Page 1





Kamis, 30 Agustus 2012



Edisi 131 „ Tahun X

TPL Rampas Lahan Warga Petani: Saya Siap Ditembak PUSAT TURUN BERESKAN KEK SEI MANGKEI „) Baca Pusat Turun ....Hal 6


Kajari Minta Audit BPK ke Wartawan SIANTAR– Kepala Kejaksaan Negeri Siantar (Kajari) Rudi H Pamenan mengaku belum menerima hasil audit Badan Pemeriksaan Keuangan Republik Indonesia (BPK RI) tentang proyek bermasalah di Dinas Tata Ruang dan Permukiman „) Baca Kajari ....Hal 7


„ Jahotman Nainggolan menunjukkan lahan dan tanaman kopi ateng miliknya yang dirusak pihak PT TPL, Rabu (29/8).

SIMALUNGUN- Sedikitnya 45 kepala keluarga (KK) warga Nagori Pondok Buluh, Kecamatan Dolok Pangribuan, Simalungun, terancam kelaparan. Pasalnya ratusan hektare (ha) lahan pertanian sebagai sumber utama mata pencaharian mereka yang tersebar di Naga Hulambu dan Paronggangan di Nagori Pondok Buluh, diserobot PT Toba Pulp Lestari (TPL) sektor Aek Nauli untuk ditanami eucalyptus. „) Baca TPL Rampas ....Hal 6

Karyawan Bank Panin Tipu Nasabah Rp774 Juta Hal6 PERAMPOKAN Pelaku Bukan Amatiran ALAT BERAT DI SIMALUNGUN Diprediksi Kembali Beraksi PERDAGANGAN- Aksi pencurian alat berat diprediksi akan berlanjut di Kabupaten Simalungun. Pasalnya pelaku ini merupakan sindikat pe-

main lama dan bertindak profesional. Kurun waktu seminggu belakangan, sindikat ini telah melakukan aksinya sebanyak dua kali, di Dolok

Ilir Serbelawan dan kawasan perkebunan Bahlias, Bandar. „) Baca Pelaku ....Hal 6


Murid Serba Hemat, Bawa Nasi ke Sekolah FOTO: FAISAL HALIMI FOR JAWA POS

„ Dahlan Iskan (kanan) membersihkan toilet di Bandara Soekarno-Hatta.

Dahlan Bersihkan Toilet Bandara

JAKARTA- Upaya mendorong perbaikan layanan publik terus dilakukan. Kali ini, Menteri Badan Usaha Milik Negara (BUMN) „) Baca Dahlan Bersihkan ....Hal 7

Awak METRO kembali ke Dusun Buntu Raja, Senin (23/7) sekira pukul 10.30 WIB dan langsung menuju gedung sekolah dasar dusun itu. Saat memasuki kawasan sekolah, suara murid anak-anak para terpidana kasus begu ganjang terdengar menjawab sejumlah pertanyaan yang dilontarkan oleh guru mereka. HORDEN SILALAHI, TAPUT „) Baca Murid Serba ....Hal 7


TANCAPKAN PISANG- Warga menancapkan pohon pisang di jalan rusak Siantar-Saribudolok, tepatnya di Sirpang Pangalbuan, Kecamatan Raya, Rabu (29/8).

Pembangunan Jalan Lamban RAYA- Pembangunan jalan di Kabupaten Simalungun terkesan lamban. Padahal nomenklaturnya sudah ditampung di APBD tahun 2012. Hingga akhir Agustus 2012, tidak tampak

tanda-tanda pembangunan jalan akan dimulai. Padahal pemkab dan DPRD Simalungun sudah menyetujui APBD 2012 „) Baca Pembangun....Hal 6


Masih Bergantung Bantuan Pemko FOTO: HORDEN SILALAHI

„ Anak-anak terpidana kasus begu ganjang berkumpul bersama saat hari libur dan dihibur sejumlah ibu-ibu

SIANTAR- Hingga saat ini, para korban banjir di Jalan Kenanga dan Jalan Handayani belum bisa beraktivitas dan masih bergantung bantuan pemko. Selain tempat tinggal yang belum bisa ditempati,

mereka masih menghabiskan waktu untuk membersihkan rumahnya dan perabot rumah. Kondisi daerah banjir di sekitar Jalan Kenanga dan Han„) Baca Masih ....Hal 6



30 Agustus 2012

Telepon Penting PMI (Palang Merah Indonesia) 118, 0622-433911 Alamat Jl Sutomo No. 248, Pematangsiantar Kantor Imigrasi Alamat: Jl. Raya Medan Km. 11,5 Pematang Siantar Telepon : (0622)465018, 465014 Samsat Dipendasu Jln Sangnawaluh No 37A 0622 7552345.

SIANTAR-Pembagian beras miskin (Raskin) di Kelurahan Sipinggol-pinggol, Kecamatan Siantar Barat, Pematangsiantar dinilai tidak tepat sasaran. Pasalnya warga yang tergolong miskin tidak mendapat bagian, malah mereka warga yang tergolong kaya (ekonominya mapan) yang mendapat jatah raskin 45 kilogram perbulan. Lurah Sipinggol-pinggol nampaknya tidak respon terhadap keluhan masyarakatnya, buktinya setiap kali datang raskin tetap saja mereka yang kaya rutin mendapatkan jatah. (mag/04osi)

RS dr Djasamen Saragih Jln Sutomo No 230. 0622 (23824) Hotel Sapadia Jl.Diponegoro No.21 A P.Siantar Telp:0622-435922 Nice Trans Siantar-Medan Medan. (061) 4558844 Siantar (0622)7000200 085275144777

Murid SDN 091394 TTidak idak Pernah Dapat Dana Boss Bupati Simalungun terhormat, kenapa murid SDN 091394 Nagori Purba, Kecamatan Haranggaol Horison tidak pernah mendapat kucuran dana Boss. Padahal sepengetahuan orangtua, sekolah tersebut rutin mendapat dana Boss. 081264243xxx

Jalan RRakutta akutta Sembiring RRusak usak PParah arah F O TO : EKO HENDRIAW A N

„ Beras bulog di kantor Lurah Sipinggol-pinggol dibagikan kepada warga mampu, Rabu (29/8),

Raskin Hak Orang Miskin

Dilakukan Pendataan Ulang

RASKIN merupakan hak orang miskin. Orang yang ekonominya mapan dan terdaftar sebagai penerima raskin, sebaiknya mengalihkannya kepada orang miskin. Mungkin saja BPS salah mendata, sehingga orang kaya pun terdaftar sebagai penerima raskin. (osi) Edi Irianto, LSM

SEBAIKNYA BPS melakukan pendataan ulang atau melakukan verifikasi data penerima raskin di setiap kelurahan, agar penyalurannya tepat sasaran sebagaimana diharapkan. (mag-02) Deny, Warga

BPS Salah Mendata Dalam penyaluran beras raskin harus berdasarkan data dari Badan Pusat Statistik (BPS). Kalau ada masyarakat miskin yang belum mendapat raskin raskin, itu kesalahannya kepada BPS. Lurah sebagai aparat pemerintah yang berhubungan langsung dengan masyarakat harusnya menerima aspirasi warganya. (mag-04) Rama, Mahasiswa



Jl. Merdeka, No. 254 CP 085362213705 P. Siantar

Membutuhkan Alumni PTN Jurusan:

• Bahasa Inggris • Matematika • Fisika • Kimia • Biologi (Dik /Nondik) Untuk menjadi tentor (staf pengajar ). Lulus tes langsung mengajar. Honor paling tinggi di P.Siantar. (DIUTAMAKAKAN YANG SUDAH BERPENGALAMAN)

LOWONGAN PEKERJAAN Sebuah perusahan yang bergerak dibidang Otomotif membutuhkan segera tenaga kerja dibidang : SALES EXECUTIVE Syarat-Syarat : 1. Pria maximal 28 tahun. 2. Berpengalaman dibidang sales min,2 tahun 3. Pendidikan minimal tamatan SMA. 4. Cekatan, Jujur, Dipsilin dan Bertanggung jawab. 5. Memiliki SIM C. 6. Memiliki kendaraan sendiri. 7. Bersedia ditugaskan keluar kota. Surat lamaran lengkap di alamatkan ke:

PT SUTAN INDO ANEKA MOBIL ( Authorized TOYOTA Dealer ) Jln. Medan Km 2,8 P.Siantar. Surat lamaran ditunggu Paling lambat 08 September 2012 dengan melampirkan Fotocopy KTP Fotocopy SIM C,Fotocopy ijazah,Daftar nilai, daftar riwayat hidup dan phasphoto terbaru ukuran 3x4 sebanyak 2 lembar. (TIDAK MELAYANI LEWAT TELEPON)

"SEKARANG TANGAN DAN KAKI SAYA SUDAH TIDAK CUCUK-CUCUK LAGI" Keluhan karena asam urat kini sudah tidak lagi dirasakan D u ng d u ng Nurwati Aritonang. Padahal, sudah 1 tahun, wanita berusia 43 tahun tersebut mengeluhkan kesehatannya terganggu karena asam urat. Kirakira apa rahasianya? Ketika ditemui di kediamannya di Desa Tanjung Gusta, Kec. Sunggal, Kab. Deli Serdang, Sumatera Utara, ia menjawabnya, "Sudah 1 tahun terakhir ini saya menderita asam urat dan telah lama berobat, namun sakitnya masih datang dan pergi. Tapi setelah saya minum Gentong Mas selama 6 bulan, sekarang kaki dan tangan saya sudah tidak cucukcucuk lagi," tuturnya menceritakan pengalaman baiknya tersebut. Gentong Mas adalah minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda) terbukti memiliki banyak manfaat untuk kesehatan. Dulu, ketika sakitnya kambuh, ibu 5 orang anak ini selalu merasakan tangan dan kakinya sakit. Tapi kini, semuanya berubah. Dengan tubuh yang sehat, ia pun dapat menjalani

aktifitasnya sehari-hari sebagai PNS dengan nyaman dan tidak segansegan membagi pengalaman sehatnya dengan orang lain. Asam urat bukanlah nama suatu penyakit, namun ia adalah suatu zat sisa metabolisme zat yang bernama purin yang berasal dari makanan yang kita konsumsi. Keadaan dimana tubuh mengalami kelebihan kadar asam urat disebut hyperuricemia. Pada kondisi normal, kelebihan purin ini akan dikeluarkan melalui urine dan feses. Namun jika purin yang masuk dalam tubuh terlalu banyak, maka ginjal akan kesulitan mengeluarkan zat tersebut sehingga terjadi penumpukan sisa metabolismenya (asam urat). Penumpukan sisa metabolisme zat purin di persendian dapat menyebabkan bengkak dan rasa nyeri. badan terasa linu, nyeri terutama di malam hari atau pagi hari saat bangun tidur, sendi terlihat bengkak, kemerahan, panas dan nyeri luar biasa pada malam dan pagi, timbul benjolan-bejolan kecil dari mulai sebesar biji beras sampai kacang hijau di daun telinga bawah (tofus) adalah gejala-gejala asam urat. Habbatussauda yang dikandung dalam Gentong Mas bermanfaat untuk menormalkan metabolisme, termasuk metabolisme purin sebagai pembentuk asam urat yang dipercaya dapat meningkatkan pengeluaran

asam urat dari darah melalui urine. Sementara, Gula Aren selain rasanya manis dan lezat juga bermanfaat untuk menurunkan penyerapan lemak dan perbaikan sistem saraf. Untuk hasil maksimal, control makanan yang dikonsumsi dan banyak minum air putih, sekitar 8 gelas sehari. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi w w Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/ toko obat terdekat atau hubungi: Medan : 081384 777787 Sidikalang: 081384777787 Humbahas : 0821 6864 2805 Gunung tua : 081384777787 Batubara : 081384777787 Tobasa : 0813 8477 7787 Nias : 0813 8477 7787 Tebing Tinggi : 0813 2209 9495 Siantar : 082167538848 Binjai : 0813 9866 6166 Lbk Pakam : 0813 6227 3308 Karo : 0821 6753 8828 Langkat : 0813 6227 3308 Kisaran : 0623 7014 362 Tj. Balai : 0812 6349 5563 Labura : 0813 7059 0972 Labuhan batu: 0852 7784 4950 P. Sidimpuan : 0821 6346 6597 Sibolga : 0813 7625 2569 Taput : 081263243034 Madina : 082163466597 Dolok Sanggul :

Wali Kota Siantar terhormat, kondisi jalan Rakutta Sembiring mulai dari lorong 9 sampai simpang Rame rusak parah. Tidak ada lagi badan jalan yang bisa dipilih untuk dilalui, semuanya berlubang-lubang. 08127686xxx

Tertibkan PPungli ungli di PParapat arapat Bupati Simalungun terhormat, tertibkan pungutan liar di pintu masuk Parapat. Mereka petugas tiket menerima uang restribusi dari wisatawan tanpa memberikan karcis. 08126406xxx


30 Agustus 2012

Syahganda Nainggolan.

“Di luar itu, wilayah DPR pun banyak disandera oleh berbagai kasus besar yang menjerat kehormatan anggotanya sendiri baik penyimpangan moral pribadi ataupun anggaran, sehingga berdampak pada krisis kepercayaan publik terhadap lembaga DPR,”

“Timwas Century mendorong Tim Pengenbalian Aset melakukan segala upaya agar aset yang dibekukan di dalan nageri maupun di dalam negeri segera dicairkan atau dirampas untuk menutup kerugian negara,” Ketua DPR Marzuki Alie.

AM Fatwa.

“DPR ini almamater saya yang sangat saya cintai, saya ikut bersedih. Betapa kebanggaan saya, saya dari penjara menjadi pimpinan di sini, sehingga saya menulis buku dari ‘Cipinang ke Senayan’. Tapi banyak teman-teman saya yang berangkat dari Senayan ke Cipinang, ya itu saya sangat sedih,”

Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter

Sikap Kami Menjaga Kerukunan PENYERANGAN terhadap kelompok minoritas akhir-akhir ini menunjukkan betapa problem kerukunan masih menggelayuti bangsa ini. Celakanya, kita seperti tak mau belajar dari peristiwa-peristiwa terdahulu, seperti penyerangan terhadap kelompok Ahmadiyah, sehingga kita tak serius menjaga kerukunan. Kalaupun belajar, kita seperti tak kunjung pintar menjaga kerukunan. Itu sebabnya peristiwa yang mengoyak kerukunan berulang kali meletus. Penyerangan terhadap kelompok minoritas Ahmadiyah tak hanya sekali, tetapi berulang-ulang terjadi. Penyerangan terhadap umat kristiani yang tengah beribadah pun berkali-kali terjadi. Paling mutakhir penyerangan terhadap kelompok minoritas Syiah di Sampang, Madura, Jawa Timur, Minggu (26/8). Penyerangan itu bukan yang pertama. Penganut Syiah itu mendapat serangan serupa pada Desember 2011. Semestinya tragedi Sampang menjadi pelajaran bahwa kita harus serius menjaga kerukunan. Kerukunan bisa dijaga bila kita memahami bahwa keberagaman merupakan keniscayaan sosial, hukum alam, sunatullah. Segala makhluk yang ada di kolong langit ini pastilah plural, jamak, banyak, tidak tunggal. Hanya Sang Pencipta yang satu, esa, tunggal. Manusia berasal dari berbagai ras, etnik, agama, dan kebudayaan. Hasil cipta, rasa, dan karsa manusia pun beragam. Termasuk penafsiran atas agama juga beragam. Itu sebabnya banyak sekali aliran dalam agama-agama. Bangsa ini harus menyadari hukum alam tidak bisa dilawan. Melawan hukum alam hanya menghasilkan kerusakan, kesengsaraan, dan penderitaan. Penghormatan terhadap keberagaman akan menciptakan harmoni. Itulah sebabnya para pendiri bangsa menciptakan semboyan Bhinneka Tunggal Ika. Sayang sekali, bangsa ini seperti melupakan, bahkan melawan, kebinekaan. Penyerangan atas nama agama terhadap kaum minoritas di Tanah Air merupakan perlawanan terhadap kebinekaan, keberagaman, dan hukum alam. Hasilnya pun hanyalah kerusakan, kesengsaraan, penderitaan, dendam, dan trauma berkepanjangan. Oleh karena itu, kita tidak punya pilihan lain kecuali menerima keberagaman dalam kehidupan sosial kita. Mari kita rayakan keberagaman sebagai keindahan kehidupan. Negara tentu punya tanggung jawab besar menjaga kerukunan. Negara harus menjadikan penyerangan terhadap kelompok Syiah di Sampang sebagai pelajaran pamungkas. Negara harus menjadikan peristiwa itu sebagai momentum untuk ekstra serius menjaga kerukunan. Kita perlu menegaskan hal itu karena, alih-alih menjaga kerukunan, negara justru acap memicu kerusuhan. Negara hadir malah untuk memicu penyerangan atas nama agama. Label sesat dari aparatur negara menjadi alat legitimasi oleh kelompok intoleran untuk menyerang kelompok-kelompok minoritas. Ketika penyerangan atas nama agama itu terjadi, negara malah absen. Terang benderang negara berpihak kepada satu kelompok ketika menyelesaikan problem kerukunan. Padahal, negara mesti bersikap bijak dan adil. Negara disebut telah menjaga kerukunan hanya bila ia hadir dan berdiri di atas semua golongan yang hidup di negeri ini. (**)

Menebar Citra di Hari Idul Fitri biasanya H-7 tiket sudah terjual habis, sekarang hingga H5 Lebaran tiket masih tersisa cukup banyak. Lebih lanjut dalam berita itu dikatakan, tahun ini lebih turun dari tahun 2011. Tahun ini, tiket belum habis beberapa hari menjelang lebaran. Lima tahun lalu, H-7 tiket sudah habis. Sekarang, sejak H-7 hingga beberapa hari menjelang lebaran, dirinya hanya memberangkatkan tiga bus dengan total 120 penumpang. Bagi pihak yang mengorganisir mudik bareng ada misimisi sosial yang dilakukan, namun ada pula misi politik atau membangun citra untuk kepentingan-kepentingan tertentu. Bagi perusahaan swasta, mudik bareng bisa dilakukan dengan tujuan untuk mengucapkan terima kasih atas loyalitas masyarakat yang telah menggunakan produknya. Bisa juga untuk mengikat masyarakat agar tetap mau menjadi distributor atau pedagang perusahaan swasta itu. Bagi partai politik, menggelar mudik bareng tentu sebagai salah satu bentuk kampanye untuk kepentingan Pemilu 2014. Dengan mudik bareng inilah pengurus partai membangun citra bahwa partainya adalah partai politik yang peduli kepada masyarakat. Melalui ikatan emosional mudik bareng inilah, partai politik mencoba mengikat masyarakat untuk memilih partainya. Kampanye atau membangun citra di saat mudik ini merupakan sebuah cara yang efektif untuk menebar pengaruh. Dalam arus mudik, jutaan orang secara bergelombang bergerak ke arah yang sama, seperti dari Jakarta menuju Jawa Tengah, Jawa Timur, Jogjakarta; Jakarta menuju Sumatera; Bandung menuju Jawa Tengah, Jawa Timur, dan Jogjakarta; serta dari satu titik ke titik lainnya. Menurut Menteri Perhubungan, E. E. Mangindaan, dalam sebuah berita, memprakirakan jumlah pemudik melalui angkutan jalan untuk tahun 2012 sebesar 5,5 juta penumpang, angkutan sungai dan penyeberangan danau, 3,3 juta penumpang, Kereta Api diprediksi 1,3 juta penumpang, untuk angkutan laut 1,5 juta penumpang, angkutan udara 3,2 juta penumpang. Dari data tersebut

Dari lebaran ke lebaran sepertinya kaum pemudik semakin dimanjakan. Mereka tidak perlu lagi berpanas-panasan untuk antre tiket, bus atau kereta, ataupun ditipu calo saat membeli tiket, sebab sekarang mereka bisa ikut program mudik bareng gratis. : Ardi Winangun MENJELANG lebaran, beberapa tahun sebelumnya dan saat ini, semakin banyak pihak, seperti partai politik, perusahaan swasta, bahkan komunitas masyarakat daerah, yang mengorganisasi mudik secara massal dan gratis, bahkan sepanjang perjalanan pemudik diberi makan dan minum. Bila pengelola mudik bareng royal, pemudik diberi kaos dan topi serta atribut lainnya. Lihat saja saat kita melintas di komplek Gelora Bung Karno, Jakarta, beberapa hari menjelang lebaran banyak terlihat pos pemberangkatan mudik bareng yang digelar berbagai perusahaan, seperti pabrik semen, perusahaan minum, dan ada partai politik. Pos pemberangkatan mudik itu nampak meriah, berbagai atribut mereka seperti bendera, baliho, dan umbul-umbul dipasang secara mencolok. Akibat dari mudik bareng ini, ada pihak yang merasa dirugikan, yakni perusahaan otobus. Dalam sebuah kabar di media massa diberitakan, perusahaan otobus mengalami penurunan omset tiket penjualan angkutan mudik. Menurut Boy Mando, agen tiket Bus Gumarang Jaya rute Jakarta-Padang mengatakan, kegiatan mudik gratis yang digelar banyak perusahaan, hanya menguntungkan warga yang mau mudik, tapi merugikan PO yang biasa melayani angkutan mudik lebaran di berbagai terminal di Jakarta. Dikatakan kepada sebuah media massa beberapa waktu yang lalu, mudik bareng gratis menurunkan omset penjualan tiket PO, yang


Menjual bahan bangunan Grosir penjualan kayu untuk bangunan Tersedia segala jenis ukuran

Jenis kayu sembarang hutan Meranti Hoting Duri dll

"Lang Dearan Bani Halak Dong Do Hita" Horas Simalungun Jaya Jl. H Ulakma Sinaga No. 45 Nagori Pamatang Simalungun Kec. Siantar Kabupaten Simalungun

Pengusaha na RM Br Simanjuntak Telp. 0622 - 7552445 HP 0821 6545 1004

bisa dibandingkan bila tahun 2011 jumlah pemudik mencapai 13 juta orang maka di tahun 2012 ada sekitar 14,8 juta orang. Bila partai politik mampu menebar citra dan pengaruh pada 14,8 juta pemudik, maka partai politik itu bisa masuk 3 besar peraih suara terbanyak dalam Pemilu 2014. Kenapa demikian? bila kita mengacu pada Pemilu 2009 terlihat perolehan suara partai politik adalah: Partai Demokrat 21.703.137 suara atau orang, Partai Golkar 15.037.757 suara, PDIP 14.600.091 suara, PKS 8.206.955 suara, PAN 6.254.580 suara, PPP 5.533.214 suara, PKB 5.146.122 suara, Gerindra 4.646.406 suara, dan Hanura 3.922.870 suara. Dari data tersebut menunjukan bahwa jumlah pemilih partai politik seperti PKS, PAN, PPP, PKB, Gerindra, dan Hanura, tidak sebanyak jumlah pemudik di tahun 2011 atau 2012. Dengan demikian tak heran bila partai politik berlomba-lomba untuk menggelar mudik bareng. Lihat saja, PAN dalam mudik bareng tahun ini menyediakan 200 bus, PKB menyediakan 35 bus AC, Partai Golkar 120 bus, dan Partai Demokrat 109 bus. Mayoritas bus-bus itu mempunyai tujuan ke berbagai kota di pulau Jawa dan Sumatera. Mudik bareng yang digelar partai politik itu baik-baik saja dan syah-syah saja, namun dengan adanya mudik bareng yang difasilitasi partai politik, menunjukan bahwa biaya politik yang dikeluarkan untuk kampanye semakin tinggi. Untung saja Idul Fitri setahun hanya sekali, bayangkan kalau Idul Fitri setahun dua kali. Semakin banyaknya kegiatan yang dilakukan partai politik untuk menjaring suara tentu akan mempengaruhi kondisi kas partai politik. Nah di sinilah perlunya transparansinya partai politik dalam mengelola keuangannya. Bila tidak transparan, jangan-jangan biaya mudik bareng itu diperoleh dari danadana yang tidak jelas, diambil dari ngentit proyek-proyek besar atau menaikan anggaran pembangunan. Selamat Idul Fitri 1433 H, Mohon Maaf Lahir dan Batin. (***) Penulis adalah Pengamat Sosial dan Budaya


30 Agustus 2012

Presiden Tunggu Surat Resmi DPR Soal Darurat Komnas HAM

JAKARTA- Masa kerja komisioner Komnas HAM akan berakhir pada 30 Agustus 2012, namun Komisi III DPR belum juga melakukan fit and proper test terhadap 30 calon anggota Komnas HAM. Presiden SBY menunggu surat resmi dari DPR sebelum mengambil sikap menyangkut nasib Komnas HAM. ”Itu kan sebenarnya dikatakan akan ada surat dari DPR kepada Presiden. Saya sudah cek tidak ada surat dimaksud belum ada di meja kami. Kami belum bisa memberikan sikap maupun pandangan apaapa,”kata Jubir Kepresidenan, Julian Aldrin Pasha, Rabu (29/8). Menurut Julian, Presiden akan segera mengambil keputusan setelah surat dari DPR diterima. Baik dalam bentuk Perppu maupun Keppres sesuai keperluan untuk memastikan dasar hukum Komnas HAM y a n g masa


kerjanya akan segera habis. ”Jadi kami menunggu surat dari DPR,” kata Julian. Masa kerja komisioner Komnas HAM akan berakhir pada 30 Agustus 2012, namun Komisi III DPR belum juga melakukan fit and proper test terhadap 30 calon anggota Komnas HAM. Komisi III DPR pun melempar bola kelanjutan Komnas HAM ke Presiden. Komisi III DPR menyadari keterlambatan fit and proper test anggota Komnas HAM bisa berdampak pada kevakuman Komnas HAM. Karena itu secepatnya Komisi III akan meminta pimpinan DPR meminta Presiden SBY segera mengeluarkan aturan memperpanjang masa kerja komisioner Komnas HAM. ”Kita serahkan kepada pimpinan DPR berkonsultasi dengan Presiden dan mengambil langkah sesuai dengan ketentuan yang berlaku agar tidak ada kevakuman,”kata Ketua Komisi III DPR Gede Pasek Suardika. Komnas HAM menemui Wakil Ketua DPR, Priyo Budi Santoso, pada tanggal 16 Agustus 2012 lalu untuk menyetorkan nama-nama hasil seleksi calon komisioner. Ada 30 nama calon komisioner Komnas HAM. (dtc/int)

Afriani Divonis 15 Tahun Badai Hantam Korsel, 9 Tewas SEOUL- Badai menghantam Korea Selatan diikuti angin kencang dan hujan lebat menyebabkan sembilan orang dan menimbulkan ombak yang menghantamkan dua kapal nelayan China menghantam karang. Tim penyelamat berhasil menyelamatkan 12 nelayan dan masih mencari 10 nelayan lainnya yang hilang setelah kapal mereka menghantam karang di lepas pantai Pulau Jeju. Sebanyak lima nelayan tewas. Di tempat terpisah, sedikitnya empat orang tewas saat Badai Bolaven memutuskan sambungan listrik ke ratusan ribu rumah di Korea Selatan, menyebabkan penerbangan ditunda, dan menghentikan latihan gabungan antara militer Amerika Serikat dan Korsel. Korea Utara yang masih berjuang memulihkan diri akibat banjir dan kekeringan kini berada dalam jalur badai tersebut. (dtc/int)

JAKARTA- Afriani Susanti dijatuhi hukuman 15 tahun penjara oleh Majelis Hakim Pengadilan Negeri Jakarta Pusat. ”Terbukti salah dan meyakinkan terdakwa dengan sengaja mengemudikan kendaraan bermotor dan mengakibatkan orang lain meninggal dunia, menjatuhkan pidana penjara selama 15 tahun,” Ujar Ketua Hakim Pengadilan Negeri Jakarta Pusat Antonius Widiyanto saat membacakan vonis di ruang sidang R Wirjono Prodjodikoro, Pengadilan Negeri Jakarta Pusat, Rabu (29/8). Menurut majelis hakim, Afriyani tak terbukti bersalah dalam dakwaan pertama Jaksa Penuntut Umum (JPU) Pasal 338 KUHP tentang pembunuhan. ”Sebelum mengemudikan mobil Daihatsu Xenia terdakwa tidak mempunyai niat secara jelas akan menabrak korban-korban diatas trotoar. Unsur sengaja tidak terbukti, dengan demikian terdakwa bebas

„ Afriani Susanti dari Pasal 338,” tuturnya. Sementara untuk Pasal 311 ayat 4 Afriyani terbukti bersalah karena mengemudikan kendaraan bermotor dalam kondisi yang membahayakan nyawa orang lain.

Terlebih setelah meminum pil ekstasi di Stadium, Jakarta. ”Dengan kondisi demikian sudah seharusnya terdakwa mengetahui kondisinya agar tidak mengemudi karena dapat membahayakan pengguna jalan lainnya. Namun terdakwa justru membawa mobil Daihatsu Xenia. Unsur dengan sengaja membawa kendaraan bermotor dalam kondisi membahayakan nyawa orang lain terbukti,” papar Majelis Hakim. Terkait kasus narkoba, majelis hakim menilai Afriani tidak terbukti pasalnya tidak ditemukan barang bukti. Majelis hakim menilai hal-hal yang meringankan terdakwa yaitu berlaku sopan dan tidak pernh dihukum. Sementara yang memberatkan perbuatan terdakwa telah memberikan duka yang mendalam bagi korban luka dan korban meninggal dunia. Selain itu, perbuatan terdakwa juga dianggap meresahkan masyarakat. (dtc/int)

KPK Kejar Tersangka Lain Kasus Angie JAKARTA- Komisi Pemberantasan Korupsi (KPK) telah melimpahkan kasus Angelina Sondakh ke pengadilan. KPK memastikan, untuk kasus suap terkait Wisma Atlet ini tidak hanya menjerat Angie. Kasus masih akan berlanjut dengan melihat fakta di persidangan. ”Pengembangan kasusnya biasanya caranya adalah proses pemeriksaan di pengadilan itu dijadikan bagian dari proses pengembangan yg punya kaitan dengan potensial suspect yg lain,” jelas Wakil Ketua KPK Bambang Widjojanto di gedung KPK, Jalan HR Rasuna Said, Kuningan, Jakarta, Rabu (29/8). Bambang mengatakan bahwa pengem-

„ Angelina Sondakh

PELUMAS MOTOR Jl. Merdeka No. 1027, Perdagangan

bangan kasus itu tidak berhenti. Selain menunggu fakta di persidangan, KPK juga terus melakukan pengumpulan bukti-bukti. ”Itu digodok. Artinya diinvestigasi, dikumpulkan bukti-buktinya untuk kemudian apakah ini bisa lantas di lidik lalu disidik,” lanjut Bambang Bambang juga menuturkan bahwa penyidik nanti akan melihat rangkaian keterangan yang didapat sehingga bisa membuktikan bahwa ada orang lain yang terlibat kasus ini atau justru sebaliknya. ”Jadi semua penyidik dalam penyelidikan itu pasti melihat rangkaian keterangan yg memungkinkan orang lain terlibat. Tapi bisa juga mengklarifikasi kalau orang lain itu tdk terlibat. Nah proses itu yg sedang berjalan. Saya belum tahu hasil dari proses itu,” tutur Bambang. (dtc/int)

Jaminkan BPKB Motor anda Proses Cepat - Aman - Mudah - Tepat DANA LANGSUNG CAIR HP 0821 6069 2290; 0853 7312 4777 (Hendrik Surya) Dapatkan cashback Rp 200.000 Menjual Segala jenis Sepeda Motor Baru dan Bekas Dengan Menjaminkan BPKB anda ke Jl.Merdeka No .1027 Perdagangan PELUMAS MOTOR CASH & KREDIT Bebas Adm dan Kendaraan di Assuransikan Juga SOLUSI DANA TUNAI SUPER CEPAT !!! Buktikan Dengan Anda Mengunjungi Dealer kami * Khusus kredit Spd Motor Mendapat Gratis OLI Selama Setahun dengan ketentuan Bayar Angsuran Tepat waktu

* Syarat Dan Ketentuan Berlaku

„ Para pimpinan KPK memberikan penjelasan terkait penanganan kasus Simulator SIM.

Kasus Simulator SIM

4 Perwira Polisi Diperiksa JAKARTA- Komisi Pemberantasan Korupsi (KPK) menjadwalkan pemeriksaan empat anggota kepolisian terkait kasus dugaan korupsi proyek simulator surat izin mengemudi (SIM), Rabu (29/ 8). Mereka diperiksa dalam kapasitas sebagai panitia lelang proyek simulator SIM. “Diperiksa sebagai saksi untuk tersangka DS (Djoko Susilo),” kata Kepala Bagian Pemberitaan dan Informasi KPK Priharsa Nugraha di Jakarta, Rabu. Keempat polisi itu adalah Ajun Komisaris Besar Wisnu Budaya, Ajun Komisaris Besar Wandi Rustiwan, Komisaris Endah Purwaningsih, dan Komisaris Ni Nyoman Suwartini. Hingga pukul 14.00, keempat anggota kepolisian itu belum memenuhi panggilan pemeriksaan KPK. Menurut Priharsa, KPK sudah mengirim panggilan pemeriksaan kepada empat anggota polisi itu sejak 15 Agustus 2012. Dalam kasus simulator SIM ini, KPK menetapkan empat tersangka atas dugaan melakukan penyalahgunaan kewenangan sehingga menimbulkan

kerugian negara. Selain Djoko, tiga orang lain yang jadi tersangka adalah Brigadir Jenderal (Pol) Didik Purnomo dan dua pihak swasta, masing-masing Budi Susanto dan Sukotjo S Bambang. Ketiga tersangka terakhir itu juga ditetapkan sebagai tersangka oleh Kepolisian Republik Indonesia. Sejauh ini, KPK belum memeriksa Djoko. Wakil Ketua KPK Busyro Muqoddas kemarin mengatakan bahwa KPK masih fokus memeriksa saksi dan mendalami barang bukti yang diperoleh. Sebelumnya, KPK memeriksa Sukotjo S Bambang sebagai saksi untuk Djoko. Selain itu, KPK memeriksa Sekretaris Budi Susanto yang bernama Intan Pardede. (kmc/int)

KPK Segera Periksa Tersangka Kasus Hambalang JAKARTA- KPK segera melakukan pemeriksaan atas Dedy Kusnidar di kasus Hambalang. Dedy merupakan tersangka pertama di kasus Hambalang. Dedy belum pernah diperiksa KPK. ”Yang saya dengar dari penyidik, pemeriksaan terhadap Dedy segera. Tapi dugaan saya tidak dalam minggu ini,” jelas Wakil Ketua KPK Bambang Widjojanto di KPK, Jl Rasuna Said, Kuningan, Jakarta, Rabu (29/8). Bambang menjelaskan, keterangan Dedy yang Kepala Biro Keuangan dan Rumah Tangga Kemenpora ini penting untuk membuka informasi lainnya terkait kasus Hambalang. ”Dedy jadi penting setelah kita dapat klarifikasi, konfirmasi, dan keterangan lain-lainnya,” tuturnya. Bambang juga menegaskan,

„ Wakil Ketua KPK Bambang Widjojanto. KPK tidak berhenti pada Dedy. Penyidikan terus berjalan mengejar tersangka lain. “Selain penyelidikan yang Dedy kan tetap jalan. Tidak pernah ada dalam statement KPK Dedy adalah anak tangga terakhir. Yang ada, Dedy anak tangga pertama,” tuturnya. (dtc/int)

PELUMAS MOTOR Jl. Merdeka No. 1027, Perdagangan HP 0821 6069 2290; 0823 6516 1890 Anda SIBUK? Cukup Hubungi Kami , Kami siap MENJEMPUT Berkas Anda!

Pastikan BPKB dan uang Anda Bermanfaat Bagi Keluarga Anda! Bunga ringan dan terjangkau serta dealer terpercaya

Ayooo… Buruan !!! Segera Kunjungi dealer kami PELUMAS MOTOR PERDAGANGAN Dapatkan Segera THR Lebaran Ini


30 Agustus 2012

PELAKU BUKAN AMATIRAN DIPREDIKSI KEMBALI BERAKSI Sambungan Halaman 1 Menurut sumber yang layak dipercaya kepada METRO, Rabu (29/8), menyebutkan, para pelaku ini dinilai memiliki keterampilan khusus untuk melakukan pencurian komputer alat berat untuk jenis eskavator, hanya saja para pelaku ini kerap beraksi di kawasan Simalungun. “Memang beberapa pekan ini kasus kriminal berbentuk aksi pencurian mesin alat berat banyak terjadi. Tetapi saya menduga mereka ini terkait dengan pemain di Serbelawan. Mereka ini sindikat pemain lama, ” kata sumber di internal polisi ini. Selama ini aksi para pelaku ini belum terungkap, jajaran Polres Simalungun dan mereka masih melakukan pengejaran terkait masalah ini. Sumber ini juga menyebutkan, aksi ini diduga akan berlanjut karena aksi sebelumnya sempat gagal dilakukan para pelaku di Serbelawan. “Mungkin karena gagal pertama mereka coba lakukan lagi lantas berhasil, inilah yang seharusnya menjadi perhatian Polres Simalungun. Saya kira aksi seperti ini akan tetap berlanjut selagi mereka tidak tertangkap,”katanya. Bahkan, untuk mensiasati maraknya aksi perampokan alat berat ini, Kapolres Simalungun diminta mengambil sikap dengan membentuk tim khusus dan berkoordinasi dengan petugas di seluruh jajaran kepolisian di Sumatera Utara. Namun demikian para pengelola proyek yang menggunakan alat berat di kawasan Simalungun ini juga harus mendapat perhatian dari Polres Simalungun. “Ini bukan masalah sepele, Kapolres harus menyertakan petugas di Polres lain untuk saling berkordinasi. Sebab diduga kuat mereka ini bukan sindikat sembarangan dan memang sudah punya jaringan,” katanya, sembari berharap agar pelaku segera tertangkap. Sementara operator eskavator Ciping merk HI-Tachi zaxis tipe 210F Ari, warga Indrapura Kabupaten Batubara mengatakan, diduga barang curian tersebut lebih dulu dipesan oleh penadahnya. “Dugaan saya, penadahnya sudah lebih dulu memesan kepada para pencuri alat berat itu, karena jika tidak ada yang pesan barang tersebut sulit untuk diperjualbelikan,” kata Ari. Kemudian disinyalir para pencuri yang beraksi malam itu salahsatu dari mereka memiliki senjata api (senpi). Dari beberapa pengalaman Ari, dia menuturkan para pencuri alat berat bukan pencuri amatiran, melainkan pencuri profesional dalam bidang alat berat. “Kalau pencuri alat berat Bang, bukan pencuri amatiran, dari beberapa pengalaman terkait pencuri spesialis beko mereka pasti memilik senpi, kerena alat berat ini bukan barang yang mudah dicuri,” tambah Ari. (mag-02/mag-04)

Masih Bergantung Bantuan Pemko Sambungan Halaman 1 dayani hingga saat ini belum banyak yang berubah. Para korban banjir masih melakukan aktivitasnya membersihkan rumahnya, serta menyuci perabot rumah tangga yang memungkinkan bisa digunakan lagi. Sedangkan untuk kebutuhan makanan, warga masih mengandalkan bantuan dari pemerintah berupa beras dan mi instant dan warga juga bisa makan di dapur umum yang disediakan oleh pemerintah di Jalan Kenanga. Sementara itu, rumah-rumah yang hancur akibat banjir masih dibiarkan pemiliknya dan belum ada perbaikan. Para korban yang rumahnya hancur mengaku tidak ada uang untuk memperbaiki rumahnya yang rusak. Bahkan untuk menyewa di tempat lain pun tidak ada uang. Sehingga mereka terpaksa tidur di rumah warga sekitar yang tidak kena dampak banjir. “Saat ini, kami sangat bingung apa yang harus dilakukan. Harta benda sudah tidak ada lagi. Sementara uang tidak ada. Makanya, kami sangat berharap pemerintah dapat membantu supaya rumah kami dapat diperbaiki,” terangnya. PMI Bantu Selimut dan Tikar Sebanyak 61 kepala keluarga (KK) korban banjir di Jalan Kelurahan Bah Kapul, Simarito, Setia Negara, Tanjung Pinggir, dan Bukit Sofa mendapat bantuan berupa tikar, selimut dan paket Hyehine Kit dari PMI Kota Siantar. Penyerahan bantuan langsung dilakukan Ketua PMI Siantar-Simalungun Sarmedi Purba, didampingi pihak Badan Penanggulangan Bencana Nasional Kota Pematangsiantar, Rabu (29/8). Kepada para korban banjir, Sarmedi, menyebutkan, setiap korban banjir mendapat dua buah tikar dan dua buah selimut, serta satu buah kotak Hyehine Kit berisi sabun odol serta pembersih lainnya. Ia juga menjelaskan, bantuan tersebut sebagai tanda bahwa PMI juga ikut prihatin atas apa yang dialami warga. Menurut dia, banjir merupakan bencana yang tidak bisa diprediksi sebelumnya. Sehingga ia meminta supaya para korban banjir tetap bisa bersabar dan tidak larut dalam kesedihan. (pra/dro)

TPL Rampas Lahan Warga Petani: Saya Siap Ditembak Sambungan Halaman 1 JahotmanNainggolan(32),salahseorangpetani, mengatakan,sejaktahun2005pihakTPLmemulai penyerobotan paksa lahan pertanian masyarakat. Setiap kali melakukan aksi brutal itu, pihak TPL membawa pengawal minimal oknum Brimob dengan persenjataan lengkap. “Mereka menakut-nakuti masyarakat. Siapa yang melawan diancam ditembak. Terang saja masyarakat ketakutan, dan sudah ada 26 kepala keluargayangmundur.Lahanmerekasudahhabis ditanami pohon eucalyptus oleh pihak TPL,” ungkap Jahotman kepada METRO, Rabu (29/8). Menurut Jahotman, sikap brutal itu hingga saat ini masih tetap berlangsung. Pada tanggal 2 Agustus, perusahaan TPL kembali menyerobot paksa lahan masyarakat di Huta Naga Hulambu, Nagori Pondok Bulu. Saatterjadipenyerobotanitu,duaanggotaBrimob mengancam akan menembak kalau masyarakat tetapmenggangguaktivitaspekerjaanTPL.Karena wargaberkerasmempertahankanlahannya,pihak TPL hanya bisa menanami 4 rante dari puluhan hektarelahanwargadiHutaNagaHulambu. “Saya menyatakan siap ditembak demi mempertahankan ladang saya supaya tidak diserobot. Sudah turun temurun keluarga kami berladang di kampung ini. Tetapi tiba-tiba TPL datang dengan pasukan dan alat beratnya melakukan penanaman paksa,” tegasnya. Ia menegaskan, dia akan terus mempertahankan lahannya supaya tidak dirampas TPL. Soal tanaman yang sempat dirusak TPL akan dia tuntut diganti rugi. “Minggu ini, kami masyarakat akan berdemo ke TPL. Kami tidak terima lahan kami diserobot paksa, dan tanaman di dalamnya dirusak dengan alat berat,” ujarnya. Dia mengatakan, akibat perusakan yang dilakukan TPL itu, pihaknya mengalami kerugian hingga puluhan juta rupiah. Dia menyebutkan, ada berbagai macam tanaman milik warga yang dirusak pihak TPL, seperti kopi ateng, aren, pisang, cabai, jengkol, dan petai. “Semua tanaman di ladang saya ini diratakan

Sambungan Halaman 1 pada Desember 2011 lalu. Anggota DPRD Bernhard Damanik, kepada METRO belum lama ini, mengungkapkan kekecewaannya atas lambannya pembangunan jalan–jalan di Simalungun. “Memang benar anggaran untuk perbaikan jalan tahun ini sekitar Rp120 miliar, tapi sebagai DPRD kita sangat kecewa atas lamban penyerapan anggaran. Soalnya APBD untuk tahun 2012 sudah disahkan per Desember 2011 lalu. Jadi tidak ada alasan lagi sampai Agustus tahun ini masih dalam proses tender,” katanya. Menurut Bernhard, salahsatu penyebab lambanya proses pembangunan jalan ini disebabkan karena kurangnya perencanaan di Dinas PU Bina Marga. “Seharusnya sebelum APBD disahkan, semua lokasi proyek sudah selesai disurvei. Jadi sudah ada dokumentasinya, tinggal proses tender dan langsung bisa dikerjakan rekanan,” kata politisi PPIB ini. Namun Kepala Bappeda Simalungun Ir Jan Wanner Saragih membantah jika pembangunan jalan tersebut lamban.Menurutdia,saatinimasihdilakukanprosestender sejumlahproyekperbaikandanpembangunanjalan.“Semua kanadaprosesnya.Saatinimasihdilakukanprosestenderdi beberapadinas.SalahsatunyaPUBinaMarga,”katanya. Menurut Jan Wanner, untuk tahun 2012 alokasi dana untuk pembangunan jalan di Kabupaten Simalungun, yakni Rp120 miliar untuk perbaikan jalan sepnjang 120 kilometer lebih. Anggaran tersebut, kata Jan Wanner, meningkat 70 persen dari anggaran tahun-tahun sebelumnya untuk perbaikan jalan dan jembatan. Ditambahkan JanWanner,ruas jalandiSimalungunsaat ini sepanjang 2.220 kilo meter dan dari seluruh ruas jalan tersebut, sebanyak 70 persen dalam keadaan rusak parah. “Kalautahun-tahunsebelumnyadianggarkanhanyaRp30 miliarsampaiRp40miliarsaja.Sengajaanggaranperbaikan jalan ditingkatkan, karena memang tahun 2012 ini diprioritaskan untuk perbaikan jalan,“ katanya yang

Sambungan Halaman 1 SIANTAR- Oknum pegawai Bank Panin Kota Siantar Suryani dituding menipu nasabah Darwin Kostan (63) sebanyak Rp774 juta. Suryani melakukan penipuan dengan modus memasukkan uang nasabah ke rekening saudaranya Sumiaty. Kuasa Hukum Darwin Kostan, Abdullah Marie ditemui di Mapolres Siantar Rabu (29/8) menyebutkan, pada mulanya proses penipuan ini terjadi 9 Pebruari 2012 sekira pukul 12.04 WIB. Saat ituDarwinKostan,wargaJalanMusyawarah,Siantar Utara yang merupakan nasabah prioritas Bank Panin menyimpan uang di Bank Panin sebanyak Rp774.410.000. Dia pun lalu menandatangani dua lembar formaplikasitransferterkaituangini. FormaplikasitransferBankPanintahapIdikirim dalam bentuk euro sebesar Rp65 ribu dengan nomor rekening 510.4.00328.4 atas nama Darwin Kostan. Yang ditransfer ke tabungan Bank Panin dengan nomor rekening 510.1110.569 atas nama Darwin Kostan dalam bentuk mata uang rupiah Rp774.410.000. KemudianaplikasitransfertahapIIdaritabungan

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel)

Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Pertemuanberdurasihampirsatusetengahjam itu terlihat alot. Warga dan beberapa pejabat TPL seperti Tagor Manik (Humas TPL), Ongung Tambunan dan beberapa stafnya sempat saling adu mulut. Bahkan, Tagor dan Edward saling berdebat menanggapi sampai dimana tanggungjawab TPL terhadap lingkungan. Beruntung Camat lihai dan selalu menengahi ketika situasi mulai memanas. Edward yang juga mantan pegawai TPL yang pada masa aktifnya bekerja di bidang Kehumasan terlihatpalingkerasbersuara.Merasaterpojokatau tidak, beberapa pertanyaan Edward tidak bisa dijawab Tagor Manik. ”Kami di sini tidak untuk mendengar Anda (Tagor Manik, red) berpidato panjang lebar, kami hanya ingin mendengarkan kapan TPL memperbaiki jalan di desa kami yang sudah rusak parah,” tantang Edward, diamini Jasmen Situmorang dan Op Jonggi Manurung, warga lainnya. Menanggapi hal itu, dengan tegas Tagor membantah pernyataan Edward dengan mengatakan pihaknya tak pernah mengkotak-kotakkan(memecahbelah,red)masyarakat.Sementara perbaikan jalan rusak dia berdalih bukan tanggungjawab mereka melainkan pemerintah karena jalan tersebut adalah jalan pemerintah. Mendengar ocehan Tagor, membuat Edward marahbesar.Lagi-lagidengansuarayangkerasdia menjelaskan, sebelum TPL hadir di wilayah itu, jalan tersebut selalu bagus karena dirawat PT Inalum. “Jalan ini dulu bagus, tidak pernah rusak karena pihak Inalum selalu memperbaiki apabila ada kerusakan. Mereka bertanggungjawab tidak sepertianda(TPL,red).Andabolehlihat,manaada jalan yang rusak di sekitar PT Inalum,” bentak Edward. Mendengar pernyataan Edward, Tagor terdiam seribu bahasa sehingga sempat membuat situasi hening beberapa saat. Lagi, Camat mengambil sikap dan mengamankan situasi. Hingga pertemuan itu berakhir, tuntutan warga tak terealisasi. Bahkan, pihak TPL tak berani memastikan kapan perbaikan jalan dimulai. Kurang memuaskan, warga pun kecewa dan membubarkan diri. (osi/dro/brams/des)


mengaku sedang berada di Jerusalem, Israel. WargaProtes, Lalu Tanam Pisang di Jalan Warga Sirpang Pangalbuan, Nagori Rayabayu, Kecamatan Raya menanam pisang di tengah jalan propinsi Siantar-Saribudolok. Aksi tersebut dilakukan sebagai bentuk protes kepada pemerintah karena jalan tersebut tak kunjung diperbaiki. Amatan METRO di Sirpang Pangalbuan, Rabu (29/8), satu batang pohon pisang setinggi 2 meter ditanam warga persis di jalan berlubang yang tergenang air. Akibatnya, bus maupun sepedamotor yang melintas terpaksa harus mengurangi laju kendaraannya karena pisang tersebut ditanam di badan jalan. Di sekitar penanaman pohon pisang tersebut tampak kondisi jalan yang berlubang di sana-sini.Lubangtersebutjugatergenangairkarenahujan yang melanda Raya dalam sebulan terakhir. Tokoh pemuda Rayabayu Rudianus Saragih, kepada METROmengatakanpenanamanpohonpisangdibadan jalan oleh warga Sirpang Pangalbuan merupakan bentuk protes kepada pemerintah, karena jalan tersebut tak kunjung diperbaiki. Menurut dia, jalan tersebut sudah pernah dilakukan perbaikan dengan menutup lubang di sepanjangjalanRayabayukeSirpangPangalbuandengan menggunakan batu dan pasir gunung. Hanya saja hal tersebut tidak bertahan lama dan jalan kembali berlubang. Selain itu akibat penaburan pasir gunung tersebut mengganggu warga karena menimbulkan abu apalagi saat musim kemarau. “Penanaman pohon ini kami lakukan sebagai bentuk protes agar jalan ini segera diperbaiki. Jika tidak kunjung diperbaiki,makaakankamiblokirjalaninidankendaraan dilarang melintas” ancamnya. Menurut Rudianus beberapa waktu lalu salahseorang anggota DPR RI sudah pernah melintas dan melihat kondisi jalan tersebut. Saat itu katanya warga yakin dalam waktu dekat akan diperbaiki karena kondisinya sudah dilihat langsung anggota DPR pusat. (hot/dro)

Sambungan Halaman 1 BANDAR- Pemerintah pusat berkeinginan kuat, agar proyek pembangunan Kawasan Ekonomi Khusus (KEK) Sei Mangkei bisa berjalan mulus. Pembangunan infrastruktur pendukung operasionalnya kawasan industri tersebut dianggap sebagai sesuatu yang mendesak. Sampaisampai, sejumlah pejabat dari Direktorat Jenderal (Ditjen) Bina Marga Kementerian Pekerjaan Umum (Kemen-PU) turun langsung ke Simalungun, Rabu (29/8). Ditjen Bina Marga ingin memastikan bahwa dukungan infrastruktur jalan yang mengakses ke kawasan KEK Sei Mangkei tidak menjadi kendala proyek tersebut. Direktur Bina Pelaksana Wilayah I Ditjen Bina Marga Subagyo menjelaskan, pihaknya siap memberikan dukungan pembangunan jalan yang mengakses ke KEK Sei Mangkei, meski ruas jalan tersebut merupakan jalan kabupaten atau jalan provinsi.“Kitasiapmemberikandukungan peningkatanjalanyangselamainistatusnya masihjalankabupatenatauprovinsi.Tetapi karenaKEKSeiMangkeiinimerupakanprogram nasional, maka pusat diminta untuk membantu penyelesaian infrastruktur tersebut,” terang Subagyo saat berada di SimalungundisertaisejumlahpejabatDitjen Bina Marga lainnya. KedatangannyakeSimalungundalamrangkapeninjauanlapangan,gunamelihatkondisiruasjalandisekitarproyekKEKSeiMangkei. Jikakondisijalanadayangbelumbagus,maka pemerintah pusat siap menyediakan dana untukpembangunannya.“Kitamelihat,inistatusjalanadayangdikerjakankabupaten.Mana

yangtidakmampu,kitadukung.Kitalihatmana yang perlu dukungan, mana yang belum tertangani,”imbuhnya. Diamembericontohruasjalanyangsedang ditanganiDitjenBinaMarga.“Daripertigaan, dari persimpangan itu, ke arah Tanjung, kita tangani sejauh tiga kilometer,” ujarnya. Kedatangannya ke Simalungun, sekaligus untukmengeceklagi,apakahmasihperlulagi Ditjen Bina Marga memberikan dukungan untukmelanjutkanperbaikanjalan.“Kitalihat apakah sisanya masih membutuhkan dukunganatautidak,”imbuhnya. Ditanya ruas jalan mana lagi yang akan mendapatdukunganperbaikandariDitjen BinaMarga,Subagyomenyebut,pokoknya jalan-jalandisekitarproyekKEKSeiMangkei. “Sekitar jalan Perdagangan ke arah PKS (Pabrik Kelapa Sawit),” ujar Subagyo. Dia menegaskan,kedatangannyakeSimalungun ini memang merupakan tugas khusus dari DirjenBinaMargaDjokoMurjanto.Ditegaskan, pemerintah pusat memang punya komitmenkuatagarproyekKEKSeiMangkei bisa berjalan sesuai target. “Saya selalu siap menjalankantugaskhususini,”pungkasnya. Selain infrastruktur jalan, sebelumnya diberitakankoranini,relkeretaapisepanjang 2,9 kilometer yang menghubungkan rel utamakeretaapieksistingmenujukawasan industri KEK Sei Mangkei juga segera dibangun.Pembangunanrelkeretaapijalur Kuala Tanjung-Perlanaan-Sei Mangkei itu akanmenghabiskandanaRp50miliar. PT Perkebunan Nusantara (PTPN) III sebagai pengelola KEK Sei Mangkei di Simalungunpunmengakutelahmendapat izin pembangunan tersebut dari Bupati SimalungunJRSaragih.(sam)

Karyawan Bank Panin Tipu Nasabah Rp774 Juta

Anggota SPS No: 438/2003/02/A/2007 Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba

Kerja Umum (RKU) yang sifatnya 10 tahun. Kemudian ada lagi Sistem Kerja Tahunan (RKT) yangsifatnya1tahun.Sistemkerjainidilaksanakan di daerah sektor Aek Nauli secara bergantian. Tahun kemarin di daerah Nagori Sihaporas, dan tahun ini di Nagori Pondok Bulu,” bebernya. Lambertus mengutarakan, setelah mereka mengantongi izin, tidak ada seorang pun yang bisa mengelolakawasanTPL,kecualipihakTPLsendiri. Sementara masyarakat yang sempat di dalamnya melakukanpemanfaatanlahan,selamainidiberikan kesempatan hanya sampai panen hasil pertaniannya. “Kita tidak ada serobot lahan pertanian masyarakat. Bahkan kita berikan mereka kesempatan sampai panen. Tetapi setelah panen, jangan lagi lahan tersebut diusahai,” ujarnya mengakhiri. WargaDesakTPL Perbaiki Jalan Rusak Sejumlah warga di Kecamatan Parmaksian mendesak PT Toba Pulp Lestari (TPL) segera bertanggungjawab terhadap kerusakan lingkungan termasuk perbaikan jalan rusak di daerah itu. Apabila tak diindahkan, warga mengancam akan menanam pohon pisang di seluruh jalan rusak tersebut. Desakan itu terkuak pada pertemuan antara Manejemen TPL dengan beberapa warga Desa Pangombusan, Banjar Ganjang, Sirait Uruk dan DesaLumbanHualadikantorCamatParmaiksian, Rabu (29/8). Pertemuan yang digagasi Camat Parmaksian Alfaret Manurung itu dimanfaatkan warga menyampaikan keluhan mereka selama pabrik penghasil bubur kertas itu hadir di Kecamatan Parmaksian, Tobasa. Edward Sitorus, mewakili warga mengatakan, sejak TPL beroperasi kembali pada tahun 2003, tak pernah berniat memperbaiki lingkungan. Tetapi, perusahaan raksasa ini hanya memikirkan bagaimana meraup untung sebesar-besarnya tanpa memperhatikan kesejahteraan masyarakat. Bahkan, TPL dinilai telah berhasil memecah belah masyarakat khususnya di sekitar lingkungan di mana perusahaan itu beroperasi. Kerusakan jalan itu menurutnya akibat truk logging mitra TPL membawa muatan berlebihan (melebihi tonase).

Pembangun Jalan Lamban

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pemimpin Perusahaan Metro Asahan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

pakai alat berat. Saat itu, mereka membawa dua anggota Brimob, dan satunya bermarga Pandiangan. Saya diancam akan ditembak. Memang merekapakaibajupolisi,adatulisanBrimobdibaju dinasnya,danmengancamtembaksaya.Lalusaya jawab, saya siap mati ditembak untuk memperjuangkan lumbung pertanian tempat kami hidup sehari-hari,” katanya. Sementara itu, petani yang lahannya sudah ditanami ekalyptus oleh TPL terpaksa tidak bekerja. Antara lain Rudin Nainggolan, Janangon Sijabat, Poltak Purba, Omer Sinaga, Probel Sinaga, Sulaiman Sinaga, Bottan Sitio, Amin Sinaga, Jawanter Sijabat, Rijon Sidabutar, Raya Manik, Saut Sinaga, Sius Pakpahan, Bonor Sinaga, Bilson Tindaon. Kemudian Esron Tindaon, Marudut Sinaga, Kinsen Sinaga, Japatar Sinaga, Ramli Sinaga, dan James Tindaon. Lebih jauh Jahotman mengatakan, setiap melakukan penyerobotan, TPL tidak pernah kordinasi dengan pemerintah setempat dan masyarakat sekitar. Masyarakat yang mengetahui itu pun hanya karena ketepatan sedang di ladang. Sebab jarak perladangan warga dari jalan besar Siantar-Parapat sekitar 14 kilometer. “Kami berharap pemerintah pro rakyat. Perusahaan TPL sudah menginjak-nginjak masyarakat petani dengan merampas semua lahan pertanian. Kami sudah tidak ada pekerjaan lagi. Anak-anak kami mau makan apa? Kalau bekerja bukan mau cari kaya, tetapi untuk sesuap nasi saja,” ujarnya dengan raut wajah sedih. Pangulu Pondok Bulu Albiner Sinaga yang mengaku sering dipanggil pihak TPL melalui humasnya juga tidak pernah datang. Padahal, pemanggilan itu untuk klarifikasi atas penyerobotan lahan pertanian masyarakat. Terpisah, Lambertus Siregar, Media Relationship TPL mengatakan, perusahaan TPL tidak pernah bekerja di luar izin yang dikeluarkan pemerintah.TPLmemilikiizinpemanfaatanhutan kayu, dan sudah dilengkapi tapal batasnya. Itu artinya tidak berani TPL bekerja di luar itu, karena bisa terjerat hukum. “Sistem kerja TPL ada yang disebut Rencana

Bank Panin dengan nomor rekening 510.1110.569 atasnamaDarwinKostandalambentukmatauang rupiahsebesarRp774.410.000yangakanditransfer kenomorrekening510.4020683atasnamaDarwin Kostan dalam bentuk uang dollar. “Selama ini, aplikasitransferhanyaditandatanganiDarwin,yang mengisi keseluruhan data pada aplikasi itu yaitu Suryani. Hal ini sudah berlangsung sejak lama, selama dua tahun belakangan. Darwin percaya kepada Suryani,” jelasnya. DijelaskanAbdullahMarie,Darwintelahmenjadi nasabahprioritasdiBankPanin.NasabahpriotasdiperolehDarwindisebabkanDarwinselalumenyimpan danmelakukantransaksikeuangannyadalamjumlah banyakdibanktersebut.“TernyatasetelahdicekDarwindinomorrekeningnyasendiridi510.4020683,uang Rp774jutatersebuttidakpernahsampaihinggahari ini.BerdasarkanpemeriksaankamikeBankPanindan pengakuanpegawaidisana,malahuangituditransfer kerekeningmilikSumiaty.Perkiraankami,Sumiatyini didugaadikataukeluargaSuryani,“ungkapnya. Lanjut Marie, saat hal ini dipertanyakan kepada pihakBankPanin,bankinisepertinya melemparkan tanggungjawabdantidakmemperdulikankeluhan

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Nasa Putramaylanda, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Eva Wahyuni,

yangdisampaikanDarwin.MerekajugamemberikanalasanSuryanitidakbekerjalagidiBankPanin. Hal ini dipertanyakan pertama kali pada Maret 2012. Sesudah itu, beberapa kali Darwin mendatangi Bank Panin, namun tetap tidak ada penyelesaian dari pihak Bank Panin sendiri. Merekatelahberusahamenyelesaikanmasalahini sebelum dilaporkan ke polisi. “Kenapa lama dilaporkan, karena selama ini Darwin takut melapor karena takut laporannya tidak diproses polisi. Laporan pengaduan ini kami buat tanggal 11 Agustus 2012. Kedatangan saya hari ini untuk mempertanyakan laporan perkembangan penyelidikan polisi,” jelasnya. Suryani Resign Dua Bulan Lalu StafBagianUmumBankPaninKotaSiantarYuda ditemuidikantornyamenyebutkan,sejakduabulan lalu atau sekitar Juni, Suryani sudah resign (mengundurkandiri)dariBankPaninKotaSiantar. “Sejakduabulanlaludiasudahresign,segalasesuatu yang berhubungan dengan dia, tidak ada lagi hubungannya dengan Bank Panin. Kalau ada kasus yang berkaitan dengan dia, sebaiknya ditanyakan langsung sama Suryani. Polisi yang datang kemari

Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

pun, kami suruh menjumpai dia, karena tidak ada kaitannyadengankamilagi,”jelasnyasantai. DisinggungpenyebabSuryaniresigndisebabkan kasuspenipuanRp774jutainikepadaDarwinKostan, Yudatidakmemberikanjawabanjelas.Menurutnya hal itu sepenuhnya merupakan urusan dari manajemen Bank Panin Kota Siantar. Dia juga enggan memberikan keterangan lebih jauh terkait kronologisataukejadianterkaituangRp774jutaini. “Dulu dia tinggal di Jalan Kartini, kamipun sudah berusahamencaridiakesana.Tidakadakamitemui dialagidisitu,diasudahtakadalagidisitu.Kamitidak tahulagidimanadiatinggal,”kilahnyalagi. Kasat Reskrim Polres Siantar AKP Azharudin membenarkan laporan pengaduan Darwin Kostan. Saat ini terus dilakukan penyelidikan dan pemeriksaan terhadap saksi-saksi. Jika bukti sudah kuat maka yang bersangkutan akan ditahan sesuai ketentuan hukum yang berlaku. Azharudin mengakumerekasendiritidakmengetahuialamat dan keberadaan Suryani saat ini. “Kita sudah melakukan pemeriksaan saksi-saksi yang dibutuhkan, kasus ini terus kita selidiki. Kita belum tahu alamat dia sekarang,” jelasnya lagi. (ral/dro)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



30 Agustus 2012

Ayah Tiri Cabuli.. Sambungan Halaman 8 disetubuhisaatiamembangunkanayahnyadanmengajakkekamarmandiuntukmenemaninyabuangairkecil. HalituterungkappadapersidanganyangdigelardiPN SimalungundipimpinmajelishakimMonalisaberanggotakan Silvia Ningsih, Rabu (29/8). Menurut Jaksa PenuntutUmum(JPU)JosronMalau,perbuatanpriayang bekerjasebagaipetaniitumelanggarpasal81ayat1No23 Tahun2002tentangPerlindunganAnak. “Peristiwaberlangsung,Minggu(22/4)sekirapukul23.00 WIB,dikediamanmereka.Saatituterdakwatidurbersama Bungadikamarbelakang.Kemudiankorbanyangmerupakan anak tirinya membangunkan terdakwa dengan mengatakan‘Pakkawaniakukencingkekamarmandi.Aku tidakbisamenghidupkanlampu!”ungkapjaksa. Lalu terdakwa bangun dan membawa korban ke kamarmandi.Saatituterdakwamenghidupkanlampu kamarmandidanmasukbersamadengankorban.Setelah itu dengan polosnya korban membuka celana dan kencing. Sementara terdakwa yang tepat berada di sampingkorban,jugamembuangairkecil. “Ternyataterdakwamelihatkemaluankorbanhingga timbulbirahinya.Selanjutnyaterdakwamencabulidan menyetubuhinya,”terangnya. Melihattindakanterdakwa,korbanlangsungmenangis karenakesakitan. “Untuk mengalihkan tangisan itu, terdakwa memandikankorban.Setelahitu,iamembawaanaktirinya itukekamartidur,”sebutMalau. Sementaradarihasilvisum,ditemukanmemardanbiru dialatkelaminluar.Selaputdararobekdiposisijam2,3,7,9 dansampaikedasar.(mua/hez)

Pengemudi Tinggalkan.. Sambungan Halaman 8

KijangBK48SSmelarikandiri.Namunsetelahmelaju sejauh 10 kilometer, sang supir ini meninggalkan mobilnyadipinggirjalan. Peristiwa berawal saat Warsito yang menetap di daerah Tanjung Morawa, Deli Serdang ini melaju di JalinsumPerdagangan-SeiLangge,Jumat(24/8)sekira pukul13.00WIB.Naas,setibanyadikilometer2-3Nagori BahLias,Simalungun,korbandanBoruSaragihyang diketahui menetap di Nagori Bandar masilam ini ditabrak mobil Toyota Kijang BK 48 SS. Akibatnya, keduakorbankritissetelahmengalamipatahtulangdi beberapabagiantubuhnya.Wargayangmenyaksikan kejadian,melarikankeduanyakerumahsakitterdekat. Sementarapengemudimobillangsungtancapgasdan meninggalkanlokasi. Setelahkabursejauh10kilometer,pengemudiKijang ini meninggalkan mobil dan pergi tanpa diketahui arahnya. SetelahdirawatdibeberaparumahsakitKotaSiantar danMedan,korbanmasihbelumpulihbenar.Namun pihak keluarga mengeluhkan biaya perobatan yang besar. Bahkan kabar terakhir mereka dapat saat akan membawakeduakorbankerumahsakitdiMedan,biaya yang harus dikeluarkan mereka berkisar Rp28 juta. Untuk itu orangtua korban Wasman merasa tak sanggup. Pada Rabu (29/8) sekira pukul 14.00 WIB, Wasman dan kerabatnya mendatangi Mapolsek Perdaganganuntukmenanyakanidentitassupiritu. “Kamimaumenanyakanalamatsupirnya,makanya datang ka kantor polisi ini. Sebab sejak Jumat (24/8) sampai hari ini, belum diketahui siapa pelaku yang menabrakWarsito,”kataWasman. NamunbegitubertemuKaposlantasPolsekPerdaganganApituWAritonang,Wasmandianjurkandatang keUnitLakaSatlantasPolresSimalungun,karenaberkas kasusnyasudahdilimpahkankeunityangberkantordi komplek asrama polisi, Jalan Sangnaualauh, Siantar Timurini. Hal yang sama dikeluhkan abang korban Edi (40) warga Kota Medan.“Kami hanya ingin supir mobil membantu biaya perobatan. Soalnya menurut keterangan dokter baru-baru ini, jika mau dioperasi, kamiharusmengeluarkanbiayaRp28juta,”ujarEdi. KanitLakaSatlantasPolresSimalungunIptuAlsem Sinaga mengatakan, pihaknya sedang menyelidiki supir yang mengemudikan Toyota Kijang BK 48 SS tersebut. (mag-4/hez)

SISWI SMA DISETUBUHI Sambungan Halaman 8 InformasidihimpunMETRO,Selasa(28/8)pukul 06.30WIB,awalnyaBungapamitkepadaayahnya untuk berangkat sekolah. Namun sebelum pergi, ayahnyaberpesanagarBungamampirkerumah kakaknyadiKecamatanraya,sepulangdarisekolah. Namunbegituloncengsekolahberbunyitanda berakhirnyajampelajaran,Bungabukanmenuju kediamankakaknya.Iamalahbertemupacarnya JHSdidepansekolahnya.Setelahbertemu,saatitu jugaJHSmengajakBungaketempatkosnya,diJalan RelaKelurahanSukaDame,SiantarUtara. Disana,merekaberistirahatsebentar.Beberapa jamkemudian,keduanyaberkelilingKotaSiantar mengendarai sepedamotor pemuda yang juga

Dahlan Iskan bahkan harus sampai membersihkan toilet bandara untuk menunjukkan pentingnya kebersihan fasilitas di tempat publik. Kepala Bagian Humas dan Protokoler Kementerian BUMN Faisal Halimi mengatakan, hal tersebut terjadi ketika Dahlan berada di Terminal 2F Bandara Soekarno-Hatta sebelum berangkat ke Surabaya sekitar pukul 15.00 WIB. “Pak Dahlan ke toilet, kemudian melihat tempatnya kotor. Jadi langsung inisiatif untuk bersih-bersih di toilet itu,” ujarnya, ketika dihubungi, Selasa (28/8). Faisal menceritakan, awalnya Dahlan hanya bersih-bersih sendiri. Namun, beberapa saat kemudian, beberapa petugas kebersihan atau cleaning service yang melihat dan mengenali Menteri BUMN, kemudian ikut membantu membersihkan lantai toilet yang kotor karena air serta jejak-jejak sepatu dengan kain pel. Sebagai gambaran Terminal 2 Bandara Soekarno-Hatta digunakan untuk penerbangan internasional dan domestik. Terminal 2D dan 2E digunakan untuk penerbangan internasional

sekolahnya di Kecamatan Raya. Namun kedua orangtuanya tidak langsung percaya begitu saja. Setelah didesak, akhirnya Bunga menceritakan bahwa dirinya telah menginap di hotel dan melakukanhubunganlayaknyasuamiistridengan JHS. Tidakterimaputrinyadicabuli,ayahBungalalu melaporkanperistiwakePolresPematangsiantar. Setelahresmidilaporkan,polisilangsungmelacak keberadaanJHS.Kemarinsekirapukul12.00WIB, JHSakhirnyadiamankandaritempatkosnya. Kasat Reskrim Polres Pematangsiantar AKP Azharudin yang dikonfirmasi menyebutkan, laporanpengaduankorbansudahmerekaterima. Tersangka sendiri sudah ditahan atas perbuatan yangdialakukan.(ral/hez)

Puluhan Warga Datangi Polsek Tiga Dolok

Sambungan Halaman 8 Dolok Panribuan, Simalungun, mendatangi MapolsekTigaDolok,Rabu(29/8)sekirapukul11.00 WIB. Maksudnya adalah mendampingi empat rekan mereka yang dibawa polisi karena terlibat perusakan rumah milik Sabar Damanik (23), tiga pekanlalu. Kedatangan warga ini sempat disambut baik Kapolsek Tiga Dolok AKP W Harianja. Namun begitu sampai di kantor polisi, para warga hanya terlihatduduk-dudukdipelatarankantorpolsek. Menurut seorang warga R Boru Purba (43), merekasempatkesaldengansikapSabarDamanik yangkerapmeresahkanwarga. ”Diaadalahmantannapiyangseringmembuat kesalwargakampungkami,”katanya. PadaMinggu(5/8),Sabarmemasangmercondi depan rumah hingga suara ledakan itu bagaikan

letusan senjata api. Makanya warga langsung berhamburan ke luar rumah untuk memastikan kejadian. Karenakesalmendengarsuaraledakanmercon, wargalangsungmendatangikediamanSabardan memintanya tidak memasang mercon lagi. Tapi permohonanwargainitidakdiindahkan.Berselang beberapa menit kemudian, Sabar kembali memasangmercondanmembuatpanikwarga. ”Disanabanyakanakkecildanlansia,tetapidia tidakpeduli.Makanyakamikesalsekalidenganulah diaitu,”katanya. Selanjutnya warga kembali mendatangi kediamanSabar.Namundirinyajustrumengancam akanmenembakparawargadenganpistol.Percaya dengan gertakan Sabar, warga kembali ke kediamannya masing-masing dan mencoba bersabar. Namun Sabar tetap mengulah. Karena kesal,

akhirnyawargadatangdanmelemparirumahnya. ”Kami sempat percaya kalau dia punya pistol. Soalnya suara mercon itu sudah seperti suara senjataapikamidengar,”katanya. Keesokan harinya, Sabar mendatangi Polsek Tiga Dolok untuk melaporkan kejadian yang dialaminya. Setelah beberapa hari, akhirnya personilPolsekTigaDolokmemeriksaempatwarga. Karena khawatir dengan kondisi temannya, warga datang dan turut mendampingi selama rekannyadiperiksa. ”Kami hanya mendampingi saja, tidak ada maksudlainnya.Kamitakutadaintervensidalam pemeriksaan,”katanya. Namun Kapolsek Tiga Dolok AKP W Harianja yanghendakdikonfirmasi,tidakberhasildihubungi. Teleponselulernyayangdihubungitidakdiangkat. Bahkan pesan singkat (SMS) yang dikirim urung dibalas.(mag-02/hez)

Diamenerangkan,terdakwapunikutbergabung minumtuakdanmemilihdudukdisampingkorban. Saatitukorbanberceritatentangusahapertaniannya. “Di tengah pembicaraan, korban mengatakan ‘aku anggapnya kau sama Nembak ini sama, namun ada bedanya’. Mendengar itu terdakwa menanyakanapabedayangdimaksud,”tiruJaksa. Kemudian korban menjawab ‘kalau sama Nembak bisa suka-suka saya tapi sama kau saya masihsegan’.Mendengaritupunterdakwamemilih diamdanmelanjutkanminumtuak.Tetapikorban kembali mengatakan hal yang sama terhadap terdakwa dan Nembak.“Mendengar peryataan samaitu,terdakwamulaikesal.Tanpabasa-basiia meninjuwajahkorbansebanyakduakali,”paparnya. Berdasarkan pertimbangan itu, agar majelis hakim menyatakan terdakwa terbukti secara sah danmeyakinkanmelakukanpenganiayaan. “Selanjutnya Jaksa menuntut terdakwa empat

bulan penjara dikurangi masa tahanan,” tambahnya. Usai mendengar tuntutan itu, hakim memberikankesempatankepadaterdakwauntuk menyampaikan sesuatu. Lalu pria ini mengaku menyesaliperbuatannya. “Sayamelakukannyalantaranemosi.Tapipak, saya bermohon untuk diberikan keringanan hukuman,usiasayasudahtuadanistrijugasudah tua. Saya tersiksa di penjara, mengingat usia saya yangsudahtua.Sayamemintapermohonanagar hukumansayadiringankan,”terangnya. Menurutnya,iamengakusudahtidaktahandan berharap permohonannya diterima. Hakim RamsesPasaribuyangmendengarpermohonanitu sedikit berseloroh dengan mengaku akan menghukumterdakwasetahunpenjara. “Maumatirasanyabilalama-lamadiLapasitu,” ujatterdakwalagi.(mua/hez)

pulanasapmemenuhiseluruhruangan,termasuk kamar Rika. Tahu rumahya terbakar,Salmanbersamaisteridanduaanaknyalangsungberlarikeluar untuk menyelamatkan diri sembari berteriak kebakaran.Masyarakatsekitaryangmelihatrumah Salamterbakarsecarasukarelaberdatanganuntuk memberibantuanmanual,sekaligusmelaporkan kejadiankePolsekPancurbatu. Untukmemudahkanupayapemadaman,warga pun menghentikan beberapa unit truk tangki air yangdatangdariarahSibolangit. Saatmendengar ada teriakan minta tolong dari salah satu kamar rumahSalam,dengangesit dantanpamemikirkan resiko, Tamat yang merupakan tetangga korban langsung meringsek masuk setelah sebelumnya mendobrakpintukamar. Ternyata,suarateriakanituadalahRikaBrSinuhaji yangmerupakananakketigaSalman.Rikatakbisalagi

menyelamatkandirikarenaseluruhruangankamarnyadipenuhiasap.Bahkan,sekujurtubuhdanwajahnyajugasudahmelepuhkarenaterjilatkobaranapi. SetelahberhasilmengeluarkanRikadarikamar, kedua orangtuanya dibantu warga, langsung melarikanRikaketempatpengobatanalternatifdi kawasanNamoPecawir,KecamatanPancurbatu. Taklamakemudian,petugasPolsekPancurbatu yang dipimpin langsung Kanit Reskrim AKP P Samosir, turun ke TKP untuk melakukan penyelidikan.Setibanyadisana,kobaranapisudahberhasil dipadamkan.Selanjutnya,petugasmengamankan sisabarangyangterbakarsebagaibarangbukti. Karena kondisi luka bakar yang cukup parah, padaRabu(29/8)sekirapukul06.00WIB,nyawaRika akhirnyataktertolonglagi.JenazahRikalangsung disemayamkankeBingkawanuntukselanjutnya dikebumikan.(roy/smg)

Saya Tersiksa di Penjara Pak Hakim!

Sambungan Halaman 8 menuntutnya empat bulan penjara, Rabu (29/8). Terdakwa mengaku menyesal dan mengaku ia merasatersiksahidupdipenjara. Halituterungkappadapersidanganyangdigelar di PN Simalungun yang dipimpin majelis hakim RamsesPasaribudanJaksaPenuntutUmum(JPU) ViktorPurba. Menurutnya,terdakwaterbuktisecarasahdan meyakinkanmelakukantindakpidanamelakukan penganiayaan dan melanggar pasal 351 ayat 1 KUHPidana. “Peristiwa berlangsung pada Minggu (20/5) sekirapukul22.00 WIB.Saatituterdakwadatangke warungKoperasiDusunTanohTinggir.Setibanya diwarung,terdakwamelihatsaksikorbanBangkit Tambun Saribu bersama Nembak Saragih dan LermanPurbatengahminumtuak,”sebutnya.

Gadis Tewas Melepuh

Sambungan Halaman 8 Informasi dihimpun menyebutkan, malam itu Salamyangtakmemilikimesingenset,menyalakan lampu teplok di kediaman mereka yang sekaligus tempat usahanya. Sebab aliran listrik di kampung mereka sedang padam. Kebetulan, salah seorang anak Salman yang bernama Rika Br Sinuhaji (20), diketahui bekerja sebagai karyawati di Hill Park Sibolangit, baru saja selesai mandi dan masuk ke kamaruntukmenggantipakaian.Salmanbersama isterinya Kumpul Br Sembiring (55) dan dua anak lainnyaberkumpuldiruangtamu.SedangkanRicard, putrasulungnyasedangmemancingdisungai. Tanpadiketahuipasti,apiyangberasaldarilampu teplokyangmerekanyalakantiba-tibamenyambar barang-barang yang mudah terbakar. Beberapa saat kemudian, api semakin membesar dan ke-

Sambungan Halaman Satu

Dahlan Bersihkan Toilet Bandara Sambungan Halaman 1

berstatus pelajar ini. Setelah habis berkeliling, seketika itu juga JHS mengajak Bunga ke sebuah penginapan yang berada di Jalan Pdt J Wismar SaragihKelurahanBane,SiantarUtara. Setelahmenyewakamar,JHSyangsudahberniat jahatmelampiaskannafsunyamulaimerayuBunga agar mau melakukan hubungan intim. Setelah dirayudandiberikanjanji-janjimanis,perbuatantak senonohitupunterjadihinggaberulangkali. Esoknya,sekirapukul08.30WIB,merekacekout daripenginapan.KemudianJHSmengantarBunga ke rumahnya. Saat tiba di rumah, kedua orangtuanya langsung bertanya kepada Bunga tentangkeberadaannyayangtakpulangkerumah. Bunga sempat berbohong dan mengatakan bahwaiamenginapdirumahsalahseorangteman

oleh maskapai swasta/asing maupun Garuda Indonesia. Adapun Terminal 2F digunakan untuk penerbangan domestik oleh Garuda Indonesia dan Merpati Nusantara Airlines (MNA). Menurut Faisal, Dahlan sempat kesal dengan kondisi toilet yang kotor tersebut. “Tidak ada gunanya petugas (bandara) jemput saya kalau lantai dan bandaranya jorok. Tidak perlu jemput saya,” ucap Faisal menirukan Dahlan. “Pak Dahlan mengulang beberapa kali perkataan tersebut,” imbuhnya. Faisal mengatakan, beberapa bulan lalu, Dahlan juga sempat marah di toilet Terminal 2F Bandara Soekarno-Hatta karena kondisinya kotor. Karena itu, begitu mendapati kondisi toilet yang masih kotor, Dahlan pun langsung turun tangan untuk membersihkannya sendiri. Sementara itu, Direktur Utama PT Angkasa Pura II Tri S Sunoko yang mengelola Bandara SoekarnoHatta mengatakan, pihaknya belum mendapat info terkait kondisi toilet bandara yang kotor. Menurut dia, kemungkinan ada beberapa bagian yang terlihat kotor karena padatnya penumpang pada musim arus balik Lebaran. “Nanti saya akan cek,” ujarnya. (owi)

Di ruang kelas I yang sekaligus kantor sekolah, awak media ini bertemu dengan Kepala SDN 177664 Sitanggor A Ompusunggu SPd. Kepada koran ini, ia menyebut jumlah murid di sekolah tersebut sebanyak 75 orang. Sedangkan tenaga pengajar terdapat enam orang berstatus PNS dan satu orang guru honor. Ditanya soal kondisi siswa di sekolah itu pasca tragedi pembunuhan sadis yang menewaskan BilsonSimaremare,danmenyebabkanayahmereka dipenjara, Ompusunggu sedikit menghela nafas. “Ahh…dang tarhatahon be sude lae (sulit untuk menjelaskansemualae),”ucapOmpusunggu. Ia menggambarkan, hampir semua siswa di sekolah itu kini serba hemat untuk kebutuhan

sekolah masing-masing. Mulai dari sepatu dan seragam sekolah yang diganti setelah koyak-koyak, hingga ke buku tulis. “Sepertinya mereka (murid, red) memang sudah diajari ibu mereka masingmasinguntukhiduphematkarenafaktorekonomi yang tambah sulit setelah bapak mereka dipenjara,” sambungnya. Dia menceritakan, pada awal peristiwa pembunuhan sadis dua tahun lalu, banyak murid di sekolah itu jarang masuk sekolah karena berbagai faktor. “Kalau awal kejadian dulu, banyak murid yang jarang masuk sekolah karena ikut stres dan faktor-faktor lainnya. Sehingga, kita selaku guru harus maklum dan berusaha ikut memulihkan mental mereka,” paparnya. Perihal hemat siswa yang diutarakan Ompusunggu, ternyata benar. Salahseorang murid yang

Supir Taksi Plat Hitam Diciduk

Sambungan Halaman 8 pelampiasan emosi di Polres Pematangsiantar. Penangkapan terjadi, Rabu (29/8) sekira pukul 15.00 WIB, persis di Jalan Bandung Kelurahan Proklamasi, Siantar Barat. Perhatian warga tertuju pada aksi R br S yang memeluk seorang pria, belakangan diketahui bernama Vijai (27), tak lain kekasihnya. Adegan bak sinetron itu malah sempat membuat empat orang personil Unit Jahtanras Polres Pematangsiantar kelimpungan. Pasalnya, R br S yang menetap di Jalan Pakis Kelurahan Kebun Sayur, Siantar Timur itu ternyata pelapor atas kasus penganiayaan yang dilakukan Vijai itu sendiri. Bahkan setibanya di ruang peyidik, R br S tetap ngotot kalau lelaki pujaannya itu tidak bersalah. Sedangkan pengaduannya itu dilakukan karena paksaan orangtuanya. “Bukan pacarku (Vijai) yang salah, mamakku itunya yang salah. Dipaksanya aku melapor,” ujar br S saat didekati wartawan. Siswi yang terdaftar di salah satu sekolah swasta Jalan Melanthon Siregar, Siantar Marihat itu mengaku bahwa peristiwa penganiayaan terjadi awal Agustus lalu, persis di Jalan Cipto Kota Siantar. Berawal ketika ia terlihat Vijai yang berprofesi sebagai supir taxi berplat hitam itu, sedang berduaan dengan pria. Karena ia tak mengaku, Vijai emosi dan langsung menampar, menumbuk hingga menendangnya. Bahkan aksi itu sempat dilerai warga hingga memanggil orangtua korban. “Dari situlah mamak (ibu) dan bapak memaksaku melapor polisi bang,” cetusnya lagi. Bahkan remaja yang mengaku sudah berulang-ulang disetubuhi Vijai ini, tak keberatan diperlakukan secara kasar. Ia mengaku, perlakuan itu berdasarkan kesalahannya sendiri, makanya ia tak rela Vijai meninggalkannya. Selain mengaku sudah sangat menyayangi Vijai, R br S bahkan memberitahu teman-temannya kalau Vijai itu suaminya. “Aku sudah istrinya, kalau nikahnya kan bisa menyusul,” cetusnya enteng tanpa merasa menyesal berpacaran dengan pria berkulit hitam keturunan Hindustan itu. Kepada polisi, Vijai membenarkan penganiayaan itu. Persoalan dipicu karena ia mengira kekasihnya itu telah berselingkuh. Bahkan hubungan asmaranya selama ini sudah diketahui orangtua korban. Ia juga sudah berencana menikahi R br S setelah remaja itu menammatkan sekolahnya. “Memang kupukul dia di depan orang banyak. Aku emosi bang, dia jalan sama pria lain,” aku Vijai singkat. Kasat Reskrim AKP Azharuddin menegaskan, pihaknya tetap menjerat Vijai dengan Undangundang perlindungan anak. Namun sejauh ini, baik korban maupun orangtuanya belum melaporkan kasus pencabulan yang dialami R br S. Begitupun pihaknya siap memproses tersangka. (Ndo/smg)

Kajari Minta Audit BPK ke Wartawan Sambungan Halaman 1 (Tarukim) dan Dinas Bina Marga dan Pengairan Kota Siantar. Uniknya, ia malah meminta hasil audit BPK tersebut pada wartawan. “Sampai sekarang kita belum ada menerima hasil audit dari BPK tentang dugaan proyek bermasalah di Dinas Tarukim, Dinas Bina Marga dan Pengairan untuk tahun 2011. Sepanjang datanya ada dan benar akurat, kita akan mempelajarinya. Ini datanya tidak ada dari mana mau kita pelajari,” kata Kajari Siantar Rudi H Pamenan, didampingi Kasi Intel Agus Salim Nasution, di ruang kerjanya, Rabu (29/8). Menurut dia, Kejaksaan Siantar belum ada menerima audit BPK tentang proyek yang dimaksudkan awak koran ini. “Dari mana kalian tahu ada proyek bermasalah yang jadi temuan BPK. Sama kita saja tidak ada dikasih. Kalau tidak minta hasil audit BPK yang kalian maksud biar kami pelajari,” paparya. Menurut dia, jika memang temuan itu benar ada, bisa jadi Kejagung menilai bahwa temuan itu bisa diteruskan. Prosedurnya jika ada temuan yakni dari pusat ke Kejatisu baru ke kejari. Selanjutnya dipelajari apakah memang benar ada

temuan yang dimaksud. “Kalau dulu memang jika ada temuan BPK RI bisa langsung ditindak lanjuti, tapi sekarang prosedurnya terserah dari BPK. Kita juga belum ada menerima berkas audit BPK itu,” tegasnya lagi. Sebelumnya, BPK RI menemukan 46 paket pengerjaan proyek yang dianggap bermasalah dan mengakibatkan kerugian Negara sebesar Rp4,7 miliar. Antara lain 9 paket di Dinas Tarukim dan Dinas Bina Marga dan Pengairan Kota Siantar. Informasi dihimpun, anggaran belanja modal pada dinas Tarukim Siantar tahun 2011 sebesar Rp16,687 miliar dengan realisasi 96,68 persen atau sebesar Rp16,133 miliar. Berdasarkan dokumen kontrak dan bukti pembayaran kepada rekanan, terdapat 9 paket pekerjaan senilai Rp8,927 miliar yang fisiknya belum selesai seluruhnya. Namun realisasi pembayaran kepada rekanan dilakukan sebesar nilai kontrak (sudah dibayar 100 persen). Untuk memuluskan pencairan dana dari Bank Sumut atau dari Dinas Pendapatan Pengelolahan Keuangan dan Aset Daerah (DPPKAD), Pejabat Pelaksana Teknis Kegiatan (PPTK) membuat berita acara kemajuan pelaksanaan pekerjaan bahwa prestasi pekerjaan dianggap sudah selesai 100 persen, untuk kemudian dilakukan pembayaran kepada rekanan. Untuk Dinas Tarukim,


„ R br S, mendatangi Polres Siantar pasca penangkapan kekasihnya Vijai, Rabu (29/8).

masih duduk di bangku kelas I Manahan Rajagukguk (6), tampak menyelipkan nasi di laci meja belajarnya. Manahan menyebut, ia selalu bawa nasi dari rumah agar tidak perlu jajan di sekolah. Sedangkan sejumlah murid lain yang duduk di bangkukelasIII,tampakmengenakansepatuyang sudah koyak-koyak dan baju sekolah yang sudah usang. Bahkan, buku tulis beberapa murid juga tampak koyak-koyak. “Seandainya dana BOS bisa digunakan untuk seragam sekolah, mungkin akan dapat terbantu. Tapi sesuai petunjuk teknis saat ini, dana BOS tidak dapat membeli seragam murid lagi. Paling kita melengkapi buku mata pelajaran saja dari dana BOS dan memperbaiki atau membeli mobiler sekolah dan kebutuhan sekolah lainnya,” imbuh Ompusunggu. Sementara itu, Ratna boru Tambunan (40), ibu

delapan anak istri dari terpidana Pasu Simaremare kepada METRO mengaku, harus mengajarkan pola hidup hemat kepada kedelapan anaknya. “Saya punya delapan anak, dua baru tamat tahun laludariSMA.Karenamemangpahitnyayangsaya alami terutama untuk mencari uang, terpaksa anak-anak saya ajari hidup sehemat mungkin,” ujar Ratna. Iamengaku,setiaphariharusbanguntidurpukul 05.00WIBuntukmembereskansarapanpagianakanaknyasebelumberangkatkesekolah.Karenasatu lagianaknyayangkinidudukdibangkuSMPharus berangkatkesekolahberjalankakisekitarlimakilometer.“Pukul07.00WIB,setelahanak-anaksemua berangkat sekolah. Saya dan tiga anak saya yang belumsekolahlangsungberangkatkeladangsambil membawa perbekalan nasi untuk makan siang.

persentase pekerjaan kesembilan proyek tersebut antara 70,35 persen sampai 90 persen, tetapi pembayaran sudah dibayar penuh. Padahal hak pembayaran yang seharusnya dilakukan adalah sebesar Rp7 miliar, tetapi faktanya Kadis Tarukim yangsaatitudijabatAdresTarigantelahmencairkan 100 persen yakni sebesar Rp8,927 miliar. Sehingga terdapat selisih anggaran sebesar Rp1,877 miliar yang menjadi kerugian negara. Sementara pada Dinas Bina Marga dan Pengairan yang dijabat Rufinus Simanjuntak, tahun 2011 mengelola anggaran belanja modal sebesar Rp22 miliar dengan realisasi sebesar Rp21,557 miliar atau 97,58 persen. Namun sebanyak 36 paket pekerjaan proyek menjadi temuan BPK RI karena proyek tersebut belum selesai dikerjakan tetapi sudah dibayar lunas. Berdasarkan dokumen kontrak dan bukti pembayaran kepada 36 rekanan senilai Rp4,517 miliar yang fisiknya belum selesai ditemukan kerugian Rp2,860 miliar. Sebab proyek keseluruhannya dibayar lunas, sementara fisiknya dikerjakan belum selesai antara 8,60 persen sampai 75 persen. Terakhir diketahui di Dinas Tarukim dan Dinas Bina Marga dan Pangairan ditemukan kerugian negara sekitar Rp4,7 miliar (Rp1,877 miliar tambah Rp2,860 miliar). (mua/dro)

Kalau untuk makan siang anak-anak sudah saya siapkan di rumah,” ungkap ibu yang suaminya dipenjara 15 tahun itu. Satu tahun lebih, Ratna mengarungi hidup seperti itu. Kini, dua anaknya yang sudah tamat SMA, terpaksa harus tinggal bersamanya untuk membantu mencari nafkah. “Tubuh saya sudah lelah, saya tidak kuat lagi bekerja keras. Makanya anak-anak tidak mau merantau. Mungkin mereka kasihanmelihatsaya,”paparibuberkulitputihdan bertubuh kurus yang masih menyusui putra paling bungsunya itu. Kerasnya perjuangan hidup yang dirasakan Ratna sama kerasnya dengan beban mental setelah suaminya dipenjara. Pasalnya, ia adalah satu dari 11 ibu lainnya yang melahirkan anak setelah suami mereka dipenjara. (Bersambung)




Supir Taksi Plat Hitam Diciduk


ANIAYA KEKASIH DI DEPAN UMUM SIANTAR- Walau sudah dianiaya di depan umum, R br S (18) tak rela pacarnya ditangkap. Dengan sekuat tenaga ia mempertahankan pria yang sudah merenggut kegadisannya itu. Ironinya, ibunya ikut menjadi

„) Baca Supir Taksi ..Hal 7

(Foto : Ikrar Lubis).

„ R br S (kiri), sebelum diperiksa penyidik di Polres Pematangsiantar terkait laporannya yang mengadukan Vijai.

Ayah Tiri Cabuli Bocah 5 Tahun

„ Bunga, didampingi keluarganya, memasuki Unit PPA Polres Siantar, Rabu (29/8).


SIANTAR- Bunga (18), siswi salah satu SMA swasta di Pamatang Raya, Kecamatan Raya, Simalungun, disetubuhi pacarnya JHS (18) di salah satu penginapan di Jalan Pdt J Wismar Saragih, Siantar Martoba, Selasa (28/8) malam. Akibatnya, pemuda warga Silaen, Pamatang Raya inipun meringkuk di sel tahanan Polres Pematangsiantar. „) Baca SISWI SMA ..Hal 7



Puluhan Warga Datangi Polsek Tiga Dolok


SIMALUNGUN- Bunga, bocah berusia lima tahun, dicabuli ayah tirinya Parulian Nainggolan (35), warga Aek Bottar Nagori Buntu Bayu, Kecamatan Hatonduan. Bunga

TIGA DOLOK- Puluhan warga Huta Silimapuluh Nagori Negeri Dolok, Kecamatan

SIMALUNGUN- Setelah menabrak Yamaha Vega R BK 4804 QM yang dikendarai Warsito Nasution (29) yang berboncengan dengan kekasihnya Sarima br Saragih (23), supir Toyota

„) Baca Ayah Tiri ...Hal 7

„) Baca Puluhan ...Hal 7

„) Baca Pengemudi..Hal 7

„ Parulian Nainggolan

Saya Tersiksa di Penjara Pak Hakim! PENGANIAYA TEMAN DITUNTUT 4 BULAN PENJARA SIMALUNGUN- Markus Saragih (58) warga Dusun Tanoh Tinggir Nagori Tanoh Tinggir, Kecamatan Purba, Simalungun, meminta keringanan hukuman setelah jaksa

„) Baca Saya ..Hal 7

Gadis Tewas Melepuh


„ Mobil Toyota Kijang BK 48 SS yang ditinggal supirnya setelah menabrak Warsito dan Sarima.

n SaSIBOLANGIT- Kediama Ginin Jam n Jala ), lam Sinuhaji (60 acam Ke n, wa gka Bin sa De ting ter g, dan Ser li tan Sibolangit, De bat Aki . lam ma /8) (28 asa bakar, Sel yang kejadian, anak gadisnya aji, uh Sin br a Rik , un tah berusia 20 . tewas melepuh dijilat api „) Baca Gadis ..Hal 7


30 Agustus 2012

Proyek Jalan Pangalbuan Pakai BBM Bersubsidi Amelia Yani Hengkang dari PPRN


PPRN - Pengurus PPRN Kabupaten Simalungun, Ir Toga Parhusip, Herman Maris dan pengurus lainnya.

SIMALUNGUN- Keabsahan kepengurusan Partai Peduli Rakyat Nasional (PPRN) di bawah pimpinan Rouchin sudah diakui oleh Gubsu Gatot Pujonugrho dalam

„ Baca PPRN Hal 10

Puluhan Juta Masuk Kantung Pribadi Dari Retribusi Masuk Parapat PARAPAT- Puluhan juta diduga menguap dan masuk kantung pribadi yang diperoleh dari uang retribusi gerbang masuk objek wisata Parapat, Kecamatan Girsang Sipangan Bolon, Simalungun. Pasalnya, uang yang diberikan pengunjung sebagai biaya retribusi sangat tinggi dan tidak disertai karcis. Informasi dihimpun METRO, Rabu (29/8), dalam sehari ada ratusan kendaraan roda dua dan roda empat yang masuk ke objek wisata Parapat melalui pintu gerbang ini. Mereka dikenakan biaya retribusi bervariatif, ada yang Rp25 ribu hingga Rp45 ribu, namun pembayaran tarif ini tidak disertai karcis retribusi. Para pengunjung juga mengaku keberatan kalau harus membayar segitu besar. Gabion Siahaan (43) dan Afandi Siregar (30), warga Kelurahan Parapat, Kecamatan Girsang Sipangan Bolon, yang

„ Baca Puluhan Hal 10


TEBANGPohon di depan kantor FKPPI, Jalan WR Supratman, Kelurahan Proklamasi, Siantar Barat, ditebang dan dijual oleh Dinas Tarukim.

Dinas Tarukim Tebang dan Jual Pohon di Tengah Kota SIANTAR- Dinas Tata Ruang dan Pemukiman (Tarukim) Pematangsiantar menebang pohon di Jalan WR Supratman, Kelu-

rahan Proklamasi, Siantar Barat, Rabu (29/ 8). Namun selanjutnya pohon besar itu dibawa ke sebuah panglong di Nagori

SIMALUNGUN- Pembukaan dan pengerasan Jalan Pangalbuan, Kecamatan Dolok Silau, Kabupaten Simalungun yang menelan dana lebih kurang Rp17 miliar yang dikerjakan perusahaan dari Kabupaten Karo, diketahui telah menggunakan BBM bersubsidi yang seharusnya menjadi hak masyarakat Simalungun.

Informasi tersebut diterima METRO dari karyawan yang mengerjakan proyek pembukaan jalan itu. Karyawan yang minta namanya dirahasiakan itu mengatakan, untuk aktivitas pembukaan jalan ini mempekerjakan 5 unit alat berat, yakni 3 beko dan 2 dozer. Untuk kebutuhan

„ Baca Proyek Hal 10

Usai Rapat Rencana Demo Hulman ke KPK dan Kejagung

Arsyad Siregar Diancam Bunuh SIANTAR- Arsyad Siregar, Penasehat Forum Solidaritas Wartawan LSM Siantar-Simalungun (FSWLSS) diancam dibunuh kalau terus mendemo Walikota Siantar Hulman Sitorus. Ancaman itu diterima Arsyad lewat pesan singkat (SMS) setelah pihaknya selesai melaksanakan rapat

rencana demo ke KPK dan Kejagung menuntut agar Hulman Sitorus ditangkap. “ Arsyad…Arsyad nanti kena tikam kau bingung. Kau tunggu saja dalam minggu ini apa yang bakalan terjadi samamu. Arsyad lebih

„ Baca Arsyad Hal 10


MEMAPARKAN: Pdt Putri Ida Saragih STh sedang memaparkan pentingnya menjaga kesehatan alat reproduksi di GKPS Bangun Tani, Minggu (25/8).

Ibu Sehat Keluarga Selamat Penyuluhan Reproduksi di Bangun Tani

DOLOK PARDAMEANPengetahuan tentang kesehatan termasuk masalah reproduksi sangat penting untuk diketahui pasangan suamiistri. Untuk kalangan perempuan, menjadi kewajiban untuk memahami menyangkut kesehatan reproduksi. Hal tersebut ditegaskan Pdt Putri Ida Saragih STh dalam

acara penyuluhan kesehatan alat reproduksi di GKPS Bangun Tani, Nagori Bangun Tani Kecamatan Dolok Pardamean, Minggu (25/8) lalu. Di hadapan 39 peserta, dimana 8 diantaranya laki-laki, Pdt Putri Ida Saragih mengatakan, anggota keluarga ditun-

„ Baca Ibu Sehat Hal 10

Plang Proyek Perbaikan Jalan Tapi yang Dibangun Parit SIDAMANIK- Sesuai plang bahwa terdapat proyek peningkatan jalan Sidamanik– Gorbus senilai Rp790.790.000. Dalam plang disebut tebal jalan tersebut berkisar 2 cm, dengan panjang 500 meter. Tapi belakangan yang dibangun di lokasi proyek justru drainase sepanjang 500 meter di Jalan Besar Sarimatondang,

Kecamatan Sidamanik, Simalungun yang dikerjakan oleh CV Simta. Amatan METRO, Selasa (28/ 8), pada plang proyek tersebut tertulis peningkatan jalan umum setebal 2 centimeter, dengan panjang lima ratus meter, proyek yang menelan

„ Baca Plang Hal 10


30 Agustus 2012

Puluhan Juta Masuk Kantung Pribadi Sambungan Halaman 9 juga bekerja sebagai tukang parkir di kawasan ini mengatakan, selama ini ada ratusan kendaraan roda dua dan empat yang masuk ke kawasan objek wisata Parapat ini setiap harinya. ”Sebenarnya sudah banyak sekali keuntungan yang diterima petugas pintu masuk objek wisata Parapat ini. Soalnya tarifnya sangat mahal sekali. Bahkan kami sendiri saja tidak sampai hati me-

masang tarif parkir yang mahal,” katanya sembari mengatakan dirinya hanya menetapkan tarif Rp1.000 untuk sekali parkir di sekitar kediamannya. Dia menjelaskan, selama ini diperkirakan kendaraan yang masuk ke objek wisata Parapat mencapai lima ratus kendaraan dalam sehari, sementara tarif retribusinya juga tidak terlihat jelas dan bervariatif, mulai Rp25 ribu hingga Rp45 ribu untuk sekali masuk. “Memang ada banyak oknum yang bermain di pintu masuk itu, soalnya tarifn-

ya tidak pernah jelas. Padahal selama ini paling sedikit 500 kendaraan masuk, apalgi hari libur, seperti hari minggu,” katanya. Sementara untuk hari libur, diperkirakan petugas jaga pintu Parapat akan meraup omzet sekitar Rp12.500.000 per hari, kemudian uang ini diduga disetorkan langsung ke Pemkab Simalungun oleh petugas jaga. Sementara pengunjung yang datang hanya diberikan sebuah stiker berwarna kuning berlapis merah oleh petugas ini. ”Pernah saya tanya kemana uang retribusi ini akan

disetorkan, terus petugas jaganya yang merupakan teman saya ini mengatakan kalau mereka menyetorkannya ke Pemkab Simalungun. Namun bagaimana Pemkab tahu berapa jumlahnya, soalnya tarifnya saja tidak jelas. Tindakan seperti ini tentunya termasuk tindak korupsi,” katanya. Terpisah, Kepala Dinas Pendapatan dan Pengelolaan Aset Daerah Simalungun Wilson Manihuruk yang dihubungi melalui selularnya justru mengaku selama ini dirinya sama sekali tidak mengetahui tarif retribusi

PPRN Tetap Satu, Tidak Terpecah Sambungan Halaman 9 pelantikan DPD PPRN kabupten/kota se Sumatera Utara yang dihadiri Ketua Umum DPP PPRN, Rouchim dan Sekjen Joller Sitorus beberapa waktu lalu. Dengan kondisi ini membuktikan PPRN dibawah kepemimpinnan Rouchim dan Sekjen Joller Sitorus diharapkanm Gubsu dapat membantu pemerintah melaksanakan pembangunan untuk mensejahterakan rakyat. PPRN sudah satu dan tidak terpecah seperti sebelumnya. Hal ini dikatakan Sekretaris DPD PPRN Simalungun Herman Maris Amd, Rabu (29/ 8), di kantornya Jalan Subur nomor 243, Kecamatan Tapian Dolok, Simalungun. Kata Herman, Amelia bukan lagi Ketua DPP PPRN seperti yang diucapkan belakangan ini. Karena sesuai keputusan

Dinas Tarukim Tebang dan Jual Pohon di Tengah Kota Sambungan Halaman 9 Siantar State, Kecamatan Siantar, dan diduga dijual kepada pihak panglong. Sebelumnya Dinas Tarukim juga sudah menebang tiga pokok pohon yang berada di sekitarnya sehingga tidak ada lagi pohon yang tersisa di pinggir jalan, tepatnya di depan kantor FKPPI. Sedangkan potonganpotongan kayu tersebut dibawa ke Siantar State untuk dijual. Supir coltdiesel yang membawa potongan kayu tersebut mengatakan, kayu tersebut dibawa ke Siantar State. “Kalau soal harganya aku kurang tahu. Tapi jenis kayu ini paling bisa digunakan untuk kayu bakar. Sebab jenis kayunya seperti kayu angina,” ujarnya. Sejumlah warga tampak berkumpul di sekitar lokasi saat penumbangan pohon besar tersebut dan arus lalu lintas sempat ditutup beberapa menit saat menumbangkan pohon. Amir, warga yang saat itu menyaksikan penebangan pohon tersebut mengatakan, tindakan Dinas Tarukim itu tidak jadi masalah kalau memang tujuannya memang baik. Namun ia mengharapkan pemerintah juga harus bisa membuat tata ruang penghijauan di Kota Siantar. “Jangan cuma ditebang saja, tapi menanam pohon tidak pernah,” katanya. Terpisah, Kabag Humas Pemko Siantar Daniel Siregar mengatakan, penebangan pohon tersebut dilakukan karena kondisi pohon sudah tua dan ranting-rantingnya sering patah ketika turun hujan. “Pohon itu dikhawatirkan akan tumbang, makanya dilakukan penebangan. Hal itu karena di sekitar lokasi sudah sering pohon tumbang akibat angin kencang,” jelasnya. (pra/ara)

Menkumham nomor M.HH-17.11.01 tahun 2011, pengurus PPRN yang sah adalah di bawah kepemimpinan H Rouchin dan Sekjen Joller Sitorus. Dia menegsakan, Amelia Yani sudah hengkang dari PPRN dan memilih pindah ke Partai Kedaulatan (PK) pimpinan Rizal Ramli. Alasannya, dia merasa terzolimi dan merasa tidak dianggap sebagai ketua DPP partai itu. Hengkangnya Amelia Yani ke PK dinyatakan Amelia dalam acara halal bihalal yang digelar Rizal Ramli di kediamannya di Jakarta Selatan, Senin (27/8) malam. Dalam pernyataannya yang disiarkan melalui sebuah media online, Amelia menyatakan kesiapannya bergabung dengan tokoh perubahan nasional DR Rizal Ramli mewujudkan agenda perubahan di Indonesia. Amelia beralasan kepindahannya ke Partai Kedaulatan pimpinan Rizal Ramli

karena selama ini dia dan rakyat telah terzoliman sehingga menginginkan perubahan. Amelia Yani juga merasa tidak dianggap sebagai Ketua PPRN. Surat yang dikirimkannya kepada Presiden dan DPR mengenai posisinya tidak juga direspon. “Setelah membaca pernyataan Amelia yang diterbitkan di sebuah media online itu, sebagai kader, pengurus PPRN ingin membesarkan partai, tetapi Amelia menyatakan hengkang dan akan bergabung dengan PK. Kami salut atas sikap Amelia yang secara legowo hengkang dari PPRN,” kata Herman. Lebih lanjut dia mengatakan, sebagai pengurus yang sah, Agustus lalu PPRN di bawah kepemimpinan H Rochin secara nasional sudah mendaftar ke KPU pusat dan mengembalikan formulir sebagai peserta Pemilu 2014. Ketua DPD PPRN Simalungun Ir Toga Parhusip menambahkan, dengan

adanya pernyataan Amelia itu, maka Kesbang Simalungun harusnya sudah bisa memilah mana yang benar dan tidak. Katanya, karena adanya oknum yang tak bertanggung jawab dan mengaku-ngaku sebagai pengurus DPD PPRN Simalungun, mengakibatkan proses PAW anggota DPRD Simalungun Tumpak Siregar SH yang telah diajukan (karena perbuatannya yang tidak loyal dan melanggar AD/ART partai) menjadi terhalang. Dia melanjutkan, surat PAW Tumpak serta mencabut tanda anggota dari DPP PPRN tanggal 9 Agustus 2012 merupakan penetapan DPP yang sah dan bukan kehendak DPD semata, dalam hal ini Ketua DPD Ir Toga Parhusip, Sekretaris Herman Maris. Lebih lanjut Parhusip meminta agar instansi terkait secepatnya memproses PAW Tumpak karena sebenarnya tidak ada aturan yang menghalanginya. (mer/ara)

Proyek Jalan Pangalbuan Pakai BBM Bersubsidi Sambungan Halaman 9 BBM kelima unit alat itu, dibutuhkan BBM jenis solar sekitar 20 ribu liter. “Ya lebih kurang 4 tangki kita butuhkan tiap minggu,” katanya sembari mengatakan 1 tangki berisi 5 ribu liter. Katanya, BBM tersebut hanya sebagian kecil dari BBM industri. “Ya hanya sekitar 6.000 liter BBM industri dari Medan,” katanya.

Ditanya siapa yang memasok BBM bersubsidi tersebut, karyawan itu mengatakan, yang memasok adalah orang yang punya pengaruh untuk pengamanan proyek. Menanggapi hal ini, Adil Saragih salah seorang pengurus LSM Simalungun Coruption Watch mengatakan, yang dilakukan perusahaan dari Tanah Karo itu adalah perampasan hak-hak masyarakat Simalungun. Katanya, mereka telah melakukan korupsi BBM industri yang bernilai

Rp7.000 per liter diganti jadi BBM bersubsidi yang harganya Rp4.500 per per liter. “Jadi kalau sampai sebanyak 14 ribu liter satu minggu, berapa hak orang Simalungun yang dirampas tiap minggu,” katanya. Adil saragih meminta agar perusahaan yang mengerjakan pembukaan jalan tersebut segera diperiksa. “Perusahaan itu harus segera diperiksa sebelum masalahnya semakin besar,” katanya. (SP/ara)

Arsyad Siregar Diancam Bunuh Sambungan Halaman 9 baik tak usah kau ganggu BK 1 W (Hulman Sitorus) daripada kau celaka ,”demikian pesan singkat yang diterima Arsyad, Rabu (29/8) sekira pukul 18.00 WIB. Arsyad Siregar mengatakan, sebelumnya mereka bersama pengurus FSWLSS sedang melakukan rapat rencana untuk demo kedua ke KPK dan Kejagung. Dua jam setelah rapat, dia mendapat SMS ancaman dari nomor 087749114xxx. Dalam pesan singkat itu, Arsyad diancam dibunuh kalau terus mendemo Hulman Sitorus. “Tanggal 7 September, FSWLSS kembali akan

mendemo kantor KPK dan Kejagung meminta Hulman supaya ditangkap atas kasus korupsi dengan tersangka mantan Kadispenda Setiawan Girsang dan bendaharanya Susilawati,” katanya. Selain itu pihaknya juga menyerahkan kepada KPK dan Kejagung apa-apa saja kerugian negara yang timbul pada masa jabatan Hulman Sitorus. Dan yang paling fatal adalah proyek fiktif yang dibayar lunas. Atas kebijakan Hulman Sitorus melalui surat edarannya, negara rugi sekitar Rp4,6 miliar khusus proyek fiktif tetapi dibayar lunas. Dan kebijakan Hulman Sitorus itu menjadi temuan kerugian negara oleh Badan Pemeriksan Keuangan (BPK).

“Dalam hasil audit BPK, proyek fiktif itu menjadi temuan kerugian negara. Itu artinya si pembuat kebijakan harus ditangkap untuk mempertanggungjawabkanperbuatannya.Kitasebagai masyarakat harus menyuarakan ini,” tegasnya. Meski mendapat SMS ancaman tersebut, Arsyad mengaku tidak takut. Pihaknya akan tetap terus melanjutkan aksi ke KPK dan Kejagung, dan Arsyad sendiri akan menjadi garda terdepan menyuarakan agar Hulman Sitorus ditangkap. “Nomor Hp yang mengirimkan pesan singkat itu sudah tidak aktif lagi. Kita tidak hiraukan ancaman itu. Demi masyarakat, kita siap menjadi garda terdepan,” tegas Arsyad diamani pengurus FSWLSS. (osi/ara)

Plang Proyek Perbaikan Jalan Tapi yang Dibangun Parit Sambungan Halaman 9 anggaran sebesar Rp790.790.000 ini bersumber dari Badan Keuangan Derah Pemkab Simalungun dan ditargetkan akan selesai sembilan puluh hari kerja. Parlindungan Siallagan (49), warga Jalan Sarimatondang, Kecamatan Sidamanik mengatakan, selama ini warga sekitar meminta pada Pemkab Simalungun agar melakukan perbaikan jalan umum di sekitar Sidamanik. ”Kami sebenarnya meminta supaya Pemkab Simalungun memperbaiki jalan kampung kami, soalnya sudah resak sekali,” kata Siallagan, yang ditemui

METRO di lokasi proyek. Kemudian, rekanan justru membangun saluran drainase yang berada di tepi jalan umum ini dengan alasan banyak drainase yang rusak dan tersumbat, sehingga jika hujan turun maka air akan meluap. ”Tadinya pernah juga kami tanyakan pada pegawai Dinas PU, kenapa justru parit yang dibangun. Lalu pegawai ini mengatakan selama ini jalan rusak karena banyak genangan air memenuhi badan jalan umum ini sehingga jalan mudah rusak,” katanya. P Simanungkalit (48), mandor lapangan proyek ini mengatakan, selama ini dirinya tidak mengetahui soal plang proyek ini sebab Dinas

PU Simalungun sebelumnya memasang plang tanpa ada koordinasi dengan dirinya. Sementaraberdasarkanperintahdaripimpinan perusahaan rekanan asal Tanah Karo ini, dirinya dan seluruh anggotanya diminta mengerjakan proyek drainase, bukan peningkatan badan jalan sebagaimanayangterteradiplangproyekini.”Kami hanya disuruh mengerjakan saluran drainase ini dankalaumemperbaikijalantidakadadisebutkan dalam pekerjaan kami ini,” katanya. Sementara Kepala Dinas PU Simalungun Jon Sabiden Purba yang hendak dikonfirmasi tidak berhasil dihubungi melalui telepon selularnya. (mag-02/ara)

masuk ke objek wisata Parapat. ”Memang saya sendiri juga belum tahu berapa sebenarnya tarif masuknya. Namun saya akan coba pertanyakan ini langsung ke petugasnya,” katanya. Dia menambahkan, selama ini pengutipan retribusi masuk ini ditangani oleh rekanan yang kemudian disetorkan ke Pemkab Simalungun. “Selama ini pengutipan ini diberikan pada rekanan. Namun kita juga belum tahu berapa tarifnya,” katanya singkat sembari menutup teleponnya. (mag-02/ara)

Ibu Sehat... Sambungan Halaman 9 tut untuk memiliki tubuh yang sehat, untuk mampu bersaing dan mensejahtera diri. “Zaman semakin hari semakin mendatangkan persaingan dan kompetisi tingkat tinggi, sehingga menjadi keharusan setiap orang untuk memiliki SDM dan tubuh yang sehat,” katanya. Dijelaskannya, dalam keluarga, peran Ibu sangat vital dan menentukan kesejahteraan keluarga. Reproduksi yang sehat akan menjamin Ibu tetap terawat tubuhnya, sehingga mampu merawat dan membesarkan anak-anak dalam keluarga. “Selain memiliki iman dan pendidikan, jemaat juga perlu memiliki kesehatan yang prima untuk mendukung pelayanan. Kesehatan menjadi mahal harganya, jika suatu saat terpaksa menjalani perawatan kesehatan di rumah sakit. Maka untuk menghindarinya, pencegahan dilakukan sejak dini,” katanya. Sementara Direktur Pelpem GKPS Ir Juniamer Purba ketika membuka penyuluhan, dalam sambutannya mengatakan, penyuluhan kesehatan kepada jemaat termasuk kesehatan reproduksi telah menjadi program dan dilaksanakan sejak tahun 2004. Sementara untuk tahun 2012, penyuluhan yang dilaksanakan di GKPS Bangun Tani merupakan yang ke-27 dari seluruh penyuluhan yang dilaksanakan di daerah kerja Pelpem GKPS. Sebanyak 932 orang telah menjadi peserta, dengan rincian 98 orang laki-laki dan 834 perempuan. “Kesehatan merupakan bagian dari hak azasi manusia dan diatur dalam undang-undang dan peraturan di Negara Kesatuan Republik Indonesia (NKRI). Seharusnya sarana pendukung kesehatan disediakan sampai ke desa-desa, termasuk sumber daya manusia terlatih,” katanya. Dijelaskannya, kesehatan alat reproduksi perempuan harus dijaga dengan teliti dengan melakukan pemeriksaan secara teratur baik dengan melibatkan tenaga kesehatan maupun pemeriksaan oleh diri sendiri. Pelpem GKPS melakukan kerjasama dengan petugas pengembangan kesehatan masyarakat Rumah Sakit Bethesda Seribudolok, Kecamatan Purba. Sementara untuk pemeriksaan yang melibatkan laboratorium, bekerjasama dengan Universitas Sumatera Utara. “Kesimpulannya, kesehatan sangat mahal harganya. Maka kesehatan harus dijaga, terutama untuk kesehatan Ibu yang menjadi penopang kebahagiaan keluarga,” katanya. Sementara Koordinator Program Pengembangan SDM Pelpem GKPS Herman Sipayung mengatakan, masih banyak tidak mengenal dan belum pernah menikmati pelayanan jaminan pelayanan sosial dan kurang memahami apa itu alat reproduksi serta jenis penyakit yang mungkin akan diderita bahkan sampai telah memasuki tingkat akut. “Mengenaai kesehatan Ibu dan Anak, kami telah diskusikan langsung dengan stakeholder yakni Pemkab Simalungun yang menjadi penanggungjawab Millenium Development Goal (MDGs) 2015. Tetapi belum ada tindak lanjutnya,” katanya. (esa)



30 Agustus 2012

Harga Karet Petani Turun Rp5 Ribu per Kg MEDAN – Petani karet di Sumatera Utara menjerit, pasalnya harga karet mereka jual kepada agen Rp5.000Rp6.000 per kg, padahal sebelumnya paling murah Rp10.000 per kg. “Harga getah sudah di bawah harga beras.Ini sudah di bawah kelaziman dimana biasanya paling murah harga karet setara satu kg beras.Petani sangat bingung dan resah,” kata petani karet di Labuhan Batu, K.Siregar, di Medan, Senin. Dengan harga itu, sebagian petani sudah mulai malas menderes getahnya. “Buat apa menderes kalau harganya murah kali.Biar sajalah apa saja dijual dulu untuk biaya hidup,”katanya. Di tengah tidak melakukan penderesan, petani memilih pergi ke Medan untuk mencari objekan seperti menjadi tukang bangunan atau narik becak. “Maunya pemerintah membeli getah petani dengan harga normal seperti yang dilakukan pemerintah Malaysia dan Thailand seperti yang kami baca di TV (televisi),” katanya. Pedagang karet di Sumut, M .Harahap, mengakui harga getah karet di petani paling mahal tinggal Rp7.000 per kg karena harga jual bahan olah karet (bokar) di pabrikan paling tinggi juga tinggal Rp21ribuan per kg. Harga getah di petani rata-rata 30 persen dari harga Bokar. “Masih lumayan harga getah

„ Petani turun.

di petani Sumut tinggal Rp5 ribuan, dan daerah lainnya di Sumatera sudah lebih rendah,”katanya. Menurut dia, bukan hanya petani yang susah, tetapi juga pedagang.“Bayangkan, pedagang sebelumnya sudah mengambil getah dengan harga di atas Rp7.000 an per kg, eh taunya harga jual ke pabrikan turun,”katanya. Meski merugi, tetapi pedagang berupaya tetap membeli getah petani untuk menjaga kelangsung kerja sama atau hubungan baik selama ini. “Jangan sampai petani marah lalu tidak mau menjual getah ke saya,”katanya. Sekretaris Eksekutif Gabungan Perusahaan Karet Indonesia (Gapkindo) Sumut, Edy Irwansyah, menyebutkan, belum ada keputusan baru setelah sebelumnya Indonesia, Thailand dan Malaysia sepakat untuk mengurangi ekspor 300.000 ton karena harga ekspor karet sudah jauh di bawah 3 dolar AS per kg. Menurut rencana, akan ada pertemuan lagi di Indonesia bulan ini juga untuk membahas kepastian jadwal dan kuota pengurangan ekspor karet untuk masing-masing negara, katanya. Harga ekspr karet SIR 20, di penutupan bursa Singapura pada 23 Agustus, memang tinggal 2,568 dolar AS per kg sehingga bokar di pabrikan juga menjadi hanya Rp19.700Rp21.700 per kg. (ant/nik)

sedang menyadap karet. Sayangnya harga karet

Oktober, Harga Suzuki Ertiga Naik 2 Juta JAKARTA - PT Suzuki Indomobil Sales (SIS) berencana menaikan harga MPV baru andalannya, Ertiga, pada awal Oktober mendatang. Harga mobil tujuh penumpang ini akan naik Rp2 juta. “Ertiga harganya kompetitif secara nasional. Semua diler di seluruh penjuru Indonesia kami kontrol, jadi tidak bisa seenaknya naikkan harga. Kenaikan akan ada pada Oktober mendatang,” terang Endro Nugroho, Direktur Marketing SIS di diler Suzuki ’Sumber Baru Aneka Mobil’ (SBAM), Jalan Raya Fatmawati. Seiring dengan adanya rencana kenaikan ini Suzuki menegaskan tidak ada kekhawatiran akan ditinggalkan konsumen, yang berpengaruh terhadap penurunan penjualan Ertiga. Menurut Suzuki, kenaikan memang sudah dihitung secara menyeluruh. “Rasanya penjualan tidak akan menurun. Malah

akan semakin naik, pasar roda empat Indonesia saat ini sedang baika.” timpal Davy Tuilan, Direktur Penjualan Suzuki SIS di tempat yang sama. Davy mencontohkan, dulu Suzuki Mega Carry dijual dengan harga awal Rp84 juta. Sekarang Mega Carry dilepas Rp93,8 jutaan, tapi permintaannya Mega Carry terus bertambah pertahunnya. Saat ini Suzuki Ertiga dilepas dengan harga Rp143 untuk tipe Etiga GA atau versi terendah, tipe GL Rp153 jutaan dan versi tertingginya atau GX dibanderol Rp165 jutaan. Bila sudah mendapat harga baru, Ertiga GA akan dilepas Rp145 juta, GL Rp155 juta dan Ertiga GX akan memiliki harga Rp167 juta. (oz/nik)

Aksesori Lucu Sambut Tablet Sony Xperia S Sony diam-diam sedang membangun tablet generasi terbaru yang menggunakan nama Xperia, sebuah merek dagang yang sebelumnya digunakan oleh unit bisnis smartphone. Tablet terbaru Sony ini kabarnya akan diberi nama Xperia S. Tablet ini mengusung desain yang lebih tipis jika dibandingkan tablet Sony

sebelumnya. Ia diperkuat dengan prosesor quad core Tegra 3 dari Nvidia, RAM 1GB dan layar berukuran 9,4 inci. Berdasarkan informasi yang diperoleh blog teknologi BGR, Sony akan membekali Xperia S dengan beragam aksesori. Yang paling bermanfaat, adalah aksesori penutup tablet yang juga berfungsi sebagai papan ketik (keyboard). Aksesori penutup ini bisa dilipat untuk menopang tablet agar berada dalam posisi tegak. (kps/nik)

„ Tablet Sony Xperia S

LOWONGAN KERJA CV HARIRI Sebuah Perusahaan yang sedang berkembang, bergerak di bidang Jasa Design, Advertising dan Event Organizer membutuhkan tenaga kerja untuk mengisi posisi sebagai.

1. Manager (1 orang) 2. Desain (2 orang) 3. Marketing (2 orang) 4. Admin (2 orang) Syarat sebagai berikut 1. Pria dan wanita 2. Menguasai Corel Draw, Adobe Pagemaker, Pothosop, Auto Cad ( khusus untuk desainer) 3. Minimal tamatan D3 4. Melampirkan foto copy ijazah 5. Lamaran kerja dan curriculum vitae 6. Melampirkan Pas foto uk. 3 x 4 ( 2 lembar) 7. Pengalaman kerja di utamakan Lamaran diantar langsung ke : CV HARIRI, Jl. Asahan Komp. Griya NO.17 P. Siantar Telp. 0622 - 7553163.


Telah hilang BPKB mobil dengan nopol BK 1306 HD An. Trimasari Lubis. Tercecer sekitar Perguruan Taman Siswa Cabang Pematangsiantar Jl. Kartini. Hilang sekitar bulan Juli 2012 Bagi yang menemukan harap dikembalikan kepada Arif Syukri Nasution GP 0813 6107 7515. Tidak dituntut tapi diberikan imbalan yang sepantasnya.

LOWONGAN KERJA PT Guna Indah Makmur yang bergerak dalam bidang Consultan Teknik dan SDM yang sudah memiliki 76 Kantor cabang di Indonesia membutuhkan tenaga kerja (SDM) untuk ditempatkan pada posisi: 40 orang teknisi Income Rp 500 rb/mgg 18 orang SPV Income Rp 500 rb/mgg 3 orang ADM Income Rp 900 rb/bln 2 orang Ast. Mgr Income Rp 1.5 jt/mgg 5 orang Ast. Eng Income Rp 500 rb/mgg 15 orang surveyor Income Rp 400 rb/mgg 3 orang Mgr Income Rp 2 jt/mgg Kualifikasi: Pria/wanita max. 32 tahun, pendidikan SMU/SMK sederajat, DI, DIII, S1 semua jurusan, pengalaman tidak diutamakan, ada basic training, leadership dan management training segera bawa lamaran lengkap dan pakaian rapi mulai jam 10.00 s.d 15.00 WIB ke: Jl. Asahan KM 3.5 Komp. Griya Siantar No. A3 Siantar Estate depan Kantor Bulog


KAMIS 30 Agustus 2012




Jl. Jawa (Simpang Mayat) Pematangsiantar

HP 0852 7020 6105

Harga Mulai

Rp 15 Jt Mengadakan Segala Jenis Sparepart Depot Air Minum

Ayo Buruan......................

Peluang Usaha • Depot Air Minum • RO & Mineral • Air Minum Dalam Kemasan (AMDK)

Optik BUKA MATA Jl. Merdeka No. 200 P. Siantar Telp. 0622 - 7143999

• Gratis periksa mata dengan Komputer sistim • Gratis servis kaca mata • Menerima resep Dokter mata • Frame + lensa dimulai dari harga Rp 200 rb-an • Kenyamanan kaca mata kita beri garansi • Pesanan kaca mata dapat diselesaikan dalam waktu 10 menit • Softlens center • Sunglasses • Frame • Lensa Bawa potongan iklan ini untuk dapatkan Diskon

Telah Hadir di

Kota P. Siantar










Jl. Merdeka No.188 P. Siantar (Depan Showroom Honda)

• HP Baru layar warna Rp 150 rb • HP China Rp 159 rb • BB 8520 Rp 1.499 rb


h& Casedit r K

TERIMA PESANAN SIAP ANTAR Hub. Ibu Sriningsing HP 0852 9673 4769



A. Untuk Refleksi dan Massage B. Umur 30-45 tahun (pria/wanita) C. Berpenampilan rapi, menarik, sopan, jujur dan rajin D. Pengalaman tidak diutamakn E. Mengikuti peraturan dan perintah dengan baik Kirim surat lamaran, photocopy KTP, daftar riwayat hidup dan pasphoto anda ke: RAJA OUKOP, Jl. Merdeka No. 118 P. Siantar. Telp. 0823 6765 9999; 0622 - 432993 (Tidak Melayani SMS)

KPM Nokia 1280 Rp. 195.000

Nokia X1-01 Rp. 380.000 + MMC 2 Gb

Nokia X2-02 Rp. 705.000 + MMC 2 Gb

Nokia C1-01 Rp. 485.000 + MMC 2 Gb

Nokia C2-03 Rp. 820.000 + MMC 2 Gb

Nokia X2-01 Rp. 685.000 + MMC 2 Gb

Nokia N100 Rp. 240.000

Nokia X2.00 Rp. 890.000 + MMC 2 Gb

Nokia N101 Rp. 325.000 + MMC 2 Gb

lus aP a u n Sem erda si P an Gar Coy al ion s a N

Jaya Ponsel

Jl. Persatuan No. 58 Parluasan (Samping Loket Karya Agung)

Promor Idul Fitri HP baru layar warna Rp 149.900 HP Cina Rp 169.000

(Blutooh, suara besar, Mp3, Camera, 2 SIM)

HP 0821 6488 0068



Telah tercecer 3 (tiga) asli surat-surat sbb: 1. Surat sawah daftar nomor 193 Ptl. No.VI/41 tahun 1996 An. Rafles Siregar 2. Surat bea air tanah An. Rafles Siregar 3. Surat perjanjian jual beli tanggal 01 Juni 1980 dari Rafles Siregar kepada Brahim Simatupang. Tercecer pada bulan Juli 2012 di sekitr Jl. Melanthon Siregar P. Siantar Tidak dituntut tapi diberikan imbalan yang sepantasnya.


Dibutuhkan wanita tamatan SD, SMP, SMA sederajat, Akper untuk di didik dan di pekerjakan menjadi: • Baby Sister • KakakAsuh • Perawat Jompo

Gaji Rp 700 rb s.d 1.300 rb / bulan bersih

Hubungi: YAYASAN MUTIARA HATI Jl. Binjai KM 10.8 Komp. Villa Mulia Mas Blok A 1/3 Medan Telp. 061 - 76220497; 0813 7707 4679

PT Wesly Tour & Travel Melayani Penjualan Tiket Pesawat dan Tiket Kapal Laut

Paket Holyland : Ziarah Tour 11 Hari 27 Agts, USD 2450 12, 20 Agts, USD 3150 3, 10 Sept, USD 2450 18, 15, 22 Oktbr, USD 2450 6, 19, 26 Nov, USD 2450

3 Des, USD 2550 20, 21 Des, USD 2850 21 Des, USD 3100 25 Des, USD 3100

Harga & tgl sewaktu2 dapat berubah Jl. Kesatria No. 18 BDB Simp. Lor. 21 P. Siantar HP 0813 7007 5873; 0813 6200 9333


Obat kuat terbaru saat ini paten, membuat ereksi lebih lama, tanpa efek samping isi 10 tablet tanpa bekas


Terobosan terbaru obat VIMAX menambah ukuran alat vitl secara permanent sekaligus menambah kejantanan pria, isi 30 capsule

PUSAT PELANGSING HERBAL PELANGSING SUPER CEPAT Cukup 1 pak Fatloss langsung terbukti turun berat badan 8 - 12 Kg dalam jangka 1 Minggu, 100& alami dan tanpa efek samping, dijamin CREAM PYDR + VACUUM 100% original import 1 kali pakar langsung terbukti besar, kencang, padat dan mengembalikan payudara, baik gadis atau ibu-ibu dijamin PENINGGI BADAN SUPER


BESAR & KERAS SinShe Aciu / Aling BLAK MAMBA Oil




Spontan kuat keras dan tahan lama 3 X lebih kuat dari obat kuat lainnya, aman di konsumsi tanpa efek samping

Melayani pengobatan

Telah tercecer STNK Honda Supra X An. Rinto Walman Nainggolan, STNK Honda Supra Fit An. Ahmad, SIM dan kartu ATM An. Anju M Sirait (Pak Naomi), alamat Jl. Tangki Lorong XX Gg. Marasi.

Full Body Refleksi Khaki Terapi Lilin Kop / Bekam

Tercecer sekitar Jl. Merdeka Parluasan Lor. 20, pada tanggal 26 Agustus 2012.

Buka : Jam 09.00 - 21.00 WIB NB:Lagi membutuhkan beberapa anggota di peter refleksi yang berpengalaman di Bidang Refleksi

Bagi yang menemukan hub: HP 0813 9634 9739

Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0813 6017 0199; 0852 7695 4557


Sekali semprot ampuh tambah gairah seks pria tanah lama, tanpa menimbulkan rasa kebas, panas, aman dan tanpa TERSEDIA: •Gemuk Badan •Obat Jerawat •Pemerah Bibir •Pembesar Pantat •Sedia aneka kondom antik r efek samping a Ant IS !Melayani pesanan luar kota dan kebutuhan sex P/W dewasa AT Via Transfer - Paket Kilat GR PIN BB 295597B6 Capsul USAtelah dan terbukti meninggikan badan dengan cepat, memperkuat daya ingat, 1-2 minggu bertambah tinggi 5 - 8 CM pasti (semua umur)

ASEN HP 0852 7558 7299 HERBAL


Peter Refleksi

Jl. Tanah Jawa No. 83 (depan ruko baru, Simp Jl Cokro) ) P. Siantar Jl. Cokro No. 349 Simp. Malik Kisaran Jl. Sirandorung NO, 63 Simp. Jl. Pardamean Rantau Prapat

JASA TEKNIK REALTY Ahlinya JUAL SEWA BELI Properti Lahan - Rumah - Ruko - Gudang

Alamat kantor

Jl. Melanthon Siregar No. 44 P. Siantar Telp. 0622 - 430946; HP 0821 6336 6709 Aman, Cepat & Terpercaya

Tidak dituntut tapi diberikan imbalan yang sepantasnya.


0852 7551 8062 Khusus Pematangsiantar sekitarnya

LOWONGAN KERJA 1. Driver 2. Resepsionis

3. Cleaning Servis 4. Security

Dengan syarat: • Pria (1, 4) / wanita (2, 3) • Penampilan menarik (1- 4) • Min. tamatan SMAsederajat (1-4) • Jujur, tekun dan bertanggung jawab (1-4) • Memiliki minimal SIMA(1) • Diutamakan lulusan SMK perhotelan (2, 3) • Mampu mengoperasikan komputer (2, 3) Lamaran langsung diantar ke:

Hotel Sing A Song Jl. Asahan No. 02 KM 2,5 PEMATANGSIANTAR


30 Agustus 2012


ejak berpisah dengan Ahmad Dhani, Maia Estianty kini belum mendapat pasangan baru. Pendiri Duo Ratu tersebut sepertinya sudah pasrah tidak mendapatkan jodoh. ”Sama seperti anak-anak aku enggak pernah mengharapkan mereka dateng,

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober) Peruntungan: Keruwetan mulai teratasi namun mungkin akan muncul yang baru, untuk itu jangan mudah percaya dengan omongan orang. Berjalanlah dengan prinsip Anda sendiri dan hiduplah yang sederhana. Asmara: Hadapilah tantangan kecil dengan hati yang besar dan lapang dada, jangan cepat menyerah.


udah pasrah,” kata Maia saat ditemui di Episentrum Kuningan Jakarta Selatan, Selasa (28/8) malam. Maia menyatakan kini dirinya tidak terlalu agresif untuk menjadi jodoh. Ia menyatakan, dirinya tidak pernah mencari jodoh. ”Anak-anak begitu udah enggak saya harapkan tiba-tiba datang.

Sama seperti jodoh saya enggak perlu cari nanti datang sendiri lah,” jelas Maia. Maia mengaku bahwa dirinya banyak didekatin cowok. “Yang deket banyak, tapi untuk jadi pasangan belum lah, saya belum mikirkan pasangan,” kata ungkapnya.(abu/ jpnn)

PERJALANAN asmara Pinkan Mambo penuh liku. Hubungannya bersama Febriyanto Wijaya, pemain sepak bola asal Mamuju, Sulawesi Selatan, telah kandas. Ia pun harus menerima kenyataan pahit itu karena terbentur perbedaan. “Aku sudah putus ya. Sekitar dua bulanan lalu. Ya begitulah, memang enggak mudah mencari orang yang benar-benar. Intinya banyak perbedaan,” ucapnya, saat ditemui di Studio Guet, Perdatam, Pancoran, Jakarta Selatan. Hubungan Pinkan dan Febriyanto sudah tak bisa lagi diselamatkan. Keduanya sulit menyatukan visi ke depan. Masing-masing punya tujuan berbeda. Sehingga, keputusan untuk berpisah merupakan jalan keluar satu-satunya. Harapannya untuk membina rumahtangga buyar. “Misalnya, gol aku ke mana, dia ke mana. Jadi,

enggak ketemu. Aku enggak bisa menjelaskan ke media. Tapi aku tentu punya pertimbangan. Aku tahu mana yang baik dan tidak. Tapi aku enggak bilang kalau dia enggak baik ya,” ucapnya. Kesedihan pun meliputinya. Namun, ia tidak mau terlalu lama larut dalam perasaan tersebut. Baginya, pengalaman asmaranya bersama Febriyanto membuatnya banyak belajar untuk menata kembali kehidupannya di masa depan. Sebagai manusia, penyanyi kelahiran Jakarta, 11 November 1980 itu, hanya bisa berencana, tetapi Tuhan punya kehendaknya sendiri. “Aku tambah belajar dari pengalaman. Aku memutuskan dengan kekuatan aku sebagai manusia. Ketika aku sudah tahu mana yang baik dan enggak, kembalikan lagi kepada Tuhan. Kalau jodoh enggak ke mana-mana,” tandasnya. (tr/int)

(21 Desember -19 Januari)

Kesempatan untuk menanjak ke atas semakin terbuka, tinggal tergantung bagaimana cara Anda bersosialisasi dengan rekan-rekan kerja sehingga tidak muncul permusuhan yang akhirnya hanya akan menghambat laju karir Anda saja. Asmara: Cekcok mulut tak akan menyelesaikan masalah, justru akan semakin memperumit saja.


(20 Januari - 18 Februari)

Peruntungan: Emosi yang labil hendaknya bisa diberi perhatian serius. Jangan sampai kesuksesan yang telah berada di depan mata hilang begitu saja hanya karena sikap Anda yang kurang bisa sabar dalam menghadapi berbagai macam omongan yang memanaskan hati. Asmara: Carilah jalan keluar dalam menghadapi masalah cinta yang memang sedang Anda hadapi ini.


19 Februari - 20 Maret

Peruntungan: Egoisme dan rendah diri itu tidak ada untungnya, untuk itu alangkah baiknya disisihkan saja. Kalau dibiarkan berjalan terus yang rugi bukan orang lain tetapi diri Anda sendiri. Asmara: Untuk lebih baiknya cinta memang tidak lantas tutup mata dan telinga, saran masuk mesti diterima dengan baik.


(21 Maret - 20 April)

Peruntungan: Isu di hari ini sangat merugikan padahal kebenarannya sudah jelas disangsikan. Semua itu hadapilah dengan hati yang lapang dan kepala dingin. Anggaplah semua ini merupakan ujian untuk meraih jenjang yang lebih tinggi. Asmara: Hindarilah pertikaian yang hanya akan memperburuk suasana dan ketenangan saja.


(21 April - 20 Mei)

Peruntungan: Di hari ini perjalanan perbintangan Anda cukup bagus, walau banyak persoalan timbul tenggelam, namun semuanya bisa teratasi dengan baik. Tetaplah optimis, apalagi simpati orang lain terhadap Anda cukup besar sehingga Anda harus bisa lebih percaya diri dan yakin dengan apa yang telah menjadi keputusan Anda. Asmara: Anda harus puas dengan apa yang selama ini dia berikan pada diri Anda.


(21 Mei - 20 Juni)

Peruntungan: Berhati-hatilah dalam melangkah sebab jika Anda salah dalam melangkahkan kaki maka bisa berakibat fatal. Bintang Anda cukup bersinar terang hanya saja ada ombak yang datang menghantam Anda, jika hati-hati maka Anda akan selamat. Asmara: Anda sedang mengalami gelombang pasang yang hebat. Cobalah Anda mengerti dengan sikap yang Anda lakukan dengan memberi kepercayaan tanpa perlu mendiktenya, seperti yang selama ini Anda lakukan.


NIKITA Mirzani senang dicaci maki masyarakat karena sering berpose vulgar. Baginya, hujatan tersebut malah memotivasi untuk berpose lebih menantang lagi. ”Niki nggak merasa terganggu dengan banyak orang komplain. Malah senang, malah jadi motivasi Niki untuk menjadi lebih untuk mempunyai foto yang bagus lagi dari foto yang lalu,” ungkap Nikita di Tebet, Jakarta Selatan. Menurut janda beranak satu ini, selama terjun ke dunia hiburan, ia tak pernah foto-foto yang berbau pornografi. ”Jadi nggak ada joroknya atau pornografinya. Karena di situ nggak ada angel foto yang mengangkang atau apa segala macam,” tegasnya. ”Foto Niki nggak ada yang hot. Mungkin lihatnya di sebelah kompor atau orang yang nabun api,” imbuhnya dalam nada canda. (idc/int)

(21 Juni- 20 Juli)

Peruntungan: Pengaruh serta kewibawaan Anda sangat menentukan bagi keadaan sekitar. Hindari rasa kurang percaya diri sebab pada hakikatnya hal ini hanya akan merugikan saja. Jangan terpancing dengan omongan-omongan, semua itu hanya akan menghalangi langkah Anda ke depan. Asmara: Bersikaplah terbuka dengan pasangan Anda sehingga bisa terhindarkan dari segala fitnah dan omongan yang tidak benar.


(21 Juli-21 Agustus)

Peruntungan: Lakukan terobosanterobosan penting di hari ini karena memang sudah waktunya dan cukup ada peluang untuk maju. Bintang Anda lagi bagus dan cukup membawa kemujuran. Karir: Cukup banyak halangan yang harus dihindari, bersabarlah. Asmara: Dengarkan saja setiap kata-katanya agar tidak selalu timbul cekcok mulut.


(23 Agustus-22 September)

. eruntungan: Jangan ragu untuk menolak P kalau itu memang tidak sesuai dengan hati Anda. Buat apa Anda pertahankan kalau akhirnya di kemudian hari hanya akan membikin pusing Anda saja? Asmara: Jangan malas untuk bertemu dengannya, minimal menelponnya jika memang tidak ada waktu.


(23 Oktober - 22 November)

Peruntungan: Inisiatif dan ide-ide cemerlang Anda tampaknya sangat diperlukan dalam setiap langkah. Walau begitu konsultasi dengan pihakpihak yang lebih berpengalaman tampaknya perlu juga. Asmara: Jangan begitu mudahnya termakan isu yang sengaja disebar olehnya.


( 23 November - 20 Desember)

Peruntungan: Jangan suka menunda pekerjaan karena bila menumpuk akan menimbulkan kebosanan. Di hari ini cobalah bekerja sepraktis mungkin sehingga kejenuhan yang sudah di ambang batas itu tidak sampai menambah pusing. Asmara: Hati boleh panas akan tetapi pikiran harus tetap dingin, dengan begitu walaupun amarah memuncak hubungan percintaan Anda tetap aman-aman saja. (int)

EMMA Stone hancur saat patah hati. Wah, karena ulah Andrew Garfield kah? Mengutip femalefirst, aktris Easy A yang saat ini masih berkencan aktor Inggris, Andrew Garfiel merasa hancur saat harus berurusan dengan retaknya hubungan kekasih. “Saya merangkak di lantai dan muntah. Saya merasa hancur dan terbunuh, namun tetap

harus menjalani hidup,” terang Emma. Emma yang saat ini tak bermasalah Andrew, justru mengaku merasa dekat dengan aktor Ryan Gosling, lawan mainnya dalam Crazy, Stupid, Love “Saya merasa nyaman, mungkin karena apa yang dipikirkannya, sama seperti apa yang saya pikirkan,” tutur Emma. (int)

Selena Gomez membeli rumah seharga US$2,9 juta atau Rp27,55 miliar di Jonah Hill di Los Angeles. Seperti dikutip Femelfirs, rumah dengan luas 4.650 kaki persegi itu memiliki lima kamar tidur, enam kamar mandi, kolam renang, lapangan tennis dan spa. Meski rumah itu dibeli dari uangnya sendiri, namun bukan berarti kekasihnya, justin Bieber, bisa seenaknya tinggal di rumah tersebut. ”Aku bahagia dengannya. Tapi aku baru 20, dan belum berani serius dalam kehidupan pribadi. Aku bersyukur memiliki teman dan tim solid yang mencintaiku,” kata Selena. ”Pernikahan dan semua hal lain aku pikir akan terjadi setelah aku merasa telah mencapai dalam setiap aspek lain dari kehidupanku,” katanya. (idc/int)



30 Agustus 2012 METRO SIANTAR

Evander Holyfield

Simalungun Minim Turnamen Sepakbola Bermutu

Pamer Kaos Bergambar

TATO TYSON EVANDERHolyfield dan Mike Tyson boleh jadi pernah terlibat pertarungan paling kontroversial dalam sejarah tinju profesional. Namun setelah gantung sarung tinju, keduanya justru saling membantu dalam mempromosikan produk yang mereka pasarkan. Tyson membuat geger dunia tinju profesional pada saat menjalanitarungulangmelawan Holyfield, 28 Juni 1997. Setelah kalah TKO di pertarungan sebelumnya, Tyson justru berbuat konyol di partai rematch. Saat memasuki ronde ketiga, Si Leher Beton tanpa terduga menggigit telinga Holyfield. Wasit langsung menghentikan laga. Tyson kemudian didiskualifikasi. Malam harinya, kerusuhan juga pecah di areal kasino yang ada di MGM Arena —lokasi pertarungan keduanya. Tyson beralasan bahwa tindakannyamerupakanbalasan atas tandukan yang dilakukan Holyfield selama pertarungan. Akibat aksi ini, Tyson dihukum denda sebesar US$ 3 juta. Selain itu, Komisi Tinju Nevada mencabut lisensi pertandingannya.

Namun dua hari setelah pertandingan, Tyson meminta maaf dan memohon lisensinya tidak dicabut. Permintaan ini akhirnya dikabulkan pada 9 Juli 1997. Pada acara The Oprah Show pada 2009 lalu, Tyson kembali meminta maaf kepada Holyfield. Setelah itu ketegangan di antara keduanya terus mencair. Bahkan belakangan, Tyson dan Holyfield menjadikan momen kontroversial tersebut sebagai bahan untuk bercanda di dunia maya. Belum lama ini, Holyfield mengunggah foto dirinya mengenakan T-Shirt bergambar tato milik Tyson pada akun twitter miliknya. Di bawahnya, Holyfiedl menuliskan “Mike Tyson mengigit telinga saya dan semua yang saya dapat hanyalah t-shirt yang buruk ini.” T-Shirt tersebut merupakan bagian Mike Tyson Collection yang saat ini sedang dipasarkan oleh Tyson. Sebelumnya Tyson juga membantu Holyfield memasarkan saus Real Deal Barbecue yang diproduksi mantan juara dunia tinju kelas berat itu. (int)

tuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515 1742 DIBUTUHKAN SEGERA: Tenaga kerja wanita usia 17-40 Tahun dengan posisi sbb:Baby Sister,Perawat jompo/Pribadi, PRT, syarat fc.ijazah, KTP, KK, gaji bersih 700rb s.d 1.500rb/bulan + bonus + THR, makan, asrama, dijemput loket, gratis. hub YYS Marel Mandiri. Jl.Cengkeh Raya No 18.C Medan HP 0813 6199 9211: 0878 6968 7879.

MNC GRUP: Mencari mitra bisnis yang berpengalaman untuk menjadi AM/FC penempatan di Siantar. Pria dan wanita usia min 22 tahun, mampu berbahaa Hokien / Mandarin, min tamatan Diploma, diutamakan yang sudah berpengalaman di asuransi, penghasilan 12 jt/bulan, bunus, jalan-jalan keluar Negeri geratis, hub. Agnes Silaen HP 0813 6135 5203 GRUP: Mencari mitra bisnis yang MNC

berpengalaman untuk menjadi AM/FC penempatan di Siantar. Pria dan wanita usia min 22 tahun, mampu berbahaa Hokien / Mandarin, min tamatan Diploma, diutamakan yang sudah berpengalaman di asuransi, penghasilan 12 jt/ bulan, bunus, jalan-jalan keluar Negeri geratis, hub. Magda HP 0812 6581 0012

LOWONGAN KERJA: Perusahaan yang bergerak dibidang distributor membutuhkan karyawan/ti, usia max 32 tahun, pendidikan SMA/ SMK sederajat, D1, D3 dan S1 (semua jurusan) untuk posisi Adm, Staf Gudang, Marketing, Pengawas, OB/OG, Asmen dan Kabag, bawa lamaran langsung test ke: CV Sentosa Abadi Jl. Medan KM 6.0 No. 58 (+ 5 M dari Simp. HKBP / Radio Diakoni Bongbongan) P. Siantar. Fasilitas: Gaji pokok, jenjang karir, komisi, mess (tempat tinggal) dan bonus DIBUTUHKAN SEGERA: Tenaga kerja wanita sebagai Penjual dan Kasir di Toko Sembako P Siantar. Syarat: KTP, KK, Ijazah, Umur antara 19 s.d 35. tahun Peminat Hub/SMS Nama, Umur, Ijazah ke 081384338004 DIBUTUHKAN: 2 orang pria tukang las listrik, umur 24-45 tahun, berpengalaman 2 tahun dalam mengelas, langsung wawancara di Jl. Cipto No. 39 Pematangsiantar DIJUAL: Kijang super KF 40 short, tahun 1990, warna dark olive, BK Siantar, sangat jarang dipakai, berminat hub. HP 0812 6567 979 (TP) DICARI: 10 truck colt diesel, baru bongkaran, untuk perbaikan jalan di ladang , hub. Bapak Petrus Manarung, HP 0813 6172 1126

diputar. Hal ini disampaikan Anggota DPRD Simalungun Manandus Sitanggang SSos kepada METRO, Rabu (29/8) di sela-sela latihan klub Gasta FC di stadion Balimbingan. Padahal saat ini sepakbola sudah menjanjikan dan memberikan jaminan hidup kepada pemain yang betul-betul berbakat. Banyak pemain sepakbola Simalungun yang sukses di klub luar Simalungun. Sebab di sana mereka bisa mengem-

bangkan bakatnya. Manandus Sitanggang menambahkan, hingga 2012 hanya ada sedikit turnamen bergulir di Simalungun. Di Stadion Balimbingan Tanah Jawa ada turnamen Saung Alam Raya U-18, kemudian turnamen sepakbola bergengsi Sugiarto Cup, dan akan menyusul turnamen sepakbola U-16 GASTA CUP Tanah Jawa yang rencanya dibuka Minggu (23/9) dan diikuti 20 kesebelasan. Hal senada disampaikan Anggota

DPRD Simalungun Ir Truly Antho Sinaga. Kejuaraan sepakbola antar pelajar SD, SMP dan SMA juga jarang diadakan. Padahal pelajar di Simalungun banyak yang berbakat dalam sepakbola. “Oleh karena itu, menyambut hari guru 25 November 2012, YP Bina Guna Tanah Jawa bekerjasama dengan GASTA FC akan menggelar turnamen sepakbola antar pelajar se-Tanah Jawa,” sebut Ir Truly Antho Sinaga yang juga Koordinator YP Bina Guna Tanah Jawa. (iwa/ara)

2 Anak Indonesia Terbang ke Jerman Menggocek si kulit bundar di daratan Eropa menjadi mimpi bagi banyak orang yang bergelut dengan sepakbola. Nah, tahun ini dua anak Indonesia berkesempatan untuk bisa berlatih dan bermain sepakbola di Eropa. Tak tanggung-tanggung, di markas Bayern Munich. Kedua anak Indonesia itu adalah Moch Aula Rizky dan Ary Rezqy Hakim. Mereka terpilih dalam seleksi ketat untuk mengikuti Allianz Junior Football Camp (AJFC) di Munich, Jerman. Aula merupakan siswa kelas VIII SMP Regina Caeli, Cileungsi. Dia merupakan putra M Zaenal Arifin dan Junaiyah yang lahir di Sidoarjo pada 16 Mei 1998. Bagi Aula, inilah pertama kalinya dia keluar negeri. Sedangkan Ary sudah beberapa kali keluar negeri untuk urusan sepakbola. Dia adalah siswa SMP Jl Ujung Menteng, Cakung, Jakarta Timur, kelas VIII. Ary adalah putra dari Fauzan Hakim dan Farihatun Munir.

Holyfield dan Tyson

YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 / bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari MAHAGA SEJAHTERA: membuYAYASAN

TANAH JAWA- Simalungun sebenarnya gudangnya atlet sepakbola, namun minim turnamen sepakbola. Meski pembinaan sepakbola usia dini menjamur di setiap kecamatan dan perkebunan BUMN, namun mereka tak punya wadah untuk untuk memperlihatkan keahlian mereka. Ini disebabkan minimnya niat sponsor untuk mendanai turnamen sepakbola. Bahkan roda kompetisi PSS Simalungun sudah 10 tahun terakhir tidak pernah

DAIHATSU PROMO LEBARAN • All New Xenia Dp. 17Jtan • All New Terios Dp. 20Jtan • Gran Max Dp. 8Jtan Proses cepat, ready stock Serius hub: Yusuf, HP. 0852 6168 1210 DAIHATSU PAKET MURAH 100% DP Angsuran • All N Xenia 24 jt 4.440.000 • Terios 24 jt 4.981.000 • Luxio 20 jt 4.902.000 • Pick up 11 jt 2.600.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0821 6308 7454. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio


• All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya ASTRA DAIHATSU

"Ramadhan Bersama Astra Daihatsu" • Pick Up mulai Dp. 11 Jutaan • Xenia Dp. 25 Jtan • Terios, Luxio, Sirion, All type ready stock Bisa tukar tambah, full diskon Hub: Mahrizal Astra, HP 0813 9669 0059; 0852 6204 2070


· All New Avanza ..Ready Stock ! Bonus Lengkap ! · All New Avanza VELOZ ... Bonus Lengkap !! · YARIS...Ready Stok,Diskon besar, Buruan !! · New Rush ..... Ready Stok !! · Grand New Innova .... Ready Stock !! · Grand New Fortuner ... Ready Stock !! · Hilux S-Cab/D-Cab .... Bensin/Diesel !! HUB. HUB. RICKY. M - 0853 7199 9499- 0812 6505 3191 SALES EXECUTIVE TOYOTA SIANTAR. Data dijemput, Cash/Credit PROSES CASH & CREDIT: Menyediakan rumah dan CEPAT..!!

tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar ASTRA DAIHATSU 100% BARU MENYAMBUT RAMADHAN • All New Xenia Dp 15% •Terios Dp 15% •Luxio Dp 15% •Pick Up Dp 15% •Grand Max Dp 15% Pastikan Anda Lebaran Mudik Dengan Mobil Baru Hub : Daud 0853 6123 3733 SUZUKI 100% BARU PT. Trans Sumatera Agung • Carry Pick Up 95,6Jt • APV Pick Up 105,6Jt • APV GL Arena 149,3Jt • APV Luxury 177,6Jt • Ertiga 155,2Jt • Splash 152,8Jt • Karimun Estillo 120,3Jt • Swift 181Jt • SX4 Cross Over 213,3Jt • Grand Vitara 305,3Jt Cash & Credit, Data dijemput David Sinaga, 0813 6132 4071

Dua anak Indonesia dikirim ke Jerman untuk latihan di camp Bayern Munich, Jerman. Menurut Head of Corporate Communication Central Function PT Asuransi Allianz Life Indonesia, Adrian Dosiwoda, kegiatan ini sudah berlangsung untuk keempat kalinya. Pertama kali kegiatan ini diselenggarakan pada 2009 lalu. “AJFC dimulai pada 2009 dan merupakan kegiatan global di Allianz Football for Life Program,” ujar Adrian dalam pesan tertulisnya, Rabu (29/8). Di AJFC, anak-anak dari berbagai negara berkumpul di tempat latihan Die

CAPELLA PEMATANGSIANTAR • All New Xenia Ready stok • Terios Ready stok • Luxio Dp 15%(hadiah menarik) • Sirion Dp 15 % • Pick up Dp 15 % • Mini Bus Dp 15 % hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Proses cepat data dijemput. Menyediakan TEST DRIVE!!


READY STOCK ALL TYPE HONDA • Honda Brio • Honda Jazz • Honda Freed • Honda CRV • Honda City • Honda Civic • Honda Accord • Honda Odyssey Dapatkan promo khusus Honda CRV bunga 0% sampai 3 tahun. Hub: Donnie (Sales Executive Honda Siantar) 085296664487.

LESTARI MOTOR: Menjual segala jenis sepeda motor Honda, Suzuki, Yamaha dan second, cash n kredit: • Honda Absolute Revo • Honda SX 125 • Scoopy, Vario Techno • Mio, Mio Soul • Jupiter Z • Satria FU, Spin, hub. 0622 - 22305; 24077; HP 0853 7070 9507; 0852 7601 5848. Jl. Merdeka No. 330 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 150 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan. Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 tahun + Rp 16 jt per bulan selama 15 tahun + Rp 1,3 jt per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Rp 100 jt, DP 20 jt, angsuran selama 10 thn + Rp 1 jt per bulan, selama 15 thn + 800 rb per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442

CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar.

CASH & CREDIT: 10 x 21,8 m Rp 76 jt, 20 x 22 m Rp 154 jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

Roten. Di sini mereka akan mendapat pelatihan khusus dan berkesempatan bertemu dengan pemain dari klub raksasa Jerman itu. Asyik! Sebanyak 65 Anak dari 22 negara ambil bagian dalam kegiatan ini. Selain Indonesia, mereka antara lain berasal dari Australia, Brasil, China, India, dan beberapa negara Eropa. “AJFC merupakan cara yang ampuh untuk menggabungkan anak-anak yang memiliki minat sama dan sekaligus

CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Rp 200 jt, Dp Rp 50 jt, angsuran selama 10 thn + 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan. Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Rp 200 jt, DP 50 jt, angsuran selama 10 thn + Rp 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan, Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 5 x 20 m Rp 17 jt, 10 x 20 m Rp 34 jt, 15 x 20 m Rp 51 jt, 20 x 20 m Rp 68 jt. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Rp 175 jt, DP 40 jt, angsuran selama 10 thn + Rp 2 jt per bulan, selama 15 thn + 1,6 jt per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Rp 95 jt, Dp 20 jt, angsuran selama 10 tahun + Rp 950 rb per bulan, selama 15 tahun + Rp 752 rb per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; 7070442 P. Siantar

KAVLING AMELYA: Dijual persil uk. 20 x 18 M (360 M) harga 68 jt (Rp 188.000 / M2) di Jl. Medan Pasar 7 Kel. Sinaksak, Kec. Tapian Dolok (Masuk 700 M dari Samp. Restoran Burung Goreng Sinaksak) harga sudah termasuk suratsurat, pajak, Sertifikat Hak Milik (SHM), An. pembeli, lebar jalan kavling 6,5 M hub R br Purba HP 0852 7539 0076; Naibaho HP 0813 9781 8088 (Tinggal 1 persil dari 25 persil) CASH & CREDIT TANAH: 5 x 25 m Rp 25 jt, 5 x 20 m Rp 20 jt, cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar DIJUAL TANAH KAVLING: • luas tanah 224 m2; 114 m2; 106 m2; 117 m2, lokasi di Dusun Tambunan Jl. Parapat KM 4,5 P. Siantar (masuk dari depan Flora In) surat Camat, posisi tanah depan jalan uk. 4 m, harga nego, hub. Br Simanjuntak HP 0852 9635 8913 Peter Refleksi SinShe Aciu / Aling: Mengobati segala penyakit •Asam lambung •Asam urat •Ambeian •Gula •Kolestrol dll Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0852 7695 4557; 0813 6017 0199 Buka : Jam 09.00 21.00 WIB REMBANG KATIKA UD JORENA: Menyediakan minyak karo yang dapat menyembuhkan •Gigitan binatang berbisa •Segala jenis luka bakar •Gegar otak dll, hub. SD Tarigan HP 0852 6290 3828 JL. Mangga No. 11 P. Siantar

CASH & CREDIT: 1.908 M2 Rp 300 jt, cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No. Telp. 0813 7612 2445; 0812 6207 631; (0622) 7070442 P. Siantar

PIJAT DAN LULURAN “MBAK SARI”: Jika Anda Capek, Pegal, Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan Badan, Urut Bayi, Terkilir serta Luluran. Hub: kami di Jl. Usgara No. 1 (Masuk dari Jl. Bali samp. SMK Negeri) P. Siantar HP. 0812 635 5430

CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Rp 150 jt, DP 30 Jt, angsuran selama 10 thn + 1,7 juta per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852.7600 0031; 0813.9688 9800.

pertukaran budaya,” imbuh Adrian. Diharapkan pengalaman yang didapat anak-anak itu di AJFC akan menginspirasi mereka untuk menjadi pendukung, pemain, pelatih, administrator atau perwakilan komunitas dan lainnya. Nah, bagaimana anak-anak ini bisa berpartisipasi? Mereka diseleksi setelah mengisi dan mengirim form di situs Football for Life. Form tersebut berisi informasi personal. Para pendaftar juga diminta untuk mendeskripsikan ‘the best football moment-nya’. Juri di setiap negara lantas akan memilih peserta yang berhak ikut dalam AJFC. Markas Bayern dipilih sebagai tempat diselenggarakannya AJFC dengan pertimbangan Die Roten merupakan salah satu tim paling terkenal di persepakbolaan Eropa. Tim berusia 112 tahun ini menjadi juara di Bundesliga sebanyak 22 kali, 15 kali memenangi DFB Pokal, dan yang tak kalah bergengsi telah menggondol 4 gelar Liga Champions. Catatan lainya, pelatihan tim junior klub asal Bavaria tersebut dikenal sebagai salah satu yang terbaik di Eropa. (int)

PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar Hp. 0813 7658 8917 Pijat dan Luluran “ IBU RESTU” Jika anda capek, Pegel Linu , Lesuh, Lelah Kurang bergairah, turun perut,Menyegarkan badan,Urut bayi,terkilir,serta luluran. Jl. Simpang Viyata Yudha Komplek kelapa 2 dekat sekolah RK Katolik Asisi Pematangsiantar HP 0821 6681 7943.

BUTIK OLYA: Menjual segala jenis pakaian jadi pria, wanita dan aneka ragam corak batik jenis kain katun, sanwos. Semua pakaian jadi dan bahan batik langsung berasal dari Solo, harga terjangkau dan kelas menengah kebawah, alamat. Jl. Melanthon Siregar Gg. PD P. Siantar HP 0812 6339 2197 ARMADA SARANA TEHNIK: Service perbaikan, isi freon •AC •Kulkas •Dispenser •Frezer •Mesin cuci, hub. Armada Purba, HP 0812 6406 6568 Jl. Handayani No. 8 P. Siantar

HASMIDA SALON: Diskon besar-besaran: • Make up/sanggul 30 rb - 50 rb •Rias pengantin 500 rb - 700 rb •Perawatan rambut 25 rb - 50 rb • Smoting 100 rb = 150 rb • Bonding 80 rb - 100 rb dan menerima rangkaian bunga, bunga salib dan juga menerima anak kost wanita. Jl. Rakkuta Sembiring No. 156 P. Siantar hub. HP 0852 6203 4593 GOODS MEUBEL: Promo besar-besaran/cuci gudang. Menjual: Perabotan rumah tangga dll, alamat Jl. Sutomo No. 11 -13 (Depan Bank Mandiri Sutomo) Telp. 0622 - 433788; 0813 9744 8215 HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” TANAM GAHARU INVESTASI MELEBIHI EMAS! Jual bibit gaharu aquilaria malaccensis tinggi mulai 20-100 CM, sedia fusarium ingul dan teknik mokulasi, sedia bibit kemenyan toba dll. Jl. Viyata Yudha Pematangsiantar. hub. HP 0813 1476 2472; 0812 2756 8840 LA ROSS SALON & FLORIST: Menerima: Make up dan sanggul, Rias pengantin, perawatan rambut, shomoting rambut. Juga menerima Roncean melati, Bunga tangan, Bunga papan, Bunga saub, Dekorasi pelaminan dll. Jl. Sisingamangaraja No. 324 Telp.08126382759

HORISON PHOTO: Spesial: •Pengadaan mesin

photo copy, servis spare parts Fotocopy Rp 125/ lbr •Pasphoto/cetak photo. Jl. Justin Sihombing (Simp. Jl. Pantai Timur) No. 7 B P. Siantar HP 0813 6100 1200 (Jhon Purba) AMANAH TOURS AND TRAVEL: Tiket promo, Medan - Jakarta - Singapura - Bangkok dll. Garuda, Lion, Batavia, Sriwijaya, dll. Hotel Promo Domestik dan Internasional. Tiket taman hiburan universal studio dll. Info: Jl. Patuan Anggi No. 159 P. Siantar. Telp. 0622 - 22115; 0813 6443 2665 dan menerima agen tiket


KAMIS 30 Agustus 2012

„ Walcott

Walcott Tolak Kontrak Baru Setelah kehilangan Robin van Persie, Arsenal dikabarkan bersiap untuk kehilangan bintang lainnya. Pemain yang dimaksud adalah Theo Walcott. Seperti dilaporkan oleh Guardian, Walcott menolak tawaran kontrak baru yang diajukan The Gunners. Padahal, kontrakpemainberusia23tahunitutinggal

satu musim lagi. Walcott, yang saat ini mendapatkan gaji sebesar 60.000 poundsterling per pekan, menginginkan kenaikan signifikan. Ia disebut meminta gaji sebesar 100.000 pounds sepekan. Namun, Arsenal bersikukuh. Me-

reka mengajukan penawaran final sebesar 75.000 pounds per pekan untuk kontrak selama lima tahun. Pembicaraan lebih lanjut segera dilakukan. Guardian menyebut, Arsene Wenger masih ingin mempertahankan pemain yang dibeli dari Southampton tersebut. Namun, Wenger juga bersiap untuk menjual Walcott sebelum bursa transfer ditutup pada 31 Agustus mendatang, jika mereka tak menerima

ketegasan si pemain untuk tetap bersama klub. Ada dua klub yang dikabarkan tertarik untuk menggaet Walcott. Mereka adalah Liverpool dan Manchester City. The Gunners dikabarkan meminta 15 juta poundsterling jika mereka akhirnya memutuskan untuk menjual Walcott. Walcott tampil sebanyak 35 kali di PremierLeaguemusimlalu.Darijumlah kesempatanbermainitu,iamenyumbang delapangoldan11assist.(dtc/int)

Harga Modric Kemahalan Keberhasilan Real Madrid mendatangkan Luka Modric dari Tottenham Hotspur disambut sinis mantan kiper Arsenal, Manuel Almunia. Menurut penjaga gawang asal Spanyol itu, Selasa (28/8), nilai jual Modric kelewat tinggi. Senin (27/8), “Los Merengues” resmi memboyong Modric dengan dana 31 juta pounds atau 42 juta euro (sekitar Rp 490 miliar). Jumlah tersebut menjadikan pemain Kroasia itu sebagai pemain termahal kedelapan sepanjang sejarah Madrid. Meski menyebut Modric sebagai pemain hebat, Almunia yang kini bermain untuk Watford masih tak percaya Madrid mau berinvestasi

besar untuk sang pemain. “Modric pemain bagus. Tapi, aku tak tahu sebenarnya apa yang dibicarakan banyak orang. Setelah paham, aku merasa 42 juta euro terlalutinggi.Diamemanghebatdan

berguna untuk Madrid. Tapi, tetap saja harganya kemahalan,” ujar Almunia kepada COM Radio. Almunia juga tak lupa memberikan tanggapannya mengenai kepindahan Alex Song dari Arsenal

menuju Barcelona. “Song seperti dinding. Dia sangat kuat dan mampu mencuri bola. Kadang, dia bermain genius dengan umpan briliannya,” sebut Almunia. (kps/int)

Martinez Selesaikan Tes Medis dengan Bayern Javi Martinez dilaporkan di ambang pintu masuk Bayern Munich setelah pemain Athletic Bilbao ini menyelesaikan rangkaian tes medis bersama klub raksasa Bundesliga tersebut. Menurut Football-Espana, Martinez tidak meminta izin klubnya untuk melakukan perjalanan ke Munich. Dia tertangkap kamera di Munich pada hari Selasa (28/8) sore dan diketahui pemain berusia 23

tahun ini bepergian dengan pesawat jet pribadi. Rumor yang menyebutkan Martinez selangkah lagi berkostum The Bavarians memang semakin gencar. Apalagi manajemen Bayern dipercaya rela merogoh kocek dalam-dalam demi memboyong gelandang internasional Spanyol itu. Bayern Munich diduga sudah mengajukan penawaran kepada




Punya kendaraan roda 2 (dua)? anda Pria/Wanita tamatan SLTA, bergabunglah bersama kami. Fasilitas yang didapat: • Insentive • Bonus • Karir • Komisi Kirimkan lamaran anda ke:

Harian METRO SIANTAR Jl. Sangnawaluh Komp. Megaland Blok A No. 24 P. Siantar

Tuliskan kode KARIR di sudut kanan amplop & cantumkan nomor Telp/HP yang bisa dihubungi

Bilbao sebesar 40 juta euro atau nilai dari klausul pembebasan kontrak untuk Martinez. Saat ini diyakini permasalahan yang tersisa sebelum mencapai kata sepakat adalah besarnya pajak dan keengganan Bilbao melepas bintangnya itu. Bintang-bintang Bilbao memang tengah menjadi incaran klub-klub besar Eropa. Selain Martinez yang juga diminati Manchester City,

DIBUTUHKAN Karyawan/ti untuk ditempatkan sebagai:

SALES SPD MOTOR Persyaratan: • Tamatan minimal SMA sederajat • Memiliki kendaraan sendiri • Memiliki SIM C • Rajin, gigih dan jujur Lamaran diantar ke:

YAMAHA HORAS MOTOR II Jl. Kartini No. 56 F PEMATANGSIANTAR Telp. 0622 - 22109

Fernando Llorente yang juga dikabarkan terus dikaitkan dengan klub raksasa Serie A, Juventus. Sementara itu, manajemen Bilbao saat ini terus berupaya mendatangkan pemain-pemain anyar untuk berjaga-jaga bila bintang mereka benar-benar pergi. Prioritas utama mereka adalah menggaet pemain Malaga, Nacho Monreal untuk dibawa ke San Mames. (oz/ int)


KAMIS 30 Agustus 2012


Team Chelsea Swansea City Everton West Brom Man City

M 3 2 2 2 2

M 3 2 2 1 1

S 0 0 0 1 1

K 0 0 0 0 0

SG 8-2 8-0 4-1 4-1 5-4

UEFA EUROPA LEAGUE Nilai 9 6 6 4 4

TOP SCORER Gol 3 2 2

Nama Michu D Duff N Dyer

Klub Swansea City Fulham Swansea City

Kualifikasi Liga Champions

SPANISH LA LIGA No 1 2 3 4 5

Team Barcelona R Valladolid R Vallecano Mallorca Málaga

M 2 2 2 2 2

M 2 2 2 1 1

S 0 0 0 1 1

K 0 0 0 0 0

SG 7-2 3-0 3-1 3-2 2-1

Nilai 6 6 6 4 4

Dila Gori Dnipro APOEL Nicosia CSKA Moscow H Tel Aviv Heerenveen Helsinki PSV Rosenborg BK Sparta Praha Steaua Bucharest Young Boys Metallist K Racing Genk Viktoria Plzen Bordeaux Club Brugge Marseille Videoton Hannover Inter Milan Levante Partizan Belgrade Rapid Wien AZ Alkmaar Lazio Newcastle Twente Liverpool Sporting

vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs

Maritimo Slovan Libere Neftchi Baku AIK F91 Dudelange Molde Ath Bilbao Zeta Golubovc Legia Warszaw Feyenoord E Panevezys Midtjylland Dinamo Bucuresti Luzern Lokeren Crvena Zvezda Debreceni VSC Sheriff Tiraspol Trabzonspor Slask Wroclaw Vaslui Motherwell Tromso PAOK Anzhi Makhachkal Mura Atromitos Bursaspor Hearts AC Horsens

1/2 : 0 0 : 1 1/4 0 : 1 1/4 0 : 1 1/2 0 : 1 3/4 0 : 1/2 3/4 : 0 0 : 2 1/2 0 : 1/2 0 : 1/4 0 : 2 1/4 0:1 0 : 1 1/4 0 : 3/4 0 : 3/4 0 : 1 1/4 0 : 1 1/4 0 : 1 3/4 0:0 0:2 0 : 1 3/4 0:2 0 : 1/2 0 : 1/4 0 : 1/4 0 : 2 1/4 0 : 1 1/2 0:1 0 : 1 3/4 0 : 1 3/4

TOP SCORER Gol 4 3 3

Nama L Messi T Hemed R Falcao

Klub Barcelona Mallorca Atlético Madrid

Liga Champions musim 2012-2013 akan segera bergulir. Lima tim telah memastikan diri lolos ke fase grup, menyusul kemenangan yang mereka raih di babak playoff.



Internazionale Napoli Chievo Genoa Juventus

1 1 1 1 1

1 1 1 1 1

0 0 0 0 0

TOP SCORER Gol 2 1 1

Nama S Jovetic E Cavani A Costa

Klub Fiorentina Napoli Sampdoria

0 0 0 0 0

3-0 3-0 2-0 2-0 2-0

3 3 3 3 3

urnamen paling elite benua biru diketahui sudah memiliki 22 kontestan yang otomatis melaju ke babak penyisihan grup. Mereka adalah tim-tim yang mengakhiri musim di papan atas klasemen Liganya masingmasing (ada yang empat, tiga, dua atau hanya satu, tergantung jatah setiap asosiasi berdasarkan peringkat di UEFA). Sementara10timlainuntukmemenuhikuota 32 klub, diambil lewat babak playoff. Nah, saat ini ada 20 tim di babak playoff yang tengah berjuang untuk mendapatkan 10 tiket tersebut. Dini hari tadi, lima tiket telah resmi dipegang oleh BATE Borisov (Belarusia), Anderlecht (Belgia), Dinamo Zagreb (Kroasia), Sporting Braga (Portugal) dan Malaga (Spanyol). BATE, klub jawara Liga Belarusia ini memastikan diri lolos ke putaran final Liga Champions usai menumbangkan wakil Yunani Hapoel Ironi Kiryat Shmona FC. BATE menang dengan agregat 3-1, usai bermain 2-0 di kandang

dan menahan imbang 1-1 juara Liga Yunani itu di kandangnya pada leg kedua, dini hari tadi. Bagi BATE, ini merupakan kali ke-3 mereka lolos ke Liga Champions sejak pertama kali pada 2008-2009. Ini jadi kesempatan kedua secara beruntun buat BATE, setelah musim lalu juga mampu melaju ke fase grup (meski langsung tersingkir). Anderlecth juga memastikan bakal meramaikan persaingan fase grup Liga Champions musim ini usai menumbangkan kampiun Liga Siprus, AEL Limassol dengan agregat 3-2. Anderlecth yang kalah 1-2 pada leg pertama di markas AEL, sukses membalikkan keadaan dengan menang 2-0 pada leg kedua di markasnya, Constant Vanden Stock Stadium, dini hari tadi. Buat Anderlecht, keberhasilan ini menjadi prestasi tersendiri setelah sebelumnya dalam dua musim terakhir, jawara 31 kali Liga Belgia ini harus puas berlaga di Europa League. Dinamo Zagreb lolos ke babak utama Liga Champions usai menjinakan NK Maribor. Kampiun Liga Kroasia ini menang agregat 3-1 berkat kemenangan 2-1 (kandang) dan 1-0 pada leg kedua di markas jawara Liga Slovenia itu, dini hari tadi. Ini merupakan kali keempat atau yang kedua secara beruntun bagi Zagreb lolos ke babak penyisihan grup. Sporting Braga membuktikan kelasnya bahwa kompetisi Liga Portugal tidak bisa diremehkan oleh liga-liga elite Eropa seperti Spanyol, Inggris, Jerman dan Italia. Hal ini dibuktikan dengan keberhasilan mereka melaju ke babak penyisihan grup Liga Champions dengan menyingkirkan salah satu unggulan di babak playoff, Udinese. Bragayangditahanimbang1-1padalegpertama,sempatdibuat cemas ketika Pablo Armero membawa Udinese unggul 1-0 pada leg kedua di Stadion Friulli, Italia. Namun, Ruben Micael menyelamatkan Braga berkat golnya di menit ke-72, untuk memaksakan skor akhir 1-1 (agregat 2-2) sekaligus digelarnya perpanjangan waktu dan klimaksnya menang lewat drama adu penalti (5-4). Dengan lolosnya Braga, maka Portugal memiliki tiga wakil pada gelaran Liga Champions musim ini. Dua tim yang sebelumnya memastikan lolos otomatis adalah FC Porto selaku jawara dan Benfica (runner-up). Sementara bagi Udinese, kegagalan klub berjuluk ‘Il Zebrette’ ini memaksa Italia hanya menyelipkan dua wakilnya di putaran final. Kedua tim tersebut adalah Juventus dan runner-up Serie A, AC Milan. Berbeda dengan Italia yang kian merosot, Spanyol justru terus menunjukkan hegemoninya sebagai salah satu liga terbaik dunia. InitaklepasdarikeberhasilanMalagamenembusLigaChampions untuk kali pertama dalam sejarah klub. Klub besutan Manuel Pellegrini ini memastikan tiket lolos, usai membungkam runner-up Liga Yunani, Panathinaikos dengan agregat 2-0. Keunggulan dua gol tanpa balas di markasnya, La Rosaleda Stadium, berhasil dipertahankan Malaga dengan menahan imbang Panathinaikos 0-0 di leg kedua, dini hari tadi. Dalam debutnya, Malaga akan mendampingi tiga tim terbaik La Liga, yakni Real Madrid, Barcelona dan Valencia yang lolos otomatis. Sementara itu, lima tiket tersisa akan diperebutkan 10 tim. Ke-10 tim yang akan saling sikut adalah Spartak Moskow vs Fenerbahce, Basel vs CFR Cluj, Helsinborg vs Glasgow Celtic, Borussia Moenchengladbach vs Dinamo Kiev dan FC Kopenhagen kontra Lille. (oz/int)







Edisi 44 „ Tahun IX


TPL Rampas Lahan Warga


Didesak Perbaiki Jalan Rusak

SIMALUNGUN- Sedikitnya 45 kepala keluarga (KK) warga Nagori Pondok Buluh, Kecamatan Dolok Pangribuan, Simalungun, terancam kelaparan.

PARMAKSIAN- Sejumlah warga di Kecamatan Parmaksian mendesak PT Toba Pulp Lestari (TPL) segera bertanggungjawab terhadap kerusakan lingkungan termasuk perbaikan jalan rusak di daerah itu. Apabila tak diindahkan, warga mengancam akan menanam pohon pisang di seluruh

Pasalnya ratusan hektare (ha) lahan pertanian sebagai sumber utama mata


TPL..Hal 6

DIRUSAK- Jahotman Nainggolan menunjukkan lahan dan tanaman kopi yang dirusak oleh pihak PT.TPL .Rabu (29/8)

‹ ‹ Baca

Pakar Hukum: Mangkir, Sintong Harusnya Ditahan JAKARTA- Jaksa Penuntut Umum (JPU) harus segera menangkap dan menahan Ketua DPRD Tapanuli Tengah. Sebab pada kenyataannya dari persidangan atas kasus ilegal logging kayu rotan sebelumnya,

JAKARTA- Entertainer yang biasanya menjadi presenter, Choky Sitohang, mendapat tantangan untuk bermain dalam opera batak. Choky akan bermain Gorga, tokoh utama dalam opera berjudul “Arga Do Bona ni Pinasa”. Meski berdarah batak, namun Choky cukup sulit memerankan tokoh Gorga. Itu karena dirinya lahir di Bandung dan tidak menguasai bahasa batak. ”Ini satu tantangan besar buat saya, karena saya harus menghapal 20 lagu berbahasa batak. Saya sebenarnya lahir di Bandung dan kurang dibiasakan berbahasa batak,” kata Choky di Gedung Energi SCBD Jakarta Selatan, Rabu (29/8). Kendala lainnya, Choky baru‹ ‹ Baca

Belajar..Hal 6

Didesak..Hal 6



Guru PAUD Dianiaya Teman

„ Rita br Nainggolan saat ditemui di rumahnya, Rabu (29/8).

SIBOLGA- Usai disebut parhutang busuk, Nuraini br Hutabarat (43) warga Gang Serasi, Kelurahan Pancuran Dewa, Kecamatan Sibolga Sambas, juga nekad menganiaya Rita br Nainggolan (40) seorang guru PAUD Annazah, Selasa (28/ 8) pukul 08.05 Wib. Rita dianiaya dengan dilempari piring lontong hingga mengalami luka di pelipis. Tidak terima diperlakukan seperti itu, Rita langsung melaporkan Nurani ke Polsek Sibolga Sambas. Rita dan Nuraini sendiri merupakan teman akrab . Menurut Rita, warga Jalan Cendrawasih, Kelurahan Pancuran Dewa ini, peristiwa itu berawal saat dia hendak menjemput salah satu muridnya ke Gang Serasi, Selasa (28/8) pukul 08.00 Wib. Namun, begitu lewat dari depan warung lontong di gang itu, tibatiba Nuraini berkata “lihat itu, si parutang busuk itu” seolah menyindir

dimana Sintong tersebut sebagai tersangka, ia sampai 12 kali mangkir dari persidangan. Pandangan ini secara tegas dikemukakan ahli hukum pi‹ ‹ Baca

‹ ‹ Baca

Pakar..Hal 6

‹ ‹ Baca

„ Singwani Siregar.

Sekwan jadi Tersangka Kasus Dugaan Palsukan Stempel SIBOLGA- Usai diperiksa seharian, Rabu (29/8) mulai pagi hingga sore pukul 17.00 Wib, Polres Tapteng menetapkan Sekretaris DPRD Singwani Siregar jadi tersangka pada kasus dugaan pemalsuan stempel. Hal itu dibenarkan Wakapolres Tapteng Kompol Enriko Silalahi saat di konfirmasi

Guru..Hal 7

‹ ‹ Baca

Sekwan..Hal 6

Berkunjung ke Dusun Buntu Raja, Pasca Tragedi Isu Begu Ganjang (Habis)

Tak Ada Kaum Bapak, Acara Adat jadi Masalah Selain dampak psikologis dan ekonomi, dampak lain pasca 42 kaum bapak di Dusun Buntu Raja masuk penjara adalah persoalan menggelar acara adat. Semisal, acara adat pernikahan atau orang yang meninggal dunia. Horden Silalahi, MUARA


„ Anak-anak terpidana kasus begu ganjang berkumpul bersama saat hari libur dan dihibur sejumlah ibuibu.

Kepala Desa Sitanggor Sangkar Rajagukguk kepada METRO mengatakan, untuk menggelar acara adat di Dusun Sitanggor, terpaksa penatua atau tokoh adat dari desa lain naik gunung ke Dusun Buntu Raja. ”Kita dari Desa Sitanggor dan dusun lain terpaksa ikut naik ke Dusun Buntu Raja untuk membantu setiap ada acara adat di sana,” ujar Sangkar. ‹ ‹ Baca

Tak Ada..Hal 7



30 Agustus 2012

Pembangunan Asrama Haji Pinangsori

Bisa Rampung Tahun Depan TAPTENG- Pembangunan Asrama Haji Pinangsori, Tapteng diharapkan rampung tahun depan. Atau selambatnya tahun 2014, asrama haji yang potensial dijadikan embarkasi itu sudah dapat difungsikan. “Pembangunan asrama itu sudah lama terkendala. Saya dengar tahun ini APBD Provinsi Sumut melalui dana Bantuan Daerah Bawahan (BDB) menganggarkan dana sebesar Rp3 miliar untuk lanjutan pembangunannya. Karena itu diharapkan tahun depan sudah bisa rampung,” tukas ketua Barisan Muda PAN Tapteng, Winsa Eko Syahputra, di Pandan, Tapteng, Rabu (29/8). Data yang dihimpun METRO, dana Rp3 miliar tersebut digunakan untuk plesteran dinding luar dalam lantai II. Kemudian, pembuatan lantai keramik pada lantai II, sebab lantai I sudah dikeramik. Pemasangan pintu dan jendela pada lantai II dan pengecatan lantai I dan II. Lalu, pembangunan gedung kantor asrama haji, serta pembangunan pondasi kolom dan dinding bata balai pertemuan. Sebelumnya, Kadis Pekerjaan Umum Tapteng, Ir Jhonson Pasaribu MSi mengakui anggaran BDB sebesar Rp3 miliar tersebut. “Kalau tahun depan dapat anggaran lagi, mudahmudahan bisa rampung selu-

ruhnya. Untuk tahun depan bisa diperuntukkan pamasangan kosen pintu, jendela serta lantai balai pertemuan. Kemudian untuk pemagaran keliling serta pengadaan mobiler dan perabotan,” ujar Jhonson belum lama ini. Sementara itu, Menteri Agama RI Suryadharma Ali pernah meminta Kanwil Sumut untuk memperhatikan sekaligus dapat membantu pengalokasian anggaran pembangunan Asrama Haji Pinangsori, Tapteng. Bantuan itu nantinya bisa ditampung melalui APBD provinsi. Untuk peningkatan menjadi embarkasi nantinya, Ali berpendapat bahwa harus dipertimbangkan lebih dulu berapa jemaah haji asal TaptengSibolga sekitarnya. “Kita lihat dulu berapa jemaah haji dari sini, kalau pantas, bisa dijadikan embarkasi,” kata Ali yang saat itu transit dari pelabuhan Hotel Wisata Indah Sibolga menuju Kecamatan Muara Batang Gadis, Madina. Di kesempatan itu, Bupati Tapteng Raja Bonaran Situmeang SH MHum juga mengakui keterbatasan dana menjadi kendala pembangunan asrama haji yang sudah lama terkatung-katung tersebut. Bonaran mengatakan, APBD Tapteng terbatas. Karena itu diharapkan ada bantuan dari pusat atau provinsi. (mor/nasa)

BKG dan BSM Rawan Pemotongan dan Pungli TAPTENG- Tahun ini, APBD Provinsi Sumut melalui dana Bantuan Daerah Bawahan (BDB) menampung dana Bantuan Kesejahteraan Guru (BKG) di Tapteng sebesar Rp4.384.800.000. Jumlah itu jauh di atas Bantuan Siswa Miskin (BSM) yang hanya Rp500 juta. Sementara untuk rehab fisik sekolah nihil sama sekali.

FPD Minta Walikota Psp

Ingatkan PNS Fokus Laksanakan Tugasnya SIDIMPUAN-Para pegawai negeri sipil (PNS) di lingkungan Pemko Psp saat ini sepertinya kurang maksimal melaksanakan tugas sebagai pengayom masyarakat. Pasalnya, pikiran mereka terpecah dengan agenda pilkada yang akan digelar beberapa bulan lagi. Untuk tidak mempengaruhi tingkat pelayanan, Fraksi Partai Demokrat (FPD) DPRD Kota Padangsidimpuan (Psp) meminta Walikota Psp, Drs H Zulkarnaen Nasution MM agar mengingatkan para PNS untuk focus melaksanakan tugasnya dan tidak ikut latah persoalan pilkada ini. Ketua FPD DPRD Psp, H Khoiruddin Nasution mengharapkan, kiranya PNS tetap melaksanakan tugas dan focus melayani masyarakat dan tidak latah nimbrung dikegiatan pilkada Kota Psp. Apalagi sesuai aturan, PNS memang dilarang berpolitik praktis. “Imbaun ini penting agar PNS tetap fokus melaksanakan tugasnya untuk memberikan pelayanan kepada masyarakat dan sebagai kepala daerah Walikota Psp harus mengingatkan semua PNS termasukpimpinanPNSitusendiri seperti Sekda dan juga para pimpinan SKPD lainnya,” tegasnya. Hal ini dikatakan Ketua Komisi III DPRD Psp agar menjaga net-

ralitas PNS dalam pilkada, namun yang terutama adalah bagaimana agar pelayanan kepada masyarakat tidak sampai terganggu karena PNS juga sibuk membahas bahkan terjun langsung dalam eforia pilkada Psp ini. “Agar ada pemahaman kepada para PNS untuk mengembang amanah dan tanggungjawabnya secara profesional. Untuk itu diharapkannya kepada Walikota Psp, Drs Zulkarnaen Nasution agar memerintahkan seluruh PNS focus pada tugasnya,” jelasnya. Ketua DPC PD Kota Psp ini menambahkan Walikota Psp harus tegas karena dirinya melihat adanya seperti penurunan semangat kerja dari para PNS apakah disebabkan karena baru libur lebaran atau karena terlalu semangat membahas masalah pilkada. “Lihat saja sudah beberapa hari masuk kerja, jumlah PNS yang hadir masih jauh dari harapan, kantor masih banyak yang pegawainya sunyi. Kita tahu apakah factor libur lebaran atau malah sibuk latah nimbrung dipilkada ini. Kita minta Walikota juga tidak latah dan membiarkan hal ini terjadi. Ingatkanlah PNS agar focus pada tugasnya saja melayani masyarakat,” tegasnya. (phn/mer)


JUARA- Felicia Rajagukguk dan kedua orangtua serta adiknya bersama Bupati Tapteng Bonaran Situmeang, kemarin.

Felicia Rajagukguk Juara 1 Melukis

tidak segan-segan membagi pengalaman sehatnya dengan orang lain. Asam urat bukanlah nama suatu penyakit, namun ia adalah suatu zat sisa metabolisme zat yang bernama purin yang berasal dari makanan yang kita konsumsi. Keadaan dimana tubuh mengalami kelebihan kadar asam urat disebut hyperuricemia. Pada kondisi normal, kelebihan purin ini akan dikeluarkan melalui urine dan feses. Namun jika purin yang masuk dalam tubuh terlalu banyak, maka ginjal akan kesulitan mengeluarkan zat tersebut sehingga terjadi penumpukan sisa metabolismenya (asam urat). Penumpukan sisa metabolisme zat purin di persendian dapat menyebabkan bengkak dan rasa nyeri. badan terasa linu, nyeri terutama di malam hari atau pagi hari saat bangun tidur, sendi terlihat bengkak, kemerahan, panas dan nyeri luar biasa pada malam dan pagi, timbul benjolan-bejolan kecil dari mulai sebesar biji beras sampai kacang hijau di daun telinga bawah (tofus) adalah gejala-gejala asam urat. Habbatussauda yang dikandung dalam Gentong Mas bermanfaat untuk menormalkan metabolisme, termasuk metabolisme purin sebagai pembentuk asam urat yang dipercaya dapat meningkatkan pengeluaran asam urat dari darah melalui urine. Sementara, Gula Aren selain rasanya manis dan lezat juga bermanfaat untuk

Medan mengurusi pencairan BKG dan BSM itu, atau proses asistensi. “Mudahmudahan bisa segera beres urusan ini. Karena banyak instansi yang mesti didatangi. Nanti penyalurannya dihitung sejak Januari-Desember,” pungkasnya. Terpisah, Sekretaris LSM Kupas Tuntas Juan Ferry Lumbangaol mengingatkan, penyaluran BKG dan BSM dilaksanakan secara transparan dan jujur. Sebab, menurut Juan, BKG dan BSM rawan pemotongan dan pungutan liar. “Data yang saya perolah, BKG dan BSM dari BDB provinsi sudah dikucurkan sejak tahun 2009 lalu. BKG tahun 2009 sebesar Rp2,41 miliar, tahun 2010 sebesar Rp6,63 miliar dan tahun 2011 sebesar Rp2,15 miliar. Sedangkan BSM tahun 2009 sebesar Rp1,89 miliar, tahun 2010 juga sebesar Rp1,89 miliar, dan tahun 2011 sebesar Rp500 juta. Penyaluran bantuan ini sangat rawan pemotongan dan pungli,” tukas Juan. Di sisi lain, Juan berpendapat untuk tahun berikutnya, para wakil rakyat di DPRD provinsi mesti memikirkan dana BDB untuk rehab fisik sekolah. “Masih banyak gedung sekolah di Tapteng yang kondisinya memprihatinkan. Atau, untuk bantuan peralatan sekolah. Saya pikir itu perlu diperhatikan,” pungkasnya. (mora)

Pemandangan Air Terjun Pulau Mursala


LUKISAN- Lukisan panorama air terjun Pulau Mursala karya Felicia Rajagukguk. PANDAN- Felicia Rajagukguk, siswi kelas 3 SD St Fransiskus Pandan, keluar sebagai juara I lomba melukis tingkat SD se-Tapteng. Lomba yang digelar untuk menyemarakkan Hari

"SEKARANG TANGAN DAN KAKI SAYA SUDAH TIDAK CUCUK-CUCUK LAGI" Keluhan sebagai PNS dengan nyaman dan menurunkan penyerapan lemak dan karena asam urat kini sudah tidak lagi dirasakan D u ng d u ng Nurwati Aritonang. Padahal, sudah 1 tahun, wanita berusia 43 tahun tersebut mengeluhkan kesehatannya terganggu karena asam urat. Kira-kira apa rahasianya? Ketika ditemui di kediamannya di Desa Tanjung Gusta, Kec. Sunggal, Kab. Deli Serdang, Sumatera Utara, ia menjawabnya, "Sudah 1 tahun terakhir ini saya menderita asam urat dan telah lama berobat, namun sakitnya masih datang dan pergi. Tapi setelah saya minum Gentong Mas selama 6 bulan, sekarang kaki dan tangan saya sudah tidak cucukcucuk lagi," tuturnya menceritakan pengalaman baiknya tersebut. Gentong Mas adalah minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda) terbukti memiliki banyak manfaat untuk kesehatan. Dulu, ketika sakitnya kambuh, ibu 5 orang anak ini selalu merasakan tangan dan kakinya sakit. Tapi kini, semuanya berubah. Dengan tubuh yang sehat, ia pun dapat menjalani aktifitasnya sehari-hari

“Masing-masing dapat Rp60 ribu per orang per bulan. BKG hanya untuk guru PNS yang belum sertifikasi dan honor yang sudah mengabdi selama minimal 2 tahun serta telah memiliki NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan). Totalnya ada sekitar 4.200-an guru di Tapteng yang mendapat BKG,” ujar Sekretaris Dinas Pendidikan Tapteng Jhonson Sihombing, Rabu (29/8) petang. Sedangkan BSM, sambung Jhonson, jumlahnya berbeda tiap tingkatan sekolah. Dinas Pendidikan Tapteng mengusulkan bagi tingkat SD sebesar Rp365 ribu per tahun per siswa, tingkat SMP sebesar Rp560 ribu per tahun per siswa, dan tingkat SMA sebesar Rp775 ribu per tahun per siswa. BSM sendiri telah diamanatkan dalam UU No 20 Tahun 2003 tentang Sistem Pendidikan Nasional, pasal 12 (1) c yang menyebutkan setiap peserta didik pada setiap satuan pendidikan berhak mendapat beasiswa bagi yang berprestasi yang orangtuanya tidak mampu membiayai pendidikannya. Dan huruf d menyebutkan, setiap peserta didik pada setiap satuan pendidikan berhak mendapat biaya pendidikan bagi mereka yang orangtuanya tidak mampu membiayai pendidikannya. Jhonson mengaku pihaknya kini sedang berada di

perbaikan sistem saraf. Untuk hasil maksimal, control makanan yang dikonsumsi dan banyak minum air putih, sekitar 8 gelas sehari. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/ toko obat terdekat atau hubungi: Medan : 081384 777787 Sidikalang: 081384777787 Humbahas : 0821 6864 2805 Gunung tua : 081384777787 Batubara : 081384777787 Tobasa : 0813 8477 7787 Nias : 0813 8477 7787 Tebing Tinggi : 0813 2209 9495 Siantar : 082167538848 Binjai : 0813 9866 6166 Lbk Pakam : 0813 6227 3308 Karo : 0821 6753 8828 Langkat : 0813 6227 3308 Kisaran : 0623 7014 362 Tj. Balai : 0812 6349 5563 Labura : 0813 7059 0972 Labuhan batu: 0852 7784 4950 P. Sidimpuan : 0821 6346 6597 Sibolga : 0813 7625 2569 Taput : 081263243034 Madina : 082163466597 Dolok Sanggul : 0821 2928 4752. Depkes:P-IRT:812.3205.01.114 w w

Jadi ke-67 Tapteng itu digelar di Tribun Lapangan Sepakbola Pandan, kemarin. “Tema lukisannya pemandangan alam air terjun Pulau Mursala. Mama pernah ajak aku

ke sana,” kata putri pertama pasangan Patricius M Rajagukguk dan Gina br Tampubolon itu, sambil menenteng piagam dan piala yang diraihnya, yang diserahkan oleh Bupati Tapteng Raja Bonaran Situmeang. Sebelumnya, Felicia juga pernah menjuarai lomba menggambar tingkat TK se-Tapteng dan diutus mewakili Tapteng di lomba serupa ke provinsi. Felicia yang saat itu bersekolah di TK St Don Bosco keluar sebagai juara II di tingkat provinsi. Selain juara lomba melukis, Felicia juga juara II lomba kreasi pakaian daerah wanita yang juga digelar dalam rangka Hari Jadi Tapteng. Dalam lomba itu, Felicia mengenakan pakaian khas daerah Bali. “Kalau kreasi pakaian daerahnya Mama yang banyak membantu,” timpalnya. (mora)

„ Juan Ferry Lumbangaol

1.150 Cama dan Cami STAIN Psp Ikuti OPAK SIDIMPUAN-Sebanyak 1.150 Calon Mahasiswa dan Mahasiswi (Cama dan Cami) Sekolah Tinggi Agama Islam Negeri (STAIN) Padangsidimpuan (Psp) Tahun Akademik (TA) 2012/2013 mengikuti Orientasi Pengenalan Akademik dan Kampus (OPAK). Kegiatan dilaksanakan di Auditorium STAIN Psp, di Jalan Tengku Rizal Nurdin, Sihitang, Kecamatan Psp Tenggara, Rabu (29/8). Ketua STAIN Psp, DR H Ibrahim Siregar MCL yang membuka secara resmi OPAK tersebut dalam sambutannya, mengajak para cama dan cami untuk dapat menyesuaikan diri dengan status mahasiswa yang disandang saat ini. “Jika dulu saudara-saudari masih berstatus siswa, namun sekarang sudah mahasiswa. Kata maha itu besar maknanya, makanya harus benar-benar mampu beradaptasi dengan baik,” ujar DR H Ibrahim.

Ketua STAIN Psp mengatakan, OPAK di gelar bertujuan untuk terciptanya mahasiswa yang tahu dan paham akan eksistensi STAIN Psp sebagai lembaga pendidikan tinggi Islam, serta sadar akan peran maupun fungsinya sebagai insan akademika yang berakhlakul karimah dan memiliki solidaritas tinggi terhadap sesama. “Dengan itu diharapkan para mahasiswa nantinya ikut berperan serta bertanggungjawab dalam mencerdaskan kehidupan berbangsa dan bernegara,” terangnya. Sasaran OPAK kata Ibrahim adalah para mahasiswa baru atau mahasiswa lama yang belum mengikuti OPAK untuk mengetahui dan memahami eksistensi, peran dan fungsi STAIN Psp sebagai lembaga pendidikan tinggi Islam. Selanjutnya, mengembangkan potensi diri mahasiswa dalam mensosialisasikan Tri Dharma Perguruan Tinggi (PT) serta membentuk ke-

pribadian mahasiswa yang berkperibadian muslim. Ditambahkannya, target OPAK ini adalah mahasiswa dapat mengetahui sejarah, visi dan misi, nama dan fungsi lembaga kemahasiswaan, sistem administrasi dan perkuliahan, karakteristik, kode etik akademik, jurusan, baris berbaris serta mampu terampil menyanyikan mars dan hymne STAIN Psp. “Semoga OPAK ini terlaksana dengan baik dan para cama dan cami dapat benarbenar mengenal penuh kampusnya sebelum resmi mengikuti perkuliahan nantinya,” harapnya. Sementara sebelumnya, Ketua Panitia OPAK, Sapriadi SPdI dalam laporannya mengungkapkan, waktu kegiatan OPAK dibagi kepada beberapa bagian yaitu tahap pendaftaran dan wawancara tanggal 23, 24, 27 dan 28 Agustus 2012, sedang tahap pembukaan dan kegiatan inti tanggal 29, 30, 31 Agustus 2012 dan dilanjutkan tahap-

an evaluasi dan pelaporan. Dijelaskannya, panitia dalam OPAK berjumlah 56 orang, narasumber 11 orang, moderator 9 orang, notulen 9 orang, instruktur umum 43 orang dan instruktur perpustakaan sebanyak 14 orang. “Peserta kegiatan OPAK tahun ini diperkirakan sebanyak 1150 orang berasal dari gelombang I dan II,” bebernya. Pembukaan OPAK yang bertemakan ‘Melalui OPAK kita tingkatkan pengenalan dan pemahaman civitas akademika yang ramah dan bersahabat’ dirangkai dengan pemakaian topi kertas dan kalung buah oleh Ketua STAIN Psp, DR H Ibrahim Siregar MCL kepada dua perwakilan peserta dan dilanjutkan dengan penyerahan berkas OPAK kepada instruktur. Hadir dalam pembukaan yaitu para Ketua Jurusan (Kajur), Kabag dan Kasubag serta unsur Badan Eksekutif Mahasiswa (BEM) dan lainnya. (neo/mer)


30 Agustus 2012

Syahganda Nainggolan.

“Di luar itu, wilayah DPR pun banyak disandera oleh berbagai kasus besar yang menjerat kehormatan anggotanya sendiri baik penyimpangan moral pribadi ataupun anggaran, sehingga berdampak pada krisis kepercayaan publik terhadap lembaga DPR,”

“Timwas Century mendorong Tim Pengenbalian Aset melakukan segala upaya agar aset yang dibekukan di dalan nageri maupun di dalam negeri segera dicairkan atau dirampas untuk menutup kerugian negara,” Ketua DPR Marzuki Alie.

AM Fatwa.

“DPR ini almamater saya yang sangat saya cintai, saya ikut bersedih. Betapa kebanggaan saya, saya dari penjara menjadi pimpinan di sini, sehingga saya menulis buku dari ‘Cipinang ke Senayan’. Tapi banyak teman-teman saya yang berangkat dari Senayan ke Cipinang, ya itu saya sangat sedih,”

Kirim Opini Anda ke email: metrotapanuli Maksimal tulisan 5.000 karakter

Sikap Kami Menjaga Kerukunan PENYERANGANterhadap kelompok minoritas akhir-akhir ini menunjukkan betapa problem kerukunan masih menggelayuti bangsa ini. Celakanya, kita seperti tak mau belajar dari peristiwaperistiwa terdahulu, seperti penyerangan terhadap kelompok Ahmadiyah, sehingga kita tak serius menjaga kerukunan. Kalaupun belajar, kita seperti tak kunjung pintar menjaga kerukunan. Itu sebabnya peristiwa yang mengoyak kerukunan berulang kali meletus. Penyerangan terhadap kelompok minoritas Ahmadiyah tak hanyasekali,tetapiberulang-ulangterjadi.Penyeranganterhadap umat kristiani yang tengah beribadah pun berkali-kali terjadi. Paling mutakhir penyerangan terhadap kelompok minoritas Syiah di Sampang, Madura, Jawa Timur, Minggu (26/8). Penyerangan itu bukan yang pertama. Penganut Syiah itu mendapat serangan serupa pada Desember 2011. Semestinya tragedi Sampang menjadi pelajaran bahwa kita harus serius menjaga kerukunan. Kerukunan bisa dijaga bila kita memahami bahwa keberagaman merupakan keniscayaan sosial, hukum alam, sunatullah. Segala makhluk yang ada di kolong langit ini pastilah plural, jamak, banyak, tidak tunggal. Hanya Sang Pencipta yang satu, esa, tunggal. Manusia berasal dari berbagai ras, etnik, agama, dan kebudayaan. Hasil cipta, rasa, dan karsa manusia pun beragam. Termasuk penafsiran atas agama juga beragam. Itu sebabnya banyak sekali aliran dalam agama-agama. Bangsa ini harus menyadarihukumalamtidakbisadilawan.Melawanhukumalam hanya menghasilkan kerusakan, kesengsaraan, dan penderitaan. Penghormatan terhadap keberagaman akan menciptakan harmoni. Itulah sebabnya para pendiri bangsa menciptakan semboyan Bhinneka Tunggal Ika.Sayang sekali, bangsa ini seperti melupakan, bahkan melawan, kebinekaan. Penyerangan atas nama agama terhadap kaum minoritas di Tanah Air merupakan perlawanan terhadap kebinekaan, keberagaman, dan hukum alam. Hasilnya pun hanyalah kerusakan, kesengsaraan, penderitaan, dendam, dan trauma berkepanjangan. Oleh karena itu, kita tidak punya pilihan lain kecuali menerima keberagaman dalam kehidupan sosial kita. Mari kita rayakan keberagaman sebagai keindahan kehidupan. Negaratentupunyatanggungjawabbesarmenjagakerukunan. Negara harus menjadikan penyerangan terhadap kelompok Syiah di Sampang sebagai pelajaran pamungkas. Negara harus menjadikan peristiwa itu sebagai momentum untuk ekstra serius menjaga kerukunan. Kita perlu menegaskan hal itu karena, alihalih menjaga kerukunan, negara justru acap memicu kerusuhan. Negara hadir malah untuk memicu penyerangan atas nama agama. Label sesat dari aparatur negara menjadi alat legitimasi oleh kelompok intoleran untuk menyerang kelompok-kelompok minoritas.Ketikapenyeranganatasnamaagamaituterjadi,negara malah absen. Terang benderang negara berpihak kepada satu kelompok ketika menyelesaikan problem kerukunan. Padahal, negaramestibersikapbijakdanadil.Negaradisebuttelahmenjaga kerukunan hanya bila ia hadir dan berdiri di atas semua golongan yang hidup di negeri ini. (**)

Menebar Citra di Hari Idul Fitri Dari lebaran ke lebaran sepertinya kaum pemudik semakin dimanjakan. Mereka tidak perlu lagi berpanas-panasan untuk antre tiket, bus atau kereta, ataupun ditipu calo saat membeli tiket, sebab sekarang mereka bisa ikut program mudik bareng gratis. : Ardi Winangun MENJELANG lebaran, beberapa tahun sebelumnya dan saat ini, semakin banyak pihak, seperti partai politik, perusahaan swasta, bahkan komunitas masyarakat daerah, yang mengorganisasi mudik secara massal dan gratis, bahkan sepanjang perjalanan pemudik diberi makan dan minum. Bila pengelola mudik bareng royal, pemudik diberi kaos dan topi serta atribut lainnya. Lihat saja saat kita melintas di komplek Gelora Bung Karno, Jakarta, beberapa hari menjelang lebaran banyak terlihat pos pemberangkatan mudik bareng yang digelar berbagai perusahaan, seperti pabrik semen, perusahaan minum, dan ada partai politik. Pos pemberangkatan mudik itu nampak meriah, berbagai atribut mereka seperti bendera, baliho, dan umbulumbul dipasang secara mencolok. Akibat dari mudik bareng ini, ada pihak yang merasa dirugikan, yakni perusahaan otobus. Dalam sebuah kabar di media massa diberitakan, perusahaan otobus mengalami penurunan omset tiket penjualan angkutan mudik. Menurut Boy Mando, agen tiket Bus Gumarang Jaya rute Jakarta-Padang mengatakan, kegiatan mudik gratis yang digelar banyak perusahaan, hanya menguntungkan warga yang mau mudik, tapi merugikan PO yang biasa melayani angkutan mudik lebaran di berbagai terminal di Jakarta. Dikatakan kepada sebuah media massa beberapa waktu yang lalu, mudik bareng gratis menurunkan

omset penjualan tiket PO, yang biasanya H-7 tiket sudah terjual habis, sekarang hingga H-5 Lebaran tiket masih tersisa cukup banyak. Lebih lanjut dalam berita itu dikatakan, tahun ini lebih turun dari tahun 2011. Tahun ini, tiket belum habis beberapa hari menjelang lebaran. Lima tahun lalu, H-7 tiket sudah habis. Sekarang, sejak H-7 hingga beberapa hari menjelang lebaran, dirinya hanya memberangkatkan tiga bus dengan total 120 penumpang. Bagi pihak yang mengorganisir mudik bareng ada misi-misi sosial yang dilakukan, namun ada pula misi politik atau membangun citra untuk kepentingankepentingan tertentu. Bagi perusahaan swasta, mudik bareng bisa dilakukan dengan tujuan untuk mengucapkan terima kasih atas loyalitas masyarakat yang telah menggunakan produknya. Bisa juga untuk mengikat masyarakat agar tetap mau menjadi distributor atau pedagang perusahaan swasta itu. Bagi partai politik, menggelar mudik bareng tentu sebagai salah satu bentuk kampanye untuk kepentingan Pemilu 2014. Dengan mudik bareng inilah pengurus partai membangun citra bahwa partainya adalah partai politik yang peduli kepada masyarakat. Melalui ikatan emosional mudik bareng inilah, partai politik mencoba mengikat masyarakat untuk memilih partainya. Kampanye atau membangun citra di saat mudik ini merupakan sebuah cara yang efektif untuk menebar pengaruh. Dalam arus mudik, jutaan orang secara bergelombang bergerak ke arah yang sama, seperti dari Jakarta menuju Jawa Tengah, Jawa Timur, Jogjakarta; Jakarta menuju Sumatera; Bandung menuju Jawa Tengah, Jawa Timur, dan Jogjakarta; serta dari satu titik ke titik lainnya. Menurut Menteri Perhubungan, E. E. Mangindaan, dalam sebuah berita, memprakirakan jumlah pemudik melalui angkutan jalan untuk tahun 2012 sebesar 5,5 juta penumpang, angkutan sungai dan penyeberangan danau, 3,3 juta penumpang, Kereta Api diprediksi 1,3 juta penumpang, untuk angkutan laut 1,5 juta penumpang, angkutan udara 3,2 juta penumpang. Dari

data tersebut bisa dibandingkan bila tahun 2011 jumlah pemudik mencapai 13 juta orang maka di tahun 2012 ada sekitar 14,8 juta orang. Bila partai politik mampu menebar citra dan pengaruh pada 14,8 juta pemudik, maka partai politik itu bisa masuk 3 besar peraih suara terbanyak dalam Pemilu 2014. Kenapa demikian? bila kita mengacu pada Pemilu 2009 terlihat perolehan suara partai politik adalah: Partai Demokrat 21.703.137 suara atau orang, Partai Golkar 15.037.757 suara, PDIP 14.600.091 suara, PKS 8.206.955 suara, PAN 6.254.580 suara, PPP 5.533.214 suara, PKB 5.146.122 suara, Gerindra 4.646.406 suara, dan Hanura 3.922.870 suara. Dari data tersebut menunjukan bahwa jumlah pemilih partai politik seperti PKS, PAN, PPP, PKB, Gerindra, dan Hanura, tidak sebanyak jumlah pemudik di tahun 2011 atau 2012. Dengan demikian tak heran bila partai politik berlomba-lomba untuk menggelar mudik bareng. Lihat saja, PAN dalam mudik bareng tahun ini menyediakan 200 bus, PKB menyediakan 35 bus AC, Partai Golkar 120 bus, dan Partai Demokrat 109 bus. Mayoritas bus-bus itu mempunyai tujuan ke berbagai kota di pulau Jawa dan Sumatera. Mudik bareng yang digelar partai politik itu baik-baik saja dan syah-syah saja, namun dengan adanya mudik bareng yang difasilitasi partai politik, menunjukan bahwa biaya politik yang dikeluarkan untuk kampanye semakin tinggi. Untung saja Idul Fitri setahun hanya sekali, bayangkan kalau Idul Fitri setahun dua kali. Semakin banyaknya kegiatan yang dilakukan partai politik untuk menjaring suara tentu akan mempengaruhi kondisi kas partai politik. Nah di sinilah perlunya transparansinya partai politik dalam mengelola keuangannya. Bila tidak transparan, jangan-jangan biaya mudik bareng itu diperoleh dari dana-dana yang tidak jelas, diambil dari ngentit proyek-proyek besar atau menaikan anggaran pembangunan. Selamat Idul Fitri 1433 H, Mohon Maaf Lahir dan Batin. (***) Penulis adalah Pengamat Sosial dan Budaya



30 Agustus 2012

GADIS 20 TAHUN TEWAS MELEPUH RUMAH TERBAKAR SAAT LISTRIK PADAM SIBOLANGIT- Kediaman Salam Sinuhaji (60), Jalan Jamin Ginting Desa Bingkawan, Kecamatan Sibolangit, Deli Serdang, terbakar, Selasa (28/8) malam. Akibat kejadian, anak gadisnya yang berusia 20 tahun, Rika br Sinuhaji, tewas melepuh dijilat api.

„ Eni, pembantu yang membobol kartu ATM majikan Rp3,5 juta. Kini ia diamankan polisi.

Pembantu Bobol ATM Majikan

HAFAL NOMOR PIN SAAT BELANJA JAKARTA- Wanita pembantu ini tak bisa dipercaya. Berulangkali dimintai majikannya mengambil uang dengan kartu ATM, ia menghafal nomor PIN-nya. Lalu diam-diam ia membobol Rp3,5 juta saat majikannya tidur. Aksi Eni (18) terungkap ketika majikanya Silvia Hakim memeriksa saldo ATM miliknya. Wanita 32 tahun itu kaget karena ada pengeluaran di luar perhitungannya. Upayanya menanyakan persoalan ATM yang bobol pada wanita pembantu rumah tangga (PRT) itu tak mendapat jawaban memuaskan. Kapolsek Tanjung Duren Kompol Dwi Indra Laksmana SIK mengatakan, kasus terungkap setelah korban memeriksa tas pembantunya. “Korban menemukan struk pengambilan uang Rp500.000 dari nomor ATM-nya,” ujarnya. Temuan barang bukti itu dilaporkan istri pengusaha plastik Ade Husni (37) ini ke polisi. Memimpin anak buahnya, Kanit Reskrim Polsek Tanjung Duren AKP Budi Setiadi langsung menjemput Eni di kediaman majikan di Apartemen Meditrania Tanjung Duren, Senin (27/8) malam. Dengan bukti tertulis, Eni tak bisa berkelit. Ia mengakui semua perbuatannya. Ibu dua anak asal Sukabumi, Jawa Barat, yang sudah 8 bulan bekerja pada Silvia dengan gaji Rp700.000 sebulan itu mengaku dipercaya majikan untuk belanja dengan ATM. Katanya, setiap pagi ia belanja berbagai kebutuhan dapur sesuai menu yang akan dimasak.

“Sekali belanja bisa Rp200.000 sampai Rp300.0000, bahkan kalau perlu bisa menambah hingga Rp500.000. Semua itu dibayar pakai ATM sampai-sampai saya hafal nomer PIN seperti yang disebutkan majikan,” ungkapnya. Majikan Tidur Melihat kemudahan mengeluarkan uang serta majikan yang dianggap tak memeriksa saldo dalam ATM, timbul niat jahat Eni. Ia pun membobol ATM itu Rp1 juta. Ditunggu berhari-hari majikan dianggap tak curiga, ia mengulang menggesekkan kartu itu untuk mengambil Rp1 juta. “Karena tak pernah ada teguran, saya jadi ketagihan,” ujarnya. Maka, Eni kembali mengambil Rp200,000, Rp500.000 dan terakhir Rp800.000. Tercatat, dalam seminggu, uang Rp3,5 juta dibobol dari ATM majikannya. Eni mengaku pembobolan dilakukan saat majikannya tidur. Kartu yang disimpan Silvia dalam dompet diam-diam diambilnya lalu ia keluar mencairkan uang sesuai keinginannya dan kembali ke apartemen sebelum majikannya bangun. Kartu itu dikembalikanya ke tempat semula. Eni mengaku uang curian itu dipakai untuk membayar utang teman di kampung. Sisanya digunakan untuk membeli pakaian. “Sekarang saya menyesal. Ibu begitu baik dan percaya sama saya. Tapi saya nggak bisa membalas kebaikannya,” katanya. (pk/int)


Saya Merasa Tersiksa di Penjara Pak Hakim! SIMALUNGUN- Markus Saragih (58) warga Dusun Tanoh Tinggir Nagori Tanoh Tinggir, Kecamatan Purba, Simalungun, meminta keringanan hukuman setelah jaksa menuntutnya empat bulan penjara, Rabu (29/ 8). Terdakwa mengaku menyesal dan mengaku ia merasa tersiksa hidup di penjara. Hal itu terungkap pada persidangan yang digelar di PN Simalungun yang dipimpin majelis hakim Ramses Pasaribu dan Jaksa Penuntut Umum (JPU) Viktor Purba. Menurutnya, terdakwa terbukti secara sah dan meyakinkan melakukan tindak pidana melakukan penganiayaan dan melanggar pasal 351 ayat 1 KUHPidana. “Peristiwa berlangsung pada Minggu (20/5) sekira pukul 22.00 WIB. Saat itu terdakwa datang ke warung Koperasi Dusun Tanoh Tinggir. Setibanya di warung, terdakwa melihat saksi korban Bangkit Tambun Saribu bersama Nembak Saragih dan Lerman Purba tengah minum tuak,” sebutnya. Dia menerangkan, terdakwa pun ikut bergabung minum tuak dan memilih duduk di samping korban. Saat itu korban bercerita tentang usaha pertaniannya. “Di tengah pembicaraan, korban mengatakan ‘aku anggapnya kau sama Nembak ini sama, namun ada bedanya’. Mendengar itu terdakwa menanyakan apa beda yang dimaksud,” tiru Jaksa. Kemudian korban menjawab ‘kalau sama Nembak bisa sukasuka saya tapi sama kau saya masih segan’. Mendengar itupun terdakwa memilih diam dan melanjutkan minum tuak. Tetapi korban kembali mengatakan hal yang sama terhadap terdakwa dan Nembak.“Mendengar peryataan sama itu, terdakwa mulai kesal. Tanpa basa-basi ia

„ Markus Saragih meninju wajah korban sebanyak dua kali,” paparnya. Berdasarkan pertimbangan itu, agar majelis hakim menyatakan terdakwa terbukti secara sah dan meyakinkan melakukan penganiayaan. “Selanjutnya Jaksa menuntut terdakwa empat bulan penjara dikurangi masa tahanan,” tambahnya. Usai mendengar tuntutan itu, hakim memberikan kesempatan kepada terdakwa untuk menyampaikan sesuatu. Lalu pria ini mengaku menyesali perbuatannya. “Saya melakukannya lantaran emosi. Tapi pak, saya bermohon untuk diberikan keringanan hukuman, usia saya sudah tua dan istri juga sudah tua. Saya tersiksa di penjara, mengingat usia saya yang sudah tua. Saya meminta permohonan agar hukuman saya diringankan,” terangnya. Menurutnya, ia mengaku sudah tidak tahan dan berharap permohonannya diterima. Hakim Ramses Pasaribu yang mendengar permohonan itu sedikit berseloroh dengan mengaku akan menghukum terdakwa setahun penjara. “Mau mati rasanya bila lamalama di Lapas itu,” ujat terdakwa lagi. (mua/hez)

Foto Roy

„ Jenazah Rika, gadis yang tewas melepuh setelah kediamannya terbakar, diratapi keluarga, Rabu (29/8).


SIMALUNGUN- Bunga, bocah berusia lima tahun, dicabuli ayah tirinya Parulian Nainggolan (35), warga Aek Bottar Nagori Buntu Bayu, Kecamatan Hatonduan. Bunga disetubuhi saat ia membangunkan ayahnya dan mengajak ke kamar mandi untuk menemaninya buang air kecil. Hal itu terungkap pada persidangan yang digelar di PN Simalungun dipimpin majelis hakim Monalisa beranggotakan Silvia Ningsih, Rabu (29/8). Menurut Jaksa Penuntut Umum (JPU) Josron Malau, perbuatan pria yang bekerja sebagai petani itu melanggar pasal 81 ayat 1 No 23 Tahun 2002 tentang Perlindungan Anak. “Peristiwa berlangsung, Minggu (22/4) sekira pukul 23.00 WIB, di kediaman mereka. Saat itu terdakwa tidur bersama Bunga di kamar belakang. Kemudian korban yang merupakan anak tirinya membangunkan

„ Parulian Nainggolan terdakwa dengan mengatakan ‘Pak kawani aku kencing ke kamar mandi. Aku tidak bisa menghidupkan lampu!” ungkap jaksa. Lalu terdakwa bangun dan

membawa korban ke kamar mandi. Saat itu terdakwa menghidupkan lampu kamar mandi dan masuk bersama dengan korban. Setelah itu dengan polosnya korban membuka celana dan kencing. Sementara terdakwa yang tepat berada di samping korban, juga membuang air kecil. “Ternyata terdakwa melihat kemaluan korban hingga timbul birahinya. Selanjutnya terdakwa mencabuli dan menyetubuhinya,” terangnya. Melihat tindakan terdakwa, korban langsung menangis karena kesakitan. “Untuk mengalihkan tangisan itu, terdakwa memandikan korban. Setelah itu, ia membawa anak tirinya itu ke kamar tidur,” sebut Malau. Sementara dari hasil visum, ditemukan memar dan biru di alat kelamin luar. Selaput dara robek di posisi jam2, 3, 7,9 dan sampai ke dasar. (mua/hez)

Informasi dihimpun menyebutkan, malam itu Salam yang tak memiliki mesin genset, menyalakan lampu teplok di kediaman mereka yang sekaligus tempat usahanya. Sebab aliran listrik di kampung mereka sedang padam. Kebetulan, salah seorang anak Salman yang bernama Rika Br Sinuhaji, diketahui bekerja sebagai karyawati di Hill Park Sibolangit, baru saja selesai mandi dan masuk ke kamar untuk mengganti pakaian. Salman bersama isterinya Kumpul Br Sembiring (55) dan dua anak lainnya berkumpul di ruang tamu. Sedangkan Ricard, putra sulungnya sedang memancing di sungai. Tanpa diketahui pasti, api yang berasal dari lampu teplok yang mereka nyalakan tiba-tiba menyambar barang-barang yang mudah terbakar. Beberapa saat kemudian, api semakin membesar dan kepulan asap memenuhi seluruh ruangan, termasuk kamar Rika. Tahu rumahya terbakar, Salman bersama isteri dan dua anaknya langsung berlari ke luar untuk menyelamatkan diri sembari berteriak kebakaran. Masyarakat sekitar yang melihat rumah Salam terbakar secara sukarela berdatangan untuk memberi bantuan manual, sekaligus melaporkan kejadian ke Polsek Pancurbatu. Untuk memudahkan upaya pemadaman, warga pun menghentikan beberapa unit truk tangki air yang datang dari arah Sibolangit. Saat mendengar ada teriakan minta tolong dari salah satu kamar rumah Salam, dengan gesit dan tanpa memikirkan resiko, Tamat yang merupakan tetangga korban langsung meringsek masuk setelah sebelumnya mendobrak pintu kamar. Ternyata, suara teriakan itu adalah Rika Br Sinuhaji yang merupakan anak ke tiga Salman. Rika tak bisa lagi menyelamatkan diri karena seluruh ruangan kamarnya dipenuhi asap. Bahkan, sekujur tubuh dan wajahnya juga sudah melepuh karena terjilat kobaran api. Setelah berhasil mengeluarkan Rika dari kamar, kedua orangtuanya dibantu warga, langsung melarikan Rika ke tempat pengobatan alternatif di kawasan Namo Pecawir, Kecamatan Pancurbatu. Tak lama kemudian, petugas Polsek Pancurbatu yang dipimpin langsung Kanit Reskrim AKP P Samosir, turun ke TKP untuk melakukan penyelidikan. Setibanya di sana, kobaran api sudah berhasil dipadamkan. Selanjutnya, petugas mengamankan sisa barang yang terbakar sebagai barang bukti. Karena kondisi luka bakar yang cukup parah, pada Rabu (29/8) sekira pukul 06.00 WIB, nyawa Rika akhirnya tak tertolong lagi. Jenazah Rika langsung disemayamkan ke Bingkawan untuk selanjutnya dikebumikan. Kapolsek Pancurbatu Kompol Darwin Sitepu melalui Kanit Reskrim AKP P Samosir saat dikonfirmasi mengatakan, asal api diduga kuat karena lampu teplok yang dinyalakan si pemilik rumah menyambar barang yang mudah terbakar. Bahkan, tabung gas elpiji yang berada di dapur rumah juga sempat meledak karena tersambar kobaran api. “Dalam kaitan itu, kita sudah mengamankan barang bukti dan meminta keterangan pemilik rumah dan sejumlah saksi mata,” ujar Samosir. Pantauan METRO di Jambur Bingkawan, Rabu (29/ 8) pagi, terlihat kedua orangtua berikut keluarga korban meratapi kepergian korban. Mereka tak menyangka, gadis yang dikenal ramah dan murah senyum itu meninggal dunia dengan cara yang tragis. Apalagi, kondisi korban cukup mengenaskan, sekujur tubuh dan wajahnya sudah hitam karena hangus terbakar. Bahkan, rambutnya juga sudah tak terisa lagi. Mereka juga menyesalkan kinerja pihak PLN yang sering melakukan pemadaman listrik di kawasan Sibolangit dan sekitarnya. Sebab kalau listrik padam, warga pasti menggunakan alat penerangan alternatif agar tidak merasa kegelapan. (roy/smg)

Pantesan Suami “Jarum Super” JIKA suami kecanduan rokok Jarum Super, seorang istri takkan sewot. Tapi ketika “jarum super” itu mengandung makna: jarang di rumah suka pergi, layak saja Ny Dwiyani (30) jadi nyap-nyap. Bayangkan, suami ngelayap melulu, ternyata kelonan dengan janda muda di rumah kontrakan. Coba… Suami jarang di rumah, itu pertanda lelaki sibuk. Bisa dalam karier, bisa non karier. Dalam karier misalnya, anggota DPR yang studi banding melulu, karena itu wujud pengabdian pada rakyat (katanya) yang diwakili. Tapi non karier, ini yang sering jadi bahaya latent rumahtangga. Ngakunya turba ke sana kemari, eh nggak tahunya turba dalam artian “turu bareng” bersama wanita. Nah, istri cap apa yang nggak mencak-mencak? Problem inilah yang kini tengah melilit rumahtangga Dwiyani-Andri (33), warga Kelurahan Bentiring Permai, Kecamatan Muara Bangkahulu, Bengkulu. Meski mereka sudah ber-

koalisi sekian lama, tapi masih juga belum satu visi dalam kehidupan rumah tangga. Maunya istri, sepulang kerja Andri langsung pulang bersatu dalam keluarga. Tapi sebagai keluarga muda, Andri tak mau diatur-atur seperti itu. Maka biasanya, habis kerja masih kelayapan ke mana-mana, sehingga tiba di rumah sudah malam. Bagi Dwiyani, sepanjang kepergiannya itu ada nilai margin (untung) untuk ekonomi keluarga, nggak masalah. Tapi yang terjadi, gaya hura-hura Andri yang suka kumpul-kumpul dengan kelompoknya ini justru berdampak pembengkakan anggaran. Karena gaji yang mestinya dibawa ke rumah, sering dipakai buat mentraktir teman-teman. Mending kalau gajinya gede, wong buat makan sehari-hari saja paspasan. Karena kelakuan yang demikian, Dwiyanti jadi kesal deh sama suami. Maka kemudian yang sering terjadi, begitu suami tiba di rumah sekitar pukul

21.00 WIB, langsung diberi kuliah tujuh menit yang isinya berupa omelan dan gerutuan. Tentu saja minum dan makannya Andri jadi tak pernah nyaman, rasanya seret macam makan kue bolu tanpa minum! Nyaris setiap hari dapat “kultum” non Aak Gym, Andri sampai pada sebuah wacana bahwa koalisi ini harus diakhiri. Dia berniat menceraikan istrinya.

Maka kepada kiai setempat, secara agama talak itu dijatuhkan. Maka sejak itu, meski satu rumah, Andri sudah tidak lagi tidur seranjang dengan istrinya. Dan sejak itupula, dia semakin jarang pulang, menjelma menjadi lelaki “Jarum Super” tanpa bandrol. Karena sudah talak agama, mestinya Dwiyani tak perlu ber-

harap banyak akan perginya suami. Tapi dia beranggapan lain, selama masih tinggal di rumahnya, tanggungjawab sebagai kepala rumah tangga harus ada. Soal jaminan onderdil, dia bisa memaklumi. Tapi jaminan material kok tiba-tiba juga berhenti, wah nanti dulu… Diam-diam Dwiyani mengadakan penyelidikan, hasilnya ternyata: Andri sudah punya WIL baru, sehingga kini Andri lebih banyak ngendon di rumah kontrakan sang gendakan. Buru-buru dia lapor polisi dan diadakan penggerebekan di rumah kontrakan di Jalan WR Supratman Kelurahan Bentiring. Dugaan benar, Andri ditemukan di situ bersama janda muda. Meski dalam kondisi tidak berbuat, keduanya pun digelandang ke Polsek Muara Bengkulu. Dalam pemeriksaan, Andri mengaku bahwa sudah cerai agama, hanya belum didafarkan ke Pengadilan Agama saja. Dengan WIL sudah kawin agama, belum? (pk/int)



30 Agustus 2012

Pakar Hukum: Mangkir, Sintong Harusnya Ditahan Sambungan Halaman 1 dana, Prof Andi Hamzah di Jakarta, Rabu (29/8). “JPU harus pro aktif meminta polisi menangkap dan menghadirkan terdakwa ke persidangan,” ungkapnya saat dimintai tanggapannya terkait perkara Sintong Gultom yang ditangani Kejaksaan Negeri Sibolga. Andi sendiri merasa heran, mengapa kasus ini bisa sampai berlarut-larut. Padahal melihat fakta-fakta hukum yang ada, seharusnya perkara telah dapat diselesaikan sejak lama. Untuk itu selain meminta pada JPU, Andi juga berharap aparat kepolisian juga melakukan langkah-langkah yang dibutuhkan. Diantarany tentu saja melakukan penangkapan. Sehingga dengan demikian, ia yakin proses persidangan selanjutnya akan dapat berjalan lebih mudah. Namun tentunya langkahlangkah hukum tidak hanya berhenti sampai pada penangkapan semata. Untuk itu pada proses persidangan, JPU menurut Andi juga harus meminta majelis hakim mengeluarkan penetapan penahanan. “Supaya tidak terulang apa yang dilakukan tersangka pada persidangan sebelumnya,” ungkapnya. Sementara itu secara terpisah, pakar hukum pidana Prof Dr Syafruddin Kalo juga menyatakan hal senada. Ia bahkan menilai penahanan Sintong perlu segera dilakukan, agar tidak menghalangi perbuatan yang sebelumnya telah ia lakukan. Yaitu tidak hadir pada persidangan. “Jadi sudah ada alasan yang tepat dan cukup untuk menahan tersangka. JPU jangan ragu-ragu. Apalagi ancaman pidana yang didakwakan terhadapnya, hingga di atas 5 tahun penjara,” tegasnya. Sebagaimana diberitakan sebelumnya, Sintong ditetapkan sebagai tersangka terkait kasus illegal loging yang terjadi pada

tahun 2005 lalu. Saat itu Sintong Gultom sendiri belum menjabat pengurus Partai Demokrat dan juga Ketua DPRD Tapteng. Dari proses hukum selanjutnya, pada Oktober 2006 JPU melimpahkan berkas ke Pengadilan Negeri setempat. Dimana majelis hakim menggelar sidang dengan pembacaan surat dakwaan. Dalam putusan sela, eksepsi terdakwa dikabulkan oleh hakim dengan alasan dakwaan disusun tidak cermat dan lengkap. Atas putusan tersebut, JPU mengajukan perlawanan hingga tingkat kasasi di Mahkamah Agung (MA). Namun dalam putusan Kasasi No 1194 K/Pid.Sus/2008 tgl 3 Nopember 2008 dinyatakan jika surat dakwaan tersebut telah sesuai dengan ketentuan hukum. Dan memerintahkan pengadilan negeri untuk melanjutkan pemeriksaan materi perkara atas terdakwa Sintong Gultom. Namun ternyata dalam persidangan yang digelar sebanyak 6 kali, Sintong tidak pernah hadir. Sehingga sidang tidak bisa dilanjutkan. Sementara Kejari Tapteng tidak melakukan upaya paksa berupa penangkapan terhadap terdakwa. Majelis hakim selanjutnya mengembalikan berkas perkara ke Kejari Sibolga. Sejak itu sampai November 2011 perkara terdakwa Sintong luput dari proses hukum. Pada 21 November 2011 berkas perkara kembali disidangkan, dan terdakwa tidak pernah hadir meski sidang lagi-lagi digelar 6 kali dan Kejaksaan juga tidak melakukan upaya paksa berupa penangkapan. Bahkan tgl 6 Februari 2012 Kejari Sibolga menyatakan mencabut berkas perkara melalui surat yang ditujukan kepada majelis hakim dengan alasan perkara nebis n idem. Padahal berdasarkan pasal 76 ayat 2 KUHP, perkara tersebut tidak bisa dinyatakan nebis in idem. (gir)

Sekwan jadi Tersangka Sambungan Halaman 1 di ruang kerjanya. Ia mengatakan, pemeriksaan terhadap Singwani terkait laporan pengaduan pemalsuan stempel pimpinan DPRD Tapteng Sintong Gultom. Sintong secara resmi mengadukan Jamaluddin Pohan dan Singwani Siregar atas tuduhan pemalsuan stempel yang mengakibatkan kerugian negara sebesar Rp200 juta ke Poldasu, sesuai bukti laporan pengaduan (LP) polisi Nomor: LP/627/VI/ 2012 SPKT II tanggal 8 Juni 2012. Poldasu kemudian melimpahkannya ke Polres Tapteng untuk penyidikan lebih lanjut. “Dalam penyelidikan ini, Singwani Siregar kita panggil sebagai tersangka, pembuatan dan penggunaan stempel palsu pimpinan DPRD Tapteng,” ujar Enriko. Wakapolres menerangkan, dalam penyidikan Singwani mengaku telah melakukan pencetakan stempel baru pimpinan Dewan. Dengan bukti satu buah stempel yang di palsukan serta surat yang menggunakan stempel baru di cetak. “Keterangan sementara yang kita dapat dari tersangka, dia mengakui telah melakukan pencetakan stempel dan digunakan,” terangnya. Saat dipertanyakan terkait penggunaan stempel yang di palsukan, Wakapolres mengatakan bahwa pemeriksaan masih sebatas proses pembuatan stempel yang baru. “Sementara kita melakukan penyelidikan tentang pemalsuan stempel dulu. Kita akan pelajari dulu BAPnya, apa guna stempel tersebut dan kemana saja stempel itu telah

digunakan. Sedangkan untuk membuktikan penggunaan stempel yang palsu, kita butuh proses dan orang yang ahli di bidangnya,” ujarnya. Terkait pidana yang dikenakan kepada Singwani, Wakapolres mengatakan Sigwani dijerat dengan Pasal 263 dan Pasal 264 junto Pasal 55 KUHPidana tentang pemalsuan surat dengan ancaman 6 tahun penjara. “Kepada tersangka tidak kita lakukan penahanan,” sebutnya tanpa merinci alasan tidak dilakukan penahanan. Terpisah, Singwani melalui kuasa hukumnya Mahmudin Harahap SH saat di wawancarai usai menghadiri pemeriksaan mengatakan terkait dugaan pemalsuan dan penggunaan stempel DPRD Tapteng, dia mengacu kepada Peraturan Bupati No 17 tanggal 30 Juli Tahun 2012. “Dalam Perbup tersebut dikatakan, stempel yang berlaku di lingkungan DPRD adalah sebagaimana diatur dalam Perbup yang dituangkan di Sekeretaris Kabupaten Tapteng. Di dalam Perbup itu dituangkan, yang berwenang dalam penggunaan stempel DPRD adalah Pimpinan DPRD bukan ketua,” jelasnya. Merujuk kepada surat Sekretaris Jenderal tanggal 3 Agustus 2012, kata Mahmudin, pejabat yang berhak menggunakan stempel DPRD adalah Ketua dan Wakil. Sedangkan yang berwenang memengang dan menyimpan stempel DPRD adalah sekretaris DPRD, bukan ketua. “Sekarang dari mana ketua mendapat stempel DPRD? Bila hal itu tidak dilaksanakan, berarti ada yang telah melanggar Perbub,” tegasnya. (cr-1)

Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

TPL Rampas Lahan Warga Sambungan Halaman 1 pencaharian mereka yang tersebar di Naga Hulambu dan Paronggangan di Nagori Pondok Buluh, diserobot PT Toba Pulp Lestari (TPL) sektor Aek Nauli untuk ditanami eucalyptus. Jahotman Nainggolan (32), salahseorang petani, mengatakan, sejak tahun 2005 pihak TPL memulai penyerobotan paksa lahan pertanian masyarakat. Setiap kali melakukan aksi brutal itu, pihak TPL membawa pengawal minimal oknum Brimob dengan persenjataan lengkap. “Mereka menakut-nakuti masyarakat. Siapa yang melawan diancam ditembak. Terang saja masyarakat ketakutan, dan sudah ada 26 kepala keluarga yang mundur. Lahan mereka sudah habis ditanami pohon eucalyptus oleh pihak TPL,” ungkap Jahotman kepada METRO, Rabu (29/8). Menurut Jahotman, sikap brutal itu hingga saat ini masih tetap berlangsung. Pada tanggal 2 Agustus, perusahaan TPL kembali menyerobot paksa lahan masyarakat di Huta Naga Hulambu, Nagori Pondok Bulu. Saat terjadi penyerobotan itu, dua anggota Brimob mengancam akan menembak kalau masyarakat tetap mengganggu aktivitas pekerjaan TPL. Karena warga berkeras mempertahankan

lahannya, pihak TPL hanya bisa menanami 4 rante dari puluhan hektare lahan warga di Huta Naga Hulambu. “Saya menyatakan siap ditembak demi mempertahankan ladang saya supaya tidak diserobot. Sudah turun temurun keluarga kami berladang di kampung ini. Tetapi tiba-tiba TPL datang dengan pasukan dan alat beratnya melakukan penanaman paksa,” tegasnya. Ia menegaskan, dia akan terus mempertahankan lahannya supaya tidak dirampas TPL. Soal tanaman yang sempat dirusak TPL akan dia tuntut diganti rugi. “Mingguini,kamimasyarakatakanberdemo ke TPL. Kami tidak terima lahan kami diserobot paksa, dan tanaman di dalamnya dirusak dengan alat berat,” ujarnya. Dia mengatakan, akibat perusakan yang dilakukan TPL itu, pihaknya mengalami kerugian hingga puluhan juta rupiah. Dia menyebutkan, ada berbagai macam tanaman milik warga yang dirusak pihak TPL, seperti kopi ateng, aren, pisang, cabai, jengkol, dan petai. “Semua tanaman di ladang saya ini diratakan pakai alat berat. Saat itu, mereka membawa dua anggota Brimob, dan satunya bermarga Pandiangan. Saya diancam akan ditembak. Memang mereka pakai baju polisi, ada tulisan Brimob di baju dinasnya, dan mengancam tembak saya. Lalu saya jawab, saya siap mati ditembak

untuk memperjuangkan lumbung pertanian tempat kami hidup sehari-hari,” katanya. Sementara itu, petani yang lahannya sudah ditanami ekalyptus oleh TPL terpaksa tidak bekerja. Antara lain Rudin Nainggolan, Janangon Sijabat, Poltak Purba, Omer Sinaga, Probel Sinaga, Sulaiman Sinaga, Bottan Sitio, Amin Sinaga, Jawanter Sijabat, Rijon Sidabutar, Raya Manik, Saut Sinaga, Sius Pakpahan, Bonor Sinaga, Bilson Tindaon. Kemudian Esron Tindaon, Marudut Sinaga, Kinsen Sinaga, Japatar Sinaga, Ramli Sinaga, dan James Tindaon. Lebih jauh Jahotman mengatakan, setiap melakukan penyerobotan, TPL tidak pernah kordinasi dengan pemerintah setempat dan masyarakat sekitar. Masyarakat yang mengetahui itu pun hanya karena ketepatan sedang di ladang. Sebab jarak perladangan warga dari jalan besar Siantar-Parapat sekitar 14 kilometer. “Kami berharap pemerintah pro rakyat. Perusahaan TPL sudah menginjak-nginjak masyarakat petani dengan merampas semua lahan pertanian. Kami sudah tidak ada pekerjaan lagi. Anak-anak kami mau makan apa? Kalau bekerja bukan mau cari kaya, tetapi untuk sesuap nasi saja,” ujarnya dengan raut wajah sedih. PanguluPondokBuluAlbinerSinagayang mengakuseringdipanggilpihakTPLmelalui

humasnyajugatidakpernahdatang.Padahal, pemanggilan itu untuk klarifikasi atas penyerobotan lahan pertanian masyarakat. Terpisah, Lambertus Siregar, Media Relationship TPL mengatakan, perusahaan TPL tidak pernah bekerja di luar izin yang dikeluarkan pemerintah. TPL memiliki izin pemanfaatan hutan kayu, dan sudah dilengkapi tapal batasnya. Itu artinya tidak berani TPL bekerja di luar itu, karena bisa terjerat hukum. “Sistem kerja TPL ada yang disebut Rencana Kerja Umum (RKU) yang sifatnya 10 tahun. Kemudian ada lagi Sistem Kerja Tahunan (RKT) yang sifatnya 1 tahun. Sistem kerja ini dilaksanakan di daerah sektor Aek Nauli secara bergantian. Tahun kemarin di daerah Nagori Sihaporas, dan tahun ini di Nagori Pondok Bulu,” bebernya. Lambertus mengutarakan, setelah mereka mengantongi izin, tidak ada seorang pun yang bisa mengelola kawasan TPL, kecuali pihak TPL sendiri. Sementara masyarakat yang sempat di dalamnya melakukan pemanfaatan lahan, selama ini diberikan kesempatan hanya sampai panen hasil pertaniannya. “Kita tidak ada serobot lahan pertanian masyarakat. Bahkan kita berikan mereka kesempatan sampai panen. Tetapi setelah panen, jangan lagi lahan tersebut diusahai,” ujarnya mengakhiri. (osi/dro)

Didesak Perbaiki Jalan Rusak Sambungan Halaman 1 jalan rusak tersebut. Desakan itu terkuak pada pertemuan antara Manejemen TPL dengan beberapa warga Desa Pangombusan, Banjar Ganjang, Sirait Uruk dan Desa Lumban Huala di kantor Camat Parmaiksian, Rabu (29/8). Pertemuan yang digagasi Camat Parmaksian Alfaret Manurung itu dimanfaatkan warga menyampaikan keluhan mereka selama pabrik penghasil bubur kertas itu hadir di Kecamatan Parmaksian, Tobasa. Edward Sitorus, mewakili warga mengatakan, sejak TPL beroperasi kembali pada tahun 2003, tak pernah berniat memperbaiki lingkungan. Tetapi, perusahaan raksasa ini hanya memikirkan bagaimana meraup untung sebesar-besarnya tanpa memperhatikan kesejahteraan masyarakat. Bahkan, TPL dinilai telah berhasil memecah belah masyarakat khususnya di sekitar lingkungan di mana

perusahaan itu beroperasi. Kerusakan jalan itu menurutnya akibat truk logging mitra TPL membawa muatan berlebihan (melebihi tonase). Pertemuan berdurasi hampir satu setengah jam itu terlihat alot. Warga dan beberapa pejabat TPL seperti Tagor Manik (Humas TPL), Ongung Tambunan dan beberapa stafnya sempat saling adu mulut. Bahkan, Tagor dan Edward saling berdebat menanggapi sampai dimana tanggungjawab TPL terhadap lingkungan. Beruntung Camat lihai dan selalu menengahi ketika situasi mulai memanas. Edward yang juga mantan pegawai TPL yang pada masa aktifnya bekerja di bidang Kehumasan terlihat paling keras bersuara. Merasa terpojok atau tidak, beberapa pertanyaan Edward tidak bisa dijawab Tagor Manik. ”Kami disini tidak untuk mendengar anda (Tagor Manik, red) berpidato panjang lebar, kami hanya ingin mendengarkan kapan TPL memperbaiki jalan di desa kami yang sudah rusak parah,” tantang Edward diamini Jasmen Situmorang dan Op Jonggi

Manurung, warga lainnya. Menanggapi hal itu, dengan tegas Tagor membantah pernyataan Edward dengan mengatakan pihaknya tak pernah mengkotak-kotakkan (memecah belah, red) masyarakat. Sementara perbaikan jalan rusak dia berdalih bukan tanggungjawab mereka melainkan pemerintah karena jalan tersebut adalah jalan pemerintah. Mendengar ocehan Tagor, membuat Edward marah besar. Lagi-lagi dengan suara yang keras dia menjelaskan, sebelum TPL hadir di wilayah itu, jalan tersebut selalu bagus karena dirawat PT Inalum. “Jalan ini dulu bagus, tidak pernah rusak karena pihak Inalum selalu memperbaiki apabila ada kerusakan. Mereka bertanggungjawab tidak seperti anda (TPL, red). Anda boleh lihat, mana ada jalan yang rusak di sekitar PT Inalum,” bentak Edward. Mendengar pernyataan Edward, Tagor terdiam seribu bahasa sehingga sempat membuat situasi hening beberapa saat. Lagi, Camat mengambil sikap dan

mengamankan situasi. Hingga pertemuan itu berakhir, tuntutan warga tak terealisasi. Bahkan, pihak TPL tak berani memastikan kapan perbaikan jalan dimulai. Kurang memuaskan, warga pun kecewa dan membubarkan diri. Jasmen Situmorang usai pertemuan kepada METRO mengaku terhadap jawaban Tagor Manik. Mereka mengancam apabila keluhan mereka tak juga digubris, warga bakal menanam pohon pisang di sepanjang jalan rusak. “Kami tunggu sampai hari Senin (3/ 9) mendatang. Jika tidak juga ada perbaikan dari TPL, kami akan bertindak. Kami menutup jalan itu dengan menanamnya pohon pisang di tengah jalan berlubang itu. Biar saja semua orang terganggu dan mengetahui seperti apa TPL itu. Sebab, dengan rusaknya jalan menyebabkan terjadi kecelakaan. Sejak jalan ini rusak, sudah banyak korban berjatuhan hanya garagara mengelakkan lubang,” pungkasnya. (brams/des)

Belajar Lagu Batak Untuk Opera Kolosal Sambungan Halaman 1 baru ini punya kerjaan di Amerika Serikat sehingga lama di luar negeri. Untuk menghapal 20 lagu berbahasa batak itu, Choky menyanyikannya hingga ke pesawat dan bandara. ”Dalam 10 hari di luar negeri, saya latihan juga. Bermodalkan handphone saya menghapal lagu-lagu itu di pesawat. Saat transit di Hongkong saya masuk ke gate lebih awal dan latihan sendiri,” ungkapnya. Choky juga meminta kepada sutradara untuk mentranslate lagu-lagu tersebut ke dalam bahasa Indonesia agar mudah dipahami. “Dari 20 lagu, hanya satu yang sebelumnya pernah saya dengar. Selebihnya lagu baru,” jelas Choky. Opera “Arga Do Bona ni Pinasa” yang berarti Cinta kepada Kampung Halaman Opera ini akan digelar tanggal 1-2 Sepetember 2012, di Plenary Hall, Jakarta Covention Center. Choky akan berpasangan dengan Zivanna Letisha Siregar (Zizi) Puteri Indonesia 2008. Keduanya akan berperan sebagai Gorga dan Marlinang. Choky mengatakan dia seolah mendapatkan kehormatan yang besar memerankan di opera ini. Tambahnya bicara budaya opera Batak bukan hanya sukuiesme semata-mata tetapi ingin menunjukkan budaya Indonesia. “Ini menjadi kekuatan yang besar untuk berkontribusi dunia parawisata khususnya Danau Toba adalah sumber daya terbaik di Indonesia,” kata Chocky Sitohang. Sementara Zizi, panggilan Puteri Indonesia 2008 ini menyatakan, dia akan menyanyikan lagu-lagu dalam bahasa Batak. Bagi Zizi, menyanyi lagu Batak merupakan tantangan tersendiri. Meski keturunan Batak namun ia lahir dan dibesarkan di Jakarta.

”Bagi saya itu tantangan banget. Saya menyanyikan 6-7 lagu. Untuk menghayatinya saya pun minta di-translate ke dalam bahasa Indonesia. Dan ternyata bisa dibilang orang Batak itu romantis ya. Dari lagu-lagunya mengenai isi hatinya,” kata Zizi di kawasan SCBD, Jakarta Pusat, Rabu (29/8). Dengan nada setengah bercanda, dara kelahiran Jakarta, 16 Februari 1989 ini pun menyatakan ketertarikannya pada pria Batak. “Selama ini (pria Batak) yang saya kenal seperti itu ya, romantis,” ujar Zizi tertawa. Opera tersebut sengaja digelar masyarakat yang berasal dari Sumatera Utara khususnya Batak, tergerak untuk membangun kembali daerahnya. Tujuannya tak lain demi melestarikan kembali budaya Batak, serta mengangkat fanatisme kedaerahan. Bonar Gultom, selaku Sutradara juga sekaligus menjadi Gorga, pemeran utama opera ini mengatakan tujuan utama didalam opera ini adalah untuk menggali budaya Batak. “Dari kecil saya senang sekali film-film musik. Genrenya adalah budaya Batak. Seluruh jalan cerita itu diisi dengan lagulagu makanya di sebut Opera,” kata Bonar di ‘Marleys Bar’ Gedung Energy lantai 2, Kawasan SCBD lot 11a, Jendral Sudirman, Jakarta, Rabu, (29/8). Hisar Gurning dari Gorga House selaku penyelenggara, mengatakan opera kolosal digelar dalam rangka melestarikan nilai-nilai budaya Batak dan mengangkat fanatisme kedaerahan sehingga masyarakat yang berasal dari Sumatra Utara khususnya Batak tergerak untuk membangun kembali daerahnya. ”Kami Ingin mengingatkan lagi bahwa masih ada Danau Toba di tanah kelahiran kami sebagai tempat tujuan wisata yang cukup terkenal di dunia,” ujar Gurning dalam jumpa pers di Jakarta, Rabu (29/8).

Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana:... Kordinator Liputan Ridwan Butarbutar, Asisten Kordinator Liputan (Bonapasogit): Horden Silalahi. Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Marihot Simamora, Freddy Tobing, Masril Rambe , Rinawati Marbun (koresponden barus), Jonter (Humbahas), Bernard Lumbangaol, Hengki Tobing (Taput), Hermanto Turnip, Brams Situmorang (Tobasa) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel),

Gurning menjelaskan, selain sebagai tontonan, opera yang bercerita tentang kecintaan kampung halaman ini juga diharapkan akan menjadi sarana untuk menggali, melestarikan, dan mengembangkan unsur-unsur seni budaya daerah. Dan terpenting, kata Gurning, membangkitkan rasa syukur kepada Sang Pencipta. ”Diharapkan dapat menggelitik dan memupuk kecintaan, kerinduan, dan kebanggaan masyarakat terhadap Tanah Airnya sendiri,” paparnya. Opera ini mengisahkan perjalanan seorang pemuda Batak bernama Gorga yang melanglang buana keliling dunia karena tidak puas dengan keadaan di tanah kelahirannya. Namun, akhirnya dia kembali lagi dan menyadari bahwa seindah-indahnya negeri orang, justru lebih indah di kampung halaman sendiri. Opera Batak Perlu Globalisasi dan Regenerasi Opera Batak Arga do Bona Ni Pinasa yang akan digelar di Plenary Hall, Jakarta Convention Center, Jakarta, pada 1 dan 2 September 2012 mendatang mendapat sambutan positif dari salah satu penggiat opera Batak sekaligus pemerhati budaya Batak, Thompson HS. “Pertunjukan opera Batak memang perlu lebih dilestarikan dan diperbanyak. Sebab, globalisasi seni budaya opera Batak akan mampu melestarikan dan memperkenalkan budaya Batak ke seluruh penjuru dunia. Tentu, kekayaan budaya Batak itu akan menguntungkan pada sisi sektor pariwisata dan perekonomian, khususnya di tanah Batak,” ujar Thomson HS. Namun, terkait pegelaran opera Batak “Arga do bona ni pinasa” yang akan digelar di Jakarta tersebut, Thomson mengimbau, agar event tersebut tidak semata-mata hanya untuk menghabiskan dana, apakah itu dari

Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan

dana bantuan pemerintah, maupun dari sumbangan sejumlah pihak. ”Sebaiknya, ada tujuan utama, yakni pelestarian budaya. Jadi bukan hanya untuk menghabiskan anggaran,” tukas pemilik gelar Ompu Datu Parningotan Tuan Patiaraja Namangunghal itu. Ditegaskannya, opera Batak “Argado Bona Ni Pinasa” bukanlah opera Batak yang murni karena sejarah Batak terdahulu. ”Opera Batak Arga do bona ni pinasa adalah pertunjukan seni budaya, tapi bukan seperti opera Batak terdahulu yang pernah dipertunjukkan nenek moyang kita terdahulu, atau berdasarkan sebuah kisah orang batak jaman dulu,” papar Thompson. Pada tahun 2001-2005, lelaki kelahiran 1959 ini berinisiatif memprakasai penyelenggaraan pesta rakyat Danau Toba, yang pada saat itu berhasil menggairahkan kembali kegiatan pariwisata di Danau Toba. Nantinya, opera ini juga didukung oleh 150 pemain dari Gereja Kristen Protestan (GKP) Bekasi Timur serta paduan suara Glorius Choir, Cherubim Male, PS Ekklesia, Hosiana Children and Youth Choir. Sekedar di ketahui opera ini pertama kali dimainkan di Medan pada tahun 1969, kemudian pada tahun 1972 diadakan di Istora Senayan pada acara Rapim ABRI dan hiburan untuk rakyat selama 5 hari. Pada tahun 1973, opera ini juga di mainkan untuk menghibur Prince Bernard (Belanda), dan tahun 1974 menghibur Raja Bouduin (Belgia) serta PM Lee Kuan Yew (Singapura) pada tahun 1975. Opera Arga Do Bona ini Pinasa juga pernah mendapatkan rekor MURI atas prestasi pencipta cerita dan sutradara pertunjukan opera dengan pendukung terbanyak yaitu 232 orang, pada acara pesta rakyat Danau Toba. (tr/ken/hsl)

Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



30 Agustus 2012

FPD Minta Walikota Psp Ingatkan PNS Fokus Kerja SIDIMPUAN-Para pegawai negeri sipil (PNS) di lingkungan Pemko Psp saat ini dinilai kurang maksimal dalam melaksanakan tugas sebagai pengayom masyarakat. Pasalnya, pikiran mereka terpecah dengan agenda pilkada yang akan digelar beberapa bulan lagi. Untuk tidak mempengaruhi tingkat pelayanan, Fraksi Partai Demokrat (FPD) DPRD Kota Padangsidimpuan (Psp) meminta Walikota Psp, Drs H Zulkarnaen Nasution MM agar mengingatkan para PNS

untuk focus melaksanakan tugasnya dan tidak ikut latah persoalan pilkada ini. Ketua FPD DPRD Psp, H Khoiruddin Nasution mengharapkan, kiranya PNS tetap melaksanakan tugas dan focus melayani masyarakat dan tidak latah nimbrung dikegiatan pilkada Kota Psp. Apalagi sesuai aturan, PNS memang dilarang berpolitik praktis. “Imbaun ini penting agar PNS tetap fokus melaksanakan tugasnya untuk memberikan pelayanan kepada

masyarakat dan sebagai kepala daerah Walikota Psp harus mengingatkan semua PNS termasuk pimpinan PNS itu sendiri seperti Sekda dan juga para pimpinan SKPD lainnya,” tegasnya. Hal ini dikatakan Ketua Komisi III DPRD Psp agar menjaga netralitas PNS dalam pilkada, namun yang terutama adalah bagaimana agar pelayanan kepada masyarakat tidak sampai terganggu karena PNS juga sibuk membahas bahkan terjun langsung dalam eforia pilkada Psp ini.

“Agar ada pemahaman kepada para PNS untuk mengembang amanah dan tanggungjawabnya secara profesional. Untuk itu diharapkannya kepada Walikota Psp, Drs Zulkarnaen Nasution agar memerintahkan seluruh PNS focus pada tugasnya,” jelasnya. Ketua DPC PD Kota Psp ini menambahkan Walikota Psp harus tegas karena dirinya melihat adanya seperti penurunan semangat kerja dari para PNS apakah disebabkan karena baru libur

lebaran atau karena terlalu semangat membahas masalah pilkada. “Lihat saja sudah beberapa hari masuk kerja, jumlah PNS yang hadir masih jauh dari harapan, kantor masih banyak yang pegawainya sunyi. Kita tahu apakah factor libur lebaran atau malah sibuk latah nimbrung dipilkada ini. Kita minta Walikota juga tidak latah dan membiarkan hal ini terjadi. Ingatkanlah PNS agar focus pada tugasnya saja melayani masyarakat,” tegasnya. (phn/mer)

PNS Disdik Sibolga ‘Diusir’ Sambungan Halaman 8 Pengosongan itu harus dilaksanakan pada hari itu juga (Rabu, 29/8-red), mengingat tidak adanya surat permohonan resmi pemakaian gedung bekas Akper tersebut ke Pemkab Tapteng. Gedung milik Pemkab Tapteng itu beberapa waktu ini ditempati Disdik Pemko Sibolga sebagai kantornya setelah kantor mereka yang ada di sebelah gedung direhap. Pantauan METRO, kedatangan PNS dan Satpol PP Pemkab Tapteng ke Kota Sibolga disambut para pegawai Pemko Sibolga yang juga didukung Satpol PP dan sejumlah pemuda Kota Sibolga dengan pengawasan personil kepolisian resort (Polres) Kota Sibolga dari satuan intel. Persoalan tersebut bakal mengancam terhentinya proses pelaksanaan proyek pembangunan gedung baru kantor Disdik Kota Sibolga bernilai Rp2 miliar lebih yang tengah berlangsung tepat disamping eks gedung/kantor Akper Pemkab Tapteng. Bahkan, dalam pembangunan gedung baru itu, Pemko Sibolga juga dituding telah

Harga Sawit dan Karet Anjlok

menyerobot lahan Pemkab Tapteng selebar 11 meter x 28 meter. “Sikap kita, yakni, Pemkab Tapteng, gedung itu harus dikosongkan pada hari ini juga,” kata Kepala Dinas (Kadis) Pendapatan, Pengelola Keuangan dan Kekayaan Daerah (P2K2D) Sokhizaro Laia, di salah satu kedai kopi di Jalan Tuanku Dorong, Sibolga, Rabu (29/8). Pemkab Tapteng sudah tegas dalam hal itu. Lahan dan gedung tersebut harus dikosongkan dan pihaknya akan tetap melakukan pengawasan untuk itu. “Tidak ada solusi lain, sebab Pemko Sibolga tidak ada melayangkan surat permohonan secara resmi atas pemakaian eks gedung/kantor Akper ditambah lagi penyerobotan lahan milik Pemkab Tapteng tersebut,” tukasnya. Kepala Seksi (Kasi) di Dinas P2K2D Pemkab Tapteng Hot Parulian Hutabarat mengakui, pihaknya selaku pengelola aset Pemkab Tapteng sama sekali tidak ada menerima surat permohonan pemakaian eks gedung/kantor Akper Pemkab Tapteng yang berada di Jalan Tuanku Dorong Kota Sibolga yang dipakai untuk sementara waktu oleh Disdik Sibolga. “Kita tidak pernah

menerima surat permohonan itu,” imbuhnya. Dia juga mengakui, Pemko Sibolga telah menyerobot lahan milik Pemkab Tapteng untuk pembangunan gedung baru Disdik Sibolga seluas 11 meter x 28 meter persegi. “Hal ini sesuai surat sertifikat hak pakai Badan Pertanahan Nasional (BPN) No 33 tahun 2003 yang ada pada kita,” ucapnya. Sementara itu, Wakil Walikota Sibolga, Marudut Situmorang yang turun ke lokasi sebelumnya melakukan pertemuan dengan sejumlah utusan dari Pemkab Tapteng diantaranya Kadis Pertahanan Drs Erwin Marpaung MSi, Kadis P2KD Ir Sokhizaro Laia, Kaban Kesbang Linmas Suroto dan staf Humas Pemkab Tapteng. Dalam pertemuan itu, Marudut mengatakan bahwa kedua pemerintah baik Sibolga dan Tapteng pada dasarnya samasama mempunyai niat yang baik untuk pembangunan. “Namun mungkin terjadi misskomunikasi, sehingga hal inilah yang harus diluruskan dan diselesaikan. Artinya memang secara lisan, Kadis Pendidikan sudah berbincang langsung dengan Bupati

Tapteng Raja Bonaran Situmeang SH Mhum soal izin pemakaian bangunan eks Akper Pemkab Tapteng. Namun begitupun, untuk menyelesaikan persoalan ini memang kedua belah pihak harus membentuk tim agar dapat duduk bersama membicarakan bagaimana langkah selanjutnya,” tukas Marudut. Begitupun, dalam bincang-bincangnya dengan sejumlah anggota DPRD Kota Sibolga yang juga turun ke lokasi di antaranya, mengakui, dari hasil konfirmasi yang dilakukannya ke Kepala Dinas (Kadis) Pendidikan Drs Alpian Hutauruk MPD terungkap, bahwa pemakaian eks gedung/ kantor Akper Pemkab Tapteng berdasarkan izin lisan hasil komunikasi langsung dengan Bupati Tapteng Raja Bonaran Situmeang. Tetapi izin lisan itu tidak direspon positif oleh Kadis Pendidikan dengan membuat surat permohonan secara resmi. Surat permohonan pemakaian eks bangunan/ kantor Akper Pemkab Tapteng secara resmi baru dibuat oleh Disdik Sibolga tertanggal 28 Agustus 2012, dan surat tersebut informasinya sampai ke Pemkab Tapteng

tertanggal 29 Agustus 2012. Persoalan kemudian bertambah atas tudingan penyerobotan lahan milik Pemkab Tapteng untuk pembangunan gedung baru Disdik Sibolga. Muchtar DS Nababan mewakili rekanrekannya mengaku prihatin dengan munculnya permasalahan tersebut. Pihaknya berharap, permasalahan yang timbul dapat diselesaikan dengan hati dingin mengingat hubungan baik kedua daerah yang telah terjalin. Secara prinsip, sebut Muchtar, pihaknya (DPRD Kota Sibolga) sama sekali tidak mengetahui secara akurat persoalan yang tengah terjadi antara Pemko Sibolga dan Pemkab Tapteng atas tudingan atau dugaan penyerobotan bangunan dan lahan eks gedung/kantor Akper Pemkab Tapteng. Pihaknya akan mempelajarinya dan membawakannya dalam rapat DPRD. “Soalnya, selain kita tidak tahu adanya kasus penyerobotan, kita juga belum melihat sertifikat tanah milik Pemko Sibolga dan Pemkab Tapteng. Jadi, kalau pun nanti ada kesilafan, kita (DPRD kota Sibolga) akan memfasilitasinya,” tandasnya. (tob/nasa)

Dukungan Pada Bakhtiar Diprotes Sambungan Halaman 8

Sambungan Halaman 8 Seorang toke getah dan sawit di wilayah Kabupaten Palas, M Hasibuan (45), Rabu (29/8) memperkirakan, penurunan harga kedua komoditas pertanian tersebut akan terus bertahan atau belum naik hingga Desember mendatang. Katanya, sebelumnya bulan Juni lalu harga karet mencapai di level Rp12.000 per kilogram, sedangkan sawit Rp1.200 per kilogram. Petani sawit Tongku Siregar warga Kabupaten Palas menuturkan, akibat turunnya harga komoditas pertanian tersebut, jelas membuat masyarakat sangat terpukul. Bahkan tidak sedikit warga yang menjual lahannya karena kebutuhan untuk pendidikan anak dan lainnya, tidak ada lagi. Kadisperindgakop dan UKM Palas, Drs H Tobing Hasibuan mengutarakan, kondisi penurunan harga kedua komoditas pertanian tersebut sangat memukul masyarakat petani. Apalagi, kondisinya saat menjelang lebaran dan masuk sekolah tahun ajaran baru. “Kita tidak bisa berbuat banyak terkait hal itu. Di pabrik juga harganya mengalami penurunan dan sudah kita cek ke lapangan. Namun harganya tetap mengacu pada perekonomian nasional atau kondisi perekonomian dunia,” tukasnya. (amr/mer)

“Pernyataan yang disampaikan oleh segelintir oknum itu bukan representatif warga Sibolga Utara. Sebab kami menilai pernyataan dukung mendukung kandidat Wali Kota Sibolga terlalu prematur disampaikan saat ini,” ungkap Peniel Sitorus SH bersama warga lainnya diantaranya, Welfrid Panggabean, Martua Purba, Alek Simatupang, Freddy Simanjuntak dan sejumlah warga lainnya, Rabu (28/8) di Kampung Betlehem, Jalan Sibual-Buali, Sibolga Julu, Kecamatan Sibolga Utara, Kota Sibolga. Menurut Peniel, segelintir oknum tersebut untuk tidak mengatasnamakan warga Sibolga Utara hanya untuk kepentingan pribadi, maupun kepentingan politik dari oknum-

oknum yang bersangkutan. “Termasuk juga dengan organisasi Format (Forum Masyarakat Tapanuli), yang juga tidak kami ketahui apa dasar dan landasan organisasinya. Masyarakat Tapanuli mana yang dibawakan oleh organisasi ini?,” tanya warga lantas berharap agar pemerintah melalui instansi terkait meninjau eksistensinya, dan bila perlu membubarkan organisasi tersebut. Jika memang ada warga yang belum puas dengan hasil pembangunan di Kota Sibolga, kata Peniel, itu sah-sah saja untuk dikritik. “Silahkan dikritik dan berikan saran yang bersifat konstruktif atas nama pribadi. Jangan mengatasnamakan warga, sebab saran, pendapat, kritikan dari seorang oknum belum bisa mewakili seluruh warga,” ujarnya.

Masih kata Peniel, pada dasarnya setiap orang, siapapun itu berhak untuk mencalonkan diri sebagai kepala daerah dan dimanapun, dengan catatan memang benar-benar berniat membangun daerah tersebut. “Namun untuk persoalan ini, Bakhtiar Sibarani kami kira hanya sebatas mencari sensasi. Malah disinyalir sengaja untuk menciptakan ketidakkondusifan di Sibolga, seperti yang diduga dilakukannya di Tapteng,” tukas Peniel. Jika berniat mencalonkan diri sebagai Wali Kota Sibolga, kata Peniel, Bakhtiar Sibarani seharusnya berkaca atau bercermin terlebih dahulu. “Sebab, sebagian besar masyarakat Sibolga maupun Tapteng sudah mengetahui siapa Bakhtiar Sibarani sebenarnya. Jangankan

untuk mengurus Sibolga dengan menjadi Wali Kota, untuk mengurus masyarakat Tapteng dan dirinya sendiripun di DPRD Tapteng belum mampu,” ketus Peniel. Meskipun begitu, sebagai warga mereka juga berharap agar Wali Kota Sibolga, Drs HM Syarfi Hutauruk tetap konsisten menjalankan program kerjanya untuk pembangunan Kota Sibolga demi peningkatan kesejahteraan masyarakat. “Kami berharap, pemerintah kota (Pemko) Sibolga dibawah kepemimpinan Drs HM Syarfi Hutauruk dan pasangannya Marudut Situmorang AP MSP untuk membangun Kota Sibolga secara adil dan merata untuk peningkatan kesejahteraan masyarakat,” tandas Peniel diamini warga lainnya. (tob/nasa)

4 Atlet TAKO Tapteng Berangkat ke Malaysia Sambungan Halaman 8 Jonni Lumbantobing SE selaku pembina, Anwar Kataren SH ketua litbang, M Samosir ketua bidang organisasi, FM Sibagariang Ketua Bidang Dana, Tampak Ginting wakil ketua bidang prestasi dan Jonathan Hasibuan menyampaikan rasa bangga karena ke empat atlet Tako asal Tapteng itu diberikan kesempatan untuk mengikuti Kejuaraan Tako tingkat internasional di Malaysia. “Artinya, para atlet ini bukan lagi hanya sekedar mewakili Tapteng semata, namun boleh dibilang mewakili Negara Indonesia sebab perhelatan ini merupakan

event internasional. Apalagi dari Sumut, informasi yang kami dapat hanya Tako Tapteng yang ikut dalam kejuaraan tersebut,” tukas Kemal. Untuk itu, sambung Kemal, atlet Tako Tapteng yang ikut dalam kejuaraan itu untuk tidak merasa minder atau malu, meskipun berasal dari daerah. “Ini sebagai sebuah kebanggaan buat adek-adek atlet, dimana dipercaya untuk ikut dalam kejuaraan tersebut. Yang penting bertanding dengan baik, sesuai dengan kemampuan yang dimiliki, jangan ada rekayasa dalam pertandingan, harus menjaga sportifitas, jangan pernah bangga jika prestasi didapat

dengan cara yang salah. Namun berbanggalah jika kemenangan itu diperoleh dengan benar dan murni karena kemampuan sendiri,” pesan Kemal. Sementara, pelatih Firman Manullang SPd yang turut mendampingi para atlet mengatakan, ke empat atlit itu yakni, Suci Hutabarat, Wiriya Lubis, Ronni Simbolon, dan Erwin, yang masing-masing atlit masih duduk dibangku SMA. “Keberangkatan atlet malamini dari Medan menuju Kuala Lumpur. “Kita berharap, para atlet ini mampu mengukir prestasi selain memperbanyak ilmu dan teknik agar semakin matang dan mampu menghadapi

kejuaraan-kejuaraan. Apalagi atlet tako Tapteng ini akan kembali mengikuti pertandingan tako memperebutkan Piala Mendiknas di Samarinda pada November 2012 dan Piala KASAD pada 2013 mendatang,” tukasnya. Menurut Firman, kejuaraan Internasional Malaysia Cup ini diikuti 10 negara termasuk Indonesia salah satunya yang mengutus 5 peserta dan 3 diantaranya atlet Tako Tapteng. “Informasi yang sampai kepada kami hanya 10 negara yang mengikuti kejuaraan ini. Sedangkan atlet Tako dari Indonesia hanya 5 orang, termasuk 3 atlet berasal dari Pengcab Tako Tapteng,” tandasnya. (tob/nasa)

Tak Ada Kaum Bapak, Acara Adat jadi Masalah Sambungan Halaman 1 Ia menjelaskan, untuk menggelar acara pesta adat Batak, butuh tokoh adat dan tenaga untuk memotong ternak dan memasak daging. Sehingga, tanpa bantuan dari dusun tetangga, warga Dusun Buntu Raja mustahil bisa menggelar acara pesta adat. ”Jadi, karena kami dari dusun tetangga memang masih satu rumpun, maka sudah kewajiban kami membantu mereka,” paparnya. Namun, sambung Sangkar, kaum laki-laki dari Desa Sitanggor, enggan naik ke Dusun Sitanggor jika tidak ada urusan penting. Pasalnya, kaum lakilaki dari desa tetangga Dusun Buntu Raja takut digosipkan selingkuh dengan kaum ibu di dusun itu. ”Kita tetap menjaga nama baik ibuibu di sana. Bahkan mufakat bersama kami, setiap laki-laki pendatang yang datang ke dusun itu harus menjelaskan maksud dan tujuannya

dan tidak boleh menginap, termasuk laki-laki dari Desa Sitanggor dan sekitarnya,” tandas Sangkar. 42 Terpidana Pisah Penjara Kejamnya dampak yang diterima ibu-ibu dan anak para terpidana kasus begu ganjang di Dusun Buntu Raja, juga menyisakan derita lain, yakni pemisahan penjara ke-42 terpidana. Dimana sembilan terpidana kini ditempatkan di Rutan Tanjung Gusta, Medan. Sedangkan sisanya, ditempatkan di LP Siborongborong, Tapanuli Utara. Dampak perih tentu dialami sembilan istri terpidana yang ditempatkan di Rutan Tanjung Kusta, Medan. Pasalnya, mereka akan sulit berkunjung ke Rutan Tanjung Gusta karena harus mengeluarkan ongkos perjalanan dan biaya banyak selama di perjalanan. Gunsol Ompusunggu, Sumurung Rajagukguk dan Raja Pangihutan Rajagukguk yang ditemui METRO di LP Siborongborong mengatakan,

mereka sangat berharap kesembilan rekan mereka bisa berkumpul di LP Siborongborong. ”Mereka (9 terpidana di Rutan Tanjung Gusta-red) mungkin ditempatkan di Medan karena semua divonis 15 tahun penjara. Tapi, waktu pemisahan itu dulu, kami sebenarnya memohon agar disatukan, tapi tidak terwujud,” ujar Sumurung. Ketiga terpidana tersebut mengaku, sembilan rekan mereka jarang ditemui istri dan anak-anaknya di penjara. ”Kalau yang kami dengar kabar dari kampung, istri dan anak mereka jarang berkunjung ke penjara. Mungkin semua itu karena faktor biaya. Ditambah lagi kalau berangkat ke Medan pasti harus menginap. Padahal, tidak semua ada punya keluarga di Medan,” papar Gunsol menimpali perkataan Sumurung. Amatan METRO, kondisi para terpidana kasus begu ganjang di LP Siborongborong dalam keadaan sehat. Mereka dibina petugas LP.

Guru PAUD Dianiaya Teman Sambungan Halaman 1 korban. Merasa tersinggung, Rita balik bertanya ke Nuraini. “Sama siapa kau bilang” lantas dijawab Nuarini “Suka Ambolah” sembari mendatangi Rita sekitar 1 meter dari warung lontong tempat Nuraini duduk. “Kemudian, begitu dekat, Nuraini memegang kepalaku dan menjambak jilbap yang aku kenakan. Tak terima diperlakukan seperti itu, saya kembali membalasnya,” ujar Rita ditemui METRO di rumahnya, Rabu (29/8). Tak berlangsung lama pergumulan

mereka,beberapawargaberusahamelerai keduanya. Ernawati (41) yang rumahnya tak jauh dari warung lontong akhirnya membawa Rita ke rumahnya dengan kondisi baju Rita yang sudak robek-robek. Tak berapa lama, Lasmin Tanjung (44) suami Rita yang menunggunya di persimpangan Gang Serasi sekitar 100 meter dari tempat kejadian datang setelah salah satu warga memberitahu kalau istrinya dianiaya rekannya sendiri. Begitu mengetahui kejadian itu, Lasmin pun menemui dan mengajak istrinya pulang. Namunsaatmerekamelintasdari depan warung lontong tempat kejadian,

Nuraini mendatangi mereka dengan membawapiringkramikberisilontongdan langsung melemparkan piring berisi lontong tersebut ke wajah Rita. Akibatnya, pelipis sebelah kiri Rita mengalami luka robek sekitar 2 cm dan jatuh pingsan. SedangkanLasminkelabakanakibatwajah dan matanya tersiram kuah lontong. Dengan keadaan setengah sadar, Rita yang wajahnya dilumuri darah langsung di bawa suaminya ke RSUD FL Tobing untuk mendapat perawatan dan visum. “Kami tidak terima perlakuan Nuraini, akhirnya kami membuat laporan ke Polsek Sambas,” sebut Rita.

“Kami di sini dibina pihak LP Siborongborong dengan baik. Banyak kegiatan kami di sini, termasuk kegiatan rohani. Hanya saja, kita terus menghitung jam, hari demi hari masa tahanan. Sehingga, kadang itu menjadi beban mental. Kami ingin hidup bersama keluarga di kampung,” ujar Raja Pangihutan. Terkait pembinaan para narapidana, Kepala LP Siborongborong Sigit Danarto SH didampingi Kepala Pengamanan Lembaga Pemasyarakatan (KPLP) Siborongborong Batara Hutasoit membenarkan. Ia mengatakan, pada prinsipnya, cara pembinaan yang mereka lakukan kepada para narapidana adalah pembinaan disiplin, mental dan kerohanian. “Pembinaan yang kita lakukan tentu tidak dapat lepas dari petunjuk yang ada. Tapi, napi itu juga butuh penyadaran atas apa yang telah diperbuatnya melanggar hukum. Jadi, disiplin, kebersamaan dan pembinaan kerohanian itu harus kita laku-

kan supaya kelak setelah keluar dari binaan kita dapat berguna bagi bangsa dan Negara, khususnya kepada keluarga mereka masing-masing,” tandas Sigit. Sebelumnya, Ratna Tambunan, istri dari Pasu Simaremare, mengaku bahwa dia tidak pernah menjenguk suaminya setelah dipindahkan dari Rutan Tarutung ke Rutan Tanjung Kusta, Medan. ”Dari manalah uang saya mau kesana, untuk memberi makan kedelapan anak saya dan biaya sekolah saja sudah syukur. Tapi suatu saat nanti, saya dan anak-anak akan berusaha ngumpul uang agar bisa berangkat ke Medan,” ujar Ratna. Namun, Ratna berharap, agar Kementerian Hukum dan HAM memindahkan suaminya ke LP Siborongborong. ”Sebenarnya, kalau boleh berharap, saya ingin suami saya ditempatkan di LP Siborongborong saja. Bayangkan anak saya yang paling kecil saja tidak dilihatnya lahir,

dan sampai berumur 15 tahun nanti mungkin anak paling kecil tidak mengenal wajah bapaknya,” ungkap Ratna berurai air mata. Kini, setelah 2 tahun 57 hari tragedi kasus begu ganjang tersebut, kondisi kehidupan warga yang tinggal di lereng perbukitan Danau Toba, Dusun Buntu Raja, Desa Sitanggor, Kecamatan Muara, Kabupaten Taput itu sangat memprihatinkan, khususnya dari sisi perekonomian. Meski begitu, harapan terakhir sebagian besar kaum ibu yang suaminya kini dipenjara itu adalah, pemindahan 9 narapidana dari Rutan Tanjung Kusta ke LP Siborongborong, pemberian remisi hukuman, serta dukungan pemberian bantuan kebutuhan pertanian dan perbaikan jalan ke dusun tersebut. Agar hasil pertanian mereka lebih baik dan untuk menjual hasil panen lebih lancar ke Kota Siborongborong yang jaraknya sekitar 25 kilometer, karena kini masih sulit dilalui mobil. (*)

Kapolsek Sibolga Sambas AKP Jalanak melalui Kanit Reskrim Ipda AT Simangunsongsaatdikonfirmasidiruang kerjanya membenarkan penganiayaan itu. Bahkan, Nuraini kini sudah ditahan di Mapolsek Sibolga Sambas, Rabu (29/8). “Benarkitatelahmenerimalaporandari korban Rita br Nainggolan, Selasa (28/8). Setelah kita proses, sesuai bukti dan keterangan saksi-saksi akhirnya kita melakukanpenahananterhadaptersangka NurainibrHutabarat,”ujarSimangunsong. Ia menjelaskan, tersangka telah dimintai keterangan terkait penganiayaan dan dikenakan melanggar Pasal 351 ayat 2. “Kita sudah menahan tersangka,

sebab kalau tidak, kita khawatir tersangka bakal mengulangi perbuatannya kembali,” tegasnya. Hanya saja sambung Simangunsong, seolah tak mau ketinggalan, setelah pengaduan itu, Nuraini kembali melaporkan Rita. “Laporan Nuraini sudah kita proses. Nuraini dan dua saksi sudah kita mintai keterangan. Kedua kasus ini masih dalam penyelidikan,” paparnya. Terpisah, Ernawati (41) salah satu saksi mengatakan, Rita dan Nuraini pernah berteman kompak. Namun berselisih paham gara-gara masalah pembayaran pakaian.“Dulukamisangatkompak,Rita, Nuraini, aku, dan teman-teman lainnya

bagaikan saudara. Makan bersama, jalan bersama dan kami merupakan satu tim diKelurahanPancuranDewayangsangat akur. Tapi keduanya berselisih paham masalah pembayaran pakaian. Sejak saat itu, mereka jadi kurang akur. Tapi belakangan ini mereka tidak lagi mempermasalahkan itu. Meskipun merekatidakpernahbersamalagi,namun pembayaran itu sudah tidak pernah di permasalahkan lagi. Namun, pastinya, masalah itu sudah selesai atau tidak, saya sendiri tidak tau. Saya sangat kecewa mengapasampaisepertiini.Yangdulunya sangat akur tiba-tiba berakhir sampai ke perkara,” tukas Ernawati.(cr-1/des)


30 Agustus 2012

Pakai Gedung Akper Tapteng Tanpa Izin


PNS Disdik Sibolga ‘Diusir’

DIBERANGKATKAN: Ketua Umum Pengcab TAKO Tapteng kemal Sianipar SH bersama jajarannya foto bersama sebelum memberangkatkan empatatlet TAKO Tapteng, Rabu (28/8).

Dukungan Pada Bakhtiar Diprotes Jangan Bawa-bawa Warga Sibolga Utara SIBOLGA- Sejumlah warga Sibolga Utara, khususnya warga Sibolga Julu keberatan atas pernyataan segelintir oknum yang mengatasnamakan warga Sibolga Utara dalam

hal mendukung Bakhtiar Sibarani jadi Wali Kota Sibolga mendatang. ‹ ‹ Baca

Dukungan..Hal 7 BERBINCANG: W akil Wali Kota Sibolga Marudut Situmorang A P MSP terlibat perbincangan serius dengan sejumlah pimpinan SKPD terkait pembangunan gedung Diknas Sibolga, Rabu (29/8) di Sibolga.

SIBOLGA- Sejumlah Pegawai Negeri Sipil didukung personel Satpol PP, Rabu (29/8) kemarin meminta kepada pegawai Dinas Pendidikan (Disdik) Pemko Sibolga segera mengosongkan gedung eks Akademi Keperawatan (Akper) milik Pemkab Tapteng di Jalan Tuanku Dorong Hutagalung. ‹ ‹ Baca

PNS ..Hal 7

4 Atlet TAKO Tapteng Berangkat ke Malaysia PANDAN- Empat atlet Pengurus Cabang Tangan Kosong (Pengcab Tako) Kabupaten Tapanuli Tengah (Tapteng) diberangkatkan Ketua Umum Pengcab Tako Tapteng, Kemal Sianipar SH, Rabu (28/ 8) pagi kemarin. Keempat atlet muda berbakat itu diberangkatkan guna mengikuti Ke-

juaraan International Cup yang digelar sejak 30 Agustus hingga 2 September 2012 mendatang. Pada kesempatan itu, Kemal yang saat itu didampingi wakil ketua I M Indra Nasution yang juga Kasi Intel Kejaksaan, ‹ ‹ Baca

4 Atlet..Hal 7 (f:metro/ist)

ANJLOK-Sejak bulan Juni lalu, harga getah karet dan sawit sebagai komoditas pertanian masyarakat Palas anjlok dipasaran. Saat ini harga sawit Rp700 per kilogram sedangkan getah karet Rp7.000 per kilogram.

Harga Sawit dan Karet Anjlok (FOTO:RIDWAN)

D I B E R A N G K ATKAN: Ketua Umum Pengcab TA K O Tapteng kemal Sianipar SH bersama jajarannya foto bersama sebelum memberangkatkan empat atlet TA K O Tapteng, Rabu (28/8).

PALAS- Sejak bulan Juni lalu, harga getah karet dan sawit sebagai komoditas pertanian masyarakat Palas anjlok dipasaran. Saat ini harga sawit Rp700 per kilo-

gram sedangkan getah karet Rp7.000 per kilogram. Belum ada tanda-tanda akan terjadi kenaikan harga. ‹ ‹ Baca

Harga ..Hal 7



Kamis 30 Agustus 2012

METRO BONAPASOGIT Teraktual dari Tarutung, Balige, Humbahas dan Samosir METRO TAPANULI

Edisi 44 „ Tahun IX

Pria Bertato ‘LAPAS 2001’ Tewas Membusuk HUMBAHAS- Warga Desa Mungkur Kecamatan Tarabintang, Kabupaten Humbahas, Selasa (28/8) sore dihebohkan dengan penemuan mayat pria tak dikenal. Pria dengan tato bertuliskan LAPAS 2001 di lengan kirinya ini ditemukan membusuk di Sungai Laemaga.

FOTO Bernad L Gaol

„ Kabag Ops Kompol PH Sinaga dan Kasubag Humas Polres Taput AIPDA W Baringbing saat meninjau lokasi pelaksanaan SG.


6 Pos Pengaman Disiapkan, Ratusan Polisi Diturunkan TAPUT- Polres Taput menyiapkan enam posko taktis untuk pengamanan pelaksanaan Sinode Godang (SG) Huria Kristen Batak Protestan (HKBP) yang digelar pada 10-16 September 2012 mendatang. Keenam pos tersebut dititik be-

„) Baca 6 Pos ..Hal 10

nya begitu saja. Sebut saja seperti di Desa Karcis, Marmar Kecamatan Balige. Pengamatan di lapangan, akibat aktifitas penebangan kayu di desa tersebut, satu aliran sungai tertutup. Pengusaha sengaja membuat jalan ke area penebangan dengan cara menutup aliran

„) Baca

LingkunganHal 10

Informasi yang dihimpun menyebutkan, mayat korban pertama kali ditemukan oleh Pa Morta Simamora (40), salah seorang warga Desa Mungkur

„) Baca Pria ..Hal 10

Parpol Diminta Segera Verifikasi ke KPU

ratkan di kawasan Auditorium tempat pelaksanaan acara. “Keenam titik pos pengamanan itu lima di antaranya merupakan pos pengamanan di kawasan Auditorium tempat

Lingkungan Dirusak Pemkab Tutup Mata TOBASA- Tidak adanya tindakan tegas dari Pemkab Tobasa dalam hal ini pihak Kantor Lingkungan Hidup, membuat para pemegang izin usaha pengelolaan galian c maupun pemegang izin penebangan kayu menjadi semakin semena-mena merusak lingkungan. Para pengusaha dinilai tak memperdulikan lingkungan yang rusak dan meninggalkan-

Saat ditemukan, korban tidak mengenakan busana apapun alias bugil. Dari tubuhnya yang sudah bengkak mengeluarkan aroma bau busuk. Hingga kini belum diketahui motif tewasnya korban.

Foto: Kristian Aritonang.

„ Mayat korban saat dievakuasi dari sungai Laemaga Desa Mungkur Kecamatan Tarabintang Kabupaten Humbahas. Belum diketahui motif tewasnya korban.

TAPUT- Ketua Komisi Pemilihan Umum (KPU) Kabupaten Taput Lamtagon Manalu meminta sejumlah partai politik khususnya yang belum lolos parlementer dan partai yang baru dibentuk agar segera mela-

kukan verifikasi pengurus dan keanggotaannya ke KPU. “Kita berharap sejumlah partai yang belum lolos secara parlementer dan partai yang

„) Baca Parpol ..Hal 10

Insentif Guru Lama Cair Akibat Birokrasi Lamban TAPUT– Lambannya proses birokrasi diduga menjadi penyebab belum dicairkannya dana insentif guru PNS yang non sertifikasi. Padahal dana tersebut sudah diturunkan peme-

rintah pusat dan parkir di kas daerah Pemkab Taput. Menurut Dompak Hutasoit Amd, pemerhati pembangunan Tapanuli Utara, saat ini adalah saat dimana proses birokrasi

di sebuah pemerintahan seharusnya cepat tanggap tanpa mempersulit sesuatu yang seharusnya mudah dilakukan.

„) Baca

Insentif ..Hal 10

FOTO Bernad L Gaol

„ Personil KPU Taput melakukan Sosialisai Verifikasi partaipolitik.



30 Agustus 2012

Pengibar Bendera Pertama Terbaring di Rumah Sakit MADINA- Amran Nasution (86), warga Jalan Veteran Nomor 1, Kelurahan Pasar Hilir, Kecamatan Panyabungan,KabpatenMandailingNatal(Madina) yang diketahui sebagai pengibar bendera di Panyabunganpadatanggal17Agustustahun1945lalu,kini terbaring di Rumah Sakit Umum Daerah (RSUD) Panyabungan. Dikamarrumahsakit,sekretarisLembagaVeteran RepublikIndonesia(LVRI)cabangMadinaitumenitip pesan bagi generasi muda; yakni tetap mempererat persatuandankesatuan.Untukpemerintahagarbenar menjalankantugasdemitercapainyapembangunan sebagaimanayangtertuangdalamUUDNegaradan termaktubdalamPancasilayaitukesejahteraansosial bagiseluruhrakyatIndonesia. “Perjuanganmerebutkemerdekaandanmempertahankankemerdekaanituadalahhalyangsangatluar biasasulitnya.Hartakitaserahkanbahkannyawajuga sudahkitarelakandemikemerdekaanagarrakyattidak lagitertindas,”ucapnya. Diceritakanpriakelahirantahun1926itu,padahari Jumattanggal17Agustus1945diabersamabeberapa rekan juangnya yang lain menerima telegram dari pusat perjuangan di Kotanopan bahwa Ir Soekarno mendeklarasikankemerdekaabagirakyatIndonesia. Lantas,saatitujugadiabersamarekannyamencari kain di pasar lalu mejahitkannya dan kemudian menaikkannyadipinggirjalanyangsekarangdikenal sebagaiJalanMerdeka,KelurahanKayuJati,tepatnya disekitarkantorKoramil013Panyabungan. Meskipunkemerdekaanitusudahdideklarasikan, sambungnya. ketika itu seluruh masyarakat Panyabunganwas-wasdankhawatirbercampurtakut sertagelisah.Betapatidakmerekasaatitumendapat tekanandaripihakbagasgodangharajaandanbanyak yangmenyampaikankontraversidarimasyarakat. “Banyak yang menanyakan kami bahkan dari keluarga bagas godang sendiri menanyakan, siapa yang berani menaikkan bendera merah putih itu. Namun,mengingatbanyakkontraversikamipuntidak beraniberterus-terangsoalbenderayangnaikkarena kami takut dilaporkan ke intelijen Hukugunco (pimpinan wilayah pada pemerintahan Jepang),” beberAmranditemanianaknyaIrSyahrulNasution. Namun, sambung Amran Nasution, beberapa waktusetelahitupusatmembentuklaskarrakyatdan PESINDO yaitu suatu lembaga yang dipersiapkan untukmenyampaikankabarkemerdekaanitukepada seluruhmasyarakat. (wan)

Parpol Diminta Segera Verifikasi ke KPU

„ Wakil bupati Tobasa Liberty Pasaribu, Ketua DPRD Sahat Panjaitan, bersama Pengurus DPK APINDO Tobasa dalam pelantikan yang dilaksanakan di Auditorium Guest House PT TPL, Rabu(29/8) Kecamatan Parmaksian, Tobasa.

DPK APINDO Tobasa Dilantik TOBASA- DPK APINDO (Dewan Pimpinan Kabupaten Asosiasi Pengusaha Indonesia) Tobasa melakukan pelantikan kepengurusan, Rabu (29/8) di Auditorium Guest House PT TPL (Toba Pulp Lestari) di Sosor Ladang Kecamatan Parmaksian. Pelantikan pengurus DPK Apindo Tobasa ini dilakukan Ketua DPP Apindo Sumut yang diwakili Ketua Bidang Organisasi dan Pemberdayaan Daerah, TF Simbolon dengan ditandai penyerahan Petaka kepada Ketua DPK Apindo Tobasa. Sebelumnya Gustimar Harahap (Sekretaris DPP Apindo Sumut) membacakan Surat

Keputusan Pembentukan pengurus DPK Apindo Tobasa. Hadir dalam kesempatan itu antara lain, wakil Bupati Tobasa Liberty Pasaribu, Ketua DPRD Toba Samosir Sahat Panjaitan, Dandim 0210/TU-TS Kol (inf) V Tampubolon, Direktur Utama PT TPL SC Paruthi, dan Camat Parmaksian Alfaret Manurung. Wakil Bupati dalam kesempatannya membacakan kata sambutan tertulis Bupati Tobasa Kasmin Pandapotan Simanjuntak. Bupati berharap DPK APINDO Tobasa diharapkan dapat memberi warna baru dalam dunia usaha maupun dunia ketenaga kerjaan di Tobasa dalam kerangka hubungan indus-

trial yang harmonis dan dinamis serta berkeadilan. Senada dengan Bupati, Ketua DPRD Toba Samosir Sahat Panjaitan mengatakan, pihaknya dari DPRD Tobasa senantiasa bersedia sebagai penengah dalam penyelesaian masalah ketenaga kerjaan. Oleh karena itu, diharapkannya, APINDO Tobasa dapat menciptakan hubungan industrial yang Pancasilais antara para pengusaha dan tenaga kerja. Ketua DPK APINDO Tobasa yang baru dilantik, Ananda Handoko, dalam sambutannya mengatakan pihaknya bersama pengurus lain akan berupaya

Pria Bertato ‘LAPAS 2001’ Tewas Membusuk Sambungan Halaman 9 yang sedang memancing ikan di Sungai Laemaga, Selasa (28/8) sekira pukul 15.30 WIB. Sore itu, Pa Morta Simamora mengaku hendak memancing di sungai tersebut. Namun saat hendak melempar kailnya, warga ini melihat sesosok manusia terapung di tepian sungai. Hal itu sontak membuat Pa Morta Simamora terkejut. “Awalnya saya kira hanya bangkai binatang. Namun setelagh saya perhatikan dengan teliti, ternyata bangkai itu

adalah mayat manusia,” ujarnya. Pa Morta Simamora mengaku setelah mengetahui adanya mayat, dirinya langsung berlari ke rumah kepala desa setempat untuk melaporkan apa yang dilihatnya. “Saya langsung lapor kepala desa. Kemudian kami ramairamai ke lokasi penemuan,” terangnya lagi. Sementara Kepala Desa (kades) Mungkur Bastiar Tinambunan (44), yang ditemui METRO membenarkan hal tersebut. “Dia (Pa Morta-red) datang dengan nafas ngos-ngosan ke rumahku. Terus dia bilang ada mayat di sungai tempat warga biasa memancing

ikan,” tutur kades. Untuk memastikan laporan tersebut, Bastiar langsung menuju lokasi. Kemudian dirinya menghubungi personel Polsek Parlilitan guna mengevakuasi mayat korban dan menyelidiki kasusnya. Sedangkan pihak Polsek Parlilitan sendiri belum memberikan keterangan resmi terkait penemuan mayat pria tanpa identitas tersebut. Guna menyelidiki penyebab kematian korban, pihak polsek membawa mayatnya ke rumah sakit untuk dilakukan otopsi.(kris/ jona/nasa)

Sambungan Halaman 9 baru segera melakukan verifikasi ke KPU untuk mengikutiPemilutahun2014,”tandasLamtagonpada acarasosialisasiverikasipartaiKPUTaputdiTarutung, Selasa(28/8). Dia menyebutkan, verikasi parpol sudah bisa dimulaisaatinihinggadeadline7September2012. “Verifikasi dengan menyerahkan Kartu Tanda Anggota(KTA)danpenguruspartaikeKPUselambatlambatnyatanggal7September,kalaulewatdarijadwal kitatidakakanmelakukanverifikasilagi,”ujarnya. Dia menyebutkan bagi partai yang belum lolos secara parlementer dan partai yang baru minimal mampumenunjukkansertamenyerahkanKTAseribu atauseperseribuKTAkeKPU,”ucapnya. Namunbagiparpolyangsudahlolossecaraparlementer, kata Lamtagon tidak dipaksakan harus melakukan verifikasi. “Namun kita berharap parpol tersebuttetapmempersiapkanberkasmanatahuada usulan tiba-tiba dari Mahkamah Konstitusi untuk melakukanverifikasi,”tandasnya. MasihLamtagon,adaduaverifikasiyangdilakukan yakni verifikasi administrasi dan verifikasi faktual. “Verifikasiadministrasiadalahpemeriksaankelengkapan bukti tertulis berkenaan dengan pemenuhan syarat parpol menjadi peserta pemilihan umum. Sedangkan verifikasi faktual adalah pencocokan kebenaranbukti-buktitertulisterhadapkenyataandi lapangan berkenaan dengan pemenuhan syarat parpolmenjadipesertapemilu,”terangnya. Diamengatakan,tugasKPUTaputmenerimadan memeriksa bukti keanggotaan parpol pada saat pendaftaran tanggal 10 Agustus hingga 7 September 2012.Selainitumemeriksaberkasbuktikeanggotaan parpoldenganketentuansyaratminimalkeanggotaan 1.000orangatau1/1.000(satuperseribu)darijumlah penduduk. “Apabila parpol telah memenuhi syarat bukti keanggotaan, maka KPU menerimanya dengan memberi tanda bukti penerimaan sesuai formulir lampiran 2 Model F-Parpol dan apabila parpol tidak memenuhisyaratdanbuktikeanggotaan,makaKPU akan mengembalikannya untuk diperbaiki kembali dan harus diserahkan paling lambat sampai batas waktupendaftaranberakhir,”sebutnya..(cr-01/nasa)

Lingkungan Dirusak Pemkab Tutup Mata Sambungan Halaman 9 sungai dengan tanah. Selain itu, jalan desa rusak akibat dilintasi truk pengangkut kayu yang melebihi tonase. Untuk mendapat persetujuan dari warga desa, pengusaha kayu berjanji akan memperbaiki jalan desa. Ompung Ayu Hutagaol (60) warga desa mengatakan, penebangan kayu di desa mereka dianggap telah merugikan warga. Pasalnya, selama aktifitas penebangan berlangsung tidak ada memberikan manfaat bagi warga. Justru jalan desa rusak dan berlubang sehingga menyulitkan mereka untuk mengangkut hasil hasil pertanian.

TOYOTA PEMATANGSIANTAR Authorized Toyota Dealer • All new Avanza ready !!! • Veloz accesories full !!! • Grand new innova ready !!!! • Yaris bonus paling lengkap dan full discount • New Rush ready !!! Hub. David Maruhawa, HP 0813 9648 7188; 0831 9355 3180. PIN BB 26C3BF8D (Sales Executive). Data dijemput !!! proses cepat !!!. NB: Harga Siantar sama dengan harga Medan

DIBUTUHKAN SEGERA Wa n i t a ( G a d i s / J a n d a ) dipekerjakan di Medan untuk jaga anak, perawat orang sakit, gaji Rp 700.000 s.d 1.2 jt/bulan (bersih) + bonus, asrama + makan gratis. Hubungi: CAHAYA 2 Jl. Gatot Subroto / Ayahanda 44 E Telp. 0813 6262 7635; 0852 6207 9555

Sampai di Medan (Terminal kami siap menjemput)

(Foto Hermanto Turnip)

„ Aliran sungai sengaja ditutup dan dibiarkan begitu saja oleh pengusaha kayu.

TOYOTA PAKET LEBARAN • Dapatkan New Toyota dengan bunga khusus , Innova dan Fortuner 0% • Dapatkan juga diskon khusus dibulan ini • Proses cepat dan bisa tukar tambah Hub: Predy Simatupang, 0813 6165 1801, 0853 6207 2000 BUTUH EXTRA INCOME !!! KERJA SAMPINGAN / FULL TIME !!! MNC LIFE ( MNC GROUP ) media terbesar di Indonesia, membutuhkan beberapa FINANCIAL CONSULTANT / AGENCY MANAGER yang handal untuk berkarir dan berpenghasilan lebih. Jika anda serius dan membutuhkan informasi tentang syarat-syarat dan proses selanjutnya, segera hubungi bagian Rekruitmen kami : IBU WATI Hp.0823 6888 4343

“Bisa dilihat sendiri, jalan masuk menuju kampung kami rusak semua,” kata ibu yang merupakan warga asli daerah tersebut, Rabu (29/8). Hutagaol mengungkapkan, karena lebih banyak merugikan warga desa maka seluruh warga kampung sepakat untuk menolak penebangan kayu di desa mereka. Mereka beramai-ramai meminta supaya segala kegiatan penebangan dihentikan. “Kami diiming iming jalan kami akan diperbaiki mereka. Nyatanya jalan kami tak kunjung diperbaiki oleh pengusaha kayu itu,” tandasnya. Warga lainnya, Mariduk Simanjuntak (55) juga mengatakan hal yang sama. Kata



Mariduk, seharusnya Pemkab Tobasa tidak hanya mementingkan penambahan pendapatan dari surat penerbitan izin penebangan. Sebab, dampak kerusakan lingkungan yang disebabkan oleh kegiatan penebangan kayu di desa mereka bukan hanya dirasakan saat sekarang ini saja. Bahkan penerimaan pajak dari izin penebangan kayu tak sebanding dengan kerusakan infrastruktur jalan. “Sebaiknya setiap pemberian izin itu disertai kajian apa dampaknya bagi lingkungan. Jangan hanya pengusaha yang diuntungkan, sebaliknya kami yang sengsara jika sampai aliran sungai di desa kami tertutup,” ujarnya.(cr-03/nasa)

Jl. Pattimura No. 42 P. Siantar Telp. 0622 - 27521 HP 0813 6234 7943 (Belakan Ramayana P. Siantar)

6 Pos Pengaman Disiapkan, Ratusan Polisi Diturunkan Sambungan Halaman 9 kegiatan Sinode. Sementara satu pos lagi di Jalan Simanungkalit pintu masuk lokasi Simanarium,” kata Kasubag Humas Polres Taput AIPDA W Baringbing bersama Kabag Ops Kompol PH Sinaga, usai meninjau lokasi titik pos pengamanan SG, Rabu (29/8). Di setiap Pos nantinya kata Barimbing, akan dijaga oleh petugas selama 24 jam sejak sehari sebelum hari H pelaksanaan SG hingga selesai. “Setiap Pos nantinya akan dijaga secara bergantian dengan sistim piket dan menempatkan 10 orang personel polisi,” sebutnya. Ia menuturkan, untuk mengantisipasi hal-hal yang tidak diinginkan, personel akan melakukan sterilisasi kawasan penyelenggaran Sinode Godang di Seminarium HKBP sehari sebelum acara digelar. “Pada H-1, kita bersama panitia akan mengecek lokasi, selanjutnya pada Minggu (9/ 9) malam akan dilakukan sterilisasi lapangan luar dalam Auditorium tempat pelaksanaan SG,” terang AIPDA W Barimbing. Disebutkan juga, selain personel Polres sesuai rencana dan koordinasi dengan pihak penyelenggara Sinode Godang, untuk pengamanan tambahan akan diturunkan sebanyak satu regu gegana Brimob Sumut. “Pelaksanaan Sinode Godang HKBP ini akan mendapat pengamanan khusus dari pihak kepolisian. Satu regu tim gegana dari Brimob Polda Sumut ditambah ratusan personil Polres Taput akan disiagakan selama berlangsungnya SG HKBP itu,” katanya. Dia menjelaskan, pihaknya juga akan mengawasi kondisi lalulintas yang masuk ke kawasan lokasi tempat digelarnya Sinode Godang. Menurutnya, anggota Satlantas juga akan ditempatkan untuk mengawasi jalanjalan umum di lokasi tempat acara SG dan berjaga dihampir semua persimpangan sehingga masyarakat lebih mendapatkan pelayanan. “Pokoknya Polisi akan benar-benar bersiaga, agar setiap agenda rangkaian demi rangkaian SG dapat berlangsung aman dan tertib tanpa ada gangguan. Kami akan berusaha mengawasi keamanan dan ketertiban lalulintas agar SG HKBP berjalan secara nyaman,” ujarnya. Keenam titik pos pengamanan tersebut antara lain di jalan simanare menuju lokasi, pintu masuk Simanarium, di depan Aiditorim, di belakang Auiditorium selanjutnya di tanah lapang atas Auditorium dan di hotel penginapan Cristian Centre. (cr-01/nasa)

Insentif Guru Lama Cair Akibat Birokrasi Lamban Sambungan Halaman 9

Digital Printing Batu Nisan Neon Box Merk Toko Prasasti Baliho Stempel Otomomatis

mewujudkan hubungan industrial yang harmonis di Tobasa guna mencapai visi dan misi yang diusung Pemkab Tobasa. Berdasarkan Surat Keputusan Dewan Pimpinan Provinsi Apindo Sumuatera Utara yang ditandatangani Ketua DPP Apindo Sumut Parlindungan Purba, susunan kepengurusan DPK Apindo Tobasa antara lain: Ketua Ananda Handoko H, Sekretaris Rudi Simamora, Wakil Sekretaris Mangarti Sigalingging, dan Bendahara Dungdung Simanjuntak. Kepengurusan ini didukung para ketua bidang yang membawahi bidangbidang tertentu.(brams/nasa)

“Jadi tidak usah dibuat susah dan beralasan masih menjalani prosedurprosedur. Sederhananya, insentif yang sumbernya dari pusat itukan sudah di tangan Pemkab. Dan tentunya pusat mengirimkannya karena data guru penerima sudah terlebih dahulu ada. Nah, secara logika seharusnya sudah bisa dicairkan. Tidak usahlah seperti-seperti itu lagi. Harusnya gampang malah dibikin susah,” kata Dompak menyayangkan. Memang, lanjut Dompak, dalam sebuah pekerjaan khususnya seperti penyaluran insentif, semua mempunyai prosedur dan mekanisme tersendiri. Namun kalau alasannya hanya karena data guru penerima belum lengkap atau mungkin saat ini sedang memeriksa data guru yang diajukan, dianggapnya hanyalah sebuah alasan klise semata. “Data mana lagi yang mau disusun Dinas Pendidikan. Pusatkan sudah mencairkan dana itu setelah adanya data guru penerima. Nah, jadinya karena Dinas

Pendidikan lama menyampikan permohonan pencairan dana ke Dipenloka (Dinas Pendapatan dan Pengelola Keuangan dan Aset Daerah) selaku pemegang dana itu, yang tentunya Dipenloka juga harus terlebih dahulu mengecek. Jadi intinya kalau cepat dari Dinas Pendidikan maka akan cepat juga dari Dipenloka,” ujarnya prihatin. Sementara itu, Anggota DPRD KabupatenTapanuli Utara Charles Simanungkalit mengatakan, pihaknya berjanji akan mempertanyakan kepada dinas pendidikan kenapa belum mencairkan dana insentif guru PNS non sertifikasi. “Saat ini kami sedang reses. Namun saya janji akan mempertanyakannya nanti kepada dinas pendidikan,” kata Charles saat dihubungi melalui selulernya, Rabu (29/8). Dikonfirmasi secara terpisah, pelaksana tugas (plt) Sekda Taput HP Marpaung kepada METRO mengatakan, kalau saat ini memang dana insentif guru non sertifikasi belum dicarikan. Marpaung juga belum dapat memastikan kapan dana insentif

tersebut akan sampai di tangan guru yang berhak menerimanya. “Saya tak bisa memastikan kapan akan dicarikan. Karena itukan punya prosedur,” ujarnya singkat. Sebelumnya, data yang dihimpun oleh METRO di Dipenloka Taput menyebutkan, dana insentif guru PNS Taput yang non sertifikasi untuk tahun 2012 yang dialokasikan pusat ke Pemkab Taput adalah sebesar Rp7.140.000.000. Dan dana itu dikirim secara bertahap per- tiga bulannya. Hingga Juli, pemerintah pusat sudah dua kali mengirim dana insentif tersebut dengan jumlah sebesar Rp3,5 M dan sudah parkir di kas daerah Taput. Seyogianya insentif tersebut dicarikan sekali tiga bulan. Sekretris Dispenloka Taput Despin Butarbutar, sebelumnya pernah mengatakan, sesuai dengan permohonan Dinas Pendidikan Tapanuli diusulkan sebanyak 2.424 guru menerima dana insentif tersebut dari mulai bulan Januari hingga Maret 2012. Namun, untuk mencairkannya pihaknya harus terlebih dahulu memeriksa data tersebut.(Cr-02/nasa)


30 Agustus 2012

Presiden Tunggu Surat Resmi DPR Soal Darurat Komnas HAM

JAKARTA- Masa kerja komisioner Komnas HAM akan berakhir pada 30 Agustus 2012, namun Komisi III DPR belum juga melakukan fit and proper test terhadap 30 calon anggota Komnas HAM. Presiden SBY menunggu surat resmi dari DPR sebelum mengambil sikap menyangkut nasib Komnas HAM. ”Itu kan sebenarnya dikatakan akan ada surat dari DPR kepada Presiden. Saya sudah cek tidak ada surat dimaksud belum ada di meja kami. Kami belum bisa memberikan sikap maupun pandangan apaapa,”kata Jubir Kepresidenan, Julian Aldrin Pasha, Rabu (29/8). Menurut Julian, Presiden akan segera mengambil keputusan setelah surat dari DPR diterima. Baik dalam bentuk Perppu maupun Keppres sesuai keperluan untuk memastikan dasar hukum Komnas HAM y a n g masa


kerjanya akan segera habis. ”Jadi kami menunggu surat dari DPR,” kata Julian. Masa kerja komisioner Komnas HAM akan berakhir pada 30 Agustus 2012, namun Komisi III DPR belum juga melakukan fit and proper test terhadap 30 calon anggota Komnas HAM. Komisi III DPR pun melempar bola kelanjutan Komnas HAM ke Presiden. Komisi III DPR menyadari keterlambatan fit and proper test anggota Komnas HAM bisa berdampak pada kevakuman Komnas HAM. Karena itu secepatnya Komisi III akan meminta pimpinan DPR meminta Presiden SBY segera mengeluarkan aturan memperpanjang masa kerja komisioner Komnas HAM. ”Kita serahkan kepada pimpinan DPR berkonsultasi dengan Presiden dan mengambil langkah sesuai dengan ketentuan yang berlaku agar tidak ada kevakuman,”kata Ketua Komisi III DPR Gede Pasek Suardika. Komnas HAM menemui Wakil Ketua DPR, Priyo Budi Santoso, pada tanggal 16 Agustus 2012 lalu untuk menyetorkan nama-nama hasil seleksi calon komisioner. Ada 30 nama calon komisioner Komnas HAM. (dtc/int)

Afriani Divonis 15 Tahun Sekelompok Tentara AS Berencana Bunuh Obama SAVANNAH- Sekelompok tentara Amerika Serikat (AS) membentuk sebuah milisi anarkis dan menghabiskan dana 87.000 dollar (Rp 829 juta) untuk persenjataan dalam rangka menggulingkan pemerintah dan akhirnya membunuh Presiden Barack Obama. Demikian menurut sebuah dakwaan pengadilan terhadap para tentara itu seperti dilaporkan Daily Telegraph, Selasa (28/8). Mereka dituduh telah membentuk sebuah kelompok yang disebut FEAR, singkatan dari Forever Enduring Always Ready, dan membeli sebidang tanah di Negara Bagian Washington. Dari tanah itulah nantinya mereka akan melancarkan serangan. Mereka dikatakan sudah berencana untuk meledakkan sebuah bendungan dan meracuni ladang apel di Negara Bagian Washington, mengebom taman di Savannah, Georgia, menyerang kendaraan-kendaraan milik para karyawan Departemen Keamanan Dalam Negeri, dan mengambil alih sebuah pusat kontrol amunisi di markas tentara yang luas di Fort Stewart, Georgia. Para jaksa mengatakan, tujuan jangka panjang mereka adalah revolusi, menjatuhkan pemerintahan AS dan membunuh Presiden Barack Obama. Namun tidak diketahui kapan dugaan persekongkolan itu akan terjadi. Rincian tentang milisi tersebut terungkap dalam proses pengadilan sipil di Georgia di mana tiga tentara telah dituduh melakukan pembunuhan. Prajurit Isaac Aguigui, yang diidentifikasi sebagai pendiri dan pemimpin FEAR, Sersan Anthony Peden, dan Prajurit Christopher Salmon, didakwa atas kematian seorang mantan tentara, Michael Roark (19 tahun), dan pacarnya Tiffany York (17 tahun). Kedua korban diduga dibunuh di hutan di Georgia Desember lalu, demi menjaga rahasia keberadaan milisi tersebut. Terdakwa keempat dalam kasus itu, Prajurit Michael Burnett (26 tahun), mengakui dua tuduhan pembunuhan pada hari Senin. Dia bersikap kooperatif dengan para jaksa dalam sebuah kesepakatan yang akan memungkinkan dia terhindar dari hukuman mati. (dtc/int)

JAKARTA- Afriani Susanti dijatuhi hukuman 15 tahun penjara oleh Majelis Hakim Pengadilan Negeri Jakarta Pusat. ”Terbukti salah dan meyakinkan terdakwa dengan sengaja mengemudikan kendaraan bermotor dan mengakibatkan orang lain meninggal dunia, menjatuhkan pidana penjara selama 15 tahun,” Ujar Ketua Hakim Pengadilan Negeri Jakarta Pusat Antonius Widiyanto saat membacakan vonis di ruang sidang R Wirjono Prodjodikoro, Pengadilan Negeri Jakarta Pusat, Rabu (29/8). Menurut majelis hakim, Afriyani tak terbukti bersalah dalam dakwaan pertama Jaksa Penuntut Umum (JPU) Pasal 338 KUHP tentang pembunuhan. ”Sebelum mengemudikan mobil Daihatsu Xenia terdakwa tidak mempunyai niat secara jelas akan menabrak korban-korban diatas trotoar. Unsur sengaja tidak terbukti, dengan demikian terdakwa bebas

„ Afriani Susanti dari Pasal 338,” tuturnya. Sementara untuk Pasal 311 ayat 4 Afriyani terbukti bersalah karena mengemudikan kendaraan bermotor dalam kondisi yang membahayakan nyawa orang lain.

Terlebih setelah meminum pil ekstasi di Stadium, Jakarta. ”Dengan kondisi demikian sudah seharusnya terdakwa mengetahui kondisinya agar tidak mengemudi karena dapat membahayakan pengguna jalan lainnya. Namun terdakwa justru membawa mobil Daihatsu Xenia. Unsur dengan sengaja membawa kendaraan bermotor dalam kondisi membahayakan nyawa orang lain terbukti,” papar Majelis Hakim. Terkait kasus narkoba, majelis hakim menilai Afriani tidak terbukti pasalnya tidak ditemukan barang bukti. Majelis hakim menilai hal-hal yang meringankan terdakwa yaitu berlaku sopan dan tidak pernh dihukum. Sementara yang memberatkan perbuatan terdakwa telah memberikan duka yang mendalam bagi korban luka dan korban meninggal dunia. Selain itu, perbuatan terdakwa juga dianggap meresahkan masyarakat. (dtc/int)

„ Para pimpinan KPK memberikan penjelasan terkait penanganan kasus Simulator SIM.

Kasus Simulator SIM

4 Perwira Polisi Diperiksa JAKARTA- Komisi Pemberantasan Korupsi (KPK) menjadwalkan pemeriksaan empat anggota kepolisian terkait kasus dugaan korupsi proyek simulator surat izin mengemudi (SIM), Rabu (29/ 8). Mereka diperiksa dalam kapasitas sebagai panitia lelang proyek simulator SIM. “Diperiksa sebagai saksi untuk tersangka DS (Djoko Susilo),” kata Kepala Bagian Pemberitaan dan Informasi KPK Priharsa Nugraha di Jakarta, Rabu. Keempat polisi itu adalah Ajun Komisaris Besar Wisnu Budaya, Ajun Komisaris Besar Wandi Rustiwan, Komisaris Endah Purwaningsih, dan Komisaris Ni Nyoman Suwartini. Hingga pukul 14.00, keempat anggota kepolisian itu belum memenuhi panggilan pemeriksaan KPK. Menurut Priharsa, KPK sudah mengirim panggilan pemeriksaan kepada empat anggota polisi itu sejak 15 Agustus 2012. Dalam kasus simulator SIM ini, KPK menetapkan empat tersangka atas dugaan melakukan penyalahgunaan kewenangan sehingga menimbulkan

kerugian negara. Selain Djoko, tiga orang lain yang jadi tersangka adalah Brigadir Jenderal (Pol) Didik Purnomo dan dua pihak swasta, masing-masing Budi Susanto dan Sukotjo S Bambang. Ketiga tersangka terakhir itu juga ditetapkan sebagai tersangka oleh Kepolisian Republik Indonesia. Sejauh ini, KPK belum memeriksa Djoko. Wakil Ketua KPK Busyro Muqoddas kemarin mengatakan bahwa KPK masih fokus memeriksa saksi dan mendalami barang bukti yang diperoleh. Sebelumnya, KPK memeriksa Sukotjo S Bambang sebagai saksi untuk Djoko. Selain itu, KPK memeriksa Sekretaris Budi Susanto yang bernama Intan Pardede. (kmc/int)

KPK Kejar Tersangka Lain Kasus Angie JAKARTA- Komisi Pemberantasan Korupsi (KPK) telah melimpahkan kasus Angelina Sondakh ke pengadilan. KPK memastikan, untuk kasus suap terkait Wisma Atlet ini tidak hanya menjerat Angie. Kasus masih akan berlanjut dengan melihat fakta di persidangan. ”Pengembangan kasusnya biasanya caranya adalah proses pemeriksaan di pengadilan itu dijadikan bagian dari proses pengembangan yg punya kaitan dengan potensial

suspect yg lain,” jelas Wakil Ketua KPK Bambang Widjojanto di gedung KPK, Jalan HR Rasuna Said, Kuningan, Jakarta, Rabu (29/8). Bambang mengatakan bahwa pengembangan kasus itu tidak berhenti. Selain menunggu fakta di persidangan, KPK juga terus melakukan pengumpulan bukti-bukti. ”Itu digodok. Artinya diinvestigasi, dikumpulkan bukti-buktinya untuk kemudian apakah ini bisa lantas di lidik lalu disidik,” lanjut Bambang Bambang juga menuturkan bahwa

penyidik nanti akan melihat rangkaian keterangan yang didapat sehingga bisa membuktikan bahwa ada orang lain yang terlibat kasus ini atau justru sebaliknya. ”Jadi semua penyidik dalam penyelidikan itu pasti melihat rangkaian keterangan yg memungkinkan orang lain terlibat. Tapi bisa juga mengklarifikasi kalau orang lain itu tdk terlibat. Nah proses itu yg sedang berjalan. Saya belum tahu hasil dari proses itu,” tutur Bambang. (dtc/int)

„ Wakil Ketua KPK Bambang Widjojanto.

KPK Segera Periksa Tersangka Kasus Hambalang JAKARTA- KPK segera melakukan pemeriksaan atas Dedy Kusnidar di kasus Hambalang. Dedy merupakan tersangka pertama di kasus Hambalang. Dedy belum pernah diperiksa KPK. ”Yang saya dengar dari penyidik, pemeriksaan terhadap Dedy segera. Tapi dugaan saya tidak dalam minggu ini,” jelas Wakil Ketua KPK Bambang Widjojanto di KPK, Jl Rasuna Said, Kuningan, Jakarta, Rabu (29/8). Bambang menjelaskan, keterangan Dedy yang Kepala Biro Keuangan dan Rumah

Badai Hantam Korsel, 9 Tewas SEOUL- Badai menghantam Korea Selatan diikuti angin kencang dan hujan lebat menyebabkan sembilan orang dan menimbulkan ombak yang menghantamkan dua kapal nelayan China menghantam karang. Tim penyelamat berhasil menyelamatkan 12 nelayan dan masih mencari 10 nelayan lainnya yang hilang setelah kapal mereka menghantam karang di lepas pantai Pulau Jeju. Sebanyak lima nelayan tewas. Di tempat terpisah, sedikitnya empat orang tewas saat Badai Bolaven memutuskan sambungan listrik ke ratusan ribu rumah di Korea Selatan, menyebabkan penerbangan ditunda, dan menghentikan latihan gabungan antara militer Amerika Serikat dan Korsel. Korea Utara yang masih berjuang memulihkan diri akibat banjir dan kekeringan kini berada dalam jalur badai tersebut. (dtc/int)

„ Angelina Sondakh

Tangga Kemenpora ini penting untuk membuka informasi lainnya terkait kasus Hambalang. ”Dedy jadi penting setelah kita dapat klarifikasi, konfirmasi, dan keterangan lain-lainnya,” tuturnya. Bambang juga menegaskan, KPK tidak berhenti pada Dedy. Penyidikan terus berjalan mengejar tersangka lain. “Selain penyelidikan yang Dedy kan tetap jalan. Tidak pernah ada dalam statement KPK Dedy adalah anak tangga terakhir. Yang ada, Dedy anak tangga pertama,” tuturnya. (dtc/int)

Tina Talisa Melapor ke Dewan Pers JAKARTA - Anggota Dewan Pers, Agus Sudibyo membenarkan bahwa kedatangan presenter kondang Tina Talisa terkait soal pemberitaan dugaan penerimaan aliran dana hasil korupsi. Tina melaporkan empat media cetak kepada Dewan Pers. ”Medianya Rakyat Merdeka, Kompas, Warta Kota, sama Berita Kota,” kata Agus saat ditemui di kantor Dewan Pers, Jalan Kebon Sirih, Jakarta Pusat, Rabu (29/8). Menurut Agus, Tina merasa disudutkan oleh pemberitaan keempat media. Pemberitaan yang dibuat keempat surat kabar tidak mencantumkan konfirmasi dari

Tina soal dugaan penerimaan uang haram dari anggota dewan. Padahal, kata Agus, konfirmasi tersebut sangat dibutuhkan karena menyangkut nama baik seseorang. ”Yang kami lihat memang tidak mengandung konfirmasi sama sekali. Padahal, konfirmasi penting dan apalagi ini menyangkut nama baik orang,” papar anggota Dewan Pers bidang Pengaduan Masyarakat dan Penegakan Etika ini. Rabu (29/8) siang tadi Tina Talisa mendatangi kantor Dewan Pers bersama Pemimpin Redaksi Indosiar, Nurjaman. Hanya saja, istri pengusaha Amrinur Okta

Jaya itu enggan menjelaskan lebih lanjut soal laporannya kepada Dewan Pers. Sebelumnya, sejumlah media massa nasional memberitakan soal presenter televisi beinisial TT yang menerima aliran dana dari anggota DPR berinisal MA pada pertengahan 2011. Selain itu, MA juga dikabarkan membeli tiga mobil mewah atas nama suami TT berinisial Oct. Antara lain mobil Range Rover tahun 2011 dengan harga Rp 2 miliar, mobil Mercy C200 tahun 2010 seharga Rp 600 juta, dan mobil BMW seri X3 seharga Rp 600juta. (dtc/int)


„ Tina Talisa didampingi Pemimpin Redaksi Indosiar, Nurjaman Mukhtar saat mengadu ke Dewan Pers di Jalan Kebon Sirih, Jakarta Pusat, Rabu (29/8).


30 Agustus 2012

Interaktif Tapanuli Berapa Tarif Ngurus SIM Sebenarnya? Yang terhormat Kapolres Tapteng dan Kasatlantas, kami warga merasa sangat terbebani dengan tarif pengurusan Surat Izin Mengemudi (SIM) yang menjampai Rp250 ribu hingga Rp400 ribu, padahal tarif yang ditetapkan pemerintah hanya Rp100 ribu hingga Rp120 ribu. Dikemanakankah uang-uang tersebut?

Pengirim: 0812620XXX

Rambu-rambu Lalulintas di Pinangsori Tak Jelas! Kepada yang terhormat Bapak Kapolres dan Kasatlantas Polres Tapteng tolong dulu ditinjau jalan Bandara Pinangsori, karena dipasang rambu-rambu yang tak menentu. Mungkin apabila diperpanjang akan menimbulkan kecelakaan bagi orang-orang yang tak mengetahui rambu tersebut, jadi tolong diperhatikan.

Pengirim: 082168332XXX

Tangkap Pemakai Narkoba d Simpang Jalan Horas! Pak Kapolresta Sibolga yang terhormat, tolong ditangkap pemakai narkoba yang berada di simpang jalan horas, tempat jualan tuak bernama LP, kami warga sini sangat keberatan akan anak kami ikut terpengaruh, mereka anak-anak terminal.

Pengirim: 085262273XXX

Air PAM Sering Macet Bapak Bupati Taput yang terhormat, kapan air PAM bisa jalan, sudah hampir sebulan kami tidak merasakan air bersih, terutama di Aek Ristop.

Pengirim: 08139706XXX


„ Jalinsum Tarutung-Sibolga yang kini sedang dalam perbaikan dan pelebaran.

Jalinsum Tarutung-Sibolga Mesti Mulus! Seribu satu keluhan tentang kondisi Jalinsum Tarutung-Sibolga. Mulai dari medannya yang berkelok-kelok, tanjakan dan turunan, rawan longsor dan anjlok, jurang dan berbukit, hingga badan jalan rusak. Meski tiap tahun pemerintah mengucurkan banyak dana untuk perbaikan dan perawatan infrastruktur vital itu, tapi kondisinya tidak pernah mulus. “Kalau mau jujur, Jalinsum Tarutung-Sibolga mesti mulus. Sebab, ada beberapa daerah yang berkepentingan dengan jalan itu. Jalan Negara ini adalah akses ekonomi masyarakat

Sibolga, Tapteng, dan daerah di Kepulauan Nias. Dan merupakan salahsatu faktor pendukung laju kemajuan dan pembangunan daerah,” kata Ketua Lembaga ICW Sibolga-Tapteng, Dohar F Sianipar. Bila kondisinya tidak mulus dan aman, sambung Dohar, maka dampaknya sangat luas. Rugi waktu dan materil, bahkan korban jiwa. “Misalnya

kalau terjadi longsor, jalan kemudian macet. Sudah berapa kerugian materi karena itu. Dan saya pikir sudah tidak terhitung lagi berapa korban jiwa di sepanjang jalan itu, baik itu yang mengalami kecelakaan atau kendaraannya terjun ke jurang di sisi jalan,” timpal Dohar. Sementara itu, kucuran anggaran untuk perbaikan jalan tersebut dari pemerintah pusat maupun provinsi terbatas. Alasannya, akan dibangun secara bertahap. Atau kerusakan akibat faktor bencana ataupun alamnya. (*)

“TIAP tahun diperbaiki dan dirawat. Tapi tak pernah bisa mulus. Padahal kalaulah pemerintah serius, pasti anggaran bisa diperbesar untuk perbaikan seluruhnya. Dan kualitas dan pengawasan pengerjaannya jangan asalasalan. Supaya mampu bertahan lama”.

Master Gultom, warga Kecamatan Sitahuis, Tapteng

ANEH TAPI NYATA Sepedamotor Berbahan Bakar

Kotoran Hewan

Si Kembar Anorexia

Akhirnya Tewas dalam Kebakaran MELBOURNE - Memiliki bentuk tubuh yang ideal adalah impian besar setiap wanita. Langsing dan proposional menjadi salah satu tujuan mereka. Untuk mencapai itu semua, banyak dari wanita yang terobsesi untuk menjadi kurus hingga menyebabkan mereka mengidap anoreksia. Gambaran seorang wanita yang diharuskan memiliki bentuk badan kurus dan langsing menjadi patokan sendiri bagi banyak wanita di dunia ini. Karena itulah, mereka berlomba-lomba untuk melakukan diet ketat demi mendapatkan predikat cantik dengan bentuk tubuh ideal. Hal ini juga terjadi pada kembar identik yang terkenal karena anoreksia, Clare dan Rachel Wallmeyer. Baru-baru ini mereka ditemui tewas akibat kebakaran di rumahnya. Sepasang kembar identik ini menjadi terkenal melalui pertempuran mereka melawan anoreksia yang diidapnya. Clare dan Rachel Wallmeyer yang sama-sama berusia 42 tahun tewas pada kebakaran yang terjadi di rumah mereka di Geelong, dekat Melbourne, salah satu dari mereka mengalami luka bakar yang parah dalam perjalanan ke rumah sakit, Rabu (29/8). Itulah akhir tragis untuk dua kehidupan yang bergolak demi meraih sosok cantik dengan bentuk tubuh impian semua wanita. Meski selama hidupnya mereka berjuang melawan itu tapi kepergian mereka yang tragis menyentuh hati semua orang di seluruh dunia.

TV Australia beberapa kali berbicara mengenai anoreksia yang telah berubah menjadi suatu habitat bagi remaja sekarang ini dan ini menjadi masalah serius bagi orangtua mereka. Dalam cerita pedih kehidupan Clare dan Rachel selama hidupnya, mereka mengatakan dalam beberapa tahun terakhir tidak pernah jatuh cinta, tidak pernah punya pekerjaan dan mereka percaya hanya soal menunggu waktu sebelum mereka meninggal bersama-sama. Kematian mereka dalam kebakaran tersebut diyakini tidak disengaja, menurut Detektif dari Unit Investigasi Kejahatan Geelong. Dalam wawancaranya dengan salah satu stasiun televisi Australia yang berjudul Australia’s 60 Minutes belum lama ini, mereka mengungkap awal mereka mengidap anoreksia. “Di masa pertumbuhan kami mulai merasakan cerminan wanita cantik itu langsing dan kurus, sehingga, entah bagaimana, kami mulai tidak makan apapun, mungkin hanya melon saja,” ungkap Claire. “Dan kami hanya meminum Diet Coke dan kopi,” imbuh Rachel yang juga mengaku meminum 20 obat pencahar setiap harinya. Rachel bahkan mengungkapkan, satu-satunya orang yang berada di sisinya selama ini hanyalah saudara kembarnya. “Setidaknya kami akan meninggal bersama. Berada di sebelah Rachel membuat semuanya mudah untuk meninggal,” jelas Claire. (oz/nik)

TOKYO, — Pembuat toilet terkemuka Jepang, Toto, Rabu (29/8) meluncurkan sepeda motor poop-powered yang bisa berjalan sejauh 300 kilometer, dengan tanki bahan bakar disi dengan kotoran hewan. Sebagaimana dilanris kantor berita AFP, Rabu, Toto mengklaim hasil produksinya ini sebagai kendaraan dengan bahan bakar kotoran hewan yang pertama di dunia. Sepeda motor atau kendaraan dengan tiga roda ini memiliki toilet sebagai tempat duduk pengemudinya dan sebuah kertas pembersih toilet ukuran besar di bagian belakang kendaraan. Dengan seorang perempuan cantik dan muda duduk di atas kendaraan ini dalam tes mengemudia hari Rabu, raksasa produsen toilet terkemuka Toto segera menegaskan bahwa perempuan tadi bukan yang memproduksi “bahan bakar” bagi sepeda motor itu.

“Biogas yang dipakai sebagai bahan bakar sepeda motor ini tidak berasal dari kotoran manusia. Biogas ini dibuat dari kotoran ternak dan limbah cair,” ujar Kenji Fujita, juru bicara Toto dalam jumpa pers di pinggiran Tokyo, Jepang. “Kami berharap produk ini menambah kesadaran di antara para pelanggan soal kampanye hijau melalui pengembangan produk yang ramah lingkungan, sebagaimana pemancur yang hemat air dan toilet yang hemat air,” tuturnya. Namun demikian, pihak Toto menegaskan, mereka tidak akan membuat sepeda motor untuk dijual secara komersial. Paling tidak, belum ada rencana ke sana. (kps/nik)

PELUNCURAN :Sepedamotor yang berbahan kotoran hewan diluncurkan.

Adik George W Bush Komunis? WASHINGTON-Adik dari mantan Presiden Amerika Serikat (AS) George W. Bush, Neil Bush, merilis foto kontroversial dengan menggunakan topi Mao Tse Tung. Foto itu juga bertulisan, “Saya berniat untuk bergabung dalam Partai Komunis China.” Foto Neil Bush muncul di jejaring sosial Weibo milik China. Beberapa pihak mengecam sikap Neil, namun beberapa orang lainnya justru menganggap hal itu sebagai lelucon. Mereka mengatakan bahwa, Neil terlalu pandai untuk menjadi pejabat Partai Komunis China. Beberapa pengguna jejaring sosial Weibo sering melontarkan kritiknya terhadap Partai Komunis China. Tak jarang mereka menyebut partai itu sebagai partai korup yang didominasi politisi pedofilia. ”Bila kau bisa bergabung dengan Partai Komunis China, kau bisa menggelapkan dana, menerima suap, mencari pelacur dan juga memerkosa bocah tanpa dihukum,” demikian komentar salah seorang pengguna Weibo, Rabu (29/8). Keluarga Bush memiliki kemitraan yang cukup erat dengan China. Kemitraan itu sudah terjalin di saat George Bush senior menjabat sebagai Kepala Perwira Penghubung di Beijing pada dekade 1970an. Neil Bush sendiri sudah aktif menggunakan jejaring sosial Weibo sejak September 2011. Neil merupakan seseorang yang sangat menghormati China dan berhasil meraih followers sebanyak 45 ribu di Weibo, hanya dalam dua hari. (oz/nik)

Bayi Prematur

Tewas Digigit Tikus

CHENNAI - Bukannya berbahagia menyambut kelahiran bayi mereka sepasang suami istri di Chennai, India justru dipaksa menghadapi kenyataan pahit. Bagaimana tidak, pasangan ini mendapati bayi mereka tewas akibat hal yang sama sekali tak wajar. Bayi yang lahir secara prematur itu kabarnya tewas di dalam inkubator. Pasangan suami istri itu pun menuding bayi mereka tewas karena digigit tikus, Rabu (29/8). Akibat insiden ini dua dokter dan

tujuh perawat di rumah sakit itu kabarnya diberhentikan karena dinilai melakukan kelalaian. Tidak hanya kedua orang tua bayi malang itu namun warga Chennai pun dilaporkan marah menanggapi insiden memilukan ini. Bahkan akibat insiden ini Kementerian Negara India pun sampai turun tangan untuk mencari solusi atas masalah tersebut demi meredam kemarahan massa. Kabar lain menyebutkan bayi tersebut telah tewas. Namun jasadnya dibiarkan berada semalaman di rumah sakit sebelum diserahkan kepada anggota keluaga keesokan harinya. Sementara itu, pihak rumah sakit dikabarkan segera menempuh langkah-langkah cepat untuk mensterilkan kawasan itu dari ular dan tikus yang kabarnya kerap berkeliaran. Untuk melaksanakan langkah ini pihak rumah sakit pun melibatkan para pemburu ular. (oz/nik)


30 Agustus 2012


ejak berpisah dengan Ahmad Dhani, Maia Estianty kini belum mendapat pasangan baru. Pendiri Duo Ratu tersebut sepertinya sudah pasrah tidak mendapatkan jodoh. ”Sama seperti anak-anak aku enggak pernah mengharapkan mereka dateng,

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober) Peruntungan: Keruwetan mulai teratasi namun mungkin akan muncul yang baru, untuk itu jangan mudah percaya dengan omongan orang. Berjalanlah dengan prinsip Anda sendiri dan hiduplah yang sederhana. Asmara: Hadapilah tantangan kecil dengan hati yang besar dan lapang dada, jangan cepat menyerah.


udah pasrah,” kata Maia saat ditemui di Episentrum Kuningan Jakarta Selatan, Selasa (28/8) malam. Maia menyatakan kini dirinya tidak terlalu agresif untuk menjadi jodoh. Ia menyatakan, dirinya tidak pernah mencari jodoh. ”Anak-anak begitu udah enggak saya harapkan tiba-tiba datang.

Sama seperti jodoh saya enggak perlu cari nanti datang sendiri lah,” jelas Maia. Maia mengaku bahwa dirinya banyak didekatin cowok. “Yang deket banyak, tapi untuk jadi pasangan belum lah, saya belum mikirkan pasangan,” kata ungkapnya.(abu/ jpnn)

PERJALANAN asmara Pinkan Mambo penuh liku. Hubungannya bersama Febriyanto Wijaya, pemain sepak bola asal Mamuju, Sulawesi Selatan, telah kandas. Ia pun harus menerima kenyataan pahit itu karena terbentur perbedaan. “Aku sudah putus ya. Sekitar dua bulanan lalu. Ya begitulah, memang enggak mudah mencari orang yang benar-benar. Intinya banyak perbedaan,” ucapnya, saat ditemui di Studio Guet, Perdatam, Pancoran, Jakarta Selatan. Hubungan Pinkan dan Febriyanto sudah tak bisa lagi diselamatkan. Keduanya sulit menyatukan visi ke depan. Masing-masing punya tujuan berbeda. Sehingga, keputusan untuk berpisah merupakan jalan keluar satu-satunya. Harapannya untuk membina rumahtangga buyar. “Misalnya, gol aku ke mana, dia ke mana. Jadi,

enggak ketemu. Aku enggak bisa menjelaskan ke media. Tapi aku tentu punya pertimbangan. Aku tahu mana yang baik dan tidak. Tapi aku enggak bilang kalau dia enggak baik ya,” ucapnya. Kesedihan pun meliputinya. Namun, ia tidak mau terlalu lama larut dalam perasaan tersebut. Baginya, pengalaman asmaranya bersama Febriyanto membuatnya banyak belajar untuk menata kembali kehidupannya di masa depan. Sebagai manusia, penyanyi kelahiran Jakarta, 11 November 1980 itu, hanya bisa berencana, tetapi Tuhan punya kehendaknya sendiri. “Aku tambah belajar dari pengalaman. Aku memutuskan dengan kekuatan aku sebagai manusia. Ketika aku sudah tahu mana yang baik dan enggak, kembalikan lagi kepada Tuhan. Kalau jodoh enggak ke mana-mana,” tandasnya. (tr/int)

(21 Desember -19 Januari)

Kesempatan untuk menanjak ke atas semakin terbuka, tinggal tergantung bagaimana cara Anda bersosialisasi dengan rekan-rekan kerja sehingga tidak muncul permusuhan yang akhirnya hanya akan menghambat laju karir Anda saja. Asmara: Cekcok mulut tak akan menyelesaikan masalah, justru akan semakin memperumit saja.


(20 Januari - 18 Februari)

Peruntungan: Emosi yang labil hendaknya bisa diberi perhatian serius. Jangan sampai kesuksesan yang telah berada di depan mata hilang begitu saja hanya karena sikap Anda yang kurang bisa sabar dalam menghadapi berbagai macam omongan yang memanaskan hati. Asmara: Carilah jalan keluar dalam menghadapi masalah cinta yang memang sedang Anda hadapi ini.


19 Februari - 20 Maret

Peruntungan: Egoisme dan rendah diri itu tidak ada untungnya, untuk itu alangkah baiknya disisihkan saja. Kalau dibiarkan berjalan terus yang rugi bukan orang lain tetapi diri Anda sendiri. Asmara: Untuk lebih baiknya cinta memang tidak lantas tutup mata dan telinga, saran masuk mesti diterima dengan baik.


(21 Maret - 20 April)

Peruntungan: Isu di hari ini sangat merugikan padahal kebenarannya sudah jelas disangsikan. Semua itu hadapilah dengan hati yang lapang dan kepala dingin. Anggaplah semua ini merupakan ujian untuk meraih jenjang yang lebih tinggi. Asmara: Hindarilah pertikaian yang hanya akan memperburuk suasana dan ketenangan saja.


(21 April - 20 Mei)

Peruntungan: Di hari ini perjalanan perbintangan Anda cukup bagus, walau banyak persoalan timbul tenggelam, namun semuanya bisa teratasi dengan baik. Tetaplah optimis, apalagi simpati orang lain terhadap Anda cukup besar sehingga Anda harus bisa lebih percaya diri dan yakin dengan apa yang telah menjadi keputusan Anda. Asmara: Anda harus puas dengan apa yang selama ini dia berikan pada diri Anda.


(21 Mei - 20 Juni)

Peruntungan: Berhati-hatilah dalam melangkah sebab jika Anda salah dalam melangkahkan kaki maka bisa berakibat fatal. Bintang Anda cukup bersinar terang hanya saja ada ombak yang datang menghantam Anda, jika hati-hati maka Anda akan selamat. Asmara: Anda sedang mengalami gelombang pasang yang hebat. Cobalah Anda mengerti dengan sikap yang Anda lakukan dengan memberi kepercayaan tanpa perlu mendiktenya, seperti yang selama ini Anda lakukan.


NIKITA Mirzani senang dicaci maki masyarakat karena sering berpose vulgar. Baginya, hujatan tersebut malah memotivasi untuk berpose lebih menantang lagi. ”Niki nggak merasa terganggu dengan banyak orang komplain. Malah senang, malah jadi motivasi Niki untuk menjadi lebih untuk mempunyai foto yang bagus lagi dari foto yang lalu,” ungkap Nikita di Tebet, Jakarta Selatan. Menurut janda beranak satu ini, selama terjun ke dunia hiburan, ia tak pernah foto-foto yang berbau pornografi. ”Jadi nggak ada joroknya atau pornografinya. Karena di situ nggak ada angel foto yang mengangkang atau apa segala macam,” tegasnya. ”Foto Niki nggak ada yang hot. Mungkin lihatnya di sebelah kompor atau orang yang nabun api,” imbuhnya dalam nada canda. (idc/int)

(21 Juni- 20 Juli)

Peruntungan: Pengaruh serta kewibawaan Anda sangat menentukan bagi keadaan sekitar. Hindari rasa kurang percaya diri sebab pada hakikatnya hal ini hanya akan merugikan saja. Jangan terpancing dengan omongan-omongan, semua itu hanya akan menghalangi langkah Anda ke depan. Asmara: Bersikaplah terbuka dengan pasangan Anda sehingga bisa terhindarkan dari segala fitnah dan omongan yang tidak benar.


(21 Juli-21 Agustus)

Peruntungan: Lakukan terobosanterobosan penting di hari ini karena memang sudah waktunya dan cukup ada peluang untuk maju. Bintang Anda lagi bagus dan cukup membawa kemujuran. Karir: Cukup banyak halangan yang harus dihindari, bersabarlah. Asmara: Dengarkan saja setiap kata-katanya agar tidak selalu timbul cekcok mulut.


(23 Agustus-22 September)

. eruntungan: Jangan ragu untuk menolak P kalau itu memang tidak sesuai dengan hati Anda. Buat apa Anda pertahankan kalau akhirnya di kemudian hari hanya akan membikin pusing Anda saja? Asmara: Jangan malas untuk bertemu dengannya, minimal menelponnya jika memang tidak ada waktu.


(23 Oktober - 22 November)

Peruntungan: Inisiatif dan ide-ide cemerlang Anda tampaknya sangat diperlukan dalam setiap langkah. Walau begitu konsultasi dengan pihakpihak yang lebih berpengalaman tampaknya perlu juga. Asmara: Jangan begitu mudahnya termakan isu yang sengaja disebar olehnya.


( 23 November - 20 Desember)

Peruntungan: Jangan suka menunda pekerjaan karena bila menumpuk akan menimbulkan kebosanan. Di hari ini cobalah bekerja sepraktis mungkin sehingga kejenuhan yang sudah di ambang batas itu tidak sampai menambah pusing. Asmara: Hati boleh panas akan tetapi pikiran harus tetap dingin, dengan begitu walaupun amarah memuncak hubungan percintaan Anda tetap aman-aman saja. (int)

EMMA Stone hancur saat patah hati. Wah, karena ulah Andrew Garfield kah? Mengutip femalefirst, aktris Easy A yang saat ini masih berkencan aktor Inggris, Andrew Garfiel merasa hancur saat harus berurusan dengan retaknya hubungan kekasih. “Saya merangkak di lantai dan muntah. Saya merasa hancur dan terbunuh, namun tetap

harus menjalani hidup,” terang Emma. Emma yang saat ini tak bermasalah Andrew, justru mengaku merasa dekat dengan aktor Ryan Gosling, lawan mainnya dalam Crazy, Stupid, Love “Saya merasa nyaman, mungkin karena apa yang dipikirkannya, sama seperti apa yang saya pikirkan,” tutur Emma. (int)

Selena Gomez membeli rumah seharga US$2,9 juta atau Rp27,55 miliar di Jonah Hill di Los Angeles. Seperti dikutip Femelfirs, rumah dengan luas 4.650 kaki persegi itu memiliki lima kamar tidur, enam kamar mandi, kolam renang, lapangan tennis dan spa. Meski rumah itu dibeli dari uangnya sendiri, namun bukan berarti kekasihnya, justin Bieber, bisa seenaknya tinggal di rumah tersebut. ”Aku bahagia dengannya. Tapi aku baru 20, dan belum berani serius dalam kehidupan pribadi. Aku bersyukur memiliki teman dan tim solid yang mencintaiku,” kata Selena. ”Pernikahan dan semua hal lain aku pikir akan terjadi setelah aku merasa telah mencapai dalam setiap aspek lain dari kehidupanku,” katanya. (idc/int)



30 Agustus 2012 METRO TAPANULI

Evander Holyfield

Pamer Kaos Bergambar

TATO TYSON EVANDERHolyfield dan Mike Tyson boleh jadi pernah terlibat pertarungan paling kontroversial dalam sejarah tinju profesional. Namun setelah gantung sarung tinju, keduanya justru saling membantu dalam mempromosikan produk yang mereka pasarkan. Tyson membuat geger dunia tinju profesional pada saat menjalanitarungulangmelawan Holyfield, 28 Juni 1997. Setelah kalah TKO di pertarungan sebelumnya, Tyson justru berbuat konyol di partai rematch. Saat memasuki ronde ketiga, Si Leher Beton tanpa terduga menggigit telinga Holyfield. Wasit langsung menghentikan laga. Tyson kemudian didiskualifikasi. Malam harinya, kerusuhan juga pecah di areal kasino yang ada di MGM Arena —lokasi pertarungan keduanya. Tyson beralasan bahwa tindakannyamerupakanbalasan atas tandukan yang dilakukan Holyfield selama pertarungan. Akibat aksi ini, Tyson dihukum denda sebesar US$ 3 juta. Selain itu, Komisi Tinju Nevada mencabut lisensi pertandingannya.

Namun dua hari setelah pertandingan, Tyson meminta maaf dan memohon lisensinya tidak dicabut. Permintaan ini akhirnya dikabulkan pada 9 Juli 1997. Pada acara The Oprah Show pada 2009 lalu, Tyson kembali meminta maaf kepada Holyfield. Setelah itu ketegangan di antara keduanya terus mencair. Bahkan belakangan, Tyson dan Holyfield menjadikan momen kontroversial tersebut sebagai bahan untuk bercanda di dunia maya. Belum lama ini, Holyfield mengunggah foto dirinya mengenakan T-Shirt bergambar tato milik Tyson pada akun twitter miliknya. Di bawahnya, Holyfiedl menuliskan “Mike Tyson mengigit telinga saya dan semua yang saya dapat hanyalah t-shirt yang buruk ini.” T-Shirt tersebut merupakan bagian Mike Tyson Collection yang saat ini sedang dipasarkan oleh Tyson. Sebelumnya Tyson juga membantu Holyfield memasarkan saus Real Deal Barbecue yang diproduksi mantan juara dunia tinju kelas berat itu. (int)

Dua anak Indonesia dikirim ke Jerman untuk latihan di camp Bayern Munich, Jerman.

2 Anak Indonesia Terbang ke Jerman Menggocek si kulit bundar di daratan Eropa menjadi mimpi bagi banyak orang yang bergelut dengan sepakbola. Nah, tahun ini dua anak Indonesia berkesempatan untuk bisa berlatih dan bermain sepakbola di Eropa. Tak tanggung-tanggung, di markas Bayern Munich. Kedua anak Indonesia itu adalah Moch Aula Rizky dan Ary Rezqy Hakim. Mereka terpilih dalam seleksi ketat untuk mengikuti Allianz Junior Football Camp (AJFC) di Munich, Jerman. Aula merupakan siswa kelas VIII SMP Regina Caeli, Cileungsi. Dia merupakan putraMZaenalArifindanJunaiyahyanglahir

Holyfield dan Tyson

diSidoarjopada16Mei1998.BagiAula,inilah pertama kalinya dia keluar negeri. Sedangkan Ary sudah beberapa kali keluar negeri untuk urusan sepakbola. Dia adalah siswa SMP Jl Ujung Menteng, Cakung, Jakarta Timur, kelas VIII. Ary adalah putra dari Fauzan Hakim dan Farihatun Munir. Menurut Head of Corporate Communication Central Function PT Asuransi Allianz Life Indonesia, Adrian Dosiwoda, kegiatan ini sudah berlangsung untuk keempat kalinya. Pertama kali kegiatan ini diselenggarakan pada 2009 lalu. “AJFC dimulai pada 2009 dan merupakan kegiatan global di Allianz Football for Life Program,” ujar Adrian dalam pesan tertulisnya, Rabu (29/8). Di AJFC, anak-anak dari berbagai negara

berkumpul di tempat latihan Die Roten. Di sini mereka akan mendapat pelatihan khusus dan berkesempatan bertemu dengan pemain dari klub raksasa Jerman itu. Asyik! Sebanyak 65 Anak dari 22 negara ambil bagian dalam kegiatan ini. Selain Indonesia, mereka antara lain berasal dari Australia, Brasil, China, India, dan beberapa negara Eropa. “AJFC merupakan cara yang ampuh untuk menggabungkan anak-anak yang memiliki minat sama dan sekaligus pertukaran budaya,” imbuh Adrian. Diharapkan pengalaman yang didapat anak-anak itu di AJFC akan menginspirasi merekauntukmenjadipendukung,pemain, pelatih, administrator atau perwakilan komunitas dan lainnya. Nah, bagaimana anak-anak ini bisa

berpartisipasi? Mereka diseleksi setelah mengisi dan mengirim form di situs Football for Life. Form tersebut berisi informasi personal. Para pendaftar juga diminta untuk mendeskripsikan‘thebestfootballmomentnya’.Juridisetiapnegaralantasakanmemilih peserta yang berhak ikut dalam AJFC. Markas Bayern dipilih sebagai tempat diselenggarakannya AJFC dengan pertimbangan Die Roten merupakan salah satu tim paling terkenal di persepakbolaan Eropa. Tim berusia 112 tahun ini menjadi juara di Bundesliga sebanyak 22 kali, 15 kali memenangi DFB Pokal, dan yang tak kalah bergengsi telah menggondol 4 gelar Liga Champions. Catatan lainya, pelatihan tim junior klub asal Bavaria tersebut dikenal sebagai salah satu yang terbaik di Eropa. (int)

Kimi Raikkonen

Tak Pernah Ragukan Lotus KIMI Raikkonen tidak pernah meragukan kapasitas Lotus. Bahkan, Kimi sangat yakin Lotus akan berusaha untuk bersaing mendapatkan gelar juara. Penampilan Lotus belakangan memang cukup konsisten di Formula One (F1) 2012/2013. Bahkan, tim yang bermarkas di Enstone itu berhasil membawa Kimi menempati peringkat kelima klasemen sementara F1. Kimi sangat puas dengan performa Lotus. Mantan juara F1 itu sangat yakin Lotus memiliki kemampuan untuk bersaing dengan tim yang lebih besar seperti, McLaren dan juga Ferrari. Ini yang menjadi alasan utama Kimi menerima pinangan Lotus. “Sudah sangat lama ketika saya

memperkuat tim papan atas dan kami juga pernah mengalami tahun yang buruk.

Setahun kemudian, kami berhasil tampil dengan hasil yang berbeda,” jelas Kimi, dikutip dari Autosport, Rabu (29/8).

“Lotus masih menjadi salah satu tim yang besar. Dasar mereka masih sama, mereka memiliki kemampuan untuk membuat mobil dengan kemampuan dan kecepatan terbaik,” lanjut pembalap asal Finlandia itu. Kimi merupakan salah satu pembalap berpengalaman di F1. Pembalap 32 tahun itu pernah memperkuat McLaren dan Ferrari. Tak heran, The Ice Man (julukan Kimi) sangat yakin Lotus bisa menyamai prestasi tim-tim besar tersebut di F1 suatu saat nanti. “Mungkin levelnya masih belum sama dengan McLaren, Ferrari atau Mercedes. Namun, Lotus memiliki pengetahuan dan mereka untuk memiliki keinginan untuk membuat mobil yang bagus,” pungkas The Ice Man. (int)

Duo Williams Lolos

DUA petenis wanita, Venus dan SerenaWilliamsloloskebabakkedua US Open 2012. Sedangkan Caroline Wozniackilangsungkandasdibabak pertama. Dalam pertandingan yang berlangsung di Flushing Meadows, Rabu (29/8), Serena Williams mendapatkan tiket ke babak kedua setelah meraih kemenangan mudah 6-1 6-1 atas lawannya, Coco Vandeweghe.

Di pertandingan itu, Serena yang menempati unggulan keempat sangatmendominasisekalidantidak memberikan kesempatan kepada lawannya untuk berkembang. Selanjutnya, Serena akan berhadapan dengan Maria Jose Martinez Sanchez. Sang kakak Venus Williams juga tidak mau kalah. Petenis yang sempat lama tidak bermain ini,

berhasil mendapatkan tiket ke babak kedua, usai menumbangkan Bethanie MattekSands 6-3 6-1. Namun lawan tangguh sudah menanti Venus. Dia akan berhadapan dengan Angelique Kerber. Kerber yang menempati unggulan keenam itu, tampil sangat gemilang untuk menyudahi perlawanan Anne Keothavong dua set langsung, 6-2 dan 6-0. Petenis unggulan kedua Agnieszka Radwanska, juga melangkah ke babak keduaUSOpen2012. Petenis asal Polandia itu,mampumengatasi rasa sakit pada bahunya untuk menyingkirkan Nina Bratchikova 6-1 6-1. (int)

Lewis Hamilton dan Nicole

Kencan Singkat LEWIS Hamilton memanfaatkan sisa masa rehat Grand Prix Formula 1 musim 2012 untuk melepas kangen dengan kekasih tercintanya, Nicole Scherzinger. Sayangnya, pertemuan dua sejoli ini berlangsung sangat singkat. Nicole bertolak dari Los Angeles, Amerika Serikat, Sabtu 25Agustus2012.SebelummenujuDubai,mantanpersonel Pussycat Dolls itu transit di Kota London, Inggris, untuk menemui Hamilton. Pertemuan Hamilton dan Nicole keesokan harinya, Minggu, begitu singkat karena hanya dalam hitungan jam. Bahkan, Nicole sengaja mengganti jadwal penerbangannya demi menghabiskan malam bersama juara dunia F1 2008 tersebut. Lalu, pada Senin 27 Agustus 2012, Nicole sudah tiba di Dubai untuk melakoni syuting bersama ITV1. Begitu

mendarat di kota bisnis Uni Emirat Arab tersebut, wanita 34 tahun itu tak sabar ingin mendengar suara Hamilton via telepon.Perbincanganmerekaberlangsungselama1,5jam. “Nicole akan menghabiskan banyak waktu di Dubai. Sebelumsyuting,diamintaizinuntukmenghabiskanwaktu bersama Lewis,” ujar salah seorang sumber seperti dilansir The Sun. “Meskipun mereka hanya bertemu beberapa jam, Nicole sangat bahagia. Mereka benar-benar dimabuk cinta,” tambah sang sumber seraya menampik kabar keretakan pasangan yang sudah bertunangan tersebut. Setelah GP Hungaria pada akhir Juli lalu, Hamilton memiliki waktu rehat cukup lama. Pembalap yang sementara ini menempati peringkat 4 klasemen tersebut akankembalikelintasanuntukmelakoniserike-12diSirkuit Spa-Francorchamps, Belgia, akhir pekan ini. (int)

Yao Ming

Inginkan Sekolah Utamakan Olahraga Ikon bola basket China, Yao Ming meminta sekolahsekolah di negaranya memberi perhatian lebih terhadap perkembangan olah raga dalam pendidikan mereka. Menurut mantan pemain klub NBA, Houston Rockets ketidakpedulian sekolah terhadap perkembangan olah raga menjadi salah satu andil yang memungkinkan stagnasi perkembangan olah raga China. “Pengajaran olah raga di sekolah negara kita sangat terbelakang,” kata Yao yang telah pensiun sebagai pemain ini. “Kita harus memulainya dan menempatkan pendidikan olah raga lebih dari sekadar membuat pelajar bugar.” Yao Ming mendirikan yayasan yang bergerak di bidang pengembangan bola basket di kalangan pelajar sekolah dasar China. Untuk itu, Yao Ming kerap datang ke sekolahsekolah untuk mencarai bibit berbakat. “Perkembangan aktivitas olah raga di sekolah-sekolah China sangat kecil,” katanya. “Olah raga masih ditempatkan sebagai bidang yang berada di bawah bidang pengajaran yang lain.” Yayasan bentukan Yao Ming berusaha mengembangkan bola basket dengan meningkatkan pembangunan sarana olah raga mau pun pelatihan para guru olah raga di sekolah-sekolah. Para pelajar sekolah di China menghadapi hal serupa dengan Indonesia dengan adanya tes ujian masuk sekolah lanjutan mau pun perguruan tinggi yang berat dan menjadi satu-satunya impian. Yao Ming menginginkan pendidikan China mengambil contoh pendidikan di Amerika. “Saat mengenang sekolah dasar, pertama-tama saya terkenang taman bermain,” katanya. Ia mendirikan yayasannya setelah bencana gempa di Sichuan pada 2008 lalu. Ia telah mendirikan 14 sekolah di sekitar lokasi bencana dan menyumbangkan peralatan olah raga seperti bola, raket dan basket bersama buku-buku pelajaran. (int)


KAMIS 30 Agustus 2012

ENGLISH PREMIER LEAGUE No 1 2 3 4 5 6 7 8 9 10

Team Chelsea Swansea City Everton West Brom Man City Fulham Man United Wigan Athletic New United West Ham U

M 3 2 2 2 2 2 2 2 2 2

M 3 2 2 1 1 1 1 1 1 1

S 0 0 0 1 1 0 0 0 0 0

K 0 0 0 0 0 1 1 1 1 1

SG 8-2 8-0 4-1 4-1 5-4 7-3 3-3 2-2 2-3 1-3


Nilai 9 6 6 4 4 3 3 3 3 3

Dila Gori Dnipro APOEL Nicosia CSKA Moscow H Tel Aviv Heerenveen Helsinki PSV Rosenborg BK Sparta Praha Steaua Bucharest Young Boys Metallist K Racing Genk Viktoria Plzen Bordeaux Club Brugge Marseille Videoton Hannover Inter Milan Levante Partizan Belgrade Rapid Wien AZ Alkmaar Lazio Newcastle Twente Liverpool Sporting

TOP SCORER Gol 3 2 2

Nama Michu D Duff N Dyer

Klub Swansea City Fulham Swansea City

SPANISH LA LIGA No 1 2 3 4 5 6 7 8 9 10

Team Barcelona R Valladolid R Vallecano Mallorca Málaga Atl Madrid Deportivo Sevilla Real Betis Getafe

M 2 2 2 2 2 2 2 2 2 2

M 2 2 2 1 1 1 1 1 1 1

S 0 0 0 1 1 1 1 1 0 0

K 0 0 0 0 0 0 0 0 1 1

SG 7-2 3-0 3-1 3-2 2-1 5-1 5-3 3-2 6-5 3-3

Nilai 6 6 6 4 4 4 4 4 3 3

vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs

Maritimo Slovan Libere Neftchi Baku AIK F91 Dudelange Molde Ath Bilbao Zeta Golubovc Legia Warszaw Feyenoord E Panevezys Midtjylland Dinamo Bucuresti Luzern Lokeren Crvena Zvezda Debreceni VSC Sheriff Tiraspol Trabzonspor Slask Wroclaw Vaslui Motherwell Tromso PAOK Anzhi Makhachkal Mura Atromitos Bursaspor Hearts AC Horsens

1/2 : 0 0 : 1 1/4 0 : 1 1/4 0 : 1 1/2 0 : 1 3/4 0 : 1/2 3/4 : 0 0 : 2 1/2 0 : 1/2 0 : 1/4 0 : 2 1/4 0:1 0 : 1 1/4 0 : 3/4 0 : 3/4 0 : 1 1/4 0 : 1 1/4 0 : 1 3/4 0:0 0:2 0 : 1 3/4 0:2 0 : 1/2 0 : 1/4 0 : 1/4 0 : 2 1/4 0 : 1 1/2 0:1 0 : 1 3/4 0 : 1 3/4

Kualifikasi Liga Champions

TOP SCORER Gol 4 3 3

Nama L Messi T Hemed R Falcao

Klub Barcelona Mallorca Atlético Madrid

Liga Champions musim 2012-2013 akan segera bergulir. Lima tim telah memastikan diri lolos ke fase grup, menyusul kemenangan yang mereka raih di babak playoff.


ITALIAN SERIE A 1 2 3 4 5 6 7 8 9 10

Internazionale Napoli Chievo Genoa Juventus Fiorentina Lazio Sampdoria Catania Roma

1 1 1 1 1 1 1 1 1 1

1 1 1 1 1 1 1 1 0 0

0 0 0 0 0 0 0 0 1 1

TOP SCORER Gol 2 1 1

Nama S Jovetic E Cavani A Costa

„ Walcott

Klub Fiorentina Napoli Sampdoria

0 0 0 0 0 0 0 0 0 0

3-0 3-0 2-0 2-0 2-0 2-1 1-0 1-0 2-2 2-2

3 3 3 3 3 3 3 2 1 1

urnamen paling elite benua biru diketahui sudah memiliki 22 kontestan yang otomatis melaju ke babak penyisihan grup. Mereka adalah tim-tim yang mengakhiri musim di papan atas klasemen Liganya masingmasing (ada yang empat, tiga, dua atau hanya satu, tergantung jatah setiap asosiasi berdasarkan peringkat di UEFA). Sementara10timlainuntukmemenuhikuota 32 klub, diambil lewat babak playoff. Nah, saat ini ada 20 tim di babak playoff yang tengah berjuang untuk mendapatkan 10 tiket tersebut. Dini hari tadi, lima tiket telah resmi dipegang oleh BATE Borisov (Belarusia), Anderlecht (Belgia), Dinamo Zagreb (Kroasia), Sporting Braga (Portugal) dan Malaga (Spanyol). BATE, klub jawara Liga Belarusia ini memastikan diri lolos ke putaran final Liga Champions usai menumbangkan wakil Yunani Hapoel Ironi Kiryat Shmona FC. BATE menang dengan agregat 3-1, usai bermain 2-0 di kandang dan menahan imbang 1-1 juara Liga Yunani itu di kandangnya pada leg kedua, dini hari tadi. Bagi BATE, ini merupakan kali ke-3 mereka lolos ke Liga Champions sejak pertama kali pada 2008-2009. Ini jadi kesempatan kedua secara beruntun buat BATE, setelah musim lalu juga

Walcott Tolak Kontrak Baru Setelah kehilangan Robin van Persie, Arsenal dikabarkan bersiap untuk kehilangan bintang lainnya. Pemain yang dimaksud adalah Theo Walcott. Seperti dilaporkan oleh Guardian, Walcott menolak tawaran kontrak baru yang diajukan The Gunners. Padahal, kontrak pemain berusia 23 tahun itu tinggal satu musim lagi. Walcott, yang saat ini mendapatkan gaji sebesar 60.000 poundsterling per pekan, menginginkan kenaikan signifikan. Ia disebut meminta gaji sebesar 100.000 pounds sepekan. Namun, Arsenal bersikukuh. Mereka mengajukan penawaran final sebesar 75.000 pounds per pekan untuk kontrak selama lima tahun. Pembicaraan lebih lanjut segera dilakukan. Guardian menyebut, Arsene Wenger masih ingin mempertahankan pemain yang dibeli dari Southampton tersebut. Namun, Wenger juga bersiap untuk menjual Walcott sebelum bursa transfer ditutup pada 31 Agustus mendatang, jika mereka tak menerima ketegasan si pemain untuk tetap bersama klub. Ada dua klub yang dikabarkan tertarik untuk menggaet Walcott. Mereka adalah Liverpool dan Manchester City. The Gunners dikabarkan meminta 15 juta poundsterling jika mereka akhirnya memutuskan untuk menjual Walcott. Walcott tampil sebanyak 35 kali di Premier League musim lalu. Dari jumlah kesempatan bermain itu, ia menyumbang delapan gol dan 11 assist. (dtc/int)

mampu melaju ke fase grup (meski langsung tersingkir). Anderlecth juga memastikan bakal meramaikan persaingan fase grup Liga Champions musim ini usai menumbangkan kampiun Liga Siprus, AEL Limassol dengan agregat 3-2. Anderlecth yang kalah 1-2 pada leg pertama di markas AEL, sukses membalikkan keadaan dengan menang 2-0 pada leg kedua di markasnya, Constant Vanden Stock Stadium, dini hari tadi. Buat Anderlecht, keberhasilan ini menjadi prestasi tersendiri setelah sebelumnya dalam dua musim terakhir, jawara 31 kali Liga Belgia ini harus puas berlaga di Europa League. Dinamo Zagreb lolos ke babak utama Liga Champions usai menjinakan NK Maribor. Kampiun Liga Kroasia ini menang agregat 3-1 berkat kemenangan 2-1 (kandang) dan 1-0 pada leg kedua di markas jawara Liga Slovenia itu, dini hari tadi. Ini merupakan kali keempat atau yang kedua secara beruntun bagi Zagreb lolos ke babak penyisihan grup. Sporting Braga membuktikan kelasnya bahwa kompetisi Liga Portugal tidak bisa diremehkan oleh liga-liga elite Eropa seperti Spanyol, Inggris, Jerman dan Italia. Hal ini

dibuktikandengankeberhasilanmerekamelaju ke babak penyisihan grup Liga Champions dengan menyingkirkan salah satu unggulan di babak playoff, Udinese. Braga yang ditahan imbang 1-1 pada leg pertama, sempat dibuat cemas ketika Pablo ArmeromembawaUdineseunggul1-0padaleg kedua di Stadion Friulli, Italia. Namun, Ruben Micael menyelamatkan Braga berkat golnya di menit ke-72, untuk memaksakan skor akhir 1-1 (agregat2-2)sekaligusdigelarnyaperpanjangan waktudanklimaksnyamenanglewatdramaadu penalti (5-4). Dengan lolosnya Braga, maka Portugal memiliki tiga wakil pada gelaran Liga Champions musim ini. Dua tim yang sebelumnya memastikan lolos otomatis adalah FCPortoselakujawaradanBenfica(runner-up). Sementara bagi Udinese, kegagalan klub berjuluk ‘Il Zebrette’ ini memaksa Italia hanya menyelipkan dua wakilnya di putaran final. KeduatimtersebutadalahJuventusdanrunnerup Serie A, AC Milan.

Berbeda dengan Italia yang kian merosot, Spanyol justru terus menunjukkan hegemoninya sebagai salah satu liga terbaik dunia. Ini tak lepas dari keberhasilan Malaga menembusLigaChampionsuntukkalipertama dalam sejarah klub. Klub besutan Manuel Pellegrini ini memastikan tiket lolos, usai membungkam runner-up Liga Yunani, Panathinaikos dengan agregat 2-0. Keunggulan dua gol tanpa balas di markasnya, La Rosaleda Stadium, berhasil dipertahankan Malaga dengan menahan imbang Panathinaikos 0-0 di leg kedua, dini hari tadi. Dalamdebutnya,Malagaakanmendampingi tiga tim terbaik La Liga, yakni Real Madrid, Barcelona dan Valencia yang lolos otomatis. Sementara itu, lima tiket tersisa akan diperebutkan 10 tim. Ke-10 tim yang akan saling sikut adalah Spartak Moskow vs Fenerbahce, Basel vs CFR Cluj, Helsinborg vs Glasgow Celtic, Borussia Moenchengladbach vs Dinamo Kiev dan FC Kopenhagen kontra Lille. (oz/int)

Harga Modric Kemahalan Keberhasilan Real Madrid mendatangkan Luka Modric dari Tottenham Hotspur disambut sinis mantan kiper Arsenal, Manuel Almunia. Menurut penjaga gawang asal Spanyol itu, Selasa (28/8), nilai jual Modric kelewat tinggi. Senin (27/8), “Los Merengues” resmi memboyong Modric dengan dana 31 juta pounds atau 42 juta euro (sekitar Rp 490 miliar). Jumlah tersebut menjadikan pemain Kroasia itu sebagai pemain termahal kedelapan sepanjang sejarah Madrid. Meski menyebut Modric sebagai pemain hebat, Almunia yang kini bermain untuk Watford masih tak percaya Madrid mau berinvestasi besar untuk sang pemain. “Modric pemain bagus. Tapi, aku tak tahu sebenarnya apa yang dibi-

carakan banyak orang. Setelah paham, aku merasa 42 juta euro terlalutinggi.Diamemanghebatdan berguna untuk Madrid. Tapi, tetap saja harganya kemahalan,” ujar

Almunia kepada COM Radio. Almunia juga tak lupa memberikan tanggapannya mengenai kepindahan Alex Song dari Arsenal menuju Barcelona.

“Song seperti dinding. Dia sangat kuat dan mampu mencuri bola. Kadang, dia bermain genius dengan umpan briliannya,” sebut Almunia. (kps/int)

Martinez Selesaikan Tes Medis dengan Bayern

„ Javi Martinez

Javi Martinez dilaporkan di ambang pintu masuk Bayern Munich setelah pemain Athletic Bilbao ini menyelesaikan rangkaian tes medis bersama klub raksasa Bundesliga tersebut. Menurut Football-Espana , Martinez tidak meminta izin klubnya untuk melakukan perjalanan ke Munich. Dia tertangkap kamera di Munich pada hari Selasa (28/8) sore dan diketahui pemain berusia 23 tahun ini bepergian dengan pesawat jet pribadi. Rumor yang menyebutkan Martinez selangkah lagi berkostum

The Bavarians memang semakin gencar. Apalagi manajemen Bayern dipercaya rela merogoh kocek dalam-dalam demi memboyong gelandang internasional Spanyol itu. Bayern Munich diduga sudah mengajukan penawaran kepada Bilbao sebesar 40 juta euro atau nilai dari klausul pembebasan kontrak untuk Martinez. Saat ini diyakini permasalahan yang tersisa sebelum mencapai kata sepakat adalah besarnya pajak dan keengganan Bilbao melepas bintangnya itu.

Bintang-bintang Bilbao memang tengah menjadi incaran klub-klub besar Eropa. Selain Martinez yang juga diminati Manchester City, Fernando Llorente yang juga dikabarkan terus dikaitkan dengan klub raksasa Serie A, Juventus. Sementara itu, manajemen Bilbao saat ini terus berupaya mendatangkan pemain-pemain anyar untuk berjaga-jaga bila bintang mereka benar-benar pergi. Prioritas utama mereka adalah menggaet pemain Malaga, Nacho Monreal untuk dibawa ke San Mames. (oz/int)





„ Wali Kota Sibolga, HM Syarfi Hutauruk, dan Wakilnya Marudut Situmorang dan jajarannya menyampaikan sambutan dalam acara halal bihalal Pemko Sibolga, Rabu (29/8).


Membangun Silaturahmi Bermanfaat Sukseskan Pembangunan

„ Sejumlah pimpinan perbankan di Kota Sibolga dan anggota DPRD berbaur mengikuti acara halal bi halal Pemko dan PNS Kota Sibolga.

Wali Kota Sibolga Drs HM Syarfi Hutauruk mengatakan, kekuatan silaturahmi sangat bermanfaat untuk mendukung dan menyukseskan program pembangunan daerah. Tanpa jalinan silaturahmi yang baik, mustahil pemerintah dapat menjalankan roda pembangunan dengan baik. “Silaturahmi memiliki makna yang sangat luas, hingga menyentuh segala sendi-sendi kehidupan masyarakat yang mencakup kerukunan umat, perekonomian hingga kesuksesan pembangunan sebuah bangsa. Dengan demikian, membangun silaturahmi, berarti membangun Kota Sibolga dengan semangat kebersamaan,” ungkap Syarfi Hutauruk di acara Halal Bihalal Pemko Sibolga bersama Muspida dan DPRD serta PNS di Kota Sibolga, Rabu (29/8) di halaman Rumah Dinas Walikota Sibolga. Bahkan, sambung Syarfi, agama Islam mengajarkan agar kaum muslimin tetap menjaga hubungan silaturahmi. Baik itu dengan sesama muslim maupun dengan pemeluk agama yang lain. Demikian pula, silaturahmi antara Pemerintah Kota (Pemko) Sibolga dengan masyarakat, tanpa itu, Pemko Sibolga tidak akan mampu berbuat apa-apa dalam melaksanakan roda

pemerintahan di ‘Negeri Berbilang Kaum’ ini dengan baik. Allah SWT sangat mencintai ummatnya yang bisa menjaga dan menjalin silaturahmi. Bahkan Allah SWT menjanjikan, akan memberikan semua kemudahan bagi orang yang menjaga silaturahmi. Sebaliknya, bagi orang yang memutuskan silaturahmi, maka diberi ganjaran yaitu, orang tersebut akan dipersulit semua urusannya. “Mudah-mudahan, kita semua termasuk sebagai orang yang dimudahkan Allah SWT segala urusannya, dipanjangkan umur dan senantiasa diberi rahmad, taufik dan hidayah dari Allah SWT, sehingga Kota Sibolga menjadi lebih baik, maju dan berkembang pada masa mendatang,” kata Syarfi seraya menyampaikan, atas nama Wali kota dan Wakil Walikota Sibolga, pihaknya mohon maaf lahir dan bathin kepada segenap PNS dan masyarakat Kota Sibolga. Hadir di acara itu, Wakil Walikota, Marudut Situmorang, Ketua DPRD Sibolga Sahlul Umur Situmeang, Sekdakot M Sugeng, Deputi Direktur BI Sibolga, Muhamad Nur, pimpinan Perbankan, SKPD, BUMN, anggota DPRD, PNS dan masyarakat Sibolga. (tob)

„ Sejumlah pimpinan BUMN di Kota Sibolga dan pimpinan SKPD dan PNS berbaur mengikuti acara halal bi halal.

„ Mochamad Sugeng bersama sejumlah pimpinan SKPD tampak berbaur mengikuti acara halal bihalal Pemko Sibolga bersama PNS Kota Sibolga.

„ Wali Kota, Wakil Wali Kota, Sekda Kota Sibolga beserta para asisten dan sejumlah pimpinan SKPD bernyayi bersama dalam acara halal bihalal.

„ Ketua TP PKK Kota Sibolga, Ny Dra Hj Delmeria Syarfi Hutauruk tampak berjoget dan bernyanyi bersama dengan para kepala SD se-Kota Sibolga.

„ Sejumlah anggota DPRD Kota Sibolga dan undangan lainnya berbaur mengikuti acara halal bi halal Pemko Sibolga.

„ Ketua TP PKK Kota Sibolga, Ny Dra Hj Delmeria Syarfi Hutauruk dan sejumlah anggota DPRD Kota Sibolga dalam acara halal bihalal Pemko Sibolga.

„ Para pengurus TP PKK Kota Sibolga juga terlihat dalam acara halal bi halal Pemko Sibolga bersama PNS.

„ Wali Kota, Wakil Wali Kota, Sekda Kota Sibolga dan Ketua TP PKK Sibolga saat disalami oleh ribuan PNS dalam acara.

„ Wakil Wali Kota Sibolga, Marudut Situmorang A P MSP memberikan saweran kepada para kepala SD se-Kota Sibolga ketika bernyanyi.

„ Para insan pers, LSM Kota Sibolga dan Tapteng bersama Kabag Humas Pemko Sibolga saat bernyanyi bersama dalam acara halal bihalal Pemko Sibolga.

„ Wali Kota dan Wakil Wali Kota Sibolga, Ketua DPRD Sibolga, dan Pimpinan BI Cabang Sibolga saat mengikuti acara halal bihalal Pemko Sibolga.

„ Wali Kota Sibolga, Drs HM Syarfi Hutauruk

„ Camat dan Lurah se-Kota Sibolga bernyanyi bersama dalam acara halal bihalal Pemko Sibolga bersama PNS di rumah Dinas Wali Kota Sibolga. Teks dan Foto: Ridwan T Butarbutar dan Humas Pemko Sibolga, Lokasi: Rumah Dinas Wali Kota Sibolga

„ Kakan Kemenag Sibolga, Drs Ilham Pasaribu MA

„ Sekdakot, Drs Mochamad Sugeng




Kamis, 30 Agustus 2012



Edisi 202 „ Tahun V


7 Pria Ngamuk di Kantor Dispora BATUBARA-Kesal proposal tak kunjung dicairkan, 7 pria mengaku anggota salah satu organisasi kepemudaan (OKP) mengamuk di kantor Dinas Pemuda dan Olahraga (Dispora) Batubara, Rabu (29/8) sekitar pukul 13.00 WIB.

Data dihimpun METRO, peristiwa itu berawal ketika 7 pria itu mendatangi kantor Dispora dan mempertanyakan soal proposal yang disampaikan ke kantor itu kepada salah

seorang staf. Kepada para pria itu, staf yang ditanyai menyebutkan tidak menge-

‹‹ Baca 7 Pria ...Hal 6


„ Meja kayu yang dibanting 7 pria anggota OKP hingga ke halaman kantor Dispora Batubara, karena kecewa proposal tidak dicairkan, Rabu (29/8).


„ Dahlan Iskan (kanan) saat membersihkan toilet di Terminal 2 F Bandara SoekarnoHatta, Selasa (28/8).

Main Opera Batak CHOCKY Sitohang akan meramaikan Opera Batak Arga Do Bona ni Pinasa yang akan digelar 1-2 Sepetember 2012, di Plenary Hall, Jakarta Covention Center. Choky akan berpasangan dengan Zivanna Letisha Siregar (Zizi) Puteri Indonesia 2008. Keduanya

‹‹ Baca Main...Hal 7

Disdik Diduga ‘Sunat’ 25 PPersen ersen Dana Rehab Sekolah BATUBARA-Dinas Pendidikan (Disdik) Batubara, diduga melakukan menyunat atau memotong dana rehab sekolah sebesar 25 persen dana rehab sekolah yang berasal dari bantuan sosial bidang pendidikan pemerintah pusat. Aktivis di Batubara Dahwir Suprianto Munthe kepada METRO menuturkan, bantuan dana rehab sekolah dari pusat itu diketahui sebesar Rp6,7 miliar. Namun, dalam prakteknya dana yang ada tidak penuh dan sudah dipotong sebesar 25 persen dari pagu anggaran. Dan hal itu, jelas berpengaruh terhadap

‹‹ Baca Disdik ...Hal 7

Pacari Brondong Janda Cantik Dihajar Keluarga Polisi MEDAN-Dian Anggraini (32) dan Jhon Robin Batuera Nainggolan (21) menjalin asmara bak dalam sinetron di televisi. Betapa tidak, pasangan yang sudah berpacaran selama dua tahun ini harus merelakan percintaannya berakhir di kantor polisi. Warga Jalan Serba Jadi KM 18 Medan Binjai yang berstatus janda anak tiga ini, mengadu ke Polsekta Medan Sunggal, Rabu (29/8) sekira pukul 15.00 WIB, lantaran dihajar keluarga Robin hingga menyebabkan memar di bagian mata. Kepada Posmetro Medan (Grup Metro Tabagsel), perempuan berambut panjang ini mengisahkan peristiwa yang dialaminya. Ceritanya, tiga hari yang lalu atau Minggu (26/8) sekira pukul 10.00 WIB, ia sedang di rumah sendirian menonton televisi (TV). Kemudian datang lima orang keluarga

‹‹ Baca Pacari ...Hal 6

Dahlan Bersihkan Toilet Bandara JAKARTA - Upaya mendorong perbaikan layanan publik terus dilakukan. Kali ini, Menteri Badan Usaha Milik Negara (BUMN) Dahlan Iskan bahkan harus sampai mem-

bersihkan toilet bandara untuk menunjukkan pentingnya kebersihan fasilitas di tempat publik.

‹‹ Baca Dahlan ...Hal 6 FOTO: BERNAD LUMBAN GAOL

„ Siswa kelas I SD 177664 Sitanggor yang berada di Dusun Buntu Raja, sedang belajar di kelas.

Berkunjung ke Dusun Buntu Raja, Pasca Tragedi Isu Begu Ganjang (2)

Murid Serba Hemat, Bawa Nasi ke Sekolah Awak METRO kembali ke Dusun Buntu Raja, Senin (23/7) sekira pukul 10.30 WIB dan langsung menuju gedung sekolah dasar dusun itu. Saat memasuki kawasan sekolah, suara murid anak-anak para terpidana kasus begu ganjang terdengar menjawab sejumlah pertanyaan yang dilontarkan oleh guru mereka. HORDEN SILALAHI-Muara ‹‹ Baca Murid ...Hal 7



30 Agustus 2012

Presiden Tunggu Surat Resmi DPR Soal Darurat Komnas HAM

JAKARTA- Masa kerja komisioner Komnas HAM akan berakhir pada 30 Agustus 2012, namun Komisi III DPR belum juga melakukan fit and proper test terhadap 30 calon anggota Komnas HAM. Presiden SBY menunggu surat resmi dari DPR sebelum mengambil sikap menyangkut nasib Komnas HAM. ”Itu kan sebenarnya dikatakan akan ada surat dari DPR kepada Presiden. Saya sudah cek tidak ada surat dimaksud belum ada di meja kami. Kami belum bisa memberikan sikap maupun pandangan apaapa,”kata Jubir Kepresidenan, Julian Aldrin Pasha, Rabu (29/8). Menurut Julian, Presiden akan segera mengambil keputusan setelah surat dari DPR diterima. Baik dalam bentuk Perppu maupun Keppres sesuai keperluan untuk memastikan dasar hukum Komnas HAM y a n g masa


kerjanya akan segera habis. ”Jadi kami menunggu surat dari DPR,” kata Julian. Masa kerja komisioner Komnas HAM akan berakhir pada 30 Agustus 2012, namun Komisi III DPR belum juga melakukan fit and proper test terhadap 30 calon anggota Komnas HAM. Komisi III DPR pun melempar bola kelanjutan Komnas HAM ke Presiden. Komisi III DPR menyadari keterlambatan fit and proper test anggota Komnas HAM bisa berdampak pada kevakuman Komnas HAM. Karena itu secepatnya Komisi III akan meminta pimpinan DPR meminta Presiden SBY segera mengeluarkan aturan memperpanjang masa kerja komisioner Komnas HAM. ”Kita serahkan kepada pimpinan DPR berkonsultasi dengan Presiden dan mengambil langkah sesuai dengan ketentuan yang berlaku agar tidak ada kevakuman,”kata Ketua Komisi III DPR Gede Pasek Suardika. Komnas HAM menemui Wakil Ketua DPR, Priyo Budi Santoso, pada tanggal 16 Agustus 2012 lalu untuk menyetorkan nama-nama hasil seleksi calon komisioner. Ada 30 nama calon komisioner Komnas HAM. (dtc/int)

Afriani Divonis 15 Tahun Sekelompok Tentara AS Berencana Bunuh Obama SAVANNAH- Sekelompok tentara Amerika Serikat (AS) membentuk sebuah milisi anarkis dan menghabiskan dana 87.000 dollar (Rp 829 juta) untuk persenjataan dalam rangka menggulingkan pemerintah dan akhirnya membunuh Presiden Barack Obama. Demikian menurut sebuah dakwaan pengadilan terhadap para tentara itu seperti dilaporkan Daily Telegraph, Selasa (28/8). Mereka dituduh telah membentuk sebuah kelompok yang disebut FEAR, singkatan dari Forever Enduring Always Ready, dan membeli sebidang tanah di Negara Bagian Washington. Dari tanah itulah nantinya mereka akan melancarkan serangan. Mereka dikatakan sudah berencana untuk meledakkan sebuah bendungan dan meracuni ladang apel di Negara Bagian Washington, mengebom taman di Savannah, Georgia, menyerang kendaraan-kendaraan milik para karyawan Departemen Keamanan Dalam Negeri, dan mengambil alih sebuah pusat kontrol amunisi di markas tentara yang luas di Fort Stewart, Georgia. Para jaksa mengatakan, tujuan jangka panjang mereka adalah revolusi, menjatuhkan pemerintahan AS dan membunuh Presiden Barack Obama. Namun tidak diketahui kapan dugaan persekongkolan itu akan terjadi.(dtc/int)

JAKARTA- Afriani Susanti dijatuhi hukuman 15 tahun penjara oleh Majelis Hakim Pengadilan Negeri Jakarta Pusat. ”Terbukti salah dan meyakinkan terdakwa dengan sengaja mengemudikan kendaraan bermotor dan mengakibatkan orang lain meninggal dunia, menjatuhkan pidana penjara selama 15 tahun,” Ujar Ketua Hakim Pengadilan Negeri Jakarta Pusat Antonius Widiyanto saat membacakan vonis di ruang sidang R Wirjono Prodjodikoro, Pengadilan Negeri Jakarta Pusat, Rabu (29/8). Menurut majelis hakim, Afriyani tak terbukti bersalah dalam dakwaan pertama Jaksa Penuntut Umum (JPU) Pasal 338 KUHP tentang pembunuhan. ”Sebelum mengemudikan mobil Daihatsu Xenia terdakwa tidak mempunyai niat secara jelas akan menabrak korban-korban diatas trotoar. Unsur sengaja tidak terbukti, dengan demikian terdakwa bebas

„ Afriani Susanti dari Pasal 338,” tuturnya. Sementara untuk Pasal 311 ayat 4 Afriyani terbukti bersalah karena mengemudikan kendaraan bermotor dalam kondisi yang membahayakan nyawa orang lain.

Kasus Simulator SIM

4 Perwira Polisi Diperiksa JAKARTA- Komisi Pemberantasan Korupsi (KPK) menjadwalkan pemeriksaan empat anggota kepolisian terkait kasus dugaan korupsi proyek simulator surat izin mengemudi (SIM), Rabu (29/ 8). Mereka diperiksa dalam kapasitas sebagai panitia lelang proyek simulator SIM. “Diperiksa sebagai saksi untuk tersangka DS (Djoko Susilo),” kata Kepala Bagian Pemberitaan dan Informasi KPK Priharsa Nugraha di Jakarta, Rabu. Keempat polisi itu adalah Ajun Komisaris Besar Wisnu Budaya, Ajun Komisaris Besar Wandi Rustiwan, Komisaris Endah Purwaningsih, dan Komisaris Ni Nyoman Suwartini. Hingga pukul 14.00, keempat anggota kepolisian itu belum memenuhi panggilan pemeriksaan KPK. Menurut Priharsa, KPK sudah mengirim panggilan pemeriksaan kepada empat anggota polisi itu sejak 15 Agustus 2012. Dalam kasus simulator SIM ini, KPK menetapkan empat tersangka atas dugaan melakukan penyalahgunaan kewenangan sehingga menimbulkan

kerugian negara. Selain Djoko, tiga orang lain yang jadi tersangka adalah Brigadir Jenderal (Pol) Didik Purnomo dan dua pihak swasta, masing-masing Budi Susanto dan Sukotjo S Bambang. Ketiga tersangka terakhir itu juga ditetapkan sebagai tersangka oleh Kepolisian Republik Indonesia. Sejauh ini, KPK belum memeriksa Djoko. Wakil Ketua KPK Busyro Muqoddas kemarin mengatakan bahwa KPK masih fokus memeriksa saksi dan mendalami barang bukti yang diperoleh. Sebelumnya, KPK memeriksa Sukotjo S Bambang sebagai saksi untuk Djoko. Selain itu, KPK memeriksa Sekretaris Budi Susanto yang bernama Intan Pardede. (kmc/int)

KPK Kejar Tersangka Lain Kasus Angie JAKARTA- Komisi Pemberantasan Korupsi (KPK) telah melimpahkan kasus Angelina Sondakh ke pengadilan. KPK memastikan, untuk kasus suap terkait Wisma Atlet ini tidak hanya menjerat Angie. Kasus masih akan berlanjut dengan melihat fakta di persidangan. ”Pengembangan kasusnya biasanya caranya adalah proses pemeriksaan di pengadilan itu dijadikan bagian dari proses pengembangan yg punya kaitan dengan potensial suspect yg lain,” jelas Wakil Ketua KPK Bambang Widjojanto di gedung KPK, Jalan HR Rasuna Said, Kuningan, Jakarta, Rabu (29/8). Bambang mengatakan bahwa pengembangan kasus

itu tidak berhenti. Selain menunggu fakta di persidangan, KPK juga terus melakukan pengumpulan buktibukti. ”Itu digodok. Artinya diinvestigasi, dikumpulkan buktibuktinya untuk kemudian apakah ini bisa lantas di lidik lalu disidik,” lanjut Bambang Bambang juga menuturkan bahwa penyidik nanti akan melihat rangkaian keterangan yang didapat sehingga bisa

"SEKARANG TANGAN DAN KAKI SAYA SUDAH TIDAK CUCUK-CUCUK LAGI" Keluhan karena asam urat kini sudah tidak lagi dirasakan D u ng d u ng Nurwati Aritonang. Padahal, sudah 1 tahun, wanita berusia 43 tahun tersebut mengeluhkan kesehatannya terganggu karena asam urat. Kirakira apa rahasianya? Ketika ditemui di kediamannya di Desa Tanjung Gusta, Kec. Sunggal, Kab. Deli Serdang, Sumatera Utara, ia menjawabnya, "Sudah 1 tahun terakhir ini saya menderita asam urat dan telah lama berobat, namun sakitnya masih datang dan pergi. Tapi setelah saya minum Gentong Mas selama 6 bulan, sekarang kaki dan tangan saya sudah tidak cucuk-cucuk lagi," tuturnya menceritakan pengalaman baiknya tersebut. Gentong Mas adalah minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda) terbukti memiliki banyak manfaat untuk kesehatan. Dulu, ketika sakitnya kambuh, ibu 5 orang anak ini selalu merasakan tangan dan kakinya sakit. Tapikini, semuanya berubah. Dengan tubuh yang sehat, ia pun dapat menjalani aktifitasnya sehari-hari sebagai PNS

Terlebih setelah meminum pil ekstasi di Stadium, Jakarta. ”Dengan kondisi demikian sudah seharusnya terdakwa mengetahui kondisinya agar tidak mengemudi karena dapat membahayakan pengguna jalan lainnya. Namun terdakwa justru membawa mobil Daihatsu Xenia. Unsur dengan sengaja membawa kendaraan bermotor dalam kondisi membahayakan nyawa orang lain terbukti,” papar Majelis Hakim. Terkait kasus narkoba, majelis hakim menilai Afriani tidak terbukti pasalnya tidak ditemukan barang bukti. Majelis hakim menilai hal-hal yang meringankan terdakwa yaitu berlaku sopan dan tidak pernh dihukum. Sementara yang memberatkan perbuatan terdakwa telah memberikan duka yang mendalam bagi korban luka dan korban meninggal dunia. Selain itu, perbuatan terdakwa juga dianggap meresahkan masyarakat. (dtc/int)

„ Para pimpinan KPK memberikan penjelasan terkait penanganan kasus Simulator SIM.

dengan nyaman dan tidak segansegan membagi pengalaman sehatnya dengan orang lain. Asam urat bukanlah nama suatu penyakit, namun ia adalah suatu zat sisa metabolisme zat yang bernama purin yang berasal dari makanan yang kita konsumsi. Keadaan dimana tubuh mengalami kelebihan kadar asam urat disebut hyperuricemia. Pada kondisi normal, kelebihan purin ini akan dikeluarkan melalui urine dan feses. Namun jika purin yang masuk dalam tubuh terlalu banyak, maka ginjal akan kesulitan mengeluarkan zat tersebut sehingga terjadi penumpukan sisa metabolismenya (asam urat). Penumpukan sisa metabolisme zat purin di persendian dapat menyebabkan bengkak dan rasa nyeri. badan terasa linu, nyeri terutama di malam hari atau pagi hari saat bangun tidur, sendi terlihat bengkak, kemerahan, panas dan nyeri luar biasa pada malam dan pagi, timbul benjolan-bejolan kecil dari mulai sebesar biji beras sampai kacang hijau di daun telinga bawah (tofus) adalah gejala-gejala asam urat. Habbatussauda yang dikandung dalam Gentong Mas bermanfaat untuk menormalkan metabolisme, termasuk metabolisme purin sebagai pembentuk asam urat yang dipercaya dapat meningkatkan pengeluaran asam urat dari darah

melalui urine. Sementara, Gula Aren selain rasanya manis dan lezat juga bermanfaat untuk menurunkan penyerapan lemak dan perbaikan sistem saraf. Untuk hasil maksimal, control makanan yang dikonsumsi dan banyak minum air putih, sekitar 8 gelas sehari. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi w w Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/ toko obat terdekat atau hubungi: Medan : 081384 777787 Sidikalang: 081384777787 Humbahas : 0821 6864 2805 Gunung tua : 081384777787 Batubara : 081384777787 Tobasa : 0813 8477 7787 Nias : 0813 8477 7787 Tebing Tinggi : 0813 2209 9495 Siantar : 082167538848 Binjai : 0813 9866 6166 Lbk Pakam : 0813 6227 3308 Karo : 0821 6753 8828 Langkat : 0813 6227 3308 Kisaran : 0623 7014 362 Tj. Balai : 0812 6349 5563 Labura : 0813 7059 0972 Labuhan batu: 0852 7784 4950 P. Sidimpuan : 0821 6346 6597 Sibolga : 0813 7625 2569 Taput : 081263243034 Madina : 082163466597 Dolok Sanggul : 0821 2928 4752. Depkes:P-IRT:812.3205.01.114

„ Angelina Sondakh

membuktikan bahwa ada orang lain yang terlibat kasus ini atau justru sebaliknya. ”Jadi semua penyidik dalam penyelidikan itu pasti melihat rangkaian keterangan yg memungkinkan orang lain terlibat. Tapi bisa juga mengklarifikasi kalau orang lain itu tdk terlibat. Nah proses itu yg sedang berjalan. Saya belum tahu hasil dari proses itu,” tutur Bambang. (dtc/int)

„ Wakil Ketua KPK Bambang Widjojanto.

KPK Segera Periksa Tersangka Kasus Hambalang JAKARTA- KPK segera melakukan pemeriksaan atas Dedy Kusnidar di kasus Hambalang. Dedy merupakan tersangka pertama di kasus Hambalang. Dedy belum pernah diperiksa KPK. ”Yang saya dengar dari penyidik, pemeriksaan terhadap Dedy segera. Tapi dugaan saya tidak dalam minggu ini,” jelas Wakil Ketua KPK Bambang Widjojanto di KPK, Jl Rasuna Said, Kuningan, Jakarta, Rabu (29/8). Bambang menjelaskan, keterangan Dedy yang Kepala Biro Keuangan dan Rumah

Tangga Kemenpora ini penting untuk membuka informasi lainnya terkait kasus Hambalang. ”Dedy jadi penting setelah kita dapat klarifikasi, konfirmasi, dan keterangan lain-lainnya,” tuturnya. Bambang juga menegaskan, KPK tidak berhenti pada Dedy. Penyidikan terus berjalan mengejar tersangka lain. “Selain penyelidikan yang Dedy kan tetap jalan. Tidak pernah ada dalam statement KPK Dedy adalah anak tangga terakhir. Yang ada, Dedy anak tangga pertama,” tuturnya. (dtc/int)


30 Agustus 2012

Syahganda Nainggolan.

“Di luar itu, wilayah DPR pun banyak disandera oleh berbagai kasus besar yang menjerat kehormatan anggotanya sendiri baik penyimpangan moral pribadi ataupun anggaran, sehingga berdampak pada krisis kepercayaan publik terhadap lembaga DPR,”

“Timwas Century mendorong Tim Pengenbalian Aset melakukan segala upaya agar aset yang dibekukan di dalan nageri maupun di dalam negeri segera dicairkan atau dirampas untuk menutup kerugian negara,” Ketua DPR Marzuki Alie.

AM Fatwa.

“DPR ini almamater saya yang sangat saya cintai, saya ikut bersedih. Betapa kebanggaan saya, saya dari penjara menjadi pimpinan di sini, sehingga saya menulis buku dari ‘Cipinang ke Senayan’. Tapi banyak teman-teman saya yang berangkat dari Senayan ke Cipinang, ya itu saya sangat sedih,”

Kirim Opini Anda ke email: metroasahan Maksimal tulisan 5.000 karakter

Sikap Kami Menjaga Kerukunan PENYERANGANterhadap kelompok minoritas akhir-akhir ini menunjukkan betapa problem kerukunan masih menggelayuti bangsa ini. Celakanya, kita seperti tak mau belajar dari peristiwaperistiwa terdahulu, seperti penyerangan terhadap kelompok Ahmadiyah, sehingga kita tak serius menjaga kerukunan. Kalaupun belajar, kita seperti tak kunjung pintar menjaga kerukunan. Itu sebabnya peristiwa yang mengoyak kerukunan berulang kali meletus. Penyerangan terhadap kelompok minoritas Ahmadiyah tak hanyasekali,tetapiberulang-ulangterjadi.Penyeranganterhadap umat kristiani yang tengah beribadah pun berkali-kali terjadi. Paling mutakhir penyerangan terhadap kelompok minoritas Syiah di Sampang, Madura, Jawa Timur, Minggu (26/8). Penyerangan itu bukan yang pertama. Penganut Syiah itu mendapat serangan serupa pada Desember 2011. Semestinya tragedi Sampang menjadi pelajaran bahwa kita harus serius menjaga kerukunan. Kerukunan bisa dijaga bila kita memahamibahwakeberagamanmerupakankeniscayaansosial, hukumalam,sunatullah.Segalamakhlukyangadadikolonglangit ini pastilah plural, jamak, banyak, tidak tunggal. Hanya Sang Pencipta yang satu, esa, tunggal. Manusia berasal dari berbagai ras, etnik, agama, dan kebudayaan. Hasil cipta, rasa, dan karsa manusia pun beragam. Termasuk penafsiran atas agama juga beragam. Itu sebabnya banyak sekali aliran dalam agama-agama. Bangsa ini harus menyadari hukum alam tidak bisa dilawan. Melawan hukum alam hanya menghasilkan kerusakan, kesengsaraan, dan penderitaan. Penghormatan terhadap keberagaman akan menciptakan harmoni. Itulah sebabnya para pendiri bangsa menciptakan semboyan Bhinneka Tunggal Ika.Sayang sekali, bangsa ini seperti melupakan, bahkan melawan, kebinekaan. Penyerangan atas nama agama terhadap kaum minoritas di Tanah Air merupakan perlawanan terhadap kebinekaan, keberagaman, dan hukum alam. Hasilnya pun hanyalah kerusakan, kesengsaraan, penderitaan, dendam, dan trauma berkepanjangan. Oleh karena itu, kita tidak punya pilihan lain kecuali menerima keberagaman dalam kehidupan sosial kita. Mari kita rayakan keberagaman sebagai keindahan kehidupan. Negaratentupunyatanggungjawabbesarmenjagakerukunan. NegaraharusmenjadikanpenyeranganterhadapkelompokSyiah di Sampang sebagai pelajaran pamungkas. Negara harus menjadikan peristiwa itu sebagai momentum untuk ekstra serius menjaga kerukunan. Kita perlu menegaskan hal itu karena, alihalih menjaga kerukunan, negara justru acap memicu kerusuhan. Negarahadirmalahuntukmemicupenyeranganatasnamaagama. Label sesat dari aparatur negara menjadi alat legitimasi oleh kelompok intoleran untuk menyerang kelompok-kelompok minoritas.Ketikapenyeranganatasnamaagamaituterjadi,negara malah absen. Terang benderang negara berpihak kepada satu kelompok ketika menyelesaikan problem kerukunan. Padahal, negaramestibersikapbijakdanadil.Negaradisebuttelahmenjaga kerukunan hanya bila ia hadir dan berdiri di atas semua golongan yang hidup di negeri ini. (**)

Menebar Citra di Hari Idul Fitri Dari lebaran ke lebaran sepertinya kaum pemudik semakin dimanjakan. Mereka tidak perlu lagi berpanas-panasan untuk antre tiket, bus atau kereta, ataupun ditipu calo saat membeli tiket, sebab sekarang mereka bisa ikut program mudik bareng gratis. : Ardi Winangun MENJELANG lebaran, beberapa tahun sebelumnya dan saat ini, semakin banyak pihak, seperti partai politik, perusahaan swasta, bahkan komunitas masyarakat daerah, yang mengorganisasi mudik secara massal dan gratis, bahkan sepanjang perjalanan pemudik diberi makan dan minum. Bila pengelola mudik bareng royal, pemudik diberi kaos dan topi serta atribut lainnya. Lihat saja saat kita melintas di komplek Gelora Bung Karno, Jakarta, beberapa hari menjelang lebaran banyak terlihat pos pemberangkatan mudik bareng yang digelar berbagai perusahaan, seperti pabrik semen, perusahaan minum, dan ada partai politik. Pos pemberangkatan mudik itu nampak meriah, berbagai atribut mereka seperti bendera, baliho, dan umbulumbul dipasang secara mencolok. Akibat dari mudik bareng ini, ada pihak yang merasa dirugikan, yakni perusahaan otobus. Dalam sebuah kabar di media massa diberitakan, perusahaan otobus mengalami penurunan omset tiket penjualan angkutan mudik. Menurut Boy Mando, agen tiket Bus Gumarang Jaya rute Jakarta-Padang mengatakan, kegiatan mudik gratis yang digelar banyak perusahaan, hanya menguntungkan warga yang mau mudik, tapi merugikan PO yang biasa melayani angkutan mudik lebaran di berbagai terminal di Jakarta. Dikatakan kepada sebuah media massa beberapa waktu yang lalu, mudik bareng gratis menurunkan

omset penjualan tiket PO, yang biasanya H-7 tiket sudah terjual habis, sekarang hingga H-5 Lebaran tiket masih tersisa cukup banyak. Lebih lanjut dalam berita itu dikatakan, tahun ini lebih turun dari tahun 2011. Tahun ini, tiket belum habis beberapa hari menjelang lebaran. Lima tahun lalu, H-7 tiket sudah habis. Sekarang, sejak H-7 hingga beberapa hari menjelang lebaran, dirinya hanya memberangkatkan tiga bus dengan total 120 penumpang. Bagi pihak yang mengorganisir mudik bareng ada misi-misi sosial yang dilakukan, namun ada pula misi politik atau membangun citra untuk kepentingankepentingan tertentu. Bagi perusahaan swasta, mudik bareng bisa dilakukan dengan tujuan untuk mengucapkan terima kasih atas loyalitas masyarakat yang telah menggunakan produknya. Bisa juga untuk mengikat masyarakat agar tetap mau menjadi distributor atau pedagang perusahaan swasta itu. Bagi partai politik, menggelar mudik bareng tentu sebagai salah satu bentuk kampanye untuk kepentingan Pemilu 2014. Dengan mudik bareng inilah pengurus partai membangun citra bahwa partainya adalah partai politik yang peduli kepada masyarakat. Melalui ikatan emosional mudik bareng inilah, partai politik mencoba mengikat masyarakat untuk memilih partainya. Kampanye atau membangun citra di saat mudik ini merupakan sebuah cara yang efektif untuk menebar pengaruh. Dalam arus mudik, jutaan orang secara bergelombang bergerak ke arah yang sama, seperti dari Jakarta menuju Jawa Tengah, Jawa Timur, Jogjakarta; Jakarta menuju Sumatera; Bandung menuju Jawa Tengah, Jawa Timur, dan Jogjakarta; serta dari satu titik ke titik lainnya. Menurut Menteri Perhubungan, E. E. Mangindaan, dalam sebuah berita, memprakirakan jumlah pemudik melalui angkutan jalan untuk tahun 2012 sebesar 5,5 juta penumpang, angkutan sungai dan penyeberangan danau, 3,3 juta penumpang, Kereta Api diprediksi 1,3 juta penumpang, untuk angkutan laut 1,5 juta penumpang, angkutan udara 3,2 juta penumpang. Dari

data tersebut bisa dibandingkan bila tahun 2011 jumlah pemudik mencapai 13 juta orang maka di tahun 2012 ada sekitar 14,8 juta orang. Bila partai politik mampu menebar citra dan pengaruh pada 14,8 juta pemudik, maka partai politik itu bisa masuk 3 besar peraih suara terbanyak dalam Pemilu 2014. Kenapa demikian? bila kita mengacu pada Pemilu 2009 terlihat perolehan suara partai politik adalah: Partai Demokrat 21.703.137 suara atau orang, Partai Golkar 15.037.757 suara, PDIP 14.600.091 suara, PKS 8.206.955 suara, PAN 6.254.580 suara, PPP 5.533.214 suara, PKB 5.146.122 suara, Gerindra 4.646.406 suara, dan Hanura 3.922.870 suara. Dari data tersebut menunjukan bahwa jumlah pemilih partai politik seperti PKS, PAN, PPP, PKB, Gerindra, dan Hanura, tidak sebanyak jumlah pemudik di tahun 2011 atau 2012. Dengan demikian tak heran bila partai politik berlomba-lomba untuk menggelar mudik bareng. Lihat saja, PAN dalam mudik bareng tahun ini menyediakan 200 bus, PKB menyediakan 35 bus AC, Partai Golkar 120 bus, dan Partai Demokrat 109 bus. Mayoritas bus-bus itu mempunyai tujuan ke berbagai kota di pulau Jawa dan Sumatera. Mudik bareng yang digelar partai politik itu baik-baik saja dan syah-syah saja, namun dengan adanya mudik bareng yang difasilitasi partai politik, menunjukan bahwa biaya politik yang dikeluarkan untuk kampanye semakin tinggi. Untung saja Idul Fitri setahun hanya sekali, bayangkan kalau Idul Fitri setahun dua kali. Semakin banyaknya kegiatan yang dilakukan partai politik untuk menjaring suara tentu akan mempengaruhi kondisi kas partai politik. Nah di sinilah perlunya transparansinya partai politik dalam mengelola keuangannya. Bila tidak transparan, jangan-jangan biaya mudik bareng itu diperoleh dari dana-dana yang tidak jelas, diambil dari ngentit proyek-proyek besar atau menaikan anggaran pembangunan. Selamat Idul Fitri 1433 H, Mohon Maaf Lahir dan Batin. (***) Penulis adalah Pengamat Sosial dan Budaya



30 Agustus 2012



GADIS 20 TAHUN TEWAS MELEPUH RUMAH TERBAKAR SAAT LISTRIK PADAM SIBOLANGIT- Kediaman Salam Sinuhaji (60), Jalan Jamin Ginting Desa Bingkawan, Kecamatan Sibolangit, Deli Serdang, terbakar, Selasa (28/8) malam. Akibat kejadian, anak gadisnya yang berusia 20 tahun, Rika br Sinuhaji, tewas melepuh dijilat api.

„ Eni, pembantu yang membobol kartu ATM majikan Rp3,5 juta. Kini ia diamankan polisi.

Pembantu Bobol ATM Majikan

HAFAL NOMOR PIN SAAT BELANJA JAKARTA- Wanita pembantu ini tak bisa dipercaya. Berulangkali dimintai majikannya mengambil uang dengan kartu ATM, ia menghafal nomor PIN-nya. Lalu diam-diam ia membobol Rp3,5 juta saat majikannya tidur. Aksi Eni (18) terungkap ketika majikanya Silvia Hakim memeriksa saldo ATM miliknya. Wanita 32 tahun itu kaget karena ada pengeluaran di luar perhitungannya. Upayanya menanyakan persoalan ATM yang bobol pada wanita pembantu rumah tangga (PRT) itu tak mendapat jawaban memuaskan. Kapolsek Tanjung Duren Kompol Dwi Indra Laksmana SIK mengatakan, kasus terungkap setelah korban memeriksa tas pembantunya. “Korban menemukan struk pengambilan uang Rp500.000 dari nomor ATM-nya,” ujarnya. Temuan barang bukti itu dilaporkan istri pengusaha plastik Ade Husni (37) ini ke polisi. Memimpin anak buahnya, Kanit Reskrim Polsek Tanjung Duren AKP Budi Setiadi langsung menjemput Eni di kediaman majikan di Apartemen Meditrania Tanjung Duren, Senin (27/8) malam. Dengan bukti tertulis, Eni tak bisa berkelit. Ia mengakui semua perbuatannya. Ibu dua anak asal Sukabumi, Jawa Barat, yang sudah 8 bulan bekerja pada Silvia dengan gaji Rp700.000 sebulan itu mengaku dipercaya majikan untuk belanja dengan ATM. Katanya, setiap pagi ia belanja berbagai kebutuhan dapur sesuai menu yang akan dimasak.

“Sekali belanja bisa Rp200.000 sampai Rp300.0000, bahkan kalau perlu bisa menambah hingga Rp500.000. Semua itu dibayar pakai ATM sampai-sampai saya hafal nomer PIN seperti yang disebutkan majikan,” ungkapnya. Majikan Tidur Melihat kemudahan mengeluarkan uang serta majikan yang dianggap tak memeriksa saldo dalam ATM, timbul niat jahat Eni. Ia pun membobol ATM itu Rp1 juta. Ditunggu berhari-hari majikan dianggap tak curiga, ia mengulang menggesekkan kartu itu untuk mengambil Rp1 juta. “Karena tak pernah ada teguran, saya jadi ketagihan,” ujarnya. Maka, Eni kembali mengambil Rp200,000, Rp500.000 dan terakhir Rp800.000. Tercatat, dalam seminggu, uang Rp3,5 juta dibobol dari ATM majikannya. Eni mengaku pembobolan dilakukan saat majikannya tidur. Kartu yang disimpan Silvia dalam dompet diam-diam diambilnya lalu ia keluar mencairkan uang sesuai keinginannya dan kembali ke apartemen sebelum majikannya bangun. Kartu itu dikembalikanya ke tempat semula. Eni mengaku uang curian itu dipakai untuk membayar utang teman di kampung. Sisanya digunakan untuk membeli pakaian. “Sekarang saya menyesal. Ibu begitu baik dan percaya sama saya. Tapi saya nggak bisa membalas kebaikannya,” katanya. (pk/int)


Saya Merasa Tersiksa di Penjara Pak Hakim! SIMALUNGUN- Markus Saragih (58) warga Dusun Tanoh Tinggir Nagori Tanoh Tinggir, Kecamatan Purba, Simalungun, meminta keringanan hukuman setelah jaksa menuntutnya empat bulan penjara, Rabu (29/8). Terdakwa mengaku menyesal dan mengaku ia merasa tersiksa hidup di penjara. Hal itu terungkap pada persidangan yang digelar di PN Simalungun yang dipimpin majelis hakim Ramses Pasaribu dan Jaksa Penuntut Umum (JPU) Viktor Purba. Menurutnya, terdakwa terbukti secara sah dan meyakinkan melakukan tindak pidana melakukan penganiayaan dan melanggar pasal 351 ayat 1 KUHPidana. “Peristiwa berlangsung pada Minggu (20/5) sekira pukul 22.00 WIB. Saat itu terdakwa datang ke warung Koperasi Dusun Tanoh Tinggir. Setibanya di warung, terdakwa melihat saksi korban Bangkit Tambun Saribu bersama Nembak Saragih dan Lerman Purba tengah minum tuak,” sebutnya. Dia menerangkan, terdakwa pun ikut bergabung minum tuak dan memilih duduk di samping korban. Saat itu korban bercerita tentang usaha pertaniannya. “Di tengah pembicaraan, korban mengatakan ‘aku anggapnya kau sama Nembak ini sama, namun ada bedanya’. Mendengar itu terdakwa menanyakan apa beda yang dimaksud,” tiru Jaksa. Kemudian korban menjawab ‘kalau sama Nembak bisa sukasuka saya tapi sama kau saya masih segan’. Mendengar itupun terdakwa memilih diam dan melanjutkan minum tuak. Tetapi korban kembali mengatakan hal yang sama terhadap terdakwa dan Nembak.“Mendengar peryataan sama itu, terdakwa mulai kesal. Tanpa

„ Markus Saragih basa-basi ia meninju wajah korban sebanyak dua kali,” paparnya. Berdasarkan pertimbangan itu, agar majelis hakim menyatakan terdakwa terbukti secara sah dan meyakinkan melakukan penganiayaan. “Selanjutnya Jaksa menuntut terdakwa empat bulan penjara dikurangi masa tahanan,” tambahnya. Usai mendengar tuntutan itu, hakim memberikan kesempatan kepada terdakwa untuk menyampaikan sesuatu. Lalu pria ini mengaku menyesali perbuatannya. “Saya melakukannya lantaran emosi. Tapi pak, saya bermohon untuk diberikan keringanan hukuman, usia saya sudah tua dan istri juga sudah tua. Saya tersiksa di penjara, mengingat usia saya yang sudah tua. Saya meminta permohonan agar hukuman saya diringankan,” terangnya. Menurutnya, ia mengaku sudah tidak tahan dan berharap permohonannya diterima. Hakim Ramses Pasaribu yang mendengar permohonan itu sedikit berseloroh dengan mengaku akan menghukum terdakwa setahun penjara. “Mau mati rasanya bila lamalama di Lapas itu,” ujat terdakwa lagi. (mua/hez)

Foto Roy

„ Jenazah Rika, gadis yang tewas melepuh setelah kediamannya terbakar, diratapi keluarga, Rabu (29-8).

AYAH TIRI SETUBUHI BOCAH 5 TAHUN DIAJAK MENEMANI BUANG AIR KECIL SIMALUNGUN- Bunga, bocah berusia lima tahun, dicabuli ayah tirinya Parulian Nainggolan (35), warga Aek Bottar Nagori Buntu Bayu, Kecamatan Hatonduan. Bunga disetubuhi saat ia membangunkan ayahnya dan mengajak ke kamar mandi untuk menemaninya buang air kecil. Hal itu terungkap pada persidangan yang digelar di PN Simalungun dipimpin majelis hakim Monalisa beranggotakan Silvia Ningsih, Rabu (29/8). Menurut Jaksa Penuntut Umum (JPU) Josron Malau, perbuatan pria yang bekerja sebagai petani itu melanggar pasal 81 ayat 1 No 23 Tahun 2002 tentang Perlindungan Anak. “Peristiwa berlangsung, Minggu (22/4) sekira pukul 23.00 WIB, di kediaman mereka. Saat itu terdakwa tidur bersama Bunga di kamar belakang. Kemudian korban yang merupakan anak tirinya membangunkan

„ Parulian Nainggolan terdakwa dengan mengatakan ‘Pak kawani aku kencing ke kamar mandi. Aku tidak bisa menghidupkan lampu!” ungkap jaksa. Lalu terdakwa bangun dan

membawa korban ke kamar mandi. Saat itu terdakwa menghidupkan lampu kamar mandi dan masuk bersama dengan korban. Setelah itu dengan polosnya korban membuka celana dan kencing. Sementara terdakwa yang tepat berada di samping korban, juga membuang air kecil. “Ternyata terdakwa melihat kemaluan korban hingga timbul birahinya. Selanjutnya terdakwa mencabuli dan menyetubuhinya,” terangnya. Melihat tindakan terdakwa, korban langsung menangis karena kesakitan. “Untuk mengalihkan tangisan itu, terdakwa memandikan korban. Setelah itu, ia membawa anak tirinya itu ke kamar tidur,” sebut Malau. Sementara dari hasil visum, ditemukan memar dan biru di alat kelamin luar. Selaput dara robek di posisi jam2, 3, 7,9 dan sampai ke dasar. (mua/hez)

Usai Tabrak Pasangan Kekasih, Supir Tinggalkan Mobil SIMALUNGUN- Setelah menabrak Yamaha Vega R BK 4804 QM yang dikendarai Warsito Nasution (29) yang berboncengan dengan kekasihnya Sarima br Saragih (23), supir Toyota Kijang BK 48 SS melarikan diri. Namun setelahmelajusejauh10kilometer,sang supir ini meninggalkan mobilnya di pinggir jalan. Peristiwa berawal saat Warsito yang menetap di daerah Tanjung Morawa, Deli Serdang ini melaju di Jalinsum Perdagangan-Sei Langge, Jumat (24/8) sekira pukul 13.00 WIB. Naas, setibanya di kilometer 2-3 Nagori Bah Lias, Simalungun, korban dan Boru Saragih yang diketahui menetap di Nagori Bandar masilam ini ditabrak mobil Toyota Kijang BK 48 SS. Akibatnya, kedua korban kritis setelah mengalami patah tulang di beberapa bagian tubuhnya. Warga yang menyaksikan kejadian, melarikan keduanya ke rumah sakit terdekat. Sementara pengemudi mobil langsungtancapgasdanmeninggalkan lokasi. Setelah kabur sejauh 10 kilometer, pengemudi Kijang ini meninggalkan mobil dan pergi tanpa diketahui arahnya. Setelah dirawat di beberapa rumah sakit Kota Siantar dan Medan, korban masihbelumpulihbenar.Namunpihak keluarga mengeluhkan biaya perobat-


„ Mobil Toyota Kijang BK 48 SS yang ditinggal supirnya sesaat setelah menabrak Warsito dan Sarima. Saat ini mobil berada di Polsek Perdagangan, Rabu (29/8). an yang besar. Bahkan kabar terakhir mereka dapat saat akan membawa keduakorbankerumahsakitdiMedan, biaya yang harus dikeluarkan mereka berkisar Rp28 juta. Untuk itu orangtua korban Wasman merasa tak sanggup. Pada Rabu (29/8) sekira pukul 14.00 WIB, Wasman dan kerabatnya mendatangi Mapolsek Perdagangan untuk menanyakan identitas supir itu. “Kami mau menanyakan alamat supirnya, makanya datang ka kantor polisi ini. Sebab sejak Jumat (24/8) sampai hari ini, belum diketahui siapa pelaku yang menabrak Warsito,” kata Wasman. Namun begitu bertemu Kaposlantas Polsek Perdagangan Apitu W Aritonang, Wasman dianjurkan datang ke Unit Laka Satlantas Polres Simalungun, karena berkas kasusnya sudah dilimpahkan ke unit yang berkantor di komplekasramapolisi,JalanSangnaualauh, Siantar Timur ini.

Hal yang sama dikeluhkan abang korban Edi (40) warga Kota Medan. Ia mengatakan, pasca kejadian korbansudahdirujukdariRSPerdagangan ke RS Harapan di Kota Siantar. Namun kerena kurang puas dengan pelayanan di sana, korban dibawa ke Medan. “Kamihanyainginsupirmobilmembantu biaya perobatan. Soalnya menurutketerangandokterbaru-baruini,jika harus dioperasi, kami harus mengeluarkan biaya Rp28 juta,” ujar Edi. Sedangkan Kanit Laka Satlantas Polres Simalungun Iptu Alsem Sinaga mengatakan,pihaknyasedangmenyelidiki supir yang mengemudikan Toyota Kijang BK 48 SS tersebut. “Seperti informasi dari warga yang kita dapat, sesaat setelah menabrak korban, supir melaju sejauh 10 kilomter dari TKP. Kemudian meninggalkan mobil begitu saja. Saat ini kasusnya masih kita selidiki,” kata Sinaga. (mag4/hez)

Informasi dihimpun menyebutkan, malam itu Salam yang tak memiliki mesin genset, menyalakan lampu teplok di kediaman mereka yang sekaligus tempat usahanya. Sebab aliran listrik di kampung mereka sedang padam. Kebetulan, salah seorang anak Salman yang bernama Rika Br Sinuhaji (20), diketahui bekerja sebagai karyawati di Hill Park Sibolangit, baru saja selesai mandi dan masuk ke kamar untuk mengganti pakaian. Salman bersama isterinya Kumpul Br Sembiring (55) dan dua anak lainnya berkumpul di ruang tamu. Sedangkan Ricard, putra sulungnya sedang memancing di sungai. Tanpa diketahui pasti, api yang berasal dari lampu teplok yang mereka nyalakan tiba-tiba menyambar barang-barang yang mudah terbakar. Beberapa saat kemudian, api semakin membesar dan kepulan asap memenuhi seluruh ruangan, termasuk kamar Rika. Tahu rumahya terbakar, Salman bersama isteri dan dua anaknya langsung berlari ke luar untuk menyelamatkan diri sembari berteriak kebakaran. Masyarakat sekitar yang melihat rumah Salam terbakar secara sukarela berdatangan untuk memberi bantuan manual, sekaligus melaporkan kejadian ke Polsek Pancurbatu. Untuk memudahkan upaya pemadaman, warga pun menghentikan beberapa unit truk tangki air yang datang dari arah Sibolangit. Saat mendengar ada teriakan minta tolong dari salah satu kamar rumah Salam, dengan gesit dan tanpa memikirkan resiko, Tamat yang merupakan tetangga korban langsung meringsek masuk setelah sebelumnya mendobrak pintu kamar. Ternyata, suara teriakan itu adalah Rika Br Sinuhaji yang merupakan anak ke tiga Salman. Rika tak bisa lagi menyelamatkan diri karena seluruh ruangan kamarnya dipenuhi asap. Bahkan, sekujur tubuh dan wajahnya juga sudah melepuh karena terjilat kobaran api. Setelah berhasil mengeluarkan Rika dari kamar, kedua orangtuanya dibantu warga, langsung melarikan Rika ke tempat pengobatan alternatif di kawasan Namo Pecawir, Kecamatan Pancurbatu. Tak lama kemudian, petugas Polsek Pancurbatu yang dipimpin langsung Kanit Reskrim AKP P Samosir, turun ke TKP untuk melakukan penyelidikan. Setibanya di sana, kobaran api sudah berhasil dipadamkan. Selanjutnya, petugas mengamankan sisa barang yang terbakar sebagai barang bukti. Karena kondisi luka bakar yang cukup parah, pada Rabu (29/8) sekira pukul 06.00 WIB, nyawa Rika akhirnya tak tertolong lagi. Jenazah Rika langsung disemayamkan ke Bingkawan untuk selanjutnya dikebumikan. Kapolsek Pancurbatu Kompol Darwin Sitepu melalui Kanit Reskrim AKP P Samosir saat dikonfirmasi mengatakan, asal api diduga kuat karena lampu teplok yang dinyalakan si pemilik rumah menyambar barang yang mudah terbakar. Bahkan, tabung gas elpiji yang berada di dapur rumah juga sempat meledak karena tersambar kobaran api. “Dalam kaitan itu, kita sudah mengamankan barang bukti dan meminta keterangan pemilik rumah dan sejumlah saksi mata,” ujar Samosir. Pantauan METRO di Jambur Bingkawan, Rabu (29/ 8) pagi, terlihat kedua orangtua berikut keluarga korban meratapi kepergian korban. Mereka tak menyangka, gadis yang dikenal ramah dan murah senyum itu meninggal dunia dengan cara yang tragis. Apalagi, kondisi korban cukup mengenaskan, sekujur tubuh dan wajahnya sudah hitam karena hangus terbakar. Bahkan, rambutnya juga sudah tak terisa lagi. Mereka juga menyesalkan kinerja pihak PLN yang sering melakukan pemadaman listrik di kawasan Sibolangit dan sekitarnya. Sebab kalau listrik padam, warga pasti menggunakan alat penerangan alternatif agar tidak merasa kegelapan. (roy/smg)

Hamili Murid, Guru Dibui 8 Tahun DIPAKSA GUGURKAN KANDUNGAN GAMBIR- Ulah guru yang satu ini sungguh bejat. Sudah menghamili muridnya, malah disuruh menggugurkan kandungan. Akibatnya, dia divonis delapan tahun penjara. Putusan terhadap guru berinisial RBS ini lebih rendah dua tahun dari tuntutan jaksa penuntut umum (JPU) dengan 10 tahun penjara. Majelis hakim yang diketuai Anas Mustaqim dalam putusannya di Pengadilan Negeri Jakarta Pusat, Selasa (28/8), menyatakan terdakwa terbukti menodai S, muridnya. Terdakwa yang guru salah satu SMK di Jakarta ini dinyatakan melanggar pasal 81 ayat 2 UU No 23/2002 tentang Perlindungan Anak. Atas putuan itu keluarga korban tidak kuasa menahan amarah saat melihat terdakwa keluar ruang sidang. “Saya kecewa sekali dengan putusan itu, saya berharap dia dihukum maksimal selama 15 tahun,” ucap Rosmini, ibu kandung korban usai sidang. Perbuatan bejat terdakwa ini dilakukan sejak 2008 hingga 2012. Ketika itu korban selalu dibujuk untuk melakukan hubungan layaknya suami istri. Meski sudah tiga kali hamil dan selalu digugurkan, terdakwa berusia 50 tahun ini selalu saja mengelak ketika diminta pertanggungjawaban. Belakangan, keluarga korban mengetahui kebejatan terdakwa setelah korban sakit parah dalam keadaan hamil. (pk/int)


30 Agustus 2012

7 Pria Ngamuk di Kantor Dispora Sambungan Halaman 1 tahui masalah proposal yang dimaksud dan meminta para pria itu bersabar, karena ada prosedur dalam proses pencairan proposal. Ternyata, jawaban stap itu membuat para anggota OKP itu tidak senang dan langsung mengamuk, memukul meja tempat staf itu. Selain itu, para pria itu membanting meja dan asbak rokok hingga rusak. Puas mengamuk, para pria itu pergi meninggalkan kantor Dispora. “Sembari memukul dan membanting meja, para pria itu mengaku tidak mau tahu soal prosesur,” kata salah seorang staf yang mengaku melihat aksi para pria itu. Kabid Olahraga Dispora

Batubara Ilyas ketika ditemui METRO, mengaku kecewa atas tindakan oknum anggota OKP itu. Namun, pihakya masih menunggu arahan dari pimpinan, apakah melaporkan peritiwa itu kepada pihak kepolisian. “Kita kecewa, masa garagara proposal bisa bertindak begitu,” katanya. Sementara informasi diperoleh METRO, banyak proposal yang masuk ke Dispora, namun dalam hal pecairan terkesal dipilih-pilih organisasi mana yang akan direspon. Bahkan, dalam hal pencairan, atas petunjuk Kadispora Hilman, katanya dilakukan pemotongan dana proposal yang dicairkan.(CK1)

Pacari Brondong Janda Cantik Dihajar Keluarga Polisi Sambungan Halaman 1 pacarnya yang merupakan anak seorang perwira polisi. Karena kenal, Dian membuka pintu rumahnya. Eh, keluarga pacarnya tersebut malah bersikap kasar terhadapnya. Ia dilabrak dan dimaki. Dan, ia hanya terdiam. Keluarga polisi ini tidak hanya memaki, bahkan salah seorang yang bernama Mora Batuara Nainggolan (19) memukul mata janda manis ini hingga lebam dan merusak rumahnya. “Mora Batuara memukul mataku sampai kayak gini. Terus mereka memecahkan kaca jendela dan mengobrak-abrik isi rumah,” bebernya. Dian mengaku tahumenahu mengapa keluarga AKP Marben Nainggolan ini menganiayanya.”Aku pun gak tau kenapa keluarga mereka menyerangku. Mungkin mereka gak setuju kalau aku pacaran sama anaknya. Kami udah dua tahun jalan. Sejauh itu, kami cuma pegang-pegang

tangan,” aku janda berbaju putih ini. Selain mata lebam dan rumah rusak, handphone (HP) miliknya pun Raib saat kejadian. “HP-ku pun entah ke mana mungkin dirampas mereka,” celoteh janda ini. Menurutnya, memang sebelum diserang keluarga polisi itu, Mora Batuara sering mengirim pesan dengan perkataan-perkataan kasar bahkan hampir seluruh keluarga pacarnya memusuhi janda ini. “Aku udah gak mau lagi ama dia. Nanti pikir keluarganya aku morotin hartanya. Padahal aku pun bisa nyari uang sendiri,” ucapnya menangis. Sementara itu, aparat Polsek Medan Sunggal yang menerima laporan janda ini langsung mengecek tempat kejadian perkara (TKP).”Udah kita suruh anggota mengecek TKP dan laporan juga udah kita terima,” ujar Kanit Reskrim Polsek Medan Sunggal AKP Victor Ziliwu. (Mri)

Dahlan Bersihkan Toilet Bandara Sambungan Halaman 1 Kepala Bagian Humas dan Protokoler Kementerian BUMN Faisal Halimi mengatakan, hal tersebut terjadi ketika Dahlan berada di Terminal 2 F Bandara Soekarno-Hatta sebelum berangkat ke Surabaya sekitar pukul 15.00 WIB. “Pak Dahlan ke toilet kemudian melihat tempatnya kotor, jadi langsung inisiatif untuk bersih-bersih di toilet itu,” ujarnya ketika dihubungi, Selasa (28/8). Faisal menceritakan, awalnya Dahlan hanya bersihbersih sendiri. Namun, beberapa saat kemudian, beberapa petugas kebersihan atau cleaning service yang melihat dan mengenali Menteri BUMN, kemudian ikut membantu membersihkan lantai toilet yang kotor karena air serta jejak-jejak sepatu dengan kain pel. Sebagai gambaran Terminal 2 Bandara Soekarno-Hatta digunakan untuk penerbangan internasional dan domestik. Terminal 2 D dan 2E digunakan untuk penerbangan internasional oleh maskapai swasta/asing maupun Garuda Indonesia. Adapun Terminal 2 F digunakan untuk

penerbangan domestik oleh Garuda Indonesia dan Merpati Nusantara Airlines (MNA). Menurut Faisal, Dahlan sempat kesal dengan kondisi toilet yang kotor tersebut. “Tidak ada gunanya petugas (bandara) jemput saya kalau lantai dan bandaranya jorok. Tidak perlu jemput saya,” ucap Faisal menirukan Dahlan. “Pak Dahlan mengulang beberapa kali perkataan tersebut,” imbuhnya. Faisal mengatakan, beberapa bulan lalu, Dahlan juga sempat marah di toilet Terminal 2 F Bandara Soekarno-Hatta karena kondisinya yang kotor. Karena itu, begitu mendapati kondisi toilet yang masih kotor, Dahlan pun langsung turun tangan untuk membersihkannya sendiri. Sementara itu, Tri S. Sunoko, Direktur Utama PT Angkasa Pura II yang mengelola Bandara Soekarno-Hatta mengatakan, pihaknya belum mendapat info terkait kondisi toilet bandara yang kotor. Menurut dia, kemungkinan ada beberapa bagian yang terlihat kotor karena padatnya penumpang pada musim arus balik Lebaran. “Nanti saya akan cek,” ujarnya. (owi)

Anggota SPS No.: 438/2003/02/A/2007

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

200 Mahasiswa Sumut Terima Bantuan dari Kemendibud MEDAN-Sedikitnya 200 mahasiswa dari 24 Perguruan Tinggi Swasta (PTS) di lingkungan Kopertis Wilayah I menerima beasiswa pendidikan untuk mahasiswa miskin atau dikenal dengan program bidik misi. Hal ini disampaikan Koordinator Kopertis Wilayah I Sumut-Aceh Prof Nawawiy Loebis saat dikonfirmasi, Rabu (29/8). “Untuk kuota pemberian beasiswa bidik misi itu ditentukan dengan populasi masyarakat miskin yang ada di setiap daerah mendapatkan kesempatan pendidikan tinggi sekaligus untuk menepis anggapan pendidikan itu hanya untuk orang kaya semata,” ungkap Nawawiy. Diakui Nawawiy, kuota yang ditetapkan Kemdikbud itu sangat kecil, baik dari jumlah

PTS nya maupun mahasiswa, karena pemerintah lebih memfokuskan kepada program-program studi percepatan pembangunan. “Hal ini sesuai dengan arahan Mendikbud, selain harus dipilih program studi strategis, mulai dari teknik, sains dan pertanian atau agrobisnis, serta akuntansi yang kelihatannya mahasiswanya makin berkurang, juga PTS tersebut harus memiliki akreditasi yang baik,”sebutnya. Tingkat kemiskinan di daerah tertentu katanya juga menjadi pertimbangan, agar yang tidak berkemampuan ekonomi tidak memikirkan jauh-jauh perguruan tingginya. “Jadi kita lihat tingkat kemiskinan di lokasi itu dengan menselaraskan antara

tingkat kemiskinan dan ketersediaan program studi di daerah tersebut untuk menentukan kuotanya,” katanya. Masih menurut Nawawy, jika dilihat dari jumlah PTS yang ada di Sumut dan Aceh hingga mencapai 300-an dengan jumlah mahasiswa hingga mencapai jutaan orang, menurutnya kuota yang diberikan itu sangat minim sekali. Karena itu, dia berharap akan ada penambahan lagi dari Kemdikbud, agar PTS di Sumut dan Aceh secepatnya memperbaiki status akreditasinya, karena syarat penerima bidik misi adalah PTS yang memiliki akreditasi B. Dari 24 PTS penerima beasiswa bidik misi itu antara lain Universitas Muhammadiyah Sumatera Utara sebanyak 42 orang disusul Universitas

HKBP Nommensen dan Universitas Methodist masing-masing untuk 18 orang, UMA 14 orang, Universitas Simalungun 12 orang dan Universitas Abuyatama di Aceh serta Universitas Samudera Langsa hanya 4 orang. Disebutkan Nawawiy, Kemdikbud memberikan 2.000 beasiswa Bidik Misi di PTS, sebagai kompensasi kenaikan harga BBM dan untuk menaikkan angka partisipasi kasar (APK) pendidikan tinggi. “Bidik Misi di PTS baru akan digelar tahun ini. Setiap mahasiswa akan mendapat suntikan dana Rp6 juta untuk satu semester atau Rp1 juta setiap bulan,” katanya. Dia menjelaskan, hanya PTS yang memenuhi syarat akan mendapatkan program Bidik Misi. Karena itu, harus ada

kesepakatan antara Kemendikbud dan PTS sebelum beasiswa Bidik Misi resmi dikucurkan. PTS penerima Bidik Misi tidak bisa lagi menggali partisipasi pendanaan dari mahasiswa miskin penerima beasiswa tersebut. Dalam pemberian beasiswa bidik misi itu, Kemendikbud juga akan mempertimbangkan PTS yang tidak memiliki konflik, baik internal ataupun eksternal. PTS juga tidak boleh ada pelanggaran hukum yang berpotensi mengganggu kegiatan akademisnya. Kemendikbud akan memilih PTS yang rajin melapor ke Koordinasi Perguruan Tinggi Swasta (Kopertis) akan akreditasi kampusnya yakni akreditasi A untuk PTS wilayah Jawa dan B untuk luar Jawa. (uma)


DIRUSAK-Jahotman Nainggolan menunjukkan lahan dan tanaman kopi ateng miliknya yang dirusak pihak PT TPL, Rabu (29/8).

TPL Rampas Lahan Warga Petani: Saya Siap Ditembak SIMALUNGUN- Sedikitnya 45 kepala keluarga (KK) warga Nagori Pondok Buluh, Kecamatan Dolok Pangribuan, Simalungun terancam kelaparan. Pasalnya ratusan hektare (ha) lahan pertanian sebagai sumber utama mata pencaharian mereka yang tersebar antara lain di Naga Hulambu dan Paronggangan di Nagori Pondok Buluh diserobot pihak Toba Pulp Lestari (TPL) sektor Aek Nauli. Selanjutnya ditanami ekaliptus. Jahotman Nainggolan (32), salahseorang petani, mengatakan sejak tahun 2005 pihak TPL memulai penyerobotan paksa lahan pertanian masyarakat. Setiap kali melakukan aksi brutal itu, pihak TPL membawa pengawal minimalnya anggota Brimob dengan persenjataan lengkap. “Mereka menakutnakuti masyarakat. Siapa yang melawan diancam ditembak. Terang saja masyarakat ketakutan, dan sudah ada 26 kepala keluarga yang mundur. Lahan mereka sudah habis ditanami pohon Ekaliptus oleh pihak TPL,” ungkap Jahotman kepada METRO, Rabu (29/8). Masih kata Jahotman, sikap brutal itu hingga saat ini masih

tetap berlangsung. Pada tanggal 2 Agustus, perusahaan TPL kembali menyerobot paksa lahan masyarakat di Huta Naga Hulambu, Nagori Pondok Bulu. Saat terjadi penyerobotan itu, dua anggota Brimob mengancam akan menembak kalau masyarakat tetap mengganggu aktivitas pekerjaan TPL. Karena warga berkeras mempertahankan lahannya, pihak TPL masih hanya bisa menanami 4 rante dari puluhan hektare lahan warga di Huta Naga Hulambu. “Saya menyatakan siap ditembak demi mempertahankan ladang saya supaya tidak diserobot. Sudah turun temurun keluarga kami berladang di kampung ini. Tetapi tiba-tiba TPL datang dengan pasukan dan alat beratnya melakukan penanaman paksa,” tegasnya. Ia kembali menegaskan, akan terus mempertahankan lahannya supaya tidak dirampas TPL. Soal tanamannya yang sempat dirusak TPL akan dia tuntut diganti rugi. “Minggu ini, kami masyarakat akan berdemo ke TPL. Kami tidak terima lahan kami diserobot paksa, dan tanaman di dalamnya dirusak

Departemen Redaksi METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput)

dengan alat berat,” ujarnya. Diutarakannya, akibat perusakan yang dilakukan TPL itu pihaknya mengalami kerugian hingga puluhan juta rupiah. Dia menyebutkan, ada berbagai macam tanaman milik warga yang dirusak pihak TPL, seperti kopi ateng, aren, pisang, cabai, jengkol, dan petai. “Semua tanaman di ladang saya ini diratakan pakai alat berat. Saat itu, mereka membawa dua anggota Brimob, dan satunya bermarga Pandiangan. Saya diancam akan ditembak. Memang mereka pakai baju polisi, ada tulisan Brimob di baju dinasnya, dan mengancam tembak saya. Lalu saya jawab, saya siap mati ditembak untuk memperjuangkan lumbung pertanian tempat kami hidup sehari-hari,” katanya. Sementara itu petani yang lahannya sudah ditanami ekaliptus oleh TPL terpaksa tidak bekerja. Antara lain; Rudin Nainggolan, Janangon Sijabat, Poltak Purba, Omer Sinaga, Probel Sinaga, Sulaiman Sinaga, Bottan Sitio, Amin Sinaga, Jawanter Sijabat, Rijon Sidabutar, Raya Manik, Saut Sinaga, Sius Pakpahan, Bonor Sinaga, Bilson Tindaon.

Kemudian Esron Tindaon, Marudut Sinaga, Kinsen Sinaga, Japatar Sinaga, Ramli Sinaga, dan James Tindaon. Lanjut kata Jahotman, setiap melakukan penyerobotan TPL tidak pernah kordinasi dengan pemerintah setempat dan masyarakat sekitar. Masyarakat yang mengetahui itu pun hanya karena ketepatan sedang di ladang. Sebab jarak perladangan warga dari jalan besar SiantarParapat sekitar 14 kilometer. “Kami berharap pemerintah pro rakyat. Perusahaan TPL sudah menginjak-nginjak masyarakat petani dengan merampas semua lahan pertanian. Kami sudah tidak ada pekerjaan lagi. Anak-anak kami mau makan apa? Kalau bekerja bukan mau cari kaya, tetapi untuk sesuap nasi saja,” ujarnya dengan raut wajah sedih. Pangulu Pondok Bulu Albiner Sinaga yang mengaku sering dipanggil pihak TPL melalui humasnya juga tidak pernah datang. Padahal pemanggilan itu untuk klarifikasi atas penyerobotan lahan pertanian masyarakat. Terpisah, Lambertus Siregar, Media Relationship TPL mengatakan, perusahaan TPL

METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

tidak pernah bekerja di luar izin yang dikeluarkan pemerintah. TPL memiliki izin pemanfaatan hutan kayu, dan sudah dilengkapi tapal batasnya. Itu artinya tidak berani TPL bekerja di luar itu, karena bisa terjerat hukum. “Sistem kerja TPL ada yang disebut Rencana Kerja Umum (RKU) yang sifatnya 10 tahun. Kemudian ada lagi Sistem Kerja Tahunan (RKT) yang sifatnya 1 tahun. Sistem kerja ini dilaksanakan di daerah sektor Aek Nauli secara bergantian. Tahun kemarin di daerah Nagori Sihaporas, dan tahun ini di Nagori Pondok Bulu,” bebernya. Lambertus mengutarakan, setelah mereka mengantongi izin, tidak ada seorang pun yang bisa mengelola kawasan TPL, kecuali pihak TPL sendiri. Sementara masyarakat yang sempat di dalamnya melakukan pemanfaatan lahan, selama ini diberikan kesempatan hanya sampai panen hasil pertaniannya. “Kita tidak ada serobot lahan pertanian masyarakat. Bahkan kita berikan mereka kesempatan sampai panen. Tetapi setelah panen, jangan lagi lahan tersebut diusahai,” ujarnya mengakhiri. (osi/dro)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


KAMIS 30 Agustus 2012

Suami Aniaya Istri & Anak di Rumah Dinas Walikota

Warga Pungut Sumbangan Sambungan Halaman 8

balasannya, warga meminta sumbangan sekedar kepedulian kepada pengendara yang melintas. Usman (60), warga Bondang Desa Air Joman, Rabu (29/8) mengatakan sudah puluhan tahun infrastruktur jalan di Bondang rusak parah dan berlubang. Bupato Asahan telah beberapa berganti, namun jalan tetap rusak dan belum diperbaiki. Diperkirakan sepanjang 26 kilometer antara Kota Kisaran menuju Kecamatan Air Joman dan berbatas dengan Desa Air Joman Baru rusak parah.

“Bupati Asahan Taufan Gama Simatupang mengatakan Asahan pada tahun 2011 akan menjadi terdepan dalam bidang pembangunan, tetapi bagaimana menjadi terdepan jika jalan rusak parah,” katanya. Dijelaskannya aksi meminta sumbangan sukarela dari pengendara yang melintas, ditujukan untuk membeli materil untuk digunakan menimbun lubang. Hasilnya, beberapa lubang berhasil ditimbun dan dapat dimanfaatkan pengendara, walau hanya beberapa saat. Ditambahkannya, selain jalan rusak, penerangan lampu jalan juga tidak tersedia. (ilu)

Sambungan Halaman 8

menemui Juar untuk meminta uang belanja dan keperluan untuk anaknya. Tetapi pada saat itu, tersangka Juar menyembunyikan diri ke dalam pos. Kemudian Juar keluar dari pos pen-

jagaan dan menarik tanganya sebelah kiri yang mengakibatkan baju yang dipakainya robek, karena dirinya meronta untuk melepaskan diri. Pada saat tarikmanarik tangan tersebut, tibatibaJuarmenamparmukaRosdan menolaknya hingga jatuh.

Melihat kejadian tersebut, Rizka Agustina mencoba melerai, tetapi Juar juga menarik tangan Rizka dan menyeretnya hingga terjatuh danketikaterjatuh,Juarmenginjak tangan Rizka. Karena tidak terima dengan perbuatan suami dan ayahnya, keduanya melaporkan

Fans Club yang dibentuk masyarakat pendukung Bintatar Hutabarat. Ketua Bintatar Fans Club Oloan Silaen, kepada METRO, Rabu (29/8) mengatakan, pihaknya memiliki tugas untuk mengumpulkan dukungan kepada Bintatar Hutabarat untuk menjadi Gubernur Sumatera Utara periode mendatang. “Bintatar Hutabarat merupakan salah seorang pegawai di PLN Cabang Sumatera Utara. Selama ini dikenal sangat merakyat serta dekat dengan masyarakat,” kata Oloan Silaen. Dijelaskan Oloan, pihaknya telah menggelar beberapa kali pertemuan dengan Bintatar Hubarat dan masyarakat Asahan. Terakhir dengan warga Dusun IV Desa Serdang Kecamatan Meranti, warga Pulo Bandring Kisaran Barat, Bandar Pasir Mandoge dan Simpang Empat. Ratusan warga hadir dan bertatap muka langsung dengan Bintatar Hutabarat di Desa Serdang Kecamatan Meranti.

“Beliau secara terus terang meminta dukungan untuk menjadi gubernur Sumut, untuk masa depan Sumut yang lebih baik,” katanya. Ditambahkannya, walau Bintatar belum resmi sebagai calon Gubsu, namun Bintatar tetapi meminta dukungan. Selain meminta dukungan, Bintatar juga menyampaikan selamat Hari Raya Idul Fitri 1433 sekaligus menyerahkan penali kasih kepada warga yang membutuhkan. Memiliki pribadi yang bersahaja dan rendah hati, menjadi daya tarik Bintatar sehingga mendapat sambutan hangat pada setiap pertemuan dengan masyarakat. Sementara tokoh masyarakat Muhson dan Kamsi ketika penyerahan penali kasih mengucapkan terimakasih kepada Bintatar Hutabarat yang memperhatikan masyarakat kecil dan kaum tani. “Sumatera Utara membutuhkan pemimpin yang dekat dengan rakyat, kami berharap cita-cita menjadi gubernur terkabul,” kata Muhson. (van)

Genjot Latihan Fisik dan Teknik

Sambungan Halaman 8

Rispa Lubis melalui wakil manajer Isnanto, kepada METRO, Rabu (29/8) mengatakan, latihan untuk tim dilakukan tiga kali dalam seminggu di lapangan Terminal Madya Kisaran di bawah pengawas pelatih bersertifikat Nasional, Sastra. “Kita berharap hasil terbaik diraih oleh tim, doa dan dukungan masyarakat Asahan kami harapkan,” katanya. Ditambahkan, 12 atlet futsal yang akan dibawa merupakan pemain terbaik pada beberapa

kompetisi yang telah digelar beberapa waktu lalu. Seperti Rahmat Hidayat, M Reza Piranda, Mukmin Hasibuan, Syafrizal, M Khadafy, Bambang Mutono, Wahyu Ariska, Sadam Husien, Lilik Warisman, Suhairuddin, Irvan Ardiansyah, Rehandi Ramadoni, Alvin Gunawan, MReza Fahlepy Siregar dan Rusli Kurnia Siregar. Seluruh pemain dinyatakan siap untuk bermain all out dengan target mencapai Divisi I melalui putaran ke-IV yang akan digelar di Jakarta. (mar)

memintauangbelanja,dandirinya mengajak menjumpai bendahara Satpol PP. Tetapi Ros menolak, dandirinyamenolakRosuntukkeluar dari pos penjagaan. Dijelaskannya, dirinya bercerai dengan Ros ketika dirinya pergi ke NAD bekerja sebagai guru honor. (ilu)

Ibu Sehat Keluarga Selamat

Ingin Maju jadi Calon Gubernur Sambungan Halaman 8

kejadian tersebut ke Mapolres Tanjungbalai. Sementara di persidangan, Juan Syahputra membantah melakukan penganiayaan terhadap Ros dan Rizka yang mendatangi pos penjagaan bersama saksi Faisal Raja Nami Harahap. Saksi datang


„ Pdt Putri Ida Saragih STh sedang memaparkan pentingnya menjaga kesehatan alat reproduksi di GKPS Bangun Tani, Minggu (25/8). SIMALUNGUN-Pengetahuan tentang kesehatan termasuk masalah reproduksi sangat penting untuk diketahui pasangan suami-istri. Untuk kalangan perempuan, menjadi kewajiban untuk memahami menyangkut kesehatan reproduksi. Hal tersebut ditegaskan Pdt Putri Ida Saragih STh dalam acara penyuluhan kesehatan alat reproduksi di GKPS Bangun Tani, Nagori Bangun Tani Kecamatan Dolok Pardamean, Minggu (25/8).

Dihadapan 39 peserta, dimana 8 diantaranya laki-laki, Pdt Putri Ida Saragih mengatakan, anggota keluarga dituntut untuk memiliki tubuh yang sehat, untuk mampu bersaing dan mensejahtera diri. “Zaman semakin hari semakin mendatangkan persaingan dan kompetisi tingkat tinggi, sehingga menjadi keharusan setiap orang untuk memiliki SDM dan tubuh yang sehat,” katanya. Dijelaskannya, dalam keluar-

ga, peran Ibu sangat vital dan menentukan kesejahteraan keluarga. Reproduksi yang sehat akan menjamin Ibu tetap terawat tubuhnya, sehingga mampu merawat dan membesarkan anak-anak dalam keluarga. “Selain memiliki iman dan pendidikan, jemaat juga perlu memiliki kesehatan yang prima untuk mendukung pelayanan. Kesehatan menjadi mahal harganya, jika suatu saat terpaksa menjalani perawatan keseha-

Puluhan Juta Masuk Kantung Pribadi Sambungan Halaman 8

kami sendiri saja tidak sampai hati memasang tarif parkir yang mahal,” katanya sembari mengatakan dirinya hanya menetapkan tarif Rp1.000 untuk sekali parkir di sekitar kediamannya. Dia menjelaskan, selama ini diperkirakan kendaraan yang masuk ke objek wisata Parapat mencapai lima ratus kendaraan dalam sehari, sementara tarif retribusinya juga tidak terlihat jelas dan bervariatif, mulai Rp25 ribu hingga Rp45 ribu untuk sekali masuk. “Memang ada banyak oknum yang bermain di pintu masuk itu, soalnya tarifnya tidak pernah jelas. Padahal selama ini paling sedikit 500 kendaraan masuk, apalgi hari libur, seperti hari minggu,” kata-

nya. Sementara untuk hari libur, diperkirakan petugas jaga pintu Parapat akan meraup omzet sekitar Rp12.500.000 per hari, kemudian uang ini diduga disetorkan langsung ke Pemkab Simalungun oleh petugas jaga. Sementara pengunjung yang datang hanya diberikan sebuah stiker berwarna kuning berlapis merah oleh petugas ini. “Pernah saya tanya kemana uang retribusi ini akan disetorkan, terus petugas jaganya yang merupakan teman saya ini mengatakan kalau mereka menyetorkannya ke Pemkab Simalungun. Namun bagaimana Pemkab tahu berapa jumlahnya, soalnya tarifnya saja tidak jelas. Tindakan seperti ini tentunya termasuk tindak korupsi,” katanya.

Terpisah, Kepala Dinas Pendapatan dan Pengelolaan Aset Daerah Simalungun Wilson Manihuruk yang dihubungi melalui selularnya justru mengaku selama ini dirinya sama sekali tidak mengetahui tarif retribusi masuk ke objek wisata Parapat. “Memang saya sendiri juga belum tahu berapa sebenarnya tarif masuknya. Namun saya akan coba pertanyakan ini langsung ke petugasnya,” katanya. Dia menambahkan, selama ini pengutipan retribusi masuk ini ditangani oleh rekanan yang kemudian disetorkan ke Pemkab Simalungun. “Selama ini pengutipan ini diberikan pada rekanan. Namun kita juga belum tahu berapa tarifnya,” katanya singkat sembari menutup teleponnya. (mag-02/ara)

tan di rumah sakit. Maka untuk menghindarinya, pencegahan dilakukan sejak dini,” katanya. Sementara Direktur Pelpem GKPS Ir Juniamer Purba ketika membuka penyuluhan, dalam sambutannya mengatakan, penyuluhan kesehatan kepada jemaat termasuk kesehatan reproduksi telah menjadi program dan dilaksanakan sejak tahun 2004. Sementara untuk tahun 2012, penyuluhan yang dilaksanakan di GKPS Bangun Tani merupakan yang ke-27 dari seluruh penyuluhan yang dilaksanakan di daerah kerja Pelpem GKPS. Sebanyak 932 orang telah menjadi peserta, dengan rincian 98 orang laki-laki dan 834 perempuan. “Kesehatan merupakan bagian dari hak azasi manusia dan diatur dalam undang-undang dan peraturan di Negara Kesatuan Republik Indonesia (NKRI). Seharusnya sarana pendukung kesehatan disediakan sampai ke desa-desa, termasuk sumber daya manusia terlatih,” katanya. Dijelaskannya, kesehatan alat reproduksi perempuan harus dijaga dengan teliti dengan melakukan pemeriksaan secara teratur baik dengan melibatkan tenaga kesehatan maupun pe-

meriksaan oleh diri sendiri. Pelpem GKPS melakukan kerjasama dengan petugas pengembangan kesehatan masyarakat Rumah Sakit Bethesda Seribudolok, Kecamatan Purba. Sementara untuk pemeriksaan yang melibatkan laboratorium, bekerjasama dengan Universitas Sumatera Utara. “Kesimpulannya, kesehatan sangat mahal harganya. Maka kesehatan harus dijaga, terutama untuk kesehatan Ibu yang menjadi penopang kebahagiaan keluarga,” katanya. Sementara Koordinator Program Pengembangan SDM Pelpem GKPS Herman Sipayung mengatakan, masih banyak tidak mengenal dan belum pernah menikmati pelayanan jaminan pelayanan sosial dan kurang memahami apa itu alat reproduksi serta jenis penyakit yang mungkin akan diderita bahkan sampai telah memasuki tingkat akut. “Mengenaai kesehatan Ibu dan Anak, kami telah diskusikan langsung dengan stakeholder yakni Pemkab Simalungun yang menjadi penanggungjawab Millenium Development Goal (MDGs) 2015. Tetapi belum ada tindak lanjutnya,” katanya. (esa)

9 Unit untuk Nelayan Tanjungbalai Sambungan Halaman 8

Rasyid kepada METRO, Rabu (29/8) menjelaskan, pengadaan kapal bot merupakan usulan masyarakat Tanjungbalai yang diperjuangkan wakil PPP di Sumatera Utara. Melalui Ketua DPW PPP Sumut Fadli Nurzal, permohonan disampaikan ke Pemprovsu dan dibahas di DPRD Sumut dan berhasil direalisasikan tahun ini. Terpisah, Sangkot Sinaga, penanggungjawab pembuatan kapal bot bantuan Pemrovsu kepada nelayan Tanjungbalai, mengatakan pihaknya sedang mengerjakan pembuatan 11 kapal penangkap ikan, 7 unit diantaranya memiliki panjang lunas 7 meter dan lebar 4 meter

sedangkan 4 unit memiliki panjang lunas 8 meter dan lebar 4 meter. Keseluruhan kapal bot dilengkapi mesin 23 PK dan Gt 4 sampai Gt 5. Dijelaskannya, rekanan yang mengerjakan pembuatan kapal adalah CV Saroha yang dipimpin oleh Rahmad Hidayat. Sementara Ketua DPW PPP Sumut Fadli Nurzal, yang juga menjabat sebagai anggota DPRD Sumut melalui telepon mengatakan, pihaknya tetap komit memperjuangkan nasib nelayan dengan mengajukan bantuan kapal. “Selain Tanjungbalai, masyarakat Batubara dan Kabupaten Langkat, Stabat, Belawan dan Serdang Bedagai juga menerima bantuan kapal,” katanya. (ilu)

Sambungan Metro Asahan Main Opera Batak Sambungan Halaman 1 akan berperan sebagai Gorga dan Marlinang. Choky mengatakan dirinya seolah mendapatkan kehormatan yang besar memerankan di opera ini. Tambahnya bicara budaya opera Batak bukan hanya sukuiesme semata-mata tetapi ingin menunjukkan budaya Indonesia.

“Ini menjadi kekuatan yang besar untuk berkontribusi dunia parawisata khususnya Danau Toba adalah sumber daya terbaik di Indonesia,” kata Chocky Sitohang. Opera tersebut sengaja digelar masyarakat yang berasal dari Sumatera Utara khususnya Batak, tergerak untuk membangun kembali daerahnya. Tujuannya tak lain demi melestarikan kembali budaya Batak,

serta mengangkat fanatisme kedaerahan. Bonar Gultom, selaku Sutradara juga sekaligus menjadi Gorga, pemeran utama opera ini mengatakan tujuan utama didalam opera ini adalah untuk menggali budaya Batak. “Dari kecil saya senang sekali filmfilm musik. Genrenya adalah budaya Batak. Seluruh jalan cerita itu diisi dengan lagu-lagu makanya di sebut Opera,” kata Bonar di ‘Marleys Bar’ Gedung Energy lantai 2, Kawasan

SCBD lot 11a, Jendral Sudirman, Jakarta, Rabu, (29/8). Hisar Gurning dari Gorga House selaku penyelenggara, mengatakan opera kolosal digelar dalam rangka melestarikan nilai-nilai budaya Batak dan mengangkat fanatisme kedaerahan sehingga masyarakat yang berasal dari Sumatra Utara khususnya Batak tergerak untuk membangun kembali daerahnya. ”Kami Ingin mengingatkan lagi bahwa masih ada Danau Toba di tanah kelahiran kami sebagai tempat

Murid Serba Hemat, Bawa Nasi ke Sekolah Sambungan Halaman 1 Di ruang kelas I yang sekaligus kantor sekolah, awak media ini bertemu dengan Kepala SD 177664 Sitanggor, A Ompusunggu SPd. Kepada koran ini, ia menyebut jumlah murid di sekolah tersebut sebanyak 75 orang. Sedangkan tenaga pengajar terdapat enam orang berstatus PNS dan satu orang guru honor. Ditanya soal kondisi siswa di sekolah itu pasca tragedi pembunuhan sadis yang menewaskan Bilson Simaremare, dan menyebabkan ayah mereka dipenjara, A Ompusunggu sedikit menghela nafas. “Ahh…dang tarhatahon be sude lae (sulit untuk menjelaskannya semua lae),” ucap Ompusunggu. Ia menggambarkan, hampir semua siswa di sekolah itu kini serba hemat untuk kebutuhan sekolah masingmasing. Mulai dari sepatu dan seragam sekolah yang diganti setelah koyak-koyak, hingga ke buku tulis. “Sepertinya mereka (murid, red) memang sudah diajari ibu mereka masing-masing untuk hidup hemat karena faktor ekonomi yang tambah sulit setelah bapak mereka dipenjara,”

sambungnya. Dia menceritakan, pada awal peristiwa pembunuhan sadis dua tahun lalu, banyak murid di sekolah itu jarang masuk sekolah karena berbagai faktor. “Kalau awal kejadian dulu, banyak murid yang jarang masuk sekolah karena ikut stres dan faktor-faktor lainnya. Sehingga, kita selaku guru harus maklum dan berusaha ikut memulihkan mental mereka,” paparnya. Perihal hemat siswa yang diutarakan A Ompusunggu, ternyata benar. Salah satu murid yang masih duduk di bangku kelas I, Manahan Rajagukguk (6), tampak menyelipkan nasi di laci meja belajarnya. Manahan menyebut, ia selalu bawa nasi dari rumah agar tidak perlu jajan di sekolah. Sedangkan sejumlah murid lain yang duduk di bangku kelas III, tampak mengenakan sepatu yang sudah koyak-koyak dan baju sekolah yang sudah usang. Bahkan, buku tulis beberapa murid juga tampak koyakkoyak. “Seandainya dana BOS bisa digunakan untuk seragam sekolah,

mungkin akan dapat terbantu. Tapi sesuai petunjuk teknis saat ini, dana BOS tidak dapat membeli seragam murid lagi. Paling kita melengkapi buku mata pelajaran saja dari dana BOS dan memperbaiki atau membeli mobiler sekolah dan kebutuhan sekolah lainnya,” imbuh Ompusunggu. Sementara itu, Ratna boru Tambunan (40), ibu delapan anak istri dari terpidana Pasu Simaremare kepada METRO mengaku, harus mengajarkan pola hidup hemat kepada kedelapan anaknya. “Saya punya delapan anak, dua baru tamat tahun lalu dari SMA. Karena memang pahitnya yang saya alami terutama untuk mencari uang, terpaksa anak-anak saya ajari hidup sehemat mungkin,” ujar Ratna. Ia mengaku, setiap hari harus bangun tidur pukul 05.00 WIB untuk membereskan sarapan pagi anakanaknya sebelum berangkat ke sekolah. Karena satu lagi anaknya yang kini duduk di bangku SMP harus berangkat ke sekolah berjalan kaki sekitar lima kilometer. “Pukul 07.00 WIB, setelah anakanak semua berangkat sekolah. Saya

dan tiga anak saya yang belum sekolah langsung berangkat ke ladang sambil membawa perbekalan nasi untuk makan siang. Kalau untuk makan siang anak-anak sudah saya siapkan di rumah,” ungkap ibu yang suaminya dipenjara 15 tahun itu. Satu tahun lebih, Ratna mengarungi hidup seperti itu. Kini, dua anaknya yang sudah tamat SMA, terpaksa harus tinggal bersamanya untuk membantu mencari nafkah. “Tubuh saya sudah lelah, saya tidak kuat lagi bekerja keras. Makanya anak-anak tidak mau merantau. Mungkin mereka kasihan melihat saya,” papar ibu berkulit putih dan bertubuh kurus yang masih menyusui putra paling bungsunya itu. Kerasnya perjuangan hidup yang dirasakan Ratna sama kerasnya dengan beban mental setelah suaminya dipenjara. Pasalnya, ia adalah satu dari 11 ibu lainnya yang melahirkan anak setelah suami mereka dipenjara.(bersambung)

tujuan wisata yang cukup terkenal di dunia,” ujar Gurning dalam jumpa pers di Jakarta, Rabu (29/8). Gurning menjelaskan, selain sebagai tontonan, opera yang bercerita tentang kecintaan kampung halaman ini juga diharapkan akan menjadi sarana untuk menggali, melestarikan, dan mengembangkan unsur-unsur seni budaya daerah. Dan terpenting, kata Gurning, membangkitkan rasa syukur kepada Sang Pencipta. ”Diharapkan dapat menggelitik dan memupuk kecintaan, kerinduan, dan kebanggaan masyarakat terhadap Tanah Airnya sendiri,” paparnya. Opera ini mengisahkan perjalanan seorang pemuda Batak bernama Gorga yang melanglang buana keliling dunia karena tidak puas dengan keadaan di tanah kelahirannya. Namun, akhirnya dia kembali lagi dan menyadari bahwa seindahindahnya negeri orang, justru lebih indah di kampung halaman sendiri. Pada tahun 2001-2005, lelaki kelahiran 1959 ini berinisiatif memprakasai penyelenggaraan pes-

ta rakyat Danau Toba, yang pada saat itu berhasil menggairahkan kembali kegiatan pariwisata di Danau Toba. Nantinya, opera ini juga didukung oleh 150 pemain dari Gereja Kristen Protestan (GKP) Bekasi Timur serta paduan suara Glorius Choir, Cherubim Male, PS Ekklesia, Hosiana Children and Youth Choir. Sekedar di ketahui opera ini pertama kali dimainkan di Medan pada tahun 1969, kemudian pada tahun 1972 diadakan di Istora Senayan pada acara Rapim ABRI dan hiburan untuk rakyat selama 5 hari. Pada tahun 1973, opera ini juga di mainkan untuk menghibur Prince Bernard (Belanda), dan tahun 1974 menghibur Raja Bouduin (Belgia) serta PM Lee Kuan Yew (Singapura) pada tahun 1975. Opera Arga Do Bona ini Pinasa juga pernah mendapatkan rekor MURI atas prestasi pencipta cerita dan sutradara pertunjukan opera dengan pendukung terbanyak yaitu 232 orang, pada acara pesta rakyat Danau Toba. (tr/int)

Disdik Diduga ‘Sunat’ 25 PPersen ersen Dana Rehab Sekolah Sambungan Halaman 1 kualitas rehab gedung sekolah, karena dikerjakan tidak sesuai dengan aturan. Hal senada dikatakan Ketua Tim Investigasi MP3 BAJAYA Muhammad Nur. Dia mengungkapkan, pemotongan dana itu dilakukan dengan cara, penyampaian terimaksih dan biaya operasional tim kabupaten untuk mendapatkan dana rehab itu dari pemerintah pusat. Ironisnya dilanjutkan M Nur, para kepala sekolah SD maupun SMP yang

mendapatkan dana itu tidak bisa menolak permintaan oknum-oknum yang melakukan pemotangan dana. Selain itu, para kepala sekolah juga tidak paham mengelola dana bantuan itu, sehingga rawan terjadinya penyelewengan dana. SementaraKepalaDisdikBatubaraOK Zainal Alwi ketika hendak dikonfirmasi di kentornya tidak berada di tempat. Menurut pegawai di kantor Disdik, OK Zainal belum ada terlihat masuk kantor.(CK-1)

KAMIS Edisi 202 th V

30 Agustus 2012

Jadwal Keberangkatan Kereta Api STASIUN TANJUNGBALAI KA Putri Deli Berangkat (Tanjung)

Tiba (Medan)

I. 06.50 WIB

11.17 WIB

KA Putri Deli Berangkat (Tanjung)

II. 12.50 WIB

Suami Aniaya Istri & Anak di Rumah Dinas Walikota Hakim hanya Vonis 2 Bulan Penjara

Tiba (Medan)

17.27 WIB

KA Putri Deli Berangkat (Tanjung)

Tiba (Medan)

III. 17.50 WIB

22.15 WIB

Sumber: Stasiun Kereta Api Tanjungbalai



TANJUNGBALAI-Juar Syahputra, terdakwa penganiaya istri Syah Rosmiyati Harahap dan anaknya Rizka Agustina di kompleks rumah dinas Walikota Tanjungbalai, September 2010 lalu, divonis Pengadilan Negeri Tanjungbalai 2 bulan penjara.


„ Rosmiyati Harahap dan Rizka Agustina korban penganiayaan.

Hukuman ini dinilai Rosmiyati dan Rizka terlalu ringan, dibandingkan rasa sakit yang diderita karena

penganiayaa tersebut. Hal ini terungkab dalam persidangan yang digelar di Pengadilan Negeri Tanjungbalai, Rabu (29/8). Sidang yang dipimpin Hakim Eginovita SH dan Hakim Anggota Rizki Zulkarnain SH dan Aurora Quintin SH MH menetapkan vonis 2 bulan sementara jaksa penuntut umum Entin Pasaribu, sebelumnya menuntut 3 bulan. Korban Syah Rosmiati Harahap dan anaknya Rizka Agustina, usai per-

sidangan, kepada METRO mengatakan hukuman yang diterima oleh Juar Syahputra, yang saat ini statusnya telah menjadi mantan suami karena keduanya telah bercerai pasca kejadian penganiayaan, sangat ringan. Dijelaskannya, pada Kamis, 2 September 2010, dirinya bersama anaknya datang ke rumah dinas Walikota Tanjungbalai di Jalan Jenderal Sudirman

„) Baca Suami....Hal 7

Pemprovsu Anggarkan Bantuan Kapal Bot

9 Unit untuk Nelayan Tanjungbalai Ia mengawali karier di film layar lebar dengan bermain dalam film Kirun + Adul pada tahun 2009. Ia pernah mengikuti ajang pemilihan Abang-None Jakarta dengan menjadi None untuk tingkat Jakarta Selatan tahun 2006 dan kemudian berlanjut menjadi finalis untuk tingkat DKI Jakarta pada tahun yang sama. Pada tahun 2007, ia ikut dalam pemilihan Wajah Femina. (int)

TANJUNGABALAI-Pemerintah Provinsi Sumatera Utara melalui APBD tahun 2012 telah menganggarkan bantuan kapal boat penangkap ikan kepada nelayan Tanjungbalai dan Batubara. 11 unit kapal boat, dengan rincian 9 unit untuk kelompok nelayan di

Tanjungbalai dan 2 unit untuk kelompok nelayan di Batubara dianggarkan sebesar Rp1,6 miliar lebih. Ketua DPC Partai Persatuan

Pembangunan (PPP) Kota Tanjungbalai Yusuf P melalui Wakil Sekretaris DPC PPP Chairul

„) Baca 9 Unit...Hal 7


„ Warga Bondang, Air Joman memperbaiki jalan yang rusak dengan meminta sumbangan kepada pengendara yang melintas.

Jalan Air Joman Rusak Parah

Warga Pungut Sumbangan


„ 11 unit kapal bot bantuan Pemprovsu sedang dikerjakan di dok pembuatan kapal di Tanjungbalai, dan akan diserahterimakan dalam waktu dekat.

AIR JOMAN-Kesal karena Pemkab Asahan tidak segera memperbaiki jalan rusak dan berlubang menuju Kecamatan Air Joman, masyarakat Dusun Bondang Desa Air Joman me-

B a k ombur

nimbun dengan batu dan pasir lubang yang banyak terdapat di jalan menuju pemukiman warga. Sebagai

„) Baca Warga...Hal 7


„ Ir Bintatar Hutabarat menyerahkan bingkisan penali kasih kepada warga Desa Serdang.

Ir Bintatar Hutabarat Mohon Doa dan Dukungan Wak Alang: Kadang hukum kito ini tidak berpihak kepada kaum lemah, terutama perempuan dan anak. Bagaimana mungkin penyaniaya ibu dan anak hanya dihukum 2 bulan. Wak Ongah: Botul juga, kemanonya nurani penegak hukum ni. (**)

Genjot Latihan Fisik dan Teknik Persiapan Putaran III Liga Futsal Amatir

KISARAN-Tim Futsal Asahan FC melakukan latihan fisik dan teknih lebih mendalam untuk menghadapi putaran ke-III Divisi I Liga Futsal Amatir Indonesia yang akan digelarr

September 2012 mendatang di Padang, Sumatera Barat. Tim Futsal Asahan FC bergabung dengan tim futsal Nanggroe Aceh Darussalam (NAD), Sumatera Barat, Riau dan

Kepri serta Sumatera Utara yang diwakili Asahan FC. Manajer Futsal Asahan FC Iwa

„) Baca Genjot...Hal 7

Puluhan Juta Masuk Kantung Pribadi Dari Retribusi Masuk Parapat SIMALUNGUN- Puluhan juta diduga menguap dan masuk kantung pribadi yang diperoleh dari uang retribusi gerbang masuk objek wisata Parapat, Kecamatan Girsang Sipangan Bolon, Simalungun. Pasalnya, uang yang diberikan pengunjung sebagai biaya retribusi sangat tinggi dan tidak disertai karcis. Informasi dihimpun METRO, Rabu (29/8), dalam sehari ada ratusan kendaraan roda dua dan roda empat yang masuk ke objek wisata Parapat melalui pintu gerbang ini. Mereka dikenakan biaya retribusi bervariatif, ada yang Rp25 ribu hingga Rp45 ribu, namun pembayaran tarif ini tidak disertai karcis

retribusi. Para pengunjung juga mengaku keberatan kalau harus membayar segitu besar. Gabion Siahaan (43) dan Afandi Siregar (30), warga Kelurahan Parapat, Kecamatan Girsang Sipangan Bolon, yang juga bekerja sebagai tukang parkir di kawasan ini mengatakan, selama ini ada ratusan kendaraan roda dua dan empat yang masuk ke kawasan objek wisata Parapat ini setiap harinya. “Sebenarnya sudah banyak sekali keuntungan yang diterima petugas pintu masuk objek wisata Parapat ini. Soalnya tarifnya sangat mahal sekali. Bahkan

„) Baca Puluhan...Hal 7

Ingin Maju jadi Calon Gubernur KISARAN-Bakal calon Gubernur Sumatera Utara, Ir Bintatar Hutabarat meminta doa dan dukungan masyarakat Kabupaten Asahan untuk maju menjadi calon gubernur Sumatera

Utara periode 2013-02018. Permintaan dukungan dilakukan dengan bertatap muka langsung serta melalui Bintatar

„) Baca Ingin...Hal 7

Dialog APF dan PWI Bersama Bupati Asahan

Asahan harus Lebih Sejahtera KISARAN-Asahan Peduli Fondation (APF) dan Persatuan Wartawan Indonesia (PWI) perwakilan Asahan menggelar dialog langsung dengan Bupati Asahan Drs Taufan Gama Simatupang, membahas pencapaian Pemkab Asahan dalam bidang pembangunan, Rabu (29/8). Bertempat di ruang Melati kantor Bupati Asahan, dan dihadiri ratusan orang yang mewakil OKP, Ormas dan tokoh masyarakat Asahan, Taufan Gama Simatupang menjawab seluruh pertanyaan peserta terkait pembangunan di Asahan. Taufan yang berperan sebagai narasumber tunggal menjelakan pencapaian empat pilar pembangunan di Asahan meliputi infrastruktur, pendidikan, kesehatan

dan pertanian/kehutanan/UMKM/ koperasi. Gambaran yang disampaikan disesuaikan dengan visi dan misi Pemkab Asahan mewujudkan Asahan yang religius, sehat, cerdas dan mandiri. Pertanyaan yang diajukan beragam, ada yang memuji dan ada yang mengkritik, tetapi Taufan yang hadir didampingi oleh Wakil Bupati H Surya, Sekda Kabupaten Asahan Sofyan serta beberapa pejabat eselon II menjawab dengan ringan dan diplomatis yang diselingi canda. Usai pertemuan, kepada METRO, Taufan Gama Simatupang mengatakan ke depan Asahan harus lebih maju dan ditandai dengan peningkatan kesejahteraan masyarakatnya. (van)

Kamis, 30 Agustus 2012

Oknum TNI Curi Sawit PTPN 3 RANTAU– Seorang oknum TNI bersama dua rekannya kepergok melakukan pencurian Tandan Buah Segar (TBS) sawit milik PTPN 3 Kebun Janji Rantauprapat, Selasa (21/8). Oknum TNI berinisial HE yang bertugas di DKI Jaya Jakarta itu berhasil ditangkap oleh Papam PTPN 3 Kebun Janji Rantauprapat yang sedang jaga malam. Informasi yang diperoleh menyebutkan, HE bersama Gugun, dan Dedek ditangkap pihak keamanan kebun. Saat itu HE sempat melarikan diri saat digelandang ke pos Papam PTPN 3 Kebun Rantauprapat itu. Namun usaha HE melarikan diri berhasil digagalkan. Ismail selaku petugas keamanan kebun mengatakan, aksi pencurian TBS milik kebun


RANTAU- Kurir sabu yang ditangkap polisi, Selasa (28/8) lalu mengaku sudah 4 kali keluar masuk Lembaga Pemasyarakatan (Lapas) kelas II A, Lobusona, Rantauprapat untuk mengambil sabu-sabu dari Bulek. Andi bisa mengambil sabu di LP Lobusona karena penjagaan di sana lemah.

„) Baca Oknum ...Hal 10

„) Baca Penjagaan ...Hal 10


„ Petugas dari Dinas Kesehatan memeriksa makanan dan obat-obatan yang dijual pihak Swalayan Indomaret.


Indomaret Tak Koordinasi ke Dinkes RANTAU- Dinas Kesehatan Labuhanbatu mengalami kesulitan dalam pengawasan makan dan obatobatan yang dijual di Indomaret, Jalan Ahmad Yani Rantauprapat. Pasalnya pihak perusahaan Indomaret tidak ada melakukan koordinasi dengan pihak Dinkes mau pun meminta izin pemeriksaan dan pengecekan makanan dan obat-obatan yang dijual. Itu dikatakan Kepala Seksi Pembinaan, Pengawasan Obat dan Makanan Dinas Kesehatan Labuhanbatu, Azrian. Menurut Azrian, pihaknya kesulitan mengecek barang-barang yang dijual pihak Indomaret.


TERBARING: Armansyah terbaring lemah di Rumah Sakit Pirngadi Medan.

Bocah 2 Tahun Derita Tumor Mata

MEDAN- Armansyah bocah berusia 2 tahun sembilan bulan, penderita tumor ganas di bagian matanya masih mendapatkan transfusi darah secara rutin. Kondisi bocah yang berdomisili di Lingkungan Temutua, Kota Pinang, Labuhanbatu Selatan itu terus menge-

2 PNS Puskesmas Sei Berombang Tersangka FOTO:AHMAD EFENDI

„ Susi korban penjambretan mendatangi Polres Labuhanbatu.

RANTAU SELATAN- Seorang warga Danau Bale, Kecamatan Rantau Selatan, Susi Rahayu (16) mendatangi Unit Propam Polres Labuhanbatu, Sabtu (18/8) lalu. Ia melaporkan Kapolsek Aek Nabara Kecamatan Bilah Hulu AKP AY Harahap karena melepaskan 2 tersangka pencurian dengan kekerasan. Kedua tersangka masing-masing, Kulal Nasution (22) dan Ucok Ritonga (18). Sebelumnya, Selasa (14/8), Susi melaporkan Kulal dan Ucok ke Polsek Aek Nabara atas kasus pencurian dan kekerasan. Itu dilakukannya sehari


„ Dedi dibantu warga membawa Ahmad naik becak bermotor untuk dibawa berobat.

setelah terjadi pencurian kekerasan terhadap dirinya, sekira pukul 17.00 WIB. Kepada METRO, Rabu (29/8) di Polres Labuhanbatu, Susi menjelaskan bahwa kejadian berawal saat dirinya sedang mengendarai sepedamotor. Tiba-tiba dirinya ditunjang oleh dua orang yang berboncengan sambil menjamberet Handphone miliknya. “Saya sedang mengendarai sepeda motor tiba-tiba ada dua orang berboncengan

KOTAPINANG- Pemeriksaan yang dilakukan tim penyidik Polres Labuhanbatu terhadap Kepala Badan Perencana Pembangunan Daerah (Bappeda) Kabupaten Labuhanbatu Selatan (Labusel) Ir Munir Tanjung di salah satu ruangan di Mapolres Labuhanbatu terkesan tertutup. Kabag Humas Polres Labuhanbatu AKP MT Aritonang, Rabu (29/8) mengatakan, dirinya kurang tahu pasti apa hasil pemeriksaan. Namun

„) Baca Kapolsek ...Hal 10

„) Baca Pemeriksaan ...Hal 10

Sahat TTak ak Dit ahan, Pr aktisi Huk um Her an Ditahan, Praktisi Hukum Heran POLISI DINILAI TAK PROFESIONAL RANTAU – Tak dilakukannya penahanan terhadap tersangka pembunuh pewaris tunggal RS Kasih Ibu Rantauprapat Sahat Tampubolon (51) membuat para peraktisi hukum di Labuhanbatu heran. Pasalnya dalam kasus ini seharusnya Sahat yang sudah ditetapkan sebagai tersangka pembunuh Martua harusnya ditahan. Seorang praktisi hukum Syahruzal Yusuf SH, Rabu (29/8) mengaku sikap yang dilakukan

pihak Mapolres Labuhanbatu mengundang keheranan. Menurutnya, dalam praktek hukum, jangankan dalam kasus pembunuhan, untuk kasus pencurian jika sudah ditetapkan sebagai tersangka semestinya dilakukan penahanan. ”Jika polisi sudah yakin dengan menetapkan seseorang sebagai tersangka, semestinya dilakukan „ Sahat

Pantesan Suami “Jarum Super” JIKA suami kecanduan rokok Jarum Super, seorang istri takkan sewot. Tapi ketika “jarum super” itu mengandung makna: jarang di rumah suka pergi, layak saja Ny Dwiyani (30) jadi nyap-nyap. Bayangkan, suami ngelayap melulu, ternyata kelonan dengan janda muda di rumah kontrakan. Coba…

„) Baca Bocah 2 Tahun ...Hal 10

Pemeriksaan KAPOLSEK AEK NABARA Kepala Bappeda DIPROPAMKAN Labusel Tertutup


„) Baca 2 PNS Puskesmas ...Hal 10

„) Baca Warga ...Hal 10

“Saat ini kata dokter masih harus menstabilkan kondisinya. Setelah itu nanti baru dilakukan langkah medis berikutnya,”ujar Sahman Sahyuti. Sementara itu Kasubbag Humas


„) Baca Indomaret ...Hal 10

RANTAU– Dua orang Pegawai Negeri Sipil (PNS) di Unit Pelayanan Teknis Daerah (UPTD) Puskesmas Sei Berombang berinisial Kaharuddin Nasution dan Sofyan dijadikan tersangka oleh Kejaksaan Negeri Rantauprapat atas kasus dugaan korupsi dana Jamkesmas dan Yankesda tahun 2008-2009 yang merugikan Negara Rp259.567.980. Kasipidsus Kejaksaan Negeri Rantauprapat Hamka Nasution, Rabu (29/8) mengatakan, meski sudah berstatus tersangka, namun kedua orang tersebut belum ditahan. Menurut Hamka saat ini kejaksaan masih terus melakukan pemeriksaan saksi-

luarkan darah dari kedua bola matanya. Hal ini diungkapkan ayah bocah penderita tumor, Sahman Sahyuti Siregar, saat ditemani di UDD PMI Cabang Medan, untuk mengambil Fresh Frozen Plasma (FFP) sel darah putih untuk anaknya, Selasa (28/8).

RANTAU- Pasangan Baliho Sutan Bhatoegana Siregar sebagai calon Gubernur Sumatera Utara tahun 2013, Ahmad (28) warga Jalan Urip Simidharjo Rantau Utara tersengat aliran listrik, Selasa (28/8). Akibatnya tangan kiri Ahmad melepuh. Pertistiwa yang menimpa Ahmad bermula pada saat Ahmad bersama seorang temanya sedang memasang Baliho Ketua DPR RI komisi

SUAMI jarang di rumah, itu pertanda lelaki sibuk. Bisa dalam karier, bisa non karier. Dalam karier misalnya, anggota DPR yang studi banding melulu, karena itu wujud pengabdian pada rakyat (katanya) yang diwakili. Tapi non karier, ini yang sering jadi bahaya latent rumahtangga. Ngakunya turba ke sana kemari, eh nggak tahunya turba dalam artian “turu bareng” bersama wanita. Nah, istri cap apa yang nggak mencak-mencak? Problem inilah yang kini tengah melilit rumahtangga Dwiyani-Andri (33), warga Kelurahan Bentiring Permai, Kecamatan Muara Bang„) Baca Pantesan ...Hal 10

„) Baca Sahat Tak Ditahan,...Hal 10

Bendahara Disdik Bantah Lakukan Pemotongan AEKKANOPAN–Bendahara di Dinas Pendidikan dan Pengajaran Kabupaten Labura Doharni br Regar membantah bahwa dirinya mengeluarkan perintah untuk memotong dana Kesejahteraan guru untuk bulan Mei dan Juni Rp750 ribu. Doharni mengaku sangat terkejut mendapat kabar bahwa ada dana Kesra guru dipotong Rp750 ribu. “Satu rupiah pun saya tidak ada menikmati pemotongan kesra itu, karena tak satupun „) Baca Bendahara ...Hal 10


30 Agustus 2012

Oknum TNI Curi Sawit PTPN 3 Sambungan Halaman 9 PTPN 3 itu terjadi di Afdeling 4. “Ditangkap di Afedling 4,” jelasnya. Ditambahkannya, setelah penangkapan oknum TNI, pihaknya selanjutnya menghubungi Markas Sub Detasemen Polisi Militer (Denpom) I/1-2 Labuhanbatu memberitahukan informasi itu. Kemudian, pihak Sub Denpom melakukan penjemputan ke pos pengamanan milik kebun. “Kita kabari ke Sub Denpom. Dan mereka yang menjemput para tersangkanya dari pos pengamanan kebun,” jelasnya. Sementara, Dedek dan Gugun diserahkan ke Mapolres Labuhanbatu. Menurut Ismail, aksi pencurian TBS di PTPN 3 sering terjadi. Komandan Sub Denpom Labuhanbatu Lettu CPM T Tambunan ketika dikonfirmasi terkait dugaan adanya oknum TNI yang terlibat pencurian tidak membantah, namun T Tambunan tak mau memberikan keterangan resmi. Alasannya, untuk konfirmasi terkait hal seperti itu merupakan kapasitas atasannya dan dirinya tidak memiliki kapasitas. “Tidak kapasitas saya menjawab konfirmasi seperti itu. Yang berwenang minimal berpangkat Kolonel. Silahkan menghubungi Siantar,” katanya. Sementara itu, Kasubbag Humas Mapolres Labuhanbatu AKP MT Aritonang membenarkan adanya dua warga sipil yang kini ditahan di Mapolres Labuhanbatu terkait aksi pencurian TBS milik PTPN 3 Kebun Rantauprapat. Aritonang menambahkan, selain itu pihaknya juga mengamankan beberapa tandan Sawit dan satu unit sepedamotor yang dijadikan sebagai barang bukti. “Benar ada dua orang yang diduga terlibat dalam aksi pencurian sawit dan seorang oknum TNI. Selain mereka juga diamankan beberapa TBS sawit dan satu unit sepedamotor milik tersangka,” jelasnya. (riz)

Indomaret Tak Koordinasi ke Dinkes Sambungan Halaman 9 “SejakberoperasinyaIndomaretAhmadYaniini belum ada koordinasi ke Dinas Kesehatan tentang barang-barang yang mereka perjual belikan. Tentunyainimembuatkitasedikitkesulitandalam melakukan pengawasan,” katanya. Sementara Pimpinan Indomaret Ahmad Yani Rantauprapat Evan Eka Yuda Butar-Butar membantah jika pihaknya telah menjual makanan kedaluarsasepertiyangtelahdiberitakansejumlah media. Katanya, konsumen yang mengaku telah membelimakanankedaluarsaitusalahpengertian dalam melihat tanggal kedaluarsa yang tertera dalam kemasan makanan. Seperti diberitakan sebelumnya, salah seorang warga menemukan makanan kedaluarsa yakni emping pedas berkemasan resmi Indomaret yang dikemas oleh Gita Snack dan dipasarkan oleh PT Indomarco Prismatama telah kedaluarsa sejak tanggal 16 Mei 2012 lalu. Terkait penemuan makanan kedaluarsa itu, petugas Dinas Kesehatan Kabupaten Labuhanbatu melakukan razia obat dan makanan yang dijual di pusat perbelanjaan Indomaret yang berlokasidiJalanAhmadYaniRantauprapat,Senin (27/8). Razia itu dilakukan terkait adanya dugaan penjualan makanan kedaluarsa di swalayan yang baru satu bulan beroperasi itu. BeberapapetugasdariDinasKesehatantampak memeriksa seluruh produk makanan dan obatobatan yang di jual di swalayan tersebut. Namun petugastidaklagimenemukanjenismakananatau pun obat-obatan yang telah kedaluarsa. “Kitasudahperiksaseluruhbarang-barangyang di jual, tapi tidak lagi menemukan adanya makanan atau obat-obatan yang kedaluarsa seperti yang diberitakan,” Azrian. Azrianmengatakan,dalamraziayangdilakukan di swalayan itu, pihaknya hanya menemukan sejumlah makanan dan minuman yang kemasannya terlihat sudah rusak. Untuk itu, pihaknya memberikan peringatan kepada pihak swalayan agar tidak lagi menjual sejumlah makanan dan minuman kemasan tersebut. “Kita hanya menemukan beberapa makanan dan minuman yang kemasannya itu tampak sudah bonyok atau rusak. Dan kita sudah berikan peringatan kepada pihak swalayan agar tidak menjual makanan dan minuman itu,” terangnya. (cr1)

Sahat Tak Ditahan, Praktisi Hukum Heran Sambungan Halaman 9 penahanan. Tapi aneh jika tidak ada penahanan,” katanya. Terpisah, Ketua Presidium Indonesia Police Watch (IPW) Neta S Pane ketika dimintai tanggapanya mengatakan dalam kasus ini kinerja polisi tidak profesional. Di samping itu, tidak ditahannya Sahat menunjukkan jika pihak kepolisian bersikap ragu-ragu dalam penetapan Sahat sebagai tersangka. Sebab menurut Neta jika polisi sudah menetapkan seseorang sebagai tersangka, maka tersangka sudah mesti ditahan. Hal itu untuk menghindari tersangka melarikan diri, mempersulit proses hukum dan juga menghindari potensi menghilangkan barang bukti. Terpisah Kabag Humas Polres Labuhanbatu AKP MT Aritonang mengatakan, pihaknya belum menahan Sahat dalam kasus dugaan pembunuhan terhadap Martua Aritonang dikarekana hingga saat ini polisi belum mendapatkan bukti yang memadai untuk melakukan penahanan terhadap tersangka. Hanya saja, sesuai dengan koordinasi pihak Kejaksaan status hukum Sahat memang sudah boleh ditingkatkan menjadi tersangka. (riz)

Penjagaan Lemah 4 Kali Lolos Ambil Sabu

Sambungan Halaman 9

Andi mengatakan bahwa selama ini Bulek merupakan narapidana di LP Lobusona yang menjadi bandar sabu-sabu. “Sejak bulan puasa hingga lebaran kemarin, sudah ada 4 kali saya ambil sabu dari si Bulek di Lapas Lobusona,” kata Andi di Polres Labuhanbatu. Kepada wartawan, Andi juga mengaku mengenal Bulek ketika sama-sama menjadi narapidana di Lapas Lobusona Rantauprapat. Di mana saat itu Andi terjerat kasus pencurian buah kelapa sawit hingga divonis 8 bulan kurungan oleh Pengadilan Negeri

Rantauprapat. Sementara Bulek, terjarat kasus narkoba jenis sabu-sabu. Di sanalah, Andi dan Bulek saling kenal hingga berteman akrab. “Aku kenal si Bulek itu di lapas. Waktu sama-sama menjadi tahanan. Dan aku baru bebas sekitar dua bulan lalu, sementara si Bulek masih di dalam,” katanya. Kata Andi, meski telah bebas dari tahanan Lapas, ia dan Bulek masih kerap berkomunikasi melalui seluler. Hingga dalam suatu pembicaraan mereka, Bulek menawari Andi untuk menjadi kurir sabu-sabu miliknya. Dengan alasan keterhimpitan ekonomi, Andi pun menerima tawaran Bulek.

“Karena aku butuh uang, makanya aku terima tawaran itu,” ungkap Andi. Andi menambahkan, dalam setiap mengantarkan sabu-sabu sampai ke tangan pembeli, Andi dibayar Bulek Rp250 ribu. Sedangkan uang hasil penjualan sabu-sabu itu ia serahkan langsung kepada Bulek di Lapas Lobusona Rantauprapat. “Uang hasil penjualan sabu itu aku berikan langsung kepada si Bulek. Dan biasanya aku digajinya Rp250 ribu setiap berhasil mengantar sabu kepada pembeli,” terangnya. Namun pengakuan Andi, ia sama sekali tidak mengenal siapa para pembeli sabu-sabu itu.

Warga Jalan Urip Tersengat Listrik Sambungan Halaman 9 VII di Jalan Jendral Ahmad Yani dengan menggunakan sebuah tangga sekitar pukul 18.30 WIB. Awalnya Ahmad dan temanya sudah hampir selesai memasang Baliho. Tiba-tiba Ahmad terjatuh ke tanah, sehingga warga yang melintas ramai mengerumuni Ahmad. Setelah beberapa menit kemudian teman

Ahmad yang dibantu warga segera melarikan Ahmad ke rumah sakit. Dedi (24) teman Ahmad saat di lokasi kejadian mengatakan, dirinya tidak tahu persis bagaimana Ahmad bisa terjatuh dan tersengat listrik. Hanya saja sebelum terjatuh Ahmad sempat berteriak minta tolong. “Saya tadi berada di bawah memegangi tangga, saya beli rokok sebentar, namun tibatiba teman saya itu terjatuh, dan tangan

kirinya terbakar terkena sengatan listrik,” ucap Dedi. Dedi menambahkan, upah untuk pemasangan baliho Rp300 ribu. “Kami diupah Rp300 ribu untuk kami berdua. Kalau kecelakaan kerja seperti ini, biaya di tanggung sendiri. Kami hanya berharap agar pemilik baliho bisa membantu biaya pengobatan teman saya,” terang Dedi. (cr2)

Pemeriksaan Kepala Bappeda Labusel Tertutup Sambungan Halaman 9 info yang diperolehnya, Munir menghadiri panggilan tersebut. Namun Aritonang mengaku belum jelas apas status Munir dipanggil polisi. “Tadi saya dengar begitu juga. Tapi kurang tahu pasti apakah benar atau tidak. Karena saya tidak melihat dia (Munir, red). Kalau ingin lebih jauhnya, coba konfirmasi ke Kanit Ekonomi saja,” kata Aritonang. Pantauan METRO, di ruangan Unit Ekonomi Mapolres Labuhanbatu tidak ditemui penyidik melakukan pemeriksaan terhadap

Munir. Namun menurut para polisi yang minta namanya jangan di korankan, Munir diperiksa di ruang kerja Kanit Ekonomi Iptu Sunarto. Terpisah, Kabag Humas Pemkab Labusel Abdul Karim menjelaskan dirinya juga mendengar perihal pemanggilan Munir. Menurut Karim, pemeriksaan Munir bukan sebagau Kepala Bappeda, namun saat Munir masih menjabat sebagai Kepala Dinas PU, Pertambangan dan Energi tahun 2009 lalu. Disinggung apa status didalam surat pemanggilan dari pihak kepolisian, Karim mengatakan kekurang paham. “Saya dengar memang mengenai penga-

daan lampu. Tapi sama-sama kita ketahui, masyarakat pun kurang menjaga aset, karena banyak lampu yang dirusakin di jalanan yang dipasang,” terangnya. Karim menambahkan, pemeriksaan terhadap Munir itu berawal dari laporan salah satu LSM di Kabupaten Labusel. “Informasi yang diperoleh, pemeriksaan dikarenakan dana yang telah dikucurkan untuk pembuatan dan pemasangan lampu hias ternyata tidak bermanfaat. Pasalnya, lampu yang telah terpasang diduga tidak sesuai dengan dokumen bahkan tidak memiliki arus, sehingga tidak bermanfaat bagi masyarakat,” kata karim. (mhr)

Bendahara Disdik Bantah Lakukan Pemotongan Sambungan Halaman 9 bendahara kecamatan yang mengaku jika mereka sudah melakukan pemotongan dana kesra menjelang lebaran kemarin,” katanya. Memang dalam sebuah ketentuan yang dilengkapi dengan petunjuk tekhnis, bagi guru yang sudah menerima gaji tambahan di luar gaji pokok tidak lagi diperbolehkan menerima insentif, tapi bukan berarti bendahara di kecamatan lantas memotong kesra itu dengan alasan untuk pengembalian insentif yang

diterima pada bulan Januari hingga Maret. “Memang bendahara Dikjar Kecamatan bodoh-bodoh semua. Mereka tidak memahami isi juknis tersebut. Padahal juknis dari pusat itu sudah saya bagikan ke sekolah masing-masing termasuk kepada Bendahara Dikjar Kecamatan. Tapi mereka tidak memahami itu. Percuma saja tiap tahun mereka mengikuti pelatihan menjadi bendahara,” katanya. Doharni menambahkan, meskipun juknis itu sudah keluar dan dibagikan kepihak

sekolah, tapi hingga kini Disdik Labura belum ada mendapat perintah semacam surat edaran apapun untuk mengembalikan dana insentif itu keasalnya. “Kalau perintah untuk mengembalikan dana insentif itu memang belum ada, tapi yang kita kwatirkan perintah itu datangnya diakhir tahun. Memang bagi guru-guru yang sudah menerima gaji tambahan di luar gaji pokok, Disdik Labura tidak lagi mencairkan insentif bulan April hingga sekarang. Sedangkan yang dibagikan kala itu hanya bulan Januari sampai Maret. (put)

KAPOLSEK AEK NABARA DIPROPAMKAN Sambungan Halaman 9 langsung menyalip kendaraan saya dan menunjang/menendang saya hingga HP BB saya hilang. Akibat kejadian itu kaki saya sampai sobek. Namun setelah saya lihat sekilas, ternyata saya mengenali si pelaku. Si pelaku masih satu kelurahan dengan saya. Kemudian saya melaporkan kejadian itu ke Polsek Aek Nabara. Setelah saya laporkan, keduanya langsung ditangkap,” katanya. Setelah kejadian itu, selang beberapa hari kemudian Susi melihat pelaku yang bernama

Kulal dan Ucok. Melihat itu Susi merasa heran, kenapa kedua tersangka yang menjambretnya tidak ditahan polisi. Susi curiga jika keduanya sengaja dilepas oleh polisi. Kerenanya Susi mendatangi Polres Labuhanbatu untuk melaporkan Kapolsek Aek Nabara ke Propam. Sementara Kapolsek Aek Nabara AKP AY Harahap melalui juru periksa Ginting mengatakan, permasalahan Kulal dan Ucok belum kuat. “Karena permasalahan itu belum kuat, maka mereka kami lepaskan. Sebab kalau belum punya bukti yang kuat kami tidak berani

menahan mereka. Itu pun penyidikan masih tetap berjalan dan rencanya dikenakan Pasal 363. Saya meminta kepada rekan wartawan jangan merekam perkataan saya, kilah Ginting sambil melaporkan perekaman kepada kapolsek. Terpisah, Kabag Humas Polres Labuhanbatu AKP MT Aritonang saat mengatakan, dirinya belum mengatahui persis pokok permasalannya. Namun jika terbukti tersangka melakukan tindakan kejahatan namun dilepas, maka ini sudah membuat malu lembaga kepolisian. (cr2)

2 PNS Puskesmas Sei Berombang Tersangka Sambungan Halaman 9 saksi yang ada. “Tersangkanya sudah kami tetapkan dan ada 2 orang dari Puskesmas Sei Berombang. Kaharuddin Nasution sebagai atasan langsung pemegang uang muka kerja dan Sofyan selaku pemegang uang muka kerja Jamkesmas dan Yankesda. Tapi keduanya belum ditahan karena masih menunggu hasil pemeriksaan lanjutan terhadap saksi-saksi, termasuk pihak Kantor Pos dan BPS,” sebut Hamka. Menurut Hamka, dari pemeriksaan penyelidikan lanjutan, mereka sudah memeriksa lima orang saksi di antaranya, Edy Tatam (bendahara), Syarifah, Parlindungan Tanjung. Hamka merincikan dari hasil perhitungan

kerugian negera oleh BPK perwakilan Sumatera Utara pada Jamkesmas 2008, dana yang dicairkan dari kas negara/daerah Rp31.350.000, sedang pengeluaran dana yang seharusnya Rp14.890.000, sehingga kerugian keuangan negara/daerah Rp16.460.000. Pada Jamkesmas 2009, dana yang dicairkan dari kas negara/daerah Rp25.900.000, sedang pengeluaran dana seharusnya Rp1 juta. Maka nilai kerugian Rp24.900.000. Pada Yankesda 2008, dana yang dicairkan dari kas negara/daerah Rp113.191.000 dan pengeluaran seharusnya Rp17.229.000 dengan nilai kerugian nagara/daerah Rp95.962.000. Serta pada Yankesda 2009, dana yang dicairkan Rp135.065.000 dan pengeluaran seharusnya Rp12.820.000, maka kerugian negara Rp122.245.980. Dengan demikian total kerugian negara khusus pada

penggunaan anggaran Jamkesmas dan Yankesda 2008-2009 Rp259.567.980. Menurut Hamka, seorang petugas Tata Usaha Puskesmas Sei Berombang bernama Afrizal menerima dana pelayanan kesehatan Rp1,1 juta, sedang yang dipertanggung jawabkan Rp5.003.000, maka pertanggung jawaban yang ada tidak sesuai Rp3.903.000. sedangkan Nurhidayah Harahap bidan PTT di Puskesmas itu menerima dana pelayanan kesehatan terhadap masyarakat Rp1 juta, namun dipertanggung jawabkan Rp6.517.000, sehingga Rp5.517.000 tidak sesuai pertanggungjawaban. Demikian dengan Surya Junita yang juga bidan PTT di Puskesmas tersebut, hanya menerima Rp250.000, tetapi dipertanggung jawabkan Rp7.713.000, maka Rp7.463.000 tidak sesuai dengan pertanggung jawabannya. (riz)

Karena para pembeli itu berhubungan langsung dengan Bulek, yang masih berada di tahanan Lapas Lobusona. “Aku tidak kenal dengan para pembeli itu. Karena biasanya, aku di telepon Bulek dan disuruh ambil barang (sabu-sabu-red) di lapas. Selanjutnya aku disuruh ngantar barang itu ke pembeli yang nomor Hp nya sudah disiapkan. Jadi aku tidak kenal siapa-siapa pembelinya,” jelasnya. Sementara Kasat Narkoba Polres Labuhanbatu AKP Sugeng mengatakan pihaknya masih melakukan penyelidikan terkait kasus tersebut. “Tindak lanjutnya masih dalam penyelidikan kita,” ujarnya. (ing)

Bocah 2 Tahun Derita Tumor Mata Sambungan Halaman 9 RSUP H Adam Malik Medan, Sairi Saragih saat dikonfirmasi mengatakan jika kondisi Armansyah masih lemah. Kini, bilang Sairi, Armansyah ditangani oleh Dokter Anak Hematologi. “Dari diagnosa awal tim medis, Armansyah mengalami tumor pada bagian matanya. Untuk langkah medis yang telah dilakukan, yakni pemberian obat-obatan, infus, serta pemberian formula gizi yang tinggi yakni M75. Ini dilakukan untuk memperbaiki kondisinya yang lemah,”terang Sairi. Menurut Sairi, saat ini Armansyah masih dapat mengkonsumsi makanan secara oral tanpa dibantu selang. Dalam kesempatan yang sama, karyawan PT XL Axiata Tbk Grha XL Medan memberikan bentuk kepedulian terhadap bocah penderita tumor di mata. Melalui Managemen Service Regional West XL, Bambang Badra T, menyalurkan secara langsung bantuan berupa uang kepada orangtua penderita di ruang Rindu B IV Anak, RSUP H Adam Malik, tempat Armansyah mendapatkan perawatan. “Setelah membaca kisah bocah penderita tumor di media, kita merasa empati sehingga secara spontan mengumpulkan uang dari seluruh karyawan kita. Selain itu juga kita menambahkannya dari anggaran company,”sebutnya. Meskipun tidak menjelaskan jumlah bantuan yang diberikan, namun Bambang mengaku bantuan diberikan untuk membantu meringankan beban kedua orangtua bocah penderita tumor. Selain bantuan dari XL, Ketua PMI Medan Cabang Medan, Musa Rajeck Shah juga memberikan kepedulian atas penderitaan sang bocah. Bentuk bantuan yang berikan yakni menanggung seluruh beban biaya darah yang dibutuhkan sang bocah. “Untuk seluruh keperluan darah bocah penderita tumor ini akan kita upayakan untuk menyediakannya tanpa mengutip biaya dari mereka,”ucap Musa Rajeck Shah melalui Pjs Unit Donor Darah (UDD) PMI Cabang Medan, Dr Barbara saat ditemui di UDD PMI Cabang Medan, Jalan HM Said Medan. Armansyah merupakan anak pasangan, Sahmansyah Yuti Siregar (23) dan Selvinaria Siahaan (25) Pengakuan Sahmansyah, ayah kandung sang bocah, berawal sekitar satu bulan lalu atau tepatnya pada awal Ramadan. Saat itu muncul tanda kebiru-biruan di sekitar bola matanya. Agar tidak semakin parah Sahmansyah selanjutnya membawa sang buah hati ke spesialis mata di Labusel dan RS di Rantauparapat. “Di RS Rantauprapat itulah anakku divonis menderita tumor syaraf. Karena fasilitas medis rumah sakit tersebut tidak bisa menangani tumor, anakku dirujuk ke sini,” kenang Sahmansyah. Perasaan haru saat General Manager West Region XL, Bambang Badra T tak mampu menahan tangis ketika melihat langsung kondisi miris sang bocah. Tak banyak yang bisa dikatakannya. Bahkan saat memberikan keterangan kepada wartawan koran ini, Bambang juga tak bisa menyimpan perasaan haru dan sedih dalam dirinya. “Harapan kita saat ini sang bocah bisa sembuh dan keluarga bisa diberikan kekuatan untuk sabar menghadapi cobaan ini,”ujarnya. (ing)

Pantesan Suami “Jarum Super” Sambungan Halaman 9 kahulu, Bengkulu. Meski mereka sudah berkoalisi sekian lama, tapi masih juga belum satu visi dalam kehidupan rumah tangga. Maunya istri, sepulang kerja Andri langsung pulang bersatu dalam keluarga. Tapi sebagai keluarga muda, Andri tak mau diatur-atur seperti itu. Maka biasanya, habis kerja masih kelayapan ke mana-mana, sehingga tiba di rumah sudah malam. Bagi Dwiyani, sepanjang kepergiannya itu ada nilai margin (untung) untuk ekonomi keluarga, nggak masalah. Tapi yang terjadi, gaya hura-hura Andri yang suka kumpulkumpul dengan kelompoknya ini justru

berdampak pembengkakan anggaran. Karena gaji yang mestinya dibawa ke rumah, sering dipakai buat mentraktir teman-teman. Mending kalau gajinya gede, wong buat makan sehari-hari saja pas-pasan. Karena kelakuan yang demikian, Dwiyanti jadi kesal deh sama suami. Maka kemudian yang sering terjadi, begitu suami tiba di rumah sekitar pukul 21.00 WIB, langsung diberi kuliah tujuh menit yang isinya berupa omelan dan gerutuan. Tentu saja minum dan makannya Andri jadi tak pernah nyaman, rasanya seret macam makan kue bolu tanpa minum! Nyaris setiap hari dapat “kultum” non Aak Gym, Andri sampai pada sebuah wacana

bahwa koalisi ini harus diakhiri. Dia berniat menceraikan istrinya. Maka kepada kiai setempat, secara agama talak itu dijatuhkan. Maka sejak itu, meski satu rumah, Andri sudah tidak lagi tidur seranjang dengan istrinya. Dan sejak itupula, dia semakin jarang pulang, menjelma menjadi lelaki “Jarum Super” tanpa bandrol. Karena sudah talak agama, mestinya Dwiyani tak perlu berharap banyak akan perginya suami. Tapi dia beranggapan lain, selama masih tinggal di rumahnya, tanggungjawab sebagai kepala rumah tangga harus ada. Soal jaminan onderdil, dia bisa memaklumi. Tapi jaminan material kok tibatiba juga berhenti, wah nanti dulu…

Diam-diam Dwiyani mengadakan penyelidikan, hasilnya ternyata: Andri sudah punya WIL baru, sehingga kini Andri lebih banyak ngendon di rumah kontrakan sang gendakan. Buru-buru dia lapor polisi dan diadakan penggerebekan di rumah kontrakan di Jalan WR Supratman Kelurahan Bentiring. Dugaan benar, Andri ditemukan di situ bersama janda muda. Meski dalam kondisi tidak berbuat, keduanya pun digelandang ke Polsek Muara Bengkulu. Dalam pemeriksaan, Andri mengaku bahwa sudah cerai agama, hanya belum didafarkan ke Pengadilan Agama saja. Dengan WIL sudah kawin agama, belum? (pk/int)


30 Agustus 2012

Bayi Prematur Tewas Digigit Tikus CHENNAI - Bukannya berbahagia menyambut kelahiran bayi mereka sepasang suami istri di Chennai, India justru dipaksa menghadapi kenyataan pahit. Bagaimana tidak, pasangan ini mendapati bayi mereka tewas akibat hal yang sama sekali tak wajar. Bayi yang lahir secara prematur itu kabarnya tewas di dalam inkubator. Pasangan suami istri itu pun menuding bayi mereka tewas karena digigit tikus, Rabu (29/8). Akibat insiden ini dua dokter dan tujuh perawat di rumah sakit itu kabarnya diberhentikan karena dinilai melakukan kelalaian. Tidak hanya kedua orang tua bayi malang itu namun warga Chennai pun dilaporkan marah

menanggapi insiden memilukan ini. Bahkan akibat insiden ini Kementerian Negara India pun sampai turun tangan untuk mencari solusi atas masalah tersebut demi meredam kemarahan massa. Kabar lain menyebutkan bayi tersebut telah tewas. Namun jasadnya dibiarkan berada semalaman di rumah sakit sebelum diserahkan kepada anggota keluaga keesokan harinya. Sementara itu, pihak rumah sakit dikabarkan segera menempuh langkah-langkah cepat untuk mensterilkan kawasan itu dari ular dan tikus yang kabarnya kerap berkeliaran. Untuk melaksanakan langkah ini pihak rumah sakit pun melibatkan para pemburu ular.(oz/ nik)

„ Illustrasi

Ribut dengan Ayam

Perempuan Ini Alami Gagal Jantung AMMAN - Seorang perempuan di Yordania dilaporkan menderita gagal jantung, setelah sempat bersitegang dengan ayam-ayam peliharaannya. Perempuan berusia 40 tahun itu kabarnya kesal karena ayam-ayam miliknya, menolak makan pakan ternak yang baru saja ia beli. Ayam-ayam tersebut memilih berlari-lari ke kebun belakang

rumah ketika perempuan itu meletakkan pakan ternak di hadapan mereka. Tidak tahan melihat ulah ayam-ayamnya, perempuan itu pun mengurung mereka di kandang dan melem-

parkan pakan ternaknya begitu saja. ”Namun, mereka masih tidak mau makan. Ia kemudian marah dan kembali ke kandang untuk memaksa mereka makan dengan memegang kepala mereka dan memaksa memasukkan makanan ke mulut mereka,” tulis sejumlah media, Selasa (28/8). ”Ayam-ayam tersebut menyem-

burkan makanan yang dimasukkan dengan paksa . Lalu perempuan itu bergegas masuk ke dalam rumah dan ia merasa sulit bernapas namun ia masih sempat ke dokter sebelum akhirnya menghembuskan napas terakhir,” sebutnya. Para tetangga menggambarkan perempuan itu, sebagai sosok yang memiliki emosi buruk.(oz/nik)

Sepedamotor Berbahan Bakar Kotoran Hewan

„ Illustrasi PELUNCURAN: Sepedamotor yang berbahan kotoran hewan diluncurkan. TOKYOPembuat toilet terkemuka Jepang, Toto, Rabu (29/ 8) meluncurkan sepeda motor

poop-powered yang bisa berjalan sejauh 300 kilometer, dengan tanki bahan bakar disi dengan kotoran



Avanza Inova Rush Yaris

• Carry P.Up FD Dp. 15Jt • APV P.Up Dp. 20,5Jt • APV Arena Dp. 23Jt • Ertiga Dp. 40Jt Tersedia : Swift, Splash, Gran Vitara, SX4 Hub : 0853 7003 2838

Angs 3 Jt-an Angs 4,5 Jt-an Angs 4,5 Jt-an Angs 4,4 Jt-an -Stock ReadyInfo:0811 6152 000; 0853 6058 2000


Dp Dp Dp Dp Dp

25 25 25 20 25

%, %, %, %, %,

angsuran angsuran angsuran angsuran angsuran

2 3 3 2 3

Jt-an Jt-an Jt-an Jt-an Jt-an

Proses cepat data dijemput

Hub: L. Rivai Sembiring 0812 6457 0000 AUTO 2000 KISARAN PROMO LEBARAN Dp 15%, AVANZA, VELOZ, INOVA, FORTUNER, YARIS, RUSH, Angsuran Ringan. Info Hubungi: 0821 6300 6266; 0821 6078 3848 Mitsubishi Ready Stock: Pajero Sport, Outlander Sport, Mirage, Strada Triton, Lancer, (Chasis, Box, Tangki, Bus, Dump Truck Colt Diesel & Fuso, Pick Up & Minibus L300 & T120ss), Pesan Segera Hubungi DONI: 0813 6224 2904 ; 0852 6130 5040


• Carry Pick Up Dp. 15,7Jt Angs 2Jt • APV Mega Carry Pick Up Dp. 23Jt angs 2Jt • APV Dp. 29Jt angs 3Jt • Ertiga Dp. 35Jt angs 3Jt • Swift Dp. 35Jt angs 4Jt • SX4 Dp. 40Jt angs 4Jt • Grand Vitara Dp. 70Jt angs 5Jt Proses Cepat, Angsuran Ringan dan data bisa dijemput. Hub: Ardi Oslan Lubis 0812 6582 0292 DI JUAL: 1 Unit Mobil Terios Thn

2009 = Rp. 145 Jt. - Terios Thn 2010 Rp. 152 Jt - Kijang Inova Thn 2006 Rp. 150 Jt. Hub :

Joni Sembiring 0852 7079 3458


Pajero Sport,Triton, Colt Diesel Dump Truck, Chasis, L-300, & Colt T120SS PickUp. DP 11% atau bunga mulai 0%. Hub: UNAS 0813 6333 3000

hewan. Sebagaimana dilanris kantor berita AFP, Rabu, Toto mengklaim

hasil produksinya ini sebgai kendaraan dengan bahan bakar kotoran hewan yang pertama di dunia. Sepeda motor atau kendaraan dengan tiga roda ini memiliki toilet sebagai tempat duduk pengemudinya dan sebuah kertas pembersih toilet ukuran besar di bagian belakang kendaraan. Dengan seorang perempuan cantik dan muda duduk di atas kendaraan ini dalam tes mengemudia hari Rabu, raksasa produsen toilet terkemuka Toto segera menegaskan bahwa perempuan tadi bukan yang memproduksi “bahan bakar” bagi sepeda motor itu. “Biogas yang dipakai sebagai bahan bakar sepeda motor ini tidak berasal dari kotoran manusia. Biogas ini dibuat dari kotoran ternak dan limbah cair,” ujar Kenji Fujita, juru bicara Toto dalam jumpa pers di pinggiran Tokyo, Jepang. “Kami berharap produk ini menambah kesadaran di antara para pelanggan soal kampanye hijau melalui pengembangan produk yang ramah lingkungan, sebagaimana pemancur yang hemat air dan toilet yang hemat air,” tuturnya. Namun demikian, pihak Toto menegaskan, mereka tidak akan membuat sepeda motor untuk dijual secara komersial. Paling tidak, belum ada rencana ke sana. (kps/nik)

NEW NISSAN: Grand Livina, Juke, X-Trail. Navara, Murano. Ready Stock, cash/credit.

SYUSUF PONSEL 4 Pusat Servis Handphone bergaransi dan Cuci photo dengan kualitas terbaik. Jl. M.Yamin Simp. Kedai Ledang Kisaran.


CASH & CREDIT ELEKTRONIK FURNITURE, Proses cepat syarat ringan.

Hub: Mili 0852 7033 7739

Hitam tahun 2008. Body/ Mesin mulus.Hub 0813 7015 5910; 0813 6163 1463 E XCELCISE


Lembaga kursus pelatihan Komputer. Kami melayani dan menerima murid baru serta menerima ketikan surat , kantor, pengetikan skripsi, majalah, proposal & surat lainnya. Kunjungi alamat kami : Jl. Malik Ibrahim No. 27 Kisaran. HP: 0813 6112 9333 ; 0812 6053 8000

GL OB AL COMPUTER GLOB OBAL Menjual : Laptop, Komputer, Accessories & Service Komputer, ATK, Kamera digital, Ipad / Tablet –PC, Belangko Undangan, Lion, Kertas HVS secara ecer dan grosir, juga melayani Cash & Credit. Alamat : Jl.Imam Bonjol No.149 Kisaran, Dpn Hotel Wisata.Tlp : 0623 41353

DIJU AL: Tanah kapling uk 6x12M, harga DIJUAL:

mulai 35jt-an, bisa nego. Lokasi strategus sebelah kolam renang Wahyu. Hub alamat: Kolam Renang Wahyu, Jl. St. Alisyah Bana, dengan Bpk IRWAN EDWIN (Buyung) Hp: 0813 7596 2988 *Juga menerima pelatihan renang yg diasuh olh Pelatih bersertifikat & berpengalaman.

Membutuhkan : Tenaga Marketing. Hub : Ir Salam , Interyasa Mitra Mandiri, Alamat : Jl. M. Ibrahim No. 25 Kisaran, Hp : 0812 6390 1055 B ATIKIT A A CCESSORIES TIKITA ACCESSORIES Menjual aneka pakaian batik, Tas batik, Kaos, Sabun Herbal, mainan kunci dan accessories lainnya. Dapat kan produknya di: Jl.SM.Raja No. 35 B, Kisaran. Dekat Rel BAKSO MONAS Menyediakan menu bakso Gong, Bakso kaget & Mie Ayam herbal. NB: Bukan makan tepung tetapi bakso daging, Dilayani karyawan dari kraton Solo, Halal, Bersih, Nikmat dan Ramah. Alamat : Jl. Merpati Simp. Gambir Baru Kisaran. KA.

PURI COLLECTION Menjual : Berbagai macam pakaian, Pria dewasa, celana & baju perempuan, pakaian remaja anak-anak, dan Accessories lainnya seperti Dompet, tas Dll. Kunjungi alamat kami : Jl. Ir Sutami No.17 Dekat KFC Simp Bunut Kisaran.

„ Illustrasi

Si Kembar Anorexia Akhirnya Tewas dalam Kebakaran MELBOURNE - Memiliki bentuk tubuh yang ideal adalah impian besar setiap wanita. Langsing dan proposional menjadi salah satu tujuan mereka. Untuk mencapai itu semua, banyak dari wanita yang terobsesi untuk menjadi kurus hingga menyebabkan mereka mengidap anoreksia. Gambaran seorang wanita yang diharuskan memiliki bentuk badan kurus dan langsing menjadi patokan sendiri bagi banyak wanita di dunia ini. Karena itulah, mereka berlomba-lomba untuk melakukan diet ketat demi mendapatkan predikat cantik dengan bentuk tubuh ideal. Hal ini juga terjadi pada kembar identik yang terkenal karena anoreksia, Clare dan Rachel Wallmeyer. Baru-baru ini mereka ditemui tewas akibat kebakaran di rumahnya. Sepasang kembar identik ini menjadi terkenal melalui pertempuran mereka melawan anoreksia yang diidapnya. Clare dan Rachel Wallmeyer yang sama-sama berusia 42 tahun tewas pada kebakaran yang terjadi di rumah mereka di Geelong, dekat Melbourne, salah satu dari mereka mengalami luka bakar yang parah dalam perjalanan ke rumah sakit, Rabu (29/8). Itulah akhir tragis untuk dua kehidupan yang bergolak demi meraih sosok cantik dengan bentuk tubuh impian semua wanita. Meski selama hidupnya mereka berjuang melawan itu tapi kepergian mereka yang tragis menyentuh hati semua orang di seluruh dunia.

TV Australia beberapa kali berbicara mengenai anoreksia yang telah berubah menjadi suatu habitat bagi remaja sekarang ini dan ini menjadi masalah serius bagi orangtua mereka. Dalam cerita pedih kehidupan Clare dan Rachel selama hidupnya, mereka mengatakan dalam beberapa tahun terakhir tidak pernah jatuh cinta, tidak pernah punya pekerjaan dan mereka percaya hanya soal menunggu waktu sebelum mereka meninggal bersama-sama. Kematian mereka dalam kebakaran tersebut diyakini tidak disengaja, menurut Detektif dari Unit Investigasi Kejahatan Geelong. Dalam wawancaranya dengan salah satu stasiun televisi Australia yang berjudul Australia’s 60 Minutes belum lama ini, mereka mengungkap awal mereka mengidap anoreksia. “Di masa pertumbuhan kami mulai merasakan cerminan wanita cantik itu langsing dan kurus, sehingga, entah bagaimana, kami mulai tidak makan apapun, mungkin hanya melon saja,” ungkap Claire. “Dan kami hanya meminum Diet Coke dan kopi,” imbuh Rachel yang juga mengaku meminum 20 obat pencahar setiap harinya. Rachel bahkan mengungkapkan, satu-satunya orang yang berada di sisinya selama ini hanyalah saudara kembarnya. “Setidaknya kami akan meninggal bersama. Berada di sebelah Rachel membuat semuanya mudah untuk meninggal,” jelas Claire.(oz/nik)

„ Illustrasi

BUTUH DANA TUNAI? Satu jam cair bawa BPKB sepeda motor anda ke: UD.JAYA MOTOR AEK LOBA Jl. Cokroaminoto Samp.SPBU kisaran,juga melayani Cash & Kredit Sepeda Motor Bekas. Hub: Hermanto: 0813 7633 2981; 0812 6295 222


BUTUH DANA TUNAI? Satu jam cair bawa BPKB Sepeda Motor anda ke : “SUMBER MOTOR” Jln. Lintas Sumatera ,SENTANG – KISARAN. HUB: WILLY 085373436668 ; Mis WATI 082161955500. * Persyaratan Ringan *

Menyediakan Nasi campur, Aneka Juice, Ikan Goreng,Ikan Bakar Dll. Jl. Gatot Subroto / Jl. Lintas Sumatera No.205 Sentang Kisaran.


Pengobatan mata herbal seperti : katarak, min plus, gloukoma, silinder, mata merah,berlemak, dll. Lemah syahwat, ambeyen, diabetes. Alamat Jl. Mas Mansyur No.65 Kisaran. Hub: Mr Mohan 0813 6613 7952 COL UMBIA CASH & CREDIT COLUMBIA Dibutuhkan segera : Tenaga Marketing & Kolektor TF. Fasilitas Mobil kerja, uang makan 8000 s/d 15000. Gaji pokok 350.000 s/d 1 Juta, komisi 4 % s/ d 8 % + intensif. Alamat : Jl. Cokroaminoto Kisaran & JL. Koptu Mahmun Lubis Aek Kanopan Tlp . 0623 44260




Menyediakan : Menu Ikan Lele, Ikan Mas, Mujair, Gurami, Nasi Uduk, Ayam Kampung & Bebek goreng, serta aneka Juice. Kunjungi Alamat kami :Jl. A. Yani Simp.Tg. Alam Kisaran


PINK’S FL ORIST FLORIST Menyediakan berbagai jenis parsel Lebaran dengan harga mulai Rp.55.000. Alamat Jl. Imam Bonjol No.104, Tlp.0623-44272 Kisaran. Hub: Natalisa 0812 6286 776

SEHAT SERVICE Melayani: Doorsmeer, Ganti Oli, Pispot, Balancing Ban, Tubless, Angin, Hidrogen, Ban luar, Radial. Jl. A Yani No. 6/8 Kisaran

RUMAH SEHAT CINTA KASIH Memberikan pelayanaan GRATIS!! Cek tensi darah & jantung serta Foot Therapy GRATIS! Tersedia susu ajaib bisa mengobati penyakit jantung, maag, darah tinggi, kolestrol, diabtes, asam urat, dll. Hub : Acong 08216 5158 899 – 0877 4954 1228. Jl. Imam Bonjol Dekat tugu Kisaran


30 Agustus 2012


ejak berpisah dengan Ahmad Dhani, Maia Estianty kini belum mendapat pasangan baru. Pendiri Duo Ratu tersebut sepertinya sudah pasrah tidak mendapatkan jodoh. ”Sama seperti anak-anak aku enggak pernah mengharapkan mereka dateng,

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober) Peruntungan: Keruwetan mulai teratasi namun mungkin akan muncul yang baru, untuk itu jangan mudah percaya dengan omongan orang. Berjalanlah dengan prinsip Anda sendiri dan hiduplah yang sederhana. Asmara: Hadapilah tantangan kecil dengan hati yang besar dan lapang dada, jangan cepat menyerah.


udah pasrah,” kata Maia saat ditemui di Episentrum Kuningan Jakarta Selatan, Selasa (28/8) malam. Maia menyatakan kini dirinya tidak terlalu agresif untuk menjadi jodoh. Ia menyatakan, dirinya tidak pernah mencari jodoh. ”Anak-anak begitu udah enggak saya harapkan tiba-tiba datang.

Sama seperti jodoh saya enggak perlu cari nanti datang sendiri lah,” jelas Maia. Maia mengaku bahwa dirinya banyak didekatin cowok. “Yang deket banyak, tapi untuk jadi pasangan belum lah, saya belum mikirkan pasangan,” kata ungkapnya.(abu/ jpnn)

PERJALANAN asmara Pinkan Mambo penuh liku. Hubungannya bersama Febriyanto Wijaya, pemain sepak bola asal Mamuju, Sulawesi Selatan, telah kandas. Ia pun harus menerima kenyataan pahit itu karena terbentur perbedaan. “Aku sudah putus ya. Sekitar dua bulanan lalu. Ya begitulah, memang enggak mudah mencari orang yang benar-benar. Intinya banyak perbedaan,” ucapnya, saat ditemui di Studio Guet, Perdatam, Pancoran, Jakarta Selatan. Hubungan Pinkan dan Febriyanto sudah tak bisa lagi diselamatkan. Keduanya sulit menyatukan visi ke depan. Masing-masing punya tujuan berbeda. Sehingga, keputusan untuk berpisah merupakan jalan keluar satu-satunya. Harapannya untuk membina rumahtangga buyar. “Misalnya, gol aku ke mana, dia ke mana. Jadi,

enggak ketemu. Aku enggak bisa menjelaskan ke media. Tapi aku tentu punya pertimbangan. Aku tahu mana yang baik dan tidak. Tapi aku enggak bilang kalau dia enggak baik ya,” ucapnya. Kesedihan pun meliputinya. Namun, ia tidak mau terlalu lama larut dalam perasaan tersebut. Baginya, pengalaman asmaranya bersama Febriyanto membuatnya banyak belajar untuk menata kembali kehidupannya di masa depan. Sebagai manusia, penyanyi kelahiran Jakarta, 11 November 1980 itu, hanya bisa berencana, tetapi Tuhan punya kehendaknya sendiri. “Aku tambah belajar dari pengalaman. Aku memutuskan dengan kekuatan aku sebagai manusia. Ketika aku sudah tahu mana yang baik dan enggak, kembalikan lagi kepada Tuhan. Kalau jodoh enggak ke mana-mana,” tandasnya. (tr/int)

(21 Desember -19 Januari)

Kesempatan untuk menanjak ke atas semakin terbuka, tinggal tergantung bagaimana cara Anda bersosialisasi dengan rekan-rekan kerja sehingga tidak muncul permusuhan yang akhirnya hanya akan menghambat laju karir Anda saja. Asmara: Cekcok mulut tak akan menyelesaikan masalah, justru akan semakin memperumit saja.


(20 Januari - 18 Februari)

Peruntungan: Emosi yang labil hendaknya bisa diberi perhatian serius. Jangan sampai kesuksesan yang telah berada di depan mata hilang begitu saja hanya karena sikap Anda yang kurang bisa sabar dalam menghadapi berbagai macam omongan yang memanaskan hati. Asmara: Carilah jalan keluar dalam menghadapi masalah cinta yang memang sedang Anda hadapi ini.


19 Februari - 20 Maret

Peruntungan: Egoisme dan rendah diri itu tidak ada untungnya, untuk itu alangkah baiknya disisihkan saja. Kalau dibiarkan berjalan terus yang rugi bukan orang lain tetapi diri Anda sendiri. Asmara: Untuk lebih baiknya cinta memang tidak lantas tutup mata dan telinga, saran masuk mesti diterima dengan baik.


(21 Maret - 20 April)

Peruntungan: Isu di hari ini sangat merugikan padahal kebenarannya sudah jelas disangsikan. Semua itu hadapilah dengan hati yang lapang dan kepala dingin. Anggaplah semua ini merupakan ujian untuk meraih jenjang yang lebih tinggi. Asmara: Hindarilah pertikaian yang hanya akan memperburuk suasana dan ketenangan saja.


(21 April - 20 Mei)

Peruntungan: Di hari ini perjalanan perbintangan Anda cukup bagus, walau banyak persoalan timbul tenggelam, namun semuanya bisa teratasi dengan baik. Tetaplah optimis, apalagi simpati orang lain terhadap Anda cukup besar sehingga Anda harus bisa lebih percaya diri dan yakin dengan apa yang telah menjadi keputusan Anda. Asmara: Anda harus puas dengan apa yang selama ini dia berikan pada diri Anda.


(21 Mei - 20 Juni)

Peruntungan: Berhati-hatilah dalam melangkah sebab jika Anda salah dalam melangkahkan kaki maka bisa berakibat fatal. Bintang Anda cukup bersinar terang hanya saja ada ombak yang datang menghantam Anda, jika hati-hati maka Anda akan selamat. Asmara: Anda sedang mengalami gelombang pasang yang hebat. Cobalah Anda mengerti dengan sikap yang Anda lakukan dengan memberi kepercayaan tanpa perlu mendiktenya, seperti yang selama ini Anda lakukan.


NIKITA Mirzani senang dicaci maki masyarakat karena sering berpose vulgar. Baginya, hujatan tersebut malah memotivasi untuk berpose lebih menantang lagi. ”Niki nggak merasa terganggu dengan banyak orang komplain. Malah senang, malah jadi motivasi Niki untuk menjadi lebih untuk mempunyai foto yang bagus lagi dari foto yang lalu,” ungkap Nikita di Tebet, Jakarta Selatan. Menurut janda beranak satu ini, selama terjun ke dunia hiburan, ia tak pernah foto-foto yang berbau pornografi. ”Jadi nggak ada joroknya atau pornografinya. Karena di situ nggak ada angel foto yang mengangkang atau apa segala macam,” tegasnya. ”Foto Niki nggak ada yang hot. Mungkin lihatnya di sebelah kompor atau orang yang nabun api,” imbuhnya dalam nada canda. (idc/int)

(21 Juni- 20 Juli)

Peruntungan: Pengaruh serta kewibawaan Anda sangat menentukan bagi keadaan sekitar. Hindari rasa kurang percaya diri sebab pada hakikatnya hal ini hanya akan merugikan saja. Jangan terpancing dengan omongan-omongan, semua itu hanya akan menghalangi langkah Anda ke depan. Asmara: Bersikaplah terbuka dengan pasangan Anda sehingga bisa terhindarkan dari segala fitnah dan omongan yang tidak benar.


(21 Juli-21 Agustus)

Peruntungan: Lakukan terobosanterobosan penting di hari ini karena memang sudah waktunya dan cukup ada peluang untuk maju. Bintang Anda lagi bagus dan cukup membawa kemujuran. Karir: Cukup banyak halangan yang harus dihindari, bersabarlah. Asmara: Dengarkan saja setiap kata-katanya agar tidak selalu timbul cekcok mulut.


(23 Agustus-22 September)

.Peruntungan: Jangan ragu untuk menolak kalau itu memang tidak sesuai dengan hati Anda. Buat apa Anda pertahankan kalau akhirnya di kemudian hari hanya akan membikin pusing Anda saja? Asmara: Jangan malas untuk bertemu dengannya, minimal menelponnya jika memang tidak ada waktu.


(23 Oktober - 22 November)

Peruntungan: Inisiatif dan ide-ide cemerlang Anda tampaknya sangat diperlukan dalam setiap langkah. Walau begitu konsultasi dengan pihakpihak yang lebih berpengalaman tampaknya perlu juga. Asmara: Jangan begitu mudahnya termakan isu yang sengaja disebar olehnya.


( 23 November - 20 Desember)

Peruntungan: Jangan suka menunda pekerjaan karena bila menumpuk akan menimbulkan kebosanan. Di hari ini cobalah bekerja sepraktis mungkin sehingga kejenuhan yang sudah di ambang batas itu tidak sampai menambah pusing. Asmara: Hati boleh panas akan tetapi pikiran harus tetap dingin, dengan begitu walaupun amarah memuncak hubungan percintaan Anda tetap aman-aman saja. (int)

EMMA Stone hancur saat patah hati. Wah, karena ulah Andrew Garfield kah? Mengutip femalefirst, aktris Easy A yang saat ini masih berkencan aktor Inggris, Andrew Garfiel merasa hancur saat harus berurusan dengan retaknya hubungan kekasih. “Saya merangkak di lantai dan muntah. Saya merasa hancur dan terbunuh, namun tetap

harus menjalani hidup,” terang Emma. Emma yang saat ini tak bermasalah Andrew, justru mengaku merasa dekat dengan aktor Ryan Gosling, lawan mainnya dalam Crazy, Stupid, Love “Saya merasa nyaman, mungkin karena apa yang dipikirkannya, sama seperti apa yang saya pikirkan,” tutur Emma. (int)

Selena Gomez membeli rumah seharga US$2,9 juta atau Rp27,55 miliar di Jonah Hill di Los Angeles. Seperti dikutip Femelfirs, rumah dengan luas 4.650 kaki persegi itu memiliki lima kamar tidur, enam kamar mandi, kolam renang, lapangan tennis dan spa. Meski rumah itu dibeli dari uangnya sendiri, namun bukan berarti kekasihnya, justin Bieber, bisa seenaknya tinggal di rumah tersebut. ”Aku bahagia dengannya. Tapi aku baru 20, dan belum berani serius dalam kehidupan pribadi. Aku bersyukur memiliki teman dan tim solid yang mencintaiku,” kata Selena. ”Pernikahan dan semua hal lain aku pikir akan terjadi setelah aku merasa telah mencapai dalam setiap aspek lain dari kehidupanku,” katanya. (idc/int)

12 KAMIS 30 AGUSTUS 2012

Cara Mendeteksi Penyakit dari Tubuh Wanita Salah satu dari banyak hal indah tentang tubuh Anda adalah, tubuh memiliki sensor penyakit yang sudah tertanam. Para ahli mengatakan, Anda bisa melihat tanda-tanda peringatan dini bahkan kondisi serius hanya dengan memperhatikan secara seksama tubuh Anda di depan cermin. Jadi silakan, lihatlah lebih dekat. KUKU Jika Anda melihat garis-garis gelap di bawah kuku Tahi lalat berukuran besar bukan satusatunya pertanda kanker kulit — penyakit ini juga dapat berkembang di bawah kuku. Garis-garis berwarna kekuningan, coklat, atau hitam adalah tanda dari kerusakan sel, mungkin akibat melanoma (bentuk kanker kulit paling mematikan), ujar Ariel Ostad, M.D., dermatolog di New York City. Dengan deteksi dini dan pengobatan, sekitar 95 persen kasus dapat disembuhkan, sehingga segera temui dokter kulit jika menemukan gejala tersebut. Jika Anda melihat garisgaris putih terang Semua orang sering mengalami bintik-bintik putih pada kuku mereka (biasanya itu tanda bahwa jari Anda terjepit di laci), tetapi jika Anda melihat perubahan warna dengan garis panjang horizontal pada permukaan kuku dan Anda merasa lelah akhir-akhir ini, itu bisa menjadi berita buruk tentang ginjal. "Garis-garis tersebut mungkin adalah tanda bahwa ginjal tidak dapat menyaring protein agar tidak keluar dari air seni Anda," kata Ostad. Itu berarti tubuh Anda kehilangan protein lebih cepat daripada yang Anda konusmsi — dan hal tersebut dapat menyebabkan gagal ginjal. Kunjungi dokter Anda secepatnya untuk tes urin. KETIAK Jika Anda melihat sebuah bagian kulit kasar dan gelap Apakah Anda baru pergi ke laut untuk berjemur? Jika tidak, gejala seperti ini berarti Anda kemungkinan mengalami diabetes, ujar Michael Smith, M.D., pemimpin redaksi medis WebMD. Kelebihan insulin dalam aliran darah dapat menyebabkan sel kulit untuk bertambah dengan cepat secara abnormal, menyebabkan penumpukan jaringan dan melanin.

Hal ini membuat kulit terlihat lebih gelap dan terasa lebih tebal. "Ini paling sering terjadi di ketiak, leher, atau selangkangan," kata Smith. Sebuah tes darah sederhana dapat menentukan apakah Anda menderita penyakit tersebut atau tidak, yang terjadi pada sekitar 24 juta orang Amerika — hampir seperempat dari mereka tidak terdiagnosis. KELOPAK MATA, SIKU, LUTUT Jika Anda melihat benjolan kecil, lembut yang terlihat putih atau mengilap Berita baiknya: Ini bukan jerawat. Berita buruknya: Ini adalah simpanan kecil dari kolesterol, ujar Smith. Sayangnya, "pada saat mereka muncul, kadar kolesterol Anda sudah sangat tinggi, ini merupakan faktor risiko serius untuk penyakit jantung." Namun mengurangi kadar kolesterol Anda sebesar 10 persen dapat mengurangi risiko tersebut sepertiga lebih sedikit. Temui dokter Anda untuk cek kolesterol, dan tanyakan padanya tentang perubahan gaya hidup atau resep obat-obatan yang bisa menurunkan kadar kolesterol Anda. KULIT KEPALA Jika Anda melihat penipisan rambut Rambut rontok berlebihan adalah indikator umum dari gangguan tiroid, yang terjadi pada sekitar 10 persen wanita Amerika. Ketika tiroid Anda (sebuah kelenjar di tengah leher Anda) rusak, hal tersebut dapat mengganggu keseimbangan hormon seks laki-laki dan perempuan. Akibatnya: lebih banyak helai rambut Anda yang terasa kasar dan rapuh, kata Sandra Fryhofer, M.D., seorang dokter di Atlanta. Dokter Anda dapat mengukur jumlah hormon tiroid dalam darah Anda — jika kadarnya terlalu banyak atau terlalu sedikit, Anda akan memerlukan obat-obatan untuk mengaturnya. Jika Anda melihat kulit kepala Anda rontok

seperti kulit ular Jika serpihan kulit kepala Anda tiba-tiba membuat bahu Anda terlihat seperti pegunungan Alpen saat musim salju, Anda perlu waspada. "Kadar stres yang berat menyebabkan tubuh Anda menghasilkan hormon kortisol dalam jumlah berlebihan," kata Ostad. "Selain mendatangkan malapetaka pada sistem kekebalan tubuh (membuat Anda lebih rentan terhadap flu) dan metabolisme Anda (membuat Anda menjadi lebih gemuk), kortisol juga dapat membuat kulit kepala Anda kering." Sebuah produk shampo ketombe dapat mengurangi kerontokan kulit kepala, tetapi jika Anda benar-benar ingin bahu yang terbebas dari salju, cobalah untuk tidur lebih banyak, bernapas lebih dalam, dan melonggarkan jadwal Anda yang sibuk. PERUT Jika Anda melihat rambut tebal, hitam berujung lancip Hutan yang tumbuh pada perut Anda cukup tebal untuk menyembunyikan keluarga hobbit? Rambut lebat, kasar yang memanjang ke arah pusar (bukan tumbuh ke bawah dari bagian atas tulang kemaluan) bisa menjadi tanda sindrom ovarium polikistik (PCOS), kata Pamela Berens, M.D., seorang ahli obstetri dan ginekologi di Universitas Texas Medical School. Disebabkan oleh kelebihan produksi androgen, kondisi tersebut dapat menyebabkan menstruasi yang tidak teratur atau berat, kenaikan berat badan, jerawat, dan rambut tebal, hitam di perut, wajah, dada, dan punggung. Satu dari 10 perempuan menderita PCOS, yang dapat menjadi faktor risiko serius seperti kemandulan dan penyakit jantung. Jika Anda mengalami gejala tersebut, temui ahli obstetri dan ginekologi, dia mungkin akan meresepkan pil KB untuk mengembalikan hormon Anda. LIDAH Jika Anda melihat lapisan, putih kuning, atau oranye Jika lidah Anda terlihat seolah-olah dicat dengan warna cerah, Anda mungkin

menumpahkan isi perut Anda saat tidur, ujar Fryhofer. Normalnya, katup satu arah di bagian bawah kerongkongan memastikan bahwa apapun yang turun tidak akan kembali naik. Refluks asam terjadi ketika katup ini membuka secara spontan dan isi perut Anda keluar dari tenggorokan Anda, membuat lidah Anda terlapisi asam pencernaan dan Anda akan memiliki napas yang tidak sedap. Kebanyakan refluks dapat diobati dengan antasid OTC atau hanya dengan menghindari makanan asam dan pedas, jika langkahlangkah tersebut tidak berhasil, temui dokter. Anda mungkin memerlukan obat-obatan resep untuk mengurangi produksi asam lambung tubuh Anda. MATA Jika Anda melihat lingkaran di bawah mata yang tidak pernah hilang Kecuali jika memiliki pekerjaan sampingan sebagai penyiar radio tengah malam, lingkaran hitam yang tiba-tiba muncul mungkin berhubungan dengan alergi. Reaksi berantai, menurut Ostad, berjalan seperti ini: Sebuah alergen menyerang tubuh Anda, yang memicu respon keluarnya histamin, zat kimia ini membuat pembuluh darah membengkak dengan darah dan cairan lainnya, dan akibatnya: daerah gelap muncul pada kulit yang tertipis. Tes kulit dapat menentukan alergen apa yang menyebabkan gejala tersebut. Jika Anda melihat bercak kekuningan di bola mata Anda Tidak, Anda tidak menderita kasus jerawat optik langka. Sebaliknya, bercak yang sedikit terangkat pada bagian putih mata Anda adalah gejala dari kondisi yang tidak berbahaya yang disebut pinguecula. "Ini tidak lebih dari pertumbuhan berlebih dari kolagen yang dipicu oleh kerusakan akibat matahari, angin, atau debu," kata Traci Goldstein, seorang dokter mata di Metropolitan Vision Correction Associates di New York City. Jaga mata Anda agar tetap lembap dengan tetes mata dan selalu pakai pelindung saat berada di luar ruangan (pastikan kacamata Anda menawarkan perlindungan 100 persen terhadap sinar UVA dan UVB) untuk mencegah bercak tumbuh lebih besar.(int)

10 Hal yang

Membuat Mete

Bahaya Kesehatan Mengancam Saat

Musim Manas HUJAN tak kujung-kunjung turun. Cuaca pun menjadi sangat panas. Bukan hanya membuat Anda cepat berkeringat, tapi juga lebih berisiko mengalami gangguan kesehatan tertentu. Cuaca memang sangat mempengaruhi kondisi kesehatan tubuh. Untuk itu, Anda wajib tahu masalah kesehatan yang sering terjadi saat musim panas. Dehidrasi Ada beberapa gejala yang ditimbulkan saat mengalami dehidrasi seperti, terjadi penurunan buang air kecil, mulut kering, dan pusing saat berdiri. Jika Anda mengalami gejala ini, segera perbanyak minum air putih dan makan buah-buahan segar. "Ketika Anda kehilangan cairan, maka volume darah Anda juga mengalami penurunan, dan memengaruhi setiap organ dalam tubuh," kata juru bicara American College of Emergency Physicians, Leigh Vinocur, MD, dikutip dari Mayo Clinic. Gangguan mata Saat musim panas datang, hal yang harus Anda perhatikan adalah sengatan sinar matahari. Pukul 10 pagi dan empat sore adalah sengatan terburuk dari sinar matahari. Kenakan kacamata hitam yang berkualitas jika memang harus ke luar rumah demi melindungi kornea mata. Pastikan kacamata yang Anda gunakan memiliki perlindungan UV-A dan UVB. Belum lagi jika terjadi iritasi pada mata karena angin dan cuaca yang panas. Mengenakan kacamata hitam memang cara paling mudah untuk melindungi mata Anda saat cuaca panas. Heatstroke Kondisi ini dapat berpotensi fatal, apalagi ketika Anda tak mampu menahan cuaca panas. Gejalanya adalah kulit kemerahan, kebingungan, sakit kepala, dan sulit bernafas. Bisa terjadi jika Anda terlalu lama berada dibawah sinar matahari. Untuk menghindarinya, carilah tempat isirahat yang teduh, jauh dari sinar matahari. Kemudian minum air yang mengandung elektrolit untuk mencegah dehidrasi. Sebaiknya hindari minuman yang mengandung kafein dan alkohol. Mengenakan pakaian longgar juga dapat membantu Anda merasa lebih nyaman. (int)

Salah makan Makanan yang tidak tepat akan berpengaruh tidak hanya pada kondisi fisik (seperti mual dan sakit perut) tapi juga kondisi hati. Anda jadi mudah marah, kurang fokus, lebih agresif, gugup atau hiperaktif. Jika Anda merasa tersiksa dengan perubahan mood Anda secara terus-menerus, cobalah menjaga asupan makan Anda dengan mencatat apa yang Anda makan serta dampaknya terhadap suasana hati. Dekorasi rumah Anda Jika Anda ingin memperbaiki mood, cobalah mengubah dekorasi rumah Anda, karena lingkungan sangat berpengaruh terhadap suasana hati. Warna merah dapat membuat beberapa orang menjadi mudah marah atau bermusuhan, sedangkan kuning dapat membuat Anda merasa bahagia dan biru dapat membantu Anda menjadi lebih rileks. Penelitian juga menemukan bahwa dengan menggantung gambar-gambar yang menenangkan seperti lukisan yang indah, mood

seseorang dapat berubah secara positif dan berkurang tingkat stres dan kegelisahan. Dipromosikan Saat kita banyak bermimpi mendapatkan promosi dalam pekerjaan, kenyataannya tidak sebaik yang Anda pikirkan. Sebuah penelitian yang dilakukan oleh beberapa peneliti dari University of Warwick menemukan, karyawan yang dipromosikan dalam pekerjaannya mengalami ketegangan mental alih-alih kualitas hidup yang membaik. Dan rata-rata ada penurunan 10 persen terhadap kesehatan mental. Lampu di samping tempat tidur Jika Anda sering membaca sambil

tidur-tiduran atau menonton TV, maka suasana hati akan ikut terdampak. Penelitian mengungkapkan, cahaya pada malam hari dapat menekan produksi hormon melatonin — yang secara rutin diproduksi pada saat suasana gelap. Jadi cobalah untuk membeli tirai dan pastikan Anda mematikan semua lampu pada malam hari untuk memberikan diri Anda dorongan kebahagiaan. Kekurangan nutrisi Depresi dapat disebabkan oleh beberapa hal, dan gejalanya dapat menjadi semakin buruk ataupun membaik berdasarkan asupan makan Anda. Kekurangan vitamin D, B (terutama B6, B12 dan folat) serta lemak Omega-3, dapat menyebabkan depresi dan kegelisahan. Cobalah untuk menambahkan makanan yang kaya akan nutrisi tersebut dalam asupan makan Anda. Teman-teman Anda Anda mungkin akan berpikir bahwa menghabiskan waktu bersama teman-teman Anda merupakan hal yang baik untuk meningkatkan mood. Namun tahukah Anda

Memi Mertahannya Mubungan Msmara ADA beberapa strastrategi relationship baru yang perlu Anda ketahui. Jika Anda (sebagai pria) sudah jenuh dengan hubungan yang terus-terusan on and off, sebaiknya Anda mencari tahu apa yang menjadi penyebabnya. Kejujuran Kejujuran sebuah kata yang sering didengar, namun terkadang pria sulit melakukannya. Padahal, percaya atau tidak, hal inilah yang menjadi dasar sebuah hubungan untuk berkembang. Contohnya, Anda tidak memberitahu kekasih bahwa Anda gemar berpesta sampai pagi hari, dan Anda berharap hal ini tetap tersembunyi dari si dia. Percayalah, ketika ia tahu, ia akan lebih marah ketimbang Anda sudah memberitahukannya di awal hubungan. Memang, Cosmo pun mengakui terkadang white lies tidak dapat dihindari dari sebuah hubungan, tapi selalu pegang garis besarnya: jangan pernah berbohong untuk hal penting seperti masa lalu, kebiasaan, pekerjaan, sampai keadaan ekonomi Anda. Jujurlah demi masa depan yang lebih baik. The Real Manliness Guys, keinginan Anda untuk selalu tampil "jantan" seringkali malah jadi hambatan terbesar lho. Why? Karena Anda tidak pernah mencoba untuk memahami kondisi emosional pribadi, apalagi pasangan! Pria kerap tidak mau atau malah menghindar terlibat secara emosional karena takut "kejantanannya" dipertanyakan. Sebenarnya ini adalah masalah ego saja. Cosmo beritahu Anda, memberikan diri sepenuhnya secara emosional kepada wanita yang dicintai tidak akan mengurangi sedikitpun kejantanan Anda. Sebagai latihan, terbukalah tentang hal-hal yang membuat Anda sedih atau membuat Anda merasa terluka.(int)

bahwa semua itu bergantung pada mood mereka? Penelitian menemukan, emosi positif dan negatif dapat menular dengan mudah tanpa disadari. Sebuah status Facebook bahkan dapat memengaruhi orang lain selama tiga hari. Waktu tidur Kita sadar bahwa kurang tidur dapat membuat mood kita memburuk, namun penelitian mengungkapkan bahwa waktu Anda tidur hampir sama pentingnya dengan seberapa banyak tidur yang Anda dapatkan. Berdasarkan sebuah studi yang dipublikasikan dalam “Psychiatry and Clinical Neurosciences”, burung hantu hampir tiga kali berpeluang mengalami gejala depresi daripada burung lain yang beraktivitas pada siang hari, jadi, cobalah untuk tidur lebih awal untuk meningkatkan mood. Obat Sebuah studi yang dilakukan oleh peneliti Monash University menemukan bahwa para wanita yang mengonsumsi pil KB berpotensi hingga dua kali mengalami depresi dari mereka yang tidak. Untuk beberapa wanita, pil KB tertentu dapat juga mengakibatkan perubahan mood, mudah marah dan kehilangan libido. Merokok Kita semua tahu kalau merokok dapat menimbulkan kanker, penyakit jantung dan penuaan dini, namun ternyata merokok juga dapat mempengaruhi kesehatan mental Anda. Menurut hasil sebuah studi yang dilakukan para peneliti dari Selandia Baru, orang yang merokok dapat meningkatkan risiko mereka terhadap depresi, dan bagi mereka yang kecanduan nikotin, dapat meningkatkan risiko hingga dua kali lipat mengalami gejala depresi dibandingkan mereka yang tidak kecanduan. Cahaya matahari Sebagian besar dari kita mungkin pernah mendengar tentang gangguan emosi yang disebabkan oleh musim dingin yang gelap, namun tahukah Anda bahwa cahaya matahari juga dapat membawa kesedihan? Saat musim panas, kurang dari satu persen populasi penduduk mengalami gangguan emosi (dibandingkan 5 persen saat musim dingin). Gangguan tersebut juga bisa mengakibatkan kondisi yang serius terhadap mereka yang mengalaminya, seperti insomnia, penurunan nafsu makan dan depresi.(int)



30 Agustus 2012

Evander Holyfield

Pamer Kaos Bergambar

TATO TYSON EVANDERHolyfield dan Mike Tyson boleh jadi pernah terlibat pertarungan paling kontroversial dalam sejarah tinju profesional. Namun setelah gantung sarung tinju, keduanya justru saling membantu dalam mempromosikan produk yang mereka pasarkan. Tyson membuat geger dunia tinju profesional pada saat menjalanitarungulangmelawan Holyfield, 28 Juni 1997. Setelah kalah TKO di pertarungan sebelumnya, Tyson justru berbuat konyol di partai rematch. Saat memasuki ronde ketiga, Si Leher Beton tanpa terduga menggigit telinga Holyfield. Wasit langsung menghentikan laga. Tyson kemudian didiskualifikasi. Malam harinya, kerusuhan juga pecah di areal kasino yang ada di MGM Arena —lokasi pertarungan keduanya. Tyson beralasan bahwa tindakannyamerupakanbalasan atas tandukan yang dilakukan Holyfield selama pertarungan. Akibat aksi ini, Tyson dihukum denda sebesar US$ 3 juta. Selain itu, Komisi Tinju Nevada mencabut lisensi pertandingannya.

Namun dua hari setelah pertandingan, Tyson meminta maaf dan memohon lisensinya tidak dicabut. Permintaan ini akhirnya dikabulkan pada 9 Juli 1997. Pada acara The Oprah Show pada 2009 lalu, Tyson kembali meminta maaf kepada Holyfield. Setelah itu ketegangan di antara keduanya terus mencair. Bahkan belakangan, Tyson dan Holyfield menjadikan momen kontroversial tersebut sebagai bahan untuk bercanda di dunia maya. Belum lama ini, Holyfield mengunggah foto dirinya mengenakan T-Shirt bergambar tato milik Tyson pada akun twitter miliknya. Di bawahnya, Holyfiedl menuliskan “Mike Tyson mengigit telinga saya dan semua yang saya dapat hanyalah t-shirt yang buruk ini.” T-Shirt tersebut merupakan bagian Mike Tyson Collection yang saat ini sedang dipasarkan oleh Tyson. Sebelumnya Tyson juga membantu Holyfield memasarkan saus Real Deal Barbecue yang diproduksi mantan juara dunia tinju kelas berat itu. (int)

Dua anak Indonesia dikirim ke Jerman untuk latihan di camp Bayern Munich, Jerman.

2 Anak Indonesia Terbang ke Jerman Menggocek si kulit bundar di daratan Eropa menjadi mimpi bagi banyak orang yang bergelut dengan sepakbola. Nah, tahun ini dua anak Indonesia berkesempatan untuk bisa berlatih dan bermain sepakbola di Eropa. Tak tanggung-tanggung, di markas Bayern Munich. Kedua anak Indonesia itu adalah Moch Aula Rizky dan Ary Rezqy Hakim. Mereka terpilih dalam seleksi ketat untuk mengikuti Allianz Junior Football Camp (AJFC) di Munich, Jerman. Aula merupakan siswa kelas VIII SMP Regina Caeli, Cileungsi. Dia merupakan putraMZaenalArifindanJunaiyahyanglahir

Holyfield dan Tyson

diSidoarjopada16Mei1998.BagiAula,inilah pertama kalinya dia keluar negeri. Sedangkan Ary sudah beberapa kali keluar negeri untuk urusan sepakbola. Dia adalah siswa SMP Jl Ujung Menteng, Cakung, Jakarta Timur, kelas VIII. Ary adalah putra dari Fauzan Hakim dan Farihatun Munir. Menurut Head of Corporate Communication Central Function PT Asuransi Allianz Life Indonesia, Adrian Dosiwoda, kegiatan ini sudah berlangsung untuk keempat kalinya. Pertama kali kegiatan ini diselenggarakan pada 2009 lalu. “AJFC dimulai pada 2009 dan merupakan kegiatan global di Allianz Football for Life Program,” ujar Adrian dalam pesan tertulisnya, Rabu (29/8). Di AJFC, anak-anak dari berbagai negara

berkumpul di tempat latihan Die Roten. Di sini mereka akan mendapat pelatihan khusus dan berkesempatan bertemu dengan pemain dari klub raksasa Jerman itu. Asyik! Sebanyak 65 Anak dari 22 negara ambil bagian dalam kegiatan ini. Selain Indonesia, mereka antara lain berasal dari Australia, Brasil, China, India, dan beberapa negara Eropa. “AJFC merupakan cara yang ampuh untuk menggabungkan anak-anak yang memiliki minat sama dan sekaligus pertukaran budaya,” imbuh Adrian. Diharapkan pengalaman yang didapat anak-anak itu di AJFC akan menginspirasi merekauntukmenjadipendukung,pemain, pelatih, administrator atau perwakilan komunitas dan lainnya. Nah, bagaimana anak-anak ini bisa

berpartisipasi? Mereka diseleksi setelah mengisi dan mengirim form di situs Football for Life. Form tersebut berisi informasi personal. Para pendaftar juga diminta untuk mendeskripsikan‘thebestfootballmomentnya’.Juridisetiapnegaralantasakanmemilih peserta yang berhak ikut dalam AJFC. Markas Bayern dipilih sebagai tempat diselenggarakannya AJFC dengan pertimbangan Die Roten merupakan salah satu tim paling terkenal di persepakbolaan Eropa. Tim berusia 112 tahun ini menjadi juara di Bundesliga sebanyak 22 kali, 15 kali memenangi DFB Pokal, dan yang tak kalah bergengsi telah menggondol 4 gelar Liga Champions. Catatan lainya, pelatihan tim junior klub asal Bavaria tersebut dikenal sebagai salah satu yang terbaik di Eropa. (int)

Kimi Raikkonen

Tak Pernah Ragukan Lotus KIMI Raikkonen tidak pernah meragukan kapasitas Lotus. Bahkan, Kimi sangat yakin Lotus akan berusaha untuk bersaing mendapatkan gelar juara. Penampilan Lotus belakangan memang cukup konsisten di Formula One (F1) 2012/2013. Bahkan, tim yang bermarkas di Enstone itu berhasil membawa Kimi menempati peringkat kelima klasemen sementara F1. Kimi sangat puas dengan performa Lotus. Mantan juara F1 itu sangat yakin Lotus memiliki kemampuan untuk bersaing dengan tim yang lebih besar seperti, McLaren dan juga Ferrari. Ini yang menjadi alasan utama Kimi menerima pinangan Lotus. “Sudah sangat lama ketika saya

memperkuat tim papan atas dan kami juga pernah mengalami tahun yang buruk.

Setahun kemudian, kami berhasil tampil dengan hasil yang berbeda,” jelas Kimi, dikutip dari Autosport, Rabu (29/8).

“Lotus masih menjadi salah satu tim yang besar. Dasar mereka masih sama, mereka memiliki kemampuan untuk membuat mobil dengan kemampuan dan kecepatan terbaik,” lanjut pembalap asal Finlandia itu. Kimi merupakan salah satu pembalap berpengalaman di F1. Pembalap 32 tahun itu pernah memperkuat McLaren dan Ferrari. Tak heran, The Ice Man (julukan Kimi) sangat yakin Lotus bisa menyamai prestasi tim-tim besar tersebut di F1 suatu saat nanti. “Mungkin levelnya masih belum sama dengan McLaren, Ferrari atau Mercedes. Namun, Lotus memiliki pengetahuan dan mereka untuk memiliki keinginan untuk membuat mobil yang bagus,” pungkas The Ice Man. (int)

Duo Williams Lolos

DUA petenis wanita, Venus dan SerenaWilliamsloloskebabakkedua US Open 2012. Sedangkan Caroline Wozniackilangsungkandasdibabak pertama. Dalam pertandingan yang berlangsung di Flushing Meadows, Rabu (29/8), Serena Williams mendapatkan tiket ke babak kedua setelah meraih kemenangan mudah 6-1 6-1 atas lawannya, Coco Vandeweghe.

Di pertandingan itu, Serena yang menempati unggulan keempat sangatmendominasisekalidantidak memberikan kesempatan kepada lawannya untuk berkembang. Selanjutnya, Serena akan berhadapan dengan Maria Jose Martinez Sanchez. Sang kakak Venus Williams juga tidak mau kalah. Petenis yang sempat lama tidak bermain ini,

berhasil mendapatkan tiket ke babak kedua, usai menumbangkan Bethanie MattekSands 6-3 6-1. Namun lawan tangguh sudah menanti Venus. Dia akan berhadapan dengan Angelique Kerber. Kerber yang menempati unggulan keenam itu, tampil sangat gemilang untuk menyudahi perlawanan Anne Keothavong dua set langsung, 6-2 dan 6-0. Petenis unggulan kedua Agnieszka Radwanska, juga melangkah ke babak keduaUSOpen2012. Petenis asal Polandia itu,mampumengatasi rasa sakit pada bahunya untuk menyingkirkan Nina Bratchikova 6-1 6-1. (int)

Lewis Hamilton dan Nicole

Kencan Singkat LEWIS Hamilton memanfaatkan sisa masa rehat Grand Prix Formula 1 musim 2012 untuk melepas kangen dengan kekasih tercintanya, Nicole Scherzinger. Sayangnya, pertemuan dua sejoli ini berlangsung sangat singkat. Nicole bertolak dari Los Angeles, Amerika Serikat, Sabtu 25Agustus2012.SebelummenujuDubai,mantanpersonel Pussycat Dolls itu transit di Kota London, Inggris, untuk menemui Hamilton. Pertemuan Hamilton dan Nicole keesokan harinya, Minggu, begitu singkat karena hanya dalam hitungan jam. Bahkan, Nicole sengaja mengganti jadwal penerbangannya demi menghabiskan malam bersama juara dunia F1 2008 tersebut. Lalu, pada Senin 27 Agustus 2012, Nicole sudah tiba di Dubai untuk melakoni syuting bersama ITV1. Begitu

mendarat di kota bisnis Uni Emirat Arab tersebut, wanita 34 tahun itu tak sabar ingin mendengar suara Hamilton via telepon.Perbincanganmerekaberlangsungselama1,5jam. “Nicole akan menghabiskan banyak waktu di Dubai. Sebelumsyuting,diamintaizinuntukmenghabiskanwaktu bersama Lewis,” ujar salah seorang sumber seperti dilansir The Sun. “Meskipun mereka hanya bertemu beberapa jam, Nicole sangat bahagia. Mereka benar-benar dimabuk cinta,” tambah sang sumber seraya menampik kabar keretakan pasangan yang sudah bertunangan tersebut. Setelah GP Hungaria pada akhir Juli lalu, Hamilton memiliki waktu rehat cukup lama. Pembalap yang sementara ini menempati peringkat 4 klasemen tersebut akankembalikelintasanuntukmelakoniserike-12diSirkuit Spa-Francorchamps, Belgia, akhir pekan ini. (int)

Yao Ming

Inginkan Sekolah Utamakan Olahraga Ikon bola basket China, Yao Ming meminta sekolahsekolah di negaranya memberi perhatian lebih terhadap perkembangan olah raga dalam pendidikan mereka. Menurut mantan pemain klub NBA, Houston Rockets ketidakpedulian sekolah terhadap perkembangan olah raga menjadi salah satu andil yang memungkinkan stagnasi perkembangan olah raga China. “Pengajaran olah raga di sekolah negara kita sangat terbelakang,” kata Yao yang telah pensiun sebagai pemain ini. “Kita harus memulainya dan menempatkan pendidikan olah raga lebih dari sekadar membuat pelajar bugar.” Yao Ming mendirikan yayasan yang bergerak di bidang pengembangan bola basket di kalangan pelajar sekolah dasar China. Untuk itu, Yao Ming kerap datang ke sekolahsekolah untuk mencarai bibit berbakat. “Perkembangan aktivitas olah raga di sekolah-sekolah China sangat kecil,” katanya. “Olah raga masih ditempatkan sebagai bidang yang berada di bawah bidang pengajaran yang lain.” Yayasan bentukan Yao Ming berusaha mengembangkan bola basket dengan meningkatkan pembangunan sarana olah raga mau pun pelatihan para guru olah raga di sekolah-sekolah. Para pelajar sekolah di China menghadapi hal serupa dengan Indonesia dengan adanya tes ujian masuk sekolah lanjutan mau pun perguruan tinggi yang berat dan menjadi satu-satunya impian. Yao Ming menginginkan pendidikan China mengambil contoh pendidikan di Amerika. “Saat mengenang sekolah dasar, pertama-tama saya terkenang taman bermain,” katanya. Ia mendirikan yayasannya setelah bencana gempa di Sichuan pada 2008 lalu. Ia telah mendirikan 14 sekolah di sekitar lokasi bencana dan menyumbangkan peralatan olah raga seperti bola, raket dan basket bersama buku-buku pelajaran. (int)


KAMIS 30 Agustus 2012

„ Walcott

Walcott Tolak Kontrak Baru Setelah kehilangan Robin van Persie, Arsenal dikabarkan bersiap untuk kehilangan bintang lainnya. Pemain yang dimaksud adalah Theo Walcott. Seperti dilaporkan oleh Guardian, Walcott menolak tawaran kontrak baru yang diajukan The Gunners. Padahal, kontrakpemainberusia23tahunitutinggal

satu musim lagi. Walcott, yang saat ini mendapatkan gaji sebesar 60.000 poundsterling per pekan, menginginkan kenaikan signifikan. Ia disebut meminta gaji sebesar 100.000 pounds sepekan. Namun, Arsenal bersikukuh. Me-

reka mengajukan penawaran final sebesar 75.000 pounds per pekan untuk kontrak selama lima tahun. Pembicaraan lebih lanjut segera dilakukan. Guardian menyebut, Arsene Wenger masih ingin mempertahankan pemain yang dibeli dari Southampton tersebut. Namun, Wenger juga bersiap untuk menjual Walcott sebelum bursa transfer ditutup pada 31 Agustus mendatang, jika mereka tak menerima

ketegasan si pemain untuk tetap bersama klub. Ada dua klub yang dikabarkan tertarik untuk menggaet Walcott. Mereka adalah Liverpool dan Manchester City. The Gunners dikabarkan meminta 15 juta poundsterling jika mereka akhirnya memutuskan untuk menjual Walcott. Walcott tampil sebanyak 35 kali di PremierLeaguemusimlalu.Darijumlah kesempatanbermainitu,iamenyumbang delapangoldan11assist.(dtc/int)

Harga Modric Kemahalan Keberhasilan Real Madrid mendatangkan Luka Modric dari Tottenham Hotspur disambut sinis mantan kiper Arsenal, Manuel Almunia. Menurut penjaga gawang asal Spanyol itu, Selasa (28/8), nilai jual Modric kelewat tinggi. Senin (27/8), “Los Merengues” resmi memboyong Modric dengan dana 31 juta pounds atau 42 juta euro (sekitar Rp 490 miliar). Jumlah tersebut menjadikan pemain Kroasia itu sebagai pemain termahal kedelapan sepanjang sejarah Madrid. Meski menyebut Modric sebagai pemain hebat, Almunia yang kini bermain untuk Watford masih tak percaya Madrid mau berinvestasi besar untuk sang pemain. “Modric pemain bagus. Tapi, aku tak tahu sebenarnya apa yang dibi-

carakan banyak orang. Setelah paham, aku merasa 42 juta euro terlalutinggi.Diamemanghebatdan berguna untuk Madrid. Tapi, tetap saja harganya kemahalan,” ujar

Almunia kepada COM Radio. Almunia juga tak lupa memberikan tanggapannya mengenai kepindahan Alex Song dari Arsenal menuju Barcelona.

Bojan Akan Berkostum Milan

„ Javi Martinez

Eriksson Sarankan Gerrard Pindah Klub berkeinginan untuk pindah klub Steven Gerrard tampaknya setelahmendengarkanwejangan tidak peduli dengan saran yang dilontarkan oleh Sven Goran darimantanpelatihnyadiTimnas Eriksson. Mantan pelatih Inggris itu. Pemain 32 tahun itu Timnas Inggris itu menganggap justru merasa tertantang untuk Gerradtidakakanbisamenjuarai bisa membawa Liverpool meraih Premier League selama masih gelar ke-19 Premier League. berkostum The Reds. “Saya tidak berpikir kami jauh Eriksson sangat prihatin dari gelar juara Premier League. dengan keadaan yang dialami Kami telah berpikir realistis dan Gerrard di Liverpool. Pasalnya „ Gerrard kamifinisdiposisidelapanmusim sejak membela The Redsmusim lalu. Tapi kami mendapatkan dua 1998 silam, Gerrard belum sama sekali trofi bergengsi serta menunjukkan bahwa mencicipi trofi Premier League. Untuk itu, kami adalah tim hebat dan kami bisa ErikssonmenyarankanagarGerrardpindah bersaing dengan siapapun,” ucap Gerrard, klub. seperti disitat Sky Sport, Rabu (29/8). “Jika kami menemukan level yang lebih Meskipun, gelar bergengsi sudah baik dari konsistensi klub, saya pikir kami dirasakannya, seperti Liga Champions, bisa menemukan diri kami di tingkat yang Piala Super Eropa, FA Cup, dan Carling Cup. lebihtinggidaripadamusimlalu,”sambung Namun terasa kurang lengkap bagi sang Skipper jika liga domestik tak dicicipinya. pemain yang telah melakoni 407 laga Gerrard tidak tersinggung ataupun bersama The Kops. (int)

Lampard Ingin Jadi Manajer The Blues FrankLampardmengakuibahwadirinya punyakeinginanuntukmenjadimanajerjika sudah tak aktif lagi sebagai pemain. Jika itu terjadi, dia hanya ingin menjadi manajer Chelsea. Lampard bergabung dengan Chelsea sejak tahun 2001. Sejak saat itu, dia menjadi idola publik Stamford Bridge. Lampard juga turut mempersambahkan beberapa gelar penting untuk Chelsea seperti titel Premier League dan Liga Champions. Loyalitas dan rasa cinta Lampard kepada Chlesea tampaknya memang tak perlu diragukan lagi. Setelah pernah menyatakan keinginannya untuk mengakhiri karier di Chelsea, gelandang 34 tahun itu mengungkapkan hasratnya untuk menjadi manajer klub yang telah membesarkan namanya itu. “Aku tahu mungkin ini terdengar besar kepala atau egois tapi aku tidak ingin ‘mempertontonkan diriku’ di klub yang lebih kecil,” ujar Lampard seperti dilkutip The Sun. “Meski aku tidak pernah berharap akan menduduki posisi seperti manajer Chelsea,

„ Gerrard ini adalah satu-satunya klub yang ingin aku manajeri,” akunya. Meski demikian, Lampard tak akan memaksakan keinginannya untuk menjadi manajer. Dia tak ingin fans melupakan capaiannya bersama Chelsea jika nantinya dia gagal menjadi manajer. “Aku akan senang jika punya kesempatan itu tapi aku ingin melakukannyadenganbaik.Akutidakingin fans melupakan semua yang telah aku lakukan sebagai pemain hanya karena aku tidak bagus kala menjadi manajer,” tukasnya. (int)

Martinez Selesaikan Tes Medis dengan Bayern Javi Martinez dilaporkan di ambang pintu masuk Bayern Munich setelah pemain Athletic Bilbao ini menyelesaikan rangkaian tes medis bersama klub raksasa Bundesliga tersebut. Menurut Football-Espana, Martinez tidak meminta izin klubnya untuk melakukan perjalanan ke Munich. Dia tertangkap kamera di Munich pada hari Selasa (28/8) sore dan diketahui pemain berusia 23 tahun ini bepergian dengan pesawat jet pribadi. RumoryangmenyebutkanMartinez selangkah lagi berkostum The Bava-

“Song seperti dinding. Dia sangat kuat dan mampu mencuri bola. Kadang, dia bermain genius dengan umpan briliannya,” sebut Almunia. (kps/int)

riansmemangsemakingencar.Apalagi manajemen Bayern dipercaya rela merogoh kocek dalam-dalam demi memboyong gelandang internasional Spanyol itu. Bayern Munich diduga sudah mengajukan penawaran kepada Bilbao sebesar 40 juta euro atau nilai dari klausul pembebasan kontrak untuk Martinez. Saat ini diyakini permasalahan yang tersisa sebelum mencapai kata sepakat adalah besarnya pajak dan keengganan Bilbao melepas bintangnya itu.

Bintang-bintang Bilbao memang tengah menjadi incaran klub-klub besar Eropa. Selain Martinez yang juga diminati Manchester City, Fernando Llorente yang juga dikabarkan terus dikaitkan dengan klub raksasa Serie A, Juventus. Sementara itu, manajemen Bilbao saat ini terus berupaya mendatangkan pemain-pemain anyar untukberjaga-jagabilabintangmereka benar-benar pergi. Prioritas utama mereka adalah menggaet pemain Malaga, Nacho Monreal untuk dibawa ke San Mames. (oz/int)

Meski transfernya dari Roma belum resmi, Bojan Krkic tampaknya sudah tidak sabar berseragam AC Milan. Pria Spanyol itu merasa terhormat bisa mengenakan kostum Rossoneri. Pemain berusia 22 tahun itu kemungkinan akan resmi bergabung dengan pasukan San Siro, Rabu (29/8), dan Bojan ingin membuktikan Milan tidak sia-sia mendatangkan dirinya. “Sebuah kehormatan bisa menggunakan kostum Milan. Saya berjanji akan memberikan segalanya untuk klub ini,” cetus mantan penyerang Barcelona itu, seperti dilansir La Gazzetta dello Sport. Meski ditinggal sejumlah pemain bintangnya, Bojan malah melihat itu sebagai salah satu kesempatan untuk menunjukan kualitasnya. “Semua penjualan yang Milan buat? Milan masih tim yang kuat, dan saya akanmempergunakankesempatanini sebaik mungkin,” tegas Bojan. Sebelumnya, Bojan juga sempat diisukan akan dibeli Malaga tapi dia menyatakan puas bisa berbelok ke Milan.“Malaga?Sayatelahmendengar banyak kabar benar dan bohong di media, tapi yang saya bisa bilang saya senang bisa ada di Milan,” imbuhnya. Jika resmi digaet tengah pekan ini, Bojan bisa saja menjalani debutnya bersama Milan akhir pekan ini saat Rossoneri bertandang ke markas Bologna. (int)

Bocah Tanpa Kaki Diundang Berlatih di Barcelona Seorang bocah tanpa kaki asal Brasil bernamaGabrielMunizdiundangoleh Barcelona untuk berlatih di akademi Barcelona. Gabriel juga akan diberi kesempatan bertemu idolanya, Lionel Messi. Gabriel terkenal di sekolahnya sebagai anak yang istimewa, dan nama bocah berusia 11 tahun ini kian menjulang ketika dia diberi kesempatan menunjukkan kebolehannya mengolahboladisalahsatustasiuntelevisi Brasil. Dari situlah Barcelona mengetahui bakat Gabriel, yang sejak lahir tidak memiliki kaki itu. Setelah melihat aksi Gabriel, pihak Blaugrana ingin dia menunjukkan keahliannya dan bertemu Messi. Ibunda Gabriel sangat senang mendengarkabarBarcelonaakanmemberi kesempatan anaknya untuk unjuk kebolehan dan mengatakan bangga dengan kekurangan fisik yang dimiliki anaknya, Barcelona tetap memberikan perhatian. Gabriel sendiri lahir dari keluarga yang sangat miskin dan mereka tak

„ Gabriel Muniz mampu untuk membiayai perawatan untuk kaki Gabriel. Dengan kesempatan yang diberikan Barcelona, ibunda Gabriel berharap kaki Gabriel mendapat perawatan dan berkembang menjadi pesepakbola profesional. “Dia mulai berjalan sebelum dia berumur satu tahun. Kami terus mengawasinyaagardiatidakjatuh,tapidia

tidak pernah jatuh,” ujar ibunda Gabriel, seperti dilansir The Sun, Rabu (29/8). Sementara itu, guru olahraga Gabriel di sekolah, Jose Lopes memuji salah satu siswa kesayangannya tersebut. Dia mengatakan, Gabriel membuktikan kepada semua orang, kekurangantidakmenjadikannyaberadadi

belakang. “Cacat hanya ada di dalam kepala kita dan dia membuktikan kepada semua orang, dia menantang normanorma sosial,” kata Jose Lopes. “Ketika dia tiba di sana (akademi Barcelona di Rio de Janiero), tidak ada yang percaya kepadanya. Tapi, dia membuktikan kepada semua orang di sana dan dia bisa berhadapan satu lawan satu dengan anak lain di lapangan,” terangnya. Gabriel akan pergi ke Spanyol pada bulanSeptemberuntukmenampilkan bakatnya di Barcelona dan berharap dia mampu mengesankan semua orang dengan keahliannya. Bukan tidak mungkin, dengan adanya fenomena Gabriel, kebijakan Paralympics di cabang olahraga sepakbola dengan tanpamemainkansebelasorangdalam satu tim bisa berubah. “Sampai hari ini tidak ada Paralympics dengan 11 pemain dalam satu tim sepakbola, namun Gabriel menunjukkan hal ini harus berubah, karena dia ingin bermain 11 lawan 11,” pungkas sang guru. (int)


KAMIS 30 Agustus 2012

ENGLISH PREMIER LEAGUE No 1 2 3 4 5 6 7 8 9 10

Team Chelsea Swansea City Everton West Brom Man City Fulham Man United Wigan Athletic New United West Ham U

M 3 2 2 2 2 2 2 2 2 2

M 3 2 2 1 1 1 1 1 1 1

S 0 0 0 1 1 0 0 0 0 0

K 0 0 0 0 0 1 1 1 1 1

SG 8-2 8-0 4-1 4-1 5-4 7-3 3-3 2-2 2-3 1-3


Nilai 9 6 6 4 4 3 3 3 3 3

Dila Gori Dnipro APOEL Nicosia CSKA Moscow H Tel Aviv Heerenveen Helsinki PSV Rosenborg BK Sparta Praha Steaua Bucharest Young Boys Metallist K Racing Genk Viktoria Plzen Bordeaux Club Brugge Marseille Videoton Hannover Inter Milan Levante Partizan Belgrade Rapid Wien AZ Alkmaar Lazio Newcastle Twente Liverpool Sporting

TOP SCORER Gol 3 2 2

Nama Michu D Duff N Dyer

Klub Swansea City Fulham Swansea City

SPANISH LA LIGA No 1 2 3 4 5 6 7 8 9 10

Team Barcelona R Valladolid R Vallecano Mallorca Málaga Atl Madrid Deportivo Sevilla Real Betis Getafe

M 2 2 2 2 2 2 2 2 2 2

M 2 2 2 1 1 1 1 1 1 1

S 0 0 0 1 1 1 1 1 0 0

K 0 0 0 0 0 0 0 0 1 1

SG 7-2 3-0 3-1 3-2 2-1 5-1 5-3 3-2 6-5 3-3

Nilai 6 6 6 4 4 4 4 4 3 3

vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs

Maritimo Slovan Libere Neftchi Baku AIK F91 Dudelange Molde Ath Bilbao Zeta Golubovc Legia Warszaw Feyenoord E Panevezys Midtjylland Dinamo Bucuresti Luzern Lokeren Crvena Zvezda Debreceni VSC Sheriff Tiraspol Trabzonspor Slask Wroclaw Vaslui Motherwell Tromso PAOK Anzhi Makhachkal Mura Atromitos Bursaspor Hearts AC Horsens

1/2 : 0 0 : 1 1/4 0 : 1 1/4 0 : 1 1/2 0 : 1 3/4 0 : 1/2 3/4 : 0 0 : 2 1/2 0 : 1/2 0 : 1/4 0 : 2 1/4 0:1 0 : 1 1/4 0 : 3/4 0 : 3/4 0 : 1 1/4 0 : 1 1/4 0 : 1 3/4 0:0 0:2 0 : 1 3/4 0:2 0 : 1/2 0 : 1/4 0 : 1/4 0 : 2 1/4 0 : 1 1/2 0:1 0 : 1 3/4 0 : 1 3/4

Kualifikasi Liga Champions

TOP SCORER Gol 4 3 3

Nama L Messi T Hemed R Falcao

Klub Barcelona Mallorca Atlético Madrid

Liga Champions musim 2012-2013 akan segera bergulir. Lima tim telah memastikan diri lolos ke fase grup, menyusul kemenangan yang mereka raih di babak playoff.


ITALIAN SERIE A 1 2 3 4 5 6 7 8 9 10

Internazionale Napoli Chievo Genoa Juventus Fiorentina Lazio Sampdoria Catania Roma

1 1 1 1 1 1 1 1 1 1

1 1 1 1 1 1 1 1 0 0

0 0 0 0 0 0 0 0 1 1

TOP SCORER Gol 2 1 1

Nama S Jovetic E Cavani A Costa

Klub Fiorentina Napoli Sampdoria

0 0 0 0 0 0 0 0 0 0

3-0 3-0 2-0 2-0 2-0 2-1 1-0 1-0 2-2 2-2

3 3 3 3 3 3 3 2 1 1

urnamen paling elite benua biru diketahui sudah memiliki 22 kontestan yang otomatis melaju ke babak penyisihan grup. Mereka adalah tim-tim yang mengakhiri musim di papan atas klasemen Liganya masingmasing (ada yang empat, tiga, dua atau hanya satu, tergantung jatah setiap asosiasi berdasarkan peringkat di UEFA). Sementara10timlainuntukmemenuhikuota 32 klub, diambil lewat babak playoff. Nah, saat ini ada 20 tim di babak playoff yang tengah berjuang untuk mendapatkan 10 tiket tersebut. Dini hari tadi, lima tiket telah resmi dipegang oleh BATE Borisov (Belarusia), Anderlecht (Belgia), Dinamo Zagreb (Kroasia), Sporting Braga (Portugal) dan Malaga (Spanyol). BATE, klub jawara Liga Belarusia ini memastikan diri lolos ke putaran final Liga Champions usai menumbangkan wakil Yunani Hapoel Ironi Kiryat Shmona FC. BATE menang dengan agregat 3-1, usai bermain 2-0 di kandang dan menahan imbang 1-1 juara Liga Yunani itu di kandangnya pada leg kedua, dini hari tadi. Bagi BATE, ini merupakan kali ke-3 mereka lolos ke Liga Champions sejak pertama kali pada 2008-2009. Ini jadi kesempatan kedua secara beruntun buat BATE, setelah musim lalu juga

mampu melaju ke fase grup (meski langsung tersingkir). Anderlecth juga memastikan bakal meramaikan persaingan fase grup Liga Champions musim ini usai menumbangkan kampiun Liga Siprus, AEL Limassol dengan agregat 3-2. Anderlecth yang kalah 1-2 pada leg pertama di markas AEL, sukses membalikkan keadaan dengan menang 2-0 pada leg kedua di markasnya, Constant Vanden Stock Stadium, dini hari tadi. Buat Anderlecht, keberhasilan ini menjadi prestasi tersendiri setelah sebelumnya dalam dua musim terakhir, jawara 31 kali Liga Belgia ini harus puas berlaga di Europa League. Dinamo Zagreb lolos ke babak utama Liga Champions usai menjinakan NK Maribor. Kampiun Liga Kroasia ini menang agregat 3-1 berkat kemenangan 2-1 (kandang) dan 1-0 pada leg kedua di markas jawara Liga Slovenia itu, dini hari tadi. Ini merupakan kali keempat atau yang kedua secara beruntun bagi Zagreb lolos ke babak penyisihan grup. Sporting Braga membuktikan kelasnya bahwa kompetisi Liga Portugal tidak bisa diremehkan oleh liga-liga elite Eropa seperti Spanyol, Inggris, Jerman dan Italia. Hal ini

dibuktikandengankeberhasilanmerekamelaju ke babak penyisihan grup Liga Champions dengan menyingkirkan salah satu unggulan di babak playoff, Udinese. Braga yang ditahan imbang 1-1 pada leg pertama, sempat dibuat cemas ketika Pablo ArmeromembawaUdineseunggul1-0padaleg kedua di Stadion Friulli, Italia. Namun, Ruben Micael menyelamatkan Braga berkat golnya di menit ke-72, untuk memaksakan skor akhir 1-1 (agregat2-2)sekaligusdigelarnyaperpanjangan waktudanklimaksnyamenanglewatdramaadu penalti (5-4). Dengan lolosnya Braga, maka Portugal memiliki tiga wakil pada gelaran Liga Champions musim ini. Dua tim yang sebelumnya memastikan lolos otomatis adalah FCPortoselakujawaradanBenfica(runner-up). Sementara bagi Udinese, kegagalan klub berjuluk ‘Il Zebrette’ ini memaksa Italia hanya menyelipkan dua wakilnya di putaran final. KeduatimtersebutadalahJuventusdanrunnerup Serie A, AC Milan.

Berbeda dengan Italia yang kian merosot, Spanyol justru terus menunjukkan hegemoninya sebagai salah satu liga terbaik dunia. Ini tak lepas dari keberhasilan Malaga menembusLigaChampionsuntukkalipertama dalam sejarah klub. Klub besutan Manuel Pellegrini ini memastikan tiket lolos, usai membungkam runner-up Liga Yunani, Panathinaikos dengan agregat 2-0. Keunggulan dua gol tanpa balas di markasnya, La Rosaleda Stadium, berhasil dipertahankan Malaga dengan menahan imbang Panathinaikos 0-0 di leg kedua, dini hari tadi. Dalamdebutnya,Malagaakanmendampingi tiga tim terbaik La Liga, yakni Real Madrid, Barcelona dan Valencia yang lolos otomatis. Sementara itu, lima tiket tersisa akan diperebutkan 10 tim. Ke-10 tim yang akan saling sikut adalah Spartak Moskow vs Fenerbahce, Basel vs CFR Cluj, Helsinborg vs Glasgow Celtic, Borussia Moenchengladbach vs Dinamo Kiev dan FC Kopenhagen kontra Lille. (oz/int)






KAMIS, 30 Agustus 2012 Edisi 232 Tahun III

Pacari Brondong, Janda Dihajar Keluarga Polisi MEDAN- Dian Anggraini (32) dan Jhon Robin Batuera (21) menjalin asmara bak dalam sinetron di televisi. Betapa tidak, pasangan yang sudah berpacaran selama dua tahun ini harus merelakan percintaannya berakhir di kantor polisi.

Warga Jalan Serba Jadi KM 18 Medan Binjai yang berstatus janda anak tiga ini, mengadu ke Polsekta Medan Sunggal, Rabu (29/8) sekira pukul 15.00 WIB, lantaran dihajar keluarga Robin hingga menyebabkan memar di bagian mata. Kepada Posmetro Medan

Pasangan Nomor Urut 4, Dedi-Affan

Dianggap Mampu Lestarikan Sungai SIDIMPUAN- Salah satu aktivis lingkungan hidup di Tabagsel, Pebriano Dasopang (27) berpendapat sejumlah sungai yang mengalir di Kota Psp seperti sungai Batang Ayumi, sungai Sangkumpal Bonang, Aek Sibontar, dan sungai lainnya harus dijaga dan dilestarikan pemerintah daerah dengan mengajak partisipasi masyarakat.

(Grup Metro Tabagsel), perempuan berambut panjang ini mengisahkan peristiwa yang dialaminya. Ceritanya, tiga hari yang lalu atau Minggu (26/8) sekira pukul 10.00 WIB, ia sedang di rumah sendirian menonton televisi (TV). Baca


Kompartemen C41 & C48 TPL Diduga Tak Miliki RKT

Pacari ...Hal 6

Pengibar Bendera Pertama Terbaring di Rumah Sakit MADINA- Amran Nasution (86), warga Jalan Veteran Nomor 1, Kelurahan Pasar Hilir, Kecamatan Panyabungan, Kabpaten Mandailing Natal (Madina) yang diketahui sebagai pengibar bendera di Panyabungan pada tanggal 17 Agustus tahun 1945 lalu, kini terbaring di Rumah Sakit Umum Daerah (RSUD) Panyabungan. Di kamar rumah sakit, sekretaris Lembaga Veteran Republik Indonesia (LVRI) cabang Madina itu menitip pesan bagi generasi muda; yakni tetap mempererat persatuan dan kesatuan. Untuk pemerintah agar benar menjalankan tugas demi tercapainya pembangunan sebagaimana yang tertuang dalam UUD Negara dan termaktub Baca

Pengibar ...Hal 6

Dianggap ...Hal 6

TOBASA- Kompartemen C41 dan C48 di Aek Raja Kabupaten Taput yang merupakan hutan bukaan baru PT TPL diduga tidak memiliki Rencana Kerja Tahunan (RKT). Kedua kompartemen itu merupakan hutan alam yang dibuka oleh TPL tahun 2009. Informasi diperoleh METRO dari sumber terpercaya menyebutkan, kedua kompartemen Dian Anggraini


Kompartemen ...Hal 6

Berkunjung ke Dusun Buntu Raja, Pasca Tragedi Isu Begu Ganjang (Habis)

Takut Digosipi Selingkuh, Lelaki Dusun Sebelah Enggan Bertandang FOTO: AMRAN POHAN

Amran Nasution ditemani anaknya di RSU.

Selain dampak psikologis dan ekonomi, dampak lain pasca 42 kaum bapak di Dusun Buntu Raja masuk penjara adalah persoalan menggelar acara adat. Semisal, acara adat pernikahan atau orang yang meninggal dunia. Horden Silalahi, Muara

JAKARTA- Entertainer yang biasanya menjadi presenter, Choky Sitohang, mendapat tantangan untuk bermain dalam opera batak. Choky akan bermain Gorga, tokoh utama dalam opera berjudul “Arga Do

Bona ni Pinasa”. Meski berdarah batak, namun Choky cukup sulit Baca

Main...Hal 7

Kepala Desa Sitanggor Sangkar Rajagukguk kepada METRO Baca

Takut ...Hal 7


Anak-anak terpidana kasus begu ganjang berkumpul bersama saat hari libur dan dihibur sejumlah ibu-ibu.






30 Agustus 2012

Staf Bupati Banyak Nongkrong di Warung PALAS-Saat ini lebih banyak pejabat-pejabat di Lingkungan Pemkab Padang Lawas (Palas) yang lebih sering di luar kantor atau nongkrong di warung kopi daripada duduk di kantornya untuk mengurusi program pembangunan daerah. Dengan kondisi ini, banyak masyarakat yang ingin berurusan dengan administrasi pemerintahan menjadi terganggu. Pasalnya, mereka jarang mendapat pelayanan yang maksimal dari para PNS sebagai bawahan, karena atasannya jarang ad di kantor pada jam-jam kerja. Himpunan Mahasiswa Alwasliyah (Himmah) Cabang Kabupaten Palas meminta kepada seluruh staf Bupati Palas, H Ali Su-

tan Harahap khususnya di jajaran pempimpin Satuan Kerja Perangkat Daerah (SKPD) , agar lebih fokus dan meningkatkan etos kerjanya. Pasalnya, saat ini disinyalir kebanyakan pembantu atau staf Bupati lebih sering nongkrong di kedai daripada di kantornya. Ketua Himmah Cabang Palas, Irham Habibi Harahap mengatakan, para pejabat dibawah pemerintahan Plt Bupati H Ali Su-

tan Harahap, ada sebagian yang lebih banyak kantornya di warung kopi daripada di ruangan kerjanya. Akibatnya, tidak menciptakan birokrasi pelayanan yang baik kepada masyarakat. “Sudah tidak rahasia lagi, di saat jam kerja banyak pejabat setingkat Kadis, Kabag, Asisten sering nongkrong di kedai kopi saat jam kerja. Sehingga, harapan masyarakat adanya perubahan di kabinet Plt Bupati yang baru nyaris sirna saat ini,” tutur Irham. Belum lagi kata Irham, banyak mulai muncul pejabat Asal Bapak Senang(ABS) saat ini, dan jika Plt Bupati tidak ada di Palas, banyak pejabatnya tidak masuk kerja.

“Ini harus dievaluasi oleh Plt Bupati. Jangan sampai terjadi pada pejabat seperti sebelumnya. Jika terus dibiarkan akan berdampak pada mental birokrat yang bobrok,” tegasnya. Kemudian aktivis yang giat mengkritiki kebijakan pemerintah selama ini, staf Plt Bupati harus melakukan jemput bola, jangan sampai menunggu bola, dan melaksanakan program kerja hanya asal asalan saja tanpa terukur. “Banyak program pembangunan selama ini hanya menghabiskan anggaran negara saja dan tidak memiliki keuntungan kepada masyarakat,” tukasnya. (amr/mer)

Bupati Diminta Cabut IUP PT Medan Madani Mining MADINA-Konsorsium Madina Bersatu (KMB) meminta Bupati Mandailing Natal (Madina),HMHidayatBatubaraSE mencabut Izin Usaha Pertambangan (IUP) Eksplorasi PT MedanMadaniMining,karena diduga melanggar ketentuan perundang-undangan. Beberapa peraturan yang dilanggar adalah UU Nomor 4 Tahun 2009 tentang Pertambangan Mineral dan Batubara serta Peraturan Pemerintah (PP) Nomor 23 Tahun 2010 tentang Pelaksanaan Kegiatan Usaha Pertambangan Mineral dan Batubara. Demikian disampaikan Konsorsium Madina Bersatu yang terdiri dari Ketua LSM Penjara UJ, Ali Musa Manto Lubis, wakil ketua KNPI Sumatera Utara, Anas Suheri Lubis, tokoh pemuda Madina M Irwansyah Nasution, dan ketua pemuda demokrasi kebangsaan Sumut, M Masyhuri Pulungan kepada wartawan, Rabu (29/8) di Panyabungan. Mereka berharap Bupati Madina meninjau ulang dan mencabut SK No.540/548.a/ K/2010 tertanggal 29 September 2010 tentang Persetujuan Perubahan KP Menjadi IUP Eksplorasi Kepada PT Medan Madani Mining yang ketika itu diterbitkan oleh Pejabat Bupati sebelumnya. Konsorsium Madina Bersatuinimenjelaskan,berdasarkan temuan di lapangan, Notaris Ali Muda Rambe SH beralamatdiMedanmenerbitkan Akta Pendirian PT Medan Madani Mining tanggal 26 Maret 2011, dan di tahun yang sama PT Medan Madani MiningresmidiregistrasidiKementerian Hukum dan HAM. Sedangkan SK No.540/548.a/K/ 2010 tentang Persetujuan Perubahan KP Menjadi IUP Eksplorasi Kepada PT Medan Madani Mining diterbitkan oleh Pj Bupati sebelumnya pada Tanggal 29 September. SementaraPasal39danPasal

65 UU No. 4 Tahun 2010 dan Pasal 24 PP No.23 Tahun 2010 dijelaskan bahwa penerbitan IUPEksplorasiwajibmemenuhi persyaratan administratif. Salah satu diantaranya adalah memilikiBadanUsahasahdan memiliki domisili yang tetap. ”Hal inilah menurut kami yangmenjadipertanyaanbesar. Apakah mungkin IUP Eksplorasi diterbitkan kepada suatu BadanUsahayangdidugatidak memilikilegalitas(fiktif),karena PT Medan Madani Mining belum terbentuk di tahun 2010, sementara legalitas PT Medan MadaniMiningtahun2011,PT MedanMadaniMiningmengajukanIUPEksplorasikePemkab Madinaatasdasarapa?danapa pula pertimbangan Pj Bupati sebelumnyasebelumnyamenerbitkanIUPEksplorasiPTMedan Madani Mining,” ungkap mereka. Terhitung hingga Tahun 2012, PT Medan Madani Mining lanjut mereka belum melakukan aktifitas apapun dilokasi termasuk pembangunan kantor site tambang (kantor perwakilan di lokasi) dan belum memenuhi kewajiban – kewajiban sebagai pemegang IUP Eksplorasi serta belum melakukan program – program pengembangan masyarakat (CSR) “Konsorsium Madina Bersatu menyimpulkan bahwa IUP yang dimiliki PT Medan Madani Mining adalah cacat hokum, dan di duga ada indikasi adanya permainan dugaan KKN yang dilakukan PT Medan Madani Mining dengan oknum tertentu di Pemkab Madina,” tegasnya. Hal tersebut tentunya dapat membahayakannamabaikdan kredibilitas Pemkab Madina. Disisilainhalinimerupakanpintu masuk bagi para Instansi penegakhukumuntukmelakukanpenyelidikanterkaitdugaan pelanggaranhukum.”Ituharapankita,aparatpenegakhokum jangantutupmata,”harapmereka.(wan/mer)


ANJLOK-Sejak bulan Juni lalu, harga getah karet dan sawit sebagai komoditas pertanian masyarakat Palas anjlok dipasaran. Saat ini harga sawit Rp700 per kilogram sedangkan getah karet Rp7.000 per kilogram.

Harga Sawit dan Karet Anjlok PALAS- Sejak bulan Juni lalu, harga getah karet dan sawit sebagai komoditas pertanian masyarakat Palas anjlok dipasaran. Saat ini harga sawit Rp700 per kilogram sedangkan getah karet Rp7.000 per kilogram. Belum ada tanda-tanda akan terjadi kenaikan harga. Seorang toke getah dan sawit di wilayah Kabupaten Palas, M Hasibuan (45), Rabu (29/8) memperkirakan, penurunan harga kedua komoditas pertanian tersebut akan terus bertahan atau belum naik hingga Desember mendatang.

dengan nyaman dan tidak segansegan membagi pengalaman sehatnya dengan orang lain. Asam urat bukanlah nama suatu penyakit, namun ia adalah suatu zat sisa metabolisme zat yang bernama purin yang berasal dari makanan yang kita konsumsi. Keadaan dimana tubuh mengalami kelebihan kadar asam urat disebut hyperuricemia. Pada kondisi normal, kelebihan purin ini akan dikeluarkan melalui urine dan feses. Namun jika purin yang masuk dalam tubuh terlalu banyak, maka ginjal akan kesulitan mengeluarkan zat tersebut sehingga terjadi penumpukan sisa metabolismenya (asam urat). Penumpukan sisa metabolisme zat purin di persendian dapat menyebabkan bengkak dan rasa nyeri. badan terasa linu, nyeri terutama di malam hari atau pagi hari saat bangun tidur, sendi terlihat bengkak, kemerahan, panas dan nyeri luar biasa pada malam dan pagi, timbul benjolan-bejolan kecil dari mulai sebesar biji beras sampai kacang hijau di daun telinga bawah (tofus) adalah gejala-gejala asam urat. Habbatussauda yang dikandung dalam Gentong Mas bermanfaat untuk menormalkan metabolisme, termasuk metabolisme purin sebagai pembentuk asam urat yang dipercaya dapat meningkatkan pengeluaran asam urat dari darah

mengutarakan, kondisi penurunan harga kedua komoditas pertanian tersebut sangat memukul masyarakat petani. Apalagi, kondisinya saat menjelang lebaran dan masuk sekolah tahun ajaran baru. “Kita tidak bisa berbuat banyak terkait hal itu. Di pabrik juga harganya mengalami penurunan dan sudah kita cek ke lapangan. Namun harganya tetap mengacu pada perekonimian nasional atau kondisi perekenomian dunia,” tukasnya. (amr/mer)

Sumut Butuh Pemimpin yang Amanah MADINA-Mahasiswa di Kabupaten Mandailing Natal (Madina) berharap pemimpin di Sumatera Utara periode ke depan adalah pemimpin yang amanah. Dia harus mengetahui apa yang diharapkan masyarakat terlepas dari basis dan suku. Pemimpin seperti itulah yang bisa membangun Sumut menuju „ Aswan Lubis masyarakat yang sejahtera. “Siapapun dia dan dari suku apapun orangnya, kita berharap pemimpin di Sumut nantinya pasangan yang amanah dan mengetahui apa yang dibutuhkan rakyat, ini demi kemajuan pembangunan menuju kesejahteraan. Jangan sampai gagal lagi sehingga Sumut semakin terpuruk. Jabatan itu adalah amanah” sebut Ketua Pergerakan Mahasiswa Peduli (PMP) Madina, Aswan Lubis bersama wakil ketua PMP Madina, Imsaruddin Nasution kepada METRO, Rabu (29/8) di Panyabungan Dijelaskan keduanya, apabila dilihat dari potensi SDA, Sumut dipastikan akan mampu mewujudkan pembangunan yang efektif dan mampu mensejahterakan rakyatnya. Itu akan terjadi jika dipimpin oleh pasangan gubernur dengan wakil gubernur yang amanah, dan akan terjadi sebaliknya apabila dipimpin oleh yang tidak peduli dengan masyarakat. ”Sampai saat ini masyarakat masih merindukan pemimpin seperti itu, sebab yang ada sekarang adalah pemimpin yang membutuhkan masyarakat ketika terjadi pencalonan dan setelah terpilih semua yang diucapkan bak angin lalu dan tidak berbekas, kita selalu merasakan itu,” sebut Aswan Lalu kata Aswan dan Imsar. agar masyarakat tahu siapakah orang yang tepat untuk dipilih sebagai pemimpin caranya kata keduanya adalah supaya para bakal calon-calon pemimpin itu bersilaturahmi dengan masyarakat. ”Bukan hanya dengan masyarakat kalangan menengah ke atas, yang kita harapkan adalah turun dan berdiskusi serta berbaur bersama masyarakat khususnya di pedesaan. Ini tujuannya supaya masyarakat semua tahu apa konsep dalam membangun daerah yang sudah lama tertidur ini. Bakal calon pemimpin itu juga tahu apa yang diharapkan masyarakat, supaya menjadi catatan besar bagi dirinya apabila memimpin kelak,” ujarnya Kemudian, sambung Aswan pemimpin yang dinantikan masyarakat adalah sosok yang tegas atas segala bentuk kemunkaran termasuk dalam system pemerintahan. ”Masyarakat diminta untuk melihat track record calon pemimpin pilihannya itu. Jangan terlalu cepat menjatuhkan pilihan karena melihat calon dari segi kemampuan ekonominya. Teorinya, semakin bakal calon mengeluarkan cost, maka semakin kuat pula indikasi terjadinya KKN lima tahun ke depan,” pungkasnya.(wan/mer)

Tertibkan Galian C di Kotapinang!

"SEKARANG TANGAN DAN KAKI SAYA SUDAH TIDAK CUCUK-CUCUK LAGI" Keluhan karena asam urat kini sudah tidak lagi dirasakan D u ng d u ng Nurwati Aritonang. Padahal, sudah 1 tahun, wanita berusia 43 tahun tersebut mengeluhkan kesehatannya terganggu karena asam urat. Kirakira apa rahasianya? Ketika ditemui di kediamannya di Desa Tanjung Gusta, Kec. Sunggal, Kab. Deli Serdang, Sumatera Utara, ia menjawabnya, "Sudah 1 tahun terakhir ini saya menderita asam urat dan telah lama berobat, namun sakitnya masih datang dan pergi. Tapi setelah saya minum Gentong Mas selama 6 bulan, sekarang kaki dan tangan saya sudah tidak cucuk-cucuk lagi," tuturnya menceritakan pengalaman baiknya tersebut. Gentong Mas adalah minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda) terbukti memiliki banyak manfaat untuk kesehatan. Dulu, ketika sakitnya kambuh, ibu 5 orang anak ini selalu merasakan tangan dan kakinya sakit. Tapikini, semuanya berubah. Dengan tubuh yang sehat, ia pun dapat menjalani aktifitasnya sehari-hari sebagai PNS

Katanya, sebelumnya bulan Juni lalu harga karet mencapai di level Rp12.000 per kilogram, sedangkan sawit Rp1.200 per kilogram. Petani sawit Tongku Siregar warga Kabupaten Palas menuturkan, akibat turunnya harga komoditas pertanian tersebut, jelas membuat masyarakat sangat terpukul. Bahkan tidak sedikit warga yang menjual lahannya karena kebutuhan untuk pendidikan anak dan lainnya, tidak ada lagi. Kadisperindgakop dan UKM Palas, Drs H Tobing Hasibuan

Mahasiswa Madina:

melalui urine. Sementara, Gula Aren selain rasanya manis dan lezat juga bermanfaat untuk menurunkan penyerapan lemak dan perbaikan sistem saraf. Untuk hasil maksimal, control makanan yang dikonsumsi dan banyak minum air putih, sekitar 8 gelas sehari. Dengan aturan penggunaan yang tepat, manfaat bagi kesehatan dan kelezatan rasanya membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi w w Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/ toko obat terdekat atau hubungi: Medan : 081384 777787 Sidikalang: 081384777787 Humbahas : 0821 6864 2805 Gunung tua : 081384777787 Batubara : 081384777787 Tobasa : 0813 8477 7787 Nias : 0813 8477 7787 Tebing Tinggi : 0813 2209 9495 Siantar : 082167538848 Binjai : 0813 9866 6166 Lbk Pakam : 0813 6227 3308 Karo : 0821 6753 8828 Langkat : 0813 6227 3308 Kisaran : 0623 7014 362 Tj. Balai : 0812 6349 5563 Labura : 0813 7059 0972 Labuhan batu: 0852 7784 4950 P. Sidimpuan : 0821 6346 6597 Sibolga : 0813 7625 2569 Taput : 081263243034 Madina : 082163466597 Dolok Sanggul : 0821 2928 4752. Depkes:P-IRT:812.3205.01.114

KOTAPINANG- Sejumlah warga yang tinggal di Desa Huta Godang, Kecamatan Sungai Kanan, Kabupaten Labuhanbatu Selatan (Labusel) mengeluhkan aktivitas penambangan galian C di Batang Air Sungai Kanan. Pasalnya warga khawatir akibat penambangan itu dapat menimbulkan erosi. Salah seorang warga Desa Huta Godang Kecamatan Sungai Kanan, Kabupaten Labusel, Dahrum (60) mengatakan, akibat aktivitas galian C yang persis berada di samping lahan perkebunan sawit miliknya, membuat tanah di kebun sawitnya mengalami erosi. “Sudah berlongsoran tanah saya akibat pengerukan galian C itu. Kami segera menyurati dan melaporkan ke kantor perizinan dan polisi atas kasus ini,” kata Dahrum, Selasa (28/8).

Menurutnya, akibat adanya galian C itu, tidak hanya lahannya yang bakal terancam, sejumlah lahan milik warga lainnya juga bakal mengalami dampak buruk. Bahkan banjir bandang juga dapat mengancam warga. Pasalnya pengusaha galian C mengalihkan aliran sungai ke lokasi lain agar kendaraan damp truk pengangkut hasil galian dapat menyeberangi sungai. “Aliran sungai sudah mau dialihkan mereka, supaya bebas masuk truk mengangkut material pasir menyeberangi sungai itu,” beber Dahrum. Senada dikatakan warga lainnya, Maklan (29), dan Hendra (32). Menurut keduanya, warga sudah pernah meminta agar pengusaha galian C menghentikan kegiatannya, namun pihak pengusaha tidak menghiraukan permintaan tersebut.

“Kami sempat bertengkar di lokasi galian C. Kami minta supaya kegiatan galian C itu dihentikan, karena bakal merusak lahan saya. Tapi pihak pengusaha tak mau menghentikan kegiatannya. Akibatnya kami bertengkar dengannya,” katanya. Hendra meminta agar Kepala Kantor Perizinan Kabupaten Labusel tidak mengeluarkan izin galian C tersebut. Sebab, mereka mendapat informasi hingga saat ini izin galian C itu ditengarai belum ada. Terpisah Kepala Badan Perizinan Pelayanan dan Terpadu (BPPT) Zulkarnain Siregar ketika dikonfirmasi mengatakan, hingga saat ini belum ada izin dikeluarkan untuk operasioal penambangan galian C di Sungai Kanan. “Memang belum ada izinnya itu. Saya belum melihat ada permohonan masuk untuk operasioanl galian C itu,” katanya. (mhr)



30 Agustus 2012

GADIS 20 TAHUN TEWAS MELEPUH RUMAH TERBAKAR SAAT LISTRIK PADAM SIBOLANGIT- Kediaman Salam Sinuhaji (60), Jalan Jamin Ginting Desa Bingkawan, Kecamatan Sibolangit, Deli Serdang, terbakar, Selasa (28/8) malam. Akibat kejadian, anak gadisnya yang berusia 20 tahun, Rika br Sinuhaji, tewas melepuh dijilat api.

„ Eni, pembantu yang membobol kartu ATM majikan Rp3,5 juta. Kini ia diamankan polisi.

Pembantu Bobol ATM Majikan HAFAL NOMOR PIN SAAT BELANJA JAKARTA- Wanita pembantu ini tak bisa dipercaya. Berulangkali dimintai majikannya mengambil uang dengan kartu ATM, ia menghafal nomor PIN-nya. Lalu diam-diam ia membobol Rp3,5 juta saat majikannya tidur. Aksi Eni (18) terungkap ketika majikanya Silvia Hakim memeriksa saldo ATM miliknya. Wanita 32 tahun itu kaget karena ada pengeluaran di luar perhitungannya. Upayanya menanyakan persoalan ATM yang bobol pada wanita pembantu rumah tangga (PRT) itu tak mendapat jawaban memuaskan. Kapolsek Tanjung Duren Kompol Dwi Indra Laksmana SIK mengatakan, kasus terungkap setelah korban memeriksa tas pembantunya. “Korban menemukan struk pengambilan uang Rp500.000 dari nomor ATM-nya,” ujarnya. Temuan barang bukti itu dilaporkan istri pengusaha plastik U P JiM C B A E R N L R O P M U S Z Iu A V rep ••C gg1 S ff4 S 44pA G 734j3 ajA V n,U igD iH nutodB cD etpigIC m eA pii6 0 7A 8 2sa1 6 9 B A R U M L O S U K Ib 53 3 :a7234m u R S Ibp905ndA R 5 2 D P. U P 0K ahU rn2;tt0 A E S X G aF skkVi nU rT lus,4H s0 eV T :nK rb8 :I3 2 8 3 7 0 0 5 O R M P OL N A R B U ccN P C yykcD 1gE Jb U pU 2aP15 P iyZ M y,p V P V E S w 43534dw S G 09k5rcttbE V pB gD a,1 tA o8 cg0 snZ ,u.1rab agt.rtd 5 0 8 8 2 A u l Husni (37) ini ke polisi. eO .daU H i3 uaase.2 Ade Memimpin anak buahnya, Kanit Reskrim Polsek Tanjung Duren AKP Budi Setiadi langsung menjemput Eni di kediaman majikan di Apartemen Meditrania Tanjung Duren, Senin (27/8) malam. Dengan bukti tertulis, Eni tak bisa berkelit. Ia mengakui semua perbuatannya. Ibu dua anak asal Sukabumi, Jawa Barat, yang sudah 8 bulan bekerja pada Silvia dengan gaji Rp700.000 sebulan itu mengaku dipercaya majikan untuk belanja dengan ATM. Katanya, setiap pagi ia belanja berbagai kebutuhan dapur sesuai menu yang akan dimasak.

“Sekali belanja bisa Rp200.000 sampai Rp300.0000, bahkan kalau perlu bisa menambah hingga Rp500.000. Semua itu dibayar pakai ATM sampai-sampai saya hafal nomer PIN seperti yang disebutkan majikan,” ungkapnya. Majikan Tidur Melihat kemudahan mengeluarkan uang serta majikan yang dianggap tak memeriksa saldo dalam ATM, timbul niat jahat Eni. Ia pun membobol ATM itu Rp1 juta. Ditunggu berhari-hari majikan dianggap tak curiga, ia mengulang menggesekkan kartu itu untuk mengambil Rp1 juta. “Karena tak pernah ada teguran, saya jadi ketagihan,” ujarnya. Maka, Eni kembali mengambil Rp200,000, Rp500.000 dan terakhir Rp800.000. Tercatat, dalam seminggu, uang Rp3,5 juta dibobol dari ATM majikannya. Eni mengaku pembobolan dilakukan saat majikannya tidur. Kartu yang disimpan Silvia dalam dompet diam-diam diambilnya lalu ia keluar mencairkan uang sesuai keinginannya dan kembali ke apartemen sebelum majikannya bangun. Kartu itu dikembalikanya ke tempat semula. Eni mengaku uang curian itu dipakai untuk membayar utang teman di kampung. Sisanya digunakan untuk membeli pakaian. “Sekarang saya menyesal. Ibu begitu baik dan percaya sama saya. Tapi saya nggak bisa membalas kebaikannya,” katanya. (pk/int)

Foto Roy

„ Jenazah Rika, gadis yang tewas melepuh setelah kediamannya terbakar, diratapi keluarga, Rabu (29/8).

Ayah Tiri Setubuhi Bocah 5 Tahun DIAJAK MENEMANI BUANG AIR KECIL SIMALUNGUN- Bunga, bocah berusia lima tahun, dicabuli ayah tirinya Parulian Nainggolan (35), warga Aek Bottar Nagori Buntu Bayu, Kecamatan Hatonduan. Bunga disetubuhi saat ia membangunkan ayahnya dan mengajak ke kamar mandi untuk menemaninya buang air kecil. Hal itu terungkap pada persidangan yang digelar di PN Simalungun dipimpin majelis hakim Monalisa beranggotakan Silvia Ningsih, Rabu (29/8). Menurut Jaksa Penuntut Umum (JPU) Josron Malau, perbuatan pria yang bekerja sebagai petani itu melanggar pasal 81 ayat 1 No 23 Tahun 2002 tentang Per-

lindungan Anak. “Peristiwa berlangsung, Minggu (22/4) sekira pukul 23.00 WIB, di kediaman mereka. Saat itu terdakwa tidur bersama Bunga di kamar belakang. Kemudian korban yang merupakan anak tirinya membangunkan terdakwa dengan mengatakan ‘Pak kawani aku kencing ke kamar mandi. Aku tidak bisa menghidupkan lampu!” ungkap jaksa. Lalu terdakwa bangun dan membawa korban ke kamar mandi. Saat itu terdakwa menghidupkan lampu kamar mandi dan masuk bersama dengan korban. Setelah itu dengan polosnya korban membuka celana dan kencing. Sementara ter-

dakwa yang tepat berada di samping korban, juga membuang air kecil. “Ternyata terdakwa melihat kemaluan korban hingga timbul birahinya. Selanjutnya terdakwa mencabuli dan menyetubuhinya,” terangnya. Melihat tindakan terdakwa, korban langsung menangis karena kesakitan. “Untuk mengalihkan tangisan itu, terdakwa memandikan korban. Setelah itu, ia membawa anak tirinya itu ke kamar tidur,” sebut Malau. Sementara dari hasil visum, ditemukan memar dan biru di alat kelamin luar. Selaput dara robek di posisi jam2, 3, 7,9 dan sampai ke dasar. (mua/hez)

Informasi dihimpun menyebutkan, malam itu Salam yang tak memiliki mesin genset, menyalakan lampu teplok dikediamanmerekayangsekaligustempatusahanya.Sebab aliran listrik di kampung mereka sedang padam. Kebetulan, salah seorang anak Salman yang bernama Rika Br Sinuhaji, diketahui bekerja sebagai karyawati di Hill Park Sibolangit, baru saja selesai mandi dan masuk ke kamar untuk mengganti pakaian. Salman bersama isterinya Kumpul Br Sembiring (55) dan dua anak lainnya berkumpul di ruang tamu. Sedangkan Ricard, putra sulungnya sedang memancing di sungai. Tanpa diketahui pasti, api yang berasal dari lampu teplok yangmerekanyalakantiba-tibamenyambarbarang-barang yang mudah terbakar. Beberapa saat kemudian, api semakin membesar dan kepulan asap memenuhi seluruh ruangan, termasuk kamar Rika. Tahu rumahya terbakar, Salman bersama isteri dan dua anaknya langsung berlari ke luar untuk menyelamatkan diri sembari berteriak kebakaran. Masyarakat sekitar yang melihat rumah Salam terbakar secara sukarela berdatangan untuk memberi bantuan manual, sekaligus melaporkan kejadian ke Polsek Pancurbatu. Untuk memudahkan upaya pemadaman, warga pun menghentikanbeberapaunittruktangkiairyangdatangdari arah Sibolangit. Saat mendengar ada teriakan minta tolong dari salah satu kamar rumah Salam, dengan gesit dan tanpa memikirkanresiko,Tamatyangmerupakantetanggakorban langsung meringsek masuk setelah sebelumnya mendobrak pintu kamar. Ternyata, suara teriakan itu adalah Rika Br Sinuhaji yang merupakan anak ke tiga Salman. Rika tak bisa lagi menyelamatkan diri karena seluruh ruangan kamarnya dipenuhi asap. Bahkan, sekujur tubuh dan wajahnya juga sudah melepuh karena terjilat kobaran api. Setelah berhasil mengeluarkan Rika dari kamar, kedua orangtuanya dibantu warga, langsung melarikan Rika ke tempat pengobatan alternatif di kawasan Namo Pecawir, Kecamatan Pancurbatu. Tak lama kemudian, petugas Polsek Pancurbatu yang dipimpin langsung Kanit Reskrim AKP P Samosir, turun ke TKP untuk melakukan penyelidikan. Setibanya di sana, kobaran api sudah berhasil dipadamkan. Selanjutnya, petugas mengamankan sisa barang yang terbakar sebagai barang bukti. Karena kondisi luka bakar yang cukup parah, pada Rabu (29/8) sekira pukul 06.00 WIB, nyawa Rika akhirnya tak tertolong lagi. Jenazah Rika langsung disemayamkan ke Bingkawan untuk selanjutnya dikebumikan. Kapolsek Pancurbatu Kompol Darwin Sitepu melalui KanitReskrimAKPPSamosirsaatdikonfirmasimengatakan, asal api diduga kuat karena lampu teplok yang dinyalakan si pemilik rumah menyambar barang yang mudah terbakar. Bahkan, tabung gas elpiji yang berada di dapur rumah juga sempat meledak karena tersambar kobaran api. “Dalamkaitanitu,kitasudahmengamankanbarangbukti danmemintaketeranganpemilikrumahdansejumlahsaksi mata,” ujar Samosir. Pantauan METRO di Jambur Bingkawan, Rabu (29/8) pagi, terlihat kedua orangtua berikut keluarga korban meratapi kepergian korban. Mereka tak menyangka, gadis yangdikenalramahdanmurahsenyumitumeninggaldunia dengan cara yang tragis. Apalagi, kondisi korban cukup mengenaskan, sekujur tubuh dan wajahnya sudah hitam karena hangus terbakar. Bahkan, rambutnya juga sudah tak terisa lagi. (roy/smg)


30 Agustus 2012

Presiden Tunggu Surat Resmi DPR Soal Darurat Komnas HAM

JAKARTA- Masa kerja komisioner Komnas HAM akan berakhir pada 30 Agustus 2012, namun Komisi III DPR belum juga melakukan fit and proper test terhadap 30 calon anggota Komnas HAM. Presiden SBY menunggu surat resmi dari DPR sebelum mengambil sikap menyangkut nasib Komnas HAM. ”Itu kan sebenarnya dikatakan akan ada surat dari DPR kepada Presiden. Saya sudah cek tidak ada surat dimaksud belum ada di meja kami. Kami belum bisa memberikan sikap maupun pandangan apaapa,”kata Jubir Kepresidenan, Julian Aldrin Pasha, Rabu (29/8). Menurut Julian, Presiden akan segera mengambil keputusan setelah surat dari DPR diterima. Baik dalam bentuk Perppu maupun Keppres sesuai keperluan untuk memastikan dasar hukum Komnas HAM y a n g masa


kerjanya akan segera habis. ”Jadi kami menunggu surat dari DPR,” kata Julian. Masa kerja komisioner Komnas HAM akan berakhir pada 30 Agustus 2012, namun Komisi III DPR belum juga melakukan fit and proper test terhadap 30 calon anggota Komnas HAM. Komisi III DPR pun melempar bola kelanjutan Komnas HAM ke Presiden. Komisi III DPR menyadari keterlambatan fit and proper test anggota Komnas HAM bisa berdampak pada kevakuman Komnas HAM. Karena itu secepatnya Komisi III akan meminta pimpinan DPR meminta Presiden SBY segera mengeluarkan aturan memperpanjang masa kerja komisioner Komnas HAM. ”Kita serahkan kepada pimpinan DPR berkonsultasi dengan Presiden dan mengambil langkah sesuai dengan ketentuan yang berlaku agar tidak ada kevakuman,”kata Ketua Komisi III DPR Gede Pasek Suardika. Komnas HAM menemui Wakil Ketua DPR, Priyo Budi Santoso, pada tanggal 16 Agustus 2012 lalu untuk menyetorkan nama-nama hasil seleksi calon komisioner. Ada 30 nama calon komisioner Komnas HAM. (dtc/int)

Afriani Divonis 15 Tahun Sekelompok Tentara AS Berencana Bunuh Obama SAVANNAH- Sekelompok tentara Amerika Serikat (AS) membentuk sebuah milisi anarkis dan menghabiskan dana 87.000 dollar (Rp 829 juta) untuk persenjataan dalam rangka menggulingkan pemerintah dan akhirnya membunuh Presiden Barack Obama. Demikian menurut sebuah dakwaan pengadilan terhadap para tentara itu seperti dilaporkan Daily Telegraph, Selasa (28/8). Mereka dituduh telah membentuk sebuah kelompok yang disebut FEAR, singkatan dari Forever Enduring Always Ready, dan membeli sebidang tanah di Negara Bagian Washington. Dari tanah itulah nantinya mereka akan melancarkan serangan. Mereka dikatakan sudah berencana untuk meledakkan sebuah bendungan dan meracuni ladang apel di Negara Bagian Washington, mengebom taman di Savannah, Georgia, menyerang kendaraan-kendaraan milik para karyawan Departemen Keamanan Dalam Negeri, dan mengambil alih sebuah pusat kontrol amunisi di markas tentara yang luas di Fort Stewart, Georgia. Para jaksa mengatakan, tujuan jangka panjang mereka adalah revolusi, menjatuhkan pemerintahan AS dan membunuh Presiden Barack Obama. Namun tidak diketahui kapan dugaan persekongkolan itu akan terjadi. Rincian tentang milisi tersebut terungkap dalam proses pengadilan sipil di Georgia di mana tiga tentara telah dituduh melakukan pembunuhan. Prajurit Isaac Aguigui, yang diidentifikasi sebagai pendiri dan pemimpin FEAR, Sersan Anthony Peden, dan Prajurit Christopher Salmon, didakwa atas kematian seorang mantan tentara, Michael Roark (19 tahun), dan pacarnya Tiffany York (17 tahun). Kedua korban diduga dibunuh di hutan di Georgia Desember lalu, demi menjaga rahasia keberadaan milisi tersebut. Terdakwa keempat dalam kasus itu, Prajurit Michael Burnett (26 tahun), mengakui dua tuduhan pembunuhan pada hari Senin. Dia bersikap kooperatif dengan para jaksa dalam sebuah kesepakatan yang akan memungkinkan dia terhindar dari hukuman mati. (dtc/int)

JAKARTA- Afriani Susanti dijatuhi hukuman 15 tahun penjara oleh Majelis Hakim Pengadilan Negeri Jakarta Pusat. ”Terbukti salah dan meyakinkan terdakwa dengan sengaja mengemudikan kendaraan bermotor dan mengakibatkan orang lain meninggal dunia, menjatuhkan pidana penjara selama 15 tahun,” Ujar Ketua Hakim Pengadilan Negeri Jakarta Pusat Antonius Widiyanto saat membacakan vonis di ruang sidang R Wirjono Prodjodikoro, Pengadilan Negeri Jakarta Pusat, Rabu (29/8). Menurut majelis hakim, Afriyani tak terbukti bersalah dalam dakwaan pertama Jaksa Penuntut Umum (JPU) Pasal 338 KUHP tentang pembunuhan. ”Sebelum mengemudikan mobil Daihatsu Xenia terdakwa tidak mempunyai niat secara jelas akan menabrak korban-korban diatas trotoar. Unsur sengaja tidak terbukti, dengan demikian terdakwa bebas

„ Afriani Susanti dari Pasal 338,” tuturnya. Sementara untuk Pasal 311 ayat 4 Afriyani terbukti bersalah karena mengemudikan kendaraan bermotor dalam kondisi yang membahayakan nyawa orang lain.

Terlebih setelah meminum pil ekstasi di Stadium, Jakarta. ”Dengan kondisi demikian sudah seharusnya terdakwa mengetahui kondisinya agar tidak mengemudi karena dapat membahayakan pengguna jalan lainnya. Namun terdakwa justru membawa mobil Daihatsu Xenia. Unsur dengan sengaja membawa kendaraan bermotor dalam kondisi membahayakan nyawa orang lain terbukti,” papar Majelis Hakim. Terkait kasus narkoba, majelis hakim menilai Afriani tidak terbukti pasalnya tidak ditemukan barang bukti. Majelis hakim menilai hal-hal yang meringankan terdakwa yaitu berlaku sopan dan tidak pernh dihukum. Sementara yang memberatkan perbuatan terdakwa telah memberikan duka yang mendalam bagi korban luka dan korban meninggal dunia. Selain itu, perbuatan terdakwa juga dianggap meresahkan masyarakat. (dtc/int)

„ Para pimpinan KPK memberikan penjelasan terkait penanganan kasus Simulator SIM.

Kasus Simulator SIM

4 Perwira Polisi Diperiksa JAKARTA- Komisi Pemberantasan Korupsi (KPK) menjadwalkan pemeriksaan empat anggota kepolisian terkait kasus dugaan korupsi proyek simulator surat izin mengemudi (SIM), Rabu (29/ 8). Mereka diperiksa dalam kapasitas sebagai panitia lelang proyek simulator SIM. “Diperiksa sebagai saksi untuk tersangka DS (Djoko Susilo),” kata Kepala Bagian Pemberitaan dan Informasi KPK Priharsa Nugraha di Jakarta, Rabu. Keempat polisi itu adalah Ajun Komisaris Besar Wisnu Budaya, Ajun Komisaris Besar Wandi Rustiwan, Komisaris Endah Purwaningsih, dan Komisaris Ni Nyoman Suwartini. Hingga pukul 14.00, keempat anggota kepolisian itu belum memenuhi panggilan pemeriksaan KPK. Menurut Priharsa, KPK sudah mengirim panggilan pemeriksaan kepada empat anggota polisi itu sejak 15 Agustus 2012. Dalam kasus simulator SIM ini, KPK menetapkan empat tersangka atas dugaan melakukan penyalahgunaan kewenangan sehingga menimbulkan

kerugian negara. Selain Djoko, tiga orang lain yang jadi tersangka adalah Brigadir Jenderal (Pol) Didik Purnomo dan dua pihak swasta, masing-masing Budi Susanto dan Sukotjo S Bambang. Ketiga tersangka terakhir itu juga ditetapkan sebagai tersangka oleh Kepolisian Republik Indonesia. Sejauh ini, KPK belum memeriksa Djoko. Wakil Ketua KPK Busyro Muqoddas kemarin mengatakan bahwa KPK masih fokus memeriksa saksi dan mendalami barang bukti yang diperoleh. Sebelumnya, KPK memeriksa Sukotjo S Bambang sebagai saksi untuk Djoko. Selain itu, KPK memeriksa Sekretaris Budi Susanto yang bernama Intan Pardede. (kmc/int)

KPK Kejar Tersangka Lain Kasus Angie JAKARTA- Komisi Pemberantasan Korupsi (KPK) telah melimpahkan kasus Angelina Sondakh ke pengadilan. KPK memastikan, untuk kasus suap terkait Wisma Atlet ini tidak hanya menjerat Angie. Kasus masih akan berlanjut dengan melihat fakta di persidangan. ”Pengembangan kasusnya biasanya caranya adalah proses pemeriksaan di pengadilan itu dijadikan bagian dari proses pengembangan yg punya kaitan dengan potensial

suspect yg lain,” jelas Wakil Ketua KPK Bambang Widjojanto di gedung KPK, Jalan HR Rasuna Said, Kuningan, Jakarta, Rabu (29/8). Bambang mengatakan bahwa pengembangan kasus itu tidak berhenti. Selain menunggu fakta di persidangan, KPK juga terus melakukan pengumpulan bukti-bukti. ”Itu digodok. Artinya diinvestigasi, dikumpulkan bukti-buktinya untuk kemudian apakah ini bisa lantas di lidik lalu disidik,” lanjut Bambang Bambang juga menuturkan bahwa

penyidik nanti akan melihat rangkaian keterangan yang didapat sehingga bisa membuktikan bahwa ada orang lain yang terlibat kasus ini atau justru sebaliknya. ”Jadi semua penyidik dalam penyelidikan itu pasti melihat rangkaian keterangan yg memungkinkan orang lain terlibat. Tapi bisa juga mengklarifikasi kalau orang lain itu tdk terlibat. Nah proses itu yg sedang berjalan. Saya belum tahu hasil dari proses itu,” tutur Bambang. (dtc/int)

„ Wakil Ketua KPK Bambang Widjojanto.

KPK Segera Periksa Tersangka Kasus Hambalang JAKARTA- KPK segera melakukan pemeriksaan atas Dedy Kusnidar di kasus Hambalang. Dedy merupakan tersangka pertama di kasus Hambalang. Dedy belum pernah diperiksa KPK. ”Yang saya dengar dari penyidik, pemeriksaan terhadap Dedy segera. Tapi dugaan saya tidak dalam minggu ini,” jelas Wakil Ketua KPK Bambang Widjojanto di KPK, Jl Rasuna Said, Kuningan, Jakarta, Rabu (29/8). Bambang menjelaskan, keterangan Dedy yang Kepala Biro Keuangan dan Rumah

Badai Hantam Korsel, 9 Tewas SEOUL- Badai menghantam Korea Selatan diikuti angin kencang dan hujan lebat menyebabkan sembilan orang dan menimbulkan ombak yang menghantamkan dua kapal nelayan China menghantam karang. Tim penyelamat berhasil menyelamatkan 12 nelayan dan masih mencari 10 nelayan lainnya yang hilang setelah kapal mereka menghantam karang di lepas pantai Pulau Jeju. Sebanyak lima nelayan tewas. Di tempat terpisah, sedikitnya empat orang tewas saat Badai Bolaven memutuskan sambungan listrik ke ratusan ribu rumah di Korea Selatan, menyebabkan penerbangan ditunda, dan menghentikan latihan gabungan antara militer Amerika Serikat dan Korsel. Korea Utara yang masih berjuang memulihkan diri akibat banjir dan kekeringan kini berada dalam jalur badai tersebut. (dtc/int)

„ Angelina Sondakh

Tangga Kemenpora ini penting untuk membuka informasi lainnya terkait kasus Hambalang. ”Dedy jadi penting setelah kita dapat klarifikasi, konfirmasi, dan keterangan lain-lainnya,” tuturnya. Bambang juga menegaskan, KPK tidak berhenti pada Dedy. Penyidikan terus berjalan mengejar tersangka lain. “Selain penyelidikan yang Dedy kan tetap jalan. Tidak pernah ada dalam statement KPK Dedy adalah anak tangga terakhir. Yang ada, Dedy anak tangga pertama,” tuturnya. (dtc/int)

Tina Talisa Melapor ke Dewan Pers JAKARTA - Anggota Dewan Pers, Agus Sudibyo membenarkan bahwa kedatangan presenter kondang Tina Talisa terkait soal pemberitaan dugaan penerimaan aliran dana hasil korupsi. Tina melaporkan empat media cetak kepada Dewan Pers. ”Medianya Rakyat Merdeka, Kompas, Warta Kota, sama Berita Kota,” kata Agus saat ditemui di kantor Dewan Pers, Jalan Kebon Sirih, Jakarta Pusat, Rabu (29/8). Menurut Agus, Tina merasa disudutkan oleh pemberitaan keempat media. Pemberitaan yang dibuat keempat surat kabar tidak mencantumkan konfirmasi dari

Tina soal dugaan penerimaan uang haram dari anggota dewan. Padahal, kata Agus, konfirmasi tersebut sangat dibutuhkan karena menyangkut nama baik seseorang. ”Yang kami lihat memang tidak mengandung konfirmasi sama sekali. Padahal, konfirmasi penting dan apalagi ini menyangkut nama baik orang,” papar anggota Dewan Pers bidang Pengaduan Masyarakat dan Penegakan Etika ini. Rabu (29/8) siang tadi Tina Talisa mendatangi kantor Dewan Pers bersama Pemimpin Redaksi Indosiar, Nurjaman. Hanya saja, istri pengusaha Amrinur Okta

Jaya itu enggan menjelaskan lebih lanjut soal laporannya kepada Dewan Pers. Sebelumnya, sejumlah media massa nasional memberitakan soal presenter televisi beinisial TT yang menerima aliran dana dari anggota DPR berinisal MA pada pertengahan 2011. Selain itu, MA juga dikabarkan membeli tiga mobil mewah atas nama suami TT berinisial Oct. Antara lain mobil Range Rover tahun 2011 dengan harga Rp 2 miliar, mobil Mercy C200 tahun 2010 seharga Rp 600 juta, dan mobil BMW seri X3 seharga Rp 600juta. (dtc/int)


„ Tina Talisa didampingi Pemimpin Redaksi Indosiar, Nurjaman Mukhtar saat mengadu ke Dewan Pers di Jalan Kebon Sirih, Jakarta Pusat, Rabu (29/8).


30 Agustus 2012

200 Mahasiswa Sumut Terima Bantuan dari Kemendibud MEDAN-Sedikitnya 200 mahasiswa dari 24 Perguruan Tinggi Swasta (PTS) di lingkungan Kopertis Wilayah I menerima beasiswa pendidikan untuk mahasiswa miskin atau dikenal dengan program bidik misi. Hal ini disampaikan Koordinator Kopertis Wilayah I Sumut-Aceh Prof Nawawiy Loebis saat dikonfirmasi, Rabu (29/8). “Untuk kuota pemberian beasiswa bidik misi itu ditentukan dengan populasi masyarakat miskin yang ada di setiap daerah mendapatkan kesempatan pendidikan tinggi sekaligus untuk menepis anggapan pendidikan itu hanya untuk orang kaya semata,” ungkap Nawawiy. Diakui Nawawiy, kuota yang ditetapkan Kemdikbud itu sangat kecil, baik dari jumlah

PTS nya maupun mahasiswa, karena pemerintah lebih memfokuskan kepada program-program studi percepatan pembangunan. “Hal ini sesuai dengan arahan Mendikbud, selain harus dipilih program studi strategis, mulai dari teknik, sains dan pertanian atau agrobisnis, serta akuntansi yang kelihatannya mahasiswanya makin berkurang, juga PTS tersebut harus memiliki akreditasi yang baik,”sebutnya. Tingkat kemiskinan di daerah tertentu katanya juga menjadi pertimbangan, agar yang tidak berkemampuan ekonomi tidak memikirkan jauh-jauh perguruan tingginya. “Jadi kita lihat tingkat kemiskinan di lokasi itu dengan menselaraskan antara tingkat

kemiskinan dan ketersediaan program studi di daerah tersebut untuk menentukan kuotanya,” katanya. Masih menurut Nawawy, jika dilihat dari jumlah PTS yang ada di Sumut dan Aceh hingga mencapai 300-an dengan jumlah mahasiswa hingga mencapai jutaan orang, menurutnya kuota yang diberikan itu sangat minim sekali. Karena itu, dia berharap akan ada penambahan lagi dari Kemdikbud, agar PTS di Sumut dan Aceh secepatnya memperbaiki status akreditasinya, karena syarat penerima bidik misi adalah PTS yang memiliki akreditasi B. Dari 24 PTS penerima beasiswa bidik misi itu antara lain Universitas Muhammadiyah Sumatera Utara sebanyak 42 orang disusul

Universitas HKBP Nommensen dan Universitas Methodist masing-masing untuk 18 orang, UMA 14 orang, Universitas Simalungun 12 orang dan Universitas Abuyatama di Aceh serta Universitas Samudera Langsa hanya 4 orang. Disebutkan Nawawiy, Kemdikbud memberikan 2.000 beasiswa Bidik Misi di PTS, sebagai kompensasi kenaikan harga BBM dan untuk menaikkan angka partisipasi kasar (APK) pendidikan tinggi. “Bidik Misi di PTS baru akan digelar tahun ini. Setiap mahasiswa akan mendapat suntikan dana Rp6 juta untuk satu semester atau Rp1 juta setiap bulan,” katanya. Dia menjelaskan, hanya PTS yang memenuhi syarat akan mendapatkan program

Bidik Misi. Karena itu, harus ada kesepakatan antara Kemendikbud dan PTS sebelum beasiswa Bidik Misi resmi dikucurkan. PTS penerima Bidik Misi tidak bisa lagi menggali partisipasi pendanaan dari mahasiswa miskin penerima beasiswa tersebut. Dalam pemberian beasiswa bidik misi itu, Kemendikbud juga akan mempertimbangkan PTS yang tidak memiliki konflik, baik internal ataupun eksternal. PTS juga tidak boleh ada pelanggaran hukum yang berpotensi mengganggu kegiatan akademisnya. Kemendikbud akan memilih PTS yang rajin melapor ke Koordinasi Perguruan Tinggi Swasta (Kopertis) akan akreditasi kampusnya yakni akreditasi A untuk PTS wilayah Jawa dan B untuk luar Jawa. (uma)

Dahlan Bersihkan Toilet Bandara


Menteri BUMN Dahlan Iskan (kanan) saat membersihkan toilet di Terminal 2 F Bandara Soekarno-Hatta, Selasa (28/8).

Pacari Brondong, Janda Dihajar Keluarga Polisi Sambungan Halaman 1 Kemudian datang lima orang keluarga pacarnya yang merupakan anak seorang perwira polisi. Karena kenal, Dian membuka pintu rumahnya. Eh, keluarga pacarnya tersebut malah bersikap kasar terhadapnya. Ia dilabrak dan dimaki. Dan, ia hanya terdiam. Keluarga polisi ini tidak hanya memaki, bahkan salah seorang yang bernamaMoraBatuara(19)memukul

mata janda manis ini hingga lebam dan merusak rumahnya. “Mora Batuara memukul mataku sampai kayak gini. Terus mereka memecahkankacajendeladanmengobrakabrik isi rumah,” bebernya. Dian mengaku tak tahu-menahu mengapa keluarga AKP Marben ini menganiayanya.”Aku pun gak tau kenapa keluarga mereka menyerangku. Mungkin mereka gak setuju kalau aku pacaran sama anaknya.Kamiudahduatahunjalan.

Sejauh itu, kami cuma pegangpegang tangan,” aku janda berbaju putih ini. Selain mata lebam dan rumah rusak, handphone (HP) miliknyapunRaibsaatkejadian.“HPku pun entah ke mana mungkin dirampas mereka,” celoteh janda ini. Menurutnya, memang sebelum diserang keluarga polisi itu, Mora Batuara sering mengirim pesan dengan perkataan-perkataan kasar bahkan hampir seluruh keluarga pacarnya memusuhi janda ini. “Aku

udahgakmaulagiamadia.Nantipikir keluarganya aku morotin hartanya. Padahal aku pun bisa nyari uang sendiri,” ucapnya menangis. Sementara itu, aparat Polsek Medan Sunggal yang menerima laporanjandainilangsungmengecek tempatkejadianperkara(TKP).”Udah kita suruh anggota mengecek TKP dan laporan juga udah kita terima,” ujar Kanit Reskrim Polsek Medan Sunggal AKP Victor Ziliwu. (Mri/ pmg)

Pengibar Bendera Pertama Terbaring di Rumah Sakit Sambungan Halaman 1 dalam Pancasila yaitu kesejahteraan sosial bagi seluruh rakyat Indonesia. “Perjuangan merebut kemerdekaan dan mempertahankan kemerdekaan itu adalah hal yang sangat luar biasa sulitnya. Harta kita serahkan bahkan nyawa juga sudah kita relakan demi kemerdekaan agar rakyat tidak lagi tertindas,” ucapnya. Diceritakan pria kelahiran tahun 1926 itu, pada hari Jumat tanggal 17 Agustus 1945 dia bersama beberapa rekan juangnya yang lain menerima telegram dari pusat perjuangan di Kotanopan bahwa Ir Soekarno mendeklarasikan kemerdekaa bagi rakyat Indonesia. Lantas, saat itu juga dia bersama rekannya mencari kain di pasar lalu mejahitkannya dan kemudian menaikkannya di pinggir jalan yang sekarang dikenal sebagai Jalan Merdeka, Kelurahan Kayu Jati, tepatnya di sekitar kantor Koramil 013 Panyabungan. Meskipun kemerdekaan itu sudah dideklarasikan, sambungnya. ketika itu seluruh masyarakat Panyabungan was-was dan khawatir bercampur takut serta gelisah. Betapa tidak mereka saat itu mendapat tekanan dari pihak bagas godang harajaan dan banyak yang menyampaikan kontraversi dari masyarakat. “Banyak yang menanyakan

kami bahkan dari keluarga bagas godang sendiri menanyakan, siapa yang berani menaikkan bendera merah putih itu. Namun, mengingat banyak kontraversi kami pun tidak berani berterusterang soal bendera yang naik karena kami takut dilaporkan ke intelijen Hukugunco (pimpinan wilayah pada pemerintahan Jepang),” beber Amran ditemani anaknya Ir Syahrul Nasution. Namun, sambung Amran Nasution, beberapa waktu setelah itu pusat membentuk laskar rakyat dan PESINDO yaitu suatu lembaga yang dipersiapkan untuk menyampaikan kabar kemerdekaan itu kepada seluruh masyarakat. ”Saya termasuk di dalamnya. Kami sengaja membuat siasat dan sandiwara agar misi kami tidak diketahui oleh Pemerintahan Jepang saat itu. Kami bentuk tim yang semuanya dari kaum muda untuk mengumpulkan dana. Lalu kami berangkat ke seluruh kampung untuk menyampaikan kemerdekaan. Orang-orang pada saat itu menganggap (kami) tidak benar bahkan mereka sempat memusuhi karena takut dengan penculikan yang kerap terjadi ketika itu,” ungkapnya. Akhirnya setelah berjuang baik secara tenaga dan harta, beberapa bulan saja kabar kemerdekaan itu sudah sampai ke seluruh masyarakat, dan rasa ketakutan warga itu semakin hari semakin berkurang.

METRO TABAGSEL Koran Kebanggaan Orang Tabagsel

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel ) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh : Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tabagsel : Pj. Pimred Metro Tapanuli : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Muhiddin Hasibuan Pandapotan MT Siallagan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

”Perjuangan kami bukan di situ saja, tetapi kami juga sempat mengerahkan seluruh kaum pemuda untuk membantu pasukan baris-berbaris (TNI) di Benteng Huraba untuk mengusir penjajah. Waktu itu saya bertugas sebagai pengantar makanan dan seluruh keperluan pasukan kita dengan menyusup ke tengahtengah hutan untuk menghindari musuh, yang terpikir saat itu bagaimana agar tidak ada ada lagi penjajahan dan penindasan biarkanlah semua harta benda kami korbankan yang kami miliki hanya tinggal pakaian di badan saja,” tambahnya sambil menangis mengenang perjuangan mereka. Diakui Amran, dari pengalamannya mulai dari masa penjajahan hingga bangsa Indonesia berhasil mengusir para penjajah, modalnya hanyalah persatuan dan kesatuan dan meghilangkan semua perbedaan dan kepentingan serta berazaskan nasionalis dan idealis. “Hanya itu modal kami, kecintaan kepada bangsa ini tidak lain tujuannya bagaimana agar bangsa ini tenteram, dama dan rakyatnya tidak terjajah artinya masyarakat bisa memperoleh kesejahteraan itu,” tambahnya. Dan apabila dibandingkan dengan kondisi semangat pemuda saat ini, dikatakan Amran Nasution sangat jauh berbeda dengan semangat persatuan

mereka meskipun dalam suasana yang sudah berbeda. “Kami akui suasana dan situasinya tidak seperti dulu lagi, tetapi setidaknya nilai-nilai leluhur yakni mencintai negara kita tidak luput dari diri dan jiwa penduduk bangsa kita khususnya bagi pemuda. Marilah kita cintai kemerdekaan kita ini dengan mempererat persatuan dan kesatuan serta menghilangkan sgala perbedaan dan mengedepankan musyawarah jangan sampai kepentingan pribadi itu menjadi tujuan. Di sinilah rusaknya moral dan etika kita sebagai warga Negara yang merdeka dari penjajahan. Pemuda harus menjadi pertahanan stabilitas masyarakat. Jangan sampai pemuda kita menjadi perusak,” ujarnya. Dan kepada pemerintah khususnya Pemkab Madina, Amran berpesan agar jangan membiarkan rakyatnya terpuruk, membiarkan masyarakatnya miskin dan sengsara. “Bangunlah musyawarah dan diskusi yang baik dengan berbagai elemen masyarakat demi tercapainya pembangunan itu, karena ruh dan cita-cita kemerdekaan itu adalah pembangunan. Membangun jiwa pemuda dengan mendidiknya menjadi manusia yang berilmu pengetahuan dan berakhlakul karimah serta mewujudkan kesejahteraan bagi masyarakat,” pesan Amran Nasution. (wan)

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN

JAKARTA - Upaya mendorong perbaikan layanan publik terus dilakukan. Kali ini, Menteri Badan Usaha Milik Negara (BUMN) Dahlan Iskan bahkan harus sampai membersihkan toilet bandara untuk menunjukkan pentingnya kebersihan fasilitas di tempat publik. Kepala Bagian Humas dan Protokoler Kementerian BUMN Faisal Halimi mengatakan, hal tersebut terjadi ketika Dahlan berada di Terminal 2 F Bandara Soekarno-Hatta sebelum berangkat ke Surabaya sekitar pukul 15.00 WIB. “Pak Dahlan ke toilet kemudian melihat tempatnya kotor, jadi langsung inisiatif untuk bersih-bersih di toilet itu,” ujarnya ketika dihubungi, Selasa (28/8). Faisal menceritakan, awalnya Dahlan hanya bersih-bersih sendiri. Namun, beberapa saat kemudian, beberapa petugas kebersihan atau cleaning service yang melihat dan mengenali Menteri BUMN, kemudian ikut membantu membersihkan lantai toilet yang kotor karena air serta jejak-jejak sepatu dengan kain pel. Sebagai gambaran Terminal 2 Bandara Soekarno-Hatta digunakan untuk penerbangan internasional dan domestik. Terminal 2 D dan 2E digunakanuntukpenerbanganinternasionaloleh

maskapai swasta/asing maupun Garuda Indonesia. Adapun Terminal 2 F digunakan untuk penerbangan domestik oleh Garuda Indonesia dan Merpati Nusantara Airlines (MNA). Menurut Faisal, Dahlan sempat kesal dengan kondisi toilet yang kotor tersebut. “Tidak ada gunanya petugas (bandara) jemput saya kalau lantai dan bandaranya jorok. Tidak perlu jemput saya,” ucap Faisal menirukan Dahlan. “Pak Dahlan mengulang beberapa kali perkataan tersebut,” imbuhnya. Faisal mengatakan, beberapa bulan lalu, Dahlan juga sempat marah di toilet Terminal 2 F Bandara Soekarno-Hatta karena kondisinya yang kotor. Karena itu, begitu mendapati kondisi toilet yang masih kotor, Dahlan pun langsung turun tangan untuk membersihkannya sendiri. Sementaraitu,TriS.Sunoko,DirekturUtamaPT Angkasa Pura II yang mengelola Bandara Soekarno-Hatta mengatakan, pihaknya belum mendapat info terkait kondisi toilet bandara yang kotor. Menurut dia, kemungkinan ada beberapa bagian yang terlihat kotor karena padatnya penumpang pada musim arus balik Lebaran. “Nanti saya akan cek,” ujarnya. (owi)

Kompartemen C41 & C48 TPL Diduga Tak Miliki RKT Sambungan Halaman 1 tersebutdibukatanpamengantongiizindariDinas Kehutanan. Artinya, PT TPL membuka lahan itu tanpaadapersetujuan.Namun,tetapsajalahanitu dibuka menjadi Hutan Tanaman Industri (HTI). Padahal, sebelum membuka lahan baru, perusahaan harus mendapatkan izin dari dinas kehutanan. “Memang betul, bahwa mereka menebangkayualamtanpaadasuratizin.Mereka (PT TPL, red) tidak bisa menunjukkan izin RKT,” ungkapsumber,Selasa(28/8)diBalige. Bukan hanya itu, PT TPL membabat habis kayu alam yang berada di lokasi dan menjadikannya sebagai kayu olahan. Sumber juga menyebutkan, pengolahan kayu alam menjadi kayu olahan telah melanggar ketentuan. “Seharusnya, kayu itu dipotong kecil-kecil dan dibuang, bukan diolah menjadi bahan jadi,” ujarnya seraya mengatakan bahwakasusinidimintasegeradiusut. Sumber lain menyebutkan, kompartemen C41 danC48dulunyasaratdenganmasalah.Diantaranya adalah, penebangan yang dilakukan PT TPL dilakukan di luar area. Dilanjutkannya, kayu alam tersebutbolehdimasukkankesawmilluntukdiolah menjadi kayu olahan dengan tujuan meraih keuntungan. “Masalahnya,apabenarkeuntungan itumasukkeperusahaanataukekantongpribadi.Di situlah letak permainannya,” kata dia. Lebih jauh diterangkannya, kayu alam yang dimasukkan ke sawmill mempunyai batasan tertentu. Kayu yang diperbolehkan diolah tidak melebihi sebesar lima persendarijumlahkayuyangdiambil. “Itu tertuang dalam RKT yang dikeluarkan oleh dinas kehutanan. Berapa luas tebangan dan keperluannyauntukapa,”tandasnya. Masih dikatakannya, PT TPL yang diduga tidak memiliki izin RKT dari dinas kehutanan di kompartemen C41 dan C48, bisa dibawa ke ranah hukum.Perusahaanbisasajadituntutkepengadilan jikaadapengaduandaridinaskehutanan. “Boleh saja diadukan, yang mengadu tentu adalahdinaskehutanan,”jelasnya. Terkait hal tersebut, Humas PT TPL Lambertus

Siregarketikadikonfirmasi,kemarin,menegaskan pihaknya memiliki izin. Sebaliknya, Lambertus mempertanyakan siapa yang mengatakan kompartemenC41danC48tidakmemilikiizin. “Tidak mungkin itu, segala kegiatan kita apalagi terkaitpenebanganmemilikiizin.Kalautidak,bisa ditangkapolehdinaskehutanan,”tegasnya. LambertusmengungkapkanRKTdiperolehdari Rencana Kerja Umum (RKU) yang dikeluarkan berdasarkansuratkeputusan(SK).DariRKU,maka dikeluarkanlahRKTolehdinaskehutanan. “Tidak ada kemungkinan kami bekerja tanpa surat izin,” tuturnya.Lebihlanjutdiutarakannya,ketentuansoal pengolahan kayu diatur menurut kondisi hutan yang akan ditebang. “Memang ada ketentuannya danhalitusebelumnyasudahdiberitahukan.Semua kegiatan kita dapat dipertanggungjawabkan,” tambahnya. Pembukaan lahan baru di Aek Raja Desa Sigulo Tapanuli Utara dilakukan pada tahun 2009 lalu. Sehingga menurut Lambertus, hal tersebut sudah lamaterjadi.Padasaatitu,sektorAekRajaditangani olehThomasSaragih. “Karenaapayangmenjadititikpersoalannyatidak begitujelasdansudahtigatahunberlalu.Sayatanya dululahThomasSaragih,”ujarLambertus.Mantan KadisKehutananTaputIrYunusCHutaurukketika dikonfirmasiMETRO,kemarin(28/8)menuturkan, setiap melakukan penebangan pohon dan melakukanpenanamaneucalyptus,PTTPLharus memiliki RKT yang dikeluarkan oleh Dinas Kehutanan Provinsi dan ditembuskan ke kabupaten yang mempunyai lahan konsesi di kabupaten tersebut. Karena kalau tidak ada, maka TPL enggak bisa melakukan penebangan dan penanaman. Ketika ditanya apakah PT TPL tidak mempunyaiRKTpadatahun2009diAekRaja,Yunus Hutaurukmengakukurangtahu.SebabsejakApril 2009,dirinyasudahmenjadistafahlibupati. “Sayatidakingatlagi.TapikalauPTTPLmelakukan penebangan, memang harus punya RKT,” ujar Yunus.“Sebagaiperusahaanpublik,tidakmungkin PT TPL tidak mempunyai RKT,” pungkasnya. (cr03/cr-02)

Dianggap Mampu Lestarikan Sungai Sambungan Halaman 1 Sebab,terangwargaKelurahanWEKVKecamatan Psp Selatan, Kota Psp ini, sungai-sungai tersebut merupakansumberkehidupandanasetyangsangat berhargayangmenjaditanggungjawabbersama. Namunpadakenyataannya,setiaptahun,kondisi sungai sangat memprihatinkan, debit airnya terus menurun,sungaimenjadikumuhakibatsampahdan lainnya. Padahal, banyak warga yang bergantung terhadapairsungaitersebutsepertiuntukmengairi areal pertanian masyarakat, mencuci, mandi dan sebagainya. Ironisnyalagi,tambahDasopang,sungaitersebut malahmenjaditempatpembuangansampahdan minimpenghijauandisepanjangbantaranataupun Daerah Aliran Sungai (DAS) menyebabkan aliran

Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotland Dolok Saribu, Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

sungaidibeberapatitikberalihdanterkadangmalah mengancampemukimanmasyarakat. Melihatfenomenaitu,diamenilaipasanganDediAffanakanmampumelestarikansungai-sungaidiPsp ini, karena Dedi sudah pernah mewacanakannya. Bukti konkrit bisa dilihat bagaimana Dedi dengan organisasiyangdipimpinnyayaituLembagaPeduli Sungai (LPS) begitu serius mengelola sungai Deli Medan,menujusungaiyangbebasdarisampahdan lainnya. “DibawahkepemimpinanDedi-Affan,salahsatu potensi daerah (sungai di Psp,red) tersebut akan tertata dengan baik dan bisa dilestarikan untuk menjagasalahsatukeseimbanganlingkungandiKota Psp ke depan. Sehingga kita optimis, Dedi-Affan mampumelestarikansungaitersebutdenganbaik,” tuturDasopangkepadaMETRO,Rabu(29/8).(neo)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


30 Agustus 2012

139 Sekolah... Sambungan halaman 8 Kerusakan itu, kata dia, dimulai dari kamar mandi, atap dan bagian gedung fisik seluruh gedung sekolah. “Kita sudah mengusulkan perbaikan sekolah ini untuk program 2013,” sebutnya. Untuk perbaikan ini, Disdik telah mengusulkan anggaran biaya rehap sebesar Rp48,6 miliar. Dengan rincian biaya untuk perbaikan SD sebesar Rp31,9 miliar, SMP Rp16 miliar lebih. Disinggung berapa sekolah yang direhab tahun ini, Arifin mengatakan, sesuai anggaran yang tersedia di APBD 2012 ada sebanyak 31 sekolah yang akan direhap. (cr-01)

Andar-Isnan Terbaik Sambungan halaman 8 Lain halnya dengan Gunung Harahap (42) warga Angkola Timur, Kabupaten Tapsel. Dia memprediksi posisi pasangan AMIN cukup diperhitungkan pada Pemilukada Psp yang tinggal hitungan bulan ini. “Ketika Andar Amin Harahap, mencalon Bupati Tapsel Tahun 2010 lalu, saya militansinya dan dukung Andar Amin. Namun hanya berhasil diperingkat II

perolehan pengumpulan suara,” kenangnya. Dikatakan Gunung, dirinya telah menggalang kekuatan penuh melalui famili, handai tolan agar memenangkan pasanga AMIN tampa pamrih pada Pemilukada Psp ini. “Saya sudah intruksikan seluruh famili, kenalan, sahabat dan lainnya untuk tidak berpaling dari pasangan AMIN. Sebab, saya menilai AMIN masih yang terbaik dengan konsep membangunnya mengedepankan

holong mangalap holong dalam artian kebaikan pasti akan dibalas dengan kebaikan di bumi dalihan na 3 ini,” ujar Gunung. Baik Rahmat, Dedi dan Gunung, ketiganya lebih jauh menyebut pasangan AMIN kini lebih dicinta, diidolakan, dan lebih melekat dihati masyarakat. “Mari kita dukung dan menangkan AMIN, dan sukseskan pemilukada Psp ini,” ajak ketiganya. (phn/ mer)

1.150 Cama...

Felicia Rajaguk-guk Sambungan halaman 8 menggambar tingkat TK se-Tapteng dan diutus mewakili Tapteng di lomba serupa ke provinsi. Felicia yang saat itu bersekolah di TK St Don Boscokeluarsebagaijuara II di tingkat provinsi. Selain juara lomba melukis, Felicia juga „ Felicia juara II lomba kreasi pakaian daerah wanita yang juga digelar dalam rangka Hari Jadi Tapteng. Dalam lomba itu, Felicia mengenakan pakaian khas daerah Bali. “Kalau kreasi pakaian daerahnya Mama yang banyak membantu,” timpalnya. (mora)

Sambungan halaman 8 berstatus siswa, namun sekarang sudah mahasiswa. Kata maha itu besar maknanya, makanya harus benar-benar mampu beradaptasi dengan baik,” ujar DR H Ibrahim. Ketua STAIN Psp mengatakan, OPAK di gelar bertujuan untuk terciptanya mahasiswa yang tahu dan paham akan eksistensi STAIN Psp sebagai lembaga pendidikan tinggi Islam, serta sadar akan peran maupun fungsinya sebagai insan akademika yang berakhlakul karimah dan memiliki solidaritas tinggi terhadap sesama. “Dengan itu diharapkan para mahasiswa nantinya ikut berperan serta bertanggungjawab dalam mencerdaskan kehidupan berbangsa dan bernegara,” terangnya. Sasaran OPAK kata Ibrahim adalah para mahasiswa baru atau mahasiswa lama yang belum mengikuti OPAK untuk mengetahui dan memahami eksistensi, peran dan fungsi STAIN Psp sebagai lembaga pendidikan tinggi Islam. Selanjutnya, mengembangkan potensi diri mahasiswa dalam mensosialisasikan Tri Dharma Perguruan Tinggi (PT) serta membentuk kepribadian mahasiswa yang berkperibadian muslim. Ditambahkannya, target OPAK ini adalah mahasiswa dapat mengetahui sejarah, visi dan misi, nama dan fungsi lembaga kemahasiswaan, sistem administrasi dan perkuliahan, karakteristik, kode etik akademik, jurusan, baris berbaris serta mampu terampil menyanyikan mars dan hymne STAIN Psp. “Semoga OPAK ini terlaksana dengan baik dan para cama dan cami dapat benar-benar mengenal penuh kampusnya sebelum resmi mengikuti perkuliahan nantinya,” harapnya. Sementara sebelumnya, Ketua Panitia OPAK, Sapriadi SPdI dalam laporannya mengungkapkan, waktu kegiatan OPAK dibagi kepada beberapa bagian yaitu tahap pendaftaran dan wawancara tanggal 23, 24, 27 dan 28 Agustus 2012, sedang tahap pembukaan dan kegiatan inti tanggal 29, 30, 31 Agustus 2012 dan dilanjutkan tahapan evaluasi dan pelaporan. Dijelaskannya, panitia dalam OPAK berjumlah 56 orang, narasumber 11 orang, moderator 9 orang, notulen 9 orang, instruktur umum 43 orang dan instruktur perpustakaan sebanyak 14 orang. “Peserta kegiatan OPAK tahun ini diperkirakan sebanyak 1150 orang berasal dari gelombang I dan II,” bebernya. Pembukaan OPAK yang bertemakan ‘Melalui OPAK kita tingkatkan pengenalan dan pemahaman civitas akademika yang ramah dan bersahabat’ dirangkai dengan pemakaian topi kertas dan kalung buah oleh Ketua STAIN Psp, DR H Ibrahim Siregar MCL kepada dua perwakilan peserta dan dilanjutkan dengan penyerahan berkas OPAK kepada instruktur. Hadir dalam pembukaan yaitu para Ketua Jurusan (Kajur), Kabag dan Kasubag serta unsur Badan Eksekutif Mahasiswa (BEM) dan lainnya. (neo/mer)

BKG dan BSM Sambungan halaman 8

RASKIN: Pemberian Raskin di Kabupaten Tobasa kepada 5.553 RTS

Distribusi Raskin Berkurang Sebanyak 5.553 RTS Sambungan halaman 8 dari basis data terpadu Pendataan Program Perlindungan Sosial (PPLS) 2011,” kata Kabag Perekonomian Setdakab Tobasa Robert Gono di Balige, Senin (27/8). Sehubungan dengan terjadinya perubahan pagu raskin pada periode tersebut, kata dia, Bupati Tobasa Kasmin Simanjuntak telah mengeluarkan Surat keputusan Nomor 46 Tahun 2012 tentang penetapan pagu yang perlu dicabut dan diganti, yakni menjadi sebanyak 1.033.200 kilogram untuk 9.840 KK Rumah Tangga Sasaran. Menurut dia, hal itu dilaksanakan berdasarkan pertimbangan antisipasi kerawanan pangan, agar warga dapat membeli

dengan harga relatif lebih murah, khususnya pada Rumah Tangga Sasaran, karena Pemerintah telah mengalokasikan dana subsidi guna pembelian beras kelas medium, sehingga RTS dimaksud mendapat kemudahan. “Setiap RTS akan mendapat pagu raskin sebanyak 15 kilogram per bulan dengan harga Rp1.600 setiap kilogram serta distribusinya dilakukan mulai Juni hingga Desember 2012,” ujarnya. Dengan ditetapkannya keputusan tersebut, maka Surat Keputusan Bupati Nomor 64 tahun 2012 tentang penetapan pagu raskin RTS 2012 dinyatakan dicabut dan tidak berlaku lagi. Tapi, kata Robert menambahkan, dirinya merasa cukup heran melihat kenyataan yang

terjadi dalam pendataan yang dilakukan petugas Badan Pusat Statistik (BPS) setempat, karena masih terdapat beberapa kekeliruan dalam hasil pencatatannya. Sebab, kata dia mencontohkan, data yang dikumpulkan petugas BPS tersebut, umumnya tidak dilaporkan kepada Kepala Desa bersangkutan, mengakibatkan salah salah satu desa di Kecamatan Bonatua Lunasi, tercatat dua orang penduduk Desa Sangkalan berasal dari luar desa dimaksud. “Kekeliruan pendataan seperti itu sangat merugikan bagi RTS yang berhak mendapat bantuan raskin program pemerintah, sehingga petugas pendata perlu lebih cermat lagi,” katanya. (ant/int)

KPU Usulkan Anggaran Pemilukada Rp17 M TARUTUNG- Komisi Pemilihan Umum (KPU) Taput, mengusulkan anggaran untuk Pemilukada tahun 2013 mendatang mencapai Rp17 miliar lebih. Jumlah itu diasumsikan untuk penyelenggaraan Pemilukada dua putaran. Demikian disebutkan Ketua KPU Taput Lamtagon Manalu kepada METRO usai mengikuti sosialisasi tahapan pemilu pendaftaran dan verifikasi parpol menjadi peserta pemilu 2014, Selasa (28/8) di kantor KPU. Menurut Lamtagon, apabila dibandingkan jumlah anggaran yang dibutuhkan pada pemilukada sebelumnya, jumlah anggaran yang dibutuhkan mengalami kenaikan. Sebab, pada pelaksanaan Pemilukada 2008, jumlah anggaran hanya berkisar sekitar Rp14 miliar. “Anggaran Pemilukada itu bertambah karena pertumbuhan penduduk juga bertambah. Selain itu, honorarium penyelenggara dan biaya cetak serta gaji penyelenggara termasuk biaya sosialisasi diambil dari anggaran itu,” ujarnya. Didampingi Anggota KPU Taput Jampiter Lumbantoruan dan Lambas Matondang, Lamtagon mengatakan, Pemilukada Taput direncanakan

diawali September 2013. Sedangkan untuk tahapannya sudah dimulai enam bulan sebelum pelaksanaan pemilihan. “Recananya, Pemilukada akan dilaksanakan September 2013. Sekarang kita sudah mengusulkan anggarannya ke pemkab agar ditampung di APBD 2013,” sebutnya. Menurutnya, meski pun ada wacana terkait adanya penundaan Pemilukada di beberapa kabupaten kota di Indonesia karena pelaksaannya berdekatan dengan pemilihan umum (Pemilu), termasuk Taput, kondisi itu belum menjadi acuan. “Jadi kita tidak berpatokan pada isu tentang wacana dari Mendagri untuk pengunduran Pemilukada. Makanya kita tetap mengusulkan dana pelaksanaannya,” terangnya. Dia menambahkan, tahapan yang telah dirancang KPU tidak akan berubah untuk alasan apapun kecuali apabila undang-undang yang menjadi dasar pelaksanaan Pemilukada berubah. “Tahapan Pemilukada Taput harus tetap dijalankan, sepanjang undang undang yang menjadi dasar pelaksanan Pemilukada tidak berubah. Jadi, kita tidak berpatokan ke wacana

Mendagri itu,” tegasnya. KPU Tandatangani Pakta Integritas Mengawali Pelaksanaan Pemilihan Umum (Pemilu) 2014, KPU Taput menandatangani pakta integritas, Selasa (14/8) di kantor KPU. Hadir pada acara itu, tokoh masyarakat, Pengurus KSPPM, Pengurus LADN, BKAG, Pengurus GMKI dan Pengurus GAMKI. Sebelum penandatanganan, dilakukan pembacaan naskah pakta integritas oleh Ketua KPU Taput Lamtagon Manalu, dilanjutkan oleh Sekretaris KPU J Purba SH. Berbunyi antara lain, janji para komisioner untuk bekerja secara profesional, adil, dan penuh waktu. Disamping itu, para komisioner berjanji untuk menjamin hak konstitusional warga, yakni menggunakan hak pilihnya pada hajat pemilu 2014. Lamtagon mengatakan, meski para komisioner sudah berjanji pada saat dilantik empat tahun silam, yang kurang lebih isinya sama, tapi penandatangan pakta integritas ini merupakan instruksi dari KPU RI yang harus dilaksanakan di semua KPU provinsi maupun kabupaten/kota. (cr-01)

kan, setiap peserta didik pada setiap satuan pendidikan berhak mendapat biaya pendidikan bagi mereka yang orangtuanya tidak mampu membiayai pendidikannya. Jhonson mengaku pihaknya kini sedang berada di Medan mengurusi pencairan BKG dan BSM itu, atau proses asistensi. “Mudah-mudahan bisa segera beres urusan ini. Karena banyak instansi yang mesti didatangi. Nanti penyalurannya dihitung sejak Januari-Desember,” pungkasnya. Terpisah, Sekretaris LSM Kupas Tuntas Juan Ferry Lumbangaol mengingatkan, penyaluran BKG dan BSM dilaksanakan secara transparan dan jujur. Sebab, menurut Juan, BKG dan BSM rawan pemotongan dan pungutan liar. “Data yang saya perolah, BKG dan BSM dari BDB provinsi sudah dikucurkan sejak tahun 2009 lalu. BKG tahun 2009 sebesar Rp2,41 miliar, tahun 2010 sebesar Rp6,63 miliar dan tahun 2011 sebesar Rp2,15 miliar. Sedangkan BSM tahun 2009 sebesar Rp1,89 miliar, tahun 2010 juga sebesar Rp1,89 miliar, dan tahun 2011 sebesar Rp500 juta. Penyaluran bantuan ini sangat rawan pemotongan dan pungli,” tukas Juan. Di sisi lain, Juan berpendapat untuk tahun berikutnya, para wakil rakyat di DPRD provinsi mesti memikirkan dana BDB untuk rehab fisik sekolah. (mora)

FPD Minta Walikota... Sambungan halaman 8 pelayanan kepada masyarakat dan sebagai kepala daerah Walikota Psp harus mengingatkan semua PNS termasuk pimpinan PNS itu sendiri seperti Sekda dan juga para pimpinan SKPD lainnya,” tegasnya. Hal ini dikatakan Ketua Komisi III DPRD Psp agar menjaga netralitas PNS dalam pilkada, namun yang terutama adalah bagaimana agar pelayanan kepada masyarakat tidak sampai terganggu karena PNS juga sibuk membahas bahkan terjun langsung dalam eforia pilkada Psp ini. “Agar ada pemahaman kepada para PNS untuk mengembang amanah dan tanggungjawabnya secara profesional. Untuk itu diharapkannya kepada Walikota Psp, Drs Zulkarnaen Nasution agar memerintahkan seluruh PNS focus pada tugasnya,” jelasnya. Ketua DPC PD Kota Psp ini menambahkan Walikota Psp harus tegas karena dirinya melihat adanya seperti penurunan semangat kerja dari para PNS apakah disebabkan karena baru libur lebaran atau karena terlalu semangat membahas masalah pilkada. “Lihat saja sudah beberapa hari masuk kerja, jumlah PNS yang hadir masih jauh dari harapan, kantor masih banyak yang pegawainya sunyi”, tegasnya. (phn/mer)

SAMBUNGAN METRO TABAGSEL Takut Digosipi Selingkuh, Lelaki Dusun Sebelah Enggan Bertandang Sambungan Halaman 1 mengatakan, untuk menggelar acara adat di Dusun Sitanggor, terpaksa penatua atau tokoh adat dari desa lain naik gunung ke Dusun Buntu Raja. ”Kita dari Desa Sitanggor dan dusun lain terpaksa ikut naik ke Dusun Buntu Raja untuk membantu setiap ada acara adat di sana,” ujar Sangkar. Ia menjelaskan, untuk menggelar acara pesta adat Batak, butuh tokoh adat dan tenaga untuk memotong ternak dan memasak daging. Sehingga, tanpa bantuan dari dusun tetangga, warga Dusun BuntuRajamustahilbisamenggelaracarapestaadat. ”Jadi, karena kami dari dusun tetangga memang masih satu rumpun, maka sudah kewajiban kami membantumereka,”paparnya. Namun, sambung Sangkar, kaum laki-laki dari DesaSitanggor,enggannaikkeDusunSitanggorjika tidak ada urusan penting. Pasalnya, kaum laki-laki dari desa tetangga Dusun Buntu Raja takut digosipkanselingkuhdengankaumibudidusunitu. ”Kita tetap menjaga nama baik ibu-ibu di sana. Bahkan mufakat bersama kami, setiap laki-laki

pendatang yang datang ke dusun itu harus menjelaskanmaksuddantujuannyadantidakboleh menginap,termasuklaki-lakidariDesaSitanggordan sekitarnya,”tandasSangkar. 42 Terpidana Pisah Penjara Kejamnya dampak yang diterima ibu-ibu dan anak para terpidana kasus begu ganjang di Dusun Buntu Raja, juga menyisakan derita lain, yakni pemisahan penjara ke-42 terpidana. Dimana sembilan terpidana kini ditempatkan di Rutan Tanjung Gusta, Medan. Sedangkan sisanya, ditempatkandiLPSiborongborong,TapanuliUtara. Dampak perih tentu dialami sembilan istri terpidanayangditempatkandiRutanTanjungKusta, Medan. Pasalnya, mereka akan sulit berkunjung ke Rutan Tanjung Gusta karena harus mengeluarkan ongkos perjalanan dan biaya banyak selama di perjalanan. Gunsol Ompusunggu, Sumurung Rajagukguk dan Raja Pangihutan Rajagukguk yang ditemui METROdiLPSiborongborongmengatakan,mereka sangat berharap kesembilan rekan mereka bisa berkumpul di LP Siborongborong.

Main Opera Batak satuyangsebelumnyapernahsayadengar.Selebihnya Sambungan Halaman 1 memerankantokohGorga.Itukarenadirinyalahir diBandungdantidakmenguasaibahasabatak. ”Ini satu tantangan besar buat saya, karena saya harus menghapal 20 lagu berbahasa batak. Saya sebenarnyalahirdiBandungdankurangdibiasakan berbahasabatak,”kataChokydiGedungEnergiSCBD JakartaSelatan,Rabu(29/8). Kendala lainnya, Choky baru-baru ini punya kerjaandiAmerikaSerikatsehinggalamadiluarnegeri. Untukmenghapal20laguberbahasabatakitu,Choky menyanyikannyahinggakepesawatdanbandara. ”Dalam 10 hari di luar negeri, saya latihan juga. Bermodalkanhandphonesayamenghapallagu-lagu itu di pesawat. Saat transit di Hongkong saya masuk kegatelebihawaldanlatihansendiri,”ungkapnya. Choky juga meminta kepada sutradara untuk mentranslatelagu-lagutersebutkedalambahasaIndonesiaagarmudahdipahami.“Dari20lagu,hanya

lagubaru,”jelasChoky. Opera“ArgaDoBonaniPinasa”yangberartiCinta kepada Kampung Halaman Opera ini akan digelar tanggal1-2Sepetember2012,diPlenaryHall,Jakarta CoventionCenter.Chokyakanberpasangandengan Zivanna Letisha Siregar (Zizi) Puteri Indonesia 2008. Keduanya akan berperan sebagai Gorga dan Marlinang. Choky mengatakan dia seolah mendapatkankehormatanyangbesarmemerankan di opera ini. Tambahnya bicara budaya opera Batak bukan hanya sukuiesme semata-mata tetapi ingin menunjukkanbudayaIndonesia. “Ini menjadi kekuatan yang besar untuk berkontribusi dunia parawisata khususnya Danau TobaadalahsumberdayaterbaikdiIndonesia,”kata ChockySitohang.SementaraZizi,panggilanPuteriIndonesia2008inimenyatakan,diaakanmenyanyikan lagu-lagudalambahasaBatak. Bagi Zizi, menyanyi lagu Batak merupakan tantangantersendiri.MeskiketurunanBataknamun

”Mereka(9terpidanadiRutanTanjungGusta-red) mungkin ditempatkan di Medan karena semua divonis15tahunpenjara.Tapi,waktupemisahanitu dulu, kami sebenarnya memohon agar disatukan, tapi tidak terwujud,” ujar Sumurung. Ketiga terpidana tersebut mengaku, sembilan rekanmerekajarangditemuiistridananak-anaknya di penjara. ”Kalau yang kami dengar kabar dari kampung, istri dan anak mereka jarang berkunjung ke penjara. Mungkin semua itu karena faktor biaya. DitambahlagikalauberangkatkeMedanpastiharus menginap.Padahal,tidaksemuaadapunyakeluarga di Medan,” papar Gunsol menimpali perkataan Sumurung. Amatan METRO, kondisi para terpidana kasus beguganjangdiLPSiborongborongdalamkeadaan sehat.MerekadibinapetugasLP.“Kamidisinidibina pihak LP Siborongborong dengan baik. Banyak kegiatan kami di sini, termasuk kegiatan rohani. Hanyasaja,kitaterusmenghitungjam,haridemihari masatahanan.Sehingga,kadangitumenjadibeban mental. Kami ingin hidup bersama keluarga di kampung,”ujarRajaPangihutan.

Terkait pembinaan para narapidana, Kepala LP Siborongborong Sigit Danarto SH didampingi Kepala Pengamanan Lembaga Pemasyarakatan (KPLP) Siborongborong Batara Hutasoit membenarkan. Ia mengatakan, pada prinsipnya, carapembinaanyangmerekalakukankepadapara narapidanaadalahpembinaandisiplin,mentaldan kerohanian. “Pembinaan yang kita lakukan tentu tidak dapat lepasdaripetunjukyangada.Tapi,napiitujugabutuh penyadaran atas apa yang telah diperbuatnya melanggar hukum. Jadi, disiplin, kebersamaan dan pembinaankerohanianituharuskitalakukansupaya kelak setelah keluar dari binaan kita dapat berguna bagibangsadanNegara,khususnyakepadakeluarga mereka masing-masing,” tandas Sigit. Sebelumnya, Ratna Tambunan, istri dari Pasu Simaremare, mengaku bahwa dia tidak pernah menjenguk suaminya setelah dipindahkan dari Rutan Tarutung ke Rutan Tanjung Kusta, Medan. ”Dari manalah uang saya mau kesana, untuk memberi makan kedelapan anak saya dan biaya sekolahsajasudahsyukur.Tapisuatusaatnanti,saya

ia lahir dan dibesarkan di Jakarta. ”Bagi saya itu tantanganbanget.Sayamenyanyikan6-7lagu.Untuk menghayatinyasayapunmintadi-translatekedalam bahasa Indonesia. Dan ternyata bisa dibilang orang Batakituromantisya.Darilagu-lagunyamengenaiisi hatinya,” kata Zizi di kawasan SCBD, Jakarta Pusat, Rabu (29/8). Dengan nada setengah bercanda, dara kelahiranJakarta,16Februari1989inipunmenyatakan ketertarikannya pada pria Batak. “Selama ini (pria Batak) yang saya kenal seperti itu ya, romantis,” ujar Zizitertawa. Opera tersebut sengaja digelar masyarakat yang berasaldariSumateraUtarakhususnyaBatak,tergerak untukmembangunkembalidaerahnya.Tujuannya taklaindemimelestarikankembalibudayaBatak,serta mengangkatfanatismekedaerahan. Bonar Gultom, selaku Sutradara juga sekaligus menjadi Gorga, pemeran utama opera ini mengatakantujuanutamadidalamoperaini adalah untukmenggalibudayaBatak. “Dari kecil saya senang sekali film-film musik.

Genrenya adalah budaya Batak. Seluruh jalan cerita itu diisi dengan lagu-lagu makanya di sebut Opera,” kata Bonar di ‘Marleys Bar’ Gedung Energy lantai 2, Kawasan SCBD lot 11a, Jendral Sudirman, Jakarta, Rabu,(29/8). HisarGurningdariGorgaHouseselaku penyelenggara, mengatakan opera kolosal digelar dalam rangka melestarikan nilai-nilai budaya Batak dan mengangkat fanatisme kedaerahan sehingga masyarakat yang berasal dari Sumatra Utara khususnya Batak tergerak untuk membangun kembalidaerahnya. ”KamiInginmengingatkanlagibahwamasihada DanauTobaditanahkelahirankamisebagaitempat tujuan wisata yang cukup terkenal di dunia,” ujar GurningdalamjumpapersdiJakarta,Rabu(29/8). Gurningmenjelaskan,selainsebagaitontonan,opera yang bercerita tentang kecintaan kampung halaman ini juga diharapkan akan menjadi sarana untukmenggali,melestarikan,danmengembangkan unsur-unsursenibudayadaerah.Danterpenting,kata Gurning, membangkitkan rasa syukur kepada Sang

dananak-anakakanberusahangumpuluangagar bisa berangkat ke Medan,” ujar Ratna. Namun, Ratna berharap, agar Kementerian HukumdanHAMmemindahkansuaminyakeLP Siborongborong. ”Sebenarnya, kalau boleh berharap,sayainginsuamisaya ditempatkandiLP Siborongborong saja. Bayangkan anak saya yang paling kecil saja tidak dilihatnya lahir, dan sampai berumur15tahunnantimungkinanakpalingkecil tidak mengenal wajah bapaknya,” ungkap Ratna beruraiairmata. Kini, setelah 2 tahun 57 hari tragedi kasus begu ganjang tersebut, kondisi kehidupan warga yang tinggal di lereng perbukitan Danau Toba, Dusun Buntu Raja, Desa Sitanggor, Kecamatan Muara, Kabupaten Taput itu sangat memprihatinkan, khususnya dari sisi perekonomian. Meski begitu, harapan terakhir sebagian besar kaum ibu yang suaminya kini dipenjara itu adalah, pemindahan 9 narapidana dari Rutan Tanjung Kusta ke LP Siborongborong, pemberian remisi hukuman, serta dukungan pemberian bantuan kebutuhanpertaniandanperbaikanjalankedusun tersebut.Agarhasilpertanianmerekalebihbaikdan untuk menjual hasil panen lebih lancar ke Kota Siborongborongyangjaraknyasekitar25kilometer, Pencipta. dapat menggelitik dan karena kini”Diharapkan masih sulit dilalui mobil. (*) memupuk kecintaan, kerinduan, dan kebanggaan masyarakatterhadapTanahAirnyasendiri,”paparnya. Opera ini mengisahkan perjalanan seorang pemuda Batak bernama Gorga yang melanglang buana keliling dunia karena tidak puas dengan keadaanditanahkelahirannya.Namun,akhirnyadia kembalilagidanmenyadaribahwaseindah-indahnya negeriorang,justrulebihindahdikampunghalaman sendiri. OperaBatakPerluGlobalisasidanRegenerasi Opera Batak Arga do Bona Ni Pinasa yang akan digelar di Plenary Hall, Jakarta Convention Center, Jakarta, pada 1 dan 2 September 2012 mendatang mendapat sambutan positif dari salah satu penggiat opera Batak sekaligus pemerhati budaya Batak, Thompson HS. “Pertunjukan opera Batak memang perlu lebih dilestarikan dan diperbanyak. Sebab, globalisasi seni budaya opera Batak akan mampu melestarikandanmemperkenalkanbudayaBatakke seluruhpenjurudunia.Tentu,kekayaanbudayaBatak itu akan menguntungkan pada sisi sektor pariwisata


30 Agustus 2012

Andar-Isnan Terbaik Energik, Serasi, Tak Sombong


RUSAK: Salah satu Sekolah Dasar di Kecamatan Muara, Taput yang membutuhkan perbaikan karena sudah rusak parah.

139 Sekolah di Taput Rusak Parah TARUTUNGKabid Sarana dan Prasarana Dinas Pendidikan (Disdik) Taput Arifin Simamora mengaku sampai saat ini terdapat 139 gedung sekolah baik tingkat SD dan SMP mengalami rusak berat. Bahkan, akibat kerusakan cukup parah membutuhkan rehab secara menyeluruh. “Jumlah sekolah yang rusak parah ini terdiri dari 107 SD dan 32 SMP. Sekolah ini harus direhab secara menye-

SIDIMPUAN-Pasangan Calon Walikota dan Calon Wakil Walikota Padangsidimpuan (Psp) Andar Amin Harahap SSTP MSi-Muhammad Isnandar Nasution SSos (AMIN) hingga saat ini masih pilihan yang terbaik di pemilihan kepala daerah (pilkada) Kota Psp. “Pasangan Nomor Urut 3 AMIN masih yang terbaik. Mereka pantas dan pas memimpin Kota Psp periode 2013-2018. Pasangan muda ini, dikenal energik, serasi, tidak sombong, familiar, cerdas, dan berjiwa membangun,” ujar Rahmat (32) seorang pemerhati pembangunan, Selasa (28/8) kemarin. Menurut Rahmat, AMIN akan mampu


luruh. Sebab, tingkat kerusakannya cukup parah. Ini hasil pendataan kita di l a p a n ga n , ” ujar Arifin kepada wartawan di Tarutung, Selasa (28/8). Sekolah yang rusak tersebut terdapat di seluruh 15 kecamatan yang ada di Taput khususnya daerah pelosok. “Hampir di semua kecamatan ada sekolah yang rusak parah, tapi paling dominan di daerah pelosok,” sebutnya.

SIDIMPUAN-Sebanyak 1.150 Calon Mahasiswa dan Mahasiswi (Cama dan Cami) Sekolah Tinggi Agama Islam Negeri (STAIN) Padangsidimpuan (Psp) Tahun Akademik (TA) 2012/2013 mengikuti Orientasi Pengenalan Akademik dan Kampus (OPAK). Kegiatan dilaksanakan di Auditorium STAIN Psp, di Jalan Tengku Rizal Nurdin, Sihitang, Kecamatan Psp Tenggara, Rabu (29/8). Ketua STAIN Psp, DR H Ibrahim Siregar MCL yang membuka secara resmi OPAK tersebut dalam sambutannya, mengajak para cama dan cami untuk dapat menyesuaikan diri dengan status mahasiswa yang disandang saat ini. “Jika dulu saudara-saudari masih

Baca 139 Hal 7

Baca 1.150 Hal 7

Pemandangan Air Terjun Pulau Mursala Sepakbola Pandan, kemarin. “Tema lukisannya pemandangan alam air terjun Pulau Mursala. Mama pernah ajak aku ke sana,” kata putri pertama pasangan Patricius M Rajagukguk dan Gina br Tampubolon itu, sambil menenteng

Baca Andar... Hal 7

1.150 Cama dan Cami STAIN Psp Ikuti OPAK

Felicia Rajagukguk Juara 1 Melukis PANDAN- Felicia Rajagukguk, siswi kelas 3 SD St Fransiskus Pandan, keluar sebagai juara I lomba melukis tingkat SD se-Tapteng. Lomba yang digelar untuk menyemarakkan Hari Jadi ke-67 Tapteng itu digelar di Tribun Lapangan

melakukan terobosan baru demi kemajuan pembangunan Kota Psp, sejalan visi misinya. AMIN pasangan yang diyakini berani ambil tindakan demi kepentingan publik, tetapi tetap dalam koridor yang ada. Seorang warga Jalan Diponegoro atau Jalan Stombol bernama Dedi (40) juga

mengatakan hal yang sama. Katanya, pasangan AMIN masih terbaik karena memiliki basis massa pendukung yang jelas, mulai dari arus bawah, menengah sampai atas, baik kaum muda, tua. Mayoritas masyarakat Psp suka AMIN karena mereka dinilai yang terbaik. “Dengan kemampuan lobi-lobi akan memaksimalkan relasi AMIN ke tingkat propinsi dan pusat untuk membantu peningkatan kesejahteran hidup 200.000 jiwa masyarakat Psp,” ujar Dedi yang juga pengusaha salah satu rumah makan di Jalan Diponegoro ini dengan optimis.

piagam dan piala yang diraihnya, yang diserahkan oleh Bupati Tapteng Raja Bonaran Situmeang. Sebelumnya, Felicia juga pernah menjuarai lomba

Baca Felicia ... Hal 7


OPAK-Ketua STAIN Psp, DR H Ibrahim Siregar MCL sedang mengenakan topi kertas sebagai atribut kepala salah seorang perwakilan peserta OPAK di gedung auditorium STAIN Psp, Rabu (29/8).

FPD Minta Walikota Psp

Ingatkan PNS Fokus Bertugas SIDIMPUAN-Para pegawai negeri sipil (PNS) di lingkungan Pemko Psp saat ini sepertinya kurang maksimal melaksanakan tugas sebagai pengayom masyarakat. Pasalnya, pikiran mereka terpecah dengan agenda pilkada yang akan digelar beberapa bulan lagi. Untuk tidak mempengaruhi tingkat pelayanan, Fraksi Partai Demokrat (FPD) DPRD Kota Padangsidimpuan (Psp) meminta Walikota Psp, Drs H Zulkarnaen Nasution MM agar mengingatkan para PNS untuk fo-

cus melaksanakan tugasnya dan tidak ikut latah persoalan pilkada ini. Ketua FPD DPRD Psp, H Khoiruddin Nasution mengharapkan, kiranya PNS tetap melaksanakan tugas dan focus melayani masyarakat dan tidak latah nimbrung dikegiatan pilkada Kota Psp. Apalagi sesuai aturan, PNS memang dilarang berpolitik praktis. “Imbaun ini penting agar PNS tetap fokus melaksanakan tugasnya untuk memberikan

Baca FPD Minta ... Hal 7

Khoiruddin Nasution

BKG dan BSM Rawan Pemotongan dan Pungli TAPTENG- Tahun ini, APBD Provinsi Sumut melalui dana Bantuan Daerah Bawahan (BDB) menampung dana Bantuan Kesejahteraan Guru (BKG) di Tapteng sebesar Rp4.384.800.000. Jumlah itu jauh di atas Bantuan Siswa Miskin (BSM) yang hanya Rp500 juta. Sementara untuk rehab fisik sekolah nihil sama sekali. “Masing-masing dapat Rp60 ribu per orang per bulan. BKG hanya untuk guru

Ferry Lumbangaol

PNS yang belum sertifikasi dan honor yang sudah mengabdi selama minimal 2 tahun serta telah memiliki NUPTK (Nomor Unik Pendidik dan Tenaga Kependidikan). Totalnya ada sekitar 4.200-an guru di Tapteng yang mendapat BKG,” ujar Sekretaris Dinas Pendidikan Tapteng Jhonson Sihombing, Rabu (29/8) petang. Sedangkan BSM, sambung Jhonson, jumlahnya berbeda tiap tingkatan sekolah. Dinas

Pendidikan Tapteng mengusulkan bagi tingkat SD sebesar Rp365 ribu per tahun per siswa, tingkat SMP sebesar Rp560 ribu per tahun per siswa, dan tingkat SMA sebesar Rp775 ribu per tahun per siswa. BSM sendiri telah diamanatkan dalam UU No 20 Tahun 2003 tentang Sistem Pendidikan Nasional, pasal 12 (1) c yang menyebutkan setiap peserta didik pada setiap satuan pendidikan berhak mendapat beasiswa bagi yang berprestasi yang orangtuanya tidak mampu membiayai pendidikannya. Dan huruf d menyebut-

Baca BKG dan BSM ... Hal 7

DistribusiRaskin Berkurang Sebanyak 5.553 RTS BALIGE- Pendistribusian beras miskin di Kabupaten Toba Samosir, untuk tahun 2012 berkurang sebanyak 5.553 Rumah Tangga Sasaran (RTS) dari sebelumnya 15.393 menjadi 9.840 RTS, akibat perubahan data berdasarkan mekanisme penyaluran yang ditetapkan. “Berkurangnya jumlah RTS penerima beras miskin (raskin) tersebut, sesuai perbaikan mekanisme penyaluran untuk periode Juni hingga Desember 2012 yang ditetapkan berdasarkan daftar rumah tangga

Baca Distribusi...Hal 7


30 Agustus 2012

Di Tangan Andar Amin Psp Akan Banyak Perubahan SIDIMPUANTamplinya Andar Amin Harahap SSTP MSi sebagai salah satu calon walikota di bumi Dalihan Na Tolu Kota Padangsidimpuan (Psp) disambut antusias warga Psp.

„ H M Salim Harahap

hun yang akan datang kaSelain sudah cukup direna pengalamannya sebakenal dikalangan masyaragai abdi negara dan abdi kat, sosok Andar Amin dimasyarakat (PNS) di Kabuyakini akan mampu membawa perubahan signifikan untuk daerah ini lima ta- ‹ Baca Di Tangan...Hal 10


„ Dari kanan ke kiri, Ketua Tim Sukses AMIN, Indar Sakti Tanjung, Ketua Line 09 Erwin, Sekretaris Arman Saputra dan wakil ketua Junaidi bertatap muka dengan tim suskes AMIN di posko tim kampanye AMIN, Jalan Suprapto, Kelurahan Bincar, Rabu (29/8).


„ Jokowi Vs Foke

Pilih Foke Karena Tak Mau Dikecewakan Jokowi Lagi JAKARTA - Partai Keadilan Sejahtera (PKS) tak mau terus-menerus disudutkan dengan anggapan bahwa keputusannya untuk mendukung pasangan Fauzi Bowo-Nachrowi Ramli dalam Pemilukada DKI Jakarta karena adanya mahar politik yang disanggupi penuhi pasangan yang tenar dengan julukan

Foke-Nara itu. Wakil Sekjen PKS, Mahfuz Sidik, menegaskan bahwa keputusan partainya mendukung calon dari Partai Demokrat itu karena semata-mata komitmen untuk tetap memimpin Jakarta selama lima tahun mendatang. Menurut Mahfud, PKS

Pengurus Angkot Line 09 Minta Terminal Pal IV Direlokasi SIDIMPUAN-Kedatangan pengurus angkutan kota (Angkot) line 09 jurusan Pusat Kota-Jalan KenangaPadangmatinggi (SMAN 3)-Pal IV Pijor Kling, Kecamatan Psp Tenggara, ke posko tim kampanye AMIN disambut hangat ketua tim, Indar Sakti Tanjung ST didampingi Sekretaris, Drs Ashari Harahap, Rabu (29/8).

Para pengurus angkot line 09 yang bertatap muka dengan tim AMIN ini dipimpin langsung Ketua, Erwin didampingi wakil ketua, Junaidi, Sekretaris, Arman Saputra dan Bendahara, Safril Hasibuan. Dalam pertemuan yang berlangsung akrab dan penuh kekeluargaan ini, kedua belah pihak saling menyampaikan gagas-

an, harapan dan ide tentang perubahan Kota Psp yang lebih baik pada masa yang akan datang. Aspirasi yang disampaikan pengurus line 09 ini tidak muluk-muluk, hanya saja apabila Andar-Isnan terpilih memimpin Kota Psp, kehidupan para supir angkot diharapkan berubah lebih baik. “Untuk itu kami siap melakukan kerja-

sama menyosialisasikan kandidat AMIN kepada masyarakat lewat pemasangan stiker AMIN di kaca mobil angkot kami masing-masing hingga usai pilkada. Tak hanya itu kami siap membantu menggalang warga demi memenangkan AMIN di pilkada

‹ Baca Pengurus...Hal 10

Kharisma Sultan Tetap Melekat di Golkar

Ketua NNB Rimdo Nauli Siap Menangkan Dedi-Affan

JAKARTA - Partai Golkar (PG) mengikhlaskan bila Gubernur Daerah Istimewa Yogyakarta, Sri Sultan Hamengkubuwono X harus meninggalkan partai karena perintah Undangundang. “Kalau itu sudah diatur oleh UU maka itu harus ikuti saja dan Golkar juga terima,” kata anggota DPR dari Fraksi PG, Yorris TH Raweyai, kepada war-

SIDIMPUAN-Ketua Naposo Nauli Bulung (NNB) Rimdo Nauli Lingkungan 9 dan Ketua Keamanan Lingkungan 9, Marwan Lubis (27) dan Muyassir Nasution (27), di Kelurahan WEK V, Kecamatan Padangsidimpuan (Psp) Selatan, Kota Psp siap memenangkan pasangan Calon Walikota dan Wakil Walikota Nomor Urut 4, Dedi Jaminsyah Putra Harahap SSTP MSP-H Affan Siregar SE di pemilukada 18 Oktober mendatang. “Saya sebagai Ketua NNB siap memenangkan Dedi-Affan di lingkungan saya

‹ Baca Pilih...Hal 10

tawan, Rabu (29/8), di Gedung DPR, Senayan, Jakarta. Yorris menambahkan, yang keluar dari PG itu hanya fisiknya Sultan saja. Menurutnya, tidak masalah jika Sultan harus meninggalkan PG. “Dia (Sultan) keluar bukan karena keinginan dia

‹ Baca Kharisma...Hal 10

„ Kiri ke kanan-Muyassir dan Marwan Lubis.


untuk Psp yang lebih baik kedepan,” ucap Marwan didampingi Muyassir kepada METRO, Rabu (29/8). Alasan dirinya siap berjuang memenangkan Dedi-Affan di lingkungannya karena menginginkan adanya perubahan di Kota Psp ini ke arah yang lebih baik kedepan. Dirinya optimis Dedi-Affan bisa membawa perubahan Kota Psp ke arah yang lebih baik kedepan, karena Dedi-Affan

‹ Baca Ketua ...Hal 10


30 Agustus 2012

Foke Janji Tindak Anak Foke Tak Punya Jawaban soal Temuan PPATK ntang Korupsi Buahnya yang Korupsi Te di Pemprov DKI JAKARTA - Gubernur DKI Jakarta, Fauzi Bowo alias Foke berjanji menindak tegas pelaku korupsi di lingkungan Pemerintah Provinsi (Pemprov) DKI Jakarta. Foke menjamin dirinya tidak akan menyembunyikan kasus korupsi yang terjadi di Pemprov DKI. Penegasan ini disampaikan Foke menanggapi hasil analisis PPATK yang menyimpulkan Pemprov DKI Jakarta sebagai provinsi terkorup. “Yang jelas, yang bersalah melawan hukum pasti akan kita tindak. Saya tidak pernah menutup-nutupi itu, siapapun yang bersalah akan kita tindak,” kata Foke usai menghadiri rapat paripurna di gedung DPRD DKI Jakarta, Jalan Kebon Sirih, Jakarta Pusat, Rabu (29/8). Menurut Foke, Pemprov DKI memiliki sistem yang mencegah celah korupsi. Salah satunya dengan mewajibkan pejabat Pemprov DKI untuk menandatangani pakta integritas. Foke mengklaim Pemprov DKI yang pertama kali mempelopori penandatanganan pakta integritas antikorupsi. “Di dalamnya tercantum, kalau dia terbukti melakukan tindak pidana korupsi maka bersedia diberhentikan. Sebelum ada aturan nasional, Jakarta sudah memberlakukan itu,” ujarnya. Lebih lanjut, Foke mengatakan

bahwa hasil audit laporan keuangan Pemrov DKI juga semakin baik. Selain itu pengadaan tender telah dilakukan via online sehingga tidak lagi tatap muka yang rentan dengan aksi sogok. “Kemudian kita juga merubah sistem pengadaan tender, yang dilakukan melalui internet. Maka hubungan antar orang per orang itu menjadi terputus. Jadi kemungkinan untuk potensi korupsi itu kecil,” papar gubernur berkumis ini. Dari hasil analisis PPATK, provinsi DKI Jakarta berada di posisi pertama sebagai daerah yang dilaporkan adanya dugaan korupsi yaitu sebanyak 46,7 persen. Diikuti Jawa Barat 6 persen, Kalimantan Timur 5,7 persen, Jawa Timur 5,2 persen, Jambi 4,1 persen, Sumatera Utara 4 persen, Jawa Tengah 3,5 persen, kemudian Aceh dan Kalimantan Selatan 2,1 persen. Sementara daerah yang paling kecil laporan tindakan korupsi adalah Kepulauan Bangka Belitung 0,1 persen, Sulawesi Barat 0,3 persen, Sulawesi Tengah 0,4 persen, Nusa Tenggara Barat dan Papua Barat 0,5 persen, Kalimantan Tengah 0,6 persen, Sumatera Barat dan Bali 0,7 persen, Nusa Tenggara Timur dan Bengkulu 0,8 persen, kemudian Sulawesi Utara 0,9 persen. (dil/ jpnn)

Tertinggi di Indonesia JAKARTA - Gubernur DKI Jakarta, Fauzi Bowo dengan gaya ceplasceplosnya mengelak pertanyaan wartawan tentang temuan Pusat Pelaporan dan Analisis Keuangan (PPATK) yang menyebut Pemprov DKI paling tinggi angka korupsinya. Pria yang biasa dipanggil Foke itu justru menyerahkan kepada PPATK soal temuan potensi korupsi di Pemprov DKI. “Nanyanya jangan sama saya, sama yang ngasih pernyataan dong,”

kata Foke singkat usai menghadiri rapat paripurna di gedung DPRD DKI Jakarta, Jalan Kebon Sirih, Jakarta Pusat, Rabu (29/8). Hasil analisis PPATK mengindikasikan DKI Jakarta sebagai provinsi dengan jumlah korupsi terbanyak. Menurut Foke, sampai saat ini pihaknya masih menunggu PPATK untuk membuktikan analisanya. “Kita nunggu juga sama seperti Anda,” seloroh Foke. Sebelumnya diberitakan, Wakil Kepala PPATK, Agus Santoso mengungkapkan adanya temuan transfer dana APBD ke rekening pejabat. Menurut Agus, pemindahan dana itu dilakukan dengan dalih me-

nyiasati anggaran yang tak terserap. “Bisa saja mereka mengaku bahwa tindakan ini adalah untuk mensiasati sistem pertanggungjawaban anggaran yang tidak boleh melewati tanggal 18 Desember. Tetapi perbuatan seperti ini, apapun tujuannya, tetap tidak bisa ditolerir. Pada saat seorang pejabat memindahkan uang negara ke kantong pribadinya, itu sudah masuk definisi korupsi,” ujar Agus seperti diberitakan barubaru ini. Dari hasil analisis PPATK, provinsi DKI Jakarta berada di posisi pertama sebagai daerah dengan tingkat korupsi paling tinggi, yaitu 46,7 persen. Diikuti Jawa Barat (6 persen),

Kalimantan Timur (5,7 persen), Jawa Timur (5,2 persen), Jambi (4,1 persen), Sumatera Utara (4 persen), Jawa Tengah (3,5 persen), kemudian Aceh dan Kalimantan Selatan masing-masing 2,1 persen. Sementara daerah yang paling kecil laporan tindakan korupsi adalah Kepulauan Bangka Belitung (0,1 persen), Sulawesi Barat (0,3 persen), Sulawesi Tengah (0,4 persen), Nusa Tenggara Barat dan Papua Barat (0,5 persen), Kalimantan Tengah (0,6 persen), Sumatera Barat dan Bali (0,7 persen), Nusa Tenggara Timur dan Bengkulu (0,8 persen), kemudian Sulawesi Utara (0,9 persen). (dil/jpnn)

„ Komisi Pemilu Jakarta melakukan sosialisasi Pilkada Jakarta putaran kedua untuk pemilih pemula di SMA 4 Jakarta, Rabu (8/8).

Kampanye Putaran Kedua, 14-16 September JAKARTA-KPU DKI Jakarta menjadwalkan kampanye putaran kedua pemilihan gubernur pada 1416 September. Kampanye dilakukan berupa penajaman visi dan misi kedua kandidat. Pada masa kampanye itu, KPU menyelenggarakan dua kali debat kandidat yang akan disiarkan melalui televisi. “Pada masa kampanye kali ini, kami

memandang tidak perlu ada rapat umum seperti pada putaran pertama. Apalagi, masa kampanye sangat sempit,” kata anggota KPU Jakarta, Suhartono, Selasa (28/8), di Jakarta. Sebagai konsekuensi, kata dia, KPU rencananya juga tidak mengharuskan kandidat untuk melaporkan dana kampanye seperti pada putaran pertama. (kps/int)

„ Sri Sultan bersalaman dengan Presiden

Kharisma Sultan Tetap Dilarang Berpartai, Sultan Tetap Bisa jadi Presiden Melekat di Golkar Sambungan Halaman 9 tapi karena ada pengaturan dalam UU. Jadi, karena UU jadikan hati dia dan platform kegolkarannya tidak akan luntur,” kata Yorris. Karenanya Yorris meyakini keluarnya Sultan tidak akan membuat suara PG berkurang. “Saya kira tidak, malah sekarang membaik kok, malah meningkat. Artinya meskipun dia (Sultan) tidak di Golkar karena UU, tapi kharisma dia tetap Golkar,” pungkas Yorris. Seperti diketahui, seluruh fraksi di

DPR menyepakati keseluruhan pasal dalam Rancangan UndangUndang Keistimewaan (RUUK) DIY, termasuk tentang aturan agar Sultan tidak masuk parpol. RUU itu rencananya disahkan 30 Agustus 2012. Seluruh fraksi sepakat agar gubernur dan wakil gubernur DIY melepaskan jabatan politik selama menjabat sebagai kepala dan wakil kepala daerah. Artinya, Sri Sultan Hamengku Buwono X harus mundur dari keanggotaannya di PG. (boy/jpnn)

Ketua NNB Rimdo Nauli Siap Menangkan Dedi-Affan Sambungan Halaman 9 memiliki hubungan yang baik dengan Kota Medan sebagai ibukota Proivinsi Sumut. Dengan hubungan yang baik itu, dia optimisi DediAffan mampu membawa investor untuk berinvestasi di Kota Psp ini. “Kalau investor sudah berdatangan di Kota Psp ini untuk berinvestasi, maka lapangan kerja akan terbuka, pengangguran bisa ditekan, perekonomian masyarakat bisa tumbuh dan bisa menambah

pendapatan daerah kedepan,” tuturnya. Dilihatnya, Dedi Jaminsyah Putra merupakan figur muda yang berpengalaman dan memiliki skil serta berpendidikan dibidangnya. “Apalagi Dedi pandai bermasyarakat, dan pemimpin seperti ini yang kita butuhkan,” pungkasnya. Begitu juga pasangannya, Affan Siregar yang merupakan birokrat senior yang segala tingkah lakunya sangat disukai masyarakat. (neo)

Pengurus Angkot Line 09 Minta Terminal Pal IV Direlokasi Sambungan Halaman 9 tanggal 18 Oktober nanti,” ungkap Erwin. Kemudian mereka juga mengusulkan supaya terminal pal IV Pijorkoling sebagai tempat mangkal line 09 menunggu penumpang bisa direlokasi. Karena lokasi terminal sekarang ini dikelilingi oleh kantor Pemko Psp sehingga kesannya kurang bertolak belakang. “Harapan kami apabila AMIN terpilih sebagai walikota dan wakil walikota terminal Pal IV Pijorkoling bisa direlokasi ke tempat yang lebih refresentatif lagi,” harap mereka sembari menerangkan jumlah ar-

mada line 09 ini sebanyak 40 unit. Seluruh aspirasi yang disampaikan pengurus line 09 itu ditampung dan diterima dengan tulus oleh ketua tim suskes, Indar Sakti dan berjanji akan memperjuangkannya nanti apabila keinginan dan cita-cita bersama tercapai yaitu kemenangan AMIN di pilkada. Kerjasama seperti ini, sambung Indar, sangat didukung oleh AMIN apalagi berkaitan dengan nasib rakyat. “AMIN sangat komit terhadap program kerakyatan dan akan diwujudkan bila diberi amanah memimpin Kota Psp selama 5 tahun yang akan datang,” kata Indar Sakti. (phn)

JAKARTA - Peluang Sri Sultan Hamengkubuwono untuk mencalonkan diri dalam Pemilu Presiden (Pilpres) tetap terbuka lebar, kendati Rancangan Undang-undang Keistimewaan (RUUK) Yogyakarta yang akan disahkan menjadi UU, Kamis (30/8) melarang Sultan dan Pakualam masuk partai politik. Bahkan Sultan tetap berpeluang untuk du-

duk sebagai anggota DPR RI. “Dia bisa menjadi presiden, jadi wapres, jadi anggota DPR, jadi bisa apa saja dia. Dan dia punya hak politik,” Kata Ketua DPR RI Marzuki Alie di kantornya, Rabu (29/8). Menurutnya, kelebihan Sultan sebagai raja di Yogyakarta memang membuatnya Sultan tidak boleh berpartai. “Beliaukan raja. Raja itu

dan sudah ditetapkan ada kekhususan di Yogyakarta, tidak melalui pemilu dan hanya penetapan saja,” kata Marzuki. Karenanya Marzuki menegaskan, Sultan memang lebih baik tidak berpartai. Meskipun tidak berpartai, Marzuki menjamin hak politik Sultan tak dikurangi. Apakah perlu gubernur, wali kota

dan bupati tidak berpartai? Marzuki menegaskan, sah-sah saja jika ada wacana seperti itu. Sebab, kepala daerah yang tidak berpartai akan terhindar dari konflik kepentintan. “Itu sah saja kalau kita inginkan, supaya tidak ada konflik kepentingan antara dia di partai dan dalam menjalankan roda pemerintahannya,” kata Marzuki. (boy/jpnn)

Di Tangan Andar Amin Psp Akan Banyak Perubahan Sambungan Halaman 9 paten Padang Lawas Utara (Paluta) sudah teruji dan terbukti lewat lobbinya ke pemerintahan provinsi Sumut dan pusat sehingga anggaran lebih banyak mengucur ke daerah yang baru mekar dari Tapanuli Selatan (Tapsel) itu. “Saya hakkul yakin Andar Amin akan membawa bumi Dalihan Na Tolu bergerak maju lebih kencang mengejar kemajuannya dari daerah lain. Usianya masih muda, semangatnya untuk memajukan daerah bumi Dalihan Na Tolu tak usah diragukan lagi. Andar akan mengabdi total demi keberhasilan pembangunan, peningkatan ekonomi dan kesejahteraan warganya. Saya yakin itu,” tutur anggota Majelis Pertimbangan Organisasi Pemuda Pancasila (MPO PP) Kota Psp, H M Salim Harahap. Mantan wakil ketua DPD KNPI Tapsel ini mengaku sudah mengenal

figur Andar Amin sejak lama. Bahkan sejak masih kuliah di STPDN, mengabdi sebagai PNS di Pemko Psp dan Paluta hingga maju sebagai calon Walikota Psp belum pernah mendengar kabar miring tentang Andar Amin. Malah, popularitas Andar Amin semakin hari makin melejit melampaui rekan-rekannya. Hal itu terjadi karena SDM yang dimilikinya cukup baik dan dapat diandalkan untuk memimpin daerah setingkat Pemko Psp. Dibidang sosial dan kemasyarakatan, sebut Salim Sarahap, sepak terjang Andar Amin tak perlu dipertanyakan lagi karena turun ke bawah, berbaur dengan warga untuk mendengarkan keluhan serta aspirasi sudah dilakukannya jauh hari sebelum melangkah sebagai calon walikota. ”Banyak masukan yang disampaikan warga bumi Dalihan Na Tolu kepadanya, apabila nanti

terpilih sebagai walikota akan dilaksanakannya dengan penuh tanggungajwab,” jelas Salim Harahap yang juga mantan Ketua PWI Perwakilan Tapsel ini. Andar Amin Harahap yang berpasangan dengan Muhammad Isnandar Nasution SSos atau populer dikenal dengan AMIN sebagai calon walikota dan calon wakil walikota Psp periode 2013-2018 merupakan perpaduan birokrat dan politisi. Duet ini memiliki nomor urut 3 pada Pemilukada tanggal 18 Oktober 2012 nanti. M Isnandar saat ini duduk untuk periode kedua sebagai anggota DPRD dan saat ini jabatnnya anggota Badan Kehormatan DPRD Psp. ”Duet birokrat dan politisi, saya kira sangat klop dan akan saling dukung mendukung dalam memberhasilkan program pemerintahan, pembangunan dan kerakyatan,” jelasnya. Salim menggambarkan bahwa

pasangan AMIN merupakan dambaan warga untuk memimpin pemerintahan di Kota Psp 5 tahun yang akan datang. Andar Amin juga tercatat aktif sebagai bendahara MPC PP Kota Psp. ”Dilembaga ormas ini (PP), Andar Amin cukup menonjol dan pandai membawa diri sehingga disayangi rekan-rekannya. Oleh sebab itu, tidak ada alasan apapun bagi keluarga besar PP Kota Psp dan Tapsel untuk tidak memenangkannya sebagai walikota,” ujar Salim Harahap. Kenapa dirinya mengajak keluarga besar PP Tapsel untuk memenangkan Andar Amin, lanjut mantan Sekretaris Inkai dan Pertina Tapsel ini, serta tokoh masyarakat Kelurahan Batunadua Jae, karena sebagian besar pengurus dan anggotanya berdomisili di Psp, tentunya memiliki hak pilih. ”Dan pilihan itu wajib disalurkan kepada Andar Amin,” tegasnya. (phn)

Pilih Foke Karena Tak Mau Dikecewakan Jokowi Lagi Sambungan Halaman 9 sebenarnya juga melakukan pembicaraan dengan Joko Widodo alias Jokowi yang menjadi pemenang Pemilukada putaran pertama. Namun Mahfud menilai Jokowi tidak bisa menunjukkan komitmennya untuk tetap memimpin Jakarta selama satu periode penuh. “Kita memang tanyakan padanya mengenai komitmennya (Jokowi) untuk menuntaskan jabatannya selama lima tahun jika menang dalam pilkada DKI ini. Karena kita

tidak mau nanti dukungan kita menjadi sia-sia karena bisa saja nanti baru satu tahun menjabat Gubernur, dia meninggalkan jabatannya,” kata Mahfud di gedung DPR RI, Rabu (29/8). Ditegaskannya, koalisi juga harus disertai dengan komitmen untuk mengawal kontrak politik. “Jokowi sendiri tidak ada konfirmasi mengenai hal itu (tetap sebagai Gubernur DKI selama lima tahun,red), jadi kita anggap tidak setuju dengan syarat yang kita ajukan,” ujar Mahfudz.

Bukankah PKS pernah mendukunhg Jokowi dalam Pemilihan Wali Kota Solo? Mahfuz tak menampik hal itu. Alasannya, karena PKS menganggap gagasan Jokowi untuk memperbaiki Solo dianggap sangat bagus. Namun PKS justru kecewa karena Jokowi mengincar jabatan lebih tinggi. “Tapi kita tidak mau orang yang diberikan amanah terus memburu jabatan yang lebih tinggi. Kita tidak mau hal itu menjadi trend atau gejala umum karena hal itu mencederai amanah yang

diberikan,” tegasnya. Bagaimana dengan tudingan bahwa PKS memutuskan mendukung Foke karena bakal diberi jatah untuk menempatkan kadernya di beberapa jabatan penting di Pemprov DKI? “Aneh kalau kami dituduh mendukung Foke karena akan mendapatkan bebarapa jabatan kepala dinas. Kepala dinas di pemerintah daerah itu PNS dan PNS aktif tidak boleh berpolitik, jadi bagaimana bisa kami mendudukkan politisi kami menjadi kepala dinas?” imbuhnya.(ara/jpnn)


30 Agustus 2012

Syahganda Nainggolan.

“Di luar itu, wilayah DPR pun banyak disandera oleh berbagai kasus besar yang menjerat kehormatan anggotanya sendiri baik penyimpangan moral pribadi ataupun anggaran, sehingga berdampak pada krisis kepercayaan publik terhadap lembaga DPR,”

“Timwas Century mendorong Tim Pengenbalian Aset melakukan segala upaya agar aset yang dibekukan di dalan nageri maupun di dalam negeri segera dicairkan atau dirampas untuk menutup kerugian negara,” Ketua DPR Marzuki Alie.

“DPR ini almamater saya yang sangat saya cintai, saya ikut bersedih. Betapa kebanggaan saya, saya dari penjara menjadi pimpinan di sini, sehingga saya menulis buku dari ‘Cipinang ke Senayan’. Tapi banyak teman-teman saya yang berangkat dari Senayan ke Cipinang, ya itu saya sangat sedih,”

AM Fatwa.

Kirim Opini Anda ke email: metrotabagsel Maksimal tulisan 5.000 karakter

Sikap Kami Menjaga Kerukunan PENYERANGAN terhadap kelompok minoritas akhirakhir ini menunjukkan betapa problem kerukunan masih menggelayuti bangsa ini. Celakanya, kita seperti tak mau belajar dari peristiwa-peristiwa terdahulu, seperti penyerangan terhadap kelompok Ahmadiyah, sehingga kita tak serius menjaga kerukunan. Kalaupun belajar, kita seperti tak kunjung pintar menjaga kerukunan. Itu sebabnya peristiwa yang mengoyak kerukunan berulang kali meletus. Penyerangan terhadap kelompok minoritas Ahmadiyah tak hanya sekali, tetapi berulang-ulang terjadi. Penyerangan terhadap umat kristiani yang tengah beribadah pun berkali-kali terjadi. Paling mutakhir penyerangan terhadap kelompok minoritas Syiah di Sampang, Madura, Jawa Timur, Minggu (26/8). Penyerangan itu bukan yang pertama. Penganut Syiah itu mendapat serangan serupa pada Desember 2011. Semestinya tragedi Sampang menjadi pelajaran bahwa kita harus serius menjaga kerukunan. Kerukunan bisa dijaga bila kita memahami bahwa keberagaman merupakan keniscayaan sosial, hukum alam, sunatullah. Segala makhluk yang ada di kolong langit ini pastilah plural, jamak, banyak, tidak tunggal. Hanya Sang Pencipta yang satu, esa, tunggal. Manusia berasal dari berbagai ras, etnik, agama, dan kebudayaan. Hasil cipta, rasa, dan karsa manusia pun beragam. Termasuk penafsiran atas agama juga beragam. Itu sebabnya banyak sekali aliran dalam agama-agama. Bangsa ini harus menyadari hukum alam tidak bisa dilawan. Melawan hukum alam hanya menghasilkan kerusakan, kesengsaraan, dan penderitaan. Penghormatan terhadap keberagaman akan menciptakan harmoni. Itulah sebabnya para pendiri bangsa menciptakan semboyan Bhinneka Tunggal Ika.Sayang sekali, bangsa ini seperti melupakan, bahkan melawan, kebinekaan. Penyerangan atas nama agama terhadap kaum minoritas di Tanah Air merupakan perlawanan terhadap kebinekaan, keberagaman, dan hukum alam. Hasilnya pun hanyalah kerusakan, kesengsaraan, penderitaan, dendam, dan trauma berkepanjangan. Oleh karena itu, kita tidak punya pilihan lain kecuali menerima keberagaman dalam kehidupan sosial kita. Mari kita rayakan keberagaman sebagai keindahan kehidupan. Negara tentu punya tanggung jawab besar menjaga kerukunan. Negara harus menjadikan penyerangan terhadap kelompok Syiah di Sampang sebagai pelajaran pamungkas. Negara harus menjadikan peristiwa itu sebagai momentum untuk ekstra serius menjaga kerukunan. Kita perlu menegaskan hal itu karena, alihalih menjaga kerukunan, negara justru acap memicu kerusuhan. Negara hadir malah untuk memicu penyerangan atas nama agama. Label sesat dari aparatur negara menjadi alat legitimasi oleh kelompok intoleran untuk menyerang kelompokkelompok minoritas. Ketika penyerangan atas nama agama itu terjadi, negara malah absen. Terang benderang negara berpihak kepada satu kelompok ketika menyelesaikan problem kerukunan. Padahal, negara mesti bersikap bijak dan adil. Negara disebut telah menjaga kerukunan hanya bila ia hadir dan berdiri di atas semua golongan yang hidup di negeri ini. (**)

Menebar Citra di Hari Idul Fitri Dari lebaran ke lebaran sepertinya kaum pemudik semakin dimanjakan. Mereka tidak perlu lagi berpanas-panasan untuk antre tiket, bus atau kereta, ataupun ditipu calo saat membeli tiket, sebab sekarang mereka bisa ikut program mudik bareng gratis. : Ardi Winangun MENJELANG lebaran, beberapa tahun sebelumnya dan saat ini, semakin banyak pihak, seperti partai politik, perusahaan swasta, bahkan komunitas masyarakat daerah, yang mengorganisasi mudik secara massal dan gratis, bahkan sepanjang perjalanan pemudik diberi makan dan minum. Bila pengelola mudik bareng royal, pemudik diberi kaos dan topi serta atribut lainnya. Lihat saja saat kita melintas di komplek Gelora Bung Karno, Jakarta, beberapa hari menjelang lebaran banyak terlihat pos pemberangkatan mudik bareng yang digelar berbagai perusahaan, seperti pabrik semen, perusahaan minum, dan ada partai politik. Pos pemberangkatan mudik itu nampak meriah, berbagai atribut mereka seperti bendera, baliho, dan umbul-umbul dipasang secara mencolok. Akibat dari mudik bareng ini, ada pihak yang merasa dirugikan, yakni perusahaan otobus. Dalam sebuah kabar di media massa

diberitakan, perusahaan otobus mengalami penurunan omset tiket penjualan angkutan mudik. Menurut Boy Mando, agen tiket Bus Gumarang Jaya rute JakartaPadang mengatakan, kegiatan mudik gratis yang digelar banyak perusahaan, hanya menguntungkan warga yang mau mudik, tapi merugikan PO yang biasa melayani angkutan mudik lebaran di berbagai terminal di Jakarta. Dikatakan kepada sebuah media massa beberapa waktu yang lalu, mudik bareng gratis menurunkan omset penjualan tiket PO, yang biasanya H-7 tiket sudah terjual habis, sekarang hingga H-5 Lebaran tiket masih tersisa cukup banyak. Lebih lanjut dalam berita itu dikatakan, tahun ini lebih turun dari tahun 2011. Tahun ini, tiket belum habis beberapa hari menjelang lebaran. Lima tahun lalu, H-7 tiket sudah habis. Sekarang, sejak H-7 hingga beberapa hari menjelang lebaran, dirinya hanya memberangkatkan tiga bus dengan total 120 penumpang.

Bagi pihak yang mengorganisir mudik bareng ada misi-misi sosial yang dilakukan, namun ada pula misi politik atau membangun citra untuk kepentingan-kepentingan tertentu. Bagi perusahaan swasta, mudik bareng bisa dilakukan dengan tujuan untuk mengucapkan terima kasih atas loyalitas masyarakat yang telah menggunakan produknya. Bisa juga untuk mengikat masyarakat agar tetap mau menjadi distributor atau pedagang perusahaan swasta itu. Bagi partai politik, menggelar mudik bareng tentu sebagai salah satu bentuk kampanye untuk kepentingan Pemilu 2014. Dengan mudik bareng inilah pengurus partai membangun citra bahwa partainya adalah partai politik yang peduli kepada masyarakat. Melalui ikatan emosional mudik bareng inilah, partai politik mencoba mengikat masyarakat untuk memilih partainya. Kampanye atau membangun citra di saat mudik ini merupakan sebuah cara yang efektif untuk menebar pengaruh. Dalam arus mudik, jutaan orang secara bergelombang bergerak ke arah yang sama, seperti dari Jakarta menuju Jawa Tengah, Jawa Timur, Jogjakarta; Jakarta menuju Sumatera; Bandung menuju Jawa Tengah, Jawa Timur, dan Jogjakarta; serta dari satu titik ke titik lainnya.

Menurut Menteri Perhubungan, E. E. Mangindaan, dalam sebuah berita, memprakirakan jumlah pemudik melalui angkutan jalan untuk tahun 2012 sebesar 5,5 juta penumpang, angkutan sungai dan penyeberangan danau, 3,3 juta penumpang, Kereta Api diprediksi 1,3 juta penumpang, untuk angkutan laut 1,5 juta penumpang, angkutan udara 3,2 juta penumpang. Dari data tersebut bisa dibandingkan bila tahun 2011 jumlah pemudik mencapai 13 juta orang maka di tahun 2012 ada sekitar 14,8 juta orang. Bila partai politik mampu menebar citra dan pengaruh pada 14,8 juta pemudik, maka partai politik itu bisa masuk 3 besar peraih suara terbanyak dalam Pemilu 2014. Kenapa demikian? bila kita mengacu pada Pemilu 2009 terlihat perolehan suara partai politik adalah: Partai Demokrat 21.703.137 suara atau orang, Partai Golkar 15.037.757 suara, PDIP 14.600.091 suara, PKS 8.206.955 suara, PAN 6.254.580 suara, PPP 5.533.214 suara, PKB 5.146.122 suara, Gerindra 4.646.406 suara, dan Hanura 3.922.870 suara. Dari data tersebut menunjukan bahwa jumlah pemilih partai politik seperti PKS, PAN, PPP, PKB, Gerindra, dan Hanura, tidak sebanyak jumlah pemudik di tahun 2011 atau 2012. Dengan demikian tak heran bila partai politik berlomba-lomba

untuk menggelar mudik bareng. Lihat saja, PAN dalam mudik bareng tahun ini menyediakan 200 bus, PKB menyediakan 35 bus AC, Partai Golkar 120 bus, dan Partai Demokrat 109 bus. Mayoritas busbus itu mempunyai tujuan ke berbagai kota di pulau Jawa dan Sumatera. Mudik bareng yang digelar partai politik itu baik-baik saja dan syah-syah saja, namun dengan adanya mudik bareng yang difasilitasi partai politik, menunjukan bahwa biaya politik yang dikeluarkan untuk kampanye semakin tinggi. Untung saja Idul Fitri setahun hanya sekali, bayangkan kalau Idul Fitri setahun dua kali. Semakin banyaknya kegiatan yang dilakukan partai politik untuk menjaring suara tentu akan mempengaruhi kondisi kas partai politik. Nah di sinilah perlunya transparansinya partai politik dalam mengelola keuangannya. Bila tidak transparan, janganjangan biaya mudik bareng itu diperoleh dari dana-dana yang tidak jelas, diambil dari ngentit proyek-proyek besar atau menaikan anggaran pembangunan. Selamat Idul Fitri 1433 H, Mohon Maaf Lahir dan Batin. (***) Penulis adalah Pengamat Sosial dan Budaya


30 Agustus 2012


ejak berpisah dengan Ahmad Dhani, Maia Estianty kini belum mendapat pasangan baru. Pendiri Duo Ratu tersebut sepertinya sudah pasrah tidak mendapatkan jodoh. ”Sama seperti anak-anak aku enggak pernah mengharapkan mereka dateng,

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober) Peruntungan: Keruwetan mulai teratasi namun mungkin akan muncul yang baru, untuk itu jangan mudah percaya dengan omongan orang. Berjalanlah dengan prinsip Anda sendiri dan hiduplah yang sederhana. Asmara: Hadapilah tantangan kecil dengan hati yang besar dan lapang dada, jangan cepat menyerah.


udah pasrah,” kata Maia saat ditemui di Episentrum Kuningan Jakarta Selatan, Selasa (28/8) malam. Maia menyatakan kini dirinya tidak terlalu agresif untuk menjadi jodoh. Ia menyatakan, dirinya tidak pernah mencari jodoh. ”Anak-anak begitu udah enggak saya harapkan tiba-tiba datang.

Sama seperti jodoh saya enggak perlu cari nanti datang sendiri lah,” jelas Maia. Maia mengaku bahwa dirinya banyak didekatin cowok. “Yang deket banyak, tapi untuk jadi pasangan belum lah, saya belum mikirkan pasangan,” kata ungkapnya.(abu/ jpnn)

PERJALANAN asmara Pinkan Mambo penuh liku. Hubungannya bersama Febriyanto Wijaya, pemain sepak bola asal Mamuju, Sulawesi Selatan, telah kandas. Ia pun harus menerima kenyataan pahit itu karena terbentur perbedaan. “Aku sudah putus ya. Sekitar dua bulanan lalu. Ya begitulah, memang enggak mudah mencari orang yang benar-benar. Intinya banyak perbedaan,” ucapnya, saat ditemui di Studio Guet, Perdatam, Pancoran, Jakarta Selatan. Hubungan Pinkan dan Febriyanto sudah tak bisa lagi diselamatkan. Keduanya sulit menyatukan visi ke depan. Masing-masing punya tujuan berbeda. Sehingga, keputusan untuk berpisah merupakan jalan keluar satu-satunya. Harapannya untuk membina rumahtangga buyar. “Misalnya, gol aku ke mana, dia ke mana. Jadi,

enggak ketemu. Aku enggak bisa menjelaskan ke media. Tapi aku tentu punya pertimbangan. Aku tahu mana yang baik dan tidak. Tapi aku enggak bilang kalau dia enggak baik ya,” ucapnya. Kesedihan pun meliputinya. Namun, ia tidak mau terlalu lama larut dalam perasaan tersebut. Baginya, pengalaman asmaranya bersama Febriyanto membuatnya banyak belajar untuk menata kembali kehidupannya di masa depan. Sebagai manusia, penyanyi kelahiran Jakarta, 11 November 1980 itu, hanya bisa berencana, tetapi Tuhan punya kehendaknya sendiri. “Aku tambah belajar dari pengalaman. Aku memutuskan dengan kekuatan aku sebagai manusia. Ketika aku sudah tahu mana yang baik dan enggak, kembalikan lagi kepada Tuhan. Kalau jodoh enggak ke mana-mana,” tandasnya. (tr/int)

(21 Desember -19 Januari)

Kesempatan untuk menanjak ke atas semakin terbuka, tinggal tergantung bagaimana cara Anda bersosialisasi dengan rekan-rekan kerja sehingga tidak muncul permusuhan yang akhirnya hanya akan menghambat laju karir Anda saja. Asmara: Cekcok mulut tak akan menyelesaikan masalah, justru akan semakin memperumit saja.


(20 Januari - 18 Februari)

Peruntungan: Emosi yang labil hendaknya bisa diberi perhatian serius. Jangan sampai kesuksesan yang telah berada di depan mata hilang begitu saja hanya karena sikap Anda yang kurang bisa sabar dalam menghadapi berbagai macam omongan yang memanaskan hati. Asmara: Carilah jalan keluar dalam menghadapi masalah cinta yang memang sedang Anda hadapi ini.


19 Februari - 20 Maret

Peruntungan: Egoisme dan rendah diri itu tidak ada untungnya, untuk itu alangkah baiknya disisihkan saja. Kalau dibiarkan berjalan terus yang rugi bukan orang lain tetapi diri Anda sendiri. Asmara: Untuk lebih baiknya cinta memang tidak lantas tutup mata dan telinga, saran masuk mesti diterima dengan baik.


(21 Maret - 20 April)

Peruntungan: Isu di hari ini sangat merugikan padahal kebenarannya sudah jelas disangsikan. Semua itu hadapilah dengan hati yang lapang dan kepala dingin. Anggaplah semua ini merupakan ujian untuk meraih jenjang yang lebih tinggi. Asmara: Hindarilah pertikaian yang hanya akan memperburuk suasana dan ketenangan saja.


(21 April - 20 Mei)

Peruntungan: Di hari ini perjalanan perbintangan Anda cukup bagus, walau banyak persoalan timbul tenggelam, namun semuanya bisa teratasi dengan baik. Tetaplah optimis, apalagi simpati orang lain terhadap Anda cukup besar sehingga Anda harus bisa lebih percaya diri dan yakin dengan apa yang telah menjadi keputusan Anda. Asmara: Anda harus puas dengan apa yang selama ini dia berikan pada diri Anda.


(21 Mei - 20 Juni)

Peruntungan: Berhati-hatilah dalam melangkah sebab jika Anda salah dalam melangkahkan kaki maka bisa berakibat fatal. Bintang Anda cukup bersinar terang hanya saja ada ombak yang datang menghantam Anda, jika hati-hati maka Anda akan selamat. Asmara: Anda sedang mengalami gelombang pasang yang hebat. Cobalah Anda mengerti dengan sikap yang Anda lakukan dengan memberi kepercayaan tanpa perlu mendiktenya, seperti yang selama ini Anda lakukan.


NIKITA Mirzani senang dicaci maki masyarakat karena sering berpose vulgar. Baginya, hujatan tersebut malah memotivasi untuk berpose lebih menantang lagi. ”Niki nggak merasa terganggu dengan banyak orang komplain. Malah senang, malah jadi motivasi Niki untuk menjadi lebih untuk mempunyai foto yang bagus lagi dari foto yang lalu,” ungkap Nikita di Tebet, Jakarta Selatan. Menurut janda beranak satu ini, selama terjun ke dunia hiburan, ia tak pernah foto-foto yang berbau pornografi. ”Jadi nggak ada joroknya atau pornografinya. Karena di situ nggak ada angel foto yang mengangkang atau apa segala macam,” tegasnya. ”Foto Niki nggak ada yang hot. Mungkin lihatnya di sebelah kompor atau orang yang nabun api,” imbuhnya dalam nada canda. (idc/int)

(21 Juni- 20 Juli)

Peruntungan: Pengaruh serta kewibawaan Anda sangat menentukan bagi keadaan sekitar. Hindari rasa kurang percaya diri sebab pada hakikatnya hal ini hanya akan merugikan saja. Jangan terpancing dengan omongan-omongan, semua itu hanya akan menghalangi langkah Anda ke depan. Asmara: Bersikaplah terbuka dengan pasangan Anda sehingga bisa terhindarkan dari segala fitnah dan omongan yang tidak benar.


(21 Juli-21 Agustus)

Peruntungan: Lakukan terobosanterobosan penting di hari ini karena memang sudah waktunya dan cukup ada peluang untuk maju. Bintang Anda lagi bagus dan cukup membawa kemujuran. Karir: Cukup banyak halangan yang harus dihindari, bersabarlah. Asmara: Dengarkan saja setiap kata-katanya agar tidak selalu timbul cekcok mulut.


(23 Agustus-22 September)

.Peruntungan: Jangan ragu untuk menolak kalau itu memang tidak sesuai dengan hati Anda. Buat apa Anda pertahankan kalau akhirnya di kemudian hari hanya akan membikin pusing Anda saja? Asmara: Jangan malas untuk bertemu dengannya, minimal menelponnya jika memang tidak ada waktu.


(23 Oktober - 22 November)

Peruntungan: Inisiatif dan ide-ide cemerlang Anda tampaknya sangat diperlukan dalam setiap langkah. Walau begitu konsultasi dengan pihakpihak yang lebih berpengalaman tampaknya perlu juga. Asmara: Jangan begitu mudahnya termakan isu yang sengaja disebar olehnya.


( 23 November - 20 Desember)

Peruntungan: Jangan suka menunda pekerjaan karena bila menumpuk akan menimbulkan kebosanan. Di hari ini cobalah bekerja sepraktis mungkin sehingga kejenuhan yang sudah di ambang batas itu tidak sampai menambah pusing. Asmara: Hati boleh panas akan tetapi pikiran harus tetap dingin, dengan begitu walaupun amarah memuncak hubungan percintaan Anda tetap aman-aman saja. (int)

EMMA Stone hancur saat patah hati. Wah, karena ulah Andrew Garfield kah? Mengutip femalefirst, aktris Easy A yang saat ini masih berkencan aktor Inggris, Andrew Garfiel merasa hancur saat harus berurusan dengan retaknya hubungan kekasih. “Saya merangkak di lantai dan muntah. Saya merasa hancur dan terbunuh, namun tetap

harus menjalani hidup,” terang Emma. Emma yang saat ini tak bermasalah Andrew, justru mengaku merasa dekat dengan aktor Ryan Gosling, lawan mainnya dalam Crazy, Stupid, Love “Saya merasa nyaman, mungkin karena apa yang dipikirkannya, sama seperti apa yang saya pikirkan,” tutur Emma. (int)

Selena Gomez membeli rumah seharga US$2,9 juta atau Rp27,55 miliar di Jonah Hill di Los Angeles. Seperti dikutip Femelfirs, rumah dengan luas 4.650 kaki persegi itu memiliki lima kamar tidur, enam kamar mandi, kolam renang, lapangan tennis dan spa. Meski rumah itu dibeli dari uangnya sendiri, namun bukan berarti kekasihnya, justin Bieber, bisa seenaknya tinggal di rumah tersebut. ”Aku bahagia dengannya. Tapi aku baru 20, dan belum berani serius dalam kehidupan pribadi. Aku bersyukur memiliki teman dan tim solid yang mencintaiku,” kata Selena. ”Pernikahan dan semua hal lain aku pikir akan terjadi setelah aku merasa telah mencapai dalam setiap aspek lain dari kehidupanku,” katanya. (idc/int)


30 Agustus 2012

Bayi Prematur Tewas Digigit Tikus CHENNAI - Bukannya berbahagia menyambut kelahiran bayi mereka sepasang suami istri di Chennai, India justru dipaksa menghadapi kenyataan pahit. Bagaimana tidak, pasangan ini mendapati bayi mereka tewas akibat hal yang sama sekali tak wajar. Bayi yang lahir secara prematur itu kabarnya tewas di dalam inkubator. Pasangan suami istri itu pun menuding bayi mereka tewas karena digigit tikus, Rabu (29/8). Akibat insiden ini dua dokter dan tujuh perawat di rumah sakit itu kabarnya diberhentikan karena dinilai melakukan kelalaian. Tidak hanya kedua orang tua bayi malang itu namun warga Chennai pun dilaporkan marah

menanggapi insiden memilukan ini. Bahkan akibat insiden ini Kementerian Negara India pun sampai turun tangan untuk mencari solusi atas masalah tersebut demi meredam kemarahan massa. Kabar lain menyebutkan bayi tersebut telah tewas. Namun jasadnya dibiarkan berada semalaman di rumah sakit sebelum diserahkan kepada anggota keluaga keesokan harinya. Sementara itu, pihak rumah sakit dikabarkan segera menempuh langkah-langkah cepat untuk mensterilkan kawasan itu dari ular dan tikus yang kabarnya kerap berkeliaran. Untuk melaksanakan langkah ini pihak rumah sakit pun melibatkan para pemburu ular.(oz/ nik)

„ Illustrasi

„ Illustrasi

Ribut dengan Ayam

Perempuan Ini Alami Gagal Jantung AMMAN - Seorang perempuan di Yordania dilaporkan menderita gagal jantung, setelah sempat bersitegang dengan ayam-ayam peliharaannya. Perempuan berusia 40 tahun itu kabarnya kesal karena ayam-ayam miliknya, menolak makan pakan ternak yang baru saja ia beli. Ayam-ayam tersebut memilih berlari-lari ke kebun belakang

rumah ketika perempuan itu meletakkan pakan ternak di hadapan mereka. Tidak tahan melihat ulah ayam-ayamnya, perempuan itu pun mengurung mereka di kandang dan melem-

parkan pakan ternaknya begitu saja. ”Namun, mereka masih tidak mau makan. Ia kemudian marah dan kembali ke kandang untuk memaksa mereka makan dengan memegang kepala mereka dan memaksa memasukkan makanan ke mulut mereka,” tulis sejumlah media, Selasa (28/8). ”Ayam-ayam tersebut menyem-

burkan makanan yang dimasukkan dengan paksa . Lalu perempuan itu bergegas masuk ke dalam rumah dan ia merasa sulit bernapas namun ia masih sempat ke dokter sebelum akhirnya menghembuskan napas terakhir,” sebutnya. Para tetangga menggambarkan perempuan itu, sebagai sosok yang memiliki emosi buruk.(oz/nik)

Sepedamotor Berbahan Bakar Kotoran Hewan

„ Illustrasi PELUNCURAN: Sepedamotor yang berbahan kotoran hewan diluncurkan. TOKYOPembuat toilet terkemuka Jepang, Toto, Rabu (29/ 8) meluncurkan sepeda motor poop-powered yang bisa berjalan sejauh 300 kilometer, dengan tanki bahan bakar disi dengan kotoran

hewan. Sebagaimana dilanris kantor berita AFP, Rabu, Toto mengklaim hasil produksinya ini sebgai kendaraan dengan bahan bakar kotoran hewan yang pertama di

dunia. Sepeda motor atau kendaraan dengan tiga roda ini memiliki toilet sebagai tempat duduk pengemudinya dan sebuah kertas pembersih toilet ukuran besar di bagian belakang

„ Neil Bush

kendaraan. Dengan seorang perempuan cantik dan muda duduk di atas kendaraan ini dalam tes mengemudia hari Rabu, raksasa produsen toilet terkemuka Toto segera menegaskan bahwa perempuan tadi bukan yang memproduksi “bahan bakar” bagi sepeda motor itu. “Biogas yang dipakai sebagai bahan bakar sepeda motor ini tidak berasal dari kotoran manusia. Biogas ini dibuat dari kotoran ternak dan limbah cair,” ujar Kenji Fujita, juru bicara Toto dalam jumpa pers di pinggiran Tokyo, Jepang. “Kami berharap produk ini menambah kesadaran di antara para pelanggan soal kampanye hijau melalui pengembangan produk yang ramah lingkungan, sebagaimana pemancur yang hemat air dan toilet yang hemat air,” tuturnya. Namun demikian, pihak Toto menegaskan, mereka tidak akan membuat sepeda motor untuk dijual secara komersial. Paling tidak, belum ada rencana ke sana. (kps/nik)

Si Kembar Anorexia Akhirnya Tewas dalam Kebakaran MELBOURNE - Memiliki bentuk tubuh yang ideal adalah impian besar setiap wanita. Langsing dan proposional menjadi salah satu tujuan mereka. Untuk mencapai itu semua, banyak dari wanita yang terobsesi untuk menjadi kurus hingga menyebabkan mereka mengidap anoreksia. Gambaran seorang wanita yang diharuskan memiliki bentuk badan kurus dan langsing menjadi patokan sendiri bagi banyak wanita di dunia ini. Karena itulah, mereka berlomba-lomba untuk melakukan diet ketat demi mendapatkan predikat cantik dengan bentuk tubuh ideal. Hal ini juga terjadi pada kembar identik yang terkenal karena anoreksia, Clare dan Rachel Wallmeyer. Baru-baru ini mereka ditemui tewas akibat kebakaran di rumahnya. Sepasang kembar identik ini menjadi terkenal melalui pertempuran mereka melawan anoreksia yang diidapnya. Clare dan Rachel Wallmeyer yang sama-sama berusia 42 tahun tewas pada kebakaran yang terjadi di rumah mereka di Geelong, dekat Melbourne, salah satu dari mereka mengalami luka bakar yang parah dalam perjalanan ke rumah sakit, Rabu (29/8). Itulah akhir tragis untuk dua kehidupan yang bergolak demi meraih sosok cantik dengan bentuk tubuh impian semua wanita. Meski selama hidupnya mereka berjuang melawan itu tapi kepergian mereka yang tragis menyentuh hati semua orang di seluruh dunia.

TV Australia beberapa kali berbicara mengenai anoreksia yang telah berubah menjadi suatu habitat bagi remaja sekarang ini dan ini menjadi masalah serius bagi orangtua mereka. Dalam cerita pedih kehidupan Clare dan Rachel selama hidupnya, mereka mengatakan dalam beberapa tahun terakhir tidak pernah jatuh cinta, tidak pernah punya pekerjaan dan mereka percaya hanya soal menunggu waktu sebelum mereka meninggal bersama-sama. Kematian mereka dalam kebakaran tersebut diyakini tidak disengaja, menurut Detektif dari Unit Investigasi Kejahatan Geelong. Dalam wawancaranya dengan salah satu stasiun televisi Australia yang berjudul Australia’s 60 Minutes belum lama ini, mereka mengungkap awal mereka mengidap anoreksia. “Di masa pertumbuhan kami mulai merasakan cerminan wanita cantik itu langsing dan kurus, sehingga, entah bagaimana, kami mulai tidak makan apapun, mungkin hanya melon saja,” ungkap Claire. “Dan kami hanya meminum Diet Coke dan kopi,” imbuh Rachel yang juga mengaku meminum 20 obat pencahar setiap harinya. Rachel bahkan mengungkapkan, satu-satunya orang yang berada di sisinya selama ini hanyalah saudara kembarnya. “Setidaknya kami akan meninggal bersama. Berada di sebelah Rachel membuat semuanya mudah untuk meninggal,” jelas Claire.(oz/nik)

„ Illustrasi

Adik George W Bush Komunis? WASHINGTON-Adik dari mantan Presiden Amerika Serikat (AS) George W. Bush, Neil Bush, merilis foto kontroversial dengan menggunakan topi Mao Tse Tung. Foto itu juga bertulisan, “Saya berniat untuk bergabung dalam Partai Komunis China,” katanya. Foto Neil Bush muncul di jejaring sosial Weibo milik China. Beberapa pihak mengecam sikap Neil, namun beberapa orang lainnya justru menganggap hal itu sebagai lelucon. Mereka mengatakan bahwa, Neil terlalu pandai untuk menjadi pejabat Partai Komunis China. Beberapa pengguna jejaring sosial Weibo sering melontarkan kritiknya terhadap Partai Komunis China. Tak jarang mereka menyebut partai itu sebagai partai korup yang didominasi politisi pedofilia. ”Bila kau bisa bergabung dengan Partai Komunis China, kau bisa menggelapkan dana, menerima suap, mencari pelacur dan juga memerkosa bocah tanpa dihukum,” demikian komentar salah seorang pengguna Weibo, Rabu (29/8). Keluarga Bush memiliki kemitraan yang cukup erat dengan China. Kemitraan itu sudah terjalin di saat George Bush senior menjabat sebagai Kepala Perwira Penghubung di Beijing pada dekade 1970an. Neil Bush sendiri sudah aktif menggunakan jejaring sosial Weibo sejak September 2011. Neil merupakan seseorang yang sangat menghormati China dan berhasil meraih followers sebanyak 45 ribu di Weibo, hanya dalam dua hari.(oz/ nik)

Pangeran Harry

Pengguna Facebook Dukung Pangeran Harry LONDON-Sekalipun keluarga Kerajaan Inggris mungkin marah atas ulah penampilan bugil Pangeran Harry di sebuah kamar suite hotel di Las Vegas, Amerika Serikat, tetapi banyak warga Inggris mendukung aksi Pangeran Harry melalui dunia maya. Sebuah grup Facebook berjudul “Dukung Pangeran Harry dengan Ulah Bugil” menggambarkan betapa banyak warga Inggris mendukung ulah dari pewaris urutan ketiga dari takhta Kerajaan Inggris ini. Diyakini banyak warga Inggris tidak mengungkapkan dukungan mereka pada Pangeran Harry. Mengutip grup Facebook ini sebagaimana disiarkan, Selasa (28/ 8) memperlihatkan, ulah Pangeran Harry ini mendapat dukungan 13.000 anggota dan angka ini terus bertambah. Grup Facebook ini muncul setelah Pangeran Harry (27) muncul dalam aksi bugil dengan seorang perempuan misterius dalam sebuah

permainan biliar di sebuah hotel di Las Vegas. Gambar bugil Pangeran Harry ini pertama kali diterbitkan situs selebriti dan gosip TMZ di AS, Rabu pekan lalu. Aksi ini meluas di seluruh dunia dan menimbulkan pro dan kontra di Inggris. Dukungan kepada Pangeran Harry ini antara lain tampil dengan bendera Union Jack atau boneka Teddy Bears. Gambar bugil Pangeran Harry yang dimuat tabloid The Sun pada Jumat pekan lalu membuat tentara Inggris yang bertugas di Afganistan juga mengirim dukungannya kepada Pangeran Harry. Pangeran Harry, yang juga seorang perwira militer Inggris, pernah bertugas di Afganistan selama sepuluh pekan dan kini berlatih sebagai pliot helikopter tempur Apache. Pangeran Harry terpaksa ditarik dari Afganistan pada Februari 2008 setelah media mengungkapkan keberadaannya di sana. (kps/nik)


Cara Mendeteksi Penyakit dari Tubuh Wanita Salah satu dari banyak hal indah tentang tubuh Anda adalah, tubuh memiliki sensor penyakit yang sudah tertanam. Para ahli mengatakan, Anda bisa melihat tanda-tanda peringatan dini bahkan kondisi serius hanya dengan memperhatikan secara seksama tubuh Anda di depan cermin. Jadi silakan, lihatlah lebih dekat. KUKU Jika Anda melihat garis-garis gelap di bawah kuku Tahi lalat berukuran besar bukan satusatunya pertanda kanker kulit — penyakit ini juga dapat berkembang di bawah kuku. Garis-garis berwarna kekuningan, coklat, atau hitam adalah tanda dari kerusakan sel, mungkin akibat melanoma (bentuk kanker kulit paling mematikan), ujar Ariel Ostad, M.D., dermatolog di New York City. Dengan deteksi dini dan pengobatan, sekitar 95 persen kasus dapat disembuhkan, sehingga segera temui dokter kulit jika menemukan gejala tersebut. Jika Anda melihat garisgaris putih terang Semua orang sering mengalami bintik-bintik putih pada kuku mereka (biasanya itu tanda bahwa jari Anda terjepit di laci), tetapi jika Anda melihat perubahan warna dengan garis panjang horizontal pada permukaan kuku dan Anda merasa lelah akhir-akhir ini, itu bisa menjadi berita buruk tentang ginjal. "Garis-garis tersebut mungkin adalah tanda bahwa ginjal tidak dapat menyaring protein agar tidak keluar dari air seni Anda," kata Ostad. Itu berarti tubuh Anda kehilangan protein lebih cepat daripada yang Anda konusmsi — dan hal tersebut dapat menyebabkan gagal ginjal. Kunjungi dokter Anda secepatnya untuk tes urin. KETIAK Jika Anda melihat sebuah bagian kulit kasar dan gelap Apakah Anda baru pergi ke laut untuk berjemur? Jika tidak, gejala seperti ini berarti Anda kemungkinan mengalami diabetes, ujar Michael Smith, M.D., pemimpin redaksi medis WebMD. Kelebihan insulin dalam aliran darah dapat menyebabkan sel kulit untuk bertambah dengan cepat secara abnormal, menyebabkan penumpukan jaringan dan melanin.

Hal ini membuat kulit terlihat lebih gelap dan terasa lebih tebal. "Ini paling sering terjadi di ketiak, leher, atau selangkangan," kata Smith. Sebuah tes darah sederhana dapat menentukan apakah Anda menderita penyakit tersebut atau tidak, yang terjadi pada sekitar 24 juta orang Amerika — hampir seperempat dari mereka tidak terdiagnosis. KELOPAK MATA, SIKU, LUTUT Jika Anda melihat benjolan kecil, lembut yang terlihat putih atau mengilap Berita baiknya: Ini bukan jerawat. Berita buruknya: Ini adalah simpanan kecil dari kolesterol, ujar Smith. Sayangnya, "pada saat mereka muncul, kadar kolesterol Anda sudah sangat tinggi, ini merupakan faktor risiko serius untuk penyakit jantung." Namun mengurangi kadar kolesterol Anda sebesar 10 persen dapat mengurangi risiko tersebut sepertiga lebih sedikit. Temui dokter Anda untuk cek kolesterol, dan tanyakan padanya tentang perubahan gaya hidup atau resep obat-obatan yang bisa menurunkan kadar kolesterol Anda. KULIT KEPALA Jika Anda melihat penipisan rambut Rambut rontok berlebihan adalah indikator umum dari gangguan tiroid, yang terjadi pada sekitar 10 persen wanita Amerika. Ketika tiroid Anda (sebuah kelenjar di tengah leher Anda) rusak, hal tersebut dapat mengganggu keseimbangan hormon seks laki-laki dan perempuan. Akibatnya: lebih banyak helai rambut Anda yang terasa kasar dan rapuh, kata Sandra Fryhofer, M.D., seorang dokter di Atlanta. Dokter Anda dapat mengukur jumlah hormon tiroid dalam darah Anda — jika kadarnya terlalu banyak atau terlalu sedikit, Anda akan memerlukan obat-obatan untuk mengaturnya. Jika Anda melihat kulit kepala Anda rontok

seperti kulit ular Jika serpihan kulit kepala Anda tiba-tiba membuat bahu Anda terlihat seperti pegunungan Alpen saat musim salju, Anda perlu waspada. "Kadar stres yang berat menyebabkan tubuh Anda menghasilkan hormon kortisol dalam jumlah berlebihan," kata Ostad. "Selain mendatangkan malapetaka pada sistem kekebalan tubuh (membuat Anda lebih rentan terhadap flu) dan metabolisme Anda (membuat Anda menjadi lebih gemuk), kortisol juga dapat membuat kulit kepala Anda kering." Sebuah produk shampo ketombe dapat mengurangi kerontokan kulit kepala, tetapi jika Anda benar-benar ingin bahu yang terbebas dari salju, cobalah untuk tidur lebih banyak, bernapas lebih dalam, dan melonggarkan jadwal Anda yang sibuk. PERUT Jika Anda melihat rambut tebal, hitam berujung lancip Hutan yang tumbuh pada perut Anda cukup tebal untuk menyembunyikan keluarga hobbit? Rambut lebat, kasar yang memanjang ke arah pusar (bukan tumbuh ke bawah dari bagian atas tulang kemaluan) bisa menjadi tanda sindrom ovarium polikistik (PCOS), kata Pamela Berens, M.D., seorang ahli obstetri dan ginekologi di Universitas Texas Medical School. Disebabkan oleh kelebihan produksi androgen, kondisi tersebut dapat menyebabkan menstruasi yang tidak teratur atau berat, kenaikan berat badan, jerawat, dan rambut tebal, hitam di perut, wajah, dada, dan punggung. Satu dari 10 perempuan menderita PCOS, yang dapat menjadi faktor risiko serius seperti kemandulan dan penyakit jantung. Jika Anda mengalami gejala tersebut, temui ahli obstetri dan ginekologi, dia mungkin akan meresepkan pil KB untuk mengembalikan hormon Anda. LIDAH Jika Anda melihat lapisan, putih kuning, atau oranye Jika lidah Anda terlihat seolah-olah dicat dengan warna cerah, Anda mungkin

menumpahkan isi perut Anda saat tidur, ujar Fryhofer. Normalnya, katup satu arah di bagian bawah kerongkongan memastikan bahwa apapun yang turun tidak akan kembali naik. Refluks asam terjadi ketika katup ini membuka secara spontan dan isi perut Anda keluar dari tenggorokan Anda, membuat lidah Anda terlapisi asam pencernaan dan Anda akan memiliki napas yang tidak sedap. Kebanyakan refluks dapat diobati dengan antasid OTC atau hanya dengan menghindari makanan asam dan pedas, jika langkahlangkah tersebut tidak berhasil, temui dokter. Anda mungkin memerlukan obat-obatan resep untuk mengurangi produksi asam lambung tubuh Anda. MATA Jika Anda melihat lingkaran di bawah mata yang tidak pernah hilang Kecuali jika memiliki pekerjaan sampingan sebagai penyiar radio tengah malam, lingkaran hitam yang tiba-tiba muncul mungkin berhubungan dengan alergi. Reaksi berantai, menurut Ostad, berjalan seperti ini: Sebuah alergen menyerang tubuh Anda, yang memicu respon keluarnya histamin, zat kimia ini membuat pembuluh darah membengkak dengan darah dan cairan lainnya, dan akibatnya: daerah gelap muncul pada kulit yang tertipis. Tes kulit dapat menentukan alergen apa yang menyebabkan gejala tersebut. Jika Anda melihat bercak kekuningan di bola mata Anda Tidak, Anda tidak menderita kasus jerawat optik langka. Sebaliknya, bercak yang sedikit terangkat pada bagian putih mata Anda adalah gejala dari kondisi yang tidak berbahaya yang disebut pinguecula. "Ini tidak lebih dari pertumbuhan berlebih dari kolagen yang dipicu oleh kerusakan akibat matahari, angin, atau debu," kata Traci Goldstein, seorang dokter mata di Metropolitan Vision Correction Associates di New York City. Jaga mata Anda agar tetap lembap dengan tetes mata dan selalu pakai pelindung saat berada di luar ruangan (pastikan kacamata Anda menawarkan perlindungan 100 persen terhadap sinar UVA dan UVB) untuk mencegah bercak tumbuh lebih besar.(int)

10 Hal yang

Membuat Mete

Bahaya Kesehatan Mengancam Saat

Musim Manas HUJAN tak kujung-kunjung turun. Cuaca pun menjadi sangat panas. Bukan hanya membuat Anda cepat berkeringat, tapi juga lebih berisiko mengalami gangguan kesehatan tertentu. Cuaca memang sangat mempengaruhi kondisi kesehatan tubuh. Untuk itu, Anda wajib tahu masalah kesehatan yang sering terjadi saat musim panas. Dehidrasi Ada beberapa gejala yang ditimbulkan saat mengalami dehidrasi seperti, terjadi penurunan buang air kecil, mulut kering, dan pusing saat berdiri. Jika Anda mengalami gejala ini, segera perbanyak minum air putih dan makan buah-buahan segar. "Ketika Anda kehilangan cairan, maka volume darah Anda juga mengalami penurunan, dan memengaruhi setiap organ dalam tubuh," kata juru bicara American College of Emergency Physicians, Leigh Vinocur, MD, dikutip dari Mayo Clinic. Gangguan mata Saat musim panas datang, hal yang harus Anda perhatikan adalah sengatan sinar matahari. Pukul 10 pagi dan empat sore adalah sengatan terburuk dari sinar matahari. Kenakan kacamata hitam yang berkualitas jika memang harus ke luar rumah demi melindungi kornea mata. Pastikan kacamata yang Anda gunakan memiliki perlindungan UV-A dan UVB. Belum lagi jika terjadi iritasi pada mata karena angin dan cuaca yang panas. Mengenakan kacamata hitam memang cara paling mudah untuk melindungi mata Anda saat cuaca panas. Heatstroke Kondisi ini dapat berpotensi fatal, apalagi ketika Anda tak mampu menahan cuaca panas. Gejalanya adalah kulit kemerahan, kebingungan, sakit kepala, dan sulit bernafas. Bisa terjadi jika Anda terlalu lama berada dibawah sinar matahari. Untuk menghindarinya, carilah tempat isirahat yang teduh, jauh dari sinar matahari. Kemudian minum air yang mengandung elektrolit untuk mencegah dehidrasi. Sebaiknya hindari minuman yang mengandung kafein dan alkohol. Mengenakan pakaian longgar juga dapat membantu Anda merasa lebih nyaman. (int)

Salah makan Makanan yang tidak tepat akan berpengaruh tidak hanya pada kondisi fisik (seperti mual dan sakit perut) tapi juga kondisi hati. Anda jadi mudah marah, kurang fokus, lebih agresif, gugup atau hiperaktif. Jika Anda merasa tersiksa dengan perubahan mood Anda secara terus-menerus, cobalah menjaga asupan makan Anda dengan mencatat apa yang Anda makan serta dampaknya terhadap suasana hati. Dekorasi rumah Anda Jika Anda ingin memperbaiki mood, cobalah mengubah dekorasi rumah Anda, karena lingkungan sangat berpengaruh terhadap suasana hati. Warna merah dapat membuat beberapa orang menjadi mudah marah atau bermusuhan, sedangkan kuning dapat membuat Anda merasa bahagia dan biru dapat membantu Anda menjadi lebih rileks. Penelitian juga menemukan bahwa dengan menggantung gambar-gambar yang menenangkan seperti lukisan yang indah, mood

seseorang dapat berubah secara positif dan berkurang tingkat stres dan kegelisahan. Dipromosikan Saat kita banyak bermimpi mendapatkan promosi dalam pekerjaan, kenyataannya tidak sebaik yang Anda pikirkan. Sebuah penelitian yang dilakukan oleh beberapa peneliti dari University of Warwick menemukan, karyawan yang dipromosikan dalam pekerjaannya mengalami ketegangan mental alih-alih kualitas hidup yang membaik. Dan rata-rata ada penurunan 10 persen terhadap kesehatan mental. Lampu di samping tempat tidur Jika Anda sering membaca sambil

tidur-tiduran atau menonton TV, maka suasana hati akan ikut terdampak. Penelitian mengungkapkan, cahaya pada malam hari dapat menekan produksi hormon melatonin — yang secara rutin diproduksi pada saat suasana gelap. Jadi cobalah untuk membeli tirai dan pastikan Anda mematikan semua lampu pada malam hari untuk memberikan diri Anda dorongan kebahagiaan. Kekurangan nutrisi Depresi dapat disebabkan oleh beberapa hal, dan gejalanya dapat menjadi semakin buruk ataupun membaik berdasarkan asupan makan Anda. Kekurangan vitamin D, B (terutama B6, B12 dan folat) serta lemak Omega-3, dapat menyebabkan depresi dan kegelisahan. Cobalah untuk menambahkan makanan yang kaya akan nutrisi tersebut dalam asupan makan Anda. Teman-teman Anda Anda mungkin akan berpikir bahwa menghabiskan waktu bersama teman-teman Anda merupakan hal yang baik untuk meningkatkan mood. Namun tahukah Anda

Memi Mertahannya Mubungan Msmara ADA beberapa strastrategi relationship baru yang perlu Anda ketahui. Jika Anda (sebagai pria) sudah jenuh dengan hubungan yang terus-terusan on and off, sebaiknya Anda mencari tahu apa yang menjadi penyebabnya. Kejujuran Kejujuran sebuah kata yang sering didengar, namun terkadang pria sulit melakukannya. Padahal, percaya atau tidak, hal inilah yang menjadi dasar sebuah hubungan untuk berkembang. Contohnya, Anda tidak memberitahu kekasih bahwa Anda gemar berpesta sampai pagi hari, dan Anda berharap hal ini tetap tersembunyi dari si dia. Percayalah, ketika ia tahu, ia akan lebih marah ketimbang Anda sudah memberitahukannya di awal hubungan. Memang, Cosmo pun mengakui terkadang white lies tidak dapat dihindari dari sebuah hubungan, tapi selalu pegang garis besarnya: jangan pernah berbohong untuk hal penting seperti masa lalu, kebiasaan, pekerjaan, sampai keadaan ekonomi Anda. Jujurlah demi masa depan yang lebih baik. The Real Manliness Guys, keinginan Anda untuk selalu tampil "jantan" seringkali malah jadi hambatan terbesar lho. Why? Karena Anda tidak pernah mencoba untuk memahami kondisi emosional pribadi, apalagi pasangan! Pria kerap tidak mau atau malah menghindar terlibat secara emosional karena takut "kejantanannya" dipertanyakan. Sebenarnya ini adalah masalah ego saja. Cosmo beritahu Anda, memberikan diri sepenuhnya secara emosional kepada wanita yang dicintai tidak akan mengurangi sedikitpun kejantanan Anda. Sebagai latihan, terbukalah tentang hal-hal yang membuat Anda sedih atau membuat Anda merasa terluka.(int)

bahwa semua itu bergantung pada mood mereka? Penelitian menemukan, emosi positif dan negatif dapat menular dengan mudah tanpa disadari. Sebuah status Facebook bahkan dapat memengaruhi orang lain selama tiga hari. Waktu tidur Kita sadar bahwa kurang tidur dapat membuat mood kita memburuk, namun penelitian mengungkapkan bahwa waktu Anda tidur hampir sama pentingnya dengan seberapa banyak tidur yang Anda dapatkan. Berdasarkan sebuah studi yang dipublikasikan dalam “Psychiatry and Clinical Neurosciences”, burung hantu hampir tiga kali berpeluang mengalami gejala depresi daripada burung lain yang beraktivitas pada siang hari, jadi, cobalah untuk tidur lebih awal untuk meningkatkan mood. Obat Sebuah studi yang dilakukan oleh peneliti Monash University menemukan bahwa para wanita yang mengonsumsi pil KB berpotensi hingga dua kali mengalami depresi dari mereka yang tidak. Untuk beberapa wanita, pil KB tertentu dapat juga mengakibatkan perubahan mood, mudah marah dan kehilangan libido. Merokok Kita semua tahu kalau merokok dapat menimbulkan kanker, penyakit jantung dan penuaan dini, namun ternyata merokok juga dapat mempengaruhi kesehatan mental Anda. Menurut hasil sebuah studi yang dilakukan para peneliti dari Selandia Baru, orang yang merokok dapat meningkatkan risiko mereka terhadap depresi, dan bagi mereka yang kecanduan nikotin, dapat meningkatkan risiko hingga dua kali lipat mengalami gejala depresi dibandingkan mereka yang tidak kecanduan. Cahaya matahari Sebagian besar dari kita mungkin pernah mendengar tentang gangguan emosi yang disebabkan oleh musim dingin yang gelap, namun tahukah Anda bahwa cahaya matahari juga dapat membawa kesedihan? Saat musim panas, kurang dari satu persen populasi penduduk mengalami gangguan emosi (dibandingkan 5 persen saat musim dingin). Gangguan tersebut juga bisa mengakibatkan kondisi yang serius terhadap mereka yang mengalaminya, seperti insomnia, penurunan nafsu makan dan depresi.(int)



30 Agustus 2012

Evander Holyfield

Pamer Kaos Bergambar

TATO TYSON EVANDERHolyfield dan Mike Tyson boleh jadi pernah terlibat pertarungan paling kontroversial dalam sejarah tinju profesional. Namun setelah gantung sarung tinju, keduanya justru saling membantu dalam mempromosikan produk yang mereka pasarkan. Tyson membuat geger dunia tinju profesional pada saat menjalanitarungulangmelawan Holyfield, 28 Juni 1997. Setelah kalah TKO di pertarungan sebelumnya, Tyson justru berbuat konyol di partai rematch. Saat memasuki ronde ketiga, Si Leher Beton tanpa terduga menggigit telinga Holyfield. Wasit langsung menghentikan laga. Tyson kemudian didiskualifikasi. Malam harinya, kerusuhan juga pecah di areal kasino yang ada di MGM Arena —lokasi pertarungan keduanya. Tyson beralasan bahwa tindakannyamerupakanbalasan atas tandukan yang dilakukan Holyfield selama pertarungan. Akibat aksi ini, Tyson dihukum denda sebesar US$ 3 juta. Selain itu, Komisi Tinju Nevada mencabut lisensi pertandingannya.

Namun dua hari setelah pertandingan, Tyson meminta maaf dan memohon lisensinya tidak dicabut. Permintaan ini akhirnya dikabulkan pada 9 Juli 1997. Pada acara The Oprah Show pada 2009 lalu, Tyson kembali meminta maaf kepada Holyfield. Setelah itu ketegangan di antara keduanya terus mencair. Bahkan belakangan, Tyson dan Holyfield menjadikan momen kontroversial tersebut sebagai bahan untuk bercanda di dunia maya. Belum lama ini, Holyfield mengunggah foto dirinya mengenakan T-Shirt bergambar tato milik Tyson pada akun twitter miliknya. Di bawahnya, Holyfiedl menuliskan “Mike Tyson mengigit telinga saya dan semua yang saya dapat hanyalah t-shirt yang buruk ini.” T-Shirt tersebut merupakan bagian Mike Tyson Collection yang saat ini sedang dipasarkan oleh Tyson. Sebelumnya Tyson juga membantu Holyfield memasarkan saus Real Deal Barbecue yang diproduksi mantan juara dunia tinju kelas berat itu. (int)

Dua anak Indonesia dikirim ke Jerman untuk latihan di camp Bayern Munich, Jerman.

2 Anak Indonesia Terbang ke Jerman Menggocek si kulit bundar di daratan Eropa menjadi mimpi bagi banyak orang yang bergelut dengan sepakbola. Nah, tahun ini dua anak Indonesia berkesempatan untuk bisa berlatih dan bermain sepakbola di Eropa. Tak tanggung-tanggung, di markas Bayern Munich. Kedua anak Indonesia itu adalah Moch Aula Rizky dan Ary Rezqy Hakim. Mereka terpilih dalam seleksi ketat untuk mengikuti Allianz Junior Football Camp (AJFC) di Munich, Jerman. Aula merupakan siswa kelas VIII SMP Regina Caeli, Cileungsi. Dia merupakan putraMZaenalArifindanJunaiyahyanglahir

Holyfield dan Tyson

diSidoarjopada16Mei1998.BagiAula,inilah pertama kalinya dia keluar negeri. Sedangkan Ary sudah beberapa kali keluar negeri untuk urusan sepakbola. Dia adalah siswa SMP Jl Ujung Menteng, Cakung, Jakarta Timur, kelas VIII. Ary adalah putra dari Fauzan Hakim dan Farihatun Munir. Menurut Head of Corporate Communication Central Function PT Asuransi Allianz Life Indonesia, Adrian Dosiwoda, kegiatan ini sudah berlangsung untuk keempat kalinya. Pertama kali kegiatan ini diselenggarakan pada 2009 lalu. “AJFC dimulai pada 2009 dan merupakan kegiatan global di Allianz Football for Life Program,” ujar Adrian dalam pesan tertulisnya, Rabu (29/8). Di AJFC, anak-anak dari berbagai negara

berkumpul di tempat latihan Die Roten. Di sini mereka akan mendapat pelatihan khusus dan berkesempatan bertemu dengan pemain dari klub raksasa Jerman itu. Asyik! Sebanyak 65 Anak dari 22 negara ambil bagian dalam kegiatan ini. Selain Indonesia, mereka antara lain berasal dari Australia, Brasil, China, India, dan beberapa negara Eropa. “AJFC merupakan cara yang ampuh untuk menggabungkan anak-anak yang memiliki minat sama dan sekaligus pertukaran budaya,” imbuh Adrian. Diharapkan pengalaman yang didapat anak-anak itu di AJFC akan menginspirasi merekauntukmenjadipendukung,pemain, pelatih, administrator atau perwakilan komunitas dan lainnya. Nah, bagaimana anak-anak ini bisa

berpartisipasi? Mereka diseleksi setelah mengisi dan mengirim form di situs Football for Life. Form tersebut berisi informasi personal. Para pendaftar juga diminta untuk mendeskripsikan‘thebestfootballmomentnya’.Juridisetiapnegaralantasakanmemilih peserta yang berhak ikut dalam AJFC. Markas Bayern dipilih sebagai tempat diselenggarakannya AJFC dengan pertimbangan Die Roten merupakan salah satu tim paling terkenal di persepakbolaan Eropa. Tim berusia 112 tahun ini menjadi juara di Bundesliga sebanyak 22 kali, 15 kali memenangi DFB Pokal, dan yang tak kalah bergengsi telah menggondol 4 gelar Liga Champions. Catatan lainya, pelatihan tim junior klub asal Bavaria tersebut dikenal sebagai salah satu yang terbaik di Eropa. (int)

Kimi Raikkonen

Tak Pernah Ragukan Lotus KIMI Raikkonen tidak pernah meragukan kapasitas Lotus. Bahkan, Kimi sangat yakin Lotus akan berusaha untuk bersaing mendapatkan gelar juara. Penampilan Lotus belakangan memang cukup konsisten di Formula One (F1) 2012/2013. Bahkan, tim yang bermarkas di Enstone itu berhasil membawa Kimi menempati peringkat kelima klasemen sementara F1. Kimi sangat puas dengan performa Lotus. Mantan juara F1 itu sangat yakin Lotus memiliki kemampuan untuk bersaing dengan tim yang lebih besar seperti, McLaren dan juga Ferrari. Ini yang menjadi alasan utama Kimi menerima pinangan Lotus. “Sudah sangat lama ketika saya

memperkuat tim papan atas dan kami juga pernah mengalami tahun yang buruk.

Setahun kemudian, kami berhasil tampil dengan hasil yang berbeda,” jelas Kimi, dikutip dari Autosport, Rabu (29/8).

“Lotus masih menjadi salah satu tim yang besar. Dasar mereka masih sama, mereka memiliki kemampuan untuk membuat mobil dengan kemampuan dan kecepatan terbaik,” lanjut pembalap asal Finlandia itu. Kimi merupakan salah satu pembalap berpengalaman di F1. Pembalap 32 tahun itu pernah memperkuat McLaren dan Ferrari. Tak heran, The Ice Man (julukan Kimi) sangat yakin Lotus bisa menyamai prestasi tim-tim besar tersebut di F1 suatu saat nanti. “Mungkin levelnya masih belum sama dengan McLaren, Ferrari atau Mercedes. Namun, Lotus memiliki pengetahuan dan mereka untuk memiliki keinginan untuk membuat mobil yang bagus,” pungkas The Ice Man. (int)

Duo Williams Lolos

DUA petenis wanita, Venus dan SerenaWilliamsloloskebabakkedua US Open 2012. Sedangkan Caroline Wozniackilangsungkandasdibabak pertama. Dalam pertandingan yang berlangsung di Flushing Meadows, Rabu (29/8), Serena Williams mendapatkan tiket ke babak kedua setelah meraih kemenangan mudah 6-1 6-1 atas lawannya, Coco Vandeweghe.

Di pertandingan itu, Serena yang menempati unggulan keempat sangatmendominasisekalidantidak memberikan kesempatan kepada lawannya untuk berkembang. Selanjutnya, Serena akan berhadapan dengan Maria Jose Martinez Sanchez. Sang kakak Venus Williams juga tidak mau kalah. Petenis yang sempat lama tidak bermain ini,

berhasil mendapatkan tiket ke babak kedua, usai menumbangkan Bethanie MattekSands 6-3 6-1. Namun lawan tangguh sudah menanti Venus. Dia akan berhadapan dengan Angelique Kerber. Kerber yang menempati unggulan keenam itu, tampil sangat gemilang untuk menyudahi perlawanan Anne Keothavong dua set langsung, 6-2 dan 6-0. Petenis unggulan kedua Agnieszka Radwanska, juga melangkah ke babak keduaUSOpen2012. Petenis asal Polandia itu,mampumengatasi rasa sakit pada bahunya untuk menyingkirkan Nina Bratchikova 6-1 6-1. (int)

Lewis Hamilton dan Nicole

Kencan Singkat LEWIS Hamilton memanfaatkan sisa masa rehat Grand Prix Formula 1 musim 2012 untuk melepas kangen dengan kekasih tercintanya, Nicole Scherzinger. Sayangnya, pertemuan dua sejoli ini berlangsung sangat singkat. Nicole bertolak dari Los Angeles, Amerika Serikat, Sabtu 25Agustus2012.SebelummenujuDubai,mantanpersonel Pussycat Dolls itu transit di Kota London, Inggris, untuk menemui Hamilton. Pertemuan Hamilton dan Nicole keesokan harinya, Minggu, begitu singkat karena hanya dalam hitungan jam. Bahkan, Nicole sengaja mengganti jadwal penerbangannya demi menghabiskan malam bersama juara dunia F1 2008 tersebut. Lalu, pada Senin 27 Agustus 2012, Nicole sudah tiba di Dubai untuk melakoni syuting bersama ITV1. Begitu

mendarat di kota bisnis Uni Emirat Arab tersebut, wanita 34 tahun itu tak sabar ingin mendengar suara Hamilton via telepon.Perbincanganmerekaberlangsungselama1,5jam. “Nicole akan menghabiskan banyak waktu di Dubai. Sebelumsyuting,diamintaizinuntukmenghabiskanwaktu bersama Lewis,” ujar salah seorang sumber seperti dilansir The Sun. “Meskipun mereka hanya bertemu beberapa jam, Nicole sangat bahagia. Mereka benar-benar dimabuk cinta,” tambah sang sumber seraya menampik kabar keretakan pasangan yang sudah bertunangan tersebut. Setelah GP Hungaria pada akhir Juli lalu, Hamilton memiliki waktu rehat cukup lama. Pembalap yang sementara ini menempati peringkat 4 klasemen tersebut akankembalikelintasanuntukmelakoniserike-12diSirkuit Spa-Francorchamps, Belgia, akhir pekan ini. (int)

Yao Ming

Inginkan Sekolah Utamakan Olahraga Ikon bola basket China, Yao Ming meminta sekolahsekolah di negaranya memberi perhatian lebih terhadap perkembangan olah raga dalam pendidikan mereka. Menurut mantan pemain klub NBA, Houston Rockets ketidakpedulian sekolah terhadap perkembangan olah raga menjadi salah satu andil yang memungkinkan stagnasi perkembangan olah raga China. “Pengajaran olah raga di sekolah negara kita sangat terbelakang,” kata Yao yang telah pensiun sebagai pemain ini. “Kita harus memulainya dan menempatkan pendidikan olah raga lebih dari sekadar membuat pelajar bugar.” Yao Ming mendirikan yayasan yang bergerak di bidang pengembangan bola basket di kalangan pelajar sekolah dasar China. Untuk itu, Yao Ming kerap datang ke sekolahsekolah untuk mencarai bibit berbakat. “Perkembangan aktivitas olah raga di sekolah-sekolah China sangat kecil,” katanya. “Olah raga masih ditempatkan sebagai bidang yang berada di bawah bidang pengajaran yang lain.” Yayasan bentukan Yao Ming berusaha mengembangkan bola basket dengan meningkatkan pembangunan sarana olah raga mau pun pelatihan para guru olah raga di sekolah-sekolah. Para pelajar sekolah di China menghadapi hal serupa dengan Indonesia dengan adanya tes ujian masuk sekolah lanjutan mau pun perguruan tinggi yang berat dan menjadi satu-satunya impian. Yao Ming menginginkan pendidikan China mengambil contoh pendidikan di Amerika. “Saat mengenang sekolah dasar, pertama-tama saya terkenang taman bermain,” katanya. Ia mendirikan yayasannya setelah bencana gempa di Sichuan pada 2008 lalu. Ia telah mendirikan 14 sekolah di sekitar lokasi bencana dan menyumbangkan peralatan olah raga seperti bola, raket dan basket bersama buku-buku pelajaran. (int)


KAMIS 30 Agustus 2012

ENGLISH PREMIER LEAGUE No 1 2 3 4 5 6 7 8 9 10

Team Chelsea Swansea City Everton West Brom Man City Fulham Man United Wigan Athletic New United West Ham U

M 3 2 2 2 2 2 2 2 2 2

M 3 2 2 1 1 1 1 1 1 1

S 0 0 0 1 1 0 0 0 0 0

K 0 0 0 0 0 1 1 1 1 1

SG 8-2 8-0 4-1 4-1 5-4 7-3 3-3 2-2 2-3 1-3


Nilai 9 6 6 4 4 3 3 3 3 3

Dila Gori Dnipro APOEL Nicosia CSKA Moscow H Tel Aviv Heerenveen Helsinki PSV Rosenborg BK Sparta Praha Steaua Bucharest Young Boys Metallist K Racing Genk Viktoria Plzen Bordeaux Club Brugge Marseille Videoton Hannover Inter Milan Levante Partizan Belgrade Rapid Wien AZ Alkmaar Lazio Newcastle Twente Liverpool Sporting

TOP SCORER Gol 3 2 2

Nama Michu D Duff N Dyer

Klub Swansea City Fulham Swansea City

SPANISH LA LIGA No 1 2 3 4 5 6 7 8 9 10

Team Barcelona R Valladolid R Vallecano Mallorca Málaga Atl Madrid Deportivo Sevilla Real Betis Getafe

M 2 2 2 2 2 2 2 2 2 2

M 2 2 2 1 1 1 1 1 1 1

S 0 0 0 1 1 1 1 1 0 0

K 0 0 0 0 0 0 0 0 1 1

SG 7-2 3-0 3-1 3-2 2-1 5-1 5-3 3-2 6-5 3-3

Nilai 6 6 6 4 4 4 4 4 3 3

vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs vs

Maritimo Slovan Libere Neftchi Baku AIK F91 Dudelange Molde Ath Bilbao Zeta Golubovc Legia Warszaw Feyenoord E Panevezys Midtjylland Dinamo Bucuresti Luzern Lokeren Crvena Zvezda Debreceni VSC Sheriff Tiraspol Trabzonspor Slask Wroclaw Vaslui Motherwell Tromso PAOK Anzhi Makhachkal Mura Atromitos Bursaspor Hearts AC Horsens

1/2 : 0 0 : 1 1/4 0 : 1 1/4 0 : 1 1/2 0 : 1 3/4 0 : 1/2 3/4 : 0 0 : 2 1/2 0 : 1/2 0 : 1/4 0 : 2 1/4 0:1 0 : 1 1/4 0 : 3/4 0 : 3/4 0 : 1 1/4 0 : 1 1/4 0 : 1 3/4 0:0 0:2 0 : 1 3/4 0:2 0 : 1/2 0 : 1/4 0 : 1/4 0 : 2 1/4 0 : 1 1/2 0:1 0 : 1 3/4 0 : 1 3/4

Kualifikasi Liga Champions

TOP SCORER Gol 4 3 3

Nama L Messi T Hemed R Falcao

Klub Barcelona Mallorca Atlético Madrid

Liga Champions musim 2012-2013 akan segera bergulir. Lima tim telah memastikan diri lolos ke fase grup, menyusul kemenangan yang mereka raih di babak playoff.


ITALIAN SERIE A 1 2 3 4 5 6 7 8 9 10

Internazionale Napoli Chievo Genoa Juventus Fiorentina Lazio Sampdoria Catania Roma

1 1 1 1 1 1 1 1 1 1

1 1 1 1 1 1 1 1 0 0

0 0 0 0 0 0 0 0 1 1

TOP SCORER Gol 2 1 1

Nama S Jovetic E Cavani A Costa

Klub Fiorentina Napoli Sampdoria

0 0 0 0 0 0 0 0 0 0

3-0 3-0 2-0 2-0 2-0 2-1 1-0 1-0 2-2 2-2

3 3 3 3 3 3 3 2 1 1

urnamen paling elite benua biru diketahui sudah memiliki 22 kontestan yang otomatis melaju ke babak penyisihan grup. Mereka adalah tim-tim yang mengakhiri musim di papan atas klasemen Liganya masingmasing (ada yang empat, tiga, dua atau hanya satu, tergantung jatah setiap asosiasi berdasarkan peringkat di UEFA). Sementara10timlainuntukmemenuhikuota 32 klub, diambil lewat babak playoff. Nah, saat ini ada 20 tim di babak playoff yang tengah berjuang untuk mendapatkan 10 tiket tersebut. Dini hari tadi, lima tiket telah resmi dipegang oleh BATE Borisov (Belarusia), Anderlecht (Belgia), Dinamo Zagreb (Kroasia), Sporting Braga (Portugal) dan Malaga (Spanyol). BATE, klub jawara Liga Belarusia ini memastikan diri lolos ke putaran final Liga Champions usai menumbangkan wakil Yunani Hapoel Ironi Kiryat Shmona FC. BATE menang dengan agregat 3-1, usai bermain 2-0 di kandang dan menahan imbang 1-1 juara Liga Yunani itu di kandangnya pada leg kedua, dini hari tadi. Bagi BATE, ini merupakan kali ke-3 mereka lolos ke Liga Champions sejak pertama kali pada 2008-2009. Ini jadi kesempatan kedua secara beruntun buat BATE, setelah musim lalu juga

mampu melaju ke fase grup (meski langsung tersingkir). Anderlecth juga memastikan bakal meramaikan persaingan fase grup Liga Champions musim ini usai menumbangkan kampiun Liga Siprus, AEL Limassol dengan agregat 3-2. Anderlecth yang kalah 1-2 pada leg pertama di markas AEL, sukses membalikkan keadaan dengan menang 2-0 pada leg kedua di markasnya, Constant Vanden Stock Stadium, dini hari tadi. Buat Anderlecht, keberhasilan ini menjadi prestasi tersendiri setelah sebelumnya dalam dua musim terakhir, jawara 31 kali Liga Belgia ini harus puas berlaga di Europa League. Dinamo Zagreb lolos ke babak utama Liga Champions usai menjinakan NK Maribor. Kampiun Liga Kroasia ini menang agregat 3-1 berkat kemenangan 2-1 (kandang) dan 1-0 pada leg kedua di markas jawara Liga Slovenia itu, dini hari tadi. Ini merupakan kali keempat atau yang kedua secara beruntun bagi Zagreb lolos ke babak penyisihan grup. Sporting Braga membuktikan kelasnya bahwa kompetisi Liga Portugal tidak bisa diremehkan oleh liga-liga elite Eropa seperti Spanyol, Inggris, Jerman dan Italia. Hal ini

dibuktikandengankeberhasilanmerekamelaju ke babak penyisihan grup Liga Champions dengan menyingkirkan salah satu unggulan di babak playoff, Udinese. Braga yang ditahan imbang 1-1 pada leg pertama, sempat dibuat cemas ketika Pablo ArmeromembawaUdineseunggul1-0padaleg kedua di Stadion Friulli, Italia. Namun, Ruben Micael menyelamatkan Braga berkat golnya di menit ke-72, untuk memaksakan skor akhir 1-1 (agregat2-2)sekaligusdigelarnyaperpanjangan waktudanklimaksnyamenanglewatdramaadu penalti (5-4). Dengan lolosnya Braga, maka Portugal memiliki tiga wakil pada gelaran Liga Champions musim ini. Dua tim yang sebelumnya memastikan lolos otomatis adalah FCPortoselakujawaradanBenfica(runner-up). Sementara bagi Udinese, kegagalan klub berjuluk ‘Il Zebrette’ ini memaksa Italia hanya menyelipkan dua wakilnya di putaran final. KeduatimtersebutadalahJuventusdanrunnerup Serie A, AC Milan.

Berbeda dengan Italia yang kian merosot, Spanyol justru terus menunjukkan hegemoninya sebagai salah satu liga terbaik dunia. Ini tak lepas dari keberhasilan Malaga menembusLigaChampionsuntukkalipertama dalam sejarah klub. Klub besutan Manuel Pellegrini ini memastikan tiket lolos, usai membungkam runner-up Liga Yunani, Panathinaikos dengan agregat 2-0. Keunggulan dua gol tanpa balas di markasnya, La Rosaleda Stadium, berhasil dipertahankan Malaga dengan menahan imbang Panathinaikos 0-0 di leg kedua, dini hari tadi. Dalamdebutnya,Malagaakanmendampingi tiga tim terbaik La Liga, yakni Real Madrid, Barcelona dan Valencia yang lolos otomatis. Sementara itu, lima tiket tersisa akan diperebutkan 10 tim. Ke-10 tim yang akan saling sikut adalah Spartak Moskow vs Fenerbahce, Basel vs CFR Cluj, Helsinborg vs Glasgow Celtic, Borussia Moenchengladbach vs Dinamo Kiev dan FC Kopenhagen kontra Lille. (oz/int)




