan tidak terbatas. TVS memberikan sentuhan manis pada dua model Apache RTR 160 dan Apache RTR 180. Fitur yang disematkan pada Apache terbaru ini tidak main-main. TVS memasang rem ABS dan lampu pilot LED yang langsung menyala saat tombol start dihidupkan. Desain tangki bahan bakar dibuat tajam dengan bantuan fairingdisetiapsisinya,panelinstrumen dengan indikator digital. Otot sepeda motor semakin dipertegas dengan penutup mesin, dengan warna menyatu antara head lamp, fairing tangki dan penutup mesin bawah. “KamitelahmerancangApacheRTR sebagai sepeda motor dengan level yang lebih tinggi. Varian ini adalah pengembangan dari brand TVS. Setiap sistem, detail dan komponen telah disempurnakan guna mendapat performa yang memaksimalkan,” kata President Director TVS Motor HS Goindi, seperti dilansir, Selasa (1/5). Apache RTR 160 tersedia dalam

„ TVS Apache RTR empatwarnaganda,merah,hijau,kuning dan abu-abu. Sementara warna hitam menjadi dasar. Sedangkan Apache 180 hadir juga dengan empat warna yakni putih, hitam, kuning dan abu-abu. TVS Apache RTR versi ABS hanya tersedia dalamwarnaputihdanhitam. Mengenai harga, TVS Apache RTR 160 dibanderol dengan harga 67.505 Rupee atau sebesar Rp11,77 jutaan. TVS Apache RTR 180 dibanderol dengan harga 72.090 Rupee atau Rp12,5 jutaan. Dan TVS Apache RTR 180 ABS hadir dengan harga 82.780 Rupee atau Rp14,4 jutaan. (int)


TELKOMSEL- Telkomsel kembali memberikan apresiasi kepada pelanggan prabayar (simPATI, Kartu As, Kartu Facebook) dan mitra outlet yang ada di Sumatera melalui program REJEKI ISI ULANG dan JUTAWAN OUTLET SUMATERA. Program ini berlaku mulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. OUTLET SUMATERA, juga akan dilakukan pada bulan September 2012. dan Informasi pemenang akan diumumkan melalui Media cetak, website resmi Telkomsel yakni, seluruh kantor pelayanan Telkomsel serta call center Telkomsel dengan menekan 155 dari handphone.

Gilang menambahkan “Kami berharap di usia Telkomsel yang kini mencapai 17 Tahun, melalui program loyalty ini baik pelanggan maupun mitra outlet dapat semakin merasakan kedekatan emosional yang lebih erat dengan Telkomsel, dan merasakan manfaat lain dari sekedar layanan Telekomunikasi”.

Pada kesempatan ini Telkomsel tetap menghimbau kepada seluruh pelanggan dan mitra outlet agar tetap berhati-hati terhadap penipuan yang mengatasnamakan Telkomsel. Dalam setiap program undiannya, Telkomsel tidak pernah memungut biaya dalam bentuk apapun. (leo/rel)

Re-Launching Sensus Pajak Nasional

Kanwil DJP Sumut Bagibagi Bunga dan Stiker SIANTAR–Kanwil Direktorat Jenderal Pajak Sumut II bersama KPP Pratama Siantar mengkampanyekan aksi simpatik pajak dengan membagi-bagikan bunga serta brosur.Kegiatan ini dilangsungkan di Megaland, Jalan Merdeka Simpang Jalan Sudirman untuk re-launching Sensus Pajak Nasional tahap dua. Kabid Penyuluhan Pelayanan dan Hubungan Masyarakat, Muhammad Ntai didampingi KPP Pratama Pardamean Tambunan dan Marlinang, Selasa (1/ 5) mengatakan, aksi simpatik membagikan bunga serta brosur ini dimaksudkan untuk mengingatkan kembali masyarakat. Masyarakat diingatkan kembali bahwa sensus pajak nasional dilaksanakan kembali. Kita berharap pemangku kepentingan dan masyarakat memberikan dukungan terhadap pelaksanaan sensus pajak

nasional Tahun 2012,” sebutnya. Lebih lanjut ia menerangkan, petugas sensus melakukan penyisiran dan pencacahan terhadap potensi pajak yakni wajib pajak dan obyek pajak. Hal ini untuk menjaring wajib pajak yang belum terdaftar dan optimalisasi atas objek pajak yang telah terdaftar. “Sasaran sensus pajak 2012 meliputi sentra ekonomi seperti kawasan bisnis, high rise building, kawasan pemukiman. Serta kawasan potensial seperti perkebunan kelapa sawit, pertambangan batu bara dan perikanan,” terangnya. Sambungnya Kanwil DJP Sumut II membawahi delapan KPP Pratama menargetkan mengumpulkan 95 ribu wajib pajak atau formulis isian sensus (fis). Untuk KKP Pratama Tebing Tinggi ditargetkan 11 ribu FIS, KPP Pratama Kisaran ditargetkan 15 ribu FIS, KPP Pratama

Rantau Prapat ditrgetkan 14 ribu FIS. Kemudian KPP Pratama Pematangsiantar 14 ribu FIS, KPP Pratama Padang Sidimpuan 14 ribu FIS, KPP Pratama Sibolga 9 ribu FIS, KPP Pratama Balige 7 ribu FIS dan KPP Pratama Kabanjahe 11 ribu FIS. “ Dalam pelaksanaan sensus pajak nasional ini terdiri dari ketua, anggota dan pendamping yang akan mendatangi wajib pajak yang menjadi sasaran. Kemudian responden mengisi serta mendantangani FIS tersebut,” ungkapnya. Menurutnya, untuk memperlancar pendataan sensus pajak nasional dokumen yang perlu disiapkan yakni Nomor Pokok Wajib Pajak (NPWP), Surat Pengukuhan Pengusaha Kena Pajak (PKP), akta pendidiran. Selanjutnya nomor pelanggan PLN, SPPT PBB, KTP/Paspor,kartu identitas penanggungjawab.(mua)


2 Mei 2012

Skandal Al Amin Nasution.. Sambungan Halaman 8 mendapatkan proyek besar terkait proses pengalihan fungsi hutan Kabupaten Bintan. Untuk memperlancar proses tersebut, Amin disuapRp3miliarolehsekretarisnya Azirwan plus bonus “perempuan” yang diduga adalah mahasiswi asal UniversitasPakuanbernamaEfielian Yonata. Setelahinformasitersebuttersebar, Efielian pun mengalami proses penyelidikan oleh KPK untuk men-

jadisaksikasuspenyuapantersebut. Efielian dalam jumpa pers mengaku,saatituiaberadadiHotelRitz Carlton dan tidak pernah mengenal Al Amin. Namun, ia sempat duduk satumejadengansuamipedangdut Kristinatersebut. Kejadianinihanyamencuatpada kasus suapnya saja, bukan skandal seks. Namun, dari kejadian ini, Efielian diisukan sebagai PSK, sehinggamemunculkanopinipublik bahwaAlAminpernahberhubungandenganEfielian.(unc/int)

Tukang Potong Kayu Tewas.. Sambungan Halaman 8

ditebangnya,Selasa(1/5)sekirapukul 16.30WIB.Peristiwaterjadididaerah Sampuran Nagori Dolok Merawan, Sergai. Menurut Sarmin (40), rekan korbanyangditemuidiRSMinaPadi, awalnya mereka bersama-sama bekerjamenebangpohonkayubesar dikawasanSampuran. “Adabeberapaorangkamibekerja menebangkayudisana.Tapiternyata pohon yang ditebang Sutiman membuatnyanaas,”kataSarmin. Sebab begitu memotong pohon menggunakan cinshaw, kayu yang sudahmiringmengarahkepadanya.

Semula korban sempat melihat keadaan dan berusaha mengelak. Namunakhirnyaiatersungkurakibat terjerat akar pohon. Akibatnya, pohonmenimpanya. Sarmin dan beberapa teman lain yang menyaksikan kejadian, langsungmembawanyakeRSMinaPadi di Sinaksak, Simalungun. Mereka berharapagarkorbanbisadiselamatkan.Namunnaas,saatdiperiksatim medis, nyawa korban sudah melayang. Peristiwa itu langsung dikabarkankepadakeluargakorban. Sekira pukul 17.45 WIB, pihak rumah sakit membawa korban ke rumah duka di Bajalingge untuk di semayamkan.(mag-4/hez)

Gadis Bugil Mengapung.. Sambungan Halaman 8

pukul 12.00 WIB. Wanita itu ditemukanpemancingdengankondisitanpa busana. HinggaSelasa(1/5)identitaskorban belum diketahui. Bahkan tidak seorangpunwargadidaerahitumengaku kehilangananggotakeluarga.OlehpolisimembawajasadkorbankeRumah SakitUmum(RSU)Pangururan. Informasi dihimpun METRO, Selasa (1/5) dari warga setempat, S Sinaga mengatakan, jasad korban pertamakaliditemukanduapemancing ikan di Pantai Namartua Sioma. Dua pria itu mengaku kaget begitu melihat jasad korban mengapung di danau. Takut dijadikan sebagai tersangka,

keduanyalangsungmemanggilwarga lainnyagunamemastikantemuanitu. Oleh warga kemudian langsung menghubungiPolsekOnanrunggu. “Daerah itu diketahui angker. Makanya mereka (pemancing) itu memanggilwarga.Selanjutnyawarga menghubungipolisiuntukmengevakuasijasadkorban,”terangSinaga. Limajamkemudian,polisibarutiba dilokasi.Padapukul16.00WIB,mayat berhasildievakuasidaridanaudibantu warga dengan mempergunakan kapalsolu-soludanmembawanyake RSUPangururan. Kapolsek Onanrunggu AKP P Simatupang membenarkan penemuan mayat perempuan dengan tinggi badan sekitar 150 cm, dan berrambutikatsebahuitu.(rait/des)

Jalinsum Parapat Macet.. Sambungan Halaman 8

PARAPAT-Satuunittruklogging BK 9729 BL bermuatan kayu pinus, terguling di Jalinsum Siantar-Parapat,tepatnyadiSualan,NagoriSibaganding, Kecamatan Girsang Sipangan Bolon, Simalungun, Senin (30/4)sekirapukul23.00WIB.Meski tidak ada korban jiwa, namun arus lalulintas di lokasi mengalami kemacetan sepanjang 2 kilometer. Informasi dihimpun, peristiwa berawal saat truk yang datangdari arah Tapanuli menuju Siantar ini melaju dengan kecepatan sedang. Setibanyadilokasikejadian,diduga kurang berhati-hati di jalan yang menikung,membuattrukmasukke beram yang memang sudah berlubang. Akibat sedang mengangkut muatan berat berupa puluhan gelondongan kayu pinus, membuat truk tak seimbang dan langsung terguling. Dalam sekejap,

Penjaga Sekolah Culik & Perawani.. Sambungan Halaman 8 Informasi dihimpun dari kepolisian menyebutkan, peristiwa terjadipada Rabu (29/2) lalu. Saat itu korban yang baru pulang sekolah dibawa pergi oleh penjaga sekolah JS. Namun dalam pengaduannya di kantor polisi, MHS tak mengetahui di mana lokasi penginapan tempat JS membawa dan memperawaninya. Sejak dibawa kabur, orangtua korban kecarian. Seluruh sanak keluarga ditanya tentang kebaradan korban. Meskipun tidak membuahkan hasil, namun keluarga tidak membuat

berang dan langsung mendatangi Polres Simalungun untuk melaporkan perbuatan oknum penjaga sekolah ini. Kapolres Simalungun AKBP M Agus Fajar SIK saat dikonfirmasi melalui Kasubbag humas AKP H Panggabean, membenarkan adanya laporan pengaduan korban bernomor LP/176/IV/2012/SU/ Simalungun. Dikatakannya, pihaknya masih melakukan pengejaran terhadap tersangka. “Jika terbukti, terlapor JS dijerat dengan UU RI nomor 23 tahun 2003 tentang perlindungan anak. Ancamannya 15 tahun penjara,” kata Panggabean. (Osi/hez)

tertanggal30September1976. “Poniman membeli tanah dari Abdul Kadir tertanggal 28 Februari 1967. Namun grand tanah yang asli, tidak dapat diserahkan Abdul Kadir saat itu, alsannya karena hilang. Namun Abdul Kadir berjanji akan menyerahkansuratapabiladitemukan.Perjanjianitudituangkandalam secarikkertas,”ujarSarbudin. “TanahitusebenarnyamilikAbdul KadirdandijualkepadaTagor.Berselang2tahun,Tagormenjualtanahitu lagi kepada Jamaintan Purba. Sampai tahun 1997 tanah itu diusahainya. Jamaintan kemudian menjual tanahkekliensayapada17Nopember1997,”paparnya. Terpisah, Jimi Siregar mengatakan, dirinya juga mempunyai bukti kepemilikan tanah tersebut yang dikeluarkan oleh BPN. “Bukti sertifikat dari BPN sudah ada. Tapi kenapa saat saya mau meratakantanah,malahdilaporkan ke polisi dengan tudingan pengerusakan Tebu. Tanah itu milik saya, alashakjelas,bisadibuktikandengan sertifikatnomor4323,”katanya. Iamengaku,seminggulalusetelah dirinya dilaporkan ke Mapolsek SiantarMartoba,ialangsungmem-

buat somasi kepada Sutan, agar tidak mengklaim tanah sebagai miliknya. “Saya adalah pemilik sah tanah itu, sudah ada sertifikat. Untuk mendapatkan sertifikat itu, saya sudahmelaluiseluruhprosesadminitrasi dengan benar sesuai ketentuanyangdisyaratkanBPN.Dengan diterbitkannyasuratitu,berartitidak ada masalah adminitrasi dan legalitasatasberkasdalampermohonan penertiban sertifikat saya tersebut,” tegasnya. MasihkataJimi,petugasalatberat yangdiperintahkannyauntukmeratakan tanah di lahan tersebut, diancam oleh Sutan. Saat itu ia mengancam akan membakar alat berat tersebut kalau saja supir melanjutkan pekerjaannya. Sutan jugamengadukansayakeMapolsek Siantar Martoba dengan tuduhan melakukanpengerusakantebu. “Sayamemangmemerintahkan supayapetugasalatberatmeratakan tanah di lahan itu. Lahan itu memang milik saya, dan baru saya belitahun2011dariHAmran,anak dari Alm Abdul Kadir, lengkap dengan alas haknya,” tegasnya. (Osi/hez)

keduanya bertemu usai bekerja. Selanjutnya terdakwa mengajak korban ke kos-nya untuk mengambil Hp yang sebelumnya dibawanya kabur. Dengan menaiki mopen, keduanya menuju Jalan Medan. Setibanya di sana, korban sempat heran. Sebab rumah yang disebutkan terdakwa bukan kos-kosan, melainkan losmen. “Saat itu juga korban berontak dan meminta pulang, tetapi terdakwa mendorongnya masuk kamar. Terdakwa kemudian mencekik leher korban seraya mengancamakanmembunuhnya jika menjerit. Malam itu terdakwa dan korban melakukan hubungan suami istri,” jelasnya. Paginya, terdakwa menghantarkan korban ke loket Intra di Jalan Pattimura serta memberikan uang Rp20ribu.Dikatakanterdakwasaat itu, ia akan bertanggung jawab jika saja terjadi apa-apa atas perbuatan mereka. Setibanya di rumah,

korban menceritakan kejadian kepada keluarganya. “Hal memberatkan, perbuaran terdakwa sangat tercela dan bertentangan dengan agama serta asulisa. Selain itu menimbulkan rasa malu terhadap korban. Hal meringankan, terdakwa belum pernah dihukum dan berterus terang di persidangan,” ungkapnya. Katanya, berdasarkan keterangan saksi dan menimbang fakta-fakta di persidangan, hakim memutuskan menghukum terdakwa 2,6 tahun penjara. Hukumanitusudahberkurangdari tuntutanJPUSitiMartitiManulang, dengan tiga tahun penjara. Usai mendengarkan putusan hakim, terdakwa kembali menangis. Bahkan selama di persidangan,takjarangterdakwamenghapus airmatanyayangmengalir.Dengan matamemerah,akhirnyaterdakwa pun menerima putusan yang dibacakan hakim. (mua/hez)

Pengusaha dan Pengacara Saling Klaim

Sambungan Halaman 8 Tinggi di Jalan Sudirman Kota Siantar, dan pengacara dari Jakarta JimiSiregarSH,salingklaim. Bahkan Jimi yang menetap di Rangkasbitung, Kabupaten Lebah, Banten, harus berurusan dengan polisiataspengaduanSutankePolsek SiantarMartobaakibatkasuspengerusakanpohontebudilahanitu. Kepada METRO, kuasa hokum Sutan,SarbudinPanjaitanmengatakan,bahwapada17Nopember1997, tanahitudibeliSutandariJamaintan Purba. Itu sesuai surat penyerahan hak atas tanah di bawah tangan. Kemudian dibuat di hadapan PejabatPembuatAktaTanah(PPAT)SM Sinaga pada 24 September 1999 dengan akte nomor 7. Sejak saat itu, yang membayar PBB atas tanah adalahSutan. Bahwa sebelumnya, Jamaintan memperoleh seluas tanah tersebut dari Tagor Nainggolan dengan pemindahanpenyerahanhakgantirugi tertanggal 27 Januari 1979 dengan akte nomor 60. Bahkan sambung Sarbudin, Tagor Nainggolan membeli tanah tersebut dari Poniman yang disaksikan kepala desa saat itu

Terdakwa Cabul Menangis

Sambungan Halaman 8

kayu-kayu yang semula berada di atas truk, berserakan di aspal jalan. Meskitaksampaimemakankorban jiwa,namunsejakkejadian,jalanan menjadimacet.Bahkankemacetan sepanjang 2 kilometer itu berlangsung hingga Selasa (1/5) siang. Kaposlantas Polsek Parapat Aiptu H Nainggolan menjelaskan, truk sudahtergulingsejakSeninpukul23. 00 WIB. “Supirnya kurang memperhatikankondisiberamjalanyangsudah berlubang. Sementara di kondisi di lokasiadalahtikungan.Tadimalam antriankedaraantidakbegitupadat, namun sejak pagi hari volume kendaraan bertambah,” kata Nainggolan. Amatan METRO di lokasi, polisi yang terjun ke lokasi, terpaksa melakukan sistem buka tutup jalan. Arus lalulintas baru berjalan lancar sekira pukul 10.12 WIB, setelah truk diderek. (Rait/hez)

laporan kehilangan. Sebab awalnya mereka optimis terhadap kepulangan putrinya. Berselang dua bulan kemudian, tepatnya Senin (30/4), korban pulang seorang diri ke rumah. Saat itu keluarga langsung mengucap syukur, namun juga was-was dan curiga dengan apa yang dialami MHS. Tak lama di rumah, korban langsung diinterogasi. Pengakuannya, ia dibawa kabur penjaga sekolahnya. Namun selama itupula ia tak tahu di mana berada. Bahkan menurutnya, ia sudah diperawani JS. Mendengar pengakuan langsung dari korban, keluarganya

Puncaknya saat hakim membacakan vonis, air matanya langsung berderai. Kuat dugaan ia tak menyangka hukuman yang diterimanya bakal selama itu. Namunsetelahsidangditutup,Riki langsungdibawakeruangtahanan sementara kejaksaan dan tak bisa diwawancarai. Sebelumnyahakimyangdipimpin Usaha Ginting beranggotakan Ulina Marbun dan Janner Purba membacakanketerangansaksidan terdakwa selama persidangan berlangsung. “Peristiwa bermula, Jumat, 4 Nopember 2011 di Losmen Anugrah Jalan Medan. Karyawan Gudang Sempana ini dengan ancaman kekerasan, memaksa perempuanyangbukanistrinyayakniLM aliasLisuntukmelakukanhubungan badan layaknya suami istri,” terangnya. Sebelum peristiwa terjadi,

sampai Rp720 per lembar. Tiba-tiba saja nilai perusahaan Garuda bertambah triliunan rupiah. Garuda sangat diuntungkan! Namun, tokoh-tokoh yang telanjur berminat itu menjadi empotempotan. Tiba-tiba mereka harus membeli saham Garuda jauh lebih mahal daripada yang mereka bayangkan. Mereka tentu mengira akan membeli saham Garuda dengan harga Rp570 per lembar seperti yang saya tawarkan. Tapi, dengan kenaikan harga saham Garuda di bursa yang begitu tinggi, masih maukah mereka membeli? Atau sebaliknya, masih maukah tiga sekuritas tersebut menjual? Bisa saja para pengusaha yang semula berminat tiba-tiba mengurungkan keinginannya. Sebaliknya, bisa saja justru tiga sekuritas kita yang tidak mau melepas, misalnya, menunggu siapa tahu harga saham tersebut masih terus menanjak. Di sinilah kontroversi akan terjadi. Kehebohan akan muncul. Tiap-tiap pihak melontarkan pandangannya sendirisendiri. Kalau dilepas sekarang dan kemudian harga saham ternyata masih naik, para pengamat akan mengecam habis-habisan: Kok dijual murah! Tapi, kalau tidak dilepas sekarang dan ternyata harga saham turun lagi (batalnya transaksi ini bisa saja memukul balik harga saham), para pengamat juga akan menggebuki tiga sekuritas tersebut. Saya memilih untuk tidak mencampuri pilihan mana yang terbaik. Direksi tiga perusahaan tersebut adalah orang-orang yang sudah malang melintang di bidang itu. Mereka adalah orang-orang yang hebat. Yang penting: Putuskan! Risiko dikecam adalah bagian dari kehidupan yang sangat indah! Ambillah keputusan terbaik dengan fokus tujuan demi kejayaan perusahaan! Kalau Anda menunda keputusan hanya karena takut heboh, perusahaanlah yang

Sambungan Halaman 8 Menurut keterangan korban, sebelum kejadian, Senin (30/4) sekira pukul 20.00 WIB, mobil memang sengaja diparkirkan di lokasi kejadian. Sebab jalan ke rumah orangtuanya berjarak 50 meterdarilokasi,tidakbisadilewati mobil. Namun ia mengaku tidak lupamenguncisemuapintumobil sebelum meninggalkannya. Setelah masu ke rumah orangtuanya, korban tertidur lelap. Pagi harinya sekira pukul 07.00 WIB, ia bangundanpergiketempatmobilnya diparkirkan. Setibanya di sana,

sulit. Kalau perusahaan menjadi sulit, banyak yang akan menderita. Orang-orang yang dulu mengecam itu (atau memuji itu) tidak akan ikut bersedih! Jadikan kecamankecaman itu bahan mengingatkan diri sendiri agar jangan ada main-main di sini. Takutlah pada permainan patgulipat! Lalu, bagaimana dengan heboh pembentukan direksi baru Garuda? Itu pun rupanya juga heboh turunan. Bahkan, pergantian direksi Garuda beberapa tahun lalu bisingnya melebihi mesin 737-200. Di setiap pergantian direksi memang akan selalu muncul pertanyaan: Mengapa si A dipilih dan mengapa si B tidak? Padahal, keduanya sama-sama hebat. Tentu yang terbaik adalah semua calon yang terbaik itu duduk di dalam satu tim direksi. Itu akan menjadi tim yang kuat. Namun, adakalanya tidak semua orang hebat bisa duduk bersama-sama dalam satu tim yang hebat. Kalau dipaksakan pun, hasilnya bisa tidak baik. Orang Surabaya sering bergurau begini: Soto yang paling enak dicampur dengan rawon yang paling enak, rasanya justru jadi kacau! Para star yang dipaksakan bergabung dalam satu tim belum tentu bisa memenangkan tujuan. Bahkan, bisa saja justru terjadi perang bintang di dalam tim itu. Setidaknya bisa terjadi perang dingin di bawah selimut. Energi terlalu banyak terbuang untuk perang bintang (yang kelihatan maupun yang tersembunyi). Bahkan, lantaran yang bersitegang itu adalah atasan, bawahan mereka bisa-bisa ikut terbelah. Dalam hal seperti itu saya mengutamakan terbentuknya sebuah tim yang kompak, serasi, saling melengkapi, dan solid. Toyotomi Hideyoshi bisa menjadi panglima yang menyatukan Jepang pada abad ke-16 dengan modal utamanya: kekompakan. Bahkan, dia sendiri mengakui bahwa dirinya bukan seorang yang ahli memainkan pedang. Karena itu,

Hideyoshi mendapat gelar Samurai tanpa Pedang. Tim direksi Garuda yang baru ini dibentuk dengan semangat itu. Juga dengan semangat menampilkan yang lebih muda. Presiden SBY sangat mendukung konsep pembentukan dream team di setiap BUMN. Munculnya tim yang kuat di Garuda itu dan terjadinya transaksi 10 persen saham Garuda di tiga sekuritas BUMN mendapat sambutan yang luar biasa dari pasar modal. Saham Garuda hari itu bukan lagi naik, tapi meloncat. Bayangkan, berapa triliun rupiah pertambahan aset Garuda hari Jumat minggu kemarin itu. Lantas, bagaimana dengan orang-orang hebat yang tidak semuanya bisa masuk tim? Saya akan terus mengamati apakah mereka memang benar-benar hebat. Orang hebat adalah orang yang tetap hebat ketika gagal jadi direksi sekalipun. Orang yang benarbenar hebat adalah mereka yang mementingkan peran melebihi jabatan. Kalau mereka bisa membuktikan diri tetap hebat dalam suasana duka sekalipun, saya harus memperhatikan orang-orang hebat dengan kepribadian hebat seperti itu: dijadikan direktur di tempat lain! Tapi, ketika orang hebat itu tiba-tiba menjadi orang yang frustrasi saat menjalani ujian hidup, berarti ternyata dia belum benarbenar hebat. Ingat: Atasan yang baik adalah atasan yang pernah menjadi bawahan yang baik! Kini tim baru Garuda Indonesia dengan Dirut-nya yang tetap Emirsyah Satar harus bisa membuat Garuda terbang lebih tinggi. Garuda yang di Singapura kini sudah dipercaya menggunakan terminal 3 yang mewah itu harus tetap kerja, kerja, kerja dengan kreatif. Tiga perusahaan sekuritas itu pun, yang sudah lebih setahun lamanya menderita, tidak terlalu galau lagi. Saya yakin “Mbah Surip lokal” juga akan bisa menggendong Garuda ke mana-mana. (*)

mobil sudah tak terlihat. Panik, korban langsung menanyakan keberadaan mobil kepada warga setempat. Namun menurut warga bernamaJeksonSihombing,sekira pukul 01.00 WIB, mobil masih terlihat parkir di lokasi. “Sayasedangmenjengukorangtua yang sedang sakit. Makanya mobil saya bawa untuk persiapan bila diperlukan nantinya,” katanya di kantor polisi. Akibat kejadian, korban mengalami kerugian Rp30 juta. Kapolsek Siantar Utara AKP M Nababan, membenarkan laporan pengaduan korban. (pra/hez)

Supir Mopen Bogem.. Sambungan Halaman 8 pukul 10.00 WIB. Menurut korban, sebelum kejadianiadanempattemannyayang sama-sama duduk di kelas III SMP sedang membeli sarapan di Jalan Jawa. Setelah jajan, mereka membawa makanan ke depan SMPN 2 di Jalan Rajamin Purba, yang juga tak jauh dari sekolahnya. “Tadi aku bersama Bayu, Irham, Ezra dan Rizky membeli sarapan,” kata korban. Selesai sarapan, korban hendak membuang bungkus mi ke tempat sampah. Namun bersamaan itupulamatanyamenolehkearahpria yang disebut-sebut bernama Angga (20-an) yang sedang

menunggu mopen. “Dia itu supir mopen Sinar Siantar, sebab sering kami naik mopennya. Tapi tadi, dia memang sedang tidak membawa mobil,” ditambahkan rekan korban. Diduga merasa tidak senang karena adu pandang, Angga mendatanginya dan memukul kepala korban berulang-ulang hingga bengkak. Setelah korban tersungkur, Angga melanjutkan serangan dengan menendang kepala korban. Warga sekitar yang menyaksikankejadian,mendatangikorban dan melerai keduanya. Karena melihat massa semakin banyakyangmengancamnyaakan dilaporkan ke polisi, Angga pergi meninggalkanlokasi.(mag-4/hez)

Mayat Pria Bercelana Hitam.. Sambungan Halaman 8 Mayat tersebut mengenakan celana pendek hitam dan tidak memakai baju. Mayat pertama kali ditemukan Pardi, warga setempat. Pagi itu, Pardi hendak mendodos kelapa sawit di perkebunan tempatnya bekerja. Oleh Pardi, temuan itu dilaporkan ke kepala lingkungan setempat. Saat ditemukan, mayat tersebut terbujur beralaskan tikar merah jambu. Kondisi mayat dipenuhi belatung dan dari tubuhnya terlihat ceceran cairan yang diduga akibat proses pembusukan. Sekretaris Kelurahan Negeri Baru Samsul Khoir yang ditemui Selasa (1/5) mengatakan, belum ada warga yang mengaku mengenal jenazah tersebut. “Penemuan jenazah ini langsung kami laporkan ke polisi,” terang Samsul. Terpisah, Kapolsek Bilah Hilir AKP Agus Supriyono didampingi Kanit Reskrim Edi Syahputra mengatakan, tidak ditemukan identitas pengenal dari mayat tersebut. Untuk memastikan penyebab kematian, mayat tersebut dikirim ke RSU dr Djasamen Saragih Pematangsiantar guna diotopsi. “Kasusnya sedang kita selidiki,” kata kapolsek. Informasi diperoleh di RSU dr Djasamen Saragih, mayat pria membusuk itu tiba dibawa mobil ambulans RSU Kisaran, Selasa (1/

Sambungan Halaman Satu

Mbah Surip Lokal untuk Garuda (2/Habis) Sambungan Halaman 1

Jenguk Orangtua Sakit..

5) sekira pukul 15.00 WIB. Mayat itu dibungkus plastik hitam dan mengeluarkan bau busuk sangat menyengat. Kanit Reskrim Polsek Bilah Hilir Aiptu Edi Syahputra yang ikut mengantar mayat menerangkan, mayat tersebut ditemukan di sekitar pekuburan China, Minggu (29/4) pagi. Kata Edi, mayat itu ditemukan warga setempat bernama Pardi. Saat melintas, ia mencium bau menyengat. Selanjutnya Pardi mencari asal bau tersebut dan ternyata ia menemukan mayat pria yang sudah membusuk. Penemuan mayat tersebut dilaporkan ke kepling dan polisi. Setelah ditunggu dua hari, tidak ada keluarga yang datang untuk mengambil mayat tersebut. Akhirnya, Selasa (1/5) polisi memutuskan membawa mayat tersebut ke RSU dr Djasamen Saragih. Dokter forensik RSU dr Djasamen Saragih dr Reinhard Hutahaean mengatakan, sesuai hasil otopsi sementara, pria tersebut diperkirakan tewas sekitar dua minggu. Ciri-cirinya, tubuh setinggi 155 cm, usia sekitar 55 tahun, kurus, dan terkesan tidak terurus. Sedangkan tanda-tanda kekerasan tidak ada ditemukan. Menurutnya, mayat tersebut akan dimakamkan hari ini, Rabu (2/5) karena administrasi dari kepolisian sudah lengkap. (riz/ pra)

Dapat Pelecehan Seks Sejak SMP Sambungan Halaman 1 ketika dihubungi METRO, Selasa (1/5) mengaku, dia dan sejumlah keluarganya sangat menyesalkan kejadian tersebut. ”Dia ( pelaku) sangat keterlaluan sekali. Tega–teganya dia memerkosa cucunya sendiri. Padahal selama ini sudah kami percayakan Melati tinggal dengannya sejak ayahnya meninggal dunia,” ujarnya. Sementara, korban juga mengaku bahwa dirinya kerap mendapatkan pelecehan seksual dari opungnya sejak duduk di bangku SMP. Namun korban menganggap itu hanya ekpresi rasa sayang pelaku terhadapnya. ”Bahkan cucu saya ini juga mengatakan, dirinya sering dipeluk oppungnya saat tidur bahkan pernah juga ketika mandi kemaluannya dipegang–pegang pelaku. Rasanya keluarga kami malu sekali melihat ulahnya,” katanya. Masih kata Oppung Melati, setelah kejadian tersebut pihak keluarga korban meminta korban mengungsi ke rumah Pak Tuanya di kawasan Dusun Petatal Kecamatan Lima Puluh Kabupaten Asahan bersama anak korban. Sementara pelaku masih berkeliaran di sekitar nagorinya. ”Sekarang korban kami pindahkan ke rumah Pak Tuanya di Patatal Lima Puluh bersama anaknya supaya lebih aman. Itu kami yang memintanya supaya dilaporkan saja ke polisi, soalnya kami gerah dengan sikap Abang kami ini,” ujarnya. Sebelumnya ibu korban tinggal seorang diri di kawasan Silimbat Balige. Di sana ibu korban bekerja sebagai petani jahe dan lengkuas miliknya familinya. Sebagian hasil kerjanya kerap dikirimkan pada korban untuk membantu biaya kebutuhan hidup korban dan bayi dari hasil hubungannya dengan oppung kandungnya. ”Di Silimbat Balige ada tanah ibunya satu rante, jadi di sanalah ibunya menanam jahe dan lengkuas. Bahkan selama ini setengah pengahasilan dari menjual jahenya ini terkadang dikirimkan pada korban untuk membantu biaya membeli susunya. Soalnya gajinya sebagai karyawan pabrik tidak mencukupi,” katanya. Terpisah Pangulu Nagori Pematang Bandar Kecamatan Bandar Simalungun ketika dihubungi METRO, Selasa (1/ 5), mengaku selama ini pelaku masih tercatat sebagai Kepala Dusun IV Nagori Pematang Bandar. ”Dia sampai saat ini masih tercatat sebagai Kepala Dusun Huta IV dan selama ini kami kenal dia Gamot yang baik,” ujarnya.

Dia menambahkan, selama ini korban diketahui sempat tinggal di Bengkulu ikut dengan kedua orang tuanya. Namun setelah ayahnya meninggal dunia karena penyakit lever, kini korban menumpang tinggal di rumah oppungnya. ”Setahu saya dia pernah tinggal di Bengkulu ikut kedua orang tuanya. Namun setelah ayahnya meninggal dunia, korban tinggal bersama oppungnya (pelaku) untuk melanjutkan sekolahnya di bangku SMP. Dan kata tersangka biaya sekolah korban ditanggung olehnya sampai korban tamat,” katanya. Namun, dia berharap, agar pelaku segera mempertanggung jawabkan perbuatannya. Sebab perbuatanya sebagai kepala dusun tidak pantas menjadi tauladan di masyarakat. Jika terbukti melakukan perbuatan cabul, maka Pangulu akan menggelar rapat terbuka dengan warga. ”Saya berharap agar pelaku ini segera mempertanggung jawabkan perbuatannya. Saya sangat kecewa dengan ulah pelaku ini. Bukannya memberi contoh yang baik, malah memberikan pengaruh buruk,” ujarnya lagi. Humas Polres Simalungun, AKP H Panggabean ketika dihubungi METRO, mengaku kasus ini masih dalam penyelidikan lanjutan. ”Kasus ini masih dalam penyelidikan kita,” katanya singkat. Diberitakan sebelumnya, Jaitan Nainggolan (55), warga Simpang Parsaoran Nagori Pematang Kerasaan Kecamatan Bandar Simalungun menyetubuhi sebut saja Melati (20), warga Balige Kabupaten Toba Samosir sejak tahun 2009 silam. Akibatnya korban mengandung dan melahirkan anak dari oppungnya yang kini berusia 2 tahun. Tidak terima dengan perlakuan oppungnya, korban kemudian melaporkan kejadian itu ke Polres Simalungun, Minggu (29/4). Nisa Br Manurung (34), warga sekitar ketika ditemui METRO, Senin (30/4) di kediamannya, mengaku seminggu sebelumnya korban sempat menceritakan pada temannya bahwa dia telah dihina oppungnya dan keluarganya. Seminggu setelah korban tinggal menetap di rumah pelaku, istri pelaku pergi ke rumah anaknya di Batam. Sehingga di rumah itu korban tinggal berdua bersama kakeknya. Saat itu niat jahat pelaku muncul setelah melihat korban tertidur di kamarnya. Sejak kejadian tersebut pelaku kerap mencabuli korban dan kesempatan ini dilakukannya di lokasi yang sama. (mag–02)


RABU 2 MEI 2012

Truk Pengangkut Pinus Terguling

Jalinsum Parapat Macet 2 Km Baca


Penjaga Sekolah Culik & Perawani Siswi SMA SIMALUNGUN- MHS (17) siswi salah satu SMA di Kabupaten Simalungun, warga Nagori Silau Panribuan, Kecamatan Silau Kahean, diculik dan diperawani JS (38), oknum penjaga sekolah tempatnya mengenyam pendidikan. „) Baca Penjaga ..Hal 7


Truk logging BK 9729 BL, terbalik di Jalinsum SiantarParapat Nagori Sibaganding, Simalungun. Akibat kejadian, jalanan mengalami kemacetan sepanjang 2 kilometer, Selasa (1/5).

Supir Mopen Bogem Anak SMP

„ Jenazah Sutiman, tukang potong kayu yang tewas tertimpa pohon, Selasa (1/5).

Dihukum 2,6 Tahun

Terdakwa Cabul Menangis SIANTAR- Terdakwa cabul Riki Arfandi (25), warga Jalan Kampung Aman Sari, Kecamatan Serbelawan, Simalungun, menangis sepanjang sidang di PN Siantar, Selasa (1/5) siang. Terlebih saat hakim membacakan vonis 2,6 tahun setelah ia terbukti melanggar pasal 285 KUHPidana. Begitu memasuki ruang sidang, Riki tampak tertunduk. Meski hakim baru masuk ke ruang sidang, matanya sudah terlihat memerah dan berkaca-kaca.

do (17) warga SIANTAR- Faisal Afrian Kelurahan ragih Jalan Pdt J Wismar Sa Martoba, dihajar r nta Sia ur, Say ok nd Po a, kepala siswa supir mopen. Ak ibatny Kartini, Siantar kelas III SMP YPI di Jalan (1/5) sekira a las Se k, ka Barat ini, beng „) Baca Supir ..Hal 7

Jenguk Orangtua Sakit, Mobil Sedan Dicuri

bil Mitsubishi SIANTAR- Satu unit mo Silalahi (33), is Az lik mi BR 6 Eterna BK 172 r Jalan Sisiggi pin hilang saat diparkir di an, Siantar eh Ka an ah lur Ke ngamangaraja l ku pu 07.00 WIB. Utara, Selasa (1/5) sekira 7 „) Baca Jenguk ..Hal

Tukang Potong Kayu Tewas Tertimpa Pohon

„ Riki Arfandi

„) Baca Terdakwa ..Hal 7

Gadis Bugil Mengapung di Danau Toba ONANRUNGGU- Seorang gadis yang diperkirakan berusia 20 tahun ditemukan tewas mengapung di Pantai Namartua Sioma, Desa

Hutahotang, Kecamatan Onanrunggu, Samosir, Sabtu (28/4) sekira

„) Baca Gadis Bugil ..Hal 7

SIMALUNGUN- Seorang tukang potong kayu bernama Sutiman (48), warga Bajalingge, Kabupaten Serdang Beda-

gai, tewas setelah tertimpa pohon kayu besar yang

„) Baca Tukang ..Hal 7

Skandal Al Amin Nasution Sudah rahasia umum, untuk melancarkan negosiasi di dalam dunia para pejabat, diperlukan penghibur. Penghibur ini bisa satu orang perempuan atau bahkan lebih dari dua perempuan. Ada yang hanya menjadi teman ngobrol dan ada pula yang sampai ke ranjang. Mungkin begitulah isu gambaran skandal seks yang pernah menimpa mantan Anggota DPR Al Amin Nasution pada 2008. Waktu itu tersebar isu bahwa suami pedangdut Kristina ini tengah „) Baca Skandal .Hal 7

„ Mayat Mr X dari Kuburan Cina Labuhanbatu, sebelum diotopsi di Instalasi Forensk Pematangsiantar, Selasa (1/5).

Mayat Pria Bercelana Hitam di Kuburan China

RANTAU–Mayat pria tidak dikenal membusuk di pelataran altar kuburan China, di Lingkungan 1 Kelurahan Negeri Baru, Kecamatan Bilah Hilir, Labuhanbatu. Mayat tersebut ditemukan Minggu (29/4) sekira pukul 08.00 WIB.

„) Baca Mayat ..Hal 7

Tanah Kosong jadi Rebutan

Pengusaha dan Pengacara Saling Klaim

SIANTAR- Sebidang tanah kosong dengan luas 20 meter kali 30 meter, berada di Jalan Sisingamangaraja Kelurahan Bukit Sofa, Siantar Sitalsari, jadi rebutan. Bahkan dua pihak, masing-masing Martius Sutan Pangulu yang merupakan pengusaha RM Bukit „) Baca Pengusaha ..Hal 7


2 Mei 2012

Petani Pasang Racun di Bedengan Sawah

Minyak Tanah Dicampur Air

Meminimalisir Serangan Hama Tikus di Baja Dolok

TANAH JAWA- Untuk meminimalisir serangan hama tikus, petani di Baja Dolok memasang racun di seluruh pamatang sawah. Pemasangan dikonsentrasikan di setiap lubang tikus di bedengan sawah. Nanang (28), petani Baja Dolok kepada METRO, Selasa (1/5) mengatakan, saat ini masa tanam padi berusai 45 hari. Meski serangan hama tikus belum begitu kelihatan, namun antispasi perlu dilakukan. Menurut dia, sulit memprediksi kapan gerombolan tikus datang merusak tanaman padi. Namun petani yang sudah melakukan perburuan tikus, tak pernah bosan–bosannya untuk membersihkan bedengan atau pematang sawah. Jika petani terus menerus melakukan pembasmian hama tikus melalui perburuan atau peracunan, diyakini populasi hama tikus bisa ditekan. UPTD Petanian Tanah Jawa R Tarigan, ketika di-

SIANTAR- Pemerintah telah mengkonversi minyak tanah ke gas, namun masih banyak masyarakat yang belum beralih. Hal itu pun dimanfaatkan sejumlah oknum melakukan tindak kejahatan dengan mengoplos minyak pakai campuran solar, dan bahkan air. Minyak tanah oplosan itu pun kini sudah beredar di Kota Pematangsiantar. Seperti dialami B Sinurat (35), warga Jalan Ercis, Kelurahan Tomuan, Kecamatan Siantar Timur, Selasa (1/5). Pedagang makanan ringan dan rokok ini mendapat minyak oplosan dari agen minyak tanah bermarga Sihombing warga Simpang Marihat, Pematangsiantar.

Baca Petani Pasang ...Hal 10

Baca Minyak ...Hal 10


OPLOSAN: Minyak tanah oplosan dengan air milik B Sinurat yang hendak terjual kepada masyarakat. Selasa (1/5).

Guru SMPN 7 Disemangati


TINJAU LOKASI- Dirut PDAM Tirtalihou Ir Jhon Pariaman Saragih, didampingi Kacab Parapat Drs M Panjaitan meninjau lokasi perbaikan pipa air di Parapat, Selasa (1/5).

Pipa PDAM Direhab Total PARAPAT- Seluruh pipa milik Perusahaan Daerah Air Minum (PDAM) Tirtalihou di Parapat Kecamatan Girsang Sipangan Bolon direhab total. Rehab itu diharapkan dapat memperlancar layanan air bersih untuk 2.352 pelanggan di kota turis itu. Ir Jhon Pariaman Saragih, didampingi Kepala Cabang Parapat Drs Manahan Panjaitan, saat meninjau lokasi perbaikan pipa air di Jalan Josep Sinaga Parapat, Selasa (1/5) mengakui, layanan air untuk pelanggan PDAM Tirtalihou di Jalan Josep, Jalan Jonatan dan Jalan Bukit Barisan sebelumnya sering mengalami gangguan. “Tapi setelah rehabilitasi dan relokasi pipa berdiameter 8 centi meter itu usai, distribusi air ke pelanggan berjalan baik,” kata Jhon. Dia mengatakan, selain perbaikan pipanisasi, mereka juga melakukan penembokan di sisi um-

Baca Pipa PDAM ...Hal 10


WARISAN LELUHUR- Walikota Siantar Hulman Sitorus dan pengunjung lainnya sedang membaca panduan untuk mengenali salahsatu benda warisan leluhur di Mesum Batak, di kompleks TB Silalahi Center, Desa Pagar Batu, Kecamatan Balige, Toba Samosir, Sabtu (14/4). Selain sebagai tempat melihat dan mempelajari benda-benda kuno serta kebudayaan leluhur Batak, dari museum ini, pemandangan Danau Toba terlihat sangat menakjubkan.

SIANTAR- Walikota Siantar Hulman Sitorus mengunjungi SMPN 7 Kota Siantar di Jalan SM Raja Siantar Utara, Selasa (1/ 5) sekira pukul 8.30 WIB. Kunjungan ini bertujuan memberikan semangat kepada guru-guru dalam menjalankan tugas sehari-hari. Dalam kunjungan tersebut, Walikota Hulman Sitorus didampingi Asisten III Leonardo Simanjuntak, Sekretaris Dinas Pendidikan Mansyur Sinaga dan Kabag Humas Daniel Siregar. Hulman meminta kepada guru-guru agar tetap fokus dalam melaksanakan tugas dan tanggung jawab sesuai dengan fungsi masing-masing. “Kepada guru-guru khususnya di


DIALOG : Walikota Pematangsiantar Hulman Sitorus sewaktu berdialog dengan guru - guru yang berada di sekolah SMP N7 Pematangsiantar, Selasa (1/5). SMP Negeri 7, jangan pernah cepat mengambil keputusan dalam suatu permasalahan, apalagi suatu permasalahan

Mabes Polri Ajak Pengusaha

Lebih Banyak IRT Dibanding WPS melampaui Wanita Pekerja Seks (WPS). Ini sebagai akibat suami yang suka melakukan hubungan dengan yang bukan pasangannya. Demikian disampaikan

Baca Lebih ...Hal 10

Baca Guru ...Hal 10

Menjaga Keamanan

Penderita HIV/AIDS di Kota Pematangsiantar

SIANTAR- Penderita HIV/ AIDS (human immunodeficiency virus/Acquired Immune Deficiency Syndrome) di Kota Pematangsiantar ternyata didominasi ibu rumah tangga (IRT). Jumlah penderita bahkan

tersebut belum pernah di klarifikasi, sebab suatu per-


Kepala SMA Methodist, Samsuddin Hua didampingi PKS I, A Situmorang beserta guru pembimbing Roberd Simarmata, M Siburan dan A Sembiring foto bersama dengan siswa/i yang berhasil meraih juara, Selasa (1/5)

SMA Methodist Diutus Ikut OSN SIANTAR– Selama April 2012, SMA swasta Methodist Kota Pematangsiantar di Jalan Pane berhasil meraih segudang prestasi, baik itu di bidang pendidikan hingga olahraga. Bahkan dalam waktu dekat siswa yang

berhasil juara akan mewakili Kota Siantar untuk mengikuti lomba Olimpiade di Medan. Kepala SMA Metrhodits Samsuddin Hua SPd,

Baca SMA...Hal 10

SERBELAWAN– Tim Mabes Polri kunjungi Polsek Serbelawan. Kedatangannya untuk mengajak pengusaha saling berkoordinasi menjaga keamanan lingkungan sekitarnya. Kapolsek Serbelawan AKP K Manurung, ditemui METRO, Selasa (1/ 5) pukul 14.00 WIB, menjelaskan, kedatangan tim Mabes Polri ini bertujuan untuk mensosialiasikan dampak analisis keamanan. “Mareka datang hanya untuk mensosialisasikan dampak analisis keamanan di

Baca Mabes...Hal 10


2 Mei 2012

Sebut Wartawan Perusak Bangsa

Dompak Ancam Demo Kadiscatpil TAPUT-Hariini,Rabu(2/5)seratusan wartawan yang tergabung dari media cetak dan elektronik akan melakukan aksi demo ke Kantor Bupati Tapanuli Utara(Taput) untuk menuntut pertanggungjawaban Kepala Dinas Catatan Sipil, Marconis Siregar yang menyebut “wartawan perusak bangsa”. Koordinator aksi demo, Dompak Hutasoit, saat dihubungi METRO, Selasa (1/5) melalui ponselnya membenar-

kaniabersamasejumlahwartawanlainnya, sudah menyampaikan surat pemberitahuan ke Polres Taput terkait aksi, dengan nomor Laporan Polisi Nomor : STTP/04/IV/2012/Intelkam. Para wartawan yang akan mendatangi Kantor Bupati, akan menuntut Marconis Siregar untuk mempertanggungjawabkan dan membuktikan ucapannya. ”Selain itu, kita juga meminta kepada Bupati Taput, Torang

Mabes Polri Ajak Pengusaha Sambungan Halaman 9 sekitaran wilayah Industri seperti kawasan pabrik,” katanya. Konsep yang dipaparkan tim Mabes Polri ini rencananya akan disosialisasikan pada seluruh jajaran polsek. Sementara dirinya menilai selama ini upaya kemanan di kawasan wilayah hukumnya sudah kondusif dan aman. ”Selama ini, kita pantau untuk kawasan kita masih kondusif dan aman. Namun kita sangat senang sebab kehadiran para pengusaha dapat memberikan ruang untuk membantu kita menjaga keamanan,” katanya. Dalam acara penyuluhan itu, turut dihadiri para utusan pimpinan daerah termasuk Camat, Lurah, pemuka agama masyarakat, serta para pengusaha Industri yang berada di wilayah hukumnya ini. ”Kita juga turut hadirkan Pimpinan Pabrik Bridgestone camat lurah dan para pemuka agama serta

masyarakat yang turut kita libatkan dalam sosialisasi in,.” katanya. Bahkan tim Mabes Polri ini juga meminta masyarakat sekitar agar pihak masyarakat dapat melakukan upaya pengajuan Proposal pada pengusaha Industri jika ingin melakukan perbaikan jalur infrastruktur dikawasan mereka. ”Mereka juga minta agar para lapisan masyarakat dapat menjadi masyarakat yang lebih pintar dan kalau mereka ingin melakukan perbaikan jalan di wilayah mereka sebaiknya mereka mengajukan proposal terlebih dahulu sehingga untuk standar teknisnya dapat lebih baik,” ujarnya lagi. Terpisah, H Ponirin (45), pemuka Agama di Serbelawan, mengaku dirinya sangat senang dengan kedatangan tim Mabes Polri. Namun ia berharap agar kedatangan tim Mabes untuk tetap menjaga berita-berita dari Simalungun Hataran. (mag–02)

Pipa PDAM Direhab Total Sambungan Halaman 9

bul air Sihole. Selama ini kata dia tanah perbukitan di atas umbul selalu longsor, terutama waktu turun hujan. Lanjut Jhon, PDAM Tirtalihou juga melakukan rehabilitasi dan relokasi pipa air sepanjang 400 meter di Jalan Merdeka Parapat serta melakukan penembokan pada sisi umbul air di Sihole Nagori Sipangan Bolon berbiaya Rp185 juta dari dana PDAM sendiri. Pada kesempatan itu, Jhon mengungkapkan dalam waktu dekat, Dinas Tarukim Propinsi

Sumut juga akan melakukan pembenahan umbul air di Jalan SM Raja. Sehingga suplai air bersih kepada pelanggan di hotel maupun rumah- rumah penduduk benar- benar semakin mantab berjalan lancar. “Hal ini dilakukan dengan tujuan untuk memperlancar dan mengantisipasi kekurangan kebutuhan air dari sebanyak 2.352 pelanggan di seputaran Parapat. Secara khusus untuk mensukseskan pelaksanaan Pesta Danau Toba (PDT) 2012 yang akan terselenggara mulai 30 Juni hingga 14 Juli 2012 nanti,” harapnya. (rait)

Guru SMPN 7 Disemangati Sambungan Halaman 9 masalahan tidak akan selesai tanpa musyawarah, seperti yang kita lakukan hari ini,” terang walikota. Selain itu, Hulman juga mengatakan, siap menerima aspirasi dan masukan 1 kali 24 jam dari masyarakat, terutama guru-guru di Kota Siantar dan aspirasi para guru tersebut bukan harus dengan cara berdemo. Namun aspirasi itu dapat dilakukan dengan musyawarah yang menghasilkan suatu kesepakatan. Kabag Humas Daniel Siregar menjelaskan, tunjangan dana profesi guru Desember 2010 telah direkonsiliasi/didata ulang Juni 2011 lalu. Hasilnya akan dibayarkan pada anggaran 2012 berdasarkan Peraturan Menteri Keuangan (PMK) No34/ PMK07/2012. “Tunjangan profesi guru Desember 2011 lalu masih menunggu rekonsilasi

tahun 2012 ini,” kata Daniel. Selanjutnya Sekretaris Dinas Pendidikan Mansyur Sinaga menambahkan, bagi guru non PNS dengan status guru tetap yayasan harus memiliki 24 jam mengajar per minggu. Dibuktikan dengan SK atau surat penugasan kepala sekolah masingmasing. Serta masa kerja tugas mulai Januari 2010 hingga 31 Desember 2011. Dia mengatakan, guru yang diusulkan menerima dana insentif harus memiliki Nomor Induk Pendidik dan Tenaga Kependidikan (NUPTK). Bagi guru yang akan diusulkan tapi belum memiliki NUPTK, maka guru tersebut diwajibkan mengisi kuisioner NUPTK untuk diproses. “Guru yang belum mendapatkan tunjangan profesi (Guru PNS dan non PNS ), itulah yang berhak mendapatkan tunjangan insentif dari gubernur,” ujar Mansyur. (ral/rel)

Lumbantobing agar mengenakan sanksi disiplin kepada Marconis serta mempertimbangkan posisi jabatannya,” tandasnya. Bahkan, ungkap Dompak, pihaknya juga akan menyampaikan foto copy Undang-undang Pokok Pers Nomor 40 Tahun 1999 kepada Marconis. ”Saat aksi itu, kita akan menyampaikan foto copy undang-undang pokok pers kepada Marconis supaya yang ber-

sangkutan tau apa tugas wartawan dalam ketentuan antara hak dan kewajiban,” ujarnya. Desakanlainnya,memintaagarbupati danjajarannyamendukungtugas-tugas jurnalistik. ”Kita ini bekerja berdasarkan undang-undangpokokpers.Dalamundang-undangitujelasapasajatugaswartawan. Jadi, berdasarkan undang-undang pokok pers Nomor 40 Tahun 1999 kita meminta bupati agar mendukung

tugasjurnalistik,”paparnya. Ia menyebut, wartawan yang diperkirakan ikut sebagai peserta aksi mencapai seratusan orang. ”Kita akan bergabung dengan teman-teman wartawan media cetak dan elektronik dari Kabupaten Humbahas, Tobasa dan kabupaten tetangga lainnya untuk aksi besok (hari ini, red),” imbuhnya. Untuk diketahui, pada tanggal 21 April 2012, Marconis Siregar mengatakan kepada wartawan “Kalian Wartawan Itu Perusak Bangsa”. Padahal, saat itu, wartawan hanya mempertanyakan dugaan pengutipan pengurusan aktanikahsenilaiRp500ribudariwarga.

Marconis sendiri, saat dihubungi METRO, Selasa (1/5) melalui ponselnya, membantah dirinya menyebutkan kata-kata tersebut kepada wartawan. ”Begini pak, yang saya bilang kan yang mengaku wartawan. Tidak ada saya bilang seperti itu pak,” ujar Marconis berkelit. Namun, Marconis menyebut, bahwa dirinya sebelumnya tidak mengenal wartawan yang mendatanginya saat itu. ”Saya kan belum kenal wartawan yang datang waktu itu. Lagian semua orang tau kalau saya itu selama ini dekat dengan semua wartawan,” akunya. (hsl/des)

Minyak Tanah Dicampur Air Sambungan Halaman 9 Sinurat saat dijumpai di rumahnya Selasa (1/5) malam tadi, mengatakan, minyak oplosan yang hendak dijualnya di warung ternyata minyak tanah oplosan bercampur air. Ibu empat orang anak ini mengaku membeli minyak tanah tersebut dari seorang pria berusia sekitar 20-an tahun yang mengaku anggota pemilik pangkalan minyak bermarga Sihombing di Simpang Marihat. “Sudah bertahun-tahun saya berjualan makanan ringan dan rokok, dan belum pernah menjual minyak tanah. Seminggu lalu seorang pria dengan ciri-ciri tinggi sekira 165 centimeter, berkulit hitam, rambut gondrong mendatangi warung saya dan menawarkan

minyak tanah. Pria itu menumpangi Honda Astrea Grand warna hitam, saya tidak lihat pelatnya. Satu kali dan dua kali pria itu datang menawarkan minyak tanah, saya menolaknya. Sabtu (28/4) siang, untuk ketiga kalinya pria itu datang lagi menawarkan minyak tanahnya. Awalnya ditawarkan sebesar Rp7.500 per liter, dan saya tawar menjadi Rp6 ribu per liter. Saya pikirpikir, nggak salah mencoba jualan minyak menambah untung sedikit. Akhirnya saya membeli minyak tersebut,” ujarnya. Setelah harga per liternya disepakati menjadi Rp6 ribu, kata Sinurat, pria itu meminta dua buah jerigen miliknya untuk diambilkan minyak dari pangkalan Sihombing sebanyak 50 liter. “Pria itu sangat pin-

tar bercakap hingga membuat saya percaya kepadanya. Dia meminta jarigen dari saya untuk mengambilkan minyak pesanan ke pangkalan milik bosnya sebanyak 50 liter. Dia mengaku anggota pemilik pangkalan minyak tanah di Simpang Marihat milik marga Sihombing. Berselang sejam kemudian, pria itu datang menumpangi betor dan membawa pesanan minyak tanah tersebut. Setelah minyak tanah tersebut diantarkan ke warung, pria itu buru-buru berangkat setelah menerima uang dari saya sebanyak Rp325 ribu. Dia mengantar minyak pesanan itu, sekaligus menunjukkan contoh minyaknya didalam plastik biru,”ujarnya lagi. Lanjut Sinurat, istri Sitinjak ini, ia baru menyadari kalau

minyak tanah yang dijualnya itu adalah oplosan, sesaat pada Selasa pagi, saat seorang anak kos bernama Ana (18) membeli minyak tanah. Ana membeli minyak tanah satu liter dari warung milik Sinurat dengan harga Rp8 ribu. Ternyata, minyak tanah yang dibeli Ana tidak bisa menghidupkan api kompor. “Terungkapnya minyak tanah yang saya jual adalah dioplos dengan air, setelah Ana membeli minyak tanah dan mengaku tidak bisa menyalakan kompor. Ternyata betul apa kata Ana, minyak tanah yang saya jual dioplos air. Selama saya beli minyak tanah itu, belum pernah saya tuang dari jerigen. Kalau nggak beli minyak tanah si Ana, saya tidak tahu kalau minyak tanah yang saya

beli itu adalah oplosan,” kesalnya dan mengharapkan uangnya dikembalikan pelaku. Masih kata Sinurat, dia mengatakan dari awal dirinya sudah merasa curiga terhadap pria yang menawarkan minyak tanah tersebut. Pasalnya, pria itu menawarkan minyak tanah tanpa membawa barangnya (minyak tanah red). Sejumlah warga Simpang Marihat yang ditanyai METRO mengatakan tidak mengenal pangkalan minyak tanah bermarga Sihombing. “Nggak tau, kami pak pemilik pangkalan bermarga Sihombing di sini. Setahu kami tidak ada pangkalan minyak tanah di sini. Rata-rata masyarakat di sini memakai gas,” ujar pria berusia sekitar 40an tahun itu. (osi)

Petani Pasang Racun di Bedengan Sawah Lebih Banyak IRTDibanding WPS Sambungan Halaman 9

mintai komentarnya sangat mendukung upaya-upaya petani mengurangi serangan

hama tikus. Pihaknya setiap saat siap akan bekerjasama dengan petani untuk melakukan perburuan tikus. Namun demikian perburaun

tikus jauh lebih efektif di saat panen baru selesai. Sebab tikus-tikus muda masih bersembunyi di lobang. (iwa/ dro)


„ Teguh pemain terbaik dan top skor Gasta Tanah Jawa terima hadiah sepatu bola dan beasiswa dari Kepala sekolah SMP Negeri Hutabayuraja Vinencius Sinaga SPd, Selasa (1/5) siang.

Teguh, Pemain Terbaik Gasta Tanah Jawa

Terima Beasiswa TANAH JAWA- Dua kali menjadi top skor di ajang turnamen U-14 dan U-15 , Teguh siswa kelas III SMP Negeri 2 Tanah Jawa menerima bantuan peralatan sepakbola serta beasiswa. Bantuan tersebut diserahkan langsung Kepala SMP Negeri I Hutabayuraja Vinencius Sinaga SPd kepada pemain sayap Gasta Remaja Tanah Jawa ini, Selasa (1/5) di ruang kantor kepala sekolah. Teguh Tri Harsoyo yang dilahirkan 28 juni 1997 di Toba Sari merupakan anak ke-3 dari 4 bersauadara. Teguh berhasil mencetak 12 gol pada turnamen Karang Taruna Anggrek Simalungun se bulan lalu. Kemudian menjadi top skor pada turnamen Bangun Cup 2011 lalu. Bergabung di klub Gasta Tanah Jawa sejak 2009 yang lalu. Sejak bergabung , bakat sebagai mesin gol sudah mulai kelihatan. Sebagai striker yang haus gol, penampilan Teguh sangat ditakuti pemain bawah lawan. Tak heran jika beberapa klub besar

perekebunan sering memakai tenaga Teguh untuk memperkuat barisan pemain depan. Kepala SMP Negeri Hutabayuraja Vinencius Sinaga saat memberikan bantuan peralatan latihan sepak bola dan bea siswa mengatakan, bantuan ini merupakan bentuk kepedulian kepada atlet sepak bola yang berbakat. Meski nilainya tak seberapa namun diharapkan bantuan dapat menambah semangat dalam latihan dan bertanding. Saat ini banyak orang yang kurang memperhatikan atlet-atlet berbakat. Padahal mereka butuh dukungan moral dan moril demi mengharumkan nama baik klub dan daerah. Vinencius Sinaga yang terkenal penggemar berat sepakbola akan tetap memperhatikan karir Teguh agar lebih bersinar pada event berikutnya. “Siapa tau suatu saat Teguh bisa memperkuat tim nasional PSSI,” sebut Vinencius Sinaga. (iwa)

Sambungan Halaman 9 Agus Marpaung, Direktur Community Based Rehabilitation (CBR), kepada METRO, Senin (30/4). Ia mengatakan, sering kali istri yang jadi korban. Terutama para wanita yang tidak tahu tindak tanduk suaminya di luar rumah akan terkena penyakit HIV AIDS. Menurut Agus, masyarakat kebanyakan barasumsi bahwa penyakit HIV/AIDS terdapat pada WPS di lokalisasi. Namun setelah diteliti CBR, lembaga swadaya masyarakat yang berkantor di Jalan Asahan Batu Anam No. 26 A, ternyata dari 420 orang WPS di daerah lokalisasi, seperti Bukit Maraja (BM), Pagok dan tempat lainnya di

Kabupaten Simalungun, hanya 12 orang saja positif penderita HIV AIDS. Sementara data yang sudah terdaftar sebagai penderita HIV/AIDS di Kabupaten Simalungun sebanyak 79 orang. Kemudian di Kota Pematangsiantar terdapat 105 orang dipastikan positif menderita HIV/AIDS. Jumlah ini diketahui dari hasil pemeriksaan pelayanan Volunteri Counsling Test (VCT) atau test HIV dapat dilakukan di Rumah Sakit dr Djasamen Saragih. Dari jumlah itu diketahui jumlah penderita lebih banyak ibu rumah tangga dibanding WPS. Bagaimana bisa kata Agus, itu karena para suami diduga suka jajan di luar dengan wanita lain, baik dengan WPS maupun dengan istri tetangga. (mag-4)

SMA Methodist Diutus Ikut OSN Sambungan Halaman 9 didampingi PKS I A Situmorang, Selasa (1/5) mengatakan, selama April ini siswa di sekolahnya berhasil memenangkan berbagai perlombaan. “Jika ada undangan untuk perlombaan baik itu di bidang pendidikan ataupun olahraga, kita selalu siap sedia. Dengan bekal serta kemampuan yang dimiliki siswa, kita selalu optimis mereka akan selalu membawa nama baik sekolah ini,” ujarnya. Ia menerangkan, siswa yang berhasil meraih juara pada perlombaan Olimpiade tingkat Kota Siantar yakni Kevin Christoper juara I Matematika, Calvin Ienawi juara II Biologi, Jeslin Salim juara III Kebumian dan Juliando juara II Komputer. Kemudian lomba pidato bahasa Inggris yang dilaksanakan pihak Universitas Simalungun (USI) juara I diperoleh Cha-

tren Ienawi dan juara III diperoleh Tifani. “Siswa kita juga berhasil meraih juara pada perlombaan bahasa Mandarin yang diselenggarakan STIE STMIK IBBI dan juara I diperoleh Christin dan juara II diperoleh Sendy Pan. Kemudian lomba pidato Mandarin tingkat kota Siantar untuk non pribumi juara I diperoleh Komang, juara II diperoleh Stefany dan untuk pribumi juara I diraih Kadek Rosmayani,” jelasnya. Untuk bidang olahraga, sambung Samsuddin, siswa mereka juga berhasil meraih prestasi juara II pada perlombaan Futsal tingkat pelajar SMA. Prestasi yang saat ini diraih para siswa tidak terlepas dari bekal dan kemauan siswa untuk terus belajar. Dukungan orangtua serta Ketua Yayasan Methodist Dr Petrus Yusuf yang selalu memperhatikan sekolah ini. (mua)


2 Mei 2012

Laba-Laba Mini

Seukuran Koin

BRISTOL- Tarantula adalah salah satu spesies laba-laba yang biasanya memiliki ukuran besar dan berbisa. Namun, baru-baru ini ditemukan seekor tarantula yang memiliki ukuran sangat kecil. Laba-laba beracun ini menetas di Kebun Binatang Bristol, Inggris. Lahir dengan ukuran yang sangat kecil, laba-laba ini memiliki ukuran setara koin 5 sen. “Jenis ini adalah salah satu tarantula yang paling indah.

Ketika laba-laba itu pertama kali menetas, mereka memiliki bulu-bulu yang berwarna merah muda,” ujar pengurus hewan Kebun Binatang Bristol Mark Bushell, Selasa (1/5). “Menginjak usia dewasa, secara bertahap bulu-bulu itu

akan rontok dan berubah menjadi tarantula berbulu biru sehingga sangat menarik penglihatan,” imbuhnya. Tarantula yang bergerak cepat dan lincah itu adalah salah satu jenis laba-laba pohon paling populer. Binatang berkaki delapan ini berasal dari Martinique, di lepas pantai Amerika Selatan dan paling sering dicari karena warnanya yang sangat menarik serta mudah untuk dijinakkan. (oz)

Lumba-lumba Tolak Kembali ke Laut

Claude, si Kepiting Raksasa dari Tasmania

HUNTINGTON BEACH-Seekor lumba-lumba yang terjebak di perairan dekat Huntington Beach, California, menolak kembali ke laut lepas. Kelakuan lumba-lumba tersebut sangat membingungkan Peter Wallerstein, Direktur Program Penyelamatan Hewan Laut. ”Dia sebenarnya tidak terjebak di kawasan ini,” ujar Wallerstein. Lumba-lumba yang dipanggil dengan nama Fred itu tampak sehat dan tidak berada dalam bahaya. ”Walaupun tampaknya dia mengalami disorientasi,” kata Wallerstein. Menurut Wallerstein, lumba-lumba itu makan ikan dengan lahap. ”Itu merupakan pertanda baik,” ucapnya. Lumba-lumba dengan panjang tiga meter tersebut pertama kali ditemukan di perairan Bolsa Chica. Dia kemudian ditolong oleh kapal penyelamat yang mendorongnya kembali ke pelabuhan. Dua ekor lumba-lumba lainnya terlihat. ”Segera setelah dia melihat mereka, dia malah berbalik lagi ke jembatan,” tutur Wallerstein. ”Saya tidak pernah melihat interaksi seperti itu. Dia memilih kembali karena beberapa alasan,” kata Wallerstein terheran-heran. Wallerstein mengatakan, dia sudah mencoba lagi agar lumba-lumba itu mau berenang ke laut lepas sehingga akhirnya dapat kembali ke habitat aslinya. (kps)

TASMANIA - Kepiting raksasa masih remaja, sehingga bernama Claude ditangkap dilepas kemungkinan besar tubuhnya Pantai Tasmania, Australia, bulan masih bisa tumbuh dua kali lipat lalu oleh seorang nelayan. Kepiting dari berat badannya sekarang. raksasa itu memiliki berat 6,8 “Ini makhluk yang kilogram (kg) dan lebar 38,1 centimeter (cm). Namun kepiting langka ini tidak akan dikonsumsi di sebuah restoran. Kepiting itu lalu dijual (Foto: Int) kepada pihak di Pantai rga wa as ep dil sa sa akuarium di DILEPAS: Kepiting rak Inggris seharga Tasmania Australia. 3.000 mengesankan. Claude poundstering atau sekira Rp36 juta seharusnya butuh waktu beberapa (Rp12.173 per pounsterling). hari untuk beradaptasi, tapi sekarang Setelah menempuh penerbangan dia sedang menikmati makanannya selama 29 jam dari Australia, Claude dan tampaknya tidak ada yang lebih akan dipamerkan di pusat Sea Life di buruk dari tempat hidupnya yang Weymouth, Dorset, Inggris. baru ini di akuarium,” ujar ahli Datangnya Claude menyebabkan biologi kelautan untuk Sea Life Rob dua kepiting lainnya yang menjadi Hicks, Selasa (1/5). penghuni akuarium itu, akan Sementara menurut ahli kelautan dipindahkan ke akuarium di Jemma Battrick, kepiting tidak Birmingham dan Berlin. makan dalam porsi banyak Claude adalah kepiting yang meskipun bisa menjadi spesies berukuran 100 kali lebih besar dari terbesar. Di akuarium ini, Claude kepiting normal yang ada di pantai hanya akan diberi makan udang dan Inggris. Ternyata usia Claude saat ini cumi-cumi.(oz)

(Foto: Int)

TERJEBAK: Seekor lumba-lumba yang terjebak di perairan dekat Huntington Beach, California, menolak kembali ke laut lepas.

Usia 5 Tahun, Tamimi Telah 30 Kali Patah Tulang JARI jari kaki seorang bocah mencongkel tanah dengan hati-hati. Secara lembut ia mengistirahatkan kakinya beralaskan lantai. Dengan perlahan ia mendorongkan kakinya ke depan ketika ayahnya memegang erat pada lengannya, dan ibunya bertepuk tangan untuk menyemangatinya. Anda mungkin mengira adegan itu momen orang tua sedang mengajari anaknya pertama kali berjalan, perkiraan anda keliru. Anak itu bernama Tamimi Syawalludin Pohan, usianya sudah 5 tahun. Tamimi menderita penyakit tulang rapuh, suatu kelainan genetik yang menyebabkan tulangnya mudah patah. Bahkan terkadang, tulang patah tanpa ada sebab yang jelas. Sejak lahir hingga usia 5 tahun, Tamimi sudah mengalami sekitar 30 kali patah tulang, yang paling sering terjadi di bagian yang melengkung pada tulang paha. Ia berobat ke rumah sakit hampir setiap bulan dan orang tuanya biasanya menggunakan kartu jaminan kesehatan mereka untuk membayar tagihan medis. Ibu Tamimi, Sarina Siregar, 41, mengatakan mereka tidak pernah menghitung berapa banyak uang yang mereka keluarkan untuk membiayai pengobatan anaknya. Ketika anak-anak lain seusianya bisa berlari, Tamimi bahkan belum bisa berdiri tegak. Selama bertahun-tahun, putranya menggunakan lengan untuk merangkak mengitari rumah dan ia harus di dorong kereta bayi jika bepergian.(kps)

(Foto: Int)

PATAH TULANG Seorang bocah Tamimi dengan hati-hati dan lembut mengistirahatkan kakinya beralaskan lantai.

(Foto: int)

SPECIES: Seekor Laba-laba Tarantula Mini.

(Foto: int)

PAKAIAN UNIK: Seorang wanita mengenakan pakaian dalam dalam fashion show.

Pakaian Dalam Wanita yang


PADA saat Anda tengah membeli bra dan celana dalam, mungkin Anda akan sangat memperhatikan antara keselarasan warna atau model yang ingin dibeli. Kebanyakan pria ternyata sangat suka bila mereka melihat bra dan celana Anda terlihat matching. Artinya pakaian yang berhubungan dengan seks. Hubungan seks pasangan suami istri (pasutri) yang dilakukan dalam kurun waktu tertentu bisa menyebabkan kejenuhan karena rutinitas yang terjadi. Karena hal tersebut maka di perlukan hal-hal yang bisa mengurangi kejenuhan atau kebosanan dalam hubungan seks. Mungkin bentukbentuk pakaian dalam aneh dan unik di bawah ini layak untuk di perhitungkan. (kps)

Kepala Alex Bisa Diputar 180 Derajat EROPA- Elastisitas otot leher pria muda bernama Alexander ini membuat kita tercengang. Bayangkan, Alex bisa memutar kepalanya hingga 180 derajat. Aksi Alexander sempat membuat seorang penjaga di sebuah supermarket melempar benda yang dia pegang dan menutup mulut, tanda tak percaya. Dengan bantuan kedua tangan, Alex memutar kepala hingga ke belakang badannya. Kemampuan tubuh Alex yang berasal dari Eropa Timur ini menarik perhatian sekelompok peneliti. Alex mengaku baru tahu soal elastitas lehernya saat berlatih gym, beberapa tahun lalu. Dia pun berlatih terus hingga kepalanya bisa diputar melebihi batas ambang orang normal. Alex juga mengaku butuh energi dari seluruh tubuhnya dan konsentrasi penuh untuk melakukan aksi tersebut. (kps)


RABU 2 Mei 2012



TERCECER Telah tercecer dompet warna hitam yang berisikan SIM A dan SIM C An. Rado Dearma Saragih, STNK nopol BK 1182 DU, STNK nopol BK 1537 TD, KTP An. Rado Dearma Saragih, ATM BCA, ATM Mandiri, ATM BRI. Tercecer di sekitar Jl. Kartini bawah dekat Telkom pada tanggal 23 April 2012, pada pukul 17.00 WIB. Bagi yang menemukan hubungi : HP. 0852 6220 7171; 0812 6202 860 Tidak dituntut tapi diberikan imbalan yang sepastasnya.



Sebuah BPKB Kijang 2003 An. Ali Zainal Abidin nomor polisi B 1004 TVC dan nomor BPKB C4953351G. Tercecer antara Tiga Balata - Pematangsiantar. Bagi yang menemukan hub: HP 0813 8397 0368 Tidak dituntut tapi diberikan imbalan yang sepantasnya


2 Mei 2012

Katy Perry

Katy Perry sempat membeli apartemen di New York sebulan sebelum menikah dengan Russell Brand di India pada 2010 lalu. Kini Katy Perry menjual apartemen TriBeCa-nya itu dengan harga sekitar Rp25 miliar. Apartemen yang berlokasi di Jalan North Moore, New York itu mempunyai dua kamar tidur, dua kamar mandi, tangga kayu ceri dan teras yang menghadap ke pemandangan kota. Seharusnya, apartemen itu menjadi tempat tinggal pertama setelah penikahannya dengan Russell. Katy dan Russell menikah pada Oktober 2010 lalu di India. Namun, setelah setahun menikah, Russell mengajukan gugatan cerai pada Katy dengan alasan perbedaan yang tidak dapat disatukan lagi. Mereka akan resmi bercerai pada Juli mendatang. Katy tengah menjalin hubungan asmara dengan gitaris band Florence and the Machine, Robert Ackroyd. Mereka terlihat mesra dan Katy tak berhenti menyebut Robert sebagai pacarnya di festival musik Coachella beberapa pekan lalu. (dtc/int)

Angel LLelga elga

Jual Apartemen Seharga Rp25 Miliar

Akhirnya, Anang dan Ashanty buka-bukaan mengenai tanggal pernikahan yang telah mereka jadwalkan. Mereka mengungkapkan akan menikah 12 Mei 2012 di Masjid Albina. ”Kita melangsungkan pernikahan 12 Mei di Albina dan 20 Mei di Shangrila,” tutur Ashanty usai fitting baju pengantin di Butik Ferry Sunarto, Jalan Ciniru, Kebayoran Baru, Jakarta Selatan, Selasa (1/5). Dalam akad nikah nanti, keduanya akan mengenakan kebaya moderen tapi kental dengan budaya Indonesia. Ashanty ingin ia dan Anang tampak ingin sempurna di hari bahagia itu. Mereka memang mempersiapkan konsep tersebut cukup lama. Tak hanya tampil dengan nuansa budaya, akad itu juga bakal dibuat glamour. “Sangat detail sekali, konsepnya sudah jelas, segala sesuatu sangat baik,” ungkapnya. Namun, Anang tak akan mengundang Syahrini. “Kemarin aku telepon ke Jember (Jawa Timur), ada wejangan luar biasa begini ‘Le kalau tahu jalan itu lubang banyak kerikil jangan dilewati, cari jalan aman saja’. Aku tanya ke kakaknya jawab begitu juga, tanya ke pesantren dijawab begitu. Diundang (Syahrini) salah, nggak diundang salah. Sebagai orang dewasa harus berpikir jernih. Tanggung jawab kepada Allah,” ujar Anang didampingi Ashanty ketika ditemui di kawasan Kebayoran Baru, Jakarta Selatan, Selasa (1/ 5). (dtc/int)

Angel LLelga elga

Tak Peduli Demo Buruh Selasa (1/5) bertepatan dengan perayaan Hari Buruh Internasional. Demo para buruh banyak di berbagai titik. Di Jakarta, bisa dipastikan demo digelar di depan gedung DPR dan Bundaran HI. Apa komentar Angel Lelga soal demo buruh ini? “Kalo demo gak terlalu setuju. Karena saya lihat cenderung kisruh,

sudah kebablasan. Kalo perlu, ditanamkan kepada pendemo, harus tahu demo. Jangan bikin takut. Bukan mahasiswa cerdas kalo kisruh,” ungkapnya. Meski sudah ada pemberitahuan soal demo buruh yang banyak digelar di Jakarta, namun Angel tetap keluar rumah. “Saya kan ada syuting. Tapi saya

suruh sopir untuk cari tahu jalan mana aja yang bisa dilalui,” ujarnya. Angel yang dijumpai di sela Konser Spesial Dahsyat, Senin (30/4), mengatakan bahwa dia pasti berangkat lebih pagi dari biasanya. “Memang kebetulan syuting jam 10, jadi jam 8 pagi berangkat dari rumah,” pungkasnya. (kpl/int)

RABU 2 Mei 2012


Hal apa saja yang kamu suka atau tidak suka dari pacar kamu? Hmmm, kalau curhat bisa panjaaaang banget... So, kamu hanya boleh share tiga hal yang disuka dan tidak disukai dari pasangan kamu... Silahkan curhat biar gak galau sendiri, hehehe....


MOBIL HEMAT B B M: Wali Kota Medan H Rahudman Harahap, Rektor USU, Syahril Pasaribu melauncing mobil hemat BBM buatan mahasiswa Fakultas Teknik Mesin USU.

Beny Nadeak Yang saya suka, hanya KEJUJURAN....yang tdk sya ska SELINGKUH !!!

Siap Bertarung di Ajang SEM Asian 2012

Saddam Dasuha Hanya 2 aku suka boong nya aplagi cintanya

Aries Joe Saragih Saat ni hub saya ma sidia ge brantakan...sebenarnya yg saya tak sukai dari dia...sering membuat perasaan saya cemburu..menjengkelkan.....klo ada maunya baru omongannya enak2 di dengar....ikh...ampun..deh......

Ndra Gayus Yapo Yg aq sukai saat ber 2 ngn nya ..yg tidak aq sukai darinya saat y mnangis .....

Iman Sinaga Yang saya Suka : Apabila Dia sudah benar-benar Pengertian dan Perhatian sama saya. Yang tidak saya suka : Apabila Dia cepat-cepat marah dan kasar ngomong nya.

Rhoumlaez EviEtdjheriztinha Chietoomourank Gak pnYa paCar

JhoNi HendRiko SitinJakxz Disukai: cantik, baik, dan rajin menabung Gak disukai: bau, jorok, pelit

Ifull Bandara Turnipz Lagi ga punya pacar nih... coment deh??!

Lindunk Mike Turnipz Disukai : Harum & bersih , Jujur , tegas & mandiri Tdk suka : Suka berbohong , Cemburuan , bersifat kekanak kanakan

Wasis Ragiel D’souza Wangi,baik, n jg cntk,

Isabella Manurung Hal yang aku suka kalau dia lagi bilang sayang , kangen , cinta ma aku Hal yang aku gk suka kalau di tlfn , gk pernah enak ngobrolnya alasanny slalu sibuk ,

EghaLuiisha Charagieh Yg q suka dy tu pngertian n pRhatian bgt. tp kLo uda marah, cuek bgt. cuek se cuek2 na. :D

Prima Gultom Pacar yg aq suka, Takut akan Tuhan,itu harga mutlak...... dan mungkin yg tidak disukai itu hal yg umum z, pokoknya smu hal2 yg tidak baik itu tidak aq sukai.......

MED AN- Sebanyak 14 MEDANakultas TTeknik eknik Mahasiswa FFakultas Universitas Sumatera Utara (FT (FT-USU) jurusan TTeknik eknik Mesin, yang tergabung dalam tim yang diberi nama Horas berhasil meluncurkan mobil hemat bahan bakar bakar,, Senin (30/4) di Pendopo USU Medan. Hasil rancangan mahasiswa ini rencananya akan diikutkan dalam kompetisi Shell Eco-Marathon (SEM) Asia 2012 di Sepang, Malaysia, Juli mendatang. “Selain USU ada 17 tim lainnya yang berhasil masuk dalam SEM. Hanya saja untuk Sumatera, hanya USU sebagai perguruan tinggi yang bisa masuk,” ungkap Manajer Tim Horas, Munawir R Siregar, di sela-sela peluncuran mobil Horas di pendopo USU, kemarin. Masih menurut Munawir, keikutsertaan USU dalam SEM Asia 2012 merupakan yang pertama selama tiga tahun kegiatan itu digelar. Yang mana, sambungnya, USU akan berkompetisi dalam kelas kendaraan Urban Concept atau mobil yang dirancang untuk menyerupai konsep mobil perkotaan saat ini, dengan bahan bakar bensin. Sejauh ini, bilang Munawir, rekor untuk katagori Urban Concept, sementara masih dipegang oleh Institut Teknologi Sepuluh Nopember Surabaya dengan pencapaian 149,8


km per liter. “Target kita saat ini yakni bisa mencapai 200 km per liter agar bisa menjadi juara, dan saat ini masih 90 km per liter. Untuk itu, kita masih akan terus melakukan penyempurnaan untuk mengejar hasil rekor tahun lalu,” sebutnya. Disinggung mengenai pembiayaan dalam proses penciptaan mobil itu, diakui Munawar akan membutuhkan biaya yang tergolong besar. Setidaknya selama 8 bulan pengerjaan rancangan mobil sudah meghabiskan sekitar Rp60 juta. “Di mana, biaya yang dibutuhkan untuk membangun kendaraan, serta akomodasi tim untuk berkompetisi di SEM Asia sesuai proposal mencapai Rp250 juta. Karena hingga saat ini masih banyak yang harus kita perbaiki lagi agar catatan nilainya bisa lebih baik,” terangnya. Dalam kesempatan yang sama Rektor USU, Syahril Pasaribu memberikan apresiasi yang besar, dengan keseriusan para mahasiswa mempersiapkan mobil rancangannya.


“Kalau aku bisa memberimu sesuatu, hal-hal kecil di sekitar satu hadiah saja untuk sepanjang hidupnya. sisa hidupmu, hadiah itu adalah Semalam bersama Emma, yang awalnya sempat membuat ini. Kepercayaan diri.” Emma Morley dan Dexter Dexter ingin segera meningMayhew kuliah di tempat yang galkannya, berubah menjadi hal sama, tapi mereka baru saling menyenangkan ketika esok bertegur sapa di malam paginya mereka meluangkan kelulusan. Saat itu pula Dexter waktu bersama. Mereka mendaki menginap di tempat kos Emma. tebing Salisbury, tertawa dan Mereka menghabiskan malam mengobrol. Inilah awal dengan saling mengobrol. Dex- persahabatan mereka dimulai. Emma dan Dexter saling ter, pria tampan yang memesona dan seorang playboy dari menyayangi dan membutuhkan keluarga yang cukup terpandang. satu sama lain. Namun mereka Emma, wanita cerdas dan cantik tak ingin mempertaruhkan jalinan yang tidak menyadari dirinya persahabatan yang ada. Ikatan menarik, anti kemapanan serta pertemanan mereka tak selakaku. Dua tipe yang bertolak manya indah. Ada tahun-tahun belakang tapi berhasil menjalin k e t i k a sebuah persahabatan. Malam itu Emma e Day mengajak Dexter dul Asli: On Ju bercakap tentang d Nicholls rencana mereka setelah Penuliss: Davi lody Violine ran dan Me b a lulus kuliah. Dexter S b o B : h Penerjema bercita-cita keliling du010 nia untuk memenuhi ) Cetakan: 2 ri Erlangga hasrat berpetualangsi (Divisi da n se E : it rb e nya. Emma dengan Pen cita-citanya yang Tebal: 421 sederhana, mengubah

“Setiap saya pulang praktek saya sempatkan melintas di lokasi mereka merancang mobil, dan anak-anak kita lihat terus bekerja tanpa mengenal lelah. Ini menunjukan keseriusan mereka untuk menyiapkan mobil ini,” sebutnya. Syahril juga mengaku bangga, karena USU bisa ikut berkompetisi dalam kegiatan SEM Asia 2012. Dan, tidak semua perguruan tinggi mampu lolos dalam perlombaan ini. “Horas adalah bukti bahwa semangat mahasiswa kami dalam menghadapi isu dan tantangan energi masa depan yang tidak kalah dengan perguruan tinggi lain di Indonesia, maupun Asia. USU sangat bangga akan kompetisi dan kerja keras dari mahasiswa fakultas teknik,” ucapnya. Syahril juga mengaku, dalam menciptakan rancangan mobil tersebut memang memiliki hambatan biaya sangat besar. Namun begitu, Syahril meminta mahasiswa tidak patah semangat. Sebab, rektorat akan membantu menyarikan pendanaan dari pihak luar, baik itu institusi pemerintahan

atau swasta. “Ini bukan persoalan menang kalah, ini persoalan kemampuan. Kita ingin buktikan bahwa anak medan bisa berkompetisi di level internasional,” jelas Syahril. Sementara hal yang sama juga diungkapkan Wali Kota Medan Rahudman Harahap, yang berkesempatan hadir dalam kegiatan itu. Rahudman memberkan apresiasi yang tinggi atas ide dan kreativitas mahasiswa yang menciptakan rancangan mobil hemat energi. “Kita bangga karena kita satu dari 18 tim yang bertarung dalam kompetisi ini, terlebih USU merupakan wakil dari Sumatera,” ucapnya. Rahudman mengaku, jika mobil itu nantinya bisa dikembangkan lebih baik lagi, maka pihaknya melalui Pemerintah Kota memiliki keinginan untuk membeli kendaraan tersebut untuk dipergunakan sehari-hari. Selain sebagai upaya mendukung penghematan energi juga mempromosikan hasil karya anak Medan. (uma/smg) mereka tidak berhubungan satu sama lain. Tidak sepenuhnya menghilang, karena baik Dexter dan Emma menyimpan kerinduan yang sama. Mereka bertemu kembali di sebuah pesta pernikahan kawan lama. Berjanji untuk kembali berteman. “Mereka sangat jarang membicarakan perasaan satu sama lain: kata-kata indah dan perhatian hangat mungkin tidak diperlukan antarsahabat yang hubungannya telah teruji dengan baik.” (hal 339) Kisah diceritakan secara berurut, sampai terakhir kematian Emma. Kemudian alur cerita maju mundur. Novel ringan dengan pemikiran yang cukup mendalam dan mencerahkan. Konflik batin serta perenungan-perenungan yang dialami oleh setiap tokohnya sangat hidup.Yang menarik dari novel One Day adalah adanya proses pendewasaan diri dari masa dewasa ke saat paruh baya melalui renungan dari tokoh Emma dan Dexter. Namun ada beberapa kesalahan eja di dalam novel ini, seperti penulisan nama Dexter. Di awal di tulis Dexter Mayhem, kadang kala tertera Mayhew. Dan teksnya sangat imut serta rapat membuat saya tidak bisa melepas kacamata.. hehe. Namun cerita yang menarik membuat saya bertahan menyelesaikannya dalam dua hari :) (int)



2 Mei 2012


36 26





2 Man United

36 26





3 Arsenal

36 20





4 Tottenham

35 18





5 Newcastle

35 18






28 26 22

Van Persie Wayne Rooney Sergio Aguero

Arsenal Man United Man City



35 29





2 Barcelona

35 26





3 Valencia

35 15





4 Malaga

35 16





5 Levante

35 15





PENCETAK GOL Lionel Messi Ronaldo Higuaín

Barcelona Real Madrid Real Madrid


Juventus Milan Napoli Udinese Lazio

35 35 35 35 35

21 22 14 15 16

14 0 8 5 13 8 10 10 7 12

62-18 68-28 62-43 47-35 50-45


Ibrahimovic Cavani Di Natale

Milan Napoli Udinese

Pukul 01.45 W IB

77 74 55 55 55

helsea saat ini masih duduk di posisi enam klasemen sementara dengan poin dikumpulkan berjumlah 61. Meski kompetisi tinggal menyisakan tiga laga, peluang John Terry dkk masuk empat besar masih terbuka lebar, mereka cuma terpaut satu angka dari Newcastle dan Tottenham Hotspur yang ada di urutan lima dan empat. Tengah pekan ini The Blues bisa masuk kembali ke jajaran empat besar terkait jadwal tanding mereka dengan The Magpies. Jika bisa meraih tiga poin, dan pada laga lain Spurs kalah atau imbang, maka Chelsea akan bertengger di posisi empat. Pasukan Roberto Di Matteo memang terus menunjukkan permainan terang benderang. Ia bahkan bisa membuat Fernando Torres mencetak hattrick saat melawan QPR di Stamford Bridge. The Bluesmemangpunyarekorhampirsempurna di The Bridge sejak Di Matteo mengambil alih. Merekatelahbermaintigakalidengan hasil dua kemenangan (vs Stoke dan Wigan) serta seri saal melawan Tottenham. Secara keseluruhan musim ini merekatelahmemenangi11dari17laga kandang dengan hanya tiga seri dan tiga kekalahan.


YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 / bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari MAHAGA SEJAHTERA: membuYAYASAN tuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515SEGERA: 1742 DIBUTUHKAN Tenaga kerja wanita

usia 17-40 Tahun dengan posisi sbb:Baby Sister,Perawat jompo/Pribadi,PRT,syarat fc.ijazah, KTP, KK, gaji bersih 700rb s.d 1.500rb/ bulan + bonus + THR, makan, asrama, dijemput loket,gratis.hub YYS Marel Mandiri.JL.Cengkeh Raya No 18.C Medan HP 0813 6199 9211: 0878 6968 7879.

BARU SUZUKI ERTIGA Suzuki Ertiga, 7 Penumpang (3 baris) 1400cc DP 10% atau bunga 3,220% mulai Rp. 150Jt-an Ready Stock : carry Pick Up Dp. Rp. 13Jt Angs Rp. 2Jt-an APV Pick up Dp. Rp. 18Jt Angs Rp. 2Jt-an APV Arena Dp. Rp. 17Jt Angs Rp. 3Jtan Hub: PT. Trans Sumatera Agung, Ricky HP 0812 6570 683 Ikuti Test Drive Berhadiah Suzuki NEW NISSAN: Grand Livina, Nissan Juke, Ertiga Nissan X-Trail, Navara, Murano. Ready Stock. Cash/Credit Hub. Wandi 0813 61400 0058, 061-7770TOYOTA 9408 SIANTAR • All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya

DAIHATSU PAKET MURAH 100% DP Angsuran • Xenia 12.750.000 3.125.000 • Terios 15.000.000 4.090.000 • Luxio 19.100.000 3.961.000 • Pick up 9.000.000 2.432.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0878 9228 2993. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio





Chelsea Newcastle

3 0

Chelsea akan menjalani laga krusial kontra Newcastle United dini hari nanti. Dan, pada pertandingan yang akan menentukan posisi empat besar, pasukan Chelsea mengklaim kalau mereka diuntungkan karena sudah terbiasa berada di sana.


43 43 21


• All New Xenia Ready stok • Terios Ready stok • Luxio Dp 15% (hadiah menarik) • Sirion Dp 15 % • Pick up Dp 15 % • Mini Bus Dp 15 % hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Proses cepat data dijemput. Menyediakan TEST DRIVE!!





The Bridge bukan sepenuhnya benteng lagi seperti era Jose Mourinho tapi setidaknya permainan mereka meyakinkan di Stadion sebelah Taman Makam Bromptom itu. Sebaliknya, NewcastlelawanTheBluespadadinihari nanti kerepotan di tandang. Rekor mereka di luar Sports Direct Arena adalah 7-3-7. Tentu saja The Magpies antara lain menang meyakinkan di Bolton. Blackburn dan Swansea. Tapi, dalam laga laga itu tuan rumah beberapa kali membuang kesempatan sebelum Newcastle mencuri gol lewat serangan balik. Setidaknya laga yang melibatkankeduatimsepanjangmusim

CASH & CREDIT: Rumah tipe 36/42/45. Atap Multi roof, atap rangka baja ringan, dinding batu bata, gibsun, relief keramik. RUKO LANTAI 1 : Pondasi untuk 2 lantai atap cor, dinding batubata, dilokasi sedang dibangun Martoba Water park. PERUMAHAN BERSATU MAJU : Lokasi jl. Pdt. Wismar Saragih P. Siantar.Telp. 081370261747-085296029651-081361161011081362303662.

· All New Avanza ..Ready Stock ! Bonus Lengkap ! · All New Avanza VELOZ ... Bonus Lengkap !! · YARIS...Ready Stok,Diskon besar, Buruan !! · New Rush ..... Ready Stok !! · Grand New Innova .... Ready Stock !! · Grand New Fortuner ... Ready Stock !! · Hilux S-Cab/D-Cab .... Bensin/Diesel !! HUB. HUB. RICKY. M - 0853 7199 9499- 0812 6505 3191 SALES EXECUTIVE TOYOTA SIANTAR. Data dijemput, Cash/Credit PROSES CEPAT..!! DIJAUL: 1 unit mobil Suzuki Escudo Nomade, warna hitam coklat, tahun 1997, harga 90 jt (nego) tanpa perantara, yang berminat hub. HP 0852 7563 8768 Y br Saragih

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 150 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan. Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 DIJUAL TOYOTA KIJANG PICK UP: tahun thn + 1.6 jt per bulan, selama 15 thn + 1.3 90. hub. HP 0853 7078 6233 jt per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) ABADIMOTORPROMOAKHIRBULAN •Mio sporty 2007 (putih) •Mio sporty 2010 7070442. (hijau) • Mio sporty 2011 (hitam, merah, CASH & CREDIT: Menyediakan rumah hijau dan putih) •Vega R new 2008 •Vega dan tanah kavling sesuai tipe dengan ZR 2011 (putih, biru dan hitam) •Jupiter Z new 2011 new 2011 CW (merah, hitam) yang anda inginkan dan stok yang •Shogon RR 2008 •Spin 2008 •Spin 2010 tersedia. Hub: Alboin Sidabalok di No.Telp. •Revo Absolute 2009 •Revo 2008 •Vario 0813 76122445; 08126207631; (0622) CW 2008 •Jupiter MX 2009 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 tahun + Rp 16 jt per bulan selama 15 tahun + Rp 1,3 jt per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Rp 100 jt, DP 20 jt, angsuran selama 10 thn + Rp 1 jt per bulan, selama 15 thn + 800 rb per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 DIKONTRAKKAN: Rumah 1 pintu, permanen, uk 4,5 x 9 M, 1 kamar tidur, ruang tamu, dapur, kamar mandi WC di dalam air PAM listrik Jl. Dahlia 27 / Bel P. Siantar. hub. AFIF HP 0813 6235 6727 CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Rp 175 jt, DP 40 jt, angsuran selama 10 thn + Rp 2 jt per bulan, selama 15 thn + 1,6 jt per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Rp 150 jt, DP 30 Jt, angsuran selama 10 thn + 1,7 juta per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

selalu bisa menghibur publik. Satu hal yang mendukung Newcastle dalam laga ini adalah terbelahnya konsentrasi tuan rumah ke final Piala FA vs Liverpool yang akan diadakan pada Sabtu (5/ 5).Chelseabisamemanggilkembali Branislav Ivanovic setelah menjalani skorsing tiga laga di kompetisi domestik. Fakta itu

CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Rp 200 jt, DP 50 jt, angsuran selama 10 thn + Rp 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan, Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 42 Luas tanah 9x12 m, atap baja ringan dinding batu-bata, gimsum, relief lantai keramik, PLN., PDAM SHM, IMB dan KPR. PERUMAHAN SETIA NEGARA BARU : lOKASI JL. Pengintai Komp. setia negara IV Telp. 081370261747- 08529602965, 081361161011- 081362303662. CASH & CREDIT: 10 x 21,8 m Rp 76 jt, 20 x 22 m Rp 154 jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Rp 95 jt, Dp 20 jt, angsuran selama 10 tahun + Rp 950 rb per bulan, selama 15 tahun + Rp 752 rb per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 47 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar. CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Rp 200 jt, Dp Rp 50 jt, angsuran selama 10 thn + 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan. Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

meringankan pikiran Di Matteo yang masih harus tanpa jasa Garu Cahill dan David Luiz. “Kami harus bermain kontra Newcastle dan saya aka memantau kondisi para pemain dalam dua hari ke depan untuk melihat apakah bisa memilih tim kuat,” ujar Di Matteo di situs resmi klub setelah melawan QPR. “Kami harus menunggu kabar

CASH & CREDIT: 1.908 M2 Rp 300 jt, cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT : Rumah tipe 36, tipe 42, Atap Multi roof, dinding batu bata , gimsum, relief lantai keramik. RUKO TIPE 40: Pondasi untuk 2 lantai, atap cor, dinding batu -bata, relief pintu besi , PLN, PDAM, SHM, IMB, dan KPR. PERUMAHAN BATU PERMATA RAYA : Lokasi Jl. Batu permata raya ujung-kelurahan bah kapu.Telp. 081370261747-085296029651081361161011-081362303662 CASH & CREDIT : Rumah tipe 36, 42. atap Multi roof, rangka atap baja ringan, dinding batubata, gimsum, relief lantai keramik. RUKO TIPE 40 : Pondasi untuk 2 lantai, atap cor, dinding batu-bata, relief pintu besi, PLN, PDAM, SHM, IMB, KPR. PERUMAHAN HERAWATI INDAH : Lokasi Jl. Viyata Yudha ujung,kelurahan Bah Kapul.(tojai baru) Telp. 081370261747085296029651-0813611611011-081362303662.

Cahill,Luiz,danJohnMikelObiyang cedera hari ini. Dan, Ivanovic bisa kembalilagi,”lanjutsangpelatih. Di Matteo akan mengejutkan banyak orang apabila mempertahankan tim sama seperti kontra QPR dengan Wembley menatap kurang dari tujuh hari. Kendatitakmengutarakannyasecara ekspisit,perubahanpastiada.(INT)

PIJAT DAN LULURAN “MBAK SARI”: Jika Anda Capek, Pegal, Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan Badan, Urut Bayi, Terkilir serta Luluran. Hub: kami di Jl. Usgara No. 1 (Masuk dari Jl. Bali samp. SMK Negeri) P. Siantar HP. 0812 635 5430 PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852.7600 0031; 0813.9688 9800. PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar Hp. 0813 7658 8917

CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

PIJAT DAN LULURAN “IBU SUM” Jika anda capek, pegal linu, lesuh, lelah kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran hub kami di Jl. flores No. 07 P. Siantar HP 0812 6526 0864; 0813 754 74647

CASH & CREDIT: 5 x 20 m Rp 17 jt, 10 x 20 m Rp 34 jt, 15 x 20 m Rp 51 jt, 20 x 20 m Rp 68 jt. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

MENYEDIAKAN ANEKA HEWAN PELIHARAAN: Burung hias/konsumsi, pheasant, bebek hias, reptile, kura-kura (import & lokal), hamster, landak mini, merpati, ayam, perkutut, anjing, kodok hias, kelinci, cicak, jangkrik, ulat Hongkong/Jerman, kroto, aksesories, pakan, kandang dll. hub. 0878 6849 0858 Medan

DIJUAL: Tanah, sertifikat, luas tanah 825 M2, lokasi Jl. SM Raja Kel. Bah Kapul Kec. Siantar Sitalasari Kota P. Siantar hub. HP 0812 9892 163 DIJUAL TANAH: Tanah ukuran 8x23,m (SHM) dan Rumah/bangunan 7 x 15 M. Kamar Tidur 3,Kamar Mandi 2, Keramik,Gipsun. Harga 275 Juta /NegoLokasi Jl. Lau Cimba Ujung. Pematangsiantar. HP 0813 7043 4885 / 0813 7031 6990 (TP) CASH & CREDIT TANAH: 5 x 25 m Rp 25 jt, 5 x 20 m Rp 20 jt, cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” BUTUH DANA CEPAT: • SERTIPIKAT • BPKB Hub: KAMI PT BPR EKA PRASETYA Jl. SM Raja no 202. P. Siantar (depan parluasan) Telp. 0622 - 430780; HP 0852 7657 8625 HARI INI INVESTASI: Mulai besok dapat profit 7% Rp. 6.300.000 setiap harinya non stop selama 200 hari (Tanpa Rekrut) Minat???? SMS "Petunjuk" ke HP 0877 8847 7900

DIJUAL: Tanah 2 kavling ukuran 22 x 23 M2, SHM, harga nego, lokasi Komp. Bah Kapul Indah Kel. Sitalasari Siantar. hub. HP 08116051 166 (TP) DIJUAL: Rumah ukuran 4,5 x 27 M di Jl. Sudirman No. 56, Harga nego. hub. 0622 25694; 0813 9630 0319

TERCECER: BPKB dan STNK asli, merk kereta Jetwin dengan nopol BK 2429 MV, tercecer di Blok 12 Batu III Desa Nagori Bosar Kec. Panei, pada tanggal 30 April 2012, jam 16.00 WIB. Bagi yang menemukan hub. HP 0821 6262 4364; 0812 6568 3083 An. Nurul

PIJAT DAN LULURAN “IBU Restu” jika anda capek, pegal linu, lesuh, lelah kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran. Jl. Simpang Viyata Yudha Komp. kelapa-2 dekat sekolah RK Katolik Asisi P. Siantar HP 0821 6681 7943; 0813 9635 4127

HOTLINE Telp. 0622 - 7553511

Edisi 269 „ Tahun VIII

RABU, 2 MEI 2012

Pakai Modus Kiriman Berisi Keripik Kentang

„ Kalapas Marasidin

PANDAN- Sipir Lapas Sibolga di Tukka, Tapteng menemukan dua paket kecil narkoba jenis sabusabu dari dalam paket bungkus makanan ringan berupa keripik kentang. Sabu tersebut ternyata titipan dari dua narapidana berinisial CC (22) dan F (33).

Kalapas Sibolga Marasidin Siregar ketika dikonfirmasi METRO, Selasa (1/5) membenarkan penemuan dua paket sabusabu seberat tiga gram di dalam bingkisan kepada warga binaan lapas. Sabu-sabu itu coba untuk

diselundupkan Sabtu (28/4) siang. “Prosedurnya setiap barang titipan memang harus diperiksa dulu. Saat diperiksa itulah sipir ‹ ‹ Baca

2 Napi..Hal 2

Jenazah Petinju Tapteng Diantar 13 Sahabatnya SORKAM- Jenazah Samuel MD Situmeang (25), petinju asal Tapteng yang tewas digilas truk di Medan, tiba di rumah duka Desa Tarutung Bolak, Kecamatan Sorkam, Selasa (1/5). Jenazah korban yang diantarkan 13 sahabat karibnya selama kuliah tersebut disambut isak tangis keluarga.

Pantauan METRO, sesampainya jenazah di rumah duka, pihak keluarga dan sanak saudara terutama kedua orang tua korban menangis histeris. Demikian juga warga yang datang melayat turut meneteskan air mata menyambut jenazah ‹ ‹ Baca

Jenazah..Hal 7


„ Ayah Samuel menangis histeris melihat jenazah putranya, Selasa (1/5).

6 Kader Demokrat Akui Kesalahan TAPTENG- DPC Partai Demokrat Tapteng akhirnya mengklarifikasi tujuh kadernya di DPRD yang dinilai melanggar AD/ART partai. Pelanggaran utama yakni ikut melakukan mosi tak percaya terhadap Ketua DPRD Sintong Gultom yang diusung Demokrat. Dari ketujuh kader tersebut, hanya enam yang bersedia memenuhi panggilan klarifikasi. Keenamnya pun mengakui ‹ ‹ Baca

6 Kader..Hal 2


„ Angelina Sondakh (tengah) seusai menjalani pemeriksaan kesehatan di rumah sakit Perhati, Jakarta, Selasa (1/5).

Hidung Bernanah, Angie Dilarikan ke RS JAKARTA- Setelah lima hari dikurung di rutan KPK, kondisi Angelina Sondakh semakin melemah. Penyakit sinusitis yang sudah lama diidapnya kumat. Anggota Komisi X DPR ini Selasa siang (1/5) langsung dilarikan ke RS THT Perhari Jalan Proklamasi Jakpus. Ternyata, hidung Puteri Indonesia 2001 itu bernanah. Kuasa hukum Angie, Teuku Nasrullah setelah menjenguk kliennya di rutan KPK pagi kemarin menceritakan, kondisi Angie lemah. “Dia nggak bisa bangun dari tempat tidur, kesakitan karena sinusnya,” kata Nasrullah kepada wartawan di luar ruang tahanan KPK. Menurut Nasrullah, Angie sudah mengidap

Kasi Camat..Hal 2

‹ ‹ Baca


„ Melati bersama neneknya M br P ditemui di rumahnya, kemarin.

‹ ‹ Baca

Hidung..Hal 2

Andrew Weintraub, Profesor Universitas Pittsburgh dan Vokalis Dangdut Cowboys (1) „ James L Purba

Keluarga Korban Cabul dan Pelaku Berdamai SIBOLGA- Kasus pelecehan seksual yang dialami sebut saja Anggrek (5) berujung perdamaian. Ini setelah ibu Anggrek, IW br S (31) menerima perdamaian yang ditawarkan pihak orangtua tiga murid SD yang mencabuli putrinya. Kepada METRO, IW br S, saat ditemui di rumahnya di Sibolga, Selasa (1/5) menuturkan, ketiga orangtua GH (6), AR (6) dan JM

BARUS- Oknum kepala seksi di kantor Camat Barus, ERS (52) tega menyetubuhi cucu tirinya, sebut saja Melati (6). Bahkan, perbuatan asusila terhadap murid SD tersebut dilakukan warga Barus ini berkali-kali sejak dua tahun lalu. Nenek korban R br P (46) yang juga istri ERS saat ditemui METRO, Selasa (1/ 5) di rumahnya di Barus menuturkan, pertama kali pencabulan terhadap cucunya tersebut diketahui tahun 2010 lalu. Saat itu cucunya Melati mengeluh kesakitan di bagian kemaluannya ketika buang air kecil. Merasa ada yang ganjil, dia pun melihat kemaluan cucunya yang ternyata sudah terluka. Namun, dia tidak curiga cucunya dicabuli suaminya. R br P menduga bahwa itu hanya sakit biasa. Disebutkannya, beberapa

(12), mendatangi kediamannya Senin (30/4) sekira pukul 22.00 WIB. Tujuannya, mengajak pihak keluarga korban untuk berdamai. “Ortu GH, AR, dan JM telah mengetahui bahwa saya telah melaporkan kasus itu ke polisi, Sabtu lalu (28/4). Jadi ketiga orangtua pelaku datang ke ‹ ‹ Baca

Keluarga..Hal 7

Kesulitan Cari Referensi Tertulis, Tak Sengaja Menemukan di Belanda Nama Andrew N Weintraub jelas kalah tenar dengan Rhoma Irama atau Inul Daratista. Namun, dalam dunia dangdut Indonesia, Andrew bukan orang asing. Dia adalah profesor dari Universitas Pittsburgh, AS, yang secara komperehensif meneliti dangdut. Dia juga membentuk kelompok orkes dangdut di Pitssburgh bernama Dangdut Cowboys. Hendromasto, Jakarta

„ Andrew Weintraub

PADA 2010 lalu nama Andrew melejit di sela-sela gegap gempitanya dunia dangdut tanah air. Saat itu, dia baru saja menyelesaikan bukunya berjudul Dangdut Stories: A Social and Musical History of Indonesia‘s Most Popular Music. Buku itu baru saja dialihbahasakan dan diterbitkan dalam bahasa Indonesia awal bulan ini dengan judul Dangdut: Musik, Identitas, dan Budaya Indonesia. Perjumpaan Andrew dengan dangdut sudah terjadi pada 1985. Saat itu,

sebagai mahasiswa musikologi, dia melakukan penelitian terhadap musik Sunda. Bandung menjadi kota tempat tinggalnya selama penelitian itu. Saat di Bandung dan mulai menyiapkan penelitiannya, Andrew mendapati sebuah musik yang tidak akrab di telinganya. Dia juga melihat musik itu manjur untuk membuat pendengarnya bergoyang dan begitu digilai banyak telinga. “Saya sempat berniat ‹ ‹ Baca

Kesulitan..Hal 7


2 Mei 2012

Kasi Camat Setubuhi Cucu Selama 2 Tahun Sambungan Halaman 1 minggu kemudian, R br P yang sedang mencuci pakaian di kamar mandi, curiga dengan suaminya yang bersama korban diruangtengahrumahnya.Kemudiandia pun mengintip suaminya bersama cucunya. “Saya sangat terkejut bagaikan disambarpetirmelihatcucukuitusedang oral seks. Kemudian suami saya minta maaf kepada saya dan berjanji tidak akan mengulanginya lagi. Dia (ERS, red) juga mengaku hanya sebatas sampai di situ. Karenamasihsayangsayasamasuamiku itu, saya maafkanlah perbuatannya saat itu,” ujar R br P saat ditemui METRO memangku cucunya Melati. Dilanjutkan ibu lima anak itu, pada Februari 2012 lalu, dia kembali memergoki suaminya ERS sedang mencabuli cucutirinyadidalamkamarkamarrumah mereka. R br P pun bertanya pada suaminya apa yang dilakukannya di dalam

kelambu kamar. Namun ERS mengakui sedang menidurkan Melati. R br P pun tidak percaya begitu saja terhadapapayangdikatakansuaminya.Dia berusaha menginterogasi cucunya tersebutdenganmembawakeluarrumah. “Di luar rumah Melati mengaku telah diperkosakakeknya.Sayatanyalagisuami saya, dia akhirnya mengaku telah memerkosacucusaya.Iapunmintamaaf lagi dan menyembah-nyembah serta berjanjitakakanmengulangilagi.Sayapun tidakmelaporkepihakberwajibkarenasaya masihsayangsamadia(ERS,red).Kamipun tetaptinggalsaturumahbersamacucusaya itu,”terangnya. DiutarakanRbrP,padaJumat(13/4)lalu, suaminyapulangkerumahdalamkeadaan mabukberat.Saathendakmasukkedalam kamar,sebuahkartuhandphonesuaminya terjatuh.RbrPpunmengambilkartutersebut danmemasangnyakehandphoneyanglain. Tiba-tibadilayarHpmunculbeberapaSMS

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers Chairman : Rida K Liamsi Komisaris Utama : Makmur Kasim Komisaris : Kadafi Direktur Utama : Marganas Nainggolan Direktur : Goldian Purba Pengasuh Pemimpin Umum/Penjab/GM : Marganas Nainggolan Wa PU/Pimpinan Perusahaan : Maranatha Tobing Pimred Metro Tapanuli : Alvin Nasution Pimred Metro Siantar : Pandhapotan MT Siallagan Pimred Metro Tabagsel : Muhiddin Hasibuan Pimred Metro Asahan : Eva Wahyuni Wapimred Metro Tapanuli : Daniel Simanjuntak Tim Ombudsman : Vincent Wijaya DIVISI PRODUKSI Departemen Redaksi Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Alvin Nasution, Eva Wahyuni, Muhidin Hasibuan, Daniel Simanjuntak, Leonardus Sihotang, Syafruddin Yusuf, Nurjannah, Hermanto Sipayung. Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput). Sekretaris Redaksi: Yanti Nurhapni METRO SIANTAR Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta) Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). METRO TABAGSEL Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina). METRO ASAHAN Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang). Departemen, Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS. Kordinator Teknisi, Maintenance IT: Irwan Nainggolan. Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria. Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika. Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman. Staf Pengembangan: Simson Winata, Roy Amarta, Ismail, Efendi Tambunan. Kordinator Ekspedisi: Jhon Tua Purba. Staf Ekspedisi: Nico, Ardi, Erik. Departemen Iklan Manager Iklan: Jamot S. Kord Iklan: Bambang Satria, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi. Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat. Perwakilan Metro Asahan Ka Perwakilan/Ka Biro Usaha: Darwin Purba. Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa. Kuasa Hukum: Binaris Situmorang SH Tarif Iklan: Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan: Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp: (0622) 7553511, Fax (0622) 7553501 Siantar. e-mail: Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak: PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733.

Sambungan Halaman 1 mencurigai dan mendapati paket mencurigakan. Selanjutnya kami serahkan ke Polres Tapteng,” tuturnya. F sendiri ditahan terkait perkara narkoba jenis sabu. Sedangkan CC ditahan di lapas karena perkara ganja. Kapolres Tapteng AKBP Dicky Patrianegara ketika dikonfirmasi melalui Kasat Narkoba AKP K Nababan, kemarin (1/5) membenarkan pihaknya telah mengamankan CC dan F di Mapolres Tapteng. “CC dan F sudah resmi ditetapkan sebagai tersangka. Untuk pemeriksaan lebih lanjut, sementara ini keduanya dibon dari Lapas dan ditahan di ruang tanahan Mapolres,” tutur Nababan. Sebelumnya, sebut Nababan, penyidik juga sempat memeriksa dua napi lainnya, RB dan AP. Kemudian ibu kandung

ka sudah berpisah. Anak itu (Melati, red) kami ambil dari ibunya sejak berusia dua tahun dan kami asuh bersama. Makanya sayasangatterpukulatasmusibahini.Dia anakyatim,sudahhancurlahmasahdepan cucu saya ini. Saya berharap polisi menangkap suami saya itu dan dihukum seberat-beratnya karena sudah merusak masadepancucusaya.DankepadaBapak Bupati Tapteng saya berharap agar memberhentikannya(ERS,red)secaratidak hormatdariPNS,”ucapnyasedih. Kapolres Tapteng AKBP Dicky Patrinegara melalui Kapolsek Barus Iptu Ferrymon, kemarin (1/5) membenarkan nenek korban yang juga istri ERS sudah membuatpengaduanterkaitpencabulan tersebut. “Benar, nenek korban yang juga istri pelaku telah mengadukan suaminya ERSsecararesmikekantorpolisi,Senin(1/ 5) dengan tuduhan telah mencabuli cucunyasendiri.Saatinikitamasihdalam tahap pengembangan kasus dan dalam

tersangka CC, yang berinisial R. Karena awalnya mereka diduga ikut terlibat. Namun akhirnya dilepaskan karena tidak didapati bukti keterlibatannya. “Ketiganya mengaku tidak mengetahui sama sekali ada diselipkan sabu di bungkusan snack itu. Makanya dilepaskan,” terang Nababan. Perwira dengan pangkat tiga balok kuning di pundaknya itu menceritakan kronoligis kasus pengiriman sabu tersebut. Awalnya bungkusan snack yang sudah dilakban itu didapati dari dalam sebuah kardus kecil. Kardus kecil itu merupakan paket titipan kepada tersangka CC dan F yang berada di Lapas Sibolga. Paket itu sebelumnya dijemput oleh seorang perempuan bernama Irma, yang merupakan orang suruhan tersangka F. Kardus itu sendiri merupakan barang kiriman teman F yang berinisial AD dari

Kisaran, Kabupaten Asahan. Lalu, paket beserta bingkisan makan siang itu kemudian diantarkan ke Lapas Sibolga oleh seorang pemuda bernama Yogi atas suruhan R untuk diserahkan kepada anaknya CC. Dan saat itulah sipir Lapas memeriksa paket tersebut dan mendapati sabu-sabu di dalamnya. “Sabu-sabu itu pesanan CC dan F dari seorang temannya di Kisaran. Mereka membelinya dari AD,” ungkap Nababan. Yogi sendiri tidak ditahan karena dia tidak mengetahui bahwa barang yang dibawanya tersebut berisikan sabu. Masih dikatakan Nababan, untuk mempertanggungjawabkan perbuatannya, kedua tersangka dijerat dengan pasal 114 ayat 1 pasal 112 ayat 1 Sub Pasal 127 ayat 1 A, dengan ancaman 5 tahun kurungan maksimal 20 tahun kurungan,” pungkas Nababan. (mora/ aris)

Hidung Bernanah, Angie Dilarikan ke RS Sambungan Halaman 1 penyakit sinusitis sebelum menjalani masa tahanan. Karena itulah, pihaknya memintaagarAngiesegeradilarikankeRS untuk memeriksakan penyakitnya. Kuasa hukumsebenarnyasudahmengirimsurat permintaan agar Angie bisa berobat ke dokter langganannya. Sebenarnya, dokter KPK, Johannes Hutabarat Senin (30/4) lalu sudah memeriksa kondisi Angie. Dokter KPK, kata Nasrullahmemangmenemukanadayang tidak beres di hidung Angie. Johannes akhirnya mengirim surat rujukan untuk Angie ke rumah sakit spesialis telinga hidung ternggorokan (THT). Namun Senin lalu KPK belum merespon permintaan Angie. Respon permintaan itu akhirnya disetujui para penyidik dan pimpinan KPK kemarin. Komisi yang dipimpin Abraham Samad ini menyetujui agar tahanannya tersebut menjalani pemeriksaan di RS THT Perhati. Para penyidik lantas berkoordinasi dengan RS yang letaknya tak jauh dari Tugu Proklamasi itu. “Kami dapat giliran waktu untuk memeriksakan Angie jam 14.00,” kata juru bicaraKPKJohanBudi.Sekitarpukul13.30 WIB, mulai ada pergerakan dari tahanan Angie. Bahkan, beberapa keluarga Angie pun mulai berdatangan ke gedung KPK untuk menjenguk Angie. Diantaranya, ayah kandung Lucky Sondakh dan ibu mertuanya Ross Suyono. Tentu saja kedatangan mereka langsung disambut wartawan. “Saya datang membawa cinta,” seru

UNTUK MENGATASI SAKIT MAAG, SAYA PILIH SUSU KAMBING Keluhan maag masih mengganggu aktifitas A n d a ? Saatnya A n d a menyimak pengalaman Risman Heri S yang kini memilih susu kambing untuk mengatasi maag yang dulu mengganggu aktifitasnya, "Untuk mengatasi sakit maag yang mengganggu, sekarang saya pilih minum Milkuma." Terang kakek 4 orang cucu tersebut. Jika dulu ia kerap merasakan tidak nyaman ketika maagnya kambuh, maka sekarang tidak lagi. Manfaat Milkuma telah dirasakan oleh pria berusia 62 tahun ini, "Setelah minum Milkuma selama 1 bulan, sekarang maag jarang kambuh, badan terasa segar, stamina dan vitalitas meningkat. Padahal dulu, saya sering serba salah ketika maag kambuh." Terang warga Desa Saeintis, Kec. Percut, Sei Tuan, Deli Serdang, Sumatera Utara tersebut. Maag atau radang lambung atau tukak lambung adalah gejala penyakit yang menyerang lambung dikarenakan terjadi luka atau peradangan pada

dia pun pulang dan Senin sampai Jumat masihmasukkantor,”bebernya. KemudianpadaJumatsore(20/4),ERS kembalipergidarirumahhinggasaatini. “Beberapahariiniseorangperempuan juga sering menelepon saya. Katanya, dia mengakusebagaiistrinya.Padahalsayalah istrinya yang telah dinikahinya secara resmi,”tambahnya. DiterangkanRbrP,diamenikahdengan ERSsekitarenamtahunlalu.Pernikahannya dengan ERS merupakan yang kedua, demikian juga dengan ERS. Sedangkan Melati, cucu kandungnya sendiri dan tinggalbersamamerekasejakberusiadua tahun. IbuMelatisaatinisedangberadadi Malaysia.SementaraayahMelatidiRantau Prapat.IbudanayahMelatisudahberpisah sejak korban dua bulan di dalam kandungan. “Anak saya dengan suaminya sudah lama berpisah. Bahkan sejak Melati dua bulandidalamkandunganibunya,mere-

2 Napi Pesan Sabu dari Lapas Sibolga

Menyuarakan Aspirasi Masyarakat Tapanuli

(Metro Tapanuli, Metro Siantar, Metro Asahan, Metro Tabagsel)

dari seorang perempuan br M dengan bahasa-bahasadanpanggilanmesrayakni sayang,mamadanpapa. “Sayatanyadia(ERS,red),siapabrMyang adadiHpitu.Tapidiamarah-marahsama sayasambilmengancammaumenceraikan saya.Diapunpergimeninggalkanrumah, dan menurut kabar yang saya dapat, dia pergikerumahbrMdiPinangsoriyangsaya dugasebagaiselingkuhannya.Kemudian saya menemui Camat Barus (Herman Suwito) untuk membicarakan masalah itu,” ungkapnya. Atas saran Camat Barus, lanjut R br P, dirinyapunmelaporkanERSsecaralisanke Mapolsek Barus dengan tuduhan pencabulan anak di bawah umur, Sabtu (21/4). “Kemudian saya membawa cucu saya ke RSUD Barus untuk divisum. Satu minggu kemudian, dia (ERS, red) menelepon saya dan menanyakan apakah dirinyasudahdilaporkankepolisi.Tapisaya bilangtakada,pulanglah.Lalu Sabtu(21/4)

lambung yang menyebabkan sakit, mulas, dan perih pada perut. Penyebabnya bisa karena penderita makannya tidak teratur, terdapat mikroorganisme yang merugikan, mengonsumsi obat-obatan tertentu, atau sebabsebab lainnya seperti mengonsumsi alkohol, pola tidur yang tidak teratur dan stress. Karena kesehatan begitu berharga, Risman tak segan-segan mengajak orang lain untuk mencoba manfaat susu kambing, "Mari kita sehat bersama Milkuma." Ajak pensiunan kepala sekolah tersebut. Sebenarnya, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu kambing. Berbeda dengan susu sapi, sesungguhnya susu kambing memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Kini, hadir Milkuma yang bermanfaat untuk menjaga daya tahan tubuh dan meningkatkan vitalitas. Selain mengandung Riboflavin, vitamin B yang penting untuk produksi energi, susu kambing pun jarang menyebabkan alergi. Satu gelas

susu kambing memasok 20,0% dari nilai harian Riboflavin. Fluorine yang terdapat dalam susu kambing bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan menetralisir asam lambung. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Ditambah dengan kandungan Gula Aren bermutu tinggi sebagai pemanisnya, menjadikan Milkuma sebagai pilihan bijak untuk kesehatan. Untuk memperoleh hasil yang maksimal, terapkan pola hidup sehat seperti disiplin dalam pola makan, rutin berolahraga dan mengkonsumsi air putih paling sedikit 8 gelas/ hari. Dapatkan informasi lengkap tentang Milkuma di Milkuma sudah tersedia di apotek2 juga toko2 obat terdekat dikota anda, atau hubungi, Sumut : 085314072195 / 061-91128785. Depkes RI NO. PIRT.6.09.3328.01.395.

Lucky saat dikerubuti wartawan dan menanyakan apa saja yang dibawanya saat menemui anaknya. Setelah mengisi surat izin kunjungan, Lucky lantas beranjak menuju ruangan tempat Angie mendekam. Beberapasaatditemuiayahnyadiruang tamu tahanan, Angie yang mengenakan kaos lengan panjang cokelat dipadu blue jeans itu lantas dijemput mobil dinas KPK. Duaorangpengawaltahananlaki-lakidan seorang polisi wanita membawa Angie menuju mobil dan membawanya ke RS Perhati. Berdasarkan pantauan Jawa Pos (grup METRO), Angie selalu berusaha tersenyum saat ditemui wartawan. Ibu Keanu Jabbar Massaid itu juga tetap mengenakan make up sehingga membuat wajahnya tampak kinclong dan segar. Sayangnya dia tidak berkomentar apapun soal izin yang dikeluarkan KPK sehingga dirinya menjalani pemeriksaan di RS. Johan mengakui berdasarkan hasil pemeriksaan dokter KPK sebelumnya, di tulang dari kiri Angie ada peradangan sinus. Angie juga merasa kesakitan beberapa waktu belakangan. Nah karena itupihaknyamengeluarkanizinagarAngie menjalani rawat jalan di rumah sakit. “Tentunya setelah diperiksa di rumah sakit yang bersangkutan akan langsung dibawa kembali rutan,” ujar Johan. Pria yang pernah mencalonkan diri sebagai pimpinan KPK menegaskan semua biaya pengobatan Angie akan ditanggung pihaknya. Sekitar pukul 16.30, Angie selesai

menjalani pemeriksaan di rumah sakit. Dia pun langsung meninggalkan rumah sakit tersebut dengan menumpang mobil dinas KPK yang tadi mengantarkannya untuk dikembalikan ke rutan. “Sudah diendoskopi, diberi obat, ternyata ada nanah di hidung. Cuma sinus, saya sudah sehat kok,” ujar Angie kepada wartawan. Saat ditanya apakah ada kemungkinan Angie akan dibantarkan mengingat kondisi kesehatannya yang menurun, Johan mengaku pihaknya akan mempertimbangkansemuahal-halyangmenyangkut kesehatan tahanannya. Keputusan pembantaran adalah urusan para penyidik yang nantinya harus mendapat persetujuan dari para pimpinan. Namun hingga kemarin, KPK belum menerima surat resmi dari pihak Angie untuk meminta pembantaran. “Kami juga belum tahu secara resmi bagaimana hasil pemeriksaan Angie di rumah sakit,” imbuhnya. Selain belum menerima permintaan pembantaran, KPK juga mengaku belum menerima permohonan kuasa hukum yangmemintaagarAngiediizinkanmembawa gitar dan perlengkapan melukis di rutan. Angie memang menyampaikan ingin membawa alat-alat tersebut untuk sekedar mengisi waktu luang selama menjalani masa tahanan. Terpisah, kemarin para penyidik KPK kembali memanggil beberapa orang sebagai saksi Angie. Diantaranya adalah Direktur Exartech Technologi Gerhana Sianipar, mantan sopir Yulianis Hidayat dan pihak swasta Dewi Untari. (jpnn)

proses penyelidikan. Mudah-mudahan secepatnyaterungkap,”kataFerrymon. Camat Barus Herman Suwito selaku atasan ERS saat ditemui METRO di kantornya kemarin (30/4) mengatakan, sejaksatumingguiniERSsudahtidakmasuk kantortanpaadapemberitahuanyangjelas. Menurut laporan istrinya, sebut Herman, bahwaERSmencabulicucumerekasejak duatahunlalu. “Minggu kemarin istrinya datang ke kantor menemui saya untuk memberitahukankasusyangmenimpacucumereka. Jadi saya sarankan agar membuat pengaduankepolisi,karenamenurutsaya yangdilakukanERSsudahperbuatanbejat yang tak bisa diampuni. Jadi saya selaku atasannyamenyesalkanperbuatanitudan memintapolisi menangkappelakukarena sudah merusak masa depan cucunya sendiridanmerusakcitraPNSkhususnya kantor Camat Barus,” pungkas Herman. (mas)

Peringatan Milad Bank Muamalat Ke-20

20 Anak TK Menabung SIBOLGA- Dalam rangka peringatan milad Bank Muamalat ke-20 yang jatuh pada 1 Mei, seluruh karyawan kantor cabang pembantu Sibolga mengikuti doa bersama. Selain itu, dilaksanakan juga servis day dan ramah tamah dengan rombongan TK As-sa‘adah Sibolga di Jalan Imam Bonjol Sibolga, Selasa (1/5). Dalam peringatan ini, Arvivan Arifin President Director Bank Muamalat dalam sambutannya yang disampaikan Efrida Yanti Siregar pimpinan kantor cabang pembantu Sibolga menawarkan konsep perbankan tanpa bunga. “Konsep tanpa bunga ini telah terbukti sebagai konsep win-win solution yang dapat mensejahterakan semua pihak,” tutur Efrida. Dilanjutkannya, juga telah dilakukan transformasi perbaikan dari sisi layanan, sistem, teknologi,riskmanagement bahkan launching logo baru. “Saya percaya, dengan kebersamaan, semangat juang yang tinggi, serta keinginan untuk terus belajar, insya Allah keinginan dan cita-cita kita akan tercapai,” terangnya. Untuk memberikan pelayanan terbaik pada nasabah, mereka menawarkan beberapa produk yang menguntungkan seperti Tabungan Haji Arafah, Deposito Muamalat, Shar-e Gold Debit, ATM Muamalat yang dapat ditarik hingga saldo “0” dan bebas diakses di luar negeri melalui Logo Visa, Tabungan Muamalat Umroh bagi mereka yang ingin Umroh, Tabungan DPLK Muamalat untuk masa pensiun dan TabunganKu untuk para pelajar. “Seperti yang kita lihat hari ini, sekitar 20 anak TK Assa`adah Sibolga membuka tabungan di sini. Ini kita lakukan merintis MoU atau kerja sama dengan pihak sekolah. Melalui itu kita berharap dapat menanamkan gemar menabung sejak dini kepada anak-anak, agar nantinya menabung itu sebagai dasar di hati mereka sampai hari tua,” tukas Efrida sambari mengajak para pelajar untuk gemar menabung. Hal ini juga disambut baik Sri Afrida Piliang A.Ma kepala sekolah TK As-sa‘adah Sibolga. Dikatakannya, setelah adanya sosialisasi dari Bank Muamalat, pihaknya langsung menyampaikan kepada orang tua murid, dan hal itu juga disambut baik para orang tua murid. “Menanamkan gemar menabung kepada anak usia dini itu perlu, karena selain mendidik anak untuk menyisihkan sebagian uang sakunya, ini juga sebagai dasar mental yang secara otomatis mengajak anak untuk menabung,” tutur Sri Afrida yang juga menabung di Bank Muamalat Sibolga. Selain itu, dilanjutkannya, setoran tabungan pertama juga hanya Rp20.000. Jadi tidak memberatkan bagi anak-anak untuk membuka tabungan sendiri. “Sedang untuk menyetornya, nanti pihak sekolah yang langsung berhubungan dengan pihak bank, berapapun yang disisihkan siswa kami terima, baik per hari ataupun perminggu tergantung kemauan mereka,” pungkasnya. (fred)

6 Kader Demokrat Akui Kesalahan Sambungan Halaman 1 kesalahanmerekaterhadappartai.Tapi,seorang lagi yakni Baktiar Ahmad Sibarani tidak mengindahkanpanggilanklarifikasiitu.Kendati sudah tiga kali disurati. Bahkan Baktiar tak menggubris saat dihubungi melalui selulernya. Demikian diungkapkan Wakil Ketua I DPC Partai Demokrat Tapteng membidangi fraksi di legislatif,JamesLPurba,disekretariatpartaiJalan PadangsidempuanKm5,2Sarudik,Selasa(1/5). Keenamkaderyangmengakuikesalahannya, kata James, yakni Antonius Hutabarat, Agus FitriadiPanggabean,LelianaSarumpaet,Marada Lumbantobing, Krismart Tua Panjaitan, dan PangihutanSihotang. Dalam klarifikasi itu keenamnya, kata James, mengakui kepengurusan DPC Partai Demokrat Taptengperiode2012-2017yangdiketuaiSintong Gultom,sesuaiSKNo.21.26/SK/DPP.PD/DPC/ II/2012 tertanggal 18 Februari 2012. Terkait tindakan mosi tidak percaya terhadap Sintong, lanjut James, keenam anggota DPRD Fraksi Demokrat tersebut mengaku mendapatkan tekanandaripihaktertentu.Namun,adajugayang hanyaikut-ikutantanpamemikirkanakibatyang timbulatastindakannyaitu.Terkaitadanyasurat pergantianKetuaFraksiDemokratNo.061/DPCPD/TT/II/2012 tertanggal 1 Maret 2012 dari AntoniusHutabaratkepadaBaktiar,terangJames, adatigadarienamanggotaDPRDFraksiDemokrat iniyangmengakuikeberadaansurattersebut. “Begitupun,pertimbangandankeputusandari semua tindakan keenam anggota dewan itu berada di tangan DPP. Mereka memang telah mengakuibersalahdanmemohonpetunjukDPC,

DPDdanDPPterkaitperbuatanmerekayangtelah merusakcitrapartai,”tegasJames. DitanyatindakanDPCterhadapkeenamnya, James mengatakan partai akan memberikan teguran dan pembinaan intensif agar tidak melakukan hal serupa lagi. Kepengurusan DPC Demokrat Tapteng saat ini, sebut James, sangat berbedadengankepengurusanperiodelalu. “Saat ini, DPC lebih menonjolkan profesionalisme berpolitik yang cerdas, bermartabat, dan santun. Atau yang disebut CBS. Yang pada akhirnya menciptakan kesejahteraan rakyat secara umum. Dan itu sudah digariskan partai terhadapseluruhkader,”terangnya. DisinggungsikappartaikepadaBaktiarSibarani yang tidak menunjukkan itikad baiknya, James menegaskan, DPC telah menyampaikan laporannya ke DPD Sumut dan DPP. “Semua keputusansoalitutergantungpetunjukDPDdan DPPnanti.Kitatunggusajaapahasilnyananti.Yang jelaskitamengambiltindakansesuaimekanisme danAD/ARTpartai,”jelasJames.Iajugaberharap seluruhkaderDemokratkhususnyayangduduk di legislatif agar benar-benar menyadari segala tindakan-tindakanyangsangatmerugikanpartai tersebut. Sekaligus diharapkan dapat menunjukkanloyalitasterhadappartaikedepan. “Karena mereka (Fraksi Demokrat, red), sejatinya sebagai perpanjangan tangan Partai Demokratdankonstituenyangmemilihmereka dudukdiDPRD.Makasudahsewajarnyamereka bertanggung jawab melakukan tugas dan fungsinya.Membangunpartaidemimewujudkan kepentinganrakyat.Sehinggatidakmelunturkan rasakecintaanrakyatterhadappartaiDemokrat,” tutupnya.

Terpisah, Antonious Hutabarat saat dikonfirmasimembenarkankalaudirinyabersamalima anggota DPRD Tapteng dari Partai Demokrat sudah mengakui kesalahan yang dilakukan soal mositidakpercayakepadaKetuaDPRDTapteng SintongGultom. “Artinya bahwa kita selaku kader Partai Demokrat harus tunduk kepada keputusan tertinggi yakni DPP Partai Demokrat. Dan kita berenam sudah mengakui kesalahan yang kita lakukansoalmositidakpercayaitu,”tukasnya. Takhanyaitu,sambungnya,padakesempatan itu mereka juga menyampaikan komitmennya untuk tetap loyal dan solid kepada Partai Demokrat selaku partai yang mendudukkan merekadiDPRDTapteng. “Termasuk juga tetap loyal dan komit menjalankan amanah partai dan program Demokrat dibawahkepemimpinanSintong,”tandasnya. Sementara itu Baktiar Sibarani ketika dikonfirmasi,Selasa(1/5)malam,membenarkansoal undangan klarifikasi kader tersebut. Namun dia mengakutidakmembacaundanganitu.Demikian juga James L Purba memang pernah menghubunginya lewat telepon seluler. Tapi, Baktiar dengan tegas mengatakan bahwa sampai kapanpun, dirinya tidak akan pernah menuruti SintongGultom.Baktiarjugatidakgentarjikananti di-PAWataubahkandipecatdaripartaisekalipun. “Saya tidak akan pernah menuruti Sintong. Dan sayatidakpernahtakutgertakannya.Maudi-PAW atau dipecat pun saya tidak takut. Saya orang organisasi, saya paham mekanisme sebuah organisasi. SK saya (sebagai anggota DPRD) dikeluarkan Gubernur. Jadi ada aturan dan mekanismenya,”tuturBaktiar.(mora)



2 Mei 2012

Konflik Lahan di Perkebunan PT Nauli Sawit

15 KK Penuhi Panggilan BARUS- Tim verifikasi tanah mengundang 27 kepala keluarga (KK) yang mengklaim tanahnya dikuasai oleh PT Nauli Sawit untuk dimintai keterangannya, Selasa (1/5). Namun yang hadir pada acara tersebut hanya 15 KK. Pertemuan digelar di aula kantor Camat Sirandorung. Hadir dalam pertemuan itu Sekda Tapteng Baharuddin Manik sebagai ketua tim, Kadis PertanahanErwinMarpaung,KadisSosial, Tenaga Kerja dan Transmigrasi Edy Supian Damanik, Kabag Ops Polres Tapteng Kompol Leo Siagian, Kasat Reskrim AKP Rahmat Faisal Simatupang, Asisten I AR Purba, Asisten II Aris Sutrisno. Ketua tim verifikasi yang juga Sekda TaptengBaharuddinManikkepadawarga yanghadirpadaacaratersebutmengatakan, dasardilaksanakannyaverifikasiinisesuaiSK Bupati Tapteng Nomor 33/Pertanahan/ 2012tentangpembentukantiminvestigasi permasalahantanahantarawargadengan PTNauliSawit. Tujuannya untuk mengiventarisasi seluruh permasalahan tanah yang ada di di Kecamatan Sorkam Barat, Sosorgadong, Andam Dewi, Sirandorung dan Manduamas yang dituduh diserobot oleh PT Nauli Sawit sejak tahun 2004 serta untuk mencari solusinya. “Telah lama kita dengar ada permasalahan tanah warga dengan PT Nauli Sawit. Untuk mencari solusinya, Bupati Bonaran Situmeang membentuk tim verifikasi. Untuk tahap pertama kita hari ini mengundang 27 KK warga Sirandorung yang masuk dalam daftar

yang tanahnya diserobot pihak perusahaan. Sedangkan yang lainnya akan kita undang di lain kesempatan. Jadi saya harapkan warga yang sudah diundang tahap pertama ini, benar-benar jujur memberikan keterangan kepada tim. Ini awal dari tim bekerja, masih banyak waktu kita untuk menyapa warga yang tanahnya diserobot pihak perusahaan. Jadi saya harapkan warga yang belum diundang hari ini agar bersabar,” ucap Sekda. Selanjutnya, kata Sekda, masa verifikasitahappertamainiselamalimahari sejakkemarin.Yaitumemberikanketerangan kepada tim. “Kepada27KKiniakanmemberikan bukti tertulis kepada tim dan cek ke lapangan.Bagiyangtidakmemilikibukti tertulis,wargajugadiberikankesempatan untukmengeceklangsungkelapangan denganmembawasaksi-saksisertabatas-batasnya. Hasilnya nanti akan kita laporkankeBupatiBonaranSitumeang. NantiBupatilahyangakanmengambil kesimpulan. Setelah tahap pertama ini tuntas, baru kita lanjutkan tahap berikutnya.Sayategaskan,kitadisinibukan untukmenerimapengaduan,tapiuntuk memverifikasi permasalahan. Kalau masalah pengaduan sudah dibentuk PolresTapteng,”pungkasnya. Kabag Ops Polres Tapteng Kompol

(photo.Masril Rambe

„ Ketua tim verifikasi Baharuddin Manik bersama anggota tim lainnya sedang memberikan penjelasan kepada warga. Leo Siagian berharap agar warga jujur. Artinya, warga jangan mengaku tanahnya ada diserobot PT Nauli Sawit, tapi ternyata tidak ada. “Tim ini independen, mari kita sportif. Tim verifikasi ini untuk menfasilitasi permasalahan warga dengan PT Nauli Sawit. Sedangkan untuk menentukan hasilnya nanti adalah Bupati Tapteng,” katanya. Amatan METRO dalam acara tersebut, para warga yang hadir dimintai keterangan awal oleh tim dengan melakukan wawancara langsung kepada warga satu persatu oleh Kasat Reskrim Polres Tapteng AKP Rahmat Faisal Simatupang, Kabag Hukum Pemkab

Dedy Safii dan Kasubsi Perkara BPN Tapteng Henry Hutahaen. Setelah satu persatu warga yang diundang selesai dimintai keterangan, mereka meninggalkan aula. Kasman Sihotang mewakili warga mengakukecewakepadatimverifikasi. Sebab menurutnya warga yang diundang tim verifikasi kemarin tidak terdaftar dalam laporan warga yang disampaikan langsung kepada Bupati pada awal bulan lalu. “Kita kecewa kepada tim ini. Kita yang berjuang sejak tahun 2004 lalu namun kita tak diundang untuk tahap awal ini. Padahal semua nama-nama yang diundang hari ini tak ada kita

usulkan ke bupati. Besok saya dan beberapa warga akan mendatangi bupati untuk mempertanyakan hal ini,” kata Kasman Sedangkan ustad M Sodhiqin Lubis ketika ditanya tentang kinerja tim ini mengaku menyambut baik. Hanya saja, dia mengatakan tetap tidak puas dengan cara yang dibuat tim. Namun dia tetap akan memberikan kesempatan kepada tim untuk bekerja, tapi tetap mengawalnya hingga tuntas. “Nanti kalau tim ini main-main, merugikan rakyat, kita akan kembali turun. Jadi sekarang kita biarkan dulu mereka itu bekerja sesuai mekanisme tim,” tandasnya. (mas)

Dicari Duta Wisata Tapteng!


AUDISI: Camat Pinangsori, Erman Lubis, Mas Intan (kaos kuning) foto bersama dengan seluruh peserta Audisi Duta Wisata tingkat kecamatan se Dapil II Tapteng, Senin (30/4) kemarin.

TAPTENG-PemkabTaptengmenggelar audisi Duta Wisata, Senin (30/4) di aula Kantor Kecamatan Pinangsori. Tahap awal adalah tingkat kecamatan. Kemudian pemenangnya akan berlomba di tingkat kabupaten. Camat Pinangsori Erman Syahrin Lubis mengatakan, audisi duta wisata hanya mencakup Dapil Tapteng terdiri dari Kecamatan Badiri, Pinangsori, Lumut, Sibabangun, dan Kecamatan Sukabangun. “Kegiatan ini sendiri diprakarsai Dinas Pariwisata dan Budaya Kabupaten Tapteng dalam rangka mendukung dan mensukseskan Program Tapteng Negeri Wisata Sejuta Pesona yang dicanangkan Bupati Tapteng Raja Bonaran Situmeang,” kata Erman.

KADAR DARAH KINI DARI 500 MG/ DI MENJADI I ndonesia sGULA a te rasa lemaAGUS s, selai n itu bSUDAH erat badaTURUN n bahagia. at ini saya turun sampai 17 kg," ujar pria Diabetes adalah peningkatan kadar menduduki yang bekerja sebagai security glukosa darah akibat kekurangan pe r i ng k at tersebut. insulin baik yang sifatnya absolut keempatd Setelah 1,5 tahun menjalani maupun relatif atau resistensi e n g a n j u m l a h pe n de ri ta berbagai pengobatan, akhirnya pria reseptor insulin. Diabetes melitus d i a b e t e s terbesar di dunia. berusia 47 tahun ini tertarik untuk sangat erat kaitannya dengan Diperkirakan, jumlah penderitanya beralih ke pengobatan yang alami mekanisme pengaturan gula norakan terus meningkat dari tahun dan pilihannya jatuh pada Gentong mal. ke tahun. Salah satu cara untuk Mas. 1 tahun setelah minum, ayah Dengan tubuh yang sehat, kini Agus mengatasinya adalah dengan terapi 3 orang anak ini pun mendapatkan dapat menjalani aktifitasnya Gentong Mas. manfaatnya, "A l h a m d u li ll a h, dengan nyaman. Ia pun tak seganAgus Tami, warga Binjai Utara, sekarang tubuh saya terasa segar, segan membagi pengalaman Binjai, Sumatera Utara kadar gula darah sudah turun dari sehatnya dengan orang lain. menceritakan, aktifitasnya dulu 500 mg/ dL menjadi 175 mg/ dL, Meracik suatu ramuan memerlukan seringkali terganggu karena diabekeluhan karena diabetes pun sudah pengetahuan, pengalaman dan tes, "Karena diabetes, badan sering berkurang." Terangnya dengan keterampilan tinggi. Tidak semua komposisi yang sama jika dicampur akan menghasilkan manfaat yang sama. K u a l I t a s b a h a n b a k u, perbandingan komposisi dari masing-masing komponen serta pengolahan yang benar akan menentukan hasil kualitas manfaatnya. Kini hadir Gentong Mas, minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda) terbukti memiliki banyak manfaat untuk kesehatan. Habbatussauda dipercaya dapat meningkatkan fungsi insulin dan mengurangi resistensi reseptor insulin, sedangkan Gula Aren berperan dalam optimalisasi kerja reseptor insulin. Gentong Mas juga mengandung Chromium yang efektif memperlancar metabolisme gula darah dan mengatur kepekaan sel

Diterangkan Erman, proses seleksi atau audisi Duta Wisata dilakukan secara selektif melalui beberapa tahapan, di antaranya interview soal potensi daerah, potensi wisata, kemudian ujian Bahasa Inggris. Selain itu peserta harus berumur 15 hingga 21 tahun. “Seluruh peserta akan diuji kemampuannya. Dan dari seluruh peserta dari Dapil II akan dipilih 2 pasang sebagai dutadariDapilIIuntukmengikutiaudisi tingkat kabupaten yang bakal digelar dalam waktu dekat,” pungkasnya. Pada kesempatan itu, Erman mengimbau kepada seluruh peserta untuk mengikuti audisi secara sportif. “Sebab,dalamsebuahaudisikalahdan menang adalah hal biasa. Namun demikian, kepada peserta yang lolos

audisi nantinya untuk tidak berlaku sombong,” kata Erman. KadisPariwisatadanBudayadiwakili Kabid Kesenian dan Budaya mengatakan, event ini merupakan kegiatan rutin Pemkab Tapteng. “Peserta yang mengikuti audisi ini terbuka untuk umum.Danparapesertayanglolosdari audisi tingkat kecamatan ini berhak untuk mengikuti seleksi Duta Pariwisata Tingkat Kabupaten,” tukasnya. Sementara,pesertayanglolosdalam audisi tingkat kecamatan se Dapil II ini untuk kategori putra adalah Ternando Situmeang dan Frans Edward Sipahutar keduanya siswa SMAN 1 Pinangsori. Untuk kategori putri; Elsa Hasanah dan Tysca Carissa, siswa SMAN 1 Pinangsori. (tob)

Ekonomi Indonesia Masih Kuat di 2012 TAPTENG-Pertumbuhan ekonomi Indonesia pada tahun 2012 menguat karena ditompang kuatnya permintaan domestik dengan peran investasi yang semakin tinggi dan juga inflasi yang masih terkendali. “Tahun ini, pertumbuhan ekonomi Indonesiadiperkirakanmencapai6,3%-6,7%,kemudian pada tahun 2013 diperkirakan sebesar 6,4%6,8%. Kegiatan perekonomian domestik masih menunjukkan kinerja yang kuat ditengah melambatnya kinerja pertumbuhan ekonomi dunia serta ketidakpastian kebijakan BBM subsidi,” ungkap Direktur Grup Kebijakan Moneter Bank Indonesia, Juda Agung pada acara Pelatihan Wartawan Ekonomi, Moneter, dan Perbankan di Hotel Grand Royal Panghegar, Bandung, Jawa Barat, Sabtu (28/4) pekan lalu. Faktorlainnyayangturutmempengaruhi,sambungnya,pergerakannilaitukarrupiahyangcenderung melemah akibat pengaruh ekspektasi inflasi dan dinamika eksternal. Konsumsi rumah tangga juga diperkirakan tetap kuat, didukung stabilitas ekonomi makro dan dukungan pembiayaansertapeningkataninvestasididukungiklim investasi yang kondusif dan persepsi terhadap prospek ekonomi Indonesia yang positif. “Bank Indonesia pada tanggal 12 April 2012 lalu tetap mempertahankan BI Rate sebesar 5,75%. Sedangkan respon kebijakan suku bunga tetap diarahkan untuk mengendalikan tekanan inflasi dari sisi fundamental sesuai prakiraan makroekonomi ke depan. Sementara untuk mengendalikan tekanan inflasi dalam jangka pendek yang bersifat temporer, kebijakan difokuskan pada penguatan operasi moneter dan pengendalian ekses likudiasi secara terukur,” beber Juda. Di sisi lainnya, lanjutnya, lembaga rating Standard and Poors datang dalam waktu yang tidak tepat, karena pada waktu yang bersamaan, RI sedang mengalami kisruh kebijakan BBM bersubsidi. Tapi Bank Indonesia (BI) optimistis peringkat Indonesia bisa segera naik. Momen kekisruhan itu, sambungnya, turut mempengaruhi Indonesia dalam mendapatkan rating dalam Standard and Poors, sebab dalam keadaan normal, tidak ada alasan bagi lembaga rating Standard and Poors untuk tidak memberikan rating yang baik bagi Indonesia. “Secara fundamental tidak ada alasan untuk tidak menaikan rating kita,” ujarnya. Sebelumnya,HarimurtiGunawandaripanitia pelatihan wartawan ekonomi, moneter dan perbankan mengatakan, pelatihan tersebut bertujuan sebagai bukti transparansi Bank Indonesia terhadap publik. Untuk itu, perlu dilakukan pelatihan kepada wartawan selaku mitra dari Bank Indonesia khususnya wartawan yang meliput di bidang ekonomi dan perbankan. Kegiatan tersebut diikuti sekitar lima puluh orang wartawan ekonomi se-Indonesia, termasuk lima wartawan utusan dari kantor perwakilan BI Sibolga di antaranya, Sahat Jason Gultom (Harian Batak Pos), Ridwan T Butarbutar (Harian Metro Tapanuli), Juniwan (Harian MedanBisnis), Yudi Arisandi Nasution (Harian Analisa), dan Suryati (RRI). (tob)


2 Mei 2012

APA KATA MEREKA Penerapan sistem kerja outsourcing di perusahaan BUMN membuat karyawan jadi malas, karena pekerjaan mereka banyak diserahkan kepada karyawan kontrak. Tidak etis jika pekerjaan yang seharusnya dikerjakan oleh pegawai BUMN, itu diserahkan kepada pekerja outsourcing. Ini kan keterlaluan.

Kondisi Indonesia yang karut marut dengan tingginya tindak pidana korupsi oleh wakil rakyat dan aparatur negara, membuat warga semakin menangis dan kepercayaan terhadap pemerintah luntur.

Penyerapan tenaga kerja yang adil dan bermartabat harus semakin ditingkatkan dengan cara semakin banyak lapangan pekerjaan dibuka, kewiraswastaan, peningkatan skill difasilitiasi olehpemerintah.

Menteri BUMN Dahlan Iskan, Selasa (1/5)

Ketua Dewan Pakar Partai NasDem Hary Tanoesoedibjo, Selasa (1/5)

Anggota Komisi IX DPR Nova Riyanti, Selasa (1/5)

Kirim Opini Anda ke email: metrotapanuli Maksimal tulisan 5.000 karakter.

Sikap Kami Angelina Sondakh dan Justice Collaborator KOMISI Pemberantasan Korupsi (KPK) memiliki banyak cara untuk mengungkapkan perkara. Salah satunya menawarkan kerja sama dengan penjahat korupsi untuk membuka tabir yang membelit kasusnya. Dalam bahasa hukum disebut justice collaborator. Tawaran kerja sama itulah yang disuguhkan KPK kepada Angelina Sondakh alias Angie. Tentu saja tawaran itu tidak gratis. Politikus Partai Demokrat itu dijanjikan insentif jika mau bekerja sama dengan KPK membuka orang-orang yang terlibat dalam perkara yang menjeratnya. Angie, anggota Komisi X DPR, sejak Jumat (27/4) ditahan KPK. Mantan Wakil Sekjen Partai Demokrat itu diduga menerima sogok dalam pembahasan anggaran di Kementerian Pemuda dan Olahraga (Kemenpora) terkait proyek Wisma Atlet serta di Kementerian Pendidikan dan Kebudayaan. Namun, KPK belum mengungkapkan jumlah duit yang mengalir ke kantong Angie. Tawaran kerja sama pernah diberikan KPK kepada Yulianis, Wakil Direktur Keuangan Grup Permai. Yulianis diduga mengetahui banyak hal mengenai aliran uang Grup Permai, perusahaan milik terpidana kasus Wisma Atlet Muhammad Nazaruddin. Yulianis, misalnya, mendapat perlakuan khusus diperiksa KPK di hotel ataupun di apartemen mewah. Selain Yulianis, ada pula mantan anggota DPR Agus Condro yang membuka kasus bagi-bagi cek pelawat kepada anggota DPR periode 1999-2004 dalam pemilihan Deputi Senior Gubernur Bank Indonesia Miranda Goeltom.Jaksa KPK menuntut Agus paling ringan dengan 1,5 tahun penjara. Setelah divonis 1 tahun 3 bulan bui, permintaan Agus untuk menjalani hukuman di Pemalang, Jawa Tengah, kampung halamannya, dipenuhi. Tawaran KPK kepada Angie agar Puteri Indonesia 2001 itu kooperatif dan mau membeberkan perkara Wisma Atlet dan kasus di Kemendikbud. Angie yang pernah menjadi ikon Partai Demokrat dengan semboyan ‘katakan tidak pada korupsi’, mestinya malu bila tidak mau membuka keterlibatan para penerima aliran dana dari proyek di dua kementerian itu. Lagi pula, mengapa ia mesti memikul sendiri beban yang mestinya bisa dibagi? Sebagai anggota DPR, apalagi dari partai penguasa, Angie dituntut jujur mengatakan hal yang sebenarnya. Kebenaran jangan ditutup-tutupi. Sebaliknya juga tidak boleh berbohong hanya untuk mengejar hadiah sebagai justice collaborator seperti ditawarkan KPK. Jangan pula menjadi justice collaborator dengan memfitnah. Jangan menjadi pahlawan dengan mengorbankan orang lain. Kita yakin KPK memiliki cukup bukti hingga menahan Angie. Kita juga yakin KPK memiliki cukup informasi mengenai dugaan keterlibatan sejumlah nama lain dalam perkara di dua kementerian itu. Tawaran justice collaborator kepada Angie mestinya hanya untuk lebih memperkuat informasi yang telah dimiliki KPK. Publik masih ingat percakapan Blackberry Messenger antara Angie dan Mindo Rosalina Manulang, terpidana 2,5 tahun kasus Wisma Atlet, yang menyebut ‘ketua besar’, ‘bos besar’, ‘apel malang’ dan ‘apel washington’. Sandi ‘apel malang’ dan ‘apel washington’ diakui merujuk pada uang rupiah dan dolar Amerika. Mudah-mudahan setelah ada tawaran justice collaborator, Angie mau mengungkapkan misteri ‘bos besar’ dan ‘ketua besar’ itu. (***)

Paradigma Politik Alternatif Menyongsong Sukses Pemilu 2014 Panggung perpolitikan merupakan panggung paling mempesona untuk dinikmati. Jelang pilpres 2014 nanti skenario perpolitikan itu sudah mulai diramu guna memantik simpati rakyat. Berbagai momen penting perjalanan pemerintahan nasional menjadi media paling efektif untuk menyampaikan pesan-pesan politis dari masing-masing partai yang akan melaju sebagai kompetitor pemilu nanti. Walau waktu pemilu tersebut masih terbilang cukup lama, namun aroma rivalitas antarpartai politik itu makin terasa menyengat.

Ach Tijani Shodiq Sepertinya masing-masing partai tidak mau kalah start dalam menyongsong even paling spektakuler itu. Bahkan, sebagian partai besar sudah menunjuk beberapa kadernya yang dianggap layak untuk maju sebagai kandidat capres pada pilpres 2014 nanti. Berbagai macam kemungkinan pun mulai dihitung-hitung, sembari terus mencari resep paling mujarab untuk mengantongi suara rakyat. Mungkin demikianlah gambaran umum kondisi parpol saat ini dalam kancah agenda perpolitikan nasional. Bila diamati secara umum, agenda panggung perpolitikan di atas tentu merupakan kondisi yang terbilang wajar. Namun demikian, tidak sedikit partai-partai tertentu sering kali melakukan skenario politiknya dengan mengorbankan nilai-nilai kewajaran (etis dan moralitas), sehingga tidak jarang ditemukan agenda-agenda partai yang ditanggung oleh finansial milik Negara. Skenario ini biasanya sering diperankan oleh partai pemangku kekuasaan alias partai pemenang pemilu yang telah lewat. Drama tersebut misalnya, bisa ditemukan pada agendaagenda pemerintah, kemudian diselipkan di dalamnya pesan-pesan politis oleh partai yang bersangkutan. Bantuan-bantuan kesejahteraan yang diperuntukkan masyarakat miskin kerap kali menjadi media jitu pemantik simpati hati rakyat. Fakta di atas walau mungkin terlihat wajar, namun secara etis melabelkan nama partai di balik agenda pemerintah merupakan pembelajaran politik yang kurang baik terhadap rakyat. Karena walau bagaimanapun, agenda pemerintah yang dijalankan partai pemangku kekuasaan merupakan bagian dari kesepakatan bersama para wakil rakyat dari seluruh partai, kemudian pada tahap berikutnya diamanahkan ke badan eksekutif. Maka, menjadi keliru ketika agenda pemerintah itu hanya diakui dan dilebeli sebagai produk kebijakan oleh partai tertentu saja. Kejujuran dan sportivitas menjadi segmen paling dianjurkan dalam setiap skenario politik yang dijalankan oleh setiap partai. Skenario politik yang ditunjukkan di atas tentu masih terkesan menciderai partai-partai yang lain, sehingga disitu akan memun-

culkan persaingan yang negatif. Pada akhirnya, hal tersebut juga akan memunculkan stigma miring terhadap ranah perpolitikan secara umum. Sebagai bentuk riil dari stigma miring itu adalah, politik terkesan sebagai lembah hitam yang didalamnya terdapat banyak keculasan dan kebohongan. Secara implisit, persaingan tidak sehat di atas tersebut juga akan melahirkan masyarakat yang pasif terhadap sejumlah agenda pemerintah. Bentuk kepasifan tersebut jika boleh diterjemahkan pada bentuk yang lebih sederhana adalah, minimnya kesadaran apresiatif masyarakat terhadap sejumlah bantuan kesejahteraan, karena mereka memahami, bahwa bantuan tersebut merupakan bagian dari proses timbal balik dalam rangka mengantongi suara mereka nanti dalam pemilu. Tumpang tindih yang tidak jelas antara agenda pemerintah dan agenda partai yang dijalankan oleh partai penguasa tidak hanya berdampak rugi pada partai-partai yang lain, akan tetapi justru merugikan partai penguasa itu sendiri. Dampak buruk itu begitu sangat kentara ketika dihadapakan pada efektifitas dan statistik agenda pemerintah yang terkesan mandul. Kemandulan tersebut tentu merupakan bagian dari akibat pembelajaran politik yang tidak sehat, yang sengaja dilakukan sendiri oleh partai penguasa terkait. Perjalanan bangsa ini sungguh berada pada lintasan semu agenda politik partai yang tidak cerdas. Ukuran kemenangan hanya dikategorikan dengan menumpuknya suara pemilih yang berjibun, sementara dukungan dan kepercayan rakyat yang sejati tidak pernah didapatkan. Akibatnya, penterjemahan kebijakan pemerintah dalam bentuk nyata tidak menemukan dukungan dari rakyat. Sementara ketertinggalan bangsa ini tidak kunjung bangkit, bahkan bisa dibilang semakin akut saja. Partai pemenang pun terlihat kelabakan menghadapi fenomena ini, sehingga kemudian berjalanlah sistem perpolitikan yang menganut sistem koalisi dan oposisi di antara partai-partai politik yang ada. Sistem perpolitikan ini awalnya dianggap cukup mapan untuk menghadapi fenomena minornya

kepercayaan dan apresiasi rakyat tersebut. Padahal senyatanya, sistem koalisi dan oposisi tersebut malah semakin menambah tidak jelasnya arah kebijakan pemerintah. Kasus rencana kenaikan BBM kemarin, membuktikan bahwa sistem oposisi dan koalisi tersebut hanya menambah beban politik saja pada partai pemenang terkait. Di dalamnya terdapat banyak intrik politik yang senyatanya merupakan manifestasi kerapuhan dari sebuah kekuasaan yang hanya didapat dari akumulasi suara saja, tanpa diiringi kepercayaan rakyat yang sesungguhnya. Politik timbal balik dengan menggunakan resep aji mumpung oleh partai penguasa dalam bentuk pemberian kepuasan materi secara instan hanya akan memberikan kesan negatif, bahwa partai hanya butuh suara untuk kekuasaan semata. Dampak buruk yang lain adalah, melahirkan efek domino berkelanjutan dan berkepanjangan, yang senyatanya efek-efek tersebut akan ditanggung oleh partai yang berkaitan itu sendiri. Salah satu rentetan efek domino yang sering kali dirasa cukup kentara adalah, kebijakankebijakan pemerintah terkesan cukup lamban. Hal tersebut diakibatkan adanya kerapuhan dalam tubuh partai yang bersangkutan, di mana partai tersebut harus melakukan sinkronisasi lebih dulu dengan partai koalisi, sebelum akhirnya mengambil sebuah keputusan. Kondisi ini sering kali ditutuptutupi dengan beralibi bahwa suatu kebijakan penting harus berproses lama, padahal senyatanya karena faktor kerapuhan yang ada dalam tubuh partai penguasa itu sendiri. Bila boleh dibahasakan dalam bentuk bahasa yang sederhana, politik timbal balik transaksional yang mengandalkan umpan materi tidak bisa memberikan power politik apa-apa pada partai terkait yang memilih sistem ini. Walau bisa meraup perolehan suara yang cukup banyak, tetapi pada kenyataannya suara-suara rakyat itu hanya fatamorgana belaka. Dukungan dan suara akan berdentang keras jika umpan materi itu terus dialirkan. Mungkin dalam kurun waktu yang singkat kendala-kendala tersebut belum begitu terasa, tapi menginjak episode kedua dari perjalanan partai penguasa bertengger di posisi puncak, kendala tersebut mulai semakin terasa. Adapun bentuk nyata dari kendala yang cukup kentara adalah, munculnya sejumlah anomali ke permukaan. Sebagai contoh dari salah satu anomali yang bisa ditemukan adalah, pemungutan uang Negara untuk kepentingan partai kerap kali dicairkan atas nama suatu proyek tertentu. Walau hal ini belum bisa dibuktikan secara hukum, namun publikpun mulai menyimpan kecurigaannya. Sejumlah kadernya di perlemen satu-persatu juga mulai digiring ke meja hijau, karena diduga melakukan tindak suap ataupun ko-

rupsi. Tindakan amoral tersebut konon disebabkan karena kader terkait ingin mengembalikan modal politiknya yang dulu dikucurkan untuk mendulang suara. Sungguh kondisi ini juga merupakan efek domino yang tak bisa dielakkan lagi dari sebuah sistem politik yang bertumpu pada kekuatan materi. Berdasar dari rentetan uraian di atas, dapat dipahami bahwa paradigma politik ke depan harus dirubah pada paradigma yang lebih ideal. Setidaknya dalam pandangan yang sederhana, hendaknya setiap partai tidak boleh berlebihan menggulirkan seluruh proses agenda politiknya dari materi. Disitu partai lebih dituntut bagaimana bisa menjalankan agenda politiknya dengan etis (tidak meninggalkan nilai-nilai kepantasan), sembari memberikan pendidikan politik yang baik bagi masyarakat luas. Dalam hal ini, uang bukanlah sebagai alat satu-satunya, tetapi ditempatkan sebagai salah satu penunjang saja. Adapun yang lebih prinsip pada model pradigma alternatif ini adalah, setiap partai harus melakukan pendekatan komunikasi logis dengan masyarakat, terkait dengan sejumlah cita-cita partai untuk membangun bangsa ini. Mungkin banyak orang yang mencibir pola paradigma yang diajukan di atas, tetapi jika bangsa ini memang menginginkan suatu perubahan positif di tubuh negeri ini, maka paradigma alternatif politik di atas layak untuk dilihat kembali. Mungkin dari sisi perolehan suara bagi partai yang berani memilih tantangan ini akan berakibat pahit, tetapi sesungguhnya partai yang berani mengambil tantangan tersebut sudah memulai dari suatu perubahan yang besar tadi. Namun ketika banyak partai masih bersikukuh dengan paradigma lama, maka sesungguhnya itu merupakan bagian dari langkah untuk sebuah kehancuran. Sebagai kelanjutan dari paradigma alternatif di atas, setiap partai juga harus merubah paradigma lainnya, yaitu menjadikan pemilu sebagai momen untuk mendulang ketulusan dan dukungan rakyat, bukan hanya sekadar mendulang suara untuk kekuasaan belaka. Kedua paradigma alternatif di atas, yaitu yang pertama, berupa perubahan dari paradigma transaksioanal-materealistis menjadi komunikasi etis-logis, kemudian yang kedua, dari paradigma pendulangan suara kuantitatifformal menjadi kulitatif-trust (dukungan dan kepercayan yang berkualitas). Kedua paradigma politik alternatif di atas adalah suatu bentuk alternatif konkret untuk suatu perubahan positif di negeri ini. Sederhana, tapi mungkin sulit diterima, sekaligus cukup menantang bukan?. (***) Penulis adalah Staf Pengajar di Madrasah Mu’allimin Muhammadiyah Yogyakarta


2 Mei 2012

Laba-Laba Mini

Seukuran Koin

BRISTOL- Tarantula adalah salah satu spesies laba-laba yang biasanya memiliki ukuran besar dan berbisa. Namun, baru-baru ini ditemukan seekor tarantula yang memiliki ukuran sangat kecil. Laba-laba beracun ini menetas di Kebun Binatang Bristol, Inggris. Lahir dengan ukuran yang sangat kecil, laba-laba ini memiliki ukuran setara koin 5 sen. “Jenis ini adalah salah satu tarantula yang paling indah.

Ketika laba-laba itu pertama kali menetas, mereka memiliki bulu-bulu yang berwarna merah muda,” ujar pengurus hewan Kebun Binatang Bristol Mark Bushell, Selasa (1/5). “Menginjak usia dewasa, secara bertahap bulu-bulu itu

akan rontok dan berubah menjadi tarantula berbulu biru sehingga sangat menarik penglihatan,” imbuhnya. Tarantula yang bergerak cepat dan lincah itu adalah salah satu jenis laba-laba pohon paling populer. Binatang berkaki delapan ini berasal dari Martinique, di lepas pantai Amerika Selatan dan paling sering dicari karena warnanya yang sangat menarik serta mudah untuk dijinakkan. (oz)

(Foto: int)

SPECIES: Seekor Laba-laba Tarantula Mini.

Pakaian Dalam Wanita yang


(Foto: int)

PAKAIAN UNIK: Seorang wanita mengenakan pakaian dalam dalam fashion show.

PADA saat Anda tengah membeli bra dan celana dalam, mungkin Anda akan sangat memperhatikan antara keselarasan warna atau model yang ingin dibeli. Kebanyakan pria ternyata sangat suka bila mereka melihat bra dan celana Anda terlihat matching. Artinya pakaian yang berhubungan dengan seks. Hubungan seks pasangan suami istri (pasutri) yang dilakukan dalam kurun waktu tertentu bisa menyebabkan kejenuhan karena rutinitas yang terjadi. Karena hal tersebut maka di perlukan hal-hal yang bisa mengurangi kejenuhan atau kebosanan dalam hubungan seks. Mungkin bentuk-bentuk pakaian dalam aneh dan unik di bawah ini layak untuk di perhitungkan. (kps)

Claude, si Kepiting Raksasa dari Tasmania TASMANIA - Kepiting raksasa bernama Claude ditangkap dilepas Pantai Tasmania, Australia, bulan lalu olehseorangnelayan.Kepitingraksasa itu memiliki berat 6,8 kilogram (kg) dan lebar 38,1 centimeter (cm). Namun kepiting langka ini tidak akan dikonsumsi di sebuah restoran. Kepiting itu lalu dijual kepada pihak akuarium di Inggris seharga 3.000

poundstering atau sekira Rp36 juta (Rp12.173 per poundsterling). Setelah menempuh penerbangan selama 29 jam dari Australia, Claude akan dipamerkan di pusat Sea Life di Weymouth, Dorset, Inggris. DatangnyaClaudemenyebabkanduakepiting lainnya yang menjadi penghuni akuarium itu, akan dipindahkan ke akuarium di Birmingham dan Berlin.

Claude adalah kepiting yang berukuran 100 kali lebih besar dari kepiting normal yang ada di pantai Inggris. Ternyata usia Claude saat ini masih remaja, sehingga kemungkinan besar tubuhnya masih bisa tumbuh dua kali lipat dari berat badannya sekarang. “Ini makhluk yang mengesankan. Claude seharusnya butuh waktu beberapa hari untuk beradaptasi, tapi sekarang dia sedang menikmati makanannya dan tampaknya tidak ada yang lebih buruk dari tempat hidupnya yang baru ini di akuarium,” ujar ahli biologi kelautan untuk Sea Life Rob Hicks, Selasa (1/5). Sementara menurut ahli kelautan Jemma Battrick, kepiting tidak makan dalam porsi banyak meskipun bisamenjadispesiesterbesar.Diakuarium ini, Claude hanya akan diberi makan udang dan cumi-cumi.(oz)

Peringatan Milad Bank Muamalat ke-20

Menanamkan Gemar Menabung Sejak Dini

„ Kepala TK As-Sa‘adah Sri Afrida Piliang A.Ma mendaftarkan siswasiswinya menjadi nasabah Bank Muamalat.

„ Seluruh Staf Bank Muamalat, guru dan siswa-siswi TK As-Sa‘adah foto bersama pada peringatan Milad Bank Muamalat ke-20, Selasa (1/5)

„ Pinca Pembantu Sibolga Efrida Yanti Siregar, dan staf mengarahkan siswa mengisi formulir pendaftaran.

„ Seorang siswa menyerahkan setoran awal “TabunganKu” sebesar Rp20.000.

„ Pinca Pembantu Bank Muamalat Sibolga Efrida Yanti Siregar dan staf serta guru TK As-Sa‘adah melakukan lomba melafalkan rukun Islam. Teks dan Foto : Fredy di Jalan Imambonjol Sibolga, Selasa (1/5)

„ Pinca Pembantu Sibolga Efrida Yanti Siregar, Kepala TK As-Sa‘adah Sri Afrida Piliang A.Ma menyerahkan hadiah kepada peserta lomba puisi.


2 Mei 2012

FRUSTRASI DITINGAL PACAR, ABG GANTUNG DIRI LANGKAT- Diduga frustasi diputuskan pacar, Doly Pranata (17) nekat gantung diri, Selasa (1/5) sekira pukul 11.15 WIB, di kediaman Pakciknya Syahrial (43), di Dusun IV Pasar VIII Desa Baru, Kecamatan Hinai, Langkat. Sebelum tewas, anak pertama dari empat bersaudara ini, meninggalkan sepucuk surat. Isinya ungkapan pamit dan permohonan maaf kepada keluarga.

Foto Well

„ Melati br Purba dan anaknya, membuat pengaduan di kantor polisi, Selasa (1/5).

Gara-gara Sayur Kol

Ibu Muda Disayat Rekan Kerja MEDAN- Hanya gara-gara sayur kol, seorang ibu muda Melati br Purba (27), warga Jalan Kapten Sumarsono Gang Abadi, Kelurahan Helvetia Timur Kota Medan, mengalami luka di lengan dan kaki. Hal itu setelah korban disayat rekan kerjanya Nova (26), menggunakan pisau cutter, Selasa (1/5) sekira pukul 17.00 WIB. Kejadian bermula saat dua wanita yang sama-sama bekerja di Gudang Sayur, Jalan Kapten Sumarsono ini terlibat salah paham. Sekitar pukul 02.00 WIB, keduanya terlihat asik bekerja memotong tunas kol di tempat kerja. Korban yang telah selesai memotong tunas kol, menemui pemilik gudang bernama Siti (35). Maksudnya adalah meminta sayur yang belum dipotong. Oleh toke-nya, korban disuruh mengambil di belakang pelaku. Saat itulah terjadi cekcok karena pelaku menuduh korban mengambil tunas kol yang telah selesai dipotong. “Aku dituduh mengambil tunas sayur yang udah dipotong dia (Nova, red). Padahal aku mengambil sayur yang belum dipotong di belakangnya,” terang korban di Mapolsek Helvetia. Tak terima dituduh mengambil tunas sayur kol yang telah dipotong, korban yang semula membela diri, emosi

dan akhirnya terjadi keributan. Duel pun tak terelakkan antara dua wanita tersebut, hingga akhirnya korban menggigit lengan Nova. Karena digigit, Nova membalas dengan menyayat korban menggunakan pisau cutter sebanyak 5 kali. Tak ayal, korban mengalami luka di lengan kanan, lengan kiri serta kaki kanan. Melihat ada perkelahian dan salah satu pekerjanya berdarah-darah, Siti menenangkan keduanya. Mereka lantas disuruh pulang. Atas peristiwa itu, korban memilih menyelesaikan permasalahan dengan jalur hukum. “Tangan sama kakiku dipotong pakai pisau, aku tak terima. Sudah aku dituduh mengambil sayurnya, malah aku dipotong seperti ini. Aku tak terima, beruntung aku tak mati,” tandas wanita yang membuat laporan bersama anaknya yang berusia 2 tahun ini. Sementara Kapolsek Medan Helvetia Kompol Sutrisno Hady mengatakan, laporan pengaduan korban sudah diterima. Selanjutnya korban diminta melengkapi laporan dengan saksi-saksi atas peristiwa tersebut. “Laporan sudah kita terima, kita minta korban melengkapi laporan dengan saksi guna memudahkan penyelidikan,” kata Sutrisno. (wel/pmg)

„ Nana.

„ Abdul Rahmad

Foto Pasta

Kencan Sama Bini Orang, Tukang Becak Dihajar PAGAR MARBAU- Keributan terjadi di Hotel Deli Indah (DI) yang berada di pinggiran Jalinsum, Desa Sukamandi Hulu, Desa Pagar Marbau, Deliserdang, Selasa (1/5) sekira pukul 12.00 WIB. Itu setelah seorang tukang becak asal Balohan, Kecamatan Sukajadi, Sabang, NAD bernama Abdul Rahmad (41), dipergoki kencan dengan Nana (30) di dalam kamar. Penggerebekan berawal dari kedatangan Rahman Nurdiansyah alias Rahman (36), pria asal Aceh yang tinggal di Kota Perbaungan, bersama tiga rekannya ke salah satu kamar hotel kelas melati itu. Meski sudah saling kenal, namun kehadiran Rahman bukan hendak mengunjungi Abdul, rekan mereka yang tengah menginap di sana. Tapi justru ingin menggerebek istrinya Nana (30) yang tengah berkencan dengan Abdul. Begitu tiba di kamar hotel itu, Rahman yang sudah dibakar amarah beserta 3 rekannya sontak masuk ke kamar dan menarik tubuh Abdul yang kala itu hanya mengenakan kaos singlet bercelana jeans hitam. Posisi Abdul terlihat sedang tidur-tiduran di atas ranjang. Keributan pun terjadi, bapak empat anak yang dituduh berselingkuh dengan istrinya itu langsung dipukul dan dihajar hingga babak belur. Bahkan keduanya langsung digiring ke Mapolres Deliserdang. “Selagi aku merantau mencari kerja, enakenakan pula kau sama biniku berselingkuh. Anjxxx kau!” bentak pria berkulit gelap itu kepada Abdul. Sementara Nana juga tampak ketakutan bercampur malu begitu tepergok suaminya berduaan dengan pria lain di kamar hotel. Tiba di ruang SPK (Sentra Pelayanan Kepolisian) Polres Deliserdang, Rahman yang sudah 7 bulan berpisah dengan istrinya, resmi membuat laporan pengaduan. Kepada polisi, Rahman mengaku dirinya memang sudah pisah ranjang dengan Nana sejak tujuh bulan lalu. Awalnya Rahman dan Nana yang juga berasal dari Sabang, merantau ke kota

Remaja Curi Helm Dihajar Massa LAMPUNG- Ingin makan enak tapi belum juga dapat uang, HMN1 (5) warga Jalan Setia Budi Kuripan, Bandarlampung, nekat mencuri helm pengendara yang sedang parkir di Pasar Cimeng, Bandarlampung. Apes, baru saja memegang helm yang mau dibawa kabur,aksinya dilihat tukang parkir. HMN yang masih di bawah umur ini babak belur dihajar massa dan diserahkan ke Polresta Bandarlampung, Selasa (1/5) sekira pukul 12.00 WIB. Kasatreskrim Polresta Bandarlampung Kompol Syaiful Wahyudi mengatakan, awal mula pelaku mencuri helm tersebut saat korban Supriyono (45) sedang berbelanja membeli bahan-bahan pokok di pasar. Sepedamotor lang-

Foto Pasta

sung di parkir dan helm dililitkan di stang. Selesai berbelanja dan akan pulang ke rumah, korban kaget melihat ramai orang ternyata ada yang mencuri helmnya. Pelaku ini memang sering berpindah-pindah tempat parkir, dimana ada pasar di situ dia parkir dan akhirnya ditangkap juga. Selain mengamankan pelaku, juga disita sebuah helm merk KYT warna putih. Akibat dari perbuatannya, pelaku dikenakan pasal 362 KUHP tentang pencurian dengan ancaman maksimal lima tahun penjara. Sementara itu pelaku mengaku terpaksa mencuri helm karena sudah lapar mau makan, namun belum juga dapat uang. (pk/int)

Perbaungan. Namun karena keduanya kerap bertengkar dan Nana diketahui suka berselingkuh dengan lelaki lain, hubungan keduanya menjadi renggang. Rahman memilih tetap tinggal di Perbaungan, sedangkan Nana pulang ke rumah orangtuanya di kota Sabang. Rahman sendiri mengetahui istrinya berada di Hotel Deli Indah setelah mendapat informasi dari seorang teman, yang tak sengaja melihat Nana di sana. Begitu mendengar informasi itu, Rahman langsung memanggil tiga rekannya untuk menggerebek pasangan mesum itu. Setelah memergoki istrinya, Rahman belum membuat keputusan apakah akan kembali bersama Nana atau tidak. Namun yang pasti, ia ingin memberi pelajaran kepada keduanya. Mengaku Dijebak Saat ditemui wartawan, Rahmad yang kala itu ditemani keluarganya, seorang personel Marinir dari Belawan mengakui perbuatannya. Katanya, ia dan Nana memang sudah berselingkuh sejak lima bulan lalu. Awalnya perkenalan mereka terjadi di kota Sabang, saat Nana pulang ke rumah orangtuanya yang tak jauh dari rumah Abdul. Selama berkencan dengan Nana di kota Sabang, Abdul mengaku sudah beberapa kali diajak Nana berhubungan intim. Keduanya memang menikmati hubungan yang mereka lakukan di seputar pantai Kota sabang, Aceh. Selain itu, bapak empat anak ini juga mengaku telah dijebak oleh Nana dan suaminya. Menurutnya, keduanya sengaja menjebak untuk memeras Abdul. Bahkan uang Rp1,5 juta milik Abdul sudah dirampas suami Nana dari kantong celana sebelah kiri. Sebab sebelum ia digiring ke Polres Deliserdang, Rahman sempat meminta uang Rp20 juta, untuk tidak mempersoalkan perselingkuhan itu. Hanya saja Abdul mengaku tak punya uang, dan saat digerebek ia tidak sedang berbuat mesum. (pasta/pmg)

Kebelet Mesum di Pasar ABG sekarang memang semakin nekad dan tak tahu malu. Seperti pasangan Masrudin-Asrofah ini misalnya, pasar mestinya untuk belanja, eh dijadikan arena mesum di siang hari bolong. Keruan saja ibu Asrofah (16) pingsan waktu tahu putrinya diarak massa gara-gara mesum di pasar. Apa definisi pasar itu? Menurut teori Ilmu Ekonomi adalah: bertemunya antara pedagang dan pembeli. Tapi jika dua makhluk berlainan jenis lalu bertemu di pasar dan kemudian berbuat mesum, apa pula ini namanya? Masihkah bagian dari teori ekonomi? Wah, ini jelas sebuah “aksioma” dari sebuah dalil. Nah, anak manusia yang merusak dalil teori ekonomi itu adalah Masrudin (18) warga Srimanguinan Sampang (Madura). Bukan sebagai konsumen, bukan pula sebagai

penjual, dia memanfaatkan kios nganggur dalam pasar untuk berbuat intim dengan kekasihnya, Asrofah. Begitu konangan tukang parkir, urusan jadi panjang. Dia diseret Satpam Pasar dan diserahkan ke Polres Sampang. “Kencing saja belum lempeng, sudah macem-macem,” kata orang, tentunya dengan bahasa Madura. Asrofah memang bertempat tinggal di seputar Pasar Srimangunan. Dia biasa main ke bango-bango (kios terbuka) di pasar tersebut, sehingga tahu mana saja kios yang nganggur dan tak dipakai dagang. Bahkan dia juga sering mendengar bahwa sebagian kios kosong isu di malam hari suka dimanfaatkan lelaki hidung belang untuk menuntaskan birahinya dan cintanya dalam beberapa jam. Seiring dengan pertumbuh-

an usia, ditambah ilmu”ekstra kurikuler” lewat internet, dia menjadi lebih cepat dewasa bila dibanding dengan usia sebenarnya. Bayangkan, dalam usia baru tiga pelita lebih sedikit, sudah punya pacar yang memperlakukannya bak gadis dewasa saja. Apa lagi si doi juga sesama ABG yang baru diasah “taji”-nya ibarat ayam jago. Maunya sicowok, Asrofah mau dipendel (dihajar dengan tajinya), mirip ayam jago aduan di medan laga. Beberapa hari lalu, agaknya “tensi” mereka dalam tata niaga asmara dalam kondisi memuncak. Diam-diam Masrudin-Asrofah masuk ke pasar, langsung menuju sebuah kios yang nganggur. Di rasa aman terkendali, keduanya pun lalu berbuat intim bak suami istri. Krusak krusek.. tanpa henti, karena hanya beralaskan karung plastik.

Adalah seorang tukang parkir yang memergoki aksi mesum tersebut. Mendengar suara mencurigakan di dalam kios, dia penasaran dan mengintipnya. Ya ampun, di dalam sana nampak AsrofahMasrudin yang sangat dikenalnya, sedang ketanggungan berbuat mesum. Langsung saja dia menghubungi Satpam Pasar sambil memberi isyarat berupa gerakan kedua tangannya. “Tuh ada anak beginian,” ujarnya. Pak Satpam pun segera bertindak. Meski belum saatnya turun minum, “pertandingan”

segera dihentikan, dan keduanya digelandang ke Pos Pasar. Orangtua wanita Asrofah, demi melihat putrinya dibawa ke polisi gara-gara berbuat mesum, langsung pingsan. Dia malu pada warga, juga malu pada diri sendiri karena merasa gagal mendidik anak. Di sekolahkan sampai SMA segala, kan agar jadi anak yang berguna, kok malah………. Maunya jadi anak berguna, eh malah bikin anak! (pk/int)

Informasi diperoleh, peristiwa terjadi saat kediaman sedang kosong. Menjelang tengah hari, Syahrial pulang berjualan dan hendak makan siang di rumah. Begitu sampai di rumah, ia heran melihat pintu depan terkunci dari dalam. Saat diperiksa dari pintu belakang, Syahrial melihat korban sudah tewas tergantung menggunakan sambungan kain sarung yang diikatkan di atas broti plafon atap rumah. Tak jauh dari jasad korban, terlihat kursi yang diduga dipakai korban untuk membantu memperlancar aksi nekatnya. Melihat itu, Syahrial berteriak meminta pertolongan warga sekitar. Tak lama, warga berduyun-duyun menyaksikan lebih dekat peristiwa tersebut. Personel Polsek Hinai yang mendapat informasi, langsung turun ke lokasi dan melakukan proses evakuasi. Jasad korban dibawa ke Puskesmas terdekat untuk dilakukan pemeriksaan. “Diduga korban bunuh diri karena frustasi akibat putus cinta,” kata Kanit Reskrim Polsek Hinai Iptu M I Saragih. Di lokasi kejadian, polisi juga menemukan sepucuk surat wasiat yang ditulis korban. Isinya tentang permohonan maaf serta meminta keluarganya untuk tabah dan merelakan kepergiannya. Keluarga korban tidak mengerti kenapa korban sampai senekat itu dan tidak pernah mengetahui kalau korban memiliki persoalan. “Kami nggak tahu dia punya persoalan, sampai nekat seperti itu. Dia itu anaknya pendiam dan tidak pernah mau cerita apa-apa. Kami curiga pasti dia punya persoalan sa-

ma pacarnya. Karena sebelum tewas, dia ada menulis surat,” kata Syahrial. Korban yang hanya tamatan SMP itu, sudah tiga tahun lebih tinggal bersama Pakciknya di lokasi, sebab ibu kandungnya berada di Jambi. Sedangkan ayahnya hingga kini tidak diketahui keberadaannya. “Kasihan dia karena sudah tidak ada lagi keluarga, dia di sini tinggal sama Pakciknya dan saat kejadian itu tidak ada orang di rumah. Anak pakciknya itu sedang sekolah,” ungkap seorang tetangga yang tinggal dekat lokasi. Meskipun demikian, pada jenazah korban ditemukan sedikit kejanggalan. Karena bekas luka jeratan di leher korban terlihat seperti terjerat tali. Padahal, korban sendiri terlihat tewas dengan cara menjerat lehernya dengan sambungan kain panjang. Sehingga muncul dugaan kalau korban sudah tewas dibunuh sebelum akhirnya dijerat pakai kain sambungan itu seolaholah seperti gantung diri. “Memang ada ditemukan bekas luka jeratan tali di lehernya. Mungkin hasilnya bisa diketahui kalau pihak keluarga bersedia dilakukan otopsi,” kata seorang polisi yang namanya minta dirahasiakan. Meskipun begitu, Kanit Reskrim Polsek Hinai Iptu M I Saragih tetap membantah tudingan tersebut. Karena tidak ditemukan adanya bekas-bekas luka penganiayaan di tubuh korban. “Tidak ada itu, kan tadi sudah dijelaskan kalau korban nekat bunuh diri karena frustasi akibat putus cinta,” ucap Kanit Reskrim Polsek Hinai menimpali. (wis/pmg)

Foto Darwis

„ Jenazah Doly Pratama, ABG yang tewas gantung diri.

Rumah Pengusaha Dirampok Satpam BOGOR- Rumah pengusaha properti dirampok. Dalam aksinya, tiga orang pelaku yang diduga satpam perusahaan konveksi memakai seragam tanpa penutup muka. Identitas pelaku diketahui saat anak korban belanja di mini market. Ia melihat pelaku tengah bertugas di salah satu pabrik konveksi. Polsek Parung yang menangani kasus ini, lalu membawa keluarga korban memutar pabrik konveksi saat ketiganya piket sore. Mendapat keterangan anak korban, personel Polsek Parung dipimpin melakukan penggerebekan. Namun dari penyergapan yang dilakukan, Selasa (1/5) siang ini, hanya seorang tersangka yang berhasil ditangkap. Dua lagi kini masih diburu. Menurut informasi, pelaku masuk ke rumah pengusaha ini dengan memakai senjata tajam. Kanit Reskrim Polsek Parung AKP Nelson Siregar menjelaskan perampokan yang dialami Yusriyawati (36) dan Abubakar (37), terjadi pada Senin (30/4), sekira pukul 24.00 WIB. Saat itu, anak korban Virda Vadillah (17) sedang tertidur pulas. Tiba-tiba ia mendengar bunyi pintu dapur terbuka. Penasaran, korban membuka pintu kamarnya. Tiba-tiba muncul seorang pelaku yang kemudian meno-

dongkan golok dan menempelkannya ke leher. Gadis belia yang masih duduk di bangku SMA itu diancam supaya melepaskan seluruh perhiasan yang dipakainya. Kalung, dua cincin, dua handphone BlackBerry, surat kendaraan dan dua kunci sepedamotor diambil. Sedangkan dua pelaku lainnya menunggu di dapur. Korban yang takut hanya bisa pasrah. Setelah melucuti seluruh barang-barang milik korban, pelaku kemudian bergerak ke arah dapur dan kabur sersama dua rekannya Yusriyawati yang sedang di kamar terbangun, karena mendengar anaknya menangis. “Anak saya cerita, kalau ia dirampok dan diancam pakai golok oleh pelaku dengan ciri potongan rambut cepak, perawakan tinggi, memakai pakaian satpam dan jaket kulit warna hitam,” kata Yusriyawati di Mapolsek Parung, Selasa (1/5) siang. Kanit Serse Polsek Parung AKP Nelson Siregar menuturkan, pihaknya menangkap pelaku setelah memiliki cukup data dari korban. Diketahui, ketiga kawanan rampok bersenjata tajam tersebut diduga merupakan satpam di PT WM, yang berlokasi di Kampung Cibandar Desa Parung, Kecamatan Parung, Bogor. (pk/int)


2 Mei 2012

Kapolsek Gagal Tangkap Pukat Trawl Sambungan Halaman 8 orang anggota serta 6 orang nelayan melakukan penyisiran di wilayah perairan Kecamatan Barus. “Kita turun ke laut dengan menggunakan boat dari Kahona menyisir pantai, sekitar 15 menit berjalan kita melihat dua unit boat pukat trawl se-

dang beroperasi di sekitar laut Sitiris-tiris. Pukat trawl tersebut merusak jaring-jaring nelayan tradisional yang tengah dipasang. Waktu kita kejar, boat pukat trawl lari ke arah Pulo Karang,” katanya. Pihak kepolisian berusaha mengejar boad trawl itu. Namun para awak pukat trawl

menghubungi rekan mereka sesame pemukat trawl untuk menghalangi aksi polisi. “Sepertinya mereka hendak melakukan serangan brutal di laut. Saya tidak ingin nelayan dan anggota polisi celaka. Maka untuk menghindari hal yang tidak diinginkan saya memerintahkan nelayan tra-

disional dan anggota kepolisian mengalah dan kami pun sandar di darat,” bebernya lagi. Setelah kejadian tersebut pihak kapolsek melakukan pertemuan antara pelaku pukat trawl dan nelayan tradisional untuk membahas hal tersebut. Dalam pertemuan itu hadir perwakilan masing-ma-

sing nelayan dari setia desa, pengusaha pukat trawl serta pihak kepolisian. Dan Ketua Himpunan Nelayan Seluruh Indonesia Kecamatan Barus, Habibi Pasaribu, mengatakan kegiatan pukat trawl telah mengancam kesejahteraan nelayan tradisional. “Sesuai hukum perairan,

pukat trawl hanya diizinkan beroperasi di wilayah 12 mil dari bibir pantai. Tapi yang terjadi sekarang pukat trawl telah beroperasi hanya 1 mil dari pantai. Untuk itu kami meminta agar Kapolsek Barus membantu menindak para pelaku pukat trawl,” terang Habibi. Sementara itu salah seorang

Hari Buruh Diperingati dengan...

Murid Pintar PRAKTIK MENGAJAR Sambungan Halaman 8 Ditanya harapannya untuk kemajuan pendidikan di tanah air, gadis manis yang bercita-cita jadi dokter itu mengatakan hendaknya biaya sekolah ditekan lebih murah dan terjangkau. Sebab, menurut dian banyak anak dari keluarga tidak mampu yang terpaksa putus sekolah, padahal anak itu punya minat belajar yang tinggi. Kasek SMP N 1 Badiri Wasdin Tumanggor SPd dan Kasek SMP N 1 Pandan Bahal Simanjuntak SPd mengatakan, sharing akademik tersebut merupakan kegiatan menyemangati Hardiknas, 2 Mei 2012. Ada 9 orang siswa SMP N 1 Pandan yang berperan dalam kegiatan itu. “Tujuannya agar siswa dapat bertukar pengalaman dalam kegiatan belajar mengajar. Yang diajarkan topik pelajaran, lalu teman bisa memberi saran dan kritik. Mata pelajaran yang disharingkan masing-maisng IPA fisika dan biologi, matematika, bahasa Inggris dan IPS,” kata Kasek SMP N 1 Pandan Bahal Simanjuntak SPd. Bahal menambahkan, sharing

akademik tersebut akan diselenggarakan di 5 sekolah lainnya. Di mana sebelumnya telah dilaksanakan juga di SMP N 2 Tapian Nauli. Sharing akademik dilaksanakan sesuai tema Hardiknas; Bangkitnya generasi emas Indonesia. “Kali ini siswa SMP N 1 Pandan yang memberikan topik pelajaran, nanti sebaliknya. Jadi siswa dituntut jadi manusia emas, kemana saja tampil tetap emas,” terang Bahal. Diharapkan, sharing akademik akan membentuk kepercayaan diri siswa, dengan berbicara di depan kelas dan di hadapan orang banyak. Lalu, dengan metode ini siswa akan berupaya menambah ilmu pengetahuannya, dan membentuk kedisiplinan. “Kami juga sudah punya program menumbuh kembangkan potensi para siswa. Banyak yang bakat terpendam, misalnya siswa peserta OSN (olimpiade sains nasional) pada mata pelajaran fisika, biologi dan matematika. Caranya, siswa potensial di bahasa Inggris akan diberikan les ekstra kulikuler gratis di luar jam belajar sekolah,” Kasek SMP N 1 Badiri Wasdin Tumanggor SPd. (mora)

YVBS Bersama HTT Sibolga Gelar Pasamuan Budhis Sambungan Halaman 8 rasa keharmonisan baik dengan sesama umat Budha dan terlebih kepada umat beragama lainnya,” pesan Andri. Di kesempatan itu, Ketua PSMTI Sibolga, Bengawan Halim didampingi Sekretarisnya, Mestika Nauli, SE, SPd sangat menyambut baik terselenggaranya kegiatan tersebut. Mereka menilai, warga Tionghoa yang berdomisili di Sibolga dan sekitarnya ini sangat menyambut baik atas diselenggaranya kegiatan pasamuan Budhis ini. “Semoga warga Tionghoa khususnya di Kota Sibolga dan Indonesia secara umum diberkati oleh Sang Budha Agung, diberikan umur panjang, limpahan rezeki serta sukses dalam karir. Karena, kegiatan ini juga sebagai jalinan silaturahmi antar umat beragama Budha dalam menyambut Tri Suci Waisak,” tutur mereka.

Pantauan METRO, pelaksanaan pasamuan Buddhis di gedung HTT Sibolga berjalan lancar. Kendati gedung pelaksanaan ritual dipadati ribuan umat Budha Sibolga dan sekitarnya, namun kegiatan pemanjatan doa, khotbah yang disampaikan Pdt. Sutoyo Virajayo, dilanjutkan dengan renungan ini penuh dengan keheningan dan hikmah. Turut hadir para tokoh Tionghoa Sibolga, antara lain Lao Toako HTT, Cahaya Sibunbun (Coa Liong Bun) dan Sugianto (Fang Cen Chien), Wakil Ketua umum YVBS Vinsen Efenly, Ketua PSMTI Sibolga Bengawan Halim, Ketua Harian Bidang Kerohanian YVBS Cang Sang Tak, Ketua Harian Bidang Sosial YVBS Hakim Sudiman (Aleng). Sementara ribuan umat Budha Kota Sibolga juga terlihat mengikuti acara Pasamuan Buddhis yang dipusatkan di gedung HTT Sibolga tersebut. (mora)

pengusaha pukat trawl Kecamatan Barus, Maringgon Tampubolon, beserta tekongnya marga Sirait, pada membantah bahwa kegiatan pukat trawl yang dilakukan anak buahnya telah merusak habitat laut dan peralatan tangkapparanelayandanmengaku hanya menggunakan jaring apung untuk menangkap ikan. (rin)

Sambungan Halaman 8


„ Khairul Harahap (paling kanan) dan warga Sigiring-Giring usai menangkap ular sawah sepanjang 5 meter dengan berat 20 kilogram, Selasa (1/5).

Ular Sawah 5 Meter Ditangkap Sambungan Halaman 8 pakai tangan. Saya tangkap kepalanya dan teman yang lain memegang bagian tengah dan

ekornya. Prosesnya hanya sekitar 10 menit, mungkin tidak sulit karena ular sedang tidur makanya tidak melawan,” paparnya. Ular hasil tangkapan warga ini,

sambung Khairul, dibawa ke Kecamatan Batang Toru. Di sana ada salah satu warga yang memelihara ular. “Agar tidak meresahkan, ular ini kita serahkan

kepada pemelihara ular di Kecamatan Batang Toru. Mudahmudahan daerah kami ini aman dan tidak ada lagi warga kehilangan ternak,” harapnya. (phn)

Di tempat terpisah Polres Tapteng juga melaksanakan doa dan zikir bersama yang dihadiri jajaran kepolisian dilaksanakan di Musola Nurul Iklas di asrama Polres Tapteng. Kegiatan doa dan zikir bersama ini memang berdasarkan surat telegram dari Polda Sumut agar masingmasing wilayah kesatuan, melaksanakan dzikir dan doa bersama dalam menyambut hari buruh sedunia. Diharapkan, zikir dan doa bersama akan selalu menciptakan situasi yang kondusif di wilayah masingmasing. (aris)

Operasi Moneter BI Kendalikan Inflasi Sambungan Halaman 8 ment) di pasar uang untuk mencapai sasaran operasional kebijakan moneter,” ujar Budianto selaku pemateri kegiatan Pelatihan Wartawan Ekonomi, Moneter, dan Perbankan di Hotel Grand Royal Panghegar, Bandung, Jawa Barat, Sabtu (28/4) pekan lalu. Sasaran operasional kebijakan moneter, katanya, dicerminkan pada perkembangan suku bunga Pasar Uang Antar Bank Overnight (PUAB O/N). Pergerakan di suku bunga PUAB tersebut diharapkan akan diikuti oleh perkembangan di suku bunga deposito, dan pada gilirannya suku bunga kredit perbankan.

Penetapan BI Rate juga dilakukan dengan mempertimbangkan faktor-faktor lain dalam perekonomian. BI akan menaikkan BI Rate apabila inflasi ke depan diperkirakan melampaui sasaran yang telah ditetapkan, sebaliknya BI akan menurunkan BI Rate apabila inflasi ke depan diperkirakan berada di bawah target sasaran. “Semisal, Bank Indonesia pada tanggal 12 April 2012 lalu, BI tetap mempertahankan BI Rate sebesar 5,75%, sebagai respon kebijakan untuk mengendalikan tekanan inflasi dari sisi fundamental sesuai prakiraan makroekonomi ke depan. Sementara untuk mengendalikan tekanan inflasi

dalam jangka pendek yang bersifat temporer, kebijakan difokuskan pada penguatan operasi moneter dan pengendalian ekses likudiasi secara terukur,” bebernya. Penetapan BI Rate (respon kebijakan moneter) dilakukan setiap bulan melalui mekanisme RDG bulanan dan berlaku sampai dengan RDG berikutnya. Penetapan BI Rate dilakukan dengan memperhatikan efek tunda kebijakan moneter ( lag of monetary policy) dalam mempengaruhi inflasi. “Bila terjadi perkembangan diluar prakiraan semula, penetapan stance Kebijakan Moneter dapat dilakukan

sebelum RDG bulanan melalui RDG mingguan. Perubahan BI Rate (secara konsisten dan bertahap dalam kelipatan 25 basis poin (bps). Dalam kondisi untuk menunjukkan intensitas Bank Indonesia yang lebih besar terhadap pencapaian sasaran inflasi, maka perubahan BI Rate dapat dilakukan lebih dari 25 bps dalam kelipatan 25 bps,” beber Budianto. Sementara itu, katanya lagi, likuiditas adalah kemampuan bank untuk memenuhi kemungkinan ditariknya deposito/simpanan oleh deposan/ penitip. Suatu bank dikatakan likuid apabila dapat memenuhi kewajiban penarikan uang dari

penitip dana maupun dari para peminjam/debitur. Secara praktis, lanjutnya, likuiditas suatu bank sering dikaitkan dengan jumlah dana pihak ketiga yang terdapat di bank tersebut pada waktu tertentu. Pemerintah melalui Bank Sentral menetapkan kewajiban setiap bank untuk memelihara likuiditas wajib minimum sebesar 5% dari besarnya kewajiban terhadap pihak ketiga. “Manajemen likuiditas bertujuan untuk menjaga kecukupan likuiditas di pasar uang dalam rangka menjaga stabilitas suku bunga jangka pendek atau overnight (O/N) dekat pada level policy rate bank sentral,” tuturnya. (tob)

Mari Bercermin untuk Kemajuan Pendidikan Sambungan Halaman 8 mengenai realitas dunia pendidikan di Indonesia bukan hal momentum. Artinya, kegiatan memikirkan keadaan dunia pendidikan ini bukan hanya muncul saat momen Hardiknas tiba, tetapi merupakan suatu pemikiran yang tumbuh

berkembang seiring kondisi nyata yang berlangsung. Satu sisi pemikiran kritis yang melahirkan keprihatinan terhadap bangsa dan negara. Kekayaan alam yang melimpah ruah kiranya tak cukup menghapus kemiskinan rakyat di berbagai penjuru tanah air. Kemiskinan menyebabkan para

orang tua sangat kesulitan untuk membiayai pendidikan anakanaknya. Di mana-mana masih selalu terdengar keluhan, betapa mahalnya pendidikan. Akibatnya, sebagian anak dan remaja putus sekolah. Melewati bangku SMA saja teramat sulit, apalagi sampai mengecap perguruan tinggi. Mimpi.

Di sisi lain, kita pun merasa khawatir akan lingkungan pergaulan anak-anak kita. Pendidikan dan pengajaran yang didapatkan di sekolah tak menghapus kecemasan itu. Anak-anak kita hidup di era teknologi maha canggih yang di satu sisi menggembirakan tetapi di sisi lain merusak, arus

informasi tanpa batas, segala yang serba instan, semua itu berkompeten membunuh rasa toleransi serta kehidupan bermasyarakat secara damai dan santun. Dunia pendidikan kita dihadapkan pada serangkaian kenyataan miris yang dapat merusak akhlak dan mental anak bangsa ini. (bersambung)

Kesulitan Cari Referensi Tertulis, Tak Sengaja Menemukan di Belanda Sambungan Halaman 1 mengganti penelitian saya tentang musik tradisi Sunda. Saya ingin menggantinya dengan penelitian tentang dangdut. Saat itu Evie Tamala sedang top-topnya,” kenang Andrew. Namun, niat mengganti tema penelitian itu langsung ditolak dosen pembimbing Andrew. Alasannya, dangdut adalah musik pop dan bukan musik tradisi yang seusai bidang keilmuan Andrew saat itu. Walau mendapat penolakan, bukan berarti Andrew lantas meninggalkan dangdut begitu saja. Dia tetap dekat dengan dangdut sebagai penikmat. Selama enam tahun Andrew menuntaskan penelitiannya tentang musik tradisi Sunda. Dia mendalami seluk beluk musik Sunda dengan beragam keunikan di sekitarnya. Mulai

kecapi, gamelan, hingga wayang golek menjadi fokus penelitiannya saat itu. “Saya tetap dekat dengan dangdut sebagai penggemar, belum menempatkannya sebagai objek penelitian,” beber warga negara AS yang fasih berbahasa Indonesia ini. Ketertarikan Andrew dengan dangdut dan menempatkannya sebagai objek penelitian baru kesampaian pada 2005. Saat itu, dia sudah menyandang gelar profesor dan mendapat beasiswa untuk meneliti dangdut. Sebagai seorang profesor, Andrew tak lagi harus terkungkung pada batas-batas musikologi yang memilah musik tradisi dan pop. Tanpa buang waktu, Andrew terbang ke Indonesia setelah menerima beasiswa dari pemerintah AS untuk mewujudkan cita-cita lamanya. Selama enam bulan Andrew menghabiskan

waktunya di Indonesia untuk mewujudkan cita-citanya menghasilkan sebuah penelitian dan buku tentang dangdut. Pada awal penelitiannya, Andrew mengakui sama sekali tidak mudah untuk menjangkau sumber-sumber dangdut. Minimnya referensi tertulis tentang dangdut dan akses kepada para pelaku musik dangdut sebagai narasumber penelitian menjadi hambatannya. “Tidak mudah untuk bisa menemui dan melakukan wawancara dengan para pemusik dangdut. Harus ada yang mengantarkan,” tutur Andrew. Namun, kesulitan menjangkau narasumber untuk wawancara itu kemudian bisa teratasi secara perlahan. Pemusik dangdut seperti Rhoma Irama, A Rafiq, Camelia Malik, hingga Munif Bahasuan dia temui untuk interview mendalam.

Andrew juga melakukan wawancara dengan para insan media seperti Ishadi SK yang dia anggap berperan membawa dangdut dekat dengan media massa, khususnya televisi. Kesulitan mendapat narasumber dari pelaku dangdut tidak lantas diikuti dengan kemudahan mendapatkan referensi tertulis tentang dangdut. Andrew harus melakukan perjalanan hingga negeri Belanda untuk mendapatkan data-data tertulis tentang dangdut dan segala macam pernik di sekitarnya. Tentang gegap gempita dangdut yang terekam dalam pemberitaan media justru diperoleh Andrew di Belanda. Di Indonesia, sumber tertulis semacam itu termasuk langka. Jerih payah Andrew mencari sumber-sumber tersebut terbayar dengan buku yang dia hasilkan. Buku tersebut tidak hanya melulu berisi tentang dangdut sebagai musik. “Saya menulis buku tentang dangdut

Keluarga Korban Cabul dan Pelaku Berdamai Sambungan Halaman 1 rumah saya untuk meminta kasus tersebut dapat diselesaikan secara kekeluargaan atau perdamaian,” tutur ibu Anggrek, IW br S. Waktu meminta perdamaian, sebut IW br S, ketiga orangtua pelaku satu per satu meminta maaf sambil menangis. “Aku dan keluargaku pun menerima perdamaian itu,” ungkapnya sembari menambahkan dirinya menerima perdamaian karena mereka juga masih ada keluarga dan bertetangga. Apalagi, keluarga korban juga pendatang. GH, AR, dan JM juga meminta maaf kepada orangtua korban dan orangtuanya masing-masing. Selain itu, ketiganya juga berjanji tidak akan

mengulangi lagi perbuatannya. Keesokan harinya, Selasa (1/5), IW br S pun melaporkan ke Polres Sibolga Kota bahwa pihak keluarga korban dan pelaku sudah berdamai. Kapolres Sibolga Kota AKBP JF Panjaitan ketika dikonfirmasi melalui Kasat Reskrim AKP Agus Pristiono, Selasa (1/5) membenarkan ortu korban dan pihak keluarga pelaku sudah berdamai. “(Selasa, red) tadi pagi jam 08.00 WIB sudah datang ke Polres orangtua korban yang menyebutkan bahwa pihak keluarga korban dan pelaku sudah berdamai. Ibu korban pun sudah mencabut pengaduannya,” ujar Agus. Ketika ditanya terkait proses hukum kasus tersebut, Agus mengatakan,

“Kalau pengaduan sudah dicabut, maka proses hukumnya tidak ada lagi.” Seperti diberitakan sebelumnya, tiga bocah duduk di sekolah dasar, yakni GH, AR dan JM dilaporkan orangtua Anggrek ke polisi atas tuduhan pencabulan. Bocah perempuan berusia lima tahun ini digerayangi di rumah JM yang masih tetangga dekat korban di Sibolga, Jumat (27/4) siang. Ibu korban, IW Br S saat ditemui di RSU Dr FL Tobing Sibolga, Senin (30/4) untuk keperluan visum buah hatinya itu menceritakan peristiwa tersebut sesuai pengakuan putrinya Anggrek. Aksi itu bermula saat GH, AR dan JM memanggil dan mengajak Anggrek untuk main ke rumah JM. Saat itu rumah JM sedang kosong. Lalu, Anggrek diajak main ke kamar, dan JM

mengunci pintu kamar. Tak beberapa lama kemudian, JM memaksa Anggrek membuka celananya sembari mengeluarkan ancaman. “Awas kalau kamu kasih tau sama orang, dan sama orangtuamu,” ancam JM kala itu seperti ditirukan ibu korban IW br S. Anggrek yang polos itu kemudian membiarkan celananya dibuka. “Saat itulah mereka (ketiga bocah SD, red) menggerayangi kemaluan anakku. Anakku mengaku kesakitan waktu itu. Anakku juga mengakui sebelumnya sudah pernah diperlakukan seperti itu,” tutur janda tiga anak ini yang telah ditinggal mati suaminya setahun lalu, saat mendampingi Anggrek divisum di RSU Dr FL Tobing Sibolga. (dungo)

agar bisa dibaca para mahasiswa, peneliti lain, dan siapa saja yang hendak meneliti musik, antropologi, dan studistudi Asia Tenggara,” sambung Andrew. Isi buku Andrew memang lintas disiplin. Sebagai sebuah buku tentang musik, jelas Andrew menuliskannya dengan komperehensif. Sebagai buku tentang fenomena sosial kaum urban Indonesia, buku Andrew juga pantas diandalkan. Menurutnya, dangdut memang bukan sekadar musik. Apa yang tertulis dalam syair dangdut adalah cerminan realitas sosial yang ada saat lagu itu tercipta. Tentang susahnya hidup jadi

gelandangan atau bebas merdekanya seorang bujangan hingga derita dan bahagia cinta ada dalam dangdut. Semuanya disampaikan dengan rasa dangdut yang khas hingga membuat pendengarnya tetap bergoyang walau lirik lagunya sedih merintih-rintih. Bagi Andrew, dangdut di Indonesia memiliki keunikan-keunikan yang tidak dimiliki oleh musik lain di tanah air. Kedekatan Andrew dengan dangdut tidak hanya berhenti pada buku. Pada 2007 lalu, dia membentuk sebuah grup dangdut di Pittsburgh. Grup dangdut itu diberi nama Dangdut Cowboys. (bersambung)

Jenazah Petinju Tapteng Diantar 13 Sahabatnya Sambungan Halaman 1 Samuel yang semasa hidup dikenal warga dengan sifatnya yang baik dan suka membantu orangtuanya. M Situmeang ayah Samuel, menangis sambil berguling-guling di lantai melihat jenazah anak kesayangannya itu. “Nadiari Sabtu i dopeho juara 1, hape saonari nga tong ho juara 1, dihoma sude pialamon (Baru Sabtu kemarin kamu juara satu, tetapi sekarang kamu juga juara satu, samamulah semua pialamu ini),” tangis ayah Samuel sambil melemparkan beberapa medali penghargaan yang diterima Samuel selama ini ke badan Samuel di peti matinya. Beberapa piagam dan medali terpajang di dekat peti jenazah Samuel yang merupakan anak ketiga dari 4 bersaudara. Samuel dikenal banyak orang dengan gelar juaranya. Selain itu korban juga banyak mengumpulkan piagam, baik dari sasana tinju, wushu maupun karate.

Dalam peti jenazah almarhum juga diletakkan sarung tinju merah dan sepatu hitam serta beberapa sabuk. Menurut ayah korban, itu adalah sarung tinju kesayangan almarhum. Demikian juga ibu Samuel, boru Simanungkalit, selalu menangisi kepergian anak kesayangannya itu. Apalagi baru hari Kamis kemarin anaknya tersebut diwisuda dari UNIMED. “Baru nadiari Kamis i dope ho wisuda, hape nga pittor lao ho saonari, tudia ma bahenokku SPd mon (baru hari Kamis kemarin kamu wisuda, tetapi sekarang kamu langsung pergi, kemanalah kubawa SPd mu ini),” tangis ibu Samuel sambil memeluk ijazah sarjana pendidikan (SPd) Samuel. Seperti diberitakan sebelumnya, Samuel MD Situmeang (25), meregang nyawa usai mengantar adiknya Rinta (19) ke terminal bus Amplas. Samuel dilindas truk ketika melintas di Jalan Menteng, Senin (30/4) sekira pukul 07.00 WIB. (fred)


2 Mei 2012

Sambut Tri Suci Waisak,

YVBS Bersama HTT Sibolga Gelar Pasamuan Budhis SIBOLGA- Menyambut peringatan Tri Suci Waisak 2556 BE yang jatuh 6 Mei minggu depan, Yayasan Vihara Budha Sibolga (YVBS) bersama Himpunan Tjinta Teman (HTT) Sibolga, Senin (30/4) malam kemarin, menggelar Pasamuan Buddhis dengan memanjatkan doa agar umat Budha Sibolga dan Indonesia umumnya dapat bersatu dan hidup berdampingan secara harmonis. Ketua umum YVBS, Hardy


PASAMUAN BUDHIS: Umat Budha Sibolga sekitarnya memanjatkan doa pada kegiatan pasamuan Buddhis.

Virgo didampingi Ketua (Toako) HTT Sibolga, Andri Parlinggoman (Tang A Law) kepada METRO usai mengikuti ritual Pasamuan Buddhis mengatakan, kegiatan tahunan ini hasil kerja sama YVBS dengan HTT Sibolga serangkaian menyambut Tri Suci Waisak 2556 BE. “Diharapkan dengan memanjatkan doa bersama ribuan umat Budha di Sibolga dan sekitarnya ini, dapat lebih memersatukan umat ber-

agama di Indonesia pada umumnya dan dapat hidup berdampingan antara satu sama lain tanpa membedabedakan suku, ras, maupun agama. Karena, hakekatnya kita hidup di dunia harus harmonis antara satu dengan lainnya, dan itu ditegaskan dalam ajaran agama apapun,” tutur Ketua umum YVBS Sibolga, Hardy Virgo. Dilanjutkan Hardy, terselenggaranya kegiatan ini berkat gagasan Himpunan

Tjinta Teman (HTT) Sibolga mengundang YVBS. “Jadi, doa bersama ini pada intinya mendoakan agar penyatuan semua umat beragama. Disamping itu, agar umat Budha Sibolga maupun masyarakat secara luas diberikan keberkahan, kesehatan, umur panjang dan sukses dalam kehidupannya,” ucap Hardy seraya mengatakan pada, Rabu (1/5) malam akan digelar hal yang sama yakni, pasamuan Buddhis di Vihara

Cetya Muni Sibolga. Toako HTT Sibolga Andri Parlinggoman menyatakan, pasamuan Buddhis tersebut juga bertujuan agar umat Budha dapat lebih mawas diri dalam kehidupan dan hidup lebih harmonis antara satu dengan lainnya. “Sebab, tanpa keharmonisan, hidup di dunia terkesan tak berarti. Maka itu, umat Budha Sibolga diharapkan lebih menanamkan

‹ Baca YVBS ‹

...Hal 7


Kapolsek Gagal Tangkap Pukat Trawl Nelayan Berharap Banyak kepada Polisi BARUS- Kegiatan pukat trawl atau pukat harimau yang beroperasi di wilayah tangkap nelayan tradisional Kecamatan Barus, Sosorgadong dan Andamdewi semakin hari semakin merajalela. Tidak hanya menyikat habis ikan-ikan “jatah” nelayan tradisional, pukat trawl juga merusak peralatan tangkap para nelayan yang sengaja di pasang di laut.

Hal tersebut semakin mengganggu ketentraman dan kesejahteraan nelayan. Untuk itu 23 April lalu, ketua HNSI Kecamatan Barus, Habibi Pasaribu membuat laporan tertulis yang ditujukan langsung kepada Kapolsek Barus. Isi laporan adalah agar kepolisian mengambil tindakan atas maraknya pukat trawl.

Kapolsek Barus Iptu Ferymon membenarkan laporan tersebut. Laporan itu, kata kapolsek ditandatangani Ketua HNSI Kecamatan Barus dan perwakilan nelayan dari sembilan desa meliputi Kahona, Sitiris-tiris, Kadetigo, Paltujuh, Kinali, Pasarterandam dan Pulo Pane.

“Mereka meminta bantuan untuk menindak para pelaku pukat trawl yang beroperasi di wilayah perairan Kecamatan Barus dan sekitarnya,” kata kapolsek, Senin (1/5). Menindaklanjuti hal itu, kapolsek mengaku 27 April lalu, dia bersama 6

‹ Baca Kapolsek ...Hal ‹


Hari Buruh Diperingati dengan

‹ Baca Hari Buruh ...Hal ‹


‹ Baca Operasi ...Hal ‹


SHARING AKADEMIK- Siswa SMP Negeri 1 Pandan, Dara Intan Mauliza mengajar di kelas VII SMP Negeri 1 Badiri dalam kegiatan sharing akademik menyambut Hardiknas, Selasa (1/5).

SMP 1 Pandan-SMP 1 Badiri Sharing Akademik


„ Di Sibolga-Tapteng, Hari Buruh Sedunia diperingati dengan menggelar zikir dan doa. Seperti di Polres Sibolga Kota, zikir dan doa digelar dengan khusuk demi terciptanya kondusifitas kota.

Operasi Moneter BI Kendalikan Inflasi BANDUNG- Kepala Biro Operasi Moneter Bank Indonesia, Budianto mengungkapkan, BI Rate atau suku bunga acuan ditetapkan oleh Bank Indonesia untuk mengendalikan tekanan inflasi dalam jangka pendek yang bersifat temporer. kebijakan tersebut difokuskan pada penguatan operasi moneter dan pengendalian ekses likuidasi. “BI Rate diumumkan oleh Dewan Gubernur Bank Indonesia setiap Rapat Dewan Gubernur (RDG) bulanan dan diimplementasikan pada operasi moneter yang dilakukan Bank Indonesia melalui pengelolaan likuiditas (liquidity manage-

Dzikir & Doa

SIBOLGA-Memperingati Hari Buruh Sedunia yang jatuh Selasa 1 Mei, kepolisian Polres Sibolga Kota menggelar zikir dan doa bersama dengan unsur muspida dan BKM Mesjid se-Kota Sibolga. Ustad Supratman Af dalam tausyiahnya berpesan agar masyarakat di Kota Sibolga menjaga kerukunan bermasyarakat. “Untuk membangun kampung ini, kita harus memiliki hati yang tulus dan ihklas agar kemajuan yang kita harapkan terwujud. Dan marilah kita bersama-sama berdoa agar terjauh dari mara bahaya dan bencana,” pesan Ustad Supratman. Pantauan koran ini, doa dan zikir yang digelar tampak khusuk. Kasubbag Humas Polres Sibolga Aiptu Rahmadansyah Sormin S.Ag mengimbau agar masyarakat selalu menjaga kerukunan.


OPERASI MONETER, Kepala Biro Operasi Moneter BI, Budianto, berbicara dihadapan peserta pelatihan wartawan ekonomi, moneter dan perbankan, di Hotel Grand Royal Panghegar, Bandung, Jawa Barat, akhir pekan lalu.

BADIRI- Untuk sharing akademik, siswa SMP Negeri 1 Pandan bertandang ke SMP Negeri 1 Badiri, Selasa (1/5). Di kesempatan itu, siswa ditampilkan mengajar layaknya seorang guru di kelas. Mata pelajaran yang disharingkan di antaranya fisika dan biologi, matematika, bahasa Inggris, serta IPS. Dara Intan Mauliza, siswa kelas VII SMP Negeri 1 Pandan yang mengajar tentang biologi sel mengatakan, kuncinya adalah

percaya diri dan belajar tekun. “Tidak susah, hanya serius belajar dan percaya diri,” kata Dara usai mengajar di kelas VII SMP Negeri 1 Badiri. Gadis belia berkacamata itu pun mengakui para siswa di kelas yang diajarnya pagi cukup kooperatif dan responsif. Saat mengajar itu, Dara didampingi seniornya sebagai pembimbing, Nadila Lumongga, siswa kelas X.

“Teman-teman di kelas VII tadi pandaipandai semua. Mereka bisa mengerti yang saya ajarkan. Saya juga senang bisa saling berbagi ilmu pengetahuan. Biarpun saya yang mengajar tadi, tapi bukan berarti saya lebih hebat dari teman-teman. Saling berbagi untuk menambah ilmu pengetahuan,” timpal Dara jugapernahmenggantikangurunyamengajar di kelasnya.

‹ Baca Murid Pintar ...Hal ‹


Ular Sawah 5 Meter Ditangkap SIDIMPUAN- Warga Lingkungan II, Sigiring-Giring, Kelurahan Timbangan, Kecamatan Padangsidimpuan (Psp) Utara, Kota Psp, Selasa (1/5) sekitar pukul 17.00 WIB berhasil menangkap ular sawah sepanjang lima meter dan berat 20 kg. Selama ini, keberadaan ular sawah itu memang meresahkan karena memakan ternak warga. Warga sekitar yang juga pawang ular, Khairul Harahap, menerangkan, penangkapan ular bermula saat ia dan beberapa warga bersih-bersih di lubuk larangan warga di Aek Sibontar. Lalu, tanpa sengaja mereka melihat ular sawah atau piton sedang tidur. “Ularnya mungkin sedang kenyang dan tertidur. Selanjutnya, kita menangkap ular


‹ Baca Ular Sawah...Hal ‹


Hari Pendidikan Nasional (1)

Mari Bercermin untuk Kemajuan Pendidikan Hari Pendidikan Nasional tanggal 2 Mei 2012 yang juga adalah hari kelahiran Ki Hajar Dewantara kembali diperingati oleh bangsa Indonesia. Jika kita catat sebagai hari ulang tahun, maka hari ini Ki Hajar Dewantara berusia 123 tahun (2 Mei 1889 – 2 Mei 2012). Siti Aisyah, Dosen Sastra Indonesia STKIP Barus Rentang waktu yang demikian panjang ini telah menorehkan catatan-

„ RA Kartini

catatan maha penting bagi perjalanan sejarah bangsa Indonesia, utamanya, sejarah dunia pendidikan Indonesia, tanpa mengabaikan nama-nama tokoh pendidikan lainnya seperti RA Kartini dan Dewi Sartika. Tentu di sini saya tak akan memaparkan sejarah yang panjang dan berliku ini. Saya pun tak ingin berandai-andai tentang bagaimana jika Ki Hajar Dewantara masih hidup hingga sekarang. Mungkinkah ada seorang sastrawan yang tergugah menuliskan sebuah naskah drama yang secara imajiner menghadirkan tokoh pendidikan nasional ini dalam usia 123 tahun. Bagaimana sang tokoh memandang bangsa dan negerinya di

masa kini. Bisa jadi sang tokoh akan terheran-heran, takjub, marah, atau tertawa dan menangis sekaligus menyaksikan tingkah polah generasi penerus bangsanya. Andai drama ini benar-benar ditulis dan dipentaskan dengan kualitas mumpuni, tentu tak kalah hebat dibanding naskah “Kereta Kencana” yang digubah oleh almarhum WS Rendra, di mana tokoh cerita menakjubkan itu adalah manusia berumur ratusan tahun. Realitas Dunia Pendidikan Kita Sebenarnya, kita sama menyadari bahwa renungan-renungan yang lahir

‹ Baca Mari ...Hal ‹



2 Mei 2012

Seputar Oppung Gagahi Cucu Sampai Melahirkan

Gadis Bugil Hanyut di Pantai Namartua

Dapat Pelecehan Seks Sejak SMP KERASAAN- Melati (nama samaran) cucu yang dijadikan budak seks oleh oppungnya sendiri, Jaitan Nainggolan (55) menurut warga sekitar, kerap mendapat pelecehan seksual sejak SMP. Ironisnya, kelakuan pelaku berlanjut ketika korban bekerja di pabrik minuman hingga melahirkan seorang anak. Namun hingga kini pelaku masih bebas berkeliaran. Menurut L Nenggolan, oppung Melati, warga Tebing Tinggi yang merupakan abang pelaku ketika duhubungi METRO, Selasa (1/5) mengaku, dia dan sejumlah keluarganya sangat menyesalkan kejadian tersebut.

”Dia (pelaku) sangat keterlaluan sekali. Tega-teganya dia memerkosa cucunya sendiri. Padahal selama ini sudah kami percayakan Melati tinggal dengannya sejak ayahnya meninggal dunia,” ujarnya. Sementara, korban juga mengaku bahwa dirinya kerap mendapatkan pelecehan seksual dari opungnya sejak duduk di bangku SMP. Namun korban menganggap itu hanya ekpresi rasa sayang pelaku terhadapnya. ”Bahkan cucu saya ini juga mengatakan, dirinya sering dipeluk opungnya saat tidur bahkan pernah juga ketika

ONANRUNGGU- Seorang gadis berusia sekitar 20 tahun ditemukan tewas mengapung di Pantai Namartua Sioma, Desa Hutahotang, Kecamatan Onanrunggu, Samosir, Sabtu (28/4) sekitar pukul 12.00 WIB. Wanita itu ditemukan pemancing dengan kondisi tanpa busana.

„) Baca Dapat ...Hal 10

Hingga Selasa (1/5) identitas korban belum diketahui. Bahkan tidak seorang pun warga di daerah itu mengaku kehilangan anggota keluarga. Oleh polisi membawa jasad korban ke Rumah Sakit Umum (RSU)

Sebut Wartawan Perusak Bangsa

Dompak Ancam Demo Kadiscatpil TAPUT- Hari ini, Rabu (2/ 5) seratusan wartawan yang tergabung dari media cetak dan elektronik akan melakukan aksi demo ke Kantor Bupati Tapanuli Utara (Taput) untuk menuntut pertanggungjawaban Kepala Dinas Catatan Sipil, Marconis Siregar yang menyebut “wartawan perusak bangsa”. Koordinator aksi demo, Dompak Hutasoit, saat dihubungi METRO, Selasa (1/ 5) melalui ponselnya mem-

benarkan ia bersama sejumlah wartawan lainnya, sudah menyampaikan surat pemberitahuan ke Polres Taput terkait aksi, dengan nomor Laporan Polisi Nomor : STTP/04/IV/2012/ Intelkam. Para wartawan yang akan mendatangi Kantor Bupati, akan menuntut Marconis Siregar untuk mempertanggungjawabkan dan membuktikan ucapannya. ”Selain


FOTO Bernad L Gaol

SERAH TERIMA: Kapolres Taput, AKBP IKG Wijadmika melakukan serah terima berkas kerja sama dengan STAKPN Tarutung.

Diduga Manipulasi Data Honorer

Polres Ajak STAKPN Jaga Kamtibmas

9 Guru SD Laporkan Kasek Saitnihuta ke BKD

Foto : Hengki Tobing.

„) Baca Gadis ...Hal 10

WARISAN LELUHUR- Walikota Siantar Hulman Sitorus dan pengunjung lainnya sedang membaca panduan untuk mengenali salahsatu benda warisan leluhur di Mesum Batak, di kompleks TB Silalahi Center, Desa Pagar Batu, Kecamatan Balige, Toba Samosir, baru-baru ini. Selain sebagai tempat melihat dan mempelajari bendabenda kuno serta kebudayaan leluhur Batak, dari museum ini, pemandangan Danau Toba terlihat sangat menakjubkan.

„) Baca Dompak ..Hal 10

DARI KANAN-KIRI: Ani Rosma br Napitupulu didampingi Sentiria Sitorus dan Pdt BM Siagian menyampaiakan keterangan pers di Gedung Seminarium HKBP, Selasa(1/5).

Pangururan. Informasi dihimpun METRO, Selasa (1/5) dari warga setempat, S Sinaga mengatakan, jasad korban pertama

DOLOKSANGGUL- Kepala Sekolah (Kasek) SD Negeri 175781 Sainihuta, Kecamatan Doloksanggul, Kabupaten Humbahas, berinisial MS dilaporkan sembilan guru ke Badan Kepegawaian Daerah (BKD) setempat. Laporan itu terkait adanya dugaan manipulasi data honorer guru di

sekolah itu menjadi CPNS. Informasi diperoleh METRO, adanya pengangkatan pemerintah melalui surat edaran Menteri Pendayagunaan Aparatur Negara dan Reformasi (Menpan-RB) soal pengangkatan CPNS diduga dimanfaatkan MS untuk memperjuangkan anak kandungnya


menjadi CPNS. Dengan mengorbankan hak guru honorer di sekolah itu yang sudah lama mengabdi. Hal tersebut terbongkar setelah keluarnya nama tenaga honor kategori II (K-II) dalam pengumuman yang dilakukan

„) Baca 9 Guru ...Hal 10



TARUTUNG- Polres Tapanuli Utara menjalin kerja sama dengan Sekolah Tinggi Agama Kristen Protestan Negeri (STAKPN) Tarutung. Mereka sepakat menjaga Kemanan dan Ketertiban Masyarakat (Kamtibmas) dan keselamatan ketertiban, kelancaran lalu lintas (kamseltibcar Lantas) di daerah itu.


Sebagai bentuk keseriusan, Kapolres Taput AKBP IKG Wijadmika Sik telah menandatangani Memorandum of Understanding (MoU) dengan Ketua STAKPN Tarutung, Drs Ibelala Gea STh MSi di Aula Mapolres, Selasa (1/5). Kapolres mengatakan,

„) Baca Polres ...Hal 10


Jemaat HKBP Gelar Selain Mobil Mewah, Telkomsel Juga Bagi-bagi Kreta & Handphone Konferensi Perempuan TAPUT- Untuk mewujudkan visi dan misi sebagai pelayan kristus agar mampu dan kuat menghadapi berbagai tantangan dalam menjalani kehidupan. Jemaat HKBP menggelar konferensi perempuan selama empat hari. sejak tanggal 3-6 Mei di Gedung Seminarium, Kecamatan Sipoholon, Tarutung. Hal ini disampaikan Ketua Umum Konferensi Perempuan HKBP, Ani Rosma Napitu-

pulu didampingi Sekretaris Umum Biv Sentiria Sitorus dan Bendahara Umum Pdt BM Siagian STh kepada wartawan pada konferensi pers, Selasa( 1/5) di Aula Gedung Seminarium. Menurut istri Bupati Humbahas, Maddin Sihombing ini, adapun maksud konferensi perempuan yang diikuti minimal dua jemaat perempuan

„) Baca Jemaat ..Hal 10

„ Telkomsel kembali memberikan apresiasi kepada pelanggan prabayar (simPATI, Kartu As, Kartu Facebook) dan mitra outlet yang ada di Sumatera.

MEDAN- Telkomsel kembali memberikan apresiasi kepada pelanggan prabayar dan mitra outlet yang ada di Sumatera melalui program Rejeki Isi Ulang dan Jutawan Outlet Sumatera. Masing-masing program ini memungkinkan pelanggan dan outlet mendapatkan hadiah utama berupa 1 Unit Mobil KIA Sportage M/T dan hadiah menarik lainnya. Menurut Head Of Telkomsel Sumatera Group, Gilang Prasetya, program Rejeki Isi Ulang Dan Jutawan Outlet Sumatera merupakan salahsatu bentuk perhatian mereka kepada pelanggan yang tetap loyal

menggunakan Telkomsel. Bukan hanya pelanggan, mitra outlet yang memiliki peranan sangat penting dalam menjaga loyalitas pelanggan melalui ketersediaan produk di outlet hingga membantu Telkomsel dalam melakukan edukasi keunggulan produk kepada pelanggan juga berhak mendapat hadiah itu. Program Rejeki Isi Ulang adalah program yang dikhususkan untuk pelanggan prabayar Telkomsel di Sumatera (kecuali nomor HLR Aceh), baik pelanggan baru maupun pelanggan yang sudah lama

„) Baca Selain ...Hal 10


2 Mei 2012

9 Guru SD Laporkan.. Sambungan Halaman 9 BKD Humbahas. Dimana nama James Purba yang notabene anak kepala sekolah SD Saitnihuta ikut tercantum. Padahal, James Purba menurut sejumlah sumber yang enggan disebutkan identitasnya, James hanya bekerja selama dua minggu menjalani tugas sebagai tenaga guru di sekolah itu. Sedangkan tenaga guru honorer lainnya yang sudahlamamengabditidakdiusulkan menjadi peserta dalam K-II. Melihatketidakadilan MSdalam memberikan kesempatan kepada guru honorer yang benar-benar mengabdi, para guru di SDN 175781 berjumlah 9 orang, komite sekolah, tokoh masyarakat setempat, serta Kepala Desa Saitnihuta mengajukansuratkeberatankepada Badan Kepegawaian Daerah (BKD) Humbahas. Pengakuan salah seorang guru yang tidak mau disebutkan namanya, kemarin di Doloksanggul mengatakan, James Purba diketahui hanya dua minggu saja menjalani tugas sebagai guru honorer. “Dalam rapat komite yang dihadiri guru, BP3 dan masyarakat beberapa waktu lalu diputuskan

James Purba sudah tidak terdaftar lagimenjadiguruhonorer.Namun setelah keluar nama nama yang masukkategori(K)II,kenapanama JamesPurbamasihada?”ujarguru itu penuh tanya. Sebelumnya,KepalaBKDHumbahasmelaluiKabidKepegawaian, Raymond Pakpahan yang menerima laporan adanya indikasi pemalsuan data yang dilakukan Kapsek MS kepada wartawan mengatakan,akanmenelusurinya.Pakpahanmenambahkan,bilaadakeberatan dari masyarakat dalam menyikapi nama-nama yang termasuk dalam daftar kategori II, akan diteruskan ke atasan untuk ditindaklanjuti. Terkait polemik tersebut, Kadis Pendidikan Humbahas, Drs Wisler Sianturimengatakanakanmenindak tegas setiap kepala sekolah yang melakukanmanipulasiSKpengangkatanguruhonorerdidearahitu. ”Sayaakantindaktegaskalauada yang seperti itu. Saya akan melakukanevaluasiatasjabatannya,”tegas Wisler. SedangkanMSsendirisaatdihubungimelaluiponselnya,Selasa(1/ 5) belum berhasil. Sebab telepon seluler bersangkutan sedang tidak aktif. (jona/hsl)

Jemaat HKBP Gelar.. Sambungan Halaman 9 dari setiap resort itu dilaksankan untukmempersiapkandanmemperlengkapi kaum perempuan agar mampu mewujudkan visi misinya sebagaipelayankristus.Selainitu,agar kaumperempuanmampudankuat dalam menghadapi berbagai tantangankehidupan. “Melalui konferensi dan pertemuan raya perempuan ini, kaum perempuandiharapkanbisameningkatkanspiritualmenujukedewasaan iman di dalam persekutuan jemaat. Kemudian, mampu memiliki kepedulian akan masalah masalah sosial, agama yang berkembang di tengah masyarakat serta mampu menjadiperempuankuatdanterampil,”paparnya. Ditambahlagi,dalamusianyake-150 tahun, HKBP telah melaksanakan Jubileum150TahunHKBP.Danpada kegiatan itu, perempuan berperan dalammewujudkanvisidanmisinya. “Melihat perkembangan zaman yang semakin maju dan tantangan besaryangakandihadapiolehgereja, maka penting dilaksanakan pertemuan raya perempuan. Hal ini untuk melanjutkan visi tahun Jubelium HKBP yang ingin mengem-

balikanjatidiri,”jelasnya. Sebab, kedudukan laki-laki dan perempuan sama di hadapan Allah. Haltersebuttertuangdalamgarisgaris besar kebijaksanaan dan pengembanganHKBP. Kegiatan ini, kata Ani, sudah beberapakalidigelar.Pertamasekitar tahun1989diPematangsiantar,kedua tahun1994diWisataRohaniBrastagi, ketiga tahun 1998 di Medan dan keempat sekitar tahun 2002 di Sipoholon. “Masuknyapengabarinjilketanah Batak tidak hanya fokus kepada kehidupan gereja. Namun telah menyentuh kehidupan masyarakat termasuk memperbaharui sikap masyarakatterhadapperempuan.Ini terlihatdarikeikutsertakananak-anak perempuan menerima bimbingan dariistriZendelingtentangfirmanAllah.KarenaparaZendingmenyadari bahwaperempuanikutmenentukan kualitassatubangsa,”paparnya. Adapaun kegiatan pada acara itu, mendengar ceramah dari Ephorus HKBP Pdt Dr Bonar Naiputupulu, KepalaDepartemenDiakoniaHKBP PdtNelsonSiregardanKetuaUmum Panitia Ani Rosma br Napitulu, kemudianditutupkebaktian minggu. (cr-02)

Polres Ajak STAKPN.. Sambungan Halaman 9 seluruh masyarakat termasuk perguruantinggidimintaikutberperan aktif dalam menjaga Kamtibmas. Sebab perguruan tinggi dinilai merupakanwadahyangbisamemberikan pencerahan bagi masyarakat. “Kita tahu Tarutung merupakan daerahyangterdiridariberbagaisuku danagama.Untukitu,marikitasamasama menjaga dan meningkatkan Kamtibmas. Apalagi dunia pendidikan merupakan salah satu wadah yang bisa memberikan pencerahanbagimasyarakat,”ujarnya. Menurutnya, untuk menjaga kemanan dan ketertiban, masyarakat tidak boleh hanya mengandalkan aparat kepolisian saja. Apalagi melihat personel polisi saat ini masih minim di daerah itu. “Salingmemberiinformasi.Polisi harus bida jadi mitra masyarakat. Meberi informasi tentang perilaku mahasiswadansebaliknya.Hal-hal yang sifatnya negatif perlu diawasi. Lebih baik mencegah daripada mengobati,” imbuhKapolres. Ketua STAKPN Tarutung, Drs Ibelala Gea membenarkan kerja sama itu. Ia berharap kerja sama seperti itu bisa ditingkatkan dan berkesinambungan untuk meningkatkan suasana kondusif dan nyaman di tengah-tengah ma-

syarakat. “Ke depan, polisi bisa lebih tegas danmemberikankomunikasiyang intens. Karena polisi berfungsi sebagai pengayom bukan musuh masyarakat,”tegasIbelala. Bahkan,kedepan,pihaknyaingin polres berperan aktif membina mental mahasiswa STAKPN. Adapunruanglingkupkerjasama itu meliputi delapan butir. Yakni, peningkatan dalam pelayanan kuliah Agama, Kuliah Umum dan Kadarkum,pemberdayaansumber daya manusia (SDM) untuk kepentingan bersama sesuai dengan kapasitas yang ada pada institusi, kerja sama dalam rangka menciptakan kamtibcar lantas, pembekalan pendidikan dan pelatihan perlengkapan atribut security sesuai kapasitas instutusi masing masing. Selain itu, pembentukan forum kemitraan Polisi dan msyarakat (FKPPM) Kampus, memberi informasi melalui call center polres dan kontak person tentang peristiwa kejadian gangguan kamtibmas, kamtibcar lantas khusus di lingkungan kampus, pemberian informasi tentang keadaan mahasiswa dan organisasi kemahasiswaan yangadasertapemanfaatansarana perkantorandanprasaranaolahraga yang ada untuk pertemuan dan pelatihan. (cr-01)

Gadis Bugil Hanyut di Pantai Namartua Sambungan Halaman 9 kali ditemukan dua orang pemancing ikan di Pantai Namartua Sioma. Dua pria itu mengaku kaget begitu melihat jasad korban mengapung di danau. Takut dijadikan sebagai tersangka, keduanya langsung memanggil warga lainnya guna memastikan temuan itu. Oleh warga kemudian langsung menghubungi Polsek Onanrunggu. “Daerah itu diketahui angker. Makanya mereka (pemancing) itu memanggil warga. Selanjutnya warga menghubungi polisi untuk mengevakuasi jasad korban,” terang Sinaga. Lima jam kemudian, polisi baru tiba di lokasi. Pada pukul 16.00 WIB, mayat berhasil dievakuasi dari danau dibantu warga dengan mempergunakan kapal solu-solu. Berhubung kondisi mayat sudah mengeluarkan bau menyengat dan kulitnya terkupas, polisi sepakat membawa korban ke RSU Pangururan. Mayat perempuan itu ditemukan sekitar lima meter dari bibir pantau dengan posisi telungkup dan tanpa busana. Kapolsek Onanrunggu, AKP P Simatupang membenarkan


Selain Mobil Mewah, Telkomsel Juga Bagi-bagi Kreta & Handphone Sambungan Halaman 9 menggunakan kartu simPATI, Kartu AS dan Kartu Facebook. Untuk mengikuti program ini tidak diperlukan registrasi khusus. Caranya pelanggan prabayar cukup melakukan isi ulang pulsa pada periode program yang berlaku mulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. Jika selama periode program telah mencapai total isi ulang minimal Rp60 ribu, secara otomatis pelanggan tersebut akan berpeluang mendapatkan salahsatu hadiah yang akan diundi pada bulan September 2012. Bagi pelanggan yang melakukan isi ulang pulsa selama periode program, mencapai total isi ulang pulsa minimum Rp300 ribu, secara otomatis berpeluang mendapatkan salahsatu dari seluruh hadiah yang disediakan berupa 30 (tiga puluh) HP Android, 30 (tiga puluh) Tas Trolley, 9 (sembilan) unit Samsung Galaxy Tab 8.9”, 9 (sembilan) unit Sepeda Motor Honda Vario,

PROMO MITSUBISHI: Pick Up L300 & T120ss. Colt Diesel Chassis & Dumptruck. Fuso, Triton, Pajero Sport. BB/BK >oke..! Kuning/Hitam>oke!! Diskon spesial Hubungi: VINA NAULI SIREGAR 0812 6036 0000

DIJUAL: Mobil Minibus Suzuki carry Futura 1.3 thun 1991, body mulus, harga nego tanpa perantara hub. D. Simanjuntak HP 0813 7554 0521 DIJUAL: Mobil kijang LGX silver metallic 2001, 1800 CC, EFI, AC, Mulus, harga negos, serius hub. HP 0821 6159 0417 / 0813 6179 9055

“Mohon sabar, karena warga yang datang belum ada yang mengaku sebagai saudara atau famili korban,” singkatnya. Terpisah, seorang ahli supranatural yang dikenal masyarakat, K br Manurung kepada METRO menuturkan, mulai dari Pantai Lontung, Onanrunggu dan Lagundi merupakan daerah angker dan dihuni roh namartua sioma yang merupakan penunggu yang dulunya dipuja-puja warga. “Kemungkinan roh itu minta tumbal. Apalagi sebentar lagi mau Pesta Danau Toba. Ketenangannya pasti terusik,” sebutnya. Namun hal itu dibantah langsung Pdt Daniel Situmorang dari Yayasan Pekabaran Injil, Hotma Togu yang melayani di Desa Lontung Samosir. Menurutnya, mitos seperti itu tidak perlu lagi dipecayai dan diikuti. Karena injil sudah masuk ke Pulau Samosir. “Kami berharap pelayanan di pulau ini membawa pengaruh agar hal hal yang terjadi di sekitar Danau Toba tidak dihubungkan dengan okultisme,“ tandasnya. (rait/ des)

SEPI: Paska penemuan mayat seorang gadis itu, Pantai Namartua Sioma Lagundi terlihat sepi, Selasa (1/5).

TOYOTA BARU ASTRA: Ready Avanza, innova, fortuner Hub. Purba 0813 9789 4633; 0813 9736 0333

MENYEDIAKAN ANEKA HEWAN PELIHARAAN: Kenari Import, Kenari Norwich, Timbradd, Scoth Folncy, Gloster, Grested, Border, Black Throolet, Mozambik, Sanger, Brim Stone, dll Hub: 0878 6849 0858 Medan

penemuan mayat perempuan itu. Usia kira kira 20 tahun dengan tinggi badan sekitar 150 cm, rambut ikat sebahu. “Melihat kondisi mayat, kita perkirakan sudah tiga atau empat hari tenggelam di Danau Toba. Biasanya mayat yang sudah gembung akan mengapung,” jelasnya. Sejak penemuan itu, kata Kapolsek, pihaknya telah mengumumkan kepada masyarakat yang merasa kehilangan anggota keluarga agar melihat jenazah perempuan itu di RSU Pangururan. “Sudah ada warga Sidikalang yang mencari. Kita menganjurkan mereka ke sana (RSU Pangururan. Bila benar itu anggota keluarga mereka, silahkan membuat laporan ke polisi,” imbaunya. Sementara seorang petugas jaga yang mengaku bertugas di RSU Pangururan dihubungi via telepon rumah sakit membenarkan jasad korban berada di rumah sakit tersebut. Dia mengatakan, jenazah perempuan itu sudah diotopsi. Namun, pihaknya belum bisa memberikan data-data sebelum pihak kepolisian dan keluarga bersangkutan memberi izin.

HARI INI INVESTASI: Mulai besok dapat profit 7% Rp. 6.300.000 setiap harinya non stop selama 200 hari (Tanpa Rekrut) Minat???? SMS "Petunjuk" ke HP 0877 8847 7900

dan hadiah utama undian berupa 1 (satu) Mobil KIA Sportage M/T. Melengkapi program Rejeki Isi Ulang, Telkomsel juga menyelenggarakan program Jutawan Outlet Sumatera (Juara). Program apresiasi ini dikhususkan bagi seluruh mitra outlet yang juga berada diwilayah Sumatera. Program ini juga menyediakan hadiah undian berupa 1 (satu) unit Mobil KIA Sportage M/T, Honda Vario, Tablet Cyrus TV Pad, Blackberry Apollo. Program yang diperuntukkan khusus untuk mitra outlet diseluruh willayah Sumatera ini, dimulai dari tanggal 1 Mei 2012 hingga 31 Juli 2012. Bagi mitra outlet yang ingin mengikuti program JUARA, akan mendapatkan informasi lengkap tentang mekanisme program melalui petugas Sales Force yang berada di masingmasing wilayah cluster mitra outlet. Sama halnya dengan program Rejeki isi Ulang, pengundian pemenang program JU-

TAWAN OUTLET SUMATERA, juga akan dilakukan pada bulan September 2012. dan Informasi pemenang akan diumumkan melalui Media cetak, website resmi Telkomsel yakni, seluruh kantor pelayanan Telkomsel serta call center Telkomsel dengan menekan 155 dari handphone. “Kami berharap di usia Telkomsel yang kini mencapai 17 tahun, melalui program loyalty ini baik pelanggan maupun mitra outlet dapat semakin merasakan kedekatan emosional yang lebih erat dengan Telkomsel, dan merasakan manfaat lain dari sekedar layanan Telekomunikasi,” ucapnya. Pada kesempatan ini, Telkomsel tetap mengimbau kepada seluruh pelanggan dan mitra outlet agar tetap berhatihati terhadap penipuan yang mengatasnamakan Telkomsel. Dalam setiap program undiannya, Telkomsel tidak pernah memungut biaya dalam bentuk apapun. (leo/rel/des)

Dompak Ancam Demo.. Sambungan Halaman 9 itu, kita juga meminta kepada Bupati Taput, Torang Lumbantobing agar mengenakan sanksi disiplin kepada Marconis serta mempertimbangkan posisi jabatannya,” tandasnya. Bahkan, ungkap Dompak, pihaknya juga akan menyampaikan foto copy Undang-undang Pokok PersNomor40Tahun1999kepada Marconis. ”Saat aksi itu, kita akan menyampaikanfotocopyundangundang pokok pers kepada Marconis supaya yang bersangkutan tau apa tugas wartawan dalam ketentuan antara hak dan kewajiban,” ujarnya. Desakan lainnya, meminta agar bupatidanjajarannyamendukung tugas-tugas jurnalistik. ”Kita ini bekerja berdasarkan undang-undang pokok pers. Dalam undangundang itu jelas apa saja tugas wartawan. Jadi, berdasarkan undang-undang pokok pers Nomor 40Tahun1999kitamemintabupati agarmendukungtugasjurnalistik,” paparnya. Ia menyebut, wartawan yang diperkirakan ikut sebagai peserta aksi mencapai seratusan orang. ”Kita akan bergabung dengan teman-teman wartawan media cetak dan elektronik dari Kabupaten Humbahas, Tobasa dan

kabupaten tetangga lainnya untuk aksi besok (hari ini, red),” imbuhnya. Untukdiketahui,padatanggal21 April 2012, Marconis Siregar mengatakankepadawartawan“Kalian Wartawan Itu Perusak Bangsa”. Padahal, saat itu, wartawan hanya mempertanyakan dugaan pengutipanpengurusanaktanikahsenilai Rp500 ribu dari warga. Marconissendiri,saatdihubungi METRO, Selasa (1/5) melalui ponselnya, membantah dirinya menyebutkan kata-kata tersebut kepada wartawan. ”Begini pak, yangsayabilangkanyangmengaku wartawan. Tidak ada saya bilang seperti itu pak,” ujar Marconis berkelit. Namun, Marconis menyebut, bahwa dirinya sebelumnya tidak mengenal wartawan yang mendatanginya saat itu. ”Saya kan belumkenalwartawanyangdatang waktu itu. Lagian semua orang tau kalau saya itu selama ini dekat dengansemuawartawan,”akunya. Ditanya terkait rencana aksi demo wartawan tersebut, Marconis hanya menanggapinya dengan enteng. ”Kalau mereka datang ya gak masalah. Karena kita tidak merasa ada bermusuhan dengan wartawan.Terimakasihpaksudah menghubungi,sayasedangbanyak tugas,” singkatnya. (hsl/des)

Dapat Pelecehan Seks.. Sambungan Halaman 9 mandi tubuh korban digerayangi pelaku.Rasanyakeluargakamimalu sekalimelihatulahnya,”katanya. Masih kata Oppung Melati, setelah kejadian tersebut pihak keluarga korban meminta korban mengungsikerumahPakTuanyadi kawasanDusunPetatalKecamatan Lima Puluh Kabupaten Asahan bersama anak korban. Sementara pelaku masih berkeliaran di sekitar nagorinya. ”Sekarang korban kami pindahkankerumahPakTuanyadi Patatal Lima Puluh bersama anaknya supaya lebih aman. Itu kami yang memintanya supaya dilaporkan saja ke polisi, soalnya kami gerah dengan sikap Abang kamiini,”ujarnya. Sebelumnya, ibu korban tinggal seorang diri di kawasan Silimbat Balige. Di sana ibu korban bekerja sebagai petani jahe dan lengkuas milik familinya. Sebagian hasil kerjanya kerap dikirimkan pada korban untuk membantu biaya kebutuhan hidup korban dan bayi dari hasil hubungannya dengan oppungkandungnya. ”Di Silimbat Balige ada tanah ibunya satu rante, jadi di sanalah ibunya menanam jahe dan lengkuas. Bahkan selama ini setengahpengahasilandarimenjual jahenya ini terkadang dikirimkan pada korban untuk membantu biaya membeli susunya. Soalnya gajinya sebagai karyawan pabrik tidakmencukupi,”bebernya. Terpisah Pangulu Nagori Pematang Bandar Kecamatan Bandar Simalungun ketika dihubungi METRO,Selasa(1/5),mengakuselama ini pelaku masih tercatat sebagai Kepala Dusun IV Nagori Pematang Bandar. ”Dia sampai saat ini masih tercatatsebagaiKepalaDusunHuta IV dan selama ini kami kenal dia Gamot yangbaik,” ujarnya. Dia menambahkan, selama ini korban diketahui sempat tinggal di Bengkulu ikut dengan kedua orang tuanya. Namun setelah ayahnya meninggal dunia karena penyakit lever, kini korban menumpang tinggal di rumah oppungnya. ”Setahusayadiapernahtinggaldi Bengkulu ikut kedua orang tuanya. Namunsetelahayahnyameninggal dunia, korban tinggal bersama oppungnya (pelaku) untuk melanjutkansekolahnyadibangku SMP. Dan kata tersangka biaya sekolahkorbanditanggungolehnya sampaikorbantamat,”terangnya. Namun, dia berharap, agar

pelaku segera mempertanggung jawabkan perbuatannya. Sebab perbuatanya sebagai kepala dusun tidak pantas menjadi tauladan di masyarakat.Jikaterbuktimelakukan perbuatan cabul, maka Pangulu akan menggelar rapat terbuka denganwarga. ”Saya berharap agar pelaku ini segeramempertanggungjawabkan perbuatannya. Saya sangat kecewa dengan ulah pelaku ini. Bukannya memberi contoh yang baik, malah memberikan pengaruh buruk,” ujarnyalagi. HumasPolresSimalungun,AKP H Panggabean ketika dihubungi METRO, mengaku kasus ini masih dalam penyelidikan lanjutan. ”Kasus ini masih dalam penyelidikankita,”singkatnya. Diberitakan sebelumnya, Jaitan Nainggolan (55), warga Simpang Parsaoran Nagori Pematang Kerasaan Kecamatan Bandar Simalungun menyetubuhi sebut saja Melati (20), warga Balige Kabupaten Toba Samosir sejak tahun2009silam.Akibatnyakorban mengandungdanmelahirkananak dari oppungnya yang kini berusia 2 tahun. Tidak terima dengan perlakuan oppungnya, korban kemudianmelaporkankejadianitu kePolresSimalungun,Minggu(29/ 4). Nisa Br Manurung (34), warga sekitar ketika ditemui METRO, Senin (30/4) di kediamannya, mengaku seminggu sebelumnya korbansempatmenceritakanpada temannya bahwa dia telah dihina oppungdankeluarganya. Seminggusetelahkorbantinggal menetap di rumah pelaku, istri pelaku pergi ke rumah anaknya di Batam. Sehingga di rumah itu korban tinggal berdua bersama kakeknya. Saat itu niat jahat pelaku muncul setelah melihat korban tertidurdikamarnya Sejak kejadian tersebut pelaku kerap mencabuli korban dan kesempatan ini dilakukannya di lokasi yang sama. Namun korban tidak kuasa melawannya karena korban takut orangtuanya mengetahuikejadianitu. Setahun kemudian korban mengandunganakpertamasertamelahirkannyadikediamanoppungnya. Namun pelaku sempat mengatakan pada warga sekitar bahwa korbandihamilipacarnyasendiri. Lalu Minggu (1/4) sepulang dari kerjanya, korban terlibat adu mulut dengan keluarga pelaku, sebab korban memutuskan ingin pulang ke rumah orangtuanya, namun pelakumelarang.(mag-02)


2 Mei 2012

KPK Yakin Anas Terlibat Proyek Hambalang di Bogor

JAKARTA- Komisi Pemberantasan Korupsi yakin Ketua Umum Partai Demokrat Anas Urbaningrum terlibat dalam proyek pembangunan kompleks olahraga terpadu di Hambalang, Bogor, Jawa Barat. Komisi Pemberantasan Korupsi (KPK) masih dalam tahap menyelidiki proyek bernilai Rp 1,5 triliun yang diduga dikorupsi tersebut. Ihwal keyakinan KPK atas keterlibatan Anas di proyek Hambalang ini diungkapkan Wakil Ketua KPK Bambang Widjojanto. Menurut Bambang, KPK telah mendapatkan pengakuan dari anggota Komisi II DPR dari Fraksi Partai Demokrat, Ignatius Mulyono, bahwa dia diperintah Anas ikut membereskan sertifikat tanah untuk proyek Hambalang. “Kan, sudah ada keterangan kalau Ignatius Mulyono disuruh Anas menyelesaikan sertifikat tanah untuk Hambalang,” kata Bambang.

KPKkemudianmenelisikbagaimana akhirnya Badan Pertanahan Nasional (BPN) mengeluarkan sertifikat tanah tersebut. Peran Ignatius muncul pertama kali dalam berita acara pemeriksaan (BAP) KPK terhadap mantan Bendahara Umum Partai Demokrat Muhammad Nazaruddin. Dalam BAP, Nazaruddin mengungkapkan, karena berada di Komisi II DPR, Ignatius diminta bertemu Kepala BPN Joyo Winoto. Salah satu mitra kerja Komisi II DPR memang BPN. Masih menurut Nazaruddin, sebelumnya dia ditanya Anas siapa yang bisa membereskan masalah sertifikasi tanah untuk proyek Hambalang. Nazaruddin yang

„ Anas Urbaningrum saat itu masih menjabat sebagai bendahara umum partai dan FraksiPartaiDemokratdiDPRpun menyodorkan nama Ignatius kepada Anas. Nazaruddin juga menuding ada uang yang mengalir dari PT Adhi Karya kepada Anas, yang

digunakan untuk pemenangan pemilihan ketua umum partai dalam Kongres Partai Demokrat di Bandung. Pengacara Anas, Patra M Zen, mengatakan yakin kliennya sama sekali tak bersalah. Dia pun meminta media hati-hati mengutip kronologi setiap keja-

dian yang melibatkan Anas. Dia mencontohkan, Nazaruddin menuding ada kaitan suap proyek wisma atlet dengan pemenangan Anas di DPR. “Nyatanya Kongres Partai Demokrat itu tahun 2010 dan aliran uang dari suap wisma atlet itu terjadi tahun 2011. Saya yakin Mas Anas dan Ibu enggak ada masalah secara hukum,” kata Patra. Demokrat: Silahkan KPK JeratAnas Partai Demokrat mempersilakan Komisi Pemberantasan Korupsi (KPK) menjerat Anas Urbaningrum, jika ia benar terlibat dan terbukti dalam kasus dugaan korupsi proyek Hambalang. Hal ini diungkapkan oleh Ketua Divisi Komunikasi Publik Partai Demokrat, Andi Nurpati, usai menghadiri diskusi di Warung Daun, Jakarta Pusat, Selasa (1/5/ 2012). “Siapapun yang terlibat dalam

AS Kerahkan Jet Tempur F-22

Tentara Kamboja-Thailand Terlibat Baku Tembak PHNOMPENH—Bakutembaksingkatantara tentara perbatasan Kamboja dan Thailand pada Minggu (29/4/2012) siang menyebabkan seorang tentara Kamboja cedera di kakinya, kata seorang komandan militer perbatasan mengonfirmasi, Senin. “Ini adalah kesalahpahaman, satu bentrokan bersenjata kecil dan bentrokan itu berlangsung sekitar10menit,”kataKolonelMeasYeoun,Wakil Komandan Militer Provinsi Preah Vihear, Kamboja, kepada Xinhua melalui telepon. Baku tembak itu terjadi di daerah perbatasan Kabupaten Chorm Kasan, Preah Vihear, yang berbatasan dengan Provinsi Ubon Ratchathani, Thailand. “Pasukan keamanan perbatasan Thailand baru saja dibingungkan oleh pasukan Kamboja dengan penebang liar ketika tentara kami berpatroli di sepanjang perbatasan, dan mereka melepaskan senjata api kecil kepada kami,” katanya. “Salah satu tentara kami terluka di kakinya, sekarang dia dirawat di rumah sakit provinsi.” Sejak awal tahun ini, tentara Thailand telah menewaskansedikitnyadelapanwargaKamboja yang secara ilegal melintasi perbatasan untuk menebang kayu di Thailand, menurut catatan Kamboja. (kmc/int)

itu diungkapkan Wakil Ketua KPK, Bambang Widjojanto. Menurut Bambang, KPK telah mendapatkan pengakuan dari anggota Komisi II DPR dari Fraksi Partai Demokrat, Ignatius Mulyono, bahwa dia diperintah Anas ikut membereskan sertifikat tanah untuk proyek Hambalang. Peran Ignatius muncul pertama kali dalam berita acara pemeriksaan (BAP) KPK terhadap mantan Bendahara Umum Partai Demokrat Muhammad Nazaruddin. Dalam BAP, Nazaruddin mengungkapkan, Anas menanyakan siapa orang yang bisa membereskan masalah sertifikasi tanah untuk proyek Hambalang. Nazaruddin, yang saat itu masih menjabat sebagai bendahara umum partai dan Fraksi Partai Demokrat di DPR, pun menyodorkan nama Ignatius kepada Anas. (*)

KPK Fokus di Sertifikat Pengadaan Proyek Hambalang


WASHINGTON — AS telah mengerahkan sejumlah jet tempur canggih F-22 ke Uni Emirat Arab (UAE) di tengah semakin tingginya ketegangan antara Iran dan tetangganya yang pro-AS itu, kata para pejabat, Senin (30/4) waktu AS. Para pejabat AS, yang tak mau disebutkan namanya, tidak bersedia mengatakan berapa banyak jumlah jet F-22 yang akan dikirim ke pangkalan udara Al-Dhafra di UAE. Para perwira militer cenderung menghindari pembahasan secaraterbukarincianoperasidipangkalanudara Amerika Serikat. Seorang juru bicara Angkatan Udara AS mengonfirmasi bahwa sejumlah F-22 Raptors, jet tempur paling canggih dalam armada AS, akan dikerahkan ke wilayah itu tanpa menyebutkan pangkalan itu atau Iran. ”Angkatan Udara Amerika Serikat telah menempatkan sejumlah F-22 ke Asia barat daya. Pengerahan-pengerahan itu untuk memperkuat hubungan militer dengan militer, meningkatkan kedaulatan dan dan keamanan regional, meningkatkan operasi taktis gabungan udara, dan meningkatkan kerja sama operasi pasukan, peralatan, serta prosedur,” kata Mayor Mary Danner-Jones. Juru bicara Pentagon, Kapten John Kirby, mengatakan kepada wartawan bahwa langkah itu “merupakan satu pergerakan yang sangat biasa” sesuai dengan penyesuaian pasukan AS di wilayah tersebut setelah penarikan pasukan Amerika dari Irak. Sengketa-sengketa teritorial antara Iran dan UAE atas lebih dari tiga pulau di Teluk Persia telah berkobar baru-baru ini. Washington menyuarakan dukungan terhadap Abu Dhabi. Sengketa atas pulau-pulau di Teluk itu muncul dengan latar belakang ketegangan terkait program nuklir Iran. Amerika Serikat, Eropa, dan Israel khawatir bahwa Tehran sedang mengejar proyek senjata nuklir rahasia. Ambisi nuklir Iran dan gudang senjata peluru kendalinya yang terus berkembang telah menimbulkan kekhawatiran di negara-negara ArabdikawasanTeluk,yangtelahmerundingkan perjanjian senjata dengan Washington untuk membangun pertahanan rudal sebagai tangkisan terhadap Iran. (kmc/int)

kasus Wisma Atlet maupun Hambalang, Partai Demokrat mempersilakan menindak lebih lanjut dan dituntaskan. Ketua Umum partai (Anas Urbaningrum) sekali pun,” kata Andi. Ia mengatakan, Ketua Dewan Pembina sekaligus Presiden Susilo Bambang Yudhoyono tidak akan melakukan intervensi, jika ada petinggi partai yang terseret kasus korupsi. “Silakan dilakukan proses penegakan hukum, seadil-adilnya. Harus berdasarkan bukti-bukti yang bisa ditunjukkan oleh penegak hukum kalau benar terlibat,” tegasnya. Sebelumnya diberitakan, KPK meyakini Ketua Umum Partai DemokratAnasUrbaningrumterlibat dalam proyek pembangunan kompleks olahraga terpadu di Hambalang, Bogor, Jawa Barat. Ihwal keyakinan KPK atas keterlibatan Anas di proyek Hambalang


TIBA DI KPK:Tersangka kasus dugaan korupsi pembahasan anggaran Kementerian Pemuda dan Olahraga Angelina Sondakh (tengah) seusai menjalani pemeriksaan kesehatan di rumah sakit Perhati, Jakarta, Selasa (1/5). Angelina Sondakh dibawa ke RS karena penyakit sinusitisnya yang dideritanya.

Angie Akan Diberi KERINGANAN HUKUMAN Bila Menjadi Justice Collaborator JAKARTA- Lembaga Perlindungan Saksi dan Korban (LPSK) membuka diri untuk Angelina Sondakh atau Angie. LPSK siap melindungai Angie, bila politisi Partai Demokrat itu ingin menjadi justice collaborator. ”LPSK siap memberikan perlindukan terhadap Angie,” kata Ketua LPSK Abdul Haris Semendawai dalam siaran pers, Selasa (1/5). Abdul Haris menjelaskan, penetapan justice collaborator bisa dilakukan berdasarkan rekomendasi KPK. Lembaga antikorupsi itu dinilai yang mengetahui peran dan informasi penting apa saja yang dimiliki Angie. ”KPK yang mengetahui apakah

Angie mau bekerjasama dengan penyidik atau tidak. Kerjasama tersebut terkait pengungkapan pihak-pihak lainnya yang terlibat dalam kasus korupsi yang lebih besar,” tuturnya. Syarat penetapan seorang justice collaborator adalah tindak pidana yang diungkap merupakan tindak pidana serius atau terorganisir. Saksi pelaku yang bekerjasama, mau memberikan keterangan yang signifikan, relevan, dan andal untuk mengungkap suatu tindak pidana, bukan pelaku utama, dan kesediaan mengembalikan aset yang diperolehnya. Juga adanya ancaman yang nyata atau kekhawatiran adanya ancaman tekanan fisik dan psikis terhadap saksi pelaku atau

keluarganya. ”Saksi pelaku yang bekerjasama bisa mengajukan permohonan apabila memenuhi syarat di atas. Yang dapat diberikan LPSK terhadap justice collaborator berupa perlindungan fisik dan psikis, perlindungan hukum, penanganan secara khusus, dan penghargaan. Bentuk penghargaan berupa keringanan tuntutan hukuman dan remisi tambahan sesuai ketentuan perundang-undangan yang berlaku,” jelas Abdul Haris. ”Peran justice collaborator sangat signifikan guna menangkap otak pelaku yang lebih besar sehingga tindak pidana dapat tuntas dan tidak berhenti pada di pelaku teri,” tambahnya lagi. (dtc/int)

JAKARTA- KPK masih mengusut kasus dugaan suap proyek pembangunan komplek olah raga di Hambalang, Bogor. Lembaga antikorupsi itu fokus pada dua aspek utama dalam kasus ini, yaitu sertifikat dan pengadaan lahan proyeknya. ”Kita di Hambalang itu menelusuri dua hal, soal sertifikat dan proses pengadaan proyek multiyears (tahun jamak),” kata Juru Bicara KPK Johan Budi di kantornya, Jl Rasuna Said, Jaksel, Selasa (1/5). Akan tetapi, Johan belum dapat menjelaskan keterlibatan pihak-pihak dalam proyek senilai Rp 1,7 triliun ini. Akan tetapi Ia menyatakan KPK masih menelusuri indikasi penyelewengan proyek Hambalang. ”Ya ini kita lagi nyari di dua ini, kita lagi nyari indikasi tindak pidananya. Kita sedang menyelidiki,” ungkap Johan KPK sendiri tengah mengusut pada proses tender, penyelesaian sertifikat tanah dan pengerjaan di proyek ini. Untuk penyelesaian sertifkat tanah, politisi Demokrat Ignatius Mulyono yang pernah diperiksa KPK, menyebut ada peran Anas. Ignatius menyebut Ketua Umum PD itu mengontaknya agar bisa melobi Ketua Badan Pertanahan Nasional (BPN) Joyo Winoto. “Saya ditanya soal dimintai tolong oleh pak Anas, soal tanah Menpora kok nggak selesai-selesai,” tutur Ignatius usai menjalani pemeriksaan di kantor KPK, Jl Rasuna Said, Jaksel, Senin (26/

3). Ignatius mengatakan, dirinya dimintai tolong Anas untuk menelpon Joyo pada akhir tahun 2009, pada saat Anas masih menjabat sebagai ketua fraksi. Dia menyebut itu merupakan permintaan tolong Anas, bukan suatu perintah. ”Nggak perintah itu minta tolong. Dia bilang tolong tanyain tanah Menpora belum selesai-selesai. Setelah itu saya hubungi Mas Joyo tapi nggak bisa-bisa, lalu saya telepon Sestama,” tutur anggota Komisi II ini. Ignatius menyatakan, dirinya tak pernah bertemu dengan Joyo. Dia hanya bisa berkomunikasi via telepon. ”Telepon. Saya bisanya telpon Sestama. Dia bilang, surat tanah Menpora masih dalam proses. Nanti kalau selesai saya beritahu,” ujarnya Kasus ini berawal dari penyelidikan KPK terkait kasus Wisma Atlet yang melibatkan mantan Bendahara Umum Partai Demokrat Muhammad Nazaruddin. Proyek senilai Rp1,2 triliun menuai banyak kontroversi setelah Nazaruddin menyebut fee proyek tersebut untuk mendanai pemenangan Anas Urbaningrum dalam Kongres Partai Demokrat tahun 2010. Nazaruddin, yang juga terdakwa kasus suap Wisma Atlet juga menyebutkan adanya keterlibatan Anas dalam kasus Hambalang, antara lain meminta dirinya melobi sejumlah pihak agar sertifikat Hambalang selesai diurus. (dtc/int)

„ Johan Budi

Kesehatan Endang Rahayu Menurun JAKARTA- Menteri Kesehatan Endang Rahayu Sedyaningsih masih menjalani perawatan akibat serangan kanker di RSCM. Belum ada tanda-tanda perbaikan dalam kesehatannya, bahkan kondisinya cenderung menurun. ”Masih sakit,” kata Wakil Menkes, Ali Ghufron, saat dihubungi wartawan, Selasa (1/5). Ali membenarkan kondisi kesehatan Endang terus menurun. Belum ada perkembangan yang cukup signifikan sejak menjalani perawatan beberapa waktu yang lalu. ”Iya agak menurun, menurun,” sambungnya. Seperti diberitakan sebelumnya, Endang divonis mengidap kanker stadium empat. Karena kondisi kesehatan inilah, Endang mengajukan pengunduran diri pada Presiden SBY.

„ Endang Rahayu

Permohonan tersebut secara prinsip sudah Presiden SBY setujui. Hingga ada keputusan yang definitif, untuk sementara tugastugas Menkes untuk sementara diserahkan kepada Wamenkes Ali Ghufron. Dahlan: Mari Kita Doakan Menkes Beredarnya kabar kondisi kesehatan Menteri Kesehatan non aktif Endang Rahayu Sedyaningsih yang menurun turut membuat beberapa pejabat berdatangan ke Rumah Sakit Cipto Mangunkusumo (RSCM) Jakarta. Berdasarkan pantauan, Selasa (1/5/2012) malam, salah satu pejabat yang terlihat mengunjungi Menkes adalah Menteri BUMN Dahlan Iskan. Dalam kunjungannya, Menteri BUMN menyampaikan maksud

kunjungannya adalah karena sama-sama pernah mengidap kanker. “Beliau bekerja keras sampai keadaan sulit sekarang. Kita doakan bersama-sama,” ucap Dahlan kepada wartawan saat ditemui usai menjenguk Menkes pada pukul 20.00 WIB tadi. Mantan Dirut PLN tersebut juga sempat menyampaikan bahwa di dalam juga sempat dibacakan tahlil dan ayat-ayat suci Alquran oleh tamu dan keluarga. Sebelumnya, pada siang tadi, Dirut RSCM, Akmal Taher mengonfirmasi bahwa kondisi kesehatan Menkes Endang Rahayu dalam keadaan menurun. Saat ini, tim dokter sedang berupaya memberikan perawatan kepada Menkes atas penyakit kanker yang dideritanya. (kmc/int)


2 Mei 2012

Audi TT RS Plus Lebih Bertenaga Pabrikan Audi merilis harga model TT RS Coupe Plus untuk pasar Inggris. Dengan begitu varian TT RS akan semakin lengkap dengan hadirnya model anyar ini. Dilansir Autoevolution, Audi TT RS Coupe Plus bertransmisi manual enam percepatan standar dibanderol 48,945 Pounsterling atau setara 730 juta. Sedangkan transmisi automatis S-Tronic lebih mahal 1.340 Pounsterling atau Rp20 jutaan. Audi TT RS Plus ini memiliki tenaga tambahan sebesar 20 hp dan torsi 15 Nm. Dengan begitu, total

output kuda besi asal Jerman ini menjadi 360 hp dan torsi puncak 465 Nm. Lebih lanjut, kecepatan maksimum mobil ini pun bertambah dari 250 km/jam menjadi 280 km/jam. Saat uji akselerasi 0-100 km/jam, TT RS Plus

hanya membukukan waktu 4,1 detik. Hasil ini merupakan dua persepuluh lebih cepat dari versi standar. Rahasia di balik terdongkraknya performa Audi TT RS Plus adalah pada sistem knalpot sport yang bersifat opsional. Dengan begitu

suara yang keluar dari saluran gas buang menjadi lebih gahar. Selain itu, TT RS Plus juga mendapat fitur tambahan pada kabin, seperti sistem navigasi dengan satelit, Bluetooth dan Audi Music Interface iPod Connection, dimana semuanya sekarang datang sebagai fitur standar. (int/mer)

„ Audi TT RS Plus

Xperia S


Printer All-in-One dari Canon PRINTER premium ini dibuat Canon demi menangani kebutuhan bisnis small office/home office (SOHO). Menurut Canon, PIXMA MX897 memiliki fitur print, scan, copy, faks, direct print serta konektivitas mobile yang mudah dioperasikan. ”PIXMA MX897 merupakan printer foto all-in-one premium dari Canon yang fiturnya cukup lengkap untuk pengguna yang menginginkan perangkat kantor multifungsi yang senyaman bekerja di rumah,” ujar Divison Manager Canon Consumer System Product, pt. Datascrip, Monica Aryasetiawan, seperti dilansir dari keterangan resminya, Jumat (27/4) meninggu lalu. “Tinta individual yang digunakan pada printer ini tentu saja menjadikan kenyamanan dan lebih ekonomis, cukup mengganti tinta warna yang habis tanpa perlu mengganti semuanya,” tambahnya. PIXMA MX897 dibekali berbagai fitur antara lain, Dual Function untuk mengubah tombol tertentu atau menonaktifkan yang lain. Misalnya, tombol panah yang difungsikan untuk menavigasi menu dapat berubah menjadi tombol angka saat mengirim faks. Selain itu, juga ada fitur Automatic Document Feeder (ADF) yang dapat melakukan scan dan copy dokumen secara otomatis. Menurut Canon, fitur ini bisa menampung sekira 35 lembar kertas sehingga bisa mempermudah penggunanya. Adanya teknologi Canon’s PIXMA Cloud Link membuat

PIXMA MX897 sangat fleksibel. Teknologi ini memberikan keleluasaan pengguna untuk memakai beberapa fitur pencetakan tanpa harus menggunakan PC. Setelah terhubung dengan Canon Cloud Server, pengguna dapat menyelusuri beberapa template. Dengan menghubungkannya ke album foto online, foto juga dapat dicetak dengan cara ini. Mobile printing menjadi fitur lain yang menguntungkan karena mengurangi ketergantungan terhadap penggunaan PC. Dengan fitur ini, pengguna dapat mencetak dengan IOS ataupun perangkat Android melalui Wi-Fi, sehingga foto-foto ataupun dokumen pdf bisa langsung dicetak dari perangkat mobile mereka. PIXMA MX897 juga dibekali fitur mode hening (Quite Mode) yang bisa digunakan untuk mengurangi tingkat kebisingan dan menjaga suasana tenang di kantor ataupun di rumah. PIXMA MX897 dibuat menggunakan teknologi FINE (Full-photolithography Inkjet Nozzle Engineering) sehingga bisa menghasilkan tinta mikroskopis sekecil 1pl. Kualitasnya gambar cetaknya diklaim tajam dan halus. pt. Datascrip sebagai Autorized Distributor Canon di Indonesia, memasarkan PIXMA MX897 dengan harga Rp 3,4 juta. Sedangkan untuk tintanya, PGI725 Black dibanderol Rp95.000 dan CLI726 Black/Cyan/Magenta/ Yellow dibanderol Rp90 ribu per buah. (int/mer)

Android Perdana Sony dengan Kamera 12MP

SETELAH All-New Vario Techno 125 PGM-FI dan beberapa model facelift diluncurkan pada kuartal pertama tahun ini. PT Astra Honda Motor (AHM) masih mempunyai empat model yang diluncurkan sampai akhir 2012. Hal tersebut sesuai dengan pernyataan Presiden Direktur AHM Yusuke Hori pada akhir 2011; pada 2012 diluncurkan 5 model baru. Hal tersebut ditegaskan lagi oleh Thomas JA Wijaya, Deputy Sales Division Head Sales Division AHM di Penang Bistro, Jakarta Pusat, Senin (30/4). Diceritakan, fokus utama Honda tahun ini “PCX 150 adalah rencananya memdiluncurkan tahun perkuat ini. Generasi segmen kedua PCX ini skutik sudah yang diluncurkan di sudah Thailand dan dikuasai. untuk masuk ke “PCX 150 Indonesia tinggal rencananya memperhitungkan momen yang diluncurkan tepat.” tahun ini,” Thomas JA ungkap Wijaya Thomas. Generasi kedua PCX ini sudah diluncurkan di Thailand dan untuk masuk ke Indonesia tinggal memperhitungkan momen yang tepat. Model lain yang disiapkan adalah BeAT dan Scoopy injeksi. “Kalau BeAT, kompetitornya sudah injeksi duluan. Kita wajib segera mengikuti. Sedangkan Scoopy masih dipertimbangkan,” beber Thomas. Untuk model keempat, kemungkinannya adalah sepeda motor sport 150cc Honda yang dijuluki “Vixion Killer”. Honda berniat “mengadu langsung” model ini dengan Yamaha Vixion yang memimpin pasar di segmen sepeda motor sport mesin 150 cc. “Mudah-mudahan bisa bersaing dengan komposisi dua banding satu nantinya,” lanjut Thomas, tersenyum. Meski sudah berbagi informasi tentang model baru Honda yang akan diluncurkan, Thomas belum mau menjelaskan jadwal peluncuran. “Semuanya pada semester kedua tahun ini,” jelasnya singkat. (int/mer)

SETELAH unit bisnis smartphone Sony berganti nama menjadi Sony Mobile Communication, vendor ponsel asal Jepang itu punya tugas berat mengubah citra produk mereka agar terlepas dari bayang-bayang Sony Ericsson. Sony mengawali debut smartphonenya di Indonesia dengan Sony Xperia S. Produk bersisitem operasi Android ini resmi dipasarkan pada 13 April 2012. Seperti apa kemampuan Sony Xperia S, berikut ulasannya. Dalam paket pembelian Xperia S, disertai dengan kabel data, charger, earphone, dan buku petunjuk dan kartu garansi. Xperia S dibanderol dengan harga Rp 5,499,000. Tahun 2012 ini, Sony merilis tiga smartphone Xperia yang tergabung dalam seri NXT. Ketiganya adalah Xperia S, Xperia P dan Xperia U. Apa bedanya seri NXT dengan smartphone keluarga Xperia lainnya? Jawabannya ada di bagian bawah smartphone. Pada tiga smartphone seri NXT, membentang garis transparan yang disebut Sony sebagai desain ikonik seri NXT. Dalam garis transparan itu terdapat ikon back, home dan menu. Ikon-ikon itu juga terlihat dari bagian belakang smartphone. Garis transparan itu akan menyala ketika layar dalam posisi aktif, sehingga memunculkan kesan elegan. Meski Sony telah memajang logo mereka sendiri di bagian depan, namun logo lama Sony Ericsson yang tersohor itu masih ada di bagian belakang. Secara bertahap, logo tersebut akan benar-benar hilang dari jajaran smartphone besutan Sony. Ketika digenggam, Xperia S yang memiliki bentang layar 4,3 inci ini terasa nyaman. Bagian belakang yang terbuat dari bahan plastik agak kesat sehingga tidak licin. Di bagian atas, terdapat tombol power/kunci dan jack audio 3,5mm. Tombol pengatur volume, port MicroHDMI dan tombol kamera di bagian kanan. Sedangkan di sisi kirinya hanya ada port MicroUSB. (int/mer)



2 Mei 2012

Katy Perry

Katy Perry sempat membeli apartemen di New York sebulan sebelum menikah dengan Russell BranddiIndiapada2010lalu.KiniKaty PerrymenjualapartemenTriBeCa-nya itu dengan harga sekitar Rp25 miliar. Apartemen yang berlokasi di Jalan North Moore, New York itu mempunyai dua kamar tidur, dua kamar mandi, tangga kayu ceri dan teras yang menghadap ke pemandangan kota. Seharusnya, apartemen itu menjadi tempat tinggal pertama setelah penikahannya dengan Russell. Katy dan Russell menikah pada Oktober 2010 lalu di India. Namun, setelah setahun menikah, Russell mengajukan gugatan cerai pada Katy dengan alasan perbedaan yang tidak dapat disatukan lagi. Mereka akan resmi bercerai pada Juli mendatang. Katy tengah menjalin hubungan asmara dengan gitaris band Florence and the Machine, Robert Ackroyd. Mereka terlihat mesra dan Katy tak berhenti menyebut Robert sebagai pacarnya di festival musik Coachella beberapa pekan lalu. (dtc/int)

HOROSKOP HARI INI TAURUS (21 April - 20 Mei) Karier: Pertahankan prestasi kerja Anda, buat bos bangga. Asmara: Bertemu orang baru yang menggetarkan hati.


(20 Januari - 18 Februari)

Karier: Banyak peluang mencapai sukses dalam dunia bisnis. Teruskan sifat hemat, bijaksana, dan berhati-hati dalam mengelola bisnis. Asmara: Hidup ini hambar tanpa cinta. Anda patut dipuji karena setia dan suka berkorban demi kebahagiaan kekasih.


(23 September - 22 Oktober)

Angel LLelga elga

Jual Apartemen Seharga Rp25 Miliar

Akhirnya, Anang dan Ashanty bukabukaan mengenai tanggal pernikahan yang telah mereka jadwalkan. Mereka mengungkapkan akan menikah 12 Mei 2012 di Masjid Albina. ”Kita melangsungkan pernikahan 12 Mei di Albina dan 20 Mei di Shangrila,” tutur Ashanty usai fitting baju pengantin di Butik Ferry Sunarto, Jalan Ciniru, Kebayoran Baru, Jakarta Selatan, Selasa (1/5). Dalam akad nikah nanti, keduanya akan mengenakan kebaya moderen tapi kental dengan budaya Indonesia. Ashanty ingin ia dan Anang tampak ingin sempurna di hari bahagia itu. Mereka memang mempersiapkan konsep tersebut cukup lama. Tak hanya tampil dengan nuansa budaya, akad itu juga bakal dibuat glamour. “Sangat detail sekali, konsepnya sudah jelas, segala sesuatu sangat baik,” ungkapnya. Namun, Anang tak akan mengundang Syahrini. “Kemarin aku telepon ke Jember (Jawa Timur), ada wejangan luar biasa begini ‘Le kalau tahu jalan itu lubang banyak kerikil jangan dilewati, cari jalan aman saja’. Aku tanya ke kakaknya jawab begitu juga, tanya ke pesantren dijawab begitu. Diundang (Syahrini) salah, nggak diundang salah. Sebagai orang dewasa harus berpikir jernih. Tanggung jawab kepada Allah,” ujar Anang didampingi Ashanty ketika ditemui di kawasan Kebayoran Baru, Jakarta Selatan, Selasa (1/ 5). Sementara Ashanty akan mengundang Krisdayanti dalam pernikahannya kelak. “Kalau ibunya anak-anak (KD), karena aku kenal dan mas Anang juga kenal pasti kita undang. Kalau nggak ada halangan itu pasti datang sama suaminya. Kalau mantan duetnya (Syahrini) nggak tahu,” paparnya. (dtc/int)

Karier: Ada beberapa kesempatan kerja. Kendati tidak seperti yang Anda harapkan, namun bisa berarti baik untuk jenjang karier Anda ke depan. Asmara: Penuh sukacita. Tampaknya Anda sudah menemukan pasangan yang meyakinkan untuk masa depan.


(23 Agustus-22 September)

(21 Desember -19 Januari)

Karier: Anda adalah tipe setia pada atasan. Tapi Anda lebih suka bekerja sendiri tanpa nasihat dan kritik.Asmara: Anda sedang merindukan cinta sejati, tetapi Anda sama sekali belum berhasil mendapatkannya.


( 23 November - 20 Desember)

Karier: Selamat! Anda tampaknya akan dipromosikan dalam waktu dekat ini, pertahankan stamina kerja Anda. Asmara: Walaupun sering selisih paham, namun hubungan Anda dengan si dia baikbaik saja.


19 Februari - 20 Maret

Karier: Berargumentasi dengan atasan Anda masih dianggap wajar apabila masih dalam jalur urusan pekerjaan. Lebih dari itu, pertanda hati-hati dengan posisi Anda sekarang. Asmara: Sikap sabar dalam menghadapi pasangan patut diacungi jempol.


(21 Mei - 20 Juni)

Olga Lydia

Karier: Berkat semangat Anda dalam mewujudkan cita-cita, maka saat ini adalah saatnya menuju sukses besar. Asmara: Banyak godaan. Jadi, tetaplah bertahan karena ini hanya sesaat.


19 Februari - 20 Maret

Karier: Jangan terpengaruh teman. Lakukan saja yang Anda mampu agar tugas kantor tidak menumpuk. Asmara: Anda sangat tergantung pada kekasih Anda, sampai-sampai Anda tidak memiliki pendirian.

Olivia Jensen


Ini dia salah satu artis yang terangterangan mengaku sudah memesan makam supermewah di San Diego Hills Memorial Parks and Funeral Homes, Karawang, Jawa Barat. Apa alasan Olga? Olga sepertinya memang tak ‘risih’ bicara tentang kematian. “Sebenarnya kelahiran itu tidak pasti, tapi kematian itu pasti,” tuturnya. ”Setiap orang pasti meninggal, itu kan sifatnya mendadak ya daripada repot ya sudah pesan dari sekarang,” tambahnya. Dengan alasan seperti itu, tidak heran jika Olga mempersiapkan segala sesuatunya meskipun saat ini boleh dibilang dalam kondisi yang sehat. Namun, bintang film ‘Ekskul’ itu enggan merinci spesifikasi ‘rumah masa depan’-nya itu. Ia hanya mengatakan bahwa sudah lama memesan pemakaman di areal yang dilengkapi dengan restauran dan kolam renang itu. ”Saya nggak hafal ya, pokoknya sudah ada,” ujarnya. (dtc/int)

Ayu Dewi

Menikah 7 Juni Jika sebelumnya selalu bungkam, akhirnya Ayu Dewi buka suara soal tanggal pernikahannya. Mau tahu kapan? Ayu akan menikah dengan kekasihnya Regi Datau pada 7 Juni mendatang. Ia pun meminta agar dilancarkan pernikahannya. ”Iya, Insya Allah,” ungkapnya usai mengisi acara musik ‘DahSyat’ di studio RCTI, Kebon Jeruk, Jakarta Barat, Selasa (1/ 5). Menjelang pernikahannya, presenter kocak yang merupakan mantan model itu pun merasakan apa yang biasa dirasakan pasangan kekasih umumnya menjelang pernikahan. Rasa gugup dan deg-degan pun menghinggapi Ayu. ”Pokoknya degdegan, sernya banyak,” ujarnya. (dtc/int)

Cegah Kanker Serviks Sejak Muda

(21 Juli-21 Agustus)

Karier: Jangan terpengaruh teman. Lakukan saja yang Anda mampu agar tugas kantor tidak menumpuk. Asmara: Anda sangat tergantung pada kekasih Anda, sampai-sampai Anda tidak memiliki pendirian.

mahasiswa cerdas kalo kisruh,” ungkapnya. Meski sudah ada pemberitahuan soal demo buruh yang banyak digelar di Jakarta, namun Angel tetap keluar rumah. “Saya kan ada syuting. Tapi saya suruh sopir untuk cari tahu jalan mana aja yang bisa dilalui,” ujarnya. Angel yang dijumpai di sela Konser Spesial Dahsyat, Senin (30/ 4), mengatakan bahwa dia pasti berangkat lebih pagi dari biasanya. “Memang kebetulan syuting jam 10, jadi jam 8 pagi berangkat dari rumah,” pungkasnya. (kpl/int)

Olivia Jensen

(21 Juni- 20 Juli)

Karier: Jangan terpengaruh teman. Lakukan saja yang Anda mampu agar tugas kantor tidak menumpuk. Asmara: Anda sangat tergantung pada kekasih Anda, sampai-sampai Anda tidak memiliki pendirian.


Selasa (1/5) bertepatan dengan perayaan Hari Buruh Internasional. Demo para buruh banyak di berbagai titik. Di Jakarta, bisa dipastikan demo digelar di depan gedung DPR dan Bundaran HI. Apa komentar Angel Lelga soal demo buruh ini? “Kalo demo gak terlalu setuju. Karena saya lihat cenderung kisruh, sudah kebablasan. Kalo perlu, ditanamkan kepada pendemo, harus tahu demo. Jangan bikin takut. Bukan

Pesan Makam Supermewah

Karier: Mulai jenuh. Hati-hati, ini akan mudah sekali terkena stres. Lebih baik Anda berencana ambil cuti tahunan dan berlibur. Asmara: Semakin berbunga-bunga. Meski sudah lama kenal, sikapnya tidak pernah membuat Anda bosan.


Tak Peduli Demo Buruh

Olga Lydia

(23 Oktober - 22 November)

Karier: Melalui masa-masa sulit. Jangan khawatir, badai pasti berlalu. Asmara: Semua terasa di dalam mimpi, karena Anda sedang dimanjakan oleh pasangan Anda. Nikmati saja.


Angel LLelga elga

Artis muda Olivia Jensen mendapatkan mandat untuk mensosialisasikan pencegahan kanker serviks atau kanker leher rahim. Dia pun tidak segan memberi contoh untuk melakukan pemeriksaan dini untuk mengetahui kesehatannya sejak dini, meski di usia masih muda. “Aku sempat medical check juga, karena umur segini jarang ada yang mau ngecek, jadi kita bagus, aku mau check up,” ungkap Olivia Jensen di acara pembukaan Women’s Week’12 di Plaza Senayan, Jakarta

Selatan. “Aku memang nggak 100 persen tahu soal kanker serviks, tapi yang penting makanan dijaga dan divaksin dari umur yang masih muda, sudah ada beberapa dan itu aman,” sambungnya. Women’s Week’12 merupakan even tahunan berisi kegiatan dan acara yang didedikasikan untuk kaum perempuan media. Acara diselenggarakan oleh Trinaya Media, perusahaan yang fokus dalam media perempuan. Trinaya Media mendelegasikan kegiatan CSR (Corporate Social Responsibility) kepada enam perempuan inspiratif,

masing-masing Maudy Koesnaedi melakukan CSR untuk pengrajin rotan, Ersa Mayori bertugas menyosialisasikan lagu anak-anak Indonesia, Ardina Lestari bertugas melestarikan taman nasional di Maluku dan Aline Adita bertugas memberdayakan pengrajin keramik, Ghea Oktarin menyosialisasikan jiwa enterpreneur di kalangan remaja dan Olivia Jansen untuk peduli kanker serviks. “Gak beban juga, justru senang karena membantu masyarakat khususnya wanita agar tidak terkena kanker serviks,” tegasnya. (kpl/int)

RABU, 2 Mei 2012

Maksudnya di sini bukan untuk men-judge pasangan Anda, tetapi terlebih untuk membantu agar ia menjadi pribadi yang jauh lebih baik lagi. Sebelumnya kenalilah tanda bahwa pasangan Anda memang kekanak-kanakan seperti berikut ini: Enggan beramah tamah pada teman Anda Saat sedang berkumpul dan hangout bareng teman Anda, ia malah menekuk wajahnya menjadi beberapa bagian dan memilih untuk diam. Memang sih tak semua orang bisa nyaman berada di lingkungan yang baru, apalagi bila memang ia tak merasa terlalu cocok masuk dalam lingkup pertemanan Anda. Namun, bukankah ia sudah menjadi pasangan Anda dan sudah seharusnya

mengenal juga siapa teman-teman Anda? Setidaknya pria yang dewasa akan menunjukkan bahwa ia cukup pantas mendampingi Anda, karena ia dapat melindungi dan menyayangi Anda sepenuh hati, baik di belakang maupun di depan temanteman Anda. Sulit mengendalikan ‘nafsu’ Kita semua tahu bahwa hampir semua pria pernah menonton film dewasa dan melakukan masturbasi. Dan apabila hingga sekarang ia masih melakukannya, dan tak dapat mengendalikan ‘nafsu’-nya tersebut, ini adalah satu tanda lagi bahwa ia memang pria yang kekanak-kanakan. Seorang pria dewasa mampu mengendalikan ‘nafsu’-nya dan tahu kapan waktu yang tepat untuk memenuhi kebutuhan biologisnya. Tak pernah punya rencana Hampir setiap keluar dengannya Andalah yang akhirnya bingung mau ke mana. Ia

sendiri tak mau pusing dan merencanakan weekend-nya, alhasil ia sering merasa jenuh, bosan akan hidupnya. Padahal, pria dewasa tahu apa yang ia mau. Punya rencana yang walaupun tidak pasti, masih dapat diandalkan sebagai panduan saat melakukan sesuatu, termasuk hal kecil seperti kencan di weekend. Bayangkan saja, bila ia tak punya rencana sederhana, mana bisa dia punya rencana besar untuk masa depannya. Ia tidak tegas, serta tak banyak membantu Anda Saat Anda menghadapi masalah, ia tak bisa bersikap tegas ataupun memberikan masukan yang berarti. Ia hanya bisa melihat Anda mengambil sikap dengan dalih menghormati Anda sebagai pengambil keputusan terhadap diri sendiri. Bahkan, saat ada seorang pria mengganggu Anda, ia bingung harus bersikap bagaimana. Oh, dear. Dia sungguh kekanak-kanakan...

Kurang peduli dan tak khawatir akan diri Anda Anda meninggalkan pesan bahwa Anda kurang enak badan. Ia kemudian membalas pesan Anda dengan “cepat sembuh ya sayang.” Oh, wow, Ok! Memang sih Anda adalah sosok wanita yang mandiri dan bisa menjaga diri sendiri. Tetapi tidak begitu juga ia harus cuek dan tak khawatir dengan kondisi Anda. Setidaknya bila ia memang tak bisa segera menemui Anda, ia akan berusaha menelepon dan memastikan Anda baik-baik saja, that’s gentleman! Boros dan tak punya tabungan Pria memang terkenal high spender bila berbicara soal gadget atau hobby, tetapi

bukan berarti juga ia akan menghabiskan semua uangnya hanya untuk bersenangsenang. Pria dewasa tahu bagaimana mengatur pengeluarannya dengan baik, sekalipun ia juga senang mengeluarkan uang dalam jumlah besar untuk sesuatu yang disukainya. Dan apabila pasangan Anda termasuk sosok yang boros, tak punya tabungan dan investasi untuk masa depan. Hmm... sudah saatnya Anda berbicara serius dengannya, Ladies. Take him or leave him, for your better future! (kl/int)

Rajin Berpelukan

Cegah Perceraian Menuruthasilpenelitianadaberagam penyebabperceraianpasangan.Namun ada satu penyebab yang kurang disadari masyarakat kita dewasa ini, hubungan intim. Bagi sebagian pasangan yang sudah menikah, hubungan intim berkesantakterlalupentingdanmenjadi rutinitas. Padahal di awal pernikahan, hubungan begitu hangat dan panas. Problem ini ternyata terjadi hampir di seluruh dunia, sehingga mendorong para ahli melakukan penelitian lebih lanjut untuk mencari solusi terbaik. Menurut sebuah penelitian yang dilakukan di Kinsey Institute, Indiana University, berpelukan dan bercumbu adalah langkah intim yang mendekatkan pasangan satu sama lain. Sayangnya, karena kesibukan masing-masing pasangan, hal sederhana tersebut makin dilupakan dan ditinggalkan. Dalam penelitian ini pula, seperti dikutip dari Indiatimes, ditemukan bahwa hubungan yang awet ditentukan oleh kepuasan seksual masing-masing pasangan. Kedekatan fisik ini membangun jembatan

batin yang membuat satu sama lain saling bergantung dan membutuhkan. Bagi pria sendiri, kebahagiaannya di dalam sebuah hubungan adalah tentang kesehatan diri dan kepuasan orgasme pasangan. Pria akan berusaha menyenangkan pasangan di atas ranjang sampai pasangan mencapai big-O. Di sisi lain, pria akan merasa lebih puas dan bahagia apabila pasangannya memberikan ciuman dan pelukan secara intens setiap hari. Sedangkan setelah menikah, wanita cenderung dibuat lebih sibuk dengan hal lainnya. Anak-anak, pekerjaan rumah tangga, membuatnya menjadi sosok yang sibuk dan lebih dingin. Alhasil, pelukan dan cumbuan itu semakin jarang diberikan kepada suami. Di sinilah kemudian hubungan mulai dingin dan renggang. “Wanita, cenderung merasa puas dan bahagia apabila keinginannya terpenuhi, hidupnya secara ekonomi berubah lebih baik, dan

anak-anaknya tumbuh dewasa,” ungkap Julia Heiman, direktur Kinsey Institute. Di sini wanita seharusnya sadar bahwa menjaga hubungan dengan pasangan tidak hanya sebatas melakukan rutinitas sehari-hari. Wanita harus tetap memperhatikan kebutuhan suami dalam hal seksual. Menyediakan waktu khusus untuk bercumbu dan berpelukan, membuat pasangan merasa nyaman dan diperhatikan. Kesalahan terbesar wanita setelah menikah adalah memberikan perhatian hanya lewat SMS, telepon atau berondongan pertanyaan mengandung kecurigaan. Yang ternyata menjadi bom waktu bagi pernikahannya sendiri. Ladies, bila Anda ingin membuat pernikahan selalu langgeng dan bahagia. Berikan perhatian lebih dalam bentuk sikap hangat seperti pelukan dan ciuman kepada suami. Hal ini akan lebih banyak membantu ketimbang pertanyaan penuh kecurigaan Anda. (kl/int)

Rahasia Perut

SMOOTHIE TOMAT CHERRY Bahan: 225 gram plain yogurt non fat 2 - 3 buah tomat cherry, cuci bersih, potong Gula secukupnya Es batu secukupnya Cara Membuat: Blender semua bahan sampai halus selama 2 menit. Tuangkan dalam gelas. Anda bisa menyematkan irisan tomat cherry sebagai hiasan pada bibir gelas. (kl/int)

Ini pengalaman nyata semua orang: ada harihari saat Anda merasa perut kembung, seolah membesarsepertibalonraksasa.KarenaAndajuga pahambahwamakanpiebuahpeachtigapotong dalam sekali waktu santap bukan ide bagus, jadi, pastibukanitupenyebabnya.Laluapa?Mengapa setelah teratur berolahraga dan makan dengantertib Anda masih mengalami kesulitan saatmengancingkancelana? “Penyebab utama perut buncit bukan besar kecilnyaporsimakanan.Yangharusdiperhatikan adalahjenismakananyangdiasup.Mengonsumsi bahan makanan tertentu yang sulit dicerna oleh lambungdanususbisamembuatperutjadipenuh gas hingga membengkak,” kata Christine Gerbstadt,M.D,R.D.,ahlidietdariSarasota,Florida, yangjugajurubicaratheAmericanDieteticAssociation.“Bahan-bahantertentuyangsulitdicerna tersebut saat melewati usus besar akan bersentuhandenganbakteriususyangkemudian menyebabkannya memproduksi gas dan bisa membuatperutjaditerasataknyaman.”Sebuah penelitiandariUniversityofUtahdiSaltLakeCity menyimpulkanbahwakira-kira20persenorang dewasa mengalami sensasi perut kembung ini. “Dan angka itu bisa saja menjadi makin besar. Pengalaman saya, pasien perempuan mengeluhkanpernahmengalamiperutkembung paling tidak sekali dalam jangka waktu tertentu,” tutur dr. Gerbstadt. “Berita baiknya, dengan pola makan sederhana dan sedikit perubahan gaya hidup,perutbuncitbisadihindari.” Ikuti beberapa tip berikut dan dapatkan perut rata...selamanya! Janganmalasbergerak Jikamerasabajudibagianpinggangmenyempit setelah makan malam, keluarlah dari rumah, lakukanjalansantaisekitar10menit.“Aktivitasfisik menolong organ perut mengeluarkan gas dari pencernaan dengan lebih cepat,” kata Dr. Gerbstadt. Nah, gas inilah yang akan sangat

mengganggujikaAndasantai-santaidisofaseusai makan. Jadi, lebih baik bergerak daripada diam. Jangan lupa, saat hari-hari pesta yang membuat Andamakanbesar,menghindariolahragaadalah ideterburuk.ParapenelitiSwediameyakinibahwa olahtubuhringan,seperti30menitbersepedatiga kaliseminggu,akanmembasmirasataknyaman di perut dan mempermudah proses pembuangan. Akrabiprobiotik Kadangkala perut kembung disebabkan oleh ketidakseimbanganbakterididalamusus.“Halini mungkin terjadi saat Anda harus mengonsumsi obat-obatanantibiotika,terutamauntukpenyakit di saluran kemih atau infeksi sinus,” demikian penjelasanSitaChokhavatia,M.D,seoranggastroenterologistdiMountSinaiSchoolofMedicinedi New York City. Probiotik bisa menjaga keseimbanganbakteriusus.Menurutpenelitian diNortwesternUniversity,bifidobacteriuminfantis adalah jenis probiotik yang sudah terbukti bisa meredakan kembung. Dr. Chokhavatia menyarankan mengonsumsi probiotik selama dua minggu sebelum membuktikan keampuhannya. Batasisusu Satu dari sepuluh orang dewasa tidak bisa mencerna laktosa, dan perut kembung bisa disebabkanolehhalini.Demikianhasilpenelitian diBaylorCollegeofMedicinepada2009.jikaAnda mencurigai bahwa susu, yoghurt, dan produk berbahansususapilainsebagaibiangkeladiperut kembung, tidak perlu lalu serta merta menghentikan konsumsinya, karena tentu saja Andamasihmembutuhkankandunganvitamin susu,misalnyakalsiumdanprotein.Setelahditeliti oleh National Institute of Health, terbukti bahwa seseorang yang lactose-intolerance tetap bisa mencerna 12 gram laktosa yang setara dengan secangkir susu, tanpa harus mengalami efek samping.“Seseorangyangalergiterhadaplaktosa


sebaiknya mengatur waktu konsumsi susu sepanjang hari. Misalnya, setengah gelas susu untuk sarapan dengan sereal di pagi hari, lalu sepotong keju dengan biskuit di sore hari,” demikianTaraGidus,R.D.,ahlinutrisidariOrlando, Florida. Ditambahkannya, “Pilih produk yang merupakan olahan yoghurt atau keju,s eperti cheddar atau provolone, karena jenis ini lebih mudahdicerna.”JikamemangtubuhAndasama sekalitakbisamenerimalaktosayangdibuktikan denganperutkembungsetelahmengonsumsinya meskisedikitsaja,segeraberalihkeprodukbebas laktosa. Bernapasperlahan Pernahmengalamihalini:merasasangatingin ke toilet sesaat sebelum marathon dimulai? Rasanya seperti saat harus memulai presentasi penting. Nah, artinya, Anda sedang mengalami kecemasan yang lalu mempengaruhi saluran

pembuangan. “Saat dilanda kecemasan, tubuh mengeluarkan hormon kortisol dan adrenalin, yang kemudian memicu pencernaan bekerja lebihgiat,”penjelasandariYuriSaito,M.D.,pakar kesehatan di the Mayo Clinic Rochester, Minnesota.Akibatnya,perutterasapenuhgas,kembung, danrasanyapenuhhinggamendesakAndasegera ke toilet. Faktor tambahan yang perlu diperhatikan:saatstres,seseorangbisasajaingin mengunyahtanpahentiataulalumakansesuatu yang ‘salah’ yang tentunya seperti menambah tenagapadapencernaanagarbekerjalebihkeras. Akibatnyaperutjadibermasalah.Jikamemang stres yang memicu perut Anda jadi tak nyaman, cara mencegahnya bisa dilakukan lewat terapi tingkah laku atau hypnotherapy. Sebuah penelitian di Kanada tahun 2009 membuktikan bahwaterapipenyelarasanpikirandantindakan efektifmengatasisindrompencernaan,misalnya sulitbuangairbesardankembung.Meditasijuga bisa jadi pilihan. Yang lebih mudah lagi adalah mengatur napas. Bernapas perlahan melalui hidungbisamenenangkanpikiran.(kl/int)


2 Mei 2012

„ Podolski

Arsenal Gaet Podolski

„ Pemain Manchester City, Nasri, berebut bola dengan pemain MU, Patrice Evra. Dalam pertandingan ini, City berhasil menang 1-0.

City Rebut Puncak Klasemen Manchester City menaklukkan Manchester United dengan skor 1-0 dalam derby Manchester. Kemenangan ini mengantarkan The Citizens naik ke puncak klasemen dan menggusur The Red Devils ke posisi kedua.


alam laga yang dihelat di Etihad Stadium, Selasa (1/ 5) dinihari WIB, City kembali memasang Carlos Tevez dan Sergio Aguero di lini depan. Di kubu tim tamu, Sir Alex Ferguson membuat kejutan dengan mencadangkan Antonio Valencia dan memberi kepercayaan kepada Park Jisung. City tampil dominan dengan penguasaan bola 53 persen. Mereka juga melepaskan 15 tembakan meski cuma tiga yang tepat sasaran. Satu-satunya gol dalam laga ini tercipta pada penghujung babak pertama. Kapten City, Vincent Kompany, jadi pahlawan lewat golnya. Tambahan tiga poin membuat City mengumpulkan 83 poin dari 36 pertandingan. Meski jumlah tersebut sama dengan milik MU, City unggul

selisih gol dan berhak naik ke peringkat teratas. Jalannya pertandingan Kedua tim bermain sangat hati-hati sejak menit-menit awal dan tempo permainan pun cenderung lambat. Alhasil, tak banyak peluang berarti yang tercipta. Pergerakan Carlos Tevez pada menit ke-16 sempat membahayakan gawang MU. Tapi, umpan datarnya ke Sergio Aguero lebih dulu disapu oleh Phil Jones. Berselang sembilan menit, Aguero mendapatkan peluang. Meski dia tak terkawal di dalam kotak penalti, tendangan volinya masih melambung. Memasuki menit ke-36, giliran Pablo Zabaleta yang mengancam gawang MU. Namun, tendangannya dari jarak dekat masih lemah dan tak menyulitkan David de Gea.

Di masa injury time babak pertama, kebuntuan akhirnya terpecahkan. Dari sebuah situasi sepak pojok, David Silva mengirimkan umpan yang diteruskan oleh Kompany dengan kepalanya. Bola masuk gawang tanpa bisa dihentikan De Gea. Kesempatan yang didapat Samir Nasri pada menit ke-58 urung berbuah gol. Tendangan melengkungnya masih melenceng.

Tim tuan rumah berpeluang menambah gol pada menit ke-72 lewat percobaan Yaya Toure. Usai menggiring bola dari tengah lapangan, Yaya melepaskan tembakan jarak jauh. Hasilnya? Arah bola masih melebar. Peluang berikutnya masih jadi miliki City, kali ini melalui Aguero. Sial buat bomber asal Argentina ini, sepakannya cuma menerpa sisi luar jala gawang MU.

Toure menyia-nyiakan peluang berharga pada menit ke-82. Mendapat ruang tembak di depan kotak penalti, dia gagal mengarahkan bola ke sasaran. Di sisa waktu, City sempat mendapatkan peluang lagi lewat Gael Clichy. Namun, tendangan Clichy masih bisa diblok De Gea dengan kakinya. Saat peluit panjang berbunyi, skor tak berubah. City menang 1-0. (int)

Bawa Pulang Raul, Mourinho!

„ Raul Gonzales Mantan presiden Real Madrid, Ramon Calderon mengatakan bahwa entrenador Jose Mourinho ingin menjaga Raul Gonzales tetap di Santiago Bernabeu. Raul sendiri baru saja menegaskan musim ini menjadi musim

terakhirnya bersama salah satu klub Bundesliga, Schalke 04. Raul merupakan legenda Madrid dan dia menyatakan untuk meninggalkan Bernabeu pada musim 2010. Kemudian dia melanglang buana ke Bundesliga selama dua musim untuk memperkuat The Royal Blues, julukan Schalke. Di Jerman, Raul tetap menunjukkan taringnya sebagai pemain berpengalaman dan dengan sangat cepat untuk menjadi idola baru publik Veltins Arena, markas Schalke. “Raul ada pemain Spanyol, tapi dia menggambarkan sebagai pemain dengan emosional yang dingin. Jelas dia pergi ke Jerman untuk menghangatkan permainannya. Pemain ini memberikan hidupnya untuk klub,” ucap Calderon, seperti disitat Insidefutbol, Selasa (1/5). Calderon mengharapkan keinginan dari Mourinho itu segera diwujudkan. Karena saat ini Raul seperti memberikan isyarat tentang masa depannya, dengan mengakhiri kontraknya bersama Schalke akhir musim ini. “Beberapa orang tahu bahwa Jose Mourinho menginginkan untuk tetap menjaga dirinya bermain semusim lagi (bersama Madrid),” pungkasnya. (int)

„ Alonso

Fernando Alonso

Merasa Seperti Petinju Rocky Balboa adalah nama karakter petinju Italia fiktif yang terus-menerus bekerja keras demi menumbangkan lawannya. Fernando Alonso, yang membela tim Italia Ferrari, menyamakan dirinya seperti Rocky. Dalam serangkaian film yang mengetengahkan kisah Rocky, petinju berjuluk ‘Italian Stallion’ tersebut selalu dihadang sejumlah tantangan dan lawan-lawan tangguh, yang pada akhirnya selalu bisa ia taklukkan. “Aku merasa seperti Rocky,

aku terus-menerus bertarung di awal musim ini. Kini tergantung kami untuk mendapatkan hasil,” lugas Alonso di La Gazzetta dello Sport. Musim ini Alonso sudah berhasil satu kali naik podium ketika memenangi seri kedua di Malaysia lalu. Namun, kerja keras masih menanti karena selain torehan Alonso itu capaian terbaik lainnya dari ‘Kuda Jingkrak’, yang diperkuat Alonso dan Felipe Massa, hanyalah finis kelima. Ferrari kini memiliki kesempatan untuk berusaha mem-

benahi performa dalam tes tengah musim F1 yang digulirkan pada 1-3 Mei ini di Mugello. Dalam kurun waktu empat tahun, baru kali ini lagi timtim ‘Jet Darat’ berkesempatan melakukan tes tengah musim. “Tes ini sangat penting dan kami akan maju terus! Aku menaruh hormat besar kepada kerja keras orang-orang di sekeliling kami. Ada sekitar 800 orang di pabrik kami yang sudah berusaha sekuat tenaga dan itu mengapa kami harus memberikan upaya 101% di lintasan,” seru Alonso. (int)

SETELAH lama terkatungkatung, proses kepindahan penyerang Jerman, Lukas Podolski dari klub papan bawah Bundesliga FC Koln ke Arsenal akhirnya menemui kepastian. Dilaporkan The Sun Selasa (1/5), kedua klub telah menyepakati transfer pemain berdarah Polandia itu dengan nilai transfer yang diperkirakan mencapai £11 juta (Rp164,1 miliar) untuk lima tahun. Pelatih Arsenal, Arsene Wenger mengatakan bahwa dirinya sangat senang bisa mengamankan transfer pemain berusia 26 tahun itu. Wenger beralasan, Podolski bisa menjadi bagian penting masa depan Arsenal. “Dia pemain kelas dunia, finisher yang sangat baik serta terbukti tampil bagus di klub maupun tim nasional,” kata pria Perancis itu. “Kami tidak sabar melihat Lukas berlaga di Euro 2012 musim panas nanti, di mana dia telah mencatat 95 caps [untuk Jerman] meskipun baru berusia 26 tahun, sebuah catatan yang fenomenal dan membuktikan kualitasnya sebagai pemain,” imbuhnya. “Kami sangat senang melakukan transfer ini jauh sebelum waktu jendela transfer dibuka. Sekarang kami tidak sabar melihat Lukas berkontribusi bagi negaranya di Ke-

juaraan Euro 2012 musim panas nanti,” ucap Wenger tentang Podolski yang telah mencatat 95 caps –penampilan- untuk timnas Jerman meskipun baru berusia 26 tahun. Podolski memulai karirnya di FC Koln pada umur 10 tahun sebelum mencoba petualangan baru di Bayern Muenchen dan kembali ke klub yang membesarkan namanya itu pada tahun 2009. Dalam laman resmi klub, CEO Koln Claus Horstmann mengaku sedih karena tidak dapat mempertahankan Podolski. Meski demikian Horstmann optimis Podolski akan sukses bersama Arsenal. Sedangkan Podolski mengatakan kepindahannya ke Arsenal adalah kesempatan baik untuk merasakan kompetisi tingkat tinggi di level klub. Dia juga menyebutkan bahwa sama sekali tidak mudah baginya meninggalkan FC Koln, karena manajemen klub, para penggemar dan keseluruhan kota Koln begitu spesial baginya. Podolski masih menyisa kan 1 tahun masa kontraknya bersama FC Koln. Musim ini dia telah mencetak 18 gol. Namun dirnya tidak mampu mengangkat performa tim yang kemungkinan besar akan terdegradasi ke divisi 1 Liga Jerman. (int)

„ Kimi

Kimi Raikkonen:

F1 Bukan Prioritas Hidup Saya! KIMI Raikkonen jarang buka suara mengomentari halhal kecil. Baginya, Formula One tak memiliki arti seujung kuku-pun bagi kehidupan pribadinya. Hanya dua hal yang membuat Kimi bersedia jalin komunikasi dengan media melalui sesi wawancara, yakni terkait mobilnya dan kemenangan di seri-seri balapan. Hal-hal lainnya yang terkait ‘tetek-bengek’ dan embelembel lain, hanya merupakan omong kosong yang tak perlu ditanggapi olehnya. Bahkan jawara F1 musim 2007 itu, tak bersedia melepas kacamata hitamnya dalam tiap-tiap sesi wawancara. Hal itu menandakan, sesi wawancara hanya formalitas belaka yang wajib dilakoninya berkat mandat dan perintah dari timnya sendiri. Sejak comeback ke lintasan jet darat dari ajang reli dunia, Kimi memang mensinyalkan perubahan dalam dirinya. Meski begitu, target tim tetap dijalaninya dengan sikap profesional. Terakhir, Kimi men-

jejakkan kaki di podium kedua pada GP Bahrain beberapa waktu lalu. “Raihan saya tidak terlalu buruk (di Bahrain). Saya menyukai apa yang saya lakukan, itu saja sudah cukup. Saya tidak peduli jika orang mengatakan raihan saya sudah bagus atau buruk. Memang mengecewakan jika anda hanya menjadi yang tercepat kedua. Tapi siapa tahu apa yang akan terjadi di seri selanjutnya,” tutur Kimi. “Tapi saya di sini hanya untuk membalap. Saya akan baik-baik saja tanpa omong kosong yang lain tentang F1,” lanjut driver berusia 32 tahun itu kepada Bild am Sonntag, Selasa (1/5). “Jika anda menghapus keberadaan mobil dari F1, saya takkan berada di sini. Formula One tidak punya peran apapun dalam kehidupan pribadi saya. Saya punya kehidupan yang sebenarnya!. Saya rasa bagi kebanyakan pembalap, F1 adalah hidup mereka, tapi tidak bagi saya,” tuntas suami Miss Scandinavia 2001 – Jenni Dahlmann tersebut. (int)

Heat Ungguli Knicks MiamiHeatsementaraunggul 2-0 atas New York Knicks dalam babakplayoffwilayahtimurNBA berlat kemenangan 104-94 di game kedua, Senin. Dwyane Wade menjadi pencetak poin terbanyak dengan 25 poin diikuti Chris Bosh dengan 21 poin dan LeBron James menghasilkan 19 poin, 7 rebound dan 9 assist.

Sementara di pihak New York Knicks, Carmelo Anthony menyumbangkan 30 poin. Game ketiga dan keempat akan berlangsungdiNewYork,Sabtudan Minggu. Di game lainnya, IndianaPacersmampumerebut satu poin dengan mengalahkan tamunya Orlando Magic 93-78. Dengan hasil ini kedua tim berbagi angka 1-1. (int)


2 Mei 2012


36 26





2 Man United

36 26





3 Arsenal

36 20





4 Tottenham

35 18





5 Newcastle

35 18





6 Chelsea

35 17





7 Everton

35 14





8 Liverpool

35 13





9 Fulham

35 12





10 WBA

36 13





11 Sunderland







12 Swansea City







13 Norwich City







14 Stoke City







15 Aston Villa







16 Wigan Athletic







17 QPR







18 Bolton Wanderers 35 10





19 Blackburn Rovers 36






20 Wolves








Trofi EURO 2012 Diarak Keliling Polandia TROFI Piala Eropa 2012 mulai diarak keliling ke sejumlah kota di Polandia yang disambut secara antusias warga negara itu, sekitar dua bulan menjelang turnamen sepak bola bergengsi itu dibuka. Bersama Ukraina, Polandia terpilih sebagai tuan rumah kejuaraan sepak bola antar negara Eropa, mulai 8 Juni sampai 1 Juli 2012 nanti. Dalam turnamen sepak bola paling bergengsi setelah Piala Dunia ini, enam belas negara yang lolos kualifikasi akan bersaing ketat untuk menjadi juara. Empat tahun lalu, Spanyol menjuarai kejuaraan ini setelah mengalahkan Jerman 1-0 di turnamen yang digelar di Austria dan Swiss. Kejuaraan ini digelar setiap empat tahun dan pertama kali digelar pada 1960. Kini, Polandia ingin menunjukkan kepada dunia bahwa mereka siap menggelar pesta sepak bola itu, setelah beberapa kalangan

sempat mempertanyakan kesiapan mereka. Kota bersejarah Dan, setelah pekan lalu dikenalkan kepada masyarakat ibukota

Warawa, warga kota pelabuhan bersejarah Gdanks pada pekan ini terlihat antusias untuk menunjukkan kepada dunia bahwa mereka siap menyambut kejuaraan


CHELSEA 28 26 22

Van Persie Wayne Rooney Sergio Aguero

memperebutkan trofi Henry Delaunay. Beberapa bekas pemain top negara itu pun dilibatkan. “Setelah melihat piala ini, Anda pasti ikut larut untuk bersama-sama

berjuang merebut piala itu di lapangan hijau,” kata mantan pemain timnas Polandia era 70 dan 80-an, Andrzej Szarmach, yang ditunjuk sebagai duta Polandia selama kejuaraan itu digelar. Szarmach yang pada masanya dikenal penyerang yang haus gol itu kemudian berkata: “Sebagai anggota tim nasional Polandia, saya hampir merebut Piala Dunia, yaitu sebanyak dua kali, tetapi pengalaman ini tak saya dapatkan pada Kejuaraan Eropa.” Dalam arak-arakan di Gdanks, piala itu sempat dibawa ke stadion Arena, salah-satu stadion yang akan digunakan selama kejuaraan. Demi menunjukkan sejarah penting kota Gdanks, piala itu juga diarak menuju pelabuhan Gdanks yang terkenal melalui gerakan buruh pimpinan Lech Walessa di masa akhir kekuasaan komunis. (int)

Arsenal Man United Man City


35 29





2 Barcelona

35 26





3 Valencia

35 15





4 Malaga

35 16





5 Levante

35 15





6 Atletico Madrid

35 13





7 Athletic Bilbao

35 12










9 Sevilla

35 12





10 Mallorca

35 12





11 Espanyol

35 12





12 Getafe

35 12





13 Real Sociedad





43 43

8 Atletico Osasuna 35


14 Real Betis

35 12




15 Rayo Vallecano

35 12





16 Granada







17 Villarreal







18 Sporting Gijon







19 Real Zaragoza







20 Racing Santander 35








Tak ada laga mudah di Premier League, tapi saya percaya kami masih bisa bersaing di peringkat empat besar.” Alan Pardew, Pelatih Newcastle United

Chelsea akan menjalani laga krusial kontra Newcastle United dini hari nanti. Dan, pada pertandingan yang akan menentukan posisi empat besar, pasukan Chelsea mengklaim kalau mereka diuntungkan karena sudah terbiasa berada di sana.


43 43 21

Lionel Messi Ronaldo Higuaín

Barcelona Real Madrid Real Madrid

SERIA A ITALIA KLASEMEN SEMENTARA 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Juventus Milan Napoli Udinese Lazio Inter Roma Catania Parma Atalanta Bologna Chievo Siena Cagliari Palermo Fiorentina Genoa Lecce Novara Cesena

35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35 35

21 22 14 15 16 16 15 11 12 13 11 11 11 10 11 10 9 8 6 4

14 8 13 10 7 7 6 14 11 13 12 11 10 12 9 11 9 11 10 10

0 5 8 10 12 12 14 10 12 9 12 13 14 13 15 14 17 16 19 21

62-18 68-28 62-43 47-35 50-45 52-47 55-50 45-47 48-52 40-36 38-42 30-41 43-40 36-42 48-54 34-41 46-66 39-53 29-61 22-53

77 74 55 55 55 55 51 47 47 46 45 44 43 42 42 41 36 35 28 22

helsea saat ini masih duduk di posisi enam klasemen sementara dengan poin dikumpulkan berjumlah 61. Meski kompetisi tinggal menyisakan tiga laga, peluang John Terry dkk masuk empat besar masih terbuka lebar, mereka cuma terpaut satu angka dari Newcastle dan Tottenham Hotspur yang ada di urutan lima dan empat. Tengah pekan ini The Blues bisa masuk kembali ke jajaran empat besar terkait jadwal tanding mereka dengan The Magpies. Jika bisa meraih tiga poin, dan pada laga lain Spurs kalah atau imbang, m a k a Chelsea

akan bertengger di posisi empat. Pasukan Roberto Di Matteo memang terus menunjukkan permainan terang benderang. Ia bahkan bisa membuat Fernando Torres mencetak hattrick saat melawan QPR di Stamford Bridge. The Bluesmemangpunyarekorhampirsempurna di The Bridge sejak Di Matteo mengambil alih. Mereka telah bermain tiga kali dengan hasil dua kemenangan (vs Stoke dan Wigan) serta seri saal melawan Tottenham. Secara keseluruhan musim ini mereka telah memenangi 11 dari 17 laga kandang dengan hanya tiga seri dan tiga kekalahan. The Bridge bukan sepenuhnya benteng lagi seperti era Jose Mourinho tapi setidaknya permainan mereka meyakinkandiStadionsebelahTamanMakam Bromptom itu. Sebaliknya, Newcastle lawan The Blues pada dini hari nanti kerepotan di tandang.


METRO Chelsea Newcastle

RekormerekadiluarSportsDirectArena adalah 7-3-7. Tentu saja The Magpies antara lain menang meyakinkan di Bolton. Blackburn dan Swansea. Tapi, dalam laga laga itu tuan rumah beberapa kali membuang kesempatan sebelum Newcastle mencuri gol lewat serangan balik. Setidaknyalagayangmelibatkankeduatimsepanjang musim selalu bisa menghibur publik. Satu hal yang mendukung Newcastle dalam laga ini adalah terbelahnya konsentrasi tuan rumah ke final Piala FA vs Liverpool yang akan diadakan pada Sabtu (5/5). Chelsea bisa memanggil kembali Branislav Ivanovic setelah menjalani skorsing tiga laga di kompetisi domestik. Fakta itu meringankan pikiran Di Matteo yang




26 22 21

Ibrahimovic Cavani Di Natale

Milan Napoli Udinese

BARCELONA VS MALAGA Kamis, 3 Mei; Pkl. 01.00 WIB BILBAO VS REAL MADRID Kamis, 3 Mei; Pkl. 03.00 WIB

masih harus tanpa jasa Garu Cahill dan David Luiz. “Kami harus bermain kontra Newcastledansayaakamemantaukondisi para pemain dalam dua hari ke depan untuk melihat apakah bisa memilih tim kuat,” ujar Di Matteo di situs resmi klub setelah melawan QPR. “KamiharusmenunggukabarCahill,Luiz, danJohnMikelObiyangcederahariini.Dan, Ivanovicbisakembalilagi,”lanjutsangpelatih. Di Matteo akan mengejutkan banyak orang apabila mempertahankan tim sama seperti kontra QPR dengan Wembley menatapkurangdaritujuhhari.Kendatitak mengutarakannya secara ekspisit, perubahan pasti ada.(INT)

3 0


Terbesar, Terdepan Dan Terbaik Di Siantar-Simalungun

Read more
Read more
Similar to
Popular now
Just for you