Page 1

Edisi 359 „ Tahun IX

KAMIS , 12 APRIL 2012

Istri Abdul Muis Protes Hanya Suaminya Terjerat (FOTO:CHANDRO PURBA)

„ Deliana Hanum Lubis.

SIMALUNGUN–Deliana Hanum Lubis (60), istri mantan Sekretaris Daerah Simalungun Abdul Muis Nasution (66), protes kenapa hanya suaminya yang dijadikan tersangka. Menurutnya, mantan Bupati Simalungun Jhon Hugo Silalahi dan mantan Ketua DPRD Simalungun Syahmidun Saragih, harus bertanggungjawab dan turut dijadikan tersangka.


DIBUANG: Di sinilah limbah PT Allegrindo dibuang, tepatnya di Nagori Togu Domu Nauli, salahsatu desa di perairan Danau Toba Kecamatan Dolok Pardamean, Rabu (11/4).

„) Baca Jhon Hugo ...Hal 2

PUNGLI DI TIMBANGAN SERBELAWAN DOLOK PARDAMEAN- PT Allegrindo dituding membuang limbah keruh dan kental ke Danau Toba. Saluran pembuangan limbah ini berada di Dusun Salbe, Nagori Togu Domu Nauli, Kecamatan Dolok Pardamean. Tindakan Allegrindo ini sudah berlangsung bertahun-tahun. A Turnip (37), warga Dusun Salbe, Nagori Togu Domu Nauli, saat ditemui Rabu (11/4) di sekitar saluran pembuangan limbah menyebutkan, selama sepuluh tahun atau sejak Allegrindo

„) Baca Allegrindo ...Hal 2

Karyawan Komplek Megaland Berhamburan SIANTAR– Gempa berkekuatan 8,5 SR yang mengguncang Aceh terasa di Kota Pematangsiantar. Para karyawan dan karyawati yang berkantor di komplek Megaland berhamburan keluar gedung. Tampak para karyawan berlarian keluar gedung. Walau tidak terlalu panik, namun hampir seluruh karyawan ke-

luar dari ruangan. Kehebohan juga tampak di kantor Badan Pertanahan Nasional di depan Megaland. Seluruh pegawai tampak keluar ruangan. Sejumlah karyawa mengatakan, getaran gempa sangat terasa di ruangan. Suara pintu terdengar

„) Baca Karyawan ...Hal 7

Miliaran Rupiah Uang Parkir Diduga Menguap

„) Baca Miliaran ...Hal 7

SERBELAWAN- Petugas Timbangan Serbelawan disinyalir melakukan pungutan liar (pungli) pada sejumlah supir yang melintas. Setiap supir dikutip sebesar Rp50 ribu setiap kali melintas. Petugas juga mempersulit mengelurkan surat berat muatan truk. Namun petugas Timbangan membantah informasi itu. Hermansyah Sinaga (41), salah seorang supir Truk colt Diesel pengangkut buah sawit dari kawasan Sawit Seberang, ketika ditemui METRO Rabu (11/4), mengaku kerap dipungli petugas Timbangan sebesar Rp50 ribu sebagai uang pelicin. ”Saya dan beberapa supir lain sering dimintai uang paling sedikit lima puluh ribu sebagai pelicin oleh petugas. Katanya supaya truk kita langsung keluar,” katanya. Supir lain, H Sinaga, bahkan mengeluhkan kurang-

„) Baca Rp50 Ribu ...Hal 2

Anda punya keluhan terhadap pelayanan publik di Siantar-Simalungun? kirim SMS ke nomor:

Target PAD Terlalu Rendah SIANTAR-Sekitar 6,5 miliar rupiah retribusi parkir di Pemko Siantar diduga menguap. Sebab, selama setahun potensi retribusi parkir di 300 titik diprediksi bisa menghasilkan Rp9 miliar. Sementara tahun 2012, target Pendapatan Asli Daerah (PAD) parkir hanya Rp2,5 miliar. Kepada METRO, Rabu (11/4), anggota DPRD

Rp50 Ribu Sekali Lintas

082164546471 Pungli di Pos Polisi Batu Gaja


BERHAMBURAN- Gempa berkekuatan 8,5 SR yang mengguncang Aceh terasa hingga Siantar Simalungun, Rabu (11/4). Di komplek Mega Land karyawan/i berhamburan keluar (kiri), begitu juga di Dermaga Ajibata.

Pak Kapolres Simalungun terhormat, tolong ditindak Polisi lalu lintas (Polantas) di Pos Batu Gaja yang setiap hari melakukan pungli di jalan lintas umum Parapat, mulai pukul 3:00 WIB sampai pukul 7:00 WIB. Masyarakat resah dengan tindakan tersebut. Pengirim: 085761302xxx



12 April 2012




Rp50 Ribu Sekali Lintas

TAPI MEMBANTAH ISTRI LAMTIAR BERSAMANYA SIANTAR- Jhonson Saragih mengakui bahwa Rajinni Sinaga itu adalah pacarnya. Selama kurang lebih 8 tahun ia menjalin hubungan pacaran, mulai tahun 2002 hingga 2011. Namun ia membantah istri Lamtiar Manurung itu bersama dirinya. Jhonson Saragih yang saat ini tinggal di Tigarunggu, Kecamatan Purba, Simalungun, melalui suratnya kepada METRO, Rabu (11/4), menuturkan bahwa ia pernah menjalin hubungan pacaran dengan Rajinni Sinaga yang kini menjadi istri Lamtiar Manurung. “Kami berpacaran lumayan lama, mulai tahun 2002 hingga 2011,” ungkap Jhonson dalam suratnya. Namun kata Jhonson, sejak Rajinni memutuskan jadi istri orang lain ia tidak pernah lagi bertemu Rajinni Sinaga, istri Lamtiar Manurung. Bahkan untuk menjalin komunikasi juga hingga sekarang,

Sambungan Halaman 1 nya pengawasan terhadap pegawai Timbangan yang kerap melakukan tindakan sewenang–wenang kepada sejumlah supir. “Kami sangat berharap agar petugas Timbangan ini disidak mendadak, terlebih malam hari. Mereka selalu memanfaatkan kesempatan jika kita sudah diburu waktu,” katanya. Dia juga mengaku kerap diminta uang Rp50 ribu untuk sekali melintas, walaupun berat muatan truk masih berada di level normal. Banyak cara dilakukan petugas mempersulit supir. “Saya kalau bawa truk Colt Diesel muatannya hanya enam ton. Sebenarnya kalau berdasarkan bobotnya masih wajar tetapi tetap saja dimintai uang. Kalau tidak diberikan, truk kita ditahan dengan berbagai tuduhan,” katanya. Dia mengatakan, di ruang piket petugas sudah tersedia cangkir plastik berwarna biru untuk menyimpan uang tersebut. ”Nanti kalau sudah diberi uang, selanjutnya uang itu dimasukkan ke dalam cangkir plastik warna biru,” katanya. Sementara, sejumlah warga sekitar ketika ditemui METRO mengaku, mereka sering melihat petugas Timbangan meminta uang kepada sejumlah supir yang melintas. Suparman (42), warga Serbelawan, yang kerap mangkal di tepi jalan di sekitar Timbangan, mengaku kerap melihat petugas Timbangan meloloskan truk angkutan kayu hingga puluhan ton yang melintas di depan mereka. ”Selama dua tahun saya jadi tukang ojek di sini, sudah sering saya lihat petugas meloloskan truk Kayu yang melintas dan nanti mereka berdiri di pinggir jalan minta uang. Kadang uangnya juga dilempar saja sama supirnya,” katanya. Masih kata Suparman, kegiatan Pungli para petugas Timbangan sudah menjadi hal lumrah bagi warga sekitar. “Kalau warga di sini sudah terbiasa melihat pungli. Mereka kadang mengaku kepada kita bahwa semua itu untuk uang masuk petugas,” katanya. Sementara HTurnip, petugas Timbangan ketika ditemui METRO mengaku mereka tidak pernah melakukan kegiatan Pungli bagi para supir angkutan truk yang melintas. ”Kami tidak melakukan Pungli ke supir, itu tidak benar,” katanya sembari berlalu meninggalkan METRO. Amatan METRO, ratusan truk yang melintas di Timbangan itu kerap turun dari truk dan langsung ke ruangan petugas, sementara ketika keluar mereka hanya berlalu tanpa dilakukan pemeriksaan. (mag–02)

Jhonson Akui Pacar Rajinni tidak pernah. Lamtiar Manurung. Lamtiar Dia mengisahkan, hupun langsung mengambil pakbungan pacaran yang ia jalin sa HP tersebut. bersama Rajinni adalah Lanjut Jhonson dalam susewaktu wanita pujaan hatinya ratnya, saat itu Rajinni tak teitu dulu masih berstatus anak rima dan memilih pergi sekolah. Jhonson mengaku menemui Lamtiar Manurung. sering membantu Rajinni daTak beberapa kemudian, kata lam hal kebutuhan kuliahnya, Jhonson, ia mendengar kabar bahkan untuk kebutuhan bahwa Rajinni melaksanakan sehari-hari. pernikahan dengan Lamtiar Namun ia mengaku kecewa Manurung di Porsea, pada tasetelah ia menyadari cintanya nggal 9 Mei 2011. “Jadi resminya „ Rajinni Sinaga telah dinodai. Diam-diam kami tidak menjalin komunirupanya Rajini menjalin hubungan khusus kasi, ya sejak pernihakan tersebut,” ujarnya. dengan lelaki lain. Dia menuturkan, kejaDia kembali menegaskan bahwa tidak diannya sekira tahun 2011. Sekali waktu benar Rajinni ada menemuinya. “Kami Jhonson mengaku pernah memergoki tidak pernah bertemu,” ujar Jhonson. Rajinni sedang bertelepon dengan seorang Terpisah, Lamtiar Manurung, suami pria yang belakangan diketahui bernama Rajinni Sinaga mengatakan, ia akan tetap

Jhon Hugo dan Syahmidun Harus Ikut Jadi Tersangka Sambungan Halaman 1 Dia mengaku, sampai ke langit manapun, ia akan memperjuangkan suaminya. Saat ini nasib Abdul Muis berada di tangan hakim yang melaksanakan PK. Pihaknya akan menunggu sampai putusan PK keluar. Jika PK sudah keluar, mereka akan melaporkan kembali orang-orang yang seharusnya pantas ikut mempertanggungjawabkan ini. “Suami saya sudah 32 tahun menjadi PNS, tapi kenapa baru sekarang ia mengalami hal seperti ini. Dia orang yang diperintahkan, seharusnya orang yang memerintah ikut bertanggungjawab. Apa yang dilakukan suami saya bukan atas permintaan sendiri tapi karena Pemkab Simalungun,” katanya. Dia mengatakan, ini merupakan kali kedua suaminya ditahan di sel Lapas. Pertama, ia mendekam selama dua minggu setelah dilimpahkan. Selanjutnya, atas tuduhan suaminya menjadi buronan, kembali ditahan padahal suaminya tidak pernah melarikan diri dan sudah mengajukan permohonan ke MA agar tidak ditahan. Dia menegaskan, sesuai pasal yang disangkakan kepada suaminya, harusnya ada tersangka lain dalam kasus tersebut. Suaminya diperintahkan, maka yang memerintah juga harus ikut bertanggungjawab. “Mantan Bupati Simalungun Jhon Hugo Silalahi, Wakil Bupati Dartati Damanik dan

Ketua DPRD Simalungun Syahmidun Saragih harus ikut bertanggungawab. Mereka yang menyetujui hingga Laporan Pertanggungjawaban (LPj) disahkan,” katanya. Bukan Buronan Deliana mengatakan, suaminya tidak pernah melarikan diri. Kepergiannya ke Makasar hanya menemani anak pertama mereka yang baru pindah kerja. Ditemani mantan kuasa hukumnya, Dewi SH, istri Abdul Muis mengaku bahwa suaminya taat hukum. “Suami saya tidak pernah melarikan diri. Untuk kasus tersebut sampai saat ini masih tahap Peninjauan Kembali (PK) di Mahkamah Agung,” ujarnya. Lebih lanjut ia menerangkan, pihaknya telah menyurati Kejagung agar suaminya jangan dieksekusi terlebih dahulu sebelum ada putusan PK. Sebab selain kepastian hukum belum selesai, sejak ditetapkan menjadi tersangka suaminya mengidap penyakit jantung. “Tidak mungkin suami saya melarikan diri melihat usianya yang sudah tua. Lagian anakanak kami juga sudah besar dan ada yang bekerja di Pemko Medan, bank dan lainnya,” jelasnya. Ia juga membantah suaminya berpindahpindah hingga ke Jakarta. Abdul Muis menemani anak pertama mereka dari empat bersaudara untuk masuk kerja di Surabaya. Selanjutnya sekitar lima bulan lalu, Abdul

Sambungan Halaman 1 berdiri di Kelurahan Tiga Runggu, Kecamatan Purba, sejak itu pula limbah keruh dan kental dibuang ke Danau Toba.

terhadap rangsangan yang pada paru-paru normal tidak akan mempengaruhi saluran pernafasan. Penyempitan ini dapat dipicu oleh berbagai rangsangan, seperti serbuk sari, debu, bulu binatang, asap, udara dingin dan olahraga. Dengan tubuh yang sehat, kini nenek 1 orang cucu tersebut dapat menjalani aktifitasnya dengan nyaman. Ia pun mengajak orang lain untuk merasakan manfaat susu etawa ini, "Mari kita sehat bersama Milkuma." Ajak ibu rumah tangga tersebut. Sebenarnya, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu etawa. Berbeda dengan susu sapi, sesungguhnya susu etawa memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Selain mengandung Riboflavin, vitamin B yang penting untuk produksi energi, susu etawa pun tidak menyebabkan alergi sehingga aman, dan bermanfaat untuk penderita asma. Satu gelas susu etawa memasok 20,0% dari nilai harian Riboflavin.

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pemimpin Umum/Penjab/GM : Wakil Pemimpin Umum : Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Muis terbang ke Makasar untuk mengantar dan menemani anaknya yang mendapat pekerjaan di sana. “Di sini telah terjadi kesalahpahaman. Suami saya tidak pernah menjadi buronan. Dia pergi ke sana untuk menemani anak saya. Sedangkan saya di Medan menemani anak saya yang tengah kuliah. Tidak mungkin kami meninggalkan anak kami yang memang masih membutuhkan dan penjagaan dari orangtua,” ujar wanita yang sudah memiliki tiga cucu ini. Dia melanjutkan, sebelum ditangkap pihak Kejaksaan, suaminya bangun sekira pukul 03.00 WITA dan melaksanakan salat di rumah. Usai salat, ia berangkat ke masjid untuk mengaji. Usai dari masjid, ia ditemui tim Kejaksaan dan menanyakan identitasnya. “Suami saya tidak ada mengelak saat tim Kejaksaan menanyakan identitasnya. Bahkan suami saya sempat meminta ganti baju, tapi pihak tidak diizinkan. Setelah bertemu anaknya, sempat menanyakan surat penangkapan. Tapi di sana pihak Kejaksaan menyampaikan ditangkap dengan terhormat atau langsung diborgol,” terangnya. Setelah ditangkap di Makasar, tanpa istirahat suaminya langsung diboyong ke Lapas. Ia sendiri mengaku ngeri melihat nasib suaminya yang sudah tua dan melakukan perjalanan tanpa istirahat. “Sampai saat ini saya belum melihat suami

di Lapas. Baru anak saya kemarin (Senin, red) datang mengunjunginya. Tadi waktu saya ingin berkunjung, ternyata masih jam istirahat. Inilah saya ingin menjenguk, kurang tahu masih sempat atau tidak lagi,” paparnya. Sementara itu Mantan Bupati Simalungun, Jhon Hugo Silalahi yang dihubungi melalui telepon enggan memberikan jawaban. Bahkan saat awak Koran ini mengirimkan pesan melalui SMS, tetap tidak kunjung di balas. Padahal terdengar dari seberang suara handphone aktif. Buang Badan Ketua LSM Macan Habonaran Jansen Napitu menilai, kasus yang menjerat Abdul Muis Nasution telah disetujui oleh DPRD. “Di sini semua pejabat yang dulu memimpin lepas badan atau buang badan. Masa Sekda bisa kena, sementara Bupati atau unsur pimpinan lain tidak kena?” katanya. Lebih lanjut ia menerangkan, semua hal yang diajukan Sekda pasti diketahui bupati dan wakil bupati. Bahkan semua pihak yang menyetujui hal tersebut harus ikut kena. Jangan karena seseorang lemah dan yang lain justru buang badan. “Seharusnya penagakan hukum harus tegas dan jelas. Tidak mungkin seorang Sekda yang memiliki atasan, namun atasanya tidak mengetahui hal tersebut. Kalau dipikir-pikir kita akan bingung dengan kasus ini. Sehingga penegak hukum harus benar-benar tegas dalam menelusuri kasus ini,” ujar Jansen. (mua)

Allegrindo Buang Limbah ke Danau Toba

NAFAS BERAT KARENA ASMA KINI SEMBUH DENGAN SUSU MILKUMA Hariyem, w a r g a Bakalan, T a m a n Agung, Muntilan, J a w a Tengah kini tak lagi merasakan derita sesak nafas. Ternyata, sudah 4 bulan ini ia minum Milkuma, minuman serbuk susu etawa yang diproses secara alami, tanpa pemanis buatan dan bahan pengawet. Bahan dasarnya adalah susu etawa segar dan gula aren. "Sudah 2 tahun saya menderita asma. Alhamdulillah setelah minum Milkuma, kini saya sudah sehat, nafas berat dan sesak karena asma sudah tidak kambuh lagi." Terang wanita berusia 50 tahun tersebut. Penyakit sesak nafas atau asma telah menjadi salah satu penyakit yang sangat familiar dengan rakyat Indonesia. Ketika asma menyerang, saluran nafas mengalami penyempitan karena hiperaktifitas terhadap rangsangan tertentu, yang menyebabkan peradangan. Penyempitan saluran pernafasan tersebut merupakan respon

mencari istrinya. “Kalau memang demikian apa boleh buat,” ucap Lamtiar. Sebelumnya Lamtiar menceritakan bahwa hubungannya dengan istrinya tidak direstui orangtua Rojinni. Pada saat itu, Rajinni sudah berpacaran dengan Jhonson Saragih. Tapi karena cinta, Lamtiar tidak mundur ia tetap berjuang keras hingga usahanya mendapat sambutan dan Rajinni bersedia jadi istrinya. “Saya tidak ada paksa dia, pernikahan kami adalah rasa saling suka dan cinta,” ucapnya. Sekadar diketahui bahwa Rajinni br Sinaga (25), istri Lamtiar M Manurung (30), pergi meninggalkan rumah di Jalan Kol Kelurahan Kebun Sayur, Siantar Timur, Senin (2/4) sekitar pukul 05.00 WIB. Namun keberadaannya hingga kini belum ada titik terang. (mag-1)

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Goldian Purba Maranatha Tobing Pandapotan MT Siallagan Alvin Nasution Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Selain itu, mengkonsumsi Milkuma sebanyak 2 gelas sehari bermanfaat untuk menjaga daya tahan tubuh dan meningkatkan vitalitas. Fluorine yang terdapat dalam susu etawa bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan tidak menimbulkan dampak diare pada orang yang mengkonsumsinya. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Milkuma dikomposisikan dengan gula aren sehingga aman bagi penderita diabetes. Milkuma juga sangat dianjurkan bagi perokok baik perokok aktif maupun pasif. Milkuma sudah tersedia di apotek2 juga toko obat terdekat dikota anda, atau hubungi, Sumut; 085314072195 / 06191128785. Pematang Siantar; Apt Sehat, Apt dear farma. Tebingtinggi; Apt Tanganmas, Apt Bulian, Apt Saudara Baru. Depkes dengan no PIRT. 6.09.3328.01.395.

“Seperti inilah limbah dibuang setiap hari, limbahnya memang berwarna keruh. Sebenarnya ini belum seberapa. Kalau malam hari mulai pukul delapan hingga pukul lima pagi, limbah yang mereka buang lebih kental lagi,” ungkap Turnip. Dia mengatakan, tindakan Allegrindo membuang limbah ke Danau Toba sudah sering mereka protes. Warga di Dusun Salbe sudah sering mendatangi Allegrindo beramai-ramai, namun hasilnya tetap nihil. Allegrindo tidak menanggapi keluhan masyarakat yang berada di sekitar Danau Toba. “Pernah sekali ikan di dalam keramba warga di sini mati. Kalau saya tidak salah ingat, kejadian itu sekitar lima tahun lalu. Si pemilik keramba mendatangi Allegrindo, mereka memang mengganti biaya ikan yang mati itu,” jelasnya. Selain pernah menyebabkan ikan di keramba mati, warga di Dusun itu juga mengeluhkan aroma tak sedap yang muncul dari saluran pembuangan. Setiap hari warga di sana harus menghirup udara tak segar. “Sekali cuma kami dikasih bantuan, setiap rumah warga sini dipasangi listrik sekitar tahun 2005 lalu. Sesudah itu tidak pernah lagi kami mendapat bantuan,” katanya lagi. Sekitar pukul 17.00 WIB kemarin, METRO berada di sekitar lokasi saluran pem-

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta) Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Alvin Nasution, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: Syafruddin Yusuf, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus),Aristo Linghten Panjaitan (Tobasa), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina)

buangan limbah di Dusun Salbe. Aroma tak sedap mulai terasa radius 500 meter dari saluran pembuangan limbah. Limbah Allegrindo berwarna keruh mengalir deras ke Danau Toba. Meski begitu, beberapa ekor itik terlihat berada di lokasi pembuangan limbah. Itik-itik ini mencari makan. J Turnip (65), warga dusun yang sama, menyebutkan, selain mencemari Danau Toba, aroma tak sedap sangat meresahkan warga. Setiap hari mereka harus menahankan aroma tak sedap yang terasa semakin menyengat pada malam hari. “Kalau udara lagi tidak berhembus pada malam hari, aroma bau dari saluran pembuangan itu sangat terasa, bau sekali lah pokoknya, bisa sakit kepala kita,” jelasnya. Sebelumnya sekira pukul 14.00 WIB saat METRO mendatangi Kantor Allegrindo di Kelurahan Tiga Runggu Kecamatan Purba, tiga orang Satpam yang berjaga di pintu masuk tidak memperbolehkan METRO masuk. Mereka mengatakan, pimpinan sedang rapat sehingga tidak bisa diganggu. Ketiganya lalu mengarahkan METRO mempertanyakan masalah ini kepada Lindung Purba yang mereka sebut Humas Allegrindo. Sementara Lindung Purba yang ditemui di salah satu Doorsmeer di Kelurahan Tiga Runggu tidak

mau memberikan komentar. Menurutnya, dia tidak berhak memberikan komentar karena dia bukan Humas Allegrindo. “Saya memang pernah dibilang sebagai Pj Humas, namun sampai sekarang tidak jelas. Saya tidak berkompeten bicara. Langsung sama Pak Sitepu saja, dia Kabag Personalia, dia yang membawahi Humas,” katanya seraya memberikan nomor telepon yang bersangkutan. Sementara saat dihubungi nomor telepon seluler tersebut, si penerima menyebutkan salah sambung dan dia bukan Kabag Personalia PT Allegrindo Kelurahan Tiga Runggu. “Salah sambung pak, saya bukan Sitepu,” ujar suara di seberang mematikan telepon. Seperti diberitakan, ratusan buruh PT Allegrindo dan Himapsi mendatangi kantor DPRD Simalungun, Senin (9/4). Koordinator Aksi Rado Damanik dalam pernyataan sikapnya mengatakan, PT Allegrindo tidak lagi menghargai dan memperdulikan kesejahteraan karyawan maupun buruh di perusahaan tersebut. Menurut Rado, PT Allegrindo telah banyak melanggar Undang-undang nomor 13 tahun 2003 tentang Ketenagakerjaan khususnya dalam pasal 66 point 2 huruf c tentang perlidungan upah dan syarat-syarat kerja serta perselisihan yang timbul menjadi tanggungjawab perusahaan.

METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Eva Wahyuni, Hermanto Sipayung, Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kord Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Roy Amarta, Ismail, Efendi Tambunan, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Erik. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

Sementara dalam pasal 66 ayat 1 setiap pekerja atau buruh mempunyai hak memperoleh perlindungan atas keselamatan dan kesehatan kerja maupun moral kesusilaan. “Selama ini pekerja tidak diberikan masker, sarung tangan dan kelengkapan lainnya. Kalau begini terus kami minta PT Allegrindo ditutup, Pemkab harus berani mencabut izin usahanya untuk kepentingan masyarakat banyak, jika tidak berani kami akan menutup paksa,” tegasnya. Rado juga mengancam akan melaporkan PT Allegrindo ke Kementerian Lingkungan Hidup karena ulah perusahaan tersebut yang diduga membuang limbah kotoran ternak serta bangkai ternak babi yang mati ke Danau Toba. “Dalam waktu dekat, kami akan terus melakukan penyelidikan untuk menemukan bukti konkrit, sehingga bisa segera dilaporkan ke Kementerian Lingkungan Hidup. Kami menyesalkan banyaknya kepala daerah di sekitar Danau Toba yang terus mengkampanyekan kelestarian Danau Toba, sementara ada perusahaan yang mencoba mengotori air danau tersebut dibiarkan begitu saja, kalau permasalah ini tidak dituntaskan, kami akan sampaikan langsung ke Pak Boediona saat kedatangannya nantinya,” katanya. (ral)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733






April 2012



Tungkul Jagung Dibuang ke Jalan

Anda punya keluhan terhadap pelayanan publik di Siantar-Simalungun ? Kirim SMS ke nomor

Pak Lurah Bah Sorma terhormat, kami warga Jalan Pisang Tanjung Pinggir, Kelurahan Bah Sorma merasa terganggu karena mesin di jurangan jagung membuang tungkul jagung bekas gilingan ke badan jalan. Sehingga pengedara bermotor terganggu kalau mau lewat. Tolong pak diperhatikan. 081376975xxx


Bagaimana Tindak Lanjut Bangunan yang Menyalahi Aturan di Jalan Balige

Tangkap Pengecer Elpiji dari Tanah Karo ke Simalungun

Pak kakan Satpol PP Siantar yang terhormat, sudah bagaimana tindak lanjut bangunan yang menyalahi aturan di Jalan Balige II, Kelurahan Martimbang, Kecamatan Siantar Selatan. Masyarakat sudah resah, karena pembangunannya jalan terus. 081362195xxx

Yang terhormat Kapolres Simalungun, tolong ditangkapi pengecer Elpiji dari Tanah Karo ukuran 3 kilogram yang merambah ke Simalungun. Menurut aturan subsidi dari Tanah Karo tidak bisa masuk ke Simalungun. Tapi kenyataannya setiap hari Elpiji 3 kilogram masuk terus ke Saribudolok, Kecamatan Silimakuta. 082164543xxx

foto:tonggo sibarani

BALAP LIAR: Setiap malam minggu Jalan Kartini dan Jalan Merdeka sering dijadikan lokasi balap liar.

BALAPAN LIAR Semakin Meresahkan SIANTAR-Balapan liar sepedamotor di Jalan Kartini dan Jalan Merdeka, Pematangsiantar masih semakin menjadi-jadi. Aksi tersebut sangat menganggu dan membahayakan pengguna jalan lain. Dimana aksi ini sudah menjadi kompetisi rutin antar geng motor di Siantar yang dilakukan setiap malam minggu. Para pembalap liar itu memacu kendaraannya dengan kencang tanpa memakai helm. (Osi)

Tindak Tegas Mereka Harusnya pihak yang berwenang bisa mengambil tindakan tegas. Ini sudah keterlaluan, selain mengganggu ketentraman pengguna jalan, juga dihantui rasa takut ketika akan melintas dari Jalan Kartini dan Jalan Merdeka yang selalu dijadikan arena balap liar. (Osi) DA Saragih, wiraswasta

Terapkan Pasal 297 UU No 22 Tahun 2009 APARAT kepolisian harus tegas menerapkan undangundang nomor 22 tahun 2009 tentang lalu lintas. Dimana dalam pasal 297 disebutkan pembalap liar wajib membayar maksimal Rp3 juta atau pidana 1 tahun kurungan. Kalau undang-undang itu diterapkan, para pelaku balap liar pasti ada efek jerahnya. (Osi) Hengky Sibarani Warga Siantar Marihat

Ancam Keselamatan Pengendara AKSI balap liar yang dilakukan sejumlah pemuda itu akan mengancam keselamatan pengendara lain. Para pembalap liar tersebut kebut-kebutan tanpa memperhatikan pengendara lainnya yang sedang melintas. (Mua) Mangara Simbolon karyawan warga Tomuan

"SEKARANG STAMINA SAYA SUDAH PULIH" Sudah 11 t a h un lamany a, D o r I s t y s e r ingkalii merasakan h i d u p ny a tidak nyaman k a r e n a men de ri ta hipertensi, "Kalau tekanan darah tinggi,saya jadi cepat lelah," cerita wanita berusia 54 tahun tersebut. Nenek 3 orang cucu ini menduga, faktor keturunan sebagai penyebab dirinya menderita hipertensi. Stress, faktor keturunan (genetik), usia, konsumsi garam yang tinggi, banyak pengawet, serta lemak dan daging yang tinggi memang merupakan faktor-faktor terjadinya hipertensi yang sering kita sebut dengan tekanan darah tinggi. Kepala terasa pusing, wajah memerah, tengkuk terasa pegal, mudah lelah, dll adalah gejala-gejala yang biasanya dirasakan oleh penderitanya. Kepercayaannya terhadap pengobatan yang alami akhirnya membuat wanita yang akrab disapa-Titi ini tertarik untuk mencoba Gentong Mas, minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda) terbukti memiliki banyak manfaat untuk kesehatan. Ternyata pilihannya itu tepat, "Saya bersyukur sekali, setelah minum Gentong Mas secara rutin selama 4

bulan, Puji Tuhan... Sekarang keluhan saya mulai berkurang, badan jadi terasa segar, dan stamina sudah pulih." Ungkap warga Perumahan Johor Indah Permai, Medan, Sumatera Utara ini dengan bahagia. Hipertensi (hypertension) adalah suatu keadaan di mana seseorang mengalami peningkatan tekanan darah di atas normal yang ditunjukkan oleh angka systolic (bagian atas) dan diastolic (angka bawah) pada pemeriksaan tensi darah. Nilai normal tekanan darah seseorang secara umum adalah 120/ 80 mmHg. Dalam aktifitas seharihari, tekanan darah bervariasi tetapi masih dalam kisaran normal. Tetapi secara umum, angka pemeriksaan tekanan darah menurun saat tidur dan meningkat diwaktu beraktifitas atau berolahraga. Dengan tubuh yang sehat, sekarang ibu rumah tangga ini dapat menjalani aktifitas sehari-harinya dengan nyaman. Ia pun tidak segansegan membagi pengalaman baiknya itu dengan orang lain, "Mudahmudahan pengalaman saya yang mendapat kesehatan dengan cara yang alami ini dapat bermanfaat bagi orang lain." Harapnya. Habbatussauda dalam Gentong Mas bermanfaat untuk memelihara pembuluh darah dari endapan lemak dan pengapuran. Sementara Kayu manis yang juga dikandung dalam Gentong Mas berfungsi sebagai

penormal tekanan darah. Sedangkan GulaAren selain rasanya manis dan lezat juga ber- m a n f a a t m e n u r u n k a n penyerapan lemak. Untuk hasil maksimal, terapkan pola hidup sehat seperti menjalani diet rendah garam, kolesterol, dan lemak jenuh, stop konsumsi makanan dan minuman beralkohol, hindari stress, olahragateratur, dll. Manfaat yang hebat bagi kesehatan dan rasa yang lezat membuat semakin banyak masyarakat mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Untuk informasi lebih lanjut silahkan kunjung i www.gentongmas. com. Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/ toko obat terdekat atau hubungi: Medan : 081384777787 Sidikalang : 081384777787 Dolok Sanggul : 081384777787 Gunung tua : 081384777787 Batubara : 081384777787 Tobasa : 0813 8477 7787 Nias : 0813 8477 7787 Tebing Tinggi : 0813 2209 9495 Siantar : 082167538848 Binjai : 0813 9866 6166 Lbk Pakam : 082164659699 Karo : 0821 6753 8828 Langkat : 0812 6321 7797 Kisaran : 0623 7014 362 Tj. Balai : 0812 6349 5563 Labura : 0813 7059 0972 Labuhan batu: 0852 7707 1977 P. Sidimpuan : 0821 6346 6597 Sibolga : 0852 9685 5211 Taput : 081263243034 Madina : 082163466597. Depkes:P-IRT:812.3205.01.114


PENGUMUMAN NOMOR : PENG- 04/WPJ.26/2012 TENTANG REGISTRASI ULANG PENGUSAHA KENA PAJAK TAHUN 2012 Dalam rangka meningkatkan pelayanan, penertiban administrasi, pengawasan dan untuk menguji pemenuhan kewajiban subjektif dan objektif Pengusaha Kena Pajak (PKP), dengan ini diberitahukan kepada seluruh Pengusaha yang telah terdaftar sebagai Pengusaha Kena Pajak (PKP) bahwa: 1. Kantor Pelayanan Pajak Pratama di Lingkungan Kanwil Direktorat Jenderal Pajak Sumatera Utara II sedang melaksanakan Kegiatan Registrasi Ulang untuk seluruh Pengusaha Kena Pajak Terdaftar. 2. Pengusaha Kena Pajak (PKP) adalah para pengusaha yang bergerak di bidang usaha industri, perdagangan dan jasa yang wajib memungut Pajak Pertambahan Nilai (PPN) atas barang dan/atau jasa yang mereka serahkan/jual dengan omset satu tahun lebih dari Rp. 600 juta. 3. Jangka waktu pelaksanaan Registrasi Ulang Pengusaha Kena Pajak dimulai sejak Pebruari 2012 sampai dengan 31 Agustus 2012. Demikian disampaikan untuk diketahui. Pematang Siantar, 13 Maret 2012 Kepala Kantor, Ttd

Harta Indra Tarigan NIP. 195808251980121001




April 2012




Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter.

Saya tidak mau menyalakan lagi kompor yang sebenarnya sudah menyala. Karenanya, saya menegaskan, tidak benar saya mau jadi presiden! Saya tidak akan menanggapi siapapun ataupun partai politik jika ada yang berencana mengusung saya.

Sikap Kami Ketika Yang Mulia Menuntut Kesejahteraan Para hakim yang mulia, tiba-tiba resah lantaran gaji yang diperolehnya dirasakan tidak mencukupi kebutuhan hidup. Anehnya, protes para hakim baru dilakukan sekarang, saat praktik mafia hukum menjadi sorotan. Benarkah protes hakim sebagai bukti efektifnya pemberantasan mafia hukum di tubuh kehakiman? Bisa jadi iya. Kini, para hakim mulai pusing atau syukur kalau sampai takut, untuk melakukan praktik suap atau kongkalikong. Tapi, bisa juga tidak terkait dengan dalih pemberantasan mafia hukum. Sebab, kata mantan hakim Konsitusi Jimly Asshiddiqie, selama ini penghasilan hakim di Indonesia memang lebih redah dari gaji Pegawai Negeri Sipil (PNS). Padahal, menurut Jimly, status para hakim masih terkait dengan PNS dan hakim bekerja atas nama negara yang mengambil keputusan demi keadilan berdasarkan Ketuhanan Yang Maha Esa. Hakim ketika memutuskan vonis harus objektif dan berdasarkan pada Ketuhanan Yang Maha Esa, bukan berdasarkan arahan atasan yang seolah-olah bisa disetir. Meski demikian, sampai saat ini, hakim tak mendapatkan tunjangan seperti PNS yang cara kerjanya berdasarkan arahan atasan. Masih banyak juga hakim yang belum punya rumah meski tak sedikit yang punya rumah mewah di kota besar. Berkaca pada dua hal itu memang pemerintah harus arif dalam menyikapinya. Memikirkan kenaikan kesejahteraan para hakim perlu dilakukan. Tapi, yang lebih penting, pengawasan terhadap hakim harus jauh lebih di perketat. Jadi, hakim yang masih miskin perlu dikatrol pendapatannya, dan yang masih doyan “bermain” harus tegas mendapatkan sanksi. Jika sudah berjalan sistem, maka dengan sendirinya wibawa hakim yang dikatakan sebagai wakil tuhan juga bisa diwujudkan. (***)

Menteri BUMN Dahlan Iskan, Rabu (11/4)

Kepala daerah bisa meminta bantuan kepada TNI untuk memberi pengamanan jika ada konflik sosial. Undang-undang juga menyebutkan jenisjenis tugas TNI

Edward Shils (1972) mengatakan bahwa praktek politik Indonesia bukan lahan subur untuk idealitas dan perjuangan. Meskipun banyak ilmuwan dan praktisi politik memiliki ide kebangsaan, namun mereka tidak berhasil membangun bangsanya sendiri.

Membangun Koalisi Cantik di Balik Rencana Reshuffle (2/Habis) Berpola dari asas politik imbalan di atas itulah negeri ini melaju, kebohongan retorika terus diujarkan tanpa menemui kejenuhannya.

Ach. Tijani Shodiq Dampak Perpolitikan Nazis Komitmen dan konsistensi gerak perpolitikan nasional sangat sulit ditemukan. Hari ini mengatakan merah, esok bisa saja putih bahkan sejam kemudian bisa saja mengatakan merah lagi. Kepentingan partai menjadi tujuan paling pokok, sementara kebutuhan rakyat semesta Nusantra diabaikan begitu saja. Amanah rakyat menjadi candu memabukkan yang melupakan segala-galanya, kekuasaan menjadi kejaran utama untuk memastikan sebagai yang terkuat. Sketsa wajah negeri di atas sungguh memperihatinkan, pijakan politik berbau imbalan semata itu telah membuat wajah negeri ini semakin kusam. Sebagai dampak paling kentara adalah penempatan individu partai pada posisi kementerian seringkali tidak akurat dengan kemampuan sang individu, sehingga tentu tidak akan pernah membuahkan

hasil yang maksimal. Selain dari pada itu, Presiden yang mempunyai hak penuh dalam memilih rekan-rekan pembantunya di kementerian juga menjadi boneka dari para partai koalisi yang mengelilinginya, sehingga memungkinkan adanya pemudaran idealisme yang ada di tubuh Presiden sebagai sang pengendali pemerintahan. Dampak buruk itupun layaknya mata rantai yang saling berkaitan, sehingga pada akhirnya koalisi itu sendiri adalah kotoran yang najis dan menjijikan. Saatnya Kembali Sejatinya bekerja sama dan berlainan pendapat itu adalah keadaan primordial dan natural dari kondisi alam demokrasi seperti Indonesia ini. Akan tetapi dua kondisi primordial tersebut hendaknya harus terus dikawal oleh suatu cita-cita kebangsaan yang menjadi citacita dari seluruh golongan atau partai. Citacita kebangsaan itu dalam arti yang sangat sederhana adalah menata kehidupan rakyat serta memenuhi hak-haknya. Cita-cita ini mau tidak mau harus menjadi yang utama dari seluruh gerak perpolitkan semua partai. Tidak ada tujuan yang lain tanpa mencantumkan tujuan kebangsaan tersebut ditempatkan sebagai yang utama. Mencantumkan cita-cita kebangsaan sebagai yang utama tidak berarti menisbikan agenda partai, akan tetapi maksud dari itu adalah menempatkan agenda partai di bawah cita-cita universal tersebut. Bila ditarik dalam

bahasa Islam, pemerintah dalam koalisinya harus berasas kebaikan dan taqwa (ta’awanu alal birri wa taqwa). Asas kerjasama ini walau begitu sangat sederhana akan tetapi sungguh mempunyai dimenasi perubahan yang besar untuk sebuah kemaslahatan nusantara. Selain dari itu, pemerintahan itu tidak cukup berhenti pada hal kerja sama semata, tetapi butuh kerja nyata. Sebagai bentuk asas kerja nyata perlu kiranya juga memungut ajaran agama sebagai asas fundamental, di mana agama memang mau tidak mau bagian dari kebutuhan manusia. Maka tidak salah jika asas koalisi itu juga merujuk pada ajaran agama, yaitu beramal baik (amilu sholihat). Akhirnya, dari uraian di atas dapat disimpulkan bahwa koalisi politik yang cantik hanya bisa dicapai jika koalisi itu berasas tiga faktor yaitu, cita-cita kebangsaan, kebaikan dan taqwa (ta’awanu ‘alal birri wa taqwa) serta beramal baik (amilu sholihat). Jika perpolitikan di negeri ini sudah bisa merujuk pada tiga asas tersebut maka cita-cita rakyat merajut baldatun thoyyibatun wa rabbun ghafur akan segera tercapai. Semoga!! (***) Penulis adalah Alumnus TMI AlAmien Prenduan Sumenep Madura dan Staf Pengajar di Madrasah Mu’allimin Muhammadiyah Yogyakarta.

Mendagri Gamawan Fauzi, Rabu (11/4)

Tuduhan aksi penolakan BBM merupakan upaya penjatuhan kekuasaan merupakan tuduhan yang salah. Perjuangan buruh murni dan tidak ada kepentingan politik sesaat.

Presiden K-SPSI Andi Gani Nena Wea, Rabu (11/4)

Sumut - Nasional



April 2012




Tambah PNS Diam-diam

Kepala Daerah Bisa Dipenjara SY RIDWAN/PADANG EKSPRES

PASCAGEMPADPADANG-SUMBAR;Masyarakatpadangberlarian saatgempa8,9sracehygdrasakandpadang,Gempalumayanterasa kencangdantidakadamaterialygrusak,pasienrumahsakitdr.m,djamil terpaksa d bwa keluar dri ruang bangsal dpadang.

RatusanWargaPesisirPantai KotaPadangMengungsi PADANG- Ratusan warga yang tinggal di pesisir pantai, tepatnya di Kelurahan Teluk Kabung Utara, Kecamatan Bungus Teluk Kabung, Kota Padang, Sumatera Barat, mengungsi ke daerah perbukitan terkait adanya peringatan status awas dari BMKG. ”Kita tadi ada mendengar suara sirine, makanya sekarang mengungsi dulu,” kata Nur Asma, seorang warga yang tinggal di Kelurahan Teluk Kabung Utara, Rabu (11/4). Nur bersama warga lainnya akan mengungsi untuk sementara ke daerah perbukitan yang sebelumnya pernah menjadi jalur evakuasi waktu gempa pada 2009. Seperti diberitakan Kantor Berita Antara, warga yang mengungsi menuju daerah perbukitan tersebut, selain membawa keluarganya, ratusan warga itu juga membawa beberapa perlengkapan, seperti selimut dan tenda terpal. Hal yang sama juga dikatakan Adek, warga Cindakir Bungus Teluk Kabung. Dia menyebutkan untuk sementara lebih memilih mengungsi ke tempat yang selama ini sudah disiapkan menjadi jalur evakuasi tsunami. ”Kami sangat khawatir den-

gan peringatan dari BMKG tersebut, apalagi kami tinggal di daerah pesisir pantai, jadi sangat dekat dengan laut,” katanya. Dari data BMKG, Gempa yang berkekuatan 8,5 Skala Richter (SR) berpusat di Aceh, Rabu, sekitar pukul 15.38 WIB juga menghentikan kegiatan para nelayan yang akan pergi melaut, dan lebih memilih kembali berkumpul dengan keluarganya. Lampung Barat Juga Siaga Tsunami Menyusul gempa besar di Nanggroe Aceh Darussalam, warga di wilayah pesisir Lampung Barat, Lampung, juga diminta siaga terhadap potensi tsunami. “Ya, statusnya awas dari tsunami di daerah Lampung pesisir. Gempa besar dan dangkal ini sangat berpotensi tsunami,” ujar M Nurhuda, Kepala Seksi Observasi dan Informasi Badan Meteorologi, Klimatologi, dan Geofisika Lampung, Rabu (11/4). Gempa berkekuatan 8,5 skala Richter mengguncang Simeulue, Aceh, sore ini pukul 15.38. Gempa ini tidak dirasakan di Lampung. Meskipun demikian, potensi tsunaminya masih membahayakan warga di pesisir barat Lampung. (kmc/int)

JAKARTA - Kementerian Dalam Negeri (Kemendagri) menyiapkan formula lain agar daerah-daerah yang terancam bangkrut bisa bertahan. Kalau sebelumnya mengancam bakal ada likuidasi, kali ini yang ditekan adalah pemimpin daerahnya. Yakni, ancaman penjara kalau nekat menambah Pegawai Negeri Sipil secara diam-diam. Seperti diketahui, saat ini moratorium penghentian penerimaan PNS memang telah berjalan. Namun, Ditjen Otonomi Daerah (Otoda) Kemendagri Djoehermansyah Johan menyebut kepala daerah masih suka mengangkat pegawai secara diam-diam. Biasanya, diawali dengan mengangkat seseorang sebagai pegawai honorer. “Biasanya untuk balas budi,” ujarnya kepada Jawa Pos. Lebih lanjut dia menjelaskan, kebanyakan yang diangkat oleh kepala daerah adalah tim suksesnya. Selama ini, tidak ada sanksi bagi kepala daerah yang nekat “menyelundupkan” pegawai baru itu. Sehingga beban keuangan daerah makin berat karena harus membayar pegawai tersebut. Agar lebih bertaring, aturan pidana bagi kepala daerah tersebut bakal dijadikan undang-undang. Saat ini, Djoe mengatakan rancangan undang-undang (RUU) Pemerintah Daerah itu sudah disampaikan ke DPR. Namun, dia enggan menerangkan lebih detail tentang ancaman penjara itu. “Yang jelas, diancam pidana,” imbuhnya. Langkah tegas itu perlu diberlakukan supaya jumlah PNS tidak membludak. Opsi moratorium memang menurutnya paling logis saat ini, sebab kalau dipaksa pendistribusian ke beberapa daerah akan makan waktu. Apalagi, beberapa daerah juga

disebutnya sudah gemuk pegawai. Seperti diberitakan sebelumnya, Forum Indonesia Untuk Transparansi Anggaran (FITRA) merilis 291 kabupaten/kota yang memproyeksikan belanja pegawainya lebih dari 50 persen. Nah, dari daerah itu terdapat 11 daerah yang memiliki belanja pegawai lebih dari 70 persen. Gara-gara itu, daerah tersebut kolaps karena tidak lagi memiliki anggaran. Sebelas daerah itu diantaranya Kota Langsa (NAD), Kabupaten Kuningan Jabar, Kota Ambon, Kabupaten Ngawi, Kabupaten Bantul, Kabupaten Bireuen (NAD), Kabupaten Klaten, Kabupaten Aceh Barat, Kota Gorontalo, Kabupaten Karanganyar, dan Kota Padang Sidempuan (Sumatera Barat). Terpisah, Komisi Pemberantasan Korupsi (KPK) turut prihatin dengan minimnya anggaran daerah yang digunakan untuk kepentingan pelayanan masyarakat. Apalagi, komisi yang dipimpin Abraham Samad itu menegaskan kongkalikong antara pemkot dan DPRD dalam pembahasan anggaran daerah kini kian marak. “Dalam beberapa waktu terakhir kami banyak mengungkap praktek-praktek korupsi antara pemkot dan DPRD. Misalnya kasus Kabupaten Seluma, Semarang dan yang terakhir Riau,” kata juru bicara KPK Johan Budi kemarin (10/4). Pengungkapkan

yang dibarengi dengan panangkapan para pejabat DPRD dan pemkot di beberapa daerah itu merupakan bukti bahwa KPK menganggap korupsi daerah merupakan permasalahan yang sangat serius. Menurut Johan, meski KPK memiliki keterbatasan sumber daya manusia, tapi pihaknya tidak akan surut berupaya memberantas korupsi di daerah. Pria yang pernah mencalonkann diri sebagai pimpinan KPK itu mengaku ada beberapa modus dalam praktek kongkalikong antara pemkot dan DPRD. Diantaranya adalah pemkot memberikan sejumlah uang pelican kepada DPRD guna untuk meloloskan pembahasan anggaran RAPBD dan untuk mengegolkan pembahasan peraturan daerah. “Korupsi jenis pasti dilakukan secara bersama-

sama,” kata Johan. Dalam beberapa kasus, pemkot beralasan memberikan pelicin kepada legislatif karena terpaksa. Menurut pengakuan mereka, jika tidak menyetor pelicin, maka DPRD akan seenaknya mempersulit pembahasan perda dan pelolosan anggaran. Sehingga yang dirugikan adalah masyarakat. Namun bagaimana pun juga, lanjut Johan, itu adalah bentuk praktek suap yang jelas-jelas melanggar UU Pemberantasan Tindak Pidana Korupsi. Pelaku, baik penyuap maupun yang disuap sama-sama bisa dijerat pidana korupsi. KPK sebenarnya tidak tinggal diam. Selain terus menangkap para pelaku di daerah, lembaga yang bermarkas di Jalan Rasuna Said Jakarta itu kerap turun ke daerah untuk memberikan pen-

guatan kepada DPRD dalam upaya pencegahan. “Kami terus turun ke daerah-daerah dengan mengandeng pihak-pihak terkait. Terutama Kemendagri,” kata dia. Pelatihan yang biasanya diberikan KPK kepada anggota DPRD adalah penguatan pemahaman fungus legistaif. Yakni pengawasan, pembuatan perda dan budgeting. Menurut dia, dua hal terakhir adalah kewenangan DPRD yang paling banyak disalahgunakan. Dalam upaya pencegahan, tentu saja KPK sangat menunggu laporan-laporan. KPK meminta masyarakat proaktif melaporkan kepada pihaknya jika memang mengetahui ada praktek korupsi di daerahnya. “Tentu saja harus membawa buktibukti yang cukup,” imbuhnya. (dim/kuh/agm/jpnn)






Voucher Flash Unlimited untuk Akses Internet Paling Indonesia MEDAN-Ivestasi dalam pembangunan infrastruktur, peningkatan kualitas layanan purna jual serta inovasi berbagai value added service adalah komitmen Telkomsel untuk membawa masyarakat Indonesia ke dunia broadband. Memberikan akses data yang mudah, terdepan dan terpercaya diwujudkan dengan hadirnya Voucher Flash Unlimited, voucher khusus layanan paket data unlimited.“Internet Paling Indonesia merupakan jawaban Telkomsel akan kebutuhan mobile internet yang sesuai karakteristik masyarakat Indonesia. Berbagai inovasi akan terus diberikan untuk mendukung kemudahan pelanggan dalam mengakses data di era Beyond Telecomunication,” kata Head of Telkomsel Area Sumatera - Gilang Prasetya Hingga saat ini, katanya, Telkomsel telah sukses menggelar layanan broadband di lebih dari 46 kota, dan di tahun 2012 menargetkan untuk menjadikan 100 kota besar di Indonesia sebagai broadband cities. Membawa Indonesia sebagai bagian dari komunitas broad-

„ Konsumen yang menggunakan Voucher Flash Unlimited. Telkomsel di Indonesia. (int)

Dan Voucher Flash Unilimited telah tersedia di semua outlet

Alumni SMP Sederhana Baru Berkumpul dan Menyatu

„ Alumni SMP Sederhana Baru Tebing Tinggi foto bersama usai reuni ke II di Hotel Pelangi Parapat, Minggu (8/4) . PARAPAT-Alumni SMP Sederhana Baru Tebing Tinggi berkumpul dan menyatu dalam momen reuni khusus Tahun Ajaran 1971. Reuni ke II Tahun 2012 ini selama tiga hari di Pelangi Hotel Parapat,

Jumat-Sabtu-Minggu (6-8/4). Ketua Reuni yang juga Kepala SMA Methodis Indonesia Samsuddin Hua SPd ( Hua Yiu Shen) mengatakan, reuni bertujuan mempererat silahturahmi dan sa-

ling mengenal sesama SMP Sederhana Baru Tahun Ajaran 1971. Apalagi SMP Sederhana Baru telah berubah nama sekolah YayasanPerguruanSMPIrHjDjuanda Tebing Tinggi tentu ada kerinduan

khusus. Diakui kegiatanpertamadigelar di Perguruan Nusantara Tebing Tinggi pada tanggal 15 November 2004, tapi cukup lama, sehingga muncul kerinduan dan bersatu kembali segenap komponen yang selama ini terpisah baik oleh waktu maupun tempat. ReunikeIIitucukupmeriahdan terharu,meskipunacaradihadiri24 alumni dari berbagai kota seperti Jakarta, Medan, Pematangsiantar dan Tebing Tinggi. Dalam acara, seharusnya dihadiri 40 orang alumni, tapi adanya kesibukan masing-masing sehingga mereka tidak menghadiri kegiatan. Begitupun, Samsudin mengharapkan kepada teman SMP Sederhana Baru Tahun Ajaran 1971 terus bersatu dan kegiatan yang sama digelar di Bandung Tahun 2013 mendatang. Acara dihadiri Sekretaris Reuni Xie Sui Yong dan Bendahara Xie Kwang Yi kini sudah pebisnis. (rel/nik)

band terdepan di dunia diwujudkan dengan menyediakan bandwith dengan kapasitas gateway internet internasional dan menggelar jaringan 3G terluas berkualitas terbaik melalui lebih dari 9500 Node B atau BTS 3G yang tersebar di berbagai wilayah Indonesia dari Sumatera hingga wilayah Indonesia Timur. Dari segi inovasi layanan, Voucher Flash Unlimited hadir untuk memberikan kemudahan bagi pelanggan SimPATI dan KartuAS untuk mengkases internet kapan saja dimana saja. Dengan menggunakan Voucher Flash Unlimited pelanggan langsung dapat mengakses internet tanpa melakukan registrasi terlebih dahulu. Pelanggan dapat menggunakan Voucher Flash Unlimited melalui SMS maupun melalui panggilan ke 888, ataupun melalui halaman depan untuk modem dan tablet yang tidak dilengkapi fitur sms. Voucher Flash Unlimited telah tersedia di semua outlet Telkomsel di Indonesia dengan nominal Rp 50,000 dan Rp 100,000,. Voucher Flash Unlimited hanya dikhususnya untuk penggunaan data sehingga tidak dapat digunakan untuk melakukan panggilan maupun SMS. Khusus untuk pelanggan yang menggunakan Voucher Flash Unlimited selama masa promo sampai 31 Mei 2012, akan mendapatkan bonus fair usage sebanyak 25 persen dari total kuota yang dimiliki. 100 kota broadband dengan didukung pembangunan infrastruktur yang menjangkau sampai ke pelosok Indonesia, dan Inovasi layanan yang terus diupayakan dalam memberikan jawaban bagi kebutuhan masyarakat, menjadi bukti nyata upaya Telkomsel menghadirkan layanan broadband kelas dunia yakni Internet Paling Indonesia. (rel/leo)

Nissan Invitation Diproduksi pada 2014

„ Nissan Invitation concept Nissan Motor Co Ltd dan Perdana Menteri Inggris, David Cameron mengumumkan akan memproduksi Nissan Invitation di pabriknya yang berada di Inggris, tepatnya di Sunderland pada pada 2014. Rencana itu diumumkan bersama saat Perdana Menteri Inggris tersebut berkunjung ke markas besar di Yokohama, Jepang dengan Chief Operating Of-

ficer (COO) Nissan Motor, Toshiyuki Shiga. Untuk itu, Nissan akan melakukan investasi baru 127 juta pounsterling ( Rp 1,86 triliun) untuk meningkatkan kapasitas pabrik di Sunderland tersebut. Tak kalah menarik, untuk menopang pertumbuhan regional, pemerintah Inggris memberikan bantuan 8,2 juta poundsterling (Rp 120 miliar) untuk

pabrik baru tersebut. Dengan demikian, nanti pabrik Nissan di Sunderland akan menghasilkan mobil setengah juta unit lebih. Saat ini, pabrik Nissan di Sunderland merupakan satu-satunya perakitan yang memproduksi mobil di atas 400.000 unit. Nissan Invitation model konsepnya diperkenalkan di Geneva Motor Show bulan lalu, merupakan hatcback untuk pasar segmen-B (subkompak). Dijelaskan pula, dengan perluasan pabrik baru menciptakan 3.000 lapangan kerja baru di sektor otomotif Inggris dalam dua tahun ke depan plus 625 pemasok komponen. Saat ini, di pabrik itu diproduksi Qashgai, Note dan Juke. Tahun lalu produksi Nissan di pabrik tersebut mencapai 480-.000 unit. Sekarang lagi mempersiapkan untuk melewati angka setengah juta unit untuk pertama kalinya. (int)



12 April 2012

DitemuiMETRO,Rabu(11/4),H Abdul Rasyid mengaku sengaja datang ke Mapolsek Perdagangan untuk melaporkan Budi, yang sudah berulangkali mencuri buah sawitnya dan warga sekitar. ”Saya dan sejumlah warga mau melaporkan Budi,” katanya. Diceitakannya awal mula kejadian, korban sempat melihat puluhan tandan buah sawitnya hilang dari pohon. Itu diketahui korban saat melihat tumpukan dahan pelepah kelapa sawit di dasar pohon. ”Awalnya kami melihat banyak pelepah kelapa sawit milik Sumarno berserakan di bawah pohon. Dan di pohon, terlihat bekas diegrek. Sementara buah sawitnyasudahtidakada,”katanya. Melihat itu, sejumlah warga ini menaruh curiga terhadap Budi, yang disebut-sebut kerap melakukan pencurian kelapa sawit di perladangan warga. Namun untuk membuktikannya, warga memilih mengintai terlebih dulu aksinya. Sejurus kemudian, sejumlah wargamengendapdiperladangan.

”Begitu kami melihat sawit Sumarno diegrek ninja, kami mengendap dan mencari tahu siapa malingnya. Waktu itu pukul 20.00 WIB, kami mengendap sampai pukul 03.00 WIB,” katanya. Sejurus kemudian, sejumlah wargayangkecewasempatmelihat pelaku melintas dengan membawa sepeda dengan egrek sawit, serta dua goni beras ukuran lima puluhkilogramuntukmengangkut buah sawit hasil curiannya. Melihat itu sejumlah warga mencoba memperhatikan gelagat pelaku selama tiga puluh menit. Hasilnya, pelaku langsung mengarahkan senternya ke atas pohon sawit sembari mengarahkan pisau egreknya ke atas. Lalu pelaku memotongdahankelapasawithingga jatuh. ”Kami lihat pelakunya memotong buah sawit dan kami tangkap dia,” tambahnya. Namun saat disergap warga, pelaku melarikan diri setelah dibebaskan seorang warga. Sementara Kapolsek Perdagangan AKP TP Butar-butar membenarkanlaporanpengaduan. “Pelaku masih dalam pengejaran,” katanya. (mag 02/hez)

Suami Bakar Rumah Sambungan Halaman 8 dasar ini mengalami luka bakar di sekujur tubuhnya dan dirawat di RS Imelda Kota Medan. Ditemui di rumah sakit, istrinya Sri (38) mengatakan, kejadian berawal saat ia membawa Celsea dari rumah suaminya di Jalan Jermal XV. “Kami sudah berpisah empat bulan,” kata Sri membuka pembicaraan. Namun, karena sering mendengar anak bungsunya jarang diberi susu saat sedang bersama suami, membuat ibu beranak tiga ini membawa Chelsea kembali. Puncaknya sekira pukul 21.30 WIB, Adi datang untuk membawa pulang Celsea. Akan tetapi, Sri tak memberikannya. Akibatnya keduanya terlibat cekcok. Merasa kesal, pria yang bekerja sebagai supir mobil box antar kota ini mengambil sebotol bensin dari samping pintu rumah. Ketepatan, orangtua Sri membuka usaha berjualan bensin eceran. “Aku bakar kalian semua ya,” kata Sri mengulang ancaman suaminya. Selanjutnya Adi menyiramkan bensin ke papan rumah orangtuanya dan mengambil mancis yang berada di saku celana. Dengan cepat api langsung membakar rumah. Naas, Kiki yang sedang tertidur pulas di ruang tamu menjadi korban. Pasalnya, api menjalar dengan cepat ke arah bola lampu dan mengenai Kiki. “Si Kiki lagi tidur di ruang tamu, rencananya kami semua mau



Rumah Perawat Dirampok Pria Bersenpi

Curi Sawit, Dipolisikan.. Sambungan Halaman 8


dibakarnya,” katanya, Rabu (11/ 4) siang. Saat ditanya mengenai pisahnya Sri dengan Adi, wanita yang bekerja sebagai kasir botot di dekat Plaza Aksara ini mengaku karena suaminya kerap mabukmabukan dan memakai narkoba. “Kalau minum minuman keras dia jarang, narkobanya ini yang nggak tahan. Kalau dia pakai sabu-sabu, sampai anak-anaknya pun sering dipukulinya. Aku sudah minta cerai, tapi dia (Adired) tetap nggak mau,” jelasnya. Setelah membakar kediaman orang tua Sri dan anak keduanya, Adi mencoba melarikan diri. Namun, warga yang mengetahui aksi main bakar ini berhasil menangkapnya dan sempat dihakimi massa hingga korban babak belur. Tak sampai disitu, setelah puas memukuli Adi, warga lalu menyerahkan tersangka ke Polsekta Medan Timur. Sedangkan korban Kiki langsung dibawa ke RS Imelda guna mengobati luka bakarnya. Sementara Kanit Reskrim Medan Timur AKP Ridwan saat dikonfirmasi mengatakan, setelah mendapat laporan dari masyarakat pihaknya langsung mengamankan tersangka yang kini masih dalam pemeriksaan guna proses lebih lanjut. “Masih kita periksa, kalau nggak cepat kita datang. Sudah habis ini dipukuli massa. Motifnya karena tak dikasih membawa anaknya, itu saja,” tandas perwira tiga balok emas dipundaknya ini. (eza/pmg)

Sambungan Halaman 8 setelah melewati ruang makan sekaligus dapur, ibu beranak empat ini tersentak dan nyaris jatuh pingsan. Di sana ia melihat seorang pria berbadan besar menodongkan senjata api dari jarak dua meter seraya mengancam akan menembak. “Kutembak kau,” ujar Yuni menirukan bahasa pelaku. Aksi itu sontak membuatnya menjerit histeris dan berbalik badan, berlari menuju pintu dapur. Setelah nerada di luar, Yuni langsung teriak dan akhirnya mengundang perhatian warga. Hitungan detik, beberapa warga sekitar berdatangan. Setelah mengetahui adanya pencurian, mereka langsung masuk dan berharap menemukan pelaku. Namun usaha itu sia-sia, sebab tak seorangpun yang pelakunya masih berada di rumah. “Bapak dan ibu sedang bekerja, sedangkan anaknya bersekolah. Bapak kerja di Vita Insani, sedangkan ibu di perusahaan asuransi,” tambahnya. Menurut Yuni, sebelum kejadian pintu garasi rumah dalam keadaan terkunci. Namun menurut pantauan, kunci pintu dari garasi menuju rumah sudah terlihat rusak. “Pelakunya berrambut pendek, cepak dan berbadan

besar. Dia mengenakan kaos hitam dan membawa Televisi Panasonic 42 Inchi layar datar. Lalu Laptop Zyrex serta Hp Blackberry yang semuanya berada di ruang tamu,” ungkap Yuni. Namun Anike br Napitupulu yang coba diwawancarai mengaku belum mengetahui apa saja barang yang hilang dari dalam lemari. Namun begitu sepenglihatannya, lemari sudah dibuka paksa oleh pelaku. Sementara warga sekitar M Butar-butar (28), yang sempat masuk ke dalam bersama dua warga lainnya, tidak menemukan siapapun berada di ruangan rumah. Namun sebelumnya, ia mengaku melihat satu unit mobil sedan berwarna Silver yang parkir sejauh 50 meter dari kediaman korban. “Hanya hitungan menit, tibatiba mobil sudah parkir di teras rumah. Kepala mobilnya mengarah ke luar rumah. Dari dalam mobil, keluar seorang wanita yang mengenakan kemeja hitam dan celana berwarna cream keputihan. Ia juga mengenakan kacamata gelap. Kami sempat mengira wanita itu tamu korban, rupanya mau mencuri,”katanya. Hal senada dikatakan tetangga lainnya br Tampubolon. Dikatakannya, sebelum kejadian, ia sedang

Truk Terjun ke Laut.. Sambungan Halaman 8

melintas di depan rumah korban dan melihat mobil sedan parkir di halaman rumah. “Tadi kami tidak curiga, namanya juga jalan lintas. Tapi aku lihat juga seperti ada kabel terburai keluar lewat pintu, tepat di belakang supir. Mereka pergi ke arah pusat kota,” ucap br Tampubolon. Hasil olah TKP yang dilakukan polisi, pelaku diperkirakan masuk dari dalam garasi lantas merusak kunci pintu yang mengarah ke ruangan tamu rumah. Selanjutnya komplotan ini memboyong harta benda korban, bahkan sempat mengobrak-abrik lemari pakaian di kamar tidur. Karena keburu diketahui pembantu, pelaku langsung kabur. Terkait kejadian, Mualim Girsang serta istrinya Anike br Napitulu mengaku tidak mempunyai masalah dengan seseroang. Baik itu di pekerjaan, maupun bertetangga di rumah. Kuat dugaan, para pelaku sudah mengetahui jam aktivitas mereka di luar rumah. “Syukurlah, pembantu kami tidak apa-apa,” ujar Anike. Dikatakan Annike, selain peralatan elektronik, pelaku juga mengambil perhiasannya berupa cincin senilai Rp10 juta. (mag-1/Mag-5/hez)

Berkas Tersangka Sabung Ayam Dilimpahkan Sambungan Halaman 8 merupakan penyampaian tahap pertama. Jika berkas yang yang disampaikanlengkapdandinyatakan sudah P21, tersangka dan barang bukti akan dilimpahkan secepatnya. Namunjiksamenurutjaksaberkas tersebut belum lengkap dan harus dipenuhi dengan unsur-unsur lainnya, maka pastinya akan dilengkapi penyidik. “Penyampaian berkas tahap pertama sudah kita lakukan. Tepatnyatadi(kemarin)(11/4),sudah diantar ke kejaksaan,” katanya. Sebelumnya 12 tersangka di-

tangkap sedang bermain judi sabung ayam di Huta I Nagori Purba GandaKecamatanPamatangBandar,Simalungun,Kamis(22/3)sore. Penangkapan sempat diwarnai aksi kejar-kejaran di tengah persawahan. Awalnya sekitar 30 orang berkumpul di tanah lapang yang berada di tengah persawahan di lokasi.Tampaklapangandikelilingi beberapa pohon yang tumbuh teduh. Lokasi berjarak 200 meter dari pemukiman warga. Selain itu, jalan menuju lokasi juga terbilang kecil, berupa jalan petak persawahanyanghanyamuatdilaluidua orang saja.

Saat disergap polisi, para tersangkasempatkejar-kejarandengan petugas. Mereka berusaha melarikandiridarisergapan.Akhirnya polisi berhasil mengamankan ke duabelastersangkadenganbarang bukti dua ekor ayam jantan, 1 buah jam dinding, tempat ayam dari plastik, tiga buah keranjang atau songkok ayam, dua kursi, serta beberapa terpal plastik dan kain spanduk. Tak jauh dari lokasi, polisi mengamankan18unitsepedamotor berbagaimerk.Didugasepedamotor ini milik tersangka judi ayam, baik yang ditangkap maupun yang berhasilmelarikandiri.. (hot/hez)

Pelajar STM Diopname Sambungan Halaman 8 GerejaHKBPSukaMakmur,dengan kecepatan tinggi. ”Sayasempatmelihatdiamelintaskencangnaikkreta,lalusepedamotornya menabrak pasir dipinggir jalan itu,” katanya. Sementara,saatkorbanterkapar di tepi jalan, sejumlah warga dan pengendara yang melintas berusaha menolong korban. ”Begitu dia jatuh, sempat menjadi tontonan warga dan pengen-

dara yang melintas. Tak lama kemudian, datang mobil ambulans dan korban dibawa ke UGD RS Harapan,” tambahnya. Keluarga korban yang diberi kabar, langsung datang dan mengevakuasi sepedamotor yang ringsek ke kediamanya. Sementara, korban yang tengah terbaring lemah ini, terlihat menderita luka koyak di bibir, luka gores di leher, serta mata kiri korban lebam dan bengkak. Saat ditemui METRO, orangtua

korbanMangaraSiagian(55)warga Jalan Farel Pasaribu, Gang Jeruk Nipis, mengatakan, sebelum kejadian korban disuruh ke kediaman keluarganya. ”Sebelumnya aku minta dia ke rumah nantulang-nya untuk mengambil kartu keluarga,” katanya. Namunsetelahditungguselama satu jam, korban tak kunjung kembali. Tak lama tetangga korban datang dan memberikabar bahwa korban sudah di RS Harapan. (mag-02/hez)

terperosok ke laut dan tenggelam. Selanjutnyaayahtigaanakinitak bisa keluar. Diduga ia sempat pingsansetelahterbenturstirmobil dan akhirnya tenggelam bersama kontainernya. “Sehari-hari dia mengangkut muatan kapal. Tapi setibanya di pelabuhan, mobilnya tercebur ke laut, dan akhirnya ia meninggal,” ucap Simangunsong. Istri korban Saidah Silalahi,

hanya mampu menangis di mobil. Sebab ia tidak tahan melihat jenazah suami tercintanya yang sudah berpulang itu. “Istrinya di mobil saja. Kalau dia kemari (ruang jenazah), dia bisa histeris, kami nggak mau nanti di rumah sakit jadi ribut,” tandasnya. Riswan sendiri diketahui telah bekerja sebagi supir truk kontainer selama 3,5 tahun di CV Belawan Indah. Ia merupakan tulang punggung keluarga. (cr-3/ hez)

Jurtul & Tukang Rekap.. Sambungan Halaman 8 perjudiandiwilayahhukumPolsek Tanah Jawa. setelah diamankan, dari tangan keduanya, polisi berhasil meyita barang bukti berupa 1 unit Hp Nokia 1280 berwarna hitam, kertas rekap dan uang hasil penjualan sebesar Rp560 ribu. Kini mereka dijebloskan ke sel Mapolsekta Tanah Jawa. Kepada METRO, Marojahan

yang kaki kirinya patah setelah mengalami kecelakaan lalu lintas ini mengatakan, baru satu bulan menjadi penulis togel dan kim. “Hasilnya kugunakan untuk beli rokok dan minum di warung,” katanya. Sementara Kapolsekta Tanah Jawa Kompol B Siallagan yang dikonfirmasi kemarin, membenarkan penangkapan kedua tersangka. (iwa/hez)

Berkelahi Gara-gara Jambar.. Sambungan Halaman 8 bulkan luka pada orang lain. “Terdakwa terbukti secara sah melakukan penganiayaan hingga menimbulkan luka pada saksi korbanMuntirPasaribu.Perbuatan itu dilakukan pada Jumat, 10 Juni 2011,” jelas Jan. Berdasarkan keterangan saksi danterdakwadipersidangan,jaksa meminta kepada hakim untuk menghukum terdakwa empat bulan penjara dikurangi masa tahanan,” sebut Jan.

Sebelumnya, terdakwa melakukan penganiaayan terhadap Muntir saat keduanya bertugas sebagai pekerja di acara pesta pernikahan di Huta Pangkalan Buntu Parluasan. Korban bertugas membagikan daging jambar. Ternyata terdakwa tidak mendapat jambar tersebut dan merasa kesal. Selanjutnya terdakwa mengajak korban berkelahi dan meninju wajah korban berulangkali. Akibatnya darah mengucur dari hidung korban. (mua/hez)

Anak Pensiunan TNI.. Sambungan Halaman 8 hilang. Seperti tilam, kursi dan lukisan dinding. “Dia kos sejak Maret 2012 dengan biaya Rp300 ribu per-bulan. Namun Eva hanya tinggal satu bulan saja. Pada Rabu (4/4), dia keluar dari kos dan tidak pamit kepadapemilikrumah,”kataAgnes (39), putri Adelina. Selanjutnya Adelina serta keluargalainnyamencarikeberadaan Eva. Hingga kemarin, Rabu (11/4), Eva di datangi di rumah temannya di kawasan Gang Kopral. Saat itu Agnes langsung mendatangi Eva danmenyakankeberadaanbarang yang sebelumnya di kamar kos. Namun Eva membantah membawanya. Karena pertengkaran mulut kedua pihak itu, warga pun berdatangan. Tak lama kemudian, Eva dibawa ke Mapolres Pematangsiantar untuk dilaporkan. Sembari menjelaskan peristiwa, Agnes mengatakan bahwa ibunya adalahistridariJahormatDamanik (alm) yang merupakan adik dari JabantenDamanik,mantanBupati Simalungun.

“Waktu itu dia tinggal bersama temannya Jepri. Kami sangat kesal mengetahui barang kami dibawanya. Yang penting barang kami dikembalikan,” ucap Agnes di ruang tunggu Polres. Sementara Eva yang sempat dikonfirmasi, membantah membawa barang-barang dari kamar bekas kos-annya itu. “Bagaiamana mungkin saya seorang perempuan membawa tilambesardankursi?”ucapmembandingkan. Ditambahkannya, satu hari sebelum keluar kos, ia bertengkar dengan Jepri di kamar tersebut. Lalu karena kesal, Eva menysun barang dan membawa kopernya keluar dari kamar. Sejak saat itu ia meninggalkan Jepri di kamar kos. “Aku ini orang Rindam bang, orangtuaku pensiunan Tentara,” ucap Eva yang mengaku bekerja di sebuahlokasikaraokeKotaSiantar. Namun hingga sore, pemeriksaan terhadap Adelina maupun Eva belum selesai. Itu akibat aliran listrik di Polres Pematangsiantar sempat padam. (mag-1/hez)

Sambungan Halaman Satu Karyawan Komplek Megaland Berhamburan Sambungan Halaman 1 berisik karena bergesekan. Para karyawan kembali masuk ke kantor setelah beberapa gempa usai. Jadwal Ferry Aman Sementara, warga dan pengunjung di Parapat, Ajibata dan Samosir, juga berhamburan dari rumah, warung dan halte penumpang Dermaga Kapal akibat getaran gempa yang terjadi sampai 2 kali berdurasi 2–3 menit. Kepala Kelompok Seksi (Kapoksi) Badan Meteorologi Klimatologi dan Geofisika (BMKG) Stasiun Parapat Ganda Matondang kepada METRO mengatakan, terjadi 2 kali setaran gempa terasa di wilayah itu. Getaran pertama pukul 15.38 WIB hingga pukul 15.40 WIB, getaran kedua pukul 17.43 WIB hingga pukul 17.45 WIB. Seperti diketahui, gempa berkekuatan besar terjadi di Aceh dan Sumut. Data Badan Metereologi Klimatologi dan Geofisika (BMKG) tercatat kekuatan gempa 8,5 SR. Sebelumnya BMKG sempat melansir 8,9 SR Gempa terjadi pukul 15.38 WIB, Rabu (11/4). Gempa terjadi di kedalaman 10 Km. Pusat gempa berada di laut dengan kedalaman 10 KM. Titik gempa berada di Simeuleu Aceh Tenggara. Getaran gempa dirasakan sangat kuat di Aceh dan berbagai kota di Sumut dan beberapa daerah lain di Sumatera. Menurut Ganda, getaran di pesisir Danau Toba adalah dampak dari gempa yang terjadi di Aceh. “Itu hasil sementara dan getaran gempa yang terjadi di kawasan pesisir

danau Toba khususnya Ajibata, Tigaraja, Parapat dan Pulau Samosir yang merupakan wilayah yang tetap kita pantau perkembangannya,” katanya. Lurah Parapat Sahat Sihombing, Lurah Tigaraja Nelson Siallagan dan Lurah Parsaoran Ajibata Drs Tigor Sirait ketika dihubungi METRO mengatakan, di wilayahnya belum ada laporan kerugian harta benda dan korban. Namun warga sempat panik dan keluar rumah. “Saya sudah anjurkan kepada warga agar tetap tenang, jangan panik karena pusat gempa sangat jauh dari kita dan keadaan di Kota Parapat sudah kembali normal,” ujar Lurah Parapat. Lurah Tigaraja Nelson Siallagan juga berharap warga tidak perlu khawatir dan tetap melakukan aktifitas dengan baik terutama bagi mereka yang akan menyebrang melalui Pelabuhan Tigaraja ke Sipolha, Panatapan, Tomok, Tuktuk, Ambarita dan Simanindo agar menjalankan rute dan jadwal penyeberangan sebagaimana biasanya. Lurah Ajibata Tigor Sirait turun langsung memantau situasi di Pantai Ajibata memastikan keadaan warganya. “Justru saya yang sempat pusing, saya kira air Danau Toba meluap,” katanya. Di sejumlah dermaga, jadwal penyeberangan tidak ada yang ditunda. “Tidak ada penundaan penyebarangan dan semua berjalan sesuai jadwal,” ujar ABK KMP Feri I dan II Jhony Manik di Pelabuhan Ajibata. Getaran gempa juga terasa di Silou

Kahean, Simalungun, sekitarnya sekitar pukul 15.41. Akibatnya, warga panik dan berhamburan keluar rumah. Suasana semakin riuh saat beberapa orangtua berteriak-teriak memanggil anaknya. Gempa juga membuat les tambahan di SMP Negeri 1 bubar. Seratusan siswa berhamburan keluar kelas. Ervina Saragih, warga Nagoridolok, menceritakan, dia sempat ketakutan saat gempa berlangsung. “Kami sedang belajar les tambahan di sekolah, tiba –tiba meja dan kursi bergoyang, kaca ruangan bergetar. Aku juga merasa pusing. Karna takut, kami berhamburan keluar kelas,” ujarnya. Camat Silou Kahean Belman Saragih belum mendapat laporan kerusakan di wilayahnya. “Belum ada laporan, tapi dilihat dari lamanya gempa dan jauhnya pusat gempa dipastikan tidak ada kerusakan. Hanya warga sempat khawatir dan berhamburan keluar rumah,” ujarnya. Suhul…! Suhul…! Di Kelurahan Tiga Runggu, Kecamatan Purba, warga berhamburan dari rumah dan sebagian warga berusia lanjut berteriak ‘suhul-suhul’. Sekitar pukul 15.00 WIB Rabu (11/4) kemarin, beberapa warga berusia tua dan muda sedang minum di kedai dekat Kantor Lurah Tiga Runggu. Tiba-tiba terjadi goyangan seperti gempa bumi dan dirasakan kuat oleh para penghuni warung. Tanpa dikomando, warga yang ada di dalam warung ini langsung berlarian keluar dan langsung mengumpul di lapangan.

Diantara pengunjung warung hanya bisa saling bertatapan dan saling melihat. Tiang listrik serta beberapa bangunan yang terbuat dari papan dan berupa rumah panggung terlihat bergoyang, namun tidak runtuh. Kejadian ini berlangsung lebih satu menit. “Suhul-suhul (gempa-gempa, red),” teriak salah seorang pengunjung berusia lanjut. Sesudah gempa, pengunjung warung sibuk menelpon keluarga masing-masing. Pembicaraan yang terdengar saat itu, mereka menanyakan kondisi keluarganya. Selain itu terjadi pembicaraan tentang lokasi pusat gempa yang barusan terjadi. “Kalau tidak pusat gempa di Aceh, biasanya di Padang. Dua lokasi ini yang sering gempa,” ujar salah satu warga bermarga Purba. Selain di warung tersebut, warga yang lain juga terlihat berhamburan keluar dari rumahnya masingmasing dan berkumpul dipinggir jalan. Usai gempa, saat METRO berkeliling di kelurahan ini, tidak terlihat satupun bangunan rumah warga dan bangunan -bangunan lain yang rusak. Namun R Sihotang (35) warga kelurahan yang sama memberikan pengakuan berbeda. Menurutnya, dia tidak ada merasakan sedikitpun gempa. Pengakuannya saat terjadi gempa, dia sedang berada di atas sepeda motor (kreta). “Tidak tahu ada gempa, lagi naik kereta tadi. Setelah berhenti dan dikasih tahu sama kawan, baru saya tahu ada gempa,” jelasnya. (rait/hp/mag-1/ral)

Miliaran Rupiah Uang Parkir Diduga Menguap Sambungan Halaman 1 Siantar Rudolf Hutabarat mengatakan, potensi parkir di Siantar sangat diharapkan mendongkrak kenaikan target PAD. Melirik di 300 titik lahan parkir di Siantar dengan setoran parkir mulai Rp30 ribu sampai Rp140 ribu per hari, sebetulnya PAD dari parkir bisa Rp9,18 miliar. Dia mengatakan, jumlah tersebut adalah data yang dilaporkan langsung Dinas Perhubungan unit pengelola parkir kepada DPRD. Kalau ditarif dari nilai setoran rata-rata Rp85 ribu per hari (pembagian dua antara Rp30 ribu sampao Rp140 ribu per hari), dalam sehari retribusi parkir mencapai Rp25,5 juta, dalam sebulan Rp765 juta dan dalam setahun Rp9,18 miliar. “Jumlah itu masih menurut data yang diberikan Dishub kepada DPRD Siantar. Sementara di lapangan ada kita temukan bed nama sampai nomor 402. Itu artinya titik parkir di Siantar sudah mencapai 400-an titik,” katanya. Menurut politisi partai Demokrat ini, tidak pantas target PAD dari perparkiran sampai Rp2,5 miliar. Target itu juga belum belum tentu terealisasi 100 persen. Hal senada diungkapkan Tugiman, anggota komisi 3 DPRD Siantar yang membidangi per-

parkiran. Menurutnya, perparkiran di Siantar sudah selayaknya dibuat limit waktu seperti di kota-kota besar. Dengan konsep tersebut, maka melalui restribusi parkir target PAD dapat dinaikkan. Jika dilirik selama ini, sambung Tugiman, tahun 2010 target PAD sebesar Rp1,2 miliar dan terealisasi Rp700 juta, tahun 2011 target PAD sebesar Rp2 miliar dan terealisasi Rp1,2 miliar, dan target PAD 2012 sebesar Rp2,5 miliar. Artinya, sangat jarang target PAD dari parkir mencapai 100 persen atau melebihi target. Padahal potensinya sangat besar. Menurutnya, untuk mencapai target tersebut, maka pengelolaan parkir harus diserahkan kepada pihak ketiga. Sedikitnya Rp5 miliar akan terealisasi. Namun, undang-undang nomor 28 tahun 2010 melarang pengelolaan restribusi parkir dipihak-ketigakan. Ia sangat menyesalkan bundel karcis parkir yang diminta komisi 3 DPRD Siantar dari UPT Perparkiran tak kunjung diberikan. Bundel karcis parkir tersebut merupakan cara penghitungan restribusi parkir. Anggota komisi 3 DPRD Siantar Prangky Boy Saragih menambahkan, penataan parkir di Siantar juga semrawut. Lokasi parkir menjadi tempat jualan dan trotoar menjadi tempat parkir. (Osi)


Crime Corner




Fakta, Peristiwa dan Hukum

Anak Pensiunan TNI


SIANTARDituding membawa kabur barangbarang dari rumah kos-nya, Eva (34) anak pensiunan TNI yang menetap di Rindam, digiring ke Polres Pematangsiantar, Rabu (11/4) sekira pukul 14.00 WIB. Peristiwa berawal saat Adelina br Siahaan (78) yang disebut-sebut istri dari Jahormat Damanik (alm),

adik mantan Bupati Simalungun, mendadak kaget setelah anak kos-nya Eva sudah tidak menempati kamar di kediamannya, kawasan Jalan Gereja Kelurahan Kristen, Siantar Selatan, pada awal April lalu. Setelah diperiksa, barang-barang di kamar yang banyak yang

„) Baca Anak ..Hal 7

TERBAKAR- Karin Cahya Fatiah, terbaring di RS Imelda Medan setelah tubuhnya terbakar, Rabu (11/4).

Tak Diizinkan Bawa Anak

Suami Bakar Rumah MEDAN- Karena dilarang istri membawa anak bungsunya Celsea (2), seorang bapak bernama Culi Mahadi (41) alias Adi nekad membakar rumah. Namun selanjutnya, bensin yang sengaja disiramkannya menjalan ke arah Karin Cahya Fatiah (12) alias

Kiki, Selasa (10/4) sekira pukul 21.30 WIB. Peristiwa terjadi di Jalan Sidorukun, Gang Sidoeleng, Kecamatan Medan Timur. Hingga kini wanita yang masih duduk di bangku sekolah


(tengah), menangis „ Anike br Napitupulu ata hu i rum ah ny a his ter is be git u me ng . dirampok, Rabu (11/4)


RAMPOKPersonel Sat Reskrim Polres Pematangsiantar melakukan olah TKP di kediaman M Girsang di Jalan DI Panjaitan Kota Siantar. Sebelumnya rumah tersebut dirampok pria bersenpi, Rabu (11/4).

Foto Fando

antu korban yang „ Yuni Hutauruk, pemb pistol dan diancam syok setelah ditodong pokan. tembak pelaku peram

Rumah Perawat Dirampok Pria Bersenpi

SIANTAR- Kediaman Mualim Girsang (53) di Jalan DI Panjaitan Kelurahan Nagahuta, Siantar Marimbun dirampok komplotan yang diduga menggunakan senjata api. Akibat kejadian, perawat anaestesi di RS Vita Insani dan istrinya Annike br Napitupulu (49) kehilangan berbagai barang elektronik dan perhiasan, Rabu (11/4) sekira pukul 11.00 WIB.

Kepada METRO, Yuni Hutauruk (49) yang merupakan pembantu korban mengaku, pelaku berjumlah lebih dari dua orang. Berawal saat ia

sedang mencuci pakaian di belakang rumah sekira pukul 10.30 WIB. Mendadak ia

mendengar suara dari dalam ruangan. Selanjutnya wanita yang sudah bekerja lebih dari dua tahun itu, masuk melalui pintu dapur y a n g terbuat dari besi. Namun



„) Baca Suami ..Hal 7 Foto Faisal

TERCEBUR- Truk kontainer BK 8412 BA dievakuasi dari dalam laut Pelabuhan Belawan, Rabu (11/ 4). Sebelumnya mobil terperosok dan tercebur dan menyebabkan supir tewas.


„ Dua belas tersangka sabung ayam yang diamankan personel Polres Simalungun, Kamis (22/3) lalu.

Berkas Tersangka Sabung Ayam Dilimpahkan RAYA- Berkas 12 tersangka judi sabung ayam yang ditangkap di Kerasaan, Kamis (22/3) lalu, sudah dilimpahkan ke Kejaksaan Negeri Simalungun. Namun untuk kepastian berkas diterima atau dikembalikan, masih menunggu dari

jaksa. Hal itu dikatakan Kasat Reskrim Polres Simalungun AKP M Adenan AS kepada METRO Rabu (11/4). Menurutnya, berkas yang disampaikan itu

„) Baca Berkas ..Hal 7

Truk Terjun ke Laut, Supir Tewas Tenggelam MEDAN- Riswan Simangunsong (35) warga Jalan Bawal XV Martubung, tewas di dasar laut setelah truk kontainer BK 8412 BA yang dikendarainya terperosok masuk air laut di dermaga Pelabuhan Belawan, Rabu (11/4) sekira pukul 01.00 WIB. Informasi yang dihimpun dari abang korban L Simangunsung (40), sebelum kejadian, Riswan pamit kepada istrinya Saidah Silalahi (30) untuk bekerja seperti biasa. Dimana ia melansir muatan yang dikirim dari kapal ke dermaga Pelabuhan Belawan. Namun saat Riswan dan beberapa rombongan mobil lainnya tiba di dermaga, mendadak mobil yang dikemudikan Riswan

„) Baca Truk ...Hal 7

Berkelahi Gara-gara Jambar, Dituntut Empat Bulan

SIMALUNGUN- Jumarim Malau, warga Huta Pangkalan Buntu Parluasan, Kelurahan Sarimatondang, Kecamatan Sidamanik, dituntut empat bulan penjara oleh jaks a, Rab u (11/ 4) seki ra siang, di Pengadilan Negeri Simalungun. Terdakwa terbukti secara sah dan meyakink an mel aku kan tind ak pidana melanggar pasal 351 KUHPidana.

Sidang kasus penganiayaan ini dipimpin majelis hakim Gabe Doris beranggotakan Irwansyah dan Monalisa, dengan Jaksa Penuntut Umum (JPU) Jan Maswan Sinu rat. Dal am tun tutannya Jan Maswan mengatakan, terdakwa terbukti secara benar melakukan penganiayaan hingga menim-

„) Baca Berkelahi ..Hal 7

CURI SAWIT, DIPOLISIKAN TETANGGA SIMALUNGUN- Diduga mencuri enam janjang TBS (Tandan Buah Segar) sawit milik tetangga, Budi (42) warga Huta Bayu, Nagori Bandar Masilam II, Kecamatan Bandar Masilam, Simalungun, dipolisikan, Rabu (11/4). Korbannya adalah H Abdul Rasyid (50) dan Sumarno (42),

keduanya sepakat melaporkan dugaan pencurian itu ke kantor polisi. Sebab Budi dituding mencuri buah sawit dari ladang mereka di Dusun Perhutaan Bagal, Nagori Bandar Silau, Kecamatan Bandar Masilam.

„) Baca Curi ..Hal 7

Disuruh Ambil KK, Tabrak Gundukan Pasir

Pelajar STM Diopname SIANTAR- Azkiel Siagian (16), pelajar kelas dua STM Persiapan Kota Siantar, terkapar di Jalan Parsoburan Kelurahan Sika Makmur, Siantar Marihat, Rabu (11/4) sekira pukul 19.30 WIB, Itu setelah sepedamotor Honda Supra tanpa plat yang ditungganginya menabrak gundukan pasir di tepi jalan. Menurut saksi mata Niko (24), ia sempat melihat koban melaju dari arah Jalan Parsoburan menuju

„) Baca Pelajar ...Hal 7

Foto Irwansyah

DITANGKAP- Jurtul dan tukang rekap togel yang ditangkap dan diamankan di Mapolsek Tanah Jawa, Rabu (11/4).

Jurtul & Tukang Rekap DITANGKAP TANAH JAWA- Meski harus pakai tongkat karena kaki kirinya patah, tak mengurangi semangat tersangka Marojahan Hamonangan Sinaga (50) warga Huta III Nagori Silakkidir, Kecamatan Hutabayuraja untuk menjadi jurtul togel. Namun aksinya itu tak berlangsung lama, sebab Sabtu ( 7/4) sekira pukul 21.00 WIB, ia di-

ringkus personel Unit Reskrim Polsekta Tanah Jawa. Tak hanya itu, pada hari yang sama polisi juga mengamankan tukang rekap bernama Hisar Purba. Penangkapan keduanya berdasarkan informasi masyarakat yang resah dengan aksi

„) Baca Jurtul ...Hal 7

KAMIS 12 April 2012 Halaman 9

Pensi SMAN 4, Siswa Bawa Golok

Nyaris Tawuran dengan Sekolah Lain SIANTAR- Siswa SMAN 4 nyaris tawuran dengan siswa sekolah lain di Jalan Thamrin, tepatnya di depan kursus Bahasa Inggris Khalsa, Rabu (11/4) sekira pukul 16.40 WIB. Peristiwa itu terjadi saat SMAN 4 sedang mengelar pentas seni (pensi) sekaligus perpisahan kelas 3. bahkan, seorang siswa kedapatan membawa golok.


Informasi dihimpun METRO, peristiwa itu berawal karena saling ejek antar geng. Lawan siswa SMAN 4 yang nyaris tawuran itu adalah salah satu band tamu yang sengaja diundang panitia. Band tamu itu adalah gabungan siswa dari beberapa sekolah di Siantar. Saat band tamu tersebut sedang tampil di atas panggung, salah seorang teman dari band tamu tersebut saling ejek dengan siswa SMAN 4 bernama Jhon. Usai band tamu

BENTROKSiswa SMAN 4 nyaris bentrok dengan puluhan siswa yang tergabung dari beberapa sekolah saat digelarnya PEnsi SMAN 4 Pematangsiantar, Rabu (11/4).

tersebut tampil satu lagu, Jhon ditarik keluar dari komplek SMAN 4. Spontan acara pensi sekaligus perpisahan itu pun berhenti sejenak, karena melihat Jhon ditarik sejumlah siswa yang bukan murid SMAN 4 ke Jalan Thamrin. Siswa yang tadinya foto-fotoan, duduk berkelompok sesuai kelasnya dan guru-guru berhamburan keluar sekolah hendak melihat apa yang terjadi. Di depan kursus Khalsa, aksi bentrok nyaris terjadi. Tiba-tiba,

Baca Pensi Hal...10

Listrik Sering Padam


Kerusakan Jaringan Tegangan

Diminta Lebih ke Simalungun

S I A N T A R Belakangan ini listrik mulai sering padam di beberapa lokasi di Pematangsiantar, seperti di sekitar DI Panjaitan, Jalan SKI, Jalan Wahiding, Jalan Sutomo, Jalan Ade Irma, sekitar BDB dan beberapa lokasi lainnya. Pihak PLN menyatakan, pemadaman terjadi karena adanya kerusakan jaringan tegangan. Marintan Manulang, warga Jalan SKI mengatakan, dalam sebulan ini listrik di daerah mereka sering padam. “Biasanya padam mulai pukul 07.00 WIB hingga pukul 11.00 WIB. Bahkan dalam sehari listrik padam hingga berulang kali,” ujarnya. Dia juga mengeluhkan, dengan pemadaman tersebut seluruh aktifitas sangat terganggu dan terbengkalai. Apalagi listrik mati dalam sehari

SIMALUNGUN- Pembagian dana Corporate Social Responsibility (CSR) PTPN IV seharusnya diprioritaskan di Kabupaten Simalungun. Hal ini sangat beralasan mengingat sebagian besar lahan perkebunan PTPN IV berada di kabupaten ini. Secara khusus kiranya dana CSR juga dapat dialokasikan kepada sektor pendidikan seperti beasiswa untuk pelajar kurang mampu dan juga kepada mahasiswa yang berprestasi asal Kabupaten Simalungun. “Sangat wajar kalau dana CSR PTPN IV dialokasikan lebih besar di Kabupaten Simalungun. Artinya, masyarakat Kabupaten Simalungun harus

Pardomuan Simanjuntak maksimal ikut menikmati keuntungan perkebunan itu,“ ujar St Marja RH Purba SH, Wakil Ketua Partuha Maujana Simalungun Kabupaten Simalungun,

Baca Diminta Hal...10

Baca Kerusakan Jaringan Hal...10

Hangatnya Isu Ruilslag SMAN 4

Itu Cagar Alam yang Tidak Bisa Diganggu SIANTAR- Isu ruilslag SMAN 4 Jalan Pattimura menjadi pembicaraan hangat warga dan politisi di Pematangsiantar. Namun, pihak sekolah menepis isu tersebut dan menyebut SMAN 4 ibarat cagar alam yang tak bisa diganggu. Mereka juga mengaku pihaknya tengah sibuk mempersiapkan diri menuju sekolah unggulan. Demikian diungkapkan Kepala SMAN 4 Helmi, Rabu (11/4). Dia mengatakan, SMAN 4 adalah bangunan cagar alam yang tidak bisa diganggu. Menurutnya, soal isu ruilslag adalah ulah orang yang tidak ingin SMAN 4 menjadi sekolah unggulan sehingga orang tersebut mencoba membuat situasi buyar dan tidak kondusif. “SMAN 4 ini seperti cagar alam yang tidak bisa diganggu gugat,” tegas Helmi. Menurut Helmi, pihak sekolah tidak tau menahu tentang isu ruilslag tersebut. katanya,

Baca Itu Cagar Hal...10



DISAMBUT- Bupati Simalungun JR Saragih dan dr Erunita JR Saragih beserta Ketua DPRD Simalungn Binton Tindaon dan rombongan disambut dengan Tortor Dihar.

DAFTAR- Ketua dan Sekretaris LSM Institut Trias Politika RI saat mendaftar di Kesbangpol Linmas Pemko Siantar, Rabu (11/4).

SIMALUNGUN- Bupati Simalungun DR JR Saragih SH MM mengajak seluruh elemen masyarakat di Kabupaten Simalungun bersama-sama mendukung, mencintai dan melestarikan Budaya Simalungun. Ajakan tersebut disampaikan JR Saragih saat menghadiri Malam Pesona Kesenian Budaya Simalungun di lokasi Pekan Raya Sumatera Utara (PRSU) Medan, Selasa (10/4). Acara dihadiri seribuan masyarakat Simalungun khususnya dari Kabupaten Simalungun dan Sumatera Utara umumnya. Dalam kesempatan itu, bupati mengatakan,

Partai Nasdem Siap Hadapi Verifikasi

kebudayaan Simalungun merupakan warisan dan harta yang tak ternilai harganya. Karenanya, Budaya Simalungun dapat dijadikan sebagai contoh dalam kehidupan, khusunya bagi generasi muda agar tetap mencintai budayanya terutama menghadapi kemajuan era globalisasi ini. JR Saragih juga menekankan kepada seluruh pejabat di Pemkab Simalungun dan instansi terkait agar meningkatkan kinerjanya dalam

SIANTAR- Dewan Pimpinan Derah (DPD) Partai Nasdem Kota Pematangsiantar telah selesai menyusun struktur kepengurusan mulai dari tingkat DPD dan DPC di delapan kecamatan. Menyusun struktur kepengurusan ini sebagai persiapan menghadapi verifikasi KPU terhadap partai politik yang baru ini. Demikian diungkapkan Ke-

Baca JR Hal...10

tua DPD Partai Nasdem Pematangsiantar Lingga Napitupulu, Rabu (11/4). Untuk kepengurusan DPC, ada beberapa pergantian yang harus dilakukan. Pergantian ini karena yang lama dinilai tidak mampu melengkapi persyaratan sesuai dengan target dan tenggat yang diberikan oleh DPP dan DPW

Baca Partai Hal...10

Institut Trias Politika RI

Ciptakan pemerintahan yang Bersih SIANTAR- Kesejahteraan bagi masyarakat belum terlaksana. Penyebabnya, menyimpangnya pelaksanaan tugas oleh para pejabat negara. Dengan begitu, Lembaga Swadaya Masyarakat (LSM) Institut Trias Politika hadir untuk melakukan pengawasan terhadap kinerja pemerintah demi menciptakan Indonesia yang adil dan bermartabat. Demikian harapan yang disampaikan Ketua LSM Institut Trias Politika Republik Indonesia wilayah Siantar-Simalungun Jekson Hutahaean usai mendaftar ke Badan Kesatuan

Bangsa, Politik dan Perlindungan Masyarakat (Kesbangpol Linmas) Pematangsiantar, Rabu (11/4). Jekson mengatakan, LSM ini telah hadir di berbagai wilayah di Indonesia, bahkan sudah sampai ke tingkat kabupaten/ kota. Dia menyampaikan, kinerja apratur pemerintah harus benar-benar diawasi demi tegaknya undang-undang. “Masih sangat banyak kinerja pemerintah yang berjalan di luar aturan yang ada, khususnya di Siantar-Simalungun.

Baca Ciptakan Hal...10

Nurganti Saragih

Menjabat di Banyak Daerah Baca Menjabat Hal...10




April 2012




Pensi SMAN 4, Siswa Bawa Golok

Sambungan Halaman 9 Jhon mengeluarkan golok dengan panjang sekitar 30 cm bergagang kayu. Belum melayangkan goloknya, para

siswa yang bukan murid SMAN 4 itupun berlarian ke arah Jalan Cokroaminoto. Berselang setengah jam kemudian saat murid SMAN 4 sudah masuk ke

komplek sekolah hendak melanjutkan acara pensi yang belum selesai, siswa dari beberapa sekolah Siantar itu datang lagi ke depan SMAN 4 menantang memegang kayu dan batu. Saat itu pun

polisi dari Polres Siantar datang dan membubarkan massa tersebut. Jhon, siswa yang membawa golok saat ditanyai METRO tidak mau berkomentar banyak. “Mereka yang

anggar massa. Karna sudah lebih banyak massa saya berlariannya orang itu,” ujar Jhon. Guru-guru yang dimintai komentarnya mengaku tidak mengenal

Jhon. Mereka mengatakan sedang mencari siswa yang bernama Jhon. Kalau memang nanti membawa golok, para guru SMAN 4 tersebut berjanji akan menyitanya. (osi/ara)

Ciptakan pemerintahan yang Bersih

Diminta Lebih ke Simalungun

Sambungan Halaman 9

Sambungan Halaman 9

Dan di sinilah diharapkan peran LSM untuk menggagalkan penyimpangan itu,” ujar Jekson didampingi Sekretaris Irawan Purba. Lebih lanjut mereka menyampaikan, LSM Institut Trias Politika berdiri sejak Agustus 2010 di Jakarta dengan Ketua Ambar Chrisdiana. “Seluruh jajaran dari pusat hingga ke daerah berkomitmen kuat menciptakan pemerintahan yang bersih. Jika ada penyimpangan, kami akan sekuat tenaga menyeretnya sampai ke tangan hukum,” tambah Jekson. Katanya, adanya jaringan kuat antara LSM ini dengan Komisi Pemberantasan Korupsi (KPK) diharapkan menjadi suatu kekuatan besar

untuk menjerat para pejabat negara yang berjalan di luar peraturan yang ada. Jekson juga mengharapkan dukungan masyarakat dalam meberikan informasi adanya pelanggaran dalam pemerintahan. “Kita sangat mengharapkan dukungan masyarakat. Jika ada pelanggaran, ayo informasikan dan kita akan laporkan kepada penegak hukum,” ajaknya sembari menerangkan, sekretariat berada di Jalan Surabaya Nomor 3, Kelurahan Dwikora, Kecamatan Siantar Barat, atau di nomor telepon 0622-434037. Selanjutnya, mereka juga berencana mendaftar ke Kesbangpol Linmas Pemkab Simalungun pekan depan. (ara)

Menjabat di Banyak Daerah Sambungan Halaman 9 WANITA kelahiran Pematangsiantar, 1 Oktober 1945 ini adalah Ketua Pengadilan Tipikor PN Jogjakarta. Selama 40 tahun mengabdi, Nurganti sudah malang melintang di wilayah Indonesia. Dia sempat menjabat Cakim di PN Jakarta Utara Timur, Hakim Pengganti di PN Sukabumi, Hakim Yustisial di Mahkamah Agung RI, Hakim di PN Tangerang, Hakim di PN Bogor, Wakil Ketua di PN Sukabumi, Hakim di PN Jakarta Barat, Hakim Tinggi di PT Tanjung Karang, Wakil Ketua di PT Jambi, Wakil Ketua di PT Yogyakarta, Wakil Ketua di PT Bandung, Ketua di PT Yogyakarta, dan kini Ketua di Pengadilan TIPIKOR Tk Banding PT Yogyakarta. Nurganti adalah lulusan SR-SMA dari Pematangsiantar, kemudian melanjut ke Universitas Indonesia F a k u l t a s Hukum, dan mengambil S2 Sekolah Tinggi Ilmu Hukum IBLAM. Dia juga telah melalui banyak pelatihan dalam bidang hukum, seperti Penataran Tingkat Kotamadya Daerah

Tingkat II Sukabumi, Penataran Singkat Proyek Pengembangan Tehnis Yustisial Penemuan Hukum dan Pemecahan Masalah Hukum Jakarta, Penataran Peradilan Tata Usaha Negara bagi Para Hakim Karyawan Eselon V, IV dan III serta Panitera Pengganti Tangerang, Pengawasan Penyelenggara Pemeriksaan SEPADYA Jakarta, Pelatihan Hak Atas Kekayaan Intelektual bagi para Hakim Angkatan II Tahun Anggaran 1999/2000 Jakarta, Pelatihan Teknis Yustisial Peningkatan Pengetahuan Hukum Hakim Peradilan Umum Bandung, Pembinaan/Koordinasi dan Konsultasi Pengawasan Mahkamah Agung RI Bogor, Rapat Kerja Dalam Rangka Penyelenggaraan Pemeriksaan dan Pengawasan Badan Pengawas Mahkamah Agung RI dengan Wakil Ketua dan Hakim Pengadilan Tingkat Banding Yogyakarta, dan Diskusi Kekompakan Terarah Penelitian Tinjauan Tentang Tindak Pidana terhadap Kebebasan Menyampaikan Pendapat dalam RUU KUHP. (int)

Partai Nasdem Siap Hadapi Verifikasi Sambungan Halaman 9 Partai Nasdem Sumatera Utara. Mantan Ketua DPRD Siantar ini mengungkapkan, Partai Nasdem telah membenahi kantor DPD dan DPC. Di samping sebagai persyaratan untuk verifikasi KPU, pembenahan kantor ini juga bertujuan lebih mendekatkan partai dengan masyarakat, khususnya masyarakat yang ingin bergabung dengan Partai Nasdem, baik menjadi anggota maupun simpatisan. Adapun mereka para ketua DPC di delapan kecamatan antara lain, Ketua PDC Siantar Utara Anka Azhari Siregar Ritongah SE, Ketua DPC Siantar Martoba Sugimin, Ketua DPC Siantar Sitalasari Antonius Barus, Ketua DPC Siantar Selatan Budi Indra, Ketua DPC Siantar Timur Drs T Sihaloho,

Ketua DPC Siantar Barat Henky Winata, Ketua PDC Siantar Marihat Rustam Sianipar dan Ketua DPC Siantar Simarimbun Drs Marappun Sihombing. “Dengan selesainya penyusunan kepengurusan dan pembenahan, Partai Nasdem Kota Pematangsiantar siap untuk diverifikasi KPU,” kata Lingga. Lanjut Lingga, saat ini pengurus dan kader secara terus menerus melakukan konsolidasi untuk menjalin dan membangun kerja sama dengan dilandasi oleh semangat restorasi untuk melakukan gerakan perubahan demi tercapainya kesejahteraan rakyat dan kejayaan bangsa Indonesia. Dan target Partai Nasdem adalah memperoleh suara terbanyak dan menjadi pemenang dalam pemilu 2014. (osi/ara)


DUDUK BERSAMA- Kepala SMAN 4, Helmi dan komite Jansen Napitu duduk bersama saat mengikuti acara pensi sekaligus perpisahan kelas 3 SMAN 4.

Itu Cagar Alam yang Tidak Bisa Diganggu Sambungan Halaman 9 pihak sekolah, guru, komite dan pegawai sedang bersiap-siap menuju SMAN 4 menjadi sekolah unggulan. Salah satu syaratnya, yakni mempersiapkan guru professional, sedikitnya 70 persen sudah tersertifikasi. “Menghadapi itu pihak sekolah mengadakan workshop membahas program kerja dan peningkatan mutu pelajaran, mempersiapkan kurikulum nasional, mempersiapkan muatan lokal sesuai daerahnya,” ujarnya didampingi Komite Jansen Napitu. Lebih lanjut dia menyampaikan, perbaikan gedung, sarana dan prasarana sekolah telah diajukan ke Dinas Pendidikan untuk dilengkapi. “Menuju sekolah unggulan dipersiapkan dari tahun ajaran baru

mendatang. sampai 3 tahun ke depan, diharapkan tuntas dan terwujudlah SMAN 4 menjadi sekolah unggulan,” katanya. Jansen Napitu komite SMAN 4 menambahkan,tidakadalaranganletak sekolah itu di pusat kota, malah kalau di pusat kota lebih cocok dan strategis. “Kalau dilihat di kota-kota besar, ratarata sekolah unggulan letaknya di pusat kota,” ujarnya. Kata Jansen, data-data ruilslag sebelumnya pun hanya rekayasa. “Kalau Rencana Tata Ruang Wilayah (RTRW) menyatakan bahwa sekolah tidak layak di pusat kota, itu adalah kebodohan DPRD yang mengesahkannya. Tidak pernah ada aturan yang menyalahkan sekolah di pusat kota. Walaupun RTRW menyatakan tidak memperbolehkan

sekolah di tengah kota, kami akan terus memperjuangkan. Kami cinta sekolah ini,” tegasnya. Terpisah, anggota DPRD Siantar, Saut Simanjuntak mengatakan bahwa dari segi RTRW, sekolah tidak pantas letaknya di pusat kota. Jadi kalau bertahan dengan menopengkan menuju sekolah unggulan, masih perlu pengkajian. Pertama seleksi siswa yang sudah harus ketat dibarengi seleksi guru. Kemudian fasilitas sekolah, bobot guru dan tipe bangunan harus standard sekolah unggulan. “Pada intinya sekolah tidak layak di RTRW. Kalau Pemko menyatakan SMAN 4, sekolah ungguan biarlah Pemko mengatakan itu. Kalau saya mengatakan itu tidak sekolah unggulan. Malu kita bilang sekolah unggulan itu,” tegasnya. (Osi/ara)

JR: Cintai dan Lestarikan Budaya Simalungun Sambungan Halaman 9 memeperkenalkan kesenian dan kebudayaan Simalungun kepada para generasi muda, sehingga kekayaan sejarah ini terus melekat di hati mereka melalui berbagai kegiatan. “Pemkab Simalungun akan memberikan dukungan bagi masyarakat maupun pemuda yang peduli terhadap kemajuan kesenian dan kebudayaan Simalungun,” tegas JR Saragih. Kegiatan malam pesona budaya Simalungun ini diawali dengan pagelaran Tortor Sombah yang dibawakan putri-putri cantik dari Yayasan Sauhur. Lalu penampilan Opera Parjabu Parsapan oleh Ikatan Mahasiswa Simalungun Universitas Sumatera Utara (IMAS-USU) dan penampilan Toping-Toping, HudaHuda serta tari Haroan Bolon tari-tarian Simalungun lainnya dari Himpunan Mahasiswa Pemuda Simalungun (HIMAPSI). Penampilan seni Budaya

Simalungun tersebut mendapat sambutan yang meriah dari para pengunjung yang hadir. Sebelumnya, Ketua DPRD Simalungun Binton Tindaon Spd mengatakan, masyarakat Simalungun harus menjunjung tinggi dan meneladani budaya Simalungun. Katanya, di tengah-tengan kemajuan teknologi saat ini, banyak generasi muda Simalungun yang mulai meninggalkan budayanya. Untuk itu, dengan diselenggarakannya pentas seni Budaya Simalungun ini, diharapkan masyarakat dan generasi muda dapat lebih mencintai budaya Simalungun. Mewakili Partuha Maujana Simalungun (PMS) Japaten Purba dalam sambutannya mengucapkan terima kasih kepada pemerintah dan masyarakat Simalungun yang turut mensukseskan acara Malam Pesona Budaya Simalungun tersebut. “Khusus kepada generasi muda Simalungun kami ajak untuk lebih giat

dalammempelajaribudayaSimalungun agar budaya Simalungun dapat tetap berkesinambungan di masa yang akan datang,” ajaknya. Ketua Yayasan PRSU Panusunan Pasaribu dalam sambutannya menyampaikan, acara Malam Pesona Budaya Simalungun ini juga dapat dijadikan sebagai ajang marsombuh sihol (melepas rindu, red). “Acara ini diharapkan dapat memotivasi dan menimbulkan semangat untuk membangun Kabupaten Simalungun. Seluruh masyarakat, tokoh adat dan pemerintah harus bersama-sama membangun Kabupaten Simalungun menjadi lebih baik,” tegas Panusunan. Tampak hadir dalam acara tersebut UspidaPlusSimalungun,parapimpinan SKPD dan camat di jajaran Pemkab Simalungun, para pengurus Partuha Maujana Simalungun (PMS), lembaga/ dinas/instansi Pemprovsu dan para pengunjung PRSU. (mer/rel/ara)

Kerusakan Jaringan Tegangan

Sambungan Halaman 9

hingga tiga jam. “Apalagi yang bisa kita lakukan kalau listrik sudah padam. Padahal saat ini seluruh pekerjaan dan aktifitas rumah tangga sudah memanfaatkan listrik,” sebutnya. Dia juga mengharapkan pihak PLN seharusnya menerapkan waktu bergilir dalam pemadaman, jangan memakan waktu cukup lama. Sementara, warga Pematang, Sri Winda mengaku di daerahnya juga hampir setiap hari listrik padam.“Jikamemangadakerusakanatau perbaikan, sebaiknya diberitahukan

kepada masyarakat. Kalau seperti ini setiap hari, barang-barang elektronik menjadirusak.Seandainyadiberitahukan, masyarakatbisaantisipasiuntukmenjaga barang-barangnya yang mudah rusak akibatlistrikseringpadam,”terangnya. Dia juga mengaku, selain pekerjaan rumah tangga terganggu, pekerjaan di kantor juga terbengkalai. Tugas-tugas yang biasanya dikerjakan dengan komputer juga menjadi terbengkalai. Sementara Humas PLN James Sirait menyebutkan, mereka sudah melakukan monitoring langsung ke lapangan.Darihasilmonitoringternyata

ada kabel PLN yang rusak di sekitar rumahdinasKorem022diJalanAsahan. “Kita sudah memperbaiki kabel tersebut hingga malam hari. Kita meminta maaf kepada masyarakat bahwa kenyamanan menjadi terganggu. Kita akan tetap mengupayakan memberikan pelayanan yang terbaik,” jelasnya. Katanya, salah satu penyebab listrik padam belakangan ini juga karena kerusakan jaringan tegangan terganggu akibat cuaca. “Maklum saja, belakangan ini cuaca sedang musim penghujan, sehingga jaringan tegangan ikut terganggu,” ujarnya. (mua/ara)

Rabu (11/4). Sementara itu Ketua Umum KONI Kabupaten Simalungun Pardomuan Nauli Simanjuntak SH juga berharap, PTPN IV juga memberi perhatian dalam rangka peningkatan prestasi olahraga di Kabupaten Simalungun. Karenanya, seharusnya PTPN IV menyisihkan dana CSR untuk pembinaan olahraga di kabupaten ini. “KONI Simalungun dalam waktu dekat akan beraudensi kepada Direksi PTPN IV untuk membicarakan hal tersebut,“ ujar Pardomuan Simanjuntak didampingi Sekretaris Drs Ulamatuah Saragih. Pardomuan juga berharap, Direksi PTPN IV sebagai Dewan Penyantun KONI Kabupaten Simalungun menjadi “bapak angkat” beberapa cabang olahraga di kabupatenini.Halinisangatberalasansebabpembinaan olahraga bukan hanya tanggung jawab pemerintah kabupaten. ”Harus disadari bahwa untuk pembinaan olahragaa itu memerlukan dana yang cukup besar, sementara kemampuan pemerintah kabupaten menyediakan anggaran melalui APBD masih terbatas,” ujarnya. Sebelumnya, Ketua Komisi C DPRD Sumut Marasal Hutasohit mengatakan bahwa dana CSR yang digelontorkan ke masyarakat sangat minim sekitar 3-5 persen. Dana CSR itu pun belum merata ke tengahtengah masyarakat atau terkesan hanya orang-orang tertentu saja, sehingga kerap memunculkan persoalan sosialantararakyatdenganperusahaan.“Sejauhini,dana CSR masih minim, tidak sebanding dengan luasan areal PTPN IV yang wilayahnya mencakup sejumlah kabupaten,” kata Marasal Hutasoit dalam rapat dengar pendapat (4/4) yang berlangsung di ruang rapat Komisi C DPRD Sumut di Medan, Rabu pekan lalu. Rapat yang dipimpin Ketua Komisi C DPRD Sumut Marasal Hutasoit didampingi anggota komisi lainnya. Sementara dari PTPN IV selain Direktur Utama Erwin Nasution juga dihadiri jajaran direksi yang baru dilantikdan. Turut hadir juga Kepala Humas Lidang Panggabean. Dalam rapat ini juga banyak mendapat aplaus atas kinerja PTPN IV selama ini dari anggota DPRDSU yang hadir, baik dari kinerja maupun keberadaan perusahaan ini di tengah-tengah masyarakat. Politisi Partai Damai Sejahtera (PDS) itu berharap, sebagai Dirut PTPN IV yang baru, Erwin Nasution beserta jajarannya dapat terus mengoptimalkan dana CSR kepada masyarakat dan meningkatkan kinerjanya. Saat ini, berdasarkan laporan, PT PTPN IV Medan tahun2012mengalokasikandanasekitarRp45miliaratau tigasampailimapersendarilababersihtahun2011sekitar Rp900miliar.DanaCSRBUMNperkebunanyangberbasis di Sumut itu meningkat seiring dengan meningkatnya laba bersih perseroan menjadi sekitar Rp900 miliar. Sebagian dari laba bersih itu (3-5 persen, red) disisihkan sebagai dana tanggung jawab sosial perusahaan. Menurut Marasal, presentase (3-5 persen) itu belum memadai, meningat kenaikan yang terjadi pada laba perusahaan cukup besar. “Kisarannya, harusnya lebih dari angka tersebut, dengan mengingat cakupan wilayah kerja PTPN IV itu meliputi Kabupaten Serdang Bedagai, Simalungun dan Asahan. Sementara Erwin Nasution dalam paparannya menjelaskan, dari dana Rp105 miliar yang disalurkan dalam bentuk CSR, paling besar dialokasikan untuk program bina lingkungan, yakni membangun sarana dan prasarana di sekitar kebun yang diuasahai PTPN IV. DirutPTPNIVyangbaruinimengatakan,programbina lingkungan lebih ditujukan kepada program membantu masyarakat di sekitar kebun, mulai dari pembangunan prasaranadansaranayangdiajukanolehmasyarakatdan program yang terkait dengan kebutuhan masyarakat petani di sekitar kebun, seperti program bina lingkungan serta juga termasuk perbaikan sarana ibadah seperti mesjid dan gereja. Sebagian besar bantuan yang disalurkan bukan berupa dana tunai, namun langsung menyangkut kebutuhan masyarakat. Dia mencontohkan, di Kabupaten Simalungun (lokasi ring satu kebun PTPN IV) banyak diberikan bantuan traktor tangan dan kebutuhan petani lainnya. Erwin Nasution juga tak lupa meminta dukungan dari semuapihak,takterkecualianggotaDPRDSU,mengingat tantangan yang dihadapi semakin besar. “Untuk membesarkan perusahaan ini, kita juga melihat masih terdapat peluang untuk menggali potensi dalam meningkatkan produksi, produktifitas serta efesiensi di PTPN IV,” ujar Dirut. (rel/ara)




April 2012

Praktik Aborsi



Aktivis Perempuan

Aksi Bugil di Tempat Ibadah KIEV – Maraknya parktik aborsi terhadap perempuan, para aktivis perempuan dari kelompok FEMEN melakukan aksi bugil di tempat ibadah Kota Kiev. Sebanyak lima orang aktivis FEMEN memanjat ke balkon tanpa busana. Mereka mendesak Pemerintah Ukraina agar melarang praktik aborsi karena dianggap melanggar hukum dan rentan kematian perempuan. Masa aksi membawa spanduk bertulisan “Stop Praktik Aborsi”. Tempat ibadah tersebut terdapat di pusat Kota Kiev dan menjadi perhatian banyak warga. Kepolisian langsung bertindak saat mereka melihat lima orang perempuan pirang yang bertelanjang dada itu. Empat orang aktivis diciduk ke kantor polisi, namun satu orang berhasil melarikan diri, Rabu (11/4). Aktivis FEMEN tak sungkansungkan untuk bertelanjang dada di saat hawa dingin menyelimuti Ukraina. Mereka juga sudah terkenal dengan aksi protesnya yang bermotif politik di seluruh negara Eropa. Kebanyakan dari para aktivis itu ditahan dan akhirnya dibebaskan. Meski demikian, pada saat FEMEN melakukan unjuk rasa di Belarus, mereka dihadapkan dengan kelompok intelijen. Kelompok intelijen itu dikabarkan menculik para aktivis dan mengancam akan mencukur habis rambut para aktivis dengan menggunakan pisau. (oz)


„ Seorang wanita ini saat menggunakan kosmetik menghabiskan Rp 6 Triliun.

Wanita Australia

Habiskan Rp6 Triliun untuk Kosmetik

„ Aktivis FEMEN ketika melakukan aksi protes aborsi di

YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 / bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari YAYASAN MAHAGA SEJAHTERA: membutuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515SEGERA: 1742 DIBUTUHKAN Perusahaan distribu-

tor membuka devisi baru untuk wilayah SiantarSimalungun dan sekitarnya, membutuhkan banyak karyawan/ti. usia maksimal 28 tahun. pendidikan SMU, SMK, D1, D3 dan S1(semua jurusan) untuk posisi ADM, Marketing, Pengawas, QC dan OB. Bawa lamaran langsung HRD HRD CV SENTOSA ABADI, Jl. Gereja No. 91 (depan simpang Jl. Sidamanik, Samping Warkop) P. Siantar. DIBUTUHKAN SEGERA: Tenaga kerja wanita usia 17 - 40 tahun dengan posisi sbb: Baby Sitter, perawat jompo/pribadi, PRT. Syarat: Fc. Ijazah, KTP, KK, gaji bersih 700 rb s.d 1. 500 rb / bulan + U cuty + Bonus + THR, makan, asrama, dijemput loket, gratis. hub. YYS Marel Mandiri. Jl. Cengkeh Raya No. 18 C Medan HP 0813 6199 9211; 0878 6968 7879

NEW NISSAN: Grand Livina, Nissan Juke, Nissan X-Trail, Navara, Murano. Ready Stock. Cash/Credit Hub. Wandi 0813 61400 0058, 061-7770 9408

Mobil Berlapis Emas Berharga Rp27 Miliar ITALIA-Sebuah Rolls-Royce berlapis emas 24 karat dikabarkan laku hingga US$ 3 juta atau sekitar Rp 27,5 miliar. Emas yang dilabur di mobil ini bisa dilihat dari eksterior hingga interiornya yang pasti akan membuat silau setiap orang yang melihat. Sebuah perusahaan asal Italia bernama Finace Milano yang dengan tekun melabur mobil mewah asal Inggris, Rolls-Royce Ghost. Dan yang pasti, ‘mobil emas’ ini bukanlah kali pertama dikerjakan oleh Finace Milano karena sudah ada beberapa mobil yang mereka laburi emas.Angka US$ 3 juta yang ditebus oleh seorang pembeli misterius pun terbilang jauh lebih tinggi dari prediksi Finace Mi-

DAIHATSU PAKET MURAH 100% DP Angsuran • Xenia 12.750.000 3.125.000 • Terios 15.000.000 4.090.000 • Luxio 19.100.000 3.961.000 • Pick up 9.000.000 2.432.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0878 9228 2993. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio MITSUBISHI 100% BARU: Mobilnya Juragan Cari Untung !!! Pajero Sport, Strada Triton T120, L300, Colt Diesel dan Fuso. Kepada yang berminat Bapak/ibu dan saudara/i,Calon Juragan Silahkan menghubungi : Ayub Supriadi Meliala HP 0813 9773 2729; 0853 5923 2999; 0857 6309 9387 PROMO DAHSYAT,Bila anda puas beritahu saudara dan kawan-kawan TOYOTA 100% BARU Ready Stock: • New Avanza • Rush • Innova • Fortuner • Yaris • Truck Dyna, dll Hub: 0813 7597 9007 / 0821 6620 6007 Andre Toyota Medan

TOYOTA SIANTAR • All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya XENIA SUZUKI: All New Dp. 20% Ertiga = Panjar sekarang, Ikat harga Hub: 0853 7003 2838

Suzuki 100 % BARU : APV Arena : Angsuran 135 ribu Carry pick up : Angsuran 83 ribu DIBUTUHKAN GURU TK-SD: di Tj. Piayu APV pick up : Angsuran 86 ribu Batam & guru bimbel di Marindal Medan, wanita Ertiga pic up : Angsuran 137 ribu single 18-30 th, min SMU HP 0852 6177 6326, Info dan pemesanan hub. RADOT 0813 6432 3472, 0821 6404 3077 (Sales Executive) HP 0852 6109 7775 DAIHATSU P. SIANTAR 100% BARU

DPAngsuran • New Xenia 23 jtready stok • Terios 29 jtready stok • Pick up 15 % • Luxio 18 jt • Sirion 23 jt hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Beli mobil gratis mobil buruan. Proses cepat data dijemput


· All New Avanza ...Unit Ready ! · All New Avanza VELOZ ... Bonus Lengkap ! · YARIS ....... Unit Ready, Diskon besar ! · New Rush ..... Unit Ready ! · Grand New Innova ..... Unit Ready ! · Grand New Fortuner ...... Unit Ready ! · Hilux S-Cab/D-Cab .... Bensin/Diesel.! HUB. SALES EXECUTIVE TOYOTA DEALER : RICKY - HP : 0853 7199 9499 – 0812 6505 3191. Data di JEMPUT, Proses MUDAH, Pasti CEPAT.

lano semula. Mobil yang masuk dalam koleksi RollsRoyce Ghost Diva ini mengambil basis Rolls-Royce Ghost yang memiliki mesin 6-liter twin-turbocharged yang mampu memberikan tenaga lebih dari 560 bhp dengan kecepatan puncak hingga 155 mph atau sekitar 250 km/jam.Namun, untuk kali ini kita tidak perlu lagi bicarakan mengenai dapur pacu yang diusungnya. Mari kita bicarakan warna silau yang menghiasi

MITSUBISHI BARU: Pajero Sport, Triton, Colt Diesel, Dump Truck, L300 FD, T230S. Suku bunga 0%, Ready stock Hub: Gultom Berlian, 0813 6169 4479 READY STOCK! • Carry pick up New Hitam • Granmax pick up N e w Hitam NB: Bisa kredit dantukar tambah. hub. 0622 7436198 CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Rp 175 jt, DP 40 jt, angsuran selama 10 thn + Rp 2 jt per bulan, selama 15 thn + 1,6 jt per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Rp 100 jt, DP 20 jt, angsuran selama 10 thn + Rp 1 jt per bulan, selama 15 thn + 800 rb per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 tahun + Rp 16 jt per bulan selama 15 tahun + Rp 1,3 jt per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: 5 x 20 m Rp 17 jt, 10 x 20 m Rp 34 jt, 15 x 20 m Rp 51 jt, 20 x 20 m Rp 68 jt. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 36/42/45. Atap Multi roof, atap rangka baja ringan, dinding batu bata, gibsun, relief keramik. RUKO LANTAI 1 : Pondasi untuk 2 lantai atap cor, dinding batubata, dilokasi sedang dibangun Martoba Water park. PERUMAHAN BERSATU MAJU : Lokasi jl. Pdt. Wismar Saragih P. Siantar.Telp. 081370261747-085296029651-081361161011081362303662.

beragam tempat di tubuhnya. Di eksterior tampak cat warna ungu yang dipadu dengan di berbagai bagian seperti grille, kap mesin, bumper, foglamp, hingga side skirt dan lingkar peleknya. (int)

CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Rp 150 jt, DP 30 Jt, angsuran selama 10 thn + 1,7 juta per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 10 x 21,8 m Rp 76 jt, 20 x 22 m Rp 154 jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 150 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan. Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Menyediakan rumah dan tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Rp 200 jt, DP 50 jt, angsuran selama 10 thn + Rp 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan, Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 42 Luas tanah 9x12 m, atap baja ringan dinding batu-bata, gimsum, relief lantai keramik, PLN., PDAM SHM, IMB dan KPR. PERUMAHAN SETIA NEGARA BARU : lOKASI JL. Pengintai Komp. setia negara IV Telp. 081370261747- 08529602965, 081361161011- 081362303662.

CASH & CREDIT : Rumah tipe 36, tipe 42, Atap Multi roof, dinding batu bata , gimsum, relief lantai keramik. RUKO TIPE 40: Pondasi untuk 2 lantai, atap cor, dinding batu -bata, relief pintu besi , PLN, PDAM, SHM, IMB, dan KPR. PERUMAHAN BATU PERMATA RAYA : Lokasi Jl. Batu permata raya ujungkelurahan bah kapu.Telp. 081370261747085296029651-081361161011-081362303662 CASH & CREDIT : Rumah tipe 36, 42. atap Multi roof, rangka atap baja ringan, dinding batubata, gimsum, relief lantai keramik. RUKO TIPE 40 : Pondasi untuk 2 lantai, atap cor, dinding batu-bata, relief pintu besi, PLN, PDAM, SHM, IMB, KPR. PERUMAHAN HERAWATI INDAH : Lokasi Jl. Viyata Yudha ujung,kelurahan Bah Kapul.(tojai baru) Telp. 081370261747085296029651-0813611611011-081362303662.

ADELAIDE-Tahun lalu, wanita Australia menghabiskan lebih dari Rp 6 triliun guna mempercantik diri lewat tindakan kosmetika. Jumlah itu meningkat 15 persen daripada tahun sebelumnya. Dalam survei yang dilakukan Ikatan Dokter Kosmetika Australia (CPSA) terhadap 584 warga Australia, tindakan paling populer adalah perawatan guna mengurangi keriput, seperti botoks; menghilangkan rambut; serta perawatan untuk memuluskan kulit menggunakan laser dan intense pulsed light. Jajak pendapat ini juga menemukan bahwa warga Australia menjalani perawatan kosmetika pada usia lebih muda dibandingkan dengan negara lain karena tingginya kasus kerusakan kulit akibat sinar matahari. Rata-rata warga Australia menjalani perawatan kosmetika pada awal sampai pertengahan usia 30 tahun. Bagi pria, perawatan yang banyak

CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Rp 95 jt, Dp 20 jt, angsuran selama 10 tahun + Rp 950 rb per bulan, selama 15 tahun + Rp 752 rb per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar. CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Rp 200 jt, Dp Rp 50 jt, angsuran selama 10 thn + 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan. Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

dilakukan adalah agar wajah tidak kelihatan lembek dan mengurangi rambut yang menipis. Sementara perawatan bagi wanita adalah mengurangi keriput dan mengatasi dagu yang menurun. Presiden CPSA Dr Gabrielle Caswell mengatakan, tersedianya teknologi baru dan tindakan yang tidak terlalu rumit membuat lebih banyak warga Australia mau menjalani perawatan kosmetika tersebut. “Usia 50 tahun sekarang sama seperti 40 tahun puluhan tahun lalu dan tindakan kedokteran kosmetika semakin umum. Kita juga hidup dan bekerja lebih lama. Saya kira mereka menjalani tindakan bukan ingin bersaing dengan generasi lebih muda, melainkan lebih untuk kepentingan diri sendiri. Jiwa mereka merasa masih muda dan mereka ingin menunjukkan lewat penampilan,” tutur Caswell. Kekhawatiran terbesar bagi pria dan wanita adalah warna kulit yang tidak rata, disusul berat badan. (int)

PIJAT DAN LULURAN “IBU Restu” jika anda capek, pegal linu, lesuh, lelah kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran. Jl. Simpang Viyata Yudha Komp. kelapa-2 dekat sekolah RK Katolik Asisi P. Siantar HP 0821 6681 7943; 0813 9635 4127 DISTRIBUTOR ALAT TERAPI - ION: Metode Rendam Kaki dan Tangan, Menggunakan Garam Terapi ( Bukan Garam Dapur ) Harga @ : Rp.11.750.000.- dan @Rp.8.900.000.Kami bukan hanya menjual, Tapi praktisi langsung & Terbukti Manfaatnya Hubungi Langsung : 0813.7127.2789. Awas Barang Tiruan Dengan Harga Murah.

PIJAT DAN LULURAN “MBAK SARI”: Jika Anda Capek, Pegal, Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan Badan, Urut Bayi, Terkilir serta Luluran. Hub: kami di Jl. Usgara No. 1 (Masuk dari Jl. Bali samp. SMK DIJUAL TANAH: Tanah ukuran 8x23,m (SHM) Negeri) P. Siantar HP. 0812 635 5430 dan Rumah/bangunan 7x15,m. Kamar Tidur PIJAT, LULURAN & OUKUP “MBAK 3,Kamar Mandi 2, Keramik,Gipsun. Harga 275 ERYKA”: Jika Anda capek, pegal linu, Juta /NegoLokasi Jl. Lau Cimba Ujung. lesu, lelah, kurang bergairah, turun Pematangsiantar. HP 0813 7043 4885 / 0813 perut, menyegarkan badan, urut bayi, 7031 6990 (TP) terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). CASH & CREDIT: 1.908 M2 Rp 300 jt, cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, Hub: Jl. Handayani Kel. Bahkapul P. depan Gereja Khatolik, Rambung Merah Hub: Siantar - HP. 0852.7600 0031; Alboin Sidabalok di No.Telp. 0813 76122445; 0813.9688 9800. 08126207631; (0622) 7070442 P. Siantar PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, CASH & CREDIT TANAH: 5 x 25 m Rp 25 Lelah, Kurang Bergairah, Turun Perut, jt, 5 x 20 m Rp 20 jt, cocok untuk memelihara Menyegarkan badan, Urut bayi, Terkilir, hurje. Jl. Laucimba Rambung Merah Hub: serta Luluran. Hub. Jl. Menambin No. Alboin Sidabalok di No.Telp. 0813 12 A Timbang Galung P. Siantar Hp. 76122445; 08126207631; (0622) 0813 7658 8917 7070442 P. Siantar DIJUAL TANAH DI PUSAT KOTA: SHM,LT, 440. M2, Cocok Untuk Rumah Kost, Tempat tinggal, Lokasi Jln TVRI Kel, Simarito. Harga 250.rb/meter (Nego) Hub. 0852 616 48112

DIJUAL TANAH: Luas 320 M2, SHM, PLN, PAM, pagar besi keliling, sangat strategis, sudah ada kios jualan, lokasi di Jl. Nias No. 3 C Kel. Toba, harga 180 jt (nego) hub. HP 0813 6218 4015 PIJAT DAN LULURAN “IBU SUM” Jika anda capek, pegal linu, lesuh, lelah kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran hub kami di Jl. flores No. 07 P. Siantar HP 0812 6526 0864; 0813 754 74647 DIJUAL: Sebidang tanah dengan ukuran 14,126 M2, SHM, di Kamboja Kel. Sinaksak Kec. Tapian Dolok Kab. Simalungun. hub. HP 0852 7607 2178 A Simarmata, 0812 6207 541 O Simarmata, 0813 7797 9294 TP / nego

HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” TERCECER: Surat akta Camat jual beli An. Muhammad Arsyad, luas tanah 5 x 20 M, terletak di Jl. Pdt. J Wismar Saragih. Tercecer pada bulan Desember 2011 di sekitar Jl. Pdt. J Wismar Saragih - Jl. Setia Negara, bagi yang menemukan dapat di hub. HP 0812 6320 4166 HOTLINE IKLAN

Telp. 0622 - 7553511


KAMIS 12 April 2012




TERCECER / HILANG 1 (satu) buah buku pemilik kendaraan bermotor (BPKB) nomor 7932146B, nomor r a n g k a M H 1 J 7 111 3 7 K O 9 4 0 8 9 , nomor mesin JF11E 10922774 An. Phieling, alamat Jl. Voli No. 33 A Pematangsiantar. Hilang Senin, 09 April 2012, sekitar Jl. Rakuta Sembiring Kec. Siantar Martoba Pematangsiantar. Bagi yang menemukan hub: Bapak AMIN, HP 0853 7061 6128 Tidak dituntut tapi diberikan imbalan yang sepantasnya.

Merokok, Shahrukh Khan Terancam Dipenjara SHAHRUKH Khan terancam berurusan dengan hukum, lantaran tertangkap kamera sedang merokok di tempat umum. Bintang Bollywood itu terlihat merokok saat menyaksikan pertandingan IPL di Sawai Man Singh Stadium, Jaipur, India. Direktur Jaipur Cricket Academy, Anand Singh Rathore bahkan sudah mendatangi pengadilan setempat, Senin lalu untuk melaporkan tindakan megabintang India itu. Rathore telah menunjukkan bukti, berupa sebuah CD yang memerlihatkan

bintang Kuch Kuch Hotta Hei itu tengah merokok dengan jelas. “Saya telah menyerahkan sebuah CD dan beberapa foto dimana aktor itu terlihat sedang merokok,” ungkap Rathore dilansir dari Timesofindia, Rabu (11/4). Pihak pengadilan telah memelajari keluhan tersebut. Rencananya, sidang pertama akan dilaksanakan hari ini, Kamis (12/4). Pengawas stadion, Gheesaram Sharma juga berencana melaporkan kejadian tersebut ke pengadilan. (oz/int)

KAMIS, 12 April 2012

Angel Lelga

Santai Dilaporkan ke Polisi JANDA Rhoma Irama, Angel Lelga bersama Indra Brugman dilaporkan ke pihak berwajib oleh pedangdut Kumala Sari. Kedua artis itu dilaporkan Kumala yang juga sempat membintangi sinetron dengan dugaan penggelapan uang atas bisnis parfum. Saat ditanya soal laporan itu, tidak tampak kekhawatiran di mimik Angel Lelga. ”Kita Tim ARA (perusahaan Angel dan Indra) sangat percaya diri. Karena kita tahu ada di

AKTRIS seksi Uli Auliani sedang patah hati. Impian Uli untuk menikah dengan kekasihnya yang berasal dari Amerika Serikat buyar. Reid Spancer Garrett, sang pacar yang beragama Yahudi tidak direstui keluarga Uli yang memeluk agama Islam. Padahal sang pacar sudah bermaksud melamar bintang film ‘Skandal’ itu. ”Belum lama ini pacarku dari Amerika datang ke Indonesia dengan maksud bertemu dengan orangtua aku untuk melamar. Tapi saat dia mau ke Bandung bersama dengan aku. Reid ditolak mentah-mentah dan dilarang untuk datang bertemu,” ujarnya saat ditemui di apartemennya di Jakarta, Selasa (10/4) malam. Hubungan yang baru dibinanya selama sebulan itu pun harus kandas. Apalagi

nasib Uli juga tak jauh beda dengan kekasihnya itu. Uli juga ditolak mentah-mentah oleh keluarga sang pacar karena perbedaan agama. ”Keluarga Reid juga ngelarang Reid menikahi aku, karena aku orang Islam. Saat Reid memberi tahu. Mereka langsung meminta dan melarang Reid berhubungan dengan aku,” katanya. Padahal sebelumnya, menurut Uli sang kekasih sudah mantap untuk melamarnya. Ia pun sudah merasa yakin dengan Reid karena sosok Reid begitu sempurna di matanya. (dtc/int)

posisi yang benar. Kita nggak mau latah selalu menanggapi omongan dia,” kata Angel saat ditemui di Studio RCTI, Kebon Jeruk, Jakarta Barat, Rabu (11/4). Laporan itu terjadi atas adanya kerjasama antara Angel, Indra dengan Kumala Sari. Kumala membeli produk parfum dari perusahaan kedua artis tersebut seharga Rp300 juta. Namun, Kumala menilai ia merasa dirugikan dari kerjasama tersebut. Baik Angel maupun Indra sudah tak mau ambil pusing dengan tudingan yang dituduhkan pada mereka. Keduanya sudah menyerahkan kasus ini kepada pihak kuasa hukum. ”Itu hak mereka untuk melaporkan. Itu sudah diurus pengacara, biar hukum berjalan,” ucap Indra. Adanya pelaporan tersebut, diakui Angel tidak mempengaruhi bisnis mereka. Hal ini pula yang membuat mereka tenang dan bisa bernapas lega. Namun, memang sempat banyak yang bertanya pada mereka soal kasus pelaporan itu. ”Banyak sih yang tanya, mulai dari keluarga, teman, semua menanyakan kasus ini. Cuma untungnya penjualan tidak berpengaruh,” ucap Indra lagi. (vnws/int)


H A L A M A N 14



Aku; menemani pagi di lampu merah, meja sarapan, dan gempita.... Aku; merelakan diri demi ikan yang dikeringkan dan kacang rebus... Aku; dipuja, dipuji, dicaci, juga dimaki.... Aku; melewati itu semua sejak sembilan tahun lalu sampai hari ini... Bersamaku; ada banyak kisah yang diungkap... Bersamaku; ada banyak cerita yang tersaji... Bersamaku; ada banyak peluh yang mengalir... Hingga kini, mimpi belum usai.......... impian belum menua......... Aku; ingin kamu; tetap di hati... Melekat, rekat, dengan jejak kebersamaan.... Aku; yang mencintai kalian semua... (Tanggal 10 April (lalu) koran METRO SIANTAR, tepat berusia 9 tahun...Nah, kalian semua ‘bebas’ mengutarakan apa saja tentang koran Metro Siantar atau akun FB Siantar Gaul boleh kritik, saran, caci, atau puji... Btw, yang mau kirim kue atau ucapan selamat, juga dipersilahkan dengan cinta :* hehehe........)

C’alay Yg CuEt Sitorus

Mantap. I like it. Smoga Semkain bnyak diminati

Rheca Raimeyca Tamboenand

Aq ngirim kue aja ya. Sama doa a.. Yar koran metro tambah sukses!

Raya Tampubolon

Hidup q hampa....hidup q sepi jk ktinggalan berita metro. bwt metro slamat y smoga smakin sukses...... Risdhy Sikomatu Ada juga yg menjadikanmu alas tidurnya.kau memang hebat dan serbaguna.Maju dan Jayalah Metro Siantar...jgn pernah bosan mengumandangkan fakta faktualmu,jgn gentar bila kau menyuarakan jeritan orang2 yg tertindas dan terzholimi..HBD 2 U

Benny Homunis Salvator

Hmpir aj lupa. Buat “METRO SIANTAR”. Moga mkin Jaya aj y, and mkin sukses,, smkin smgat dlm ngelaksnain tgas ny ..

Buddi Michaell

Met ulta ya metro mga mkin mantab aj...tpi klu bs ada brita otomotif jg ya..

Bonor Tiangnitonga

Tiada jarak yg memisahkan,tiada kabar yg tak tersampaikan..Dari kota hingga desa..Aq slalu setia menemani,aq slalu ada untuk berbagi. Happy birtday..Moga mkn jaya dan sukses.

Gerhana Zelvioxx Sitinjak Full

Metro siantar...I LOVE U FULL !! semoga kedepannya semakin sukses. dan halaman xpresi fbnya semakin diperbanyak.

Ferywilsoen Putra Sulung Roemahorboe

Happy birthday and moga makin berani dalam mengungkapkan fakta

Rickz D’ Bastian

Dirgahayu.. smoga menyajikan brita yang di kemas lebih baik dan menarik. Sukses metro!

Tamsar Shu Purba

Dirgahayu koran kebanggaan org siantar – simalungun, mudah2an di hari ultah koran ini akan menyajikan berita yg bukan hanya sekedar berita tapi berita yg dapat membangun kaum muda.

“K ok pulang lama?” tanya ibu di depan pintu. “Kok “Tadi ada kerja tambahan,” jawabku berbohong berbohong.. “Berkelahi lagi dengan waktu? Sekalisekali Sekali-sekali cobalah untuk mengalah,” ucap ibu sembari meninggalkan aku yang sibuk memarkirkan sepedamotor sepedamotor.. Untuk sekian kali aku berbohong sama mahluk Tuhan yang paling mulia. Tiap malam dia menunggu kepulanganku sambil menenun detik menjadi kain waktu di kursi kayu yang usianya lebih muda dari umurku. Di kursi kayu yang sudah mengelupas warna hijaunya itu, ibu sabar menanti aku, anak gadisnya kembali dari dunia kata-kata yang sejak dua tahun terakhir kulakoni. Saat ibu memerhatikan jarum jam bermain bak ombak yang mengganggu karang dan diintip camar dari atas cakrawala, saat itu pula aku berselingkuh dengan alat teknologi bernama komputer. Saat ibu tetap menatap jarum jam yang berkejaran seperti seorang sopir angkot yang membelah jalan dengan kecepatan tinggi hanya untuk dua kata, kejar setoran, saat itu pula aku bercumbu dengan keyboard dan bersetubuh dengan monitor lalu orgasme ketika di layar komputerku tertera N mengomentari status Anda. “Maaf ibu, aku bohong lagi malam ini,” gumamku. Kusempatkan menghadap Tuhan sebelum merebahkan tubuh di atas pembaringan. *** Aku terbangun tepat pukul 08.00 WIB. Sepi kembali menyelimuti ruang hati yang paling dalam. Aku biasa rasakan itu. Argh…. Kenapa setiap hari aku harus dibangunkan alarm telepon genggam? Bukankah nyanyian burung dan siulan jangkrik jauh lebih merdu dibanding jeritan suara dari hasil kemajuan teknologi? Bukankah suara ibu lebih hangat dibandingkan sinar matahari yang memaksa masuk dari lubang angin di jendela itu? “Anak gadis kalau sudah bangun tidur, jangan mengkhayal. Ntar, sepanjang hari bawaannya mengkhayal melulu,” suara ibu mengaduk sepi menjadi sedikit gaduh. “Bu, besok banguni Aya cepat ya,” pintaku. “Oke, sekarang kamu mandi.” “Ibu nggak nanya kenapa?” tanyaku. “Kamu ada liputan kan ?” ujar ibu balik bertanya. “Kok ibu tau,” tanyaku menjawab pertanyaan ibu. “Satu-satunya alasan kamu bangun cepat hanya liputan,” pungkas ibu. “Hehe…,” aku cengengesan lalu bergegas mengambil peralatan tempur dari lemari. Aku ingin berperang dengan air yang dingin. Dengan air yang datang dari saluran pipa di samping rumahku yang hampir rubuh dimakan zaman. “Hei, lipat selimut dulu baru

mandi. Ibu masuk kamar cuma mau lihat kamu sudah sadar atau masih peluk bantal,” timpal ibu sebelum menginggalkanku sendiri di ruangan abu-abu ini. *** Aku tak pernah bermimpi bisa

disibukkan dengan rutinitas membaca buku bergambar karya komikus Japan , negeri sejuta kemajuan tapi tetap mempertahankan keaslian budaya. *** “Benarkan yang ibu bilang.” Lagi suara ibu terdengar di telingaku. “Eh ibu… ngagetin aja.” “Lagi mikiri apa?” “Mikir yang ringan-ringan.” “Misalnya?” tanya ibu sembari mendaratkan bokongnya yang tidak lagi

lambat.” “Iya sih Bu. Tapi, mengapa harus menelanjangi diri?” “Sebab, itu cara mereka.” “Menurut ibu sisi positif Indonesia itu apa?” “Banyak.” *** Waktu aku masih ingusan, seorang perempuan renta dibalut kulit keriput, rambut putih, dan sanggul mirip tiara yang bertahta di kepala ratu sejagad, berkata; “Dulu, rumah ini hijau. Warna itu mampu

bekerja di perusahaan media terbesar di kotaku, kota yang sebentar lagi menghelat pesta rakyat dengan 10 calon yang akan bertarung merebutkan singgasana empuk orang nomor satu. Aku juga tak pernah bermimpi harus melawan waktu demi menyusun huruf menjadi katakata lalu merangkainya jadi kalimat sebelum akhirnya dinikmati bersama secangkir kopi atau segelas teh di meja sarapan. Atau dikoyak menjadi beberapa bagian lalu dijadikan pembungkus ikan asin. Aku tak pernah bermimpi untuk kedua hal tersebut. Tapi, aku pernah bertanya kepada langit, bagaimana proses pembuatan Koran yang tiap hari dibawa-bawa bang Mamat, tukang loper yang setiap pagi mengajak berantam karena Koran itu dilemparkan begitu saja dan pernah mengenai aku yang akan berangkat sekolah. Waktu itu, aku masih duduk di bangku sekolah menengah pertama (SMP) di salah satu sekolah negeri. Aku heran… bagaimana caranya paragraf informasi itu bisa berbaris rapi ditemani beberapa foto pada 12 atau 16 lembar kertas. Namun, rasa heranku itu tak bertahan lama. Untuk seterusnya aku

montok karena letih melahirkan sepuluh anak, di tempat tidurku. “Berapa ya harga cabai 1 ons?” “Jangan rebut jatah pikiran ibu dong.” “Hehehe… Bu, kapan ya kita kaya?” “Kamu mau kaya apa? Hati atau harta?” “Dua-duanya.” “Percayalah…. Kalau kamu sudah kaya hati, urusan harta hanya seupil.” “ Ibu bisa aja.. Oya, ibu nggak capek tinggal di Indonesia ?” “Katanya mikiri yang ringan, kok nanya yang berat?” “Habisnya Aya suntuk lihat Indonesia , Negara segudang masalah tanpa ujung. Tanpa hutan dan air sungai yang hijau.” “Nak, cobalah lihat Indonesia dari sisi positif. Yang kritik dan marah-marah Indonesia itu begini, Indonesia itu begitu sudah banyak, jangan ditambahi lagi. Belajar mencintai apa adanya dan menghargai apa yang ada.” “So far….. Aya masih melihat Indonesia dari sisi positif. Hanya, Aya sebal di internet, televisi, dan Koran full masalah. Kesannya Indonesia itu surga untuk buat dosa.” “Take it easy. Toh, semuanya akan berlalu cepat atau

membangkitkan nafsu katak untuk mengajak katak lainnya bernyanyi sebagai puji syukur atas air yang tumpah dari atas. Sekarang, jangankan katak, untuk melihat peri-peri kecil yang bermain di tanah berlubang, tempat sisa-sisa air tangisan langit yang bermuara di bumi, sulit aku temui. Semen dan batu itu buat hatiku perih.” Hingga kini, kata-kata itu senantiasa menari di dalam ruang hati sebelah kanan dekat dengan ruangan aku menyimpan perasaan sayang untuk orang yang aku cintai, namun terlarang. *** Dulu… Aku juga pernah melihat, membaca, dan mengagumi keindahan Danau Toba via Koran berwarna edisi Minggu terbitan media lokal. Bukan hanya keeksotisan mentari tenggelam di ujung danau yang disajikan fotografer lewat karyanya yang aku nikmati. Saat itu, pikiranku mencari jawaban soal bagaimana cara menyusun kata-kata apik dan foto-foto menarik itu pada kertas berukuran 2 kali lebih luas dari HVS putih yang biasa kulipat-lipat menjadi pesawat dan kapal saat guru PPKN absen karena sakit waktu zaman SMP. Pertanyaan itu memaksa dan meringsek masuk ke dalam hati

lalu menendang pesan ke arah otak, bagaimana proses pembuatannya? Akhirnya, aku temukan jawaban untuk itu sekitar setahun lalu. Saat aku menjabat sebagai asisten redaktur di pabrik kata-kata tempatku menghabiskan waktu tiap malam. Ternyata……Sebelum sampai ke tanganku koran-koran itu harus melalui proses dan perjuangan panjang lebih panjang dari barang berharga yang sering diributkan kaum Adam dan Hawa. Proses awal, mahluk berjudul reporter mencari bahan baku sekaligus berjibaku dengan ruang dan waktu, juga sanjung plus maki narasumber. Lalu, reporter itu mengumpulkan semua bahan-bahan yang diperolehnya dan membuatnya jadi barisan paragraf. Selesai itu, seorang redaktur mulai memainkan perannya. Ia bertugas mengambil alih barisan paragraf itu. Selanjutnya, tangan redaktur memperbaiki barisan paragraf yang ditulis reporter sesuai dengan ejaan yang disepakati dalam kamus besar bahasa Indonesia Ia adon tulisan itu dan memperkaya kembali dengan berbagai rasa sebelum rangkaian kata-kata itu dimasukkan ke pemanggangan. Dan, jauh sebelum proses pemanggangan, ada koki pertama dan penanggung jawab rasa yang mengawal proses pembuatannnya. Nah, rangkaian kata yang sudah diadon redaktur diberikan kepada juru masak pertama bernama lay outer. Mereka bertugas untuk menyusun barisan paragraf dan foto serta mengatur perwarnaan menjadi selembar kue yang harus dicicipi oleh seorang penanggung jawab. Penanggung jawab ini lah yang bertugas memberikan sentuhan rasa dan jiwa agar kue Koran tersebut benar-benar layak panggang. Usai kesepakatan bersama, lembaran kertas tadi berubah status menjadi kalikir dan polyster, untuk selanjutnya diberikan kepada tangan kreatif dan teliti seorang monting. Setelah itu, kue Koran sedia untuk dipanggang oleh koki kedua. Namun, kue Koran tadi masih harus melalui proses panjang sebelum dinikmati para pembaca. Ada proses penghitungan Koran yang akan dipasarkan dan distribusi Koran yang harus melintasi jalan rusak dan mengalah dengan hujan di perjalanan. *** Terakhir, betapa naifnya orang-orang sepertiku. Orangorang yang berat merogoh kocek Rp2 ribu untuk membeli kue Koran yang di dalamnya mengandung segudang informasi dan perjuangan manusia untuk bertahan hidup dan menyambung nafas dari kue Koran itu. (*) (Nurjannah)

All Sport


12 April 2012




Crutchlow Bisa Jadi Idola Baru Penampilan fantastis Cal Crutchlow yang finis keempat pada seri pembuka MotoGP di Qatar mendulang pujian dari bos Yamaha Factory Racing, Lin Jarvis. Jarvis yakin bila Cruthlow bisa meneruskan performa hebatnya ini maka pembalap asal Inggris tersebut bisa menjadi favorit para fans di masa depan. “Cal benar-benar berkarakter dan olah raga ini butuh orang berkarakter sepertinya. Valentino (Rossi) telah mendominasi beberapa tahun terakhir dan dia kini masih bersama-sama kita maka kita harus memanfaatkannya,” kata Jarvis seperti dikutip dari Motorcycle News, Rabu (11/4). “Tapi pada titik tertentu di masa depan dia akan melakukan hal lain dan kita harus menciptakannya menjadi bintang baru. Saya tidak mengatakan dia akan menggantikan Valentino tapi kita harus mempromosikan pembalap lain untuk disukai para penonton,” urai Jarvis. Penampilan mengesankan Crutchlow sepanjang 22 lap MotoGP Qatar menegaskan awal yang hebat ba-

„ Kebahagiaan para pemain Liverpool setelah meraih kemenangan dramatis atas Blacburn

„ Crutchlow gi era baru 1.000cc Yamaha. Crutchlow yang start dari baris terdepan untuk pertama kalinya sepanjang kariernya berhasil mencuri posisi keempat dari rekan setimnya yang jauh lebih berpengalaman Andrea Dovizioso pada lap ke-17. “Sejujurnya saya terkejut. Saya tidak memperkirakannya tapi sungguh menyenangkan melihatnya me-

masuki musim ini dengan awal yang sangat positif,” aku Jarvis. “Dia terlihat lebih senang dengan motornya. Ini merupakan tahun kedua baginya dalam tim. Saya penasaran melihat bagaimana dia akan perform. Saya pikir dia punya kesempatan memperoleh hasil-hasil yang top pada musim ini,” pungkas Jarvis. (oz/int)

Blackburn 2 vs 3 Liverpool

MENANG DRAMATIS Liverpool akhirnya bisa bangkit kembali setelah pekan lalu dipermalukan 1:0 oleh Sunderland pada ajang Liga Premier. Namun dalam laga Rabu (11/4) dini hari tadi, The Reds berhasil meraih kemenangan secara dramatis atas tuan rumah Blackburn Rovers. Meski harus bermain dengan 10 pemain saja, namun tim asuhan Kenny Daglish itu mampu membukukan kemenangan dengan skor 3:2 dan memantapkan posisinya di posisi delapan klasemen sementara. Bertandang ke markas Blackburn di Ewood Park, sejak menit-menit awal Liverpool mampu mendominasi laga. Pada menit ke-12, Maxi Rodríguez mencetak gol setelah memanfaatkan umpan cepat Craig Bellamy dari sayap kiri. Tanpa ampun bola menghujam ke jala Blackburn yang dijaga Paul Robinson, sehingga skor menjadi 0:1 untuk tim Liverpool.

Tak butuh waktu lama, empat kemudian Maxi mencetak gol kedua. Ia berhasil memaksa Robinson memungut bola dari jalanya sendiri untuk kali kedua. Maxi berhasil memanfaatkan bola liar yang tak mampu dihalau barisan pertahanan tuan rumah. Skor 2:0 untuk kemenangan Liverpool. Namun demikian dominasi Liverpool itu mulai luntur beberapa menit kemudian. Pada menit ke-25, wasit Anthony Taylor mengusir kiper Liverpool, Alexander Doni karena melanggar striker tuan rumah Junior Hoilett di kotak terlarang. Kartu merah itu sekaligus dilengkapi dengan tendangan

penalti. Daglish kemudian menarik keluar bek John Flanagan, agar kiper pengganti Brad Jones bisa menjaga gawang. Pilihan King Kenny ini rupanya tepat, karena Jones secara gemilang berhasil mementahkan eksekusi penalti Yakubu Aiyegbeni. Namun demikian, unggul satu pemain jelas membuat Blackburn berada di atas angin. Hasilnya terlihat pada menit ke 36, ketika tendangan bebas David Dunn berhasil disundul Yakubu yang membuat Jones tidak kuasa menjangkau bola. Skor 2:1 bertahan hingga turun minum. Memasuki babak kedua, Liverpool mencoba melupakan kurangnya jumlah pemain. Anak-anak kota pelabuhan ini melancarkan serangan ke jantung pertahanan tuan rumah. Namun tuan rumah yang unggul jumlah pemain mampu menghalau serangan Andy

Caroll dan kawan-kawan. Menit ke-61, Blackburn yang telah menemukan ritme permainan kembali mendapatkan hadiah penalti dari wasit. Penalti didapat karena Jones melanggar Yakubu di kotak dua belas pas. Tak mau mengulangi kesalahan, Yakubu sukses memperdaya Jones. Tuan rumah menyamakan keunggulan menjadi 2:2. Namun demikian disaat laga sepertinya akan berakhir imbang, Liverpool justru berhasil mengembalikan kemenangan. Pada masa injury time, tepatnya menit ke-91, sundulan Daniel Agger mampu dilesakkan dengan heading sempurna oleh Gol Andy Carroll. Liverpool pun kembali unggul menjadi 3:2 dan menutup laga dengan kemenangan dan menyisakan duka bagi tuan rumah. Kekalahan ini sendiri semakin membenamkan Blackburn di zona degradasi. (jpnn)

Jelang F1 GP China 2012

Vettel Antusias

„ Sebastian Vettel

Sempat bermuram durja karena frustrasi di Sepang, Malaysia, Sebastian Vettel akan kembali ke trek di GP China, dengan rona wajah yang sedikit cerah. Vettel antusias untuk turun ke sirkuit Shanghai yang dinilainya unik dari segi ukuran. Karakter Shanghai International circuit yang terkesan memanjang dan lebar, amat disukai Vettel, karena akan tercipta banyak kesempatan untuk melakukan salip-menyalip. Tentunya, Vettel akan menjanjikan pertarungan seru yang akan kem-

bali digelar, 14 April mendatang. “Trek di China, buat saya unik dari sisi ukurannya. Luasnya trek di sana akan meninggalkan ruang yang cukup untuk melakukan aksi overtake. Selain itu juga terdapat area luas untuk menggeber kecepatan,” ujar Vettel, seperti dikutip Planet-F1, Rabu (11/4). “Bahkan jika di area pit trek lain sempit, area pit stop di Shanghai terbilang cukup luas,” lanjut sang juara bertahan F1. Soal prestasi di negeri tirai bambu itu, Baby Schumi punya

catatan cukup bagus. Pertama kali mencapai puncak podium Shanghai, adalah saat Vettel tampil di musim 2009. Dan di tahun lalu, Vettel berada di podium kedua, setelah driver McLaren, Lewis Hamilton. “Saya punya hasil yang cukup bagus di China, kami mendulang hasil baik di tahun 2009 saat kami pertama kali menang di China. Musim lalu, saya finis di urutan kedua dan semoga, saya mendapat hasil yang memuaskan untuk mengoleksi banyak poin,” tuntasnya. (oz/int)

Jelang Saul Alvarez vs Shane Mosley

Mosley: Saya Tak Pernah Redup Mantan jawara tinju di tiga divisi, ‘Sugar’ Shane Mosley bakal kembali naik ring berebut titel kelas light-middleweight WBC melawan petinju yang 19 tahun lebih muda darinya, Saúl ‘Canelo’ Álvarez. Umur boleh saja berbeda jauh, tapi Mosley menolak laga ini akan hanya menjadi penghibur semata. Mosley tetap akan mengeluarkan kemampuan terbaiknya, meski usianya kini sudah menginjak 40 tahun. Memang tiga catatan pertarungan Mosley tak menggembirakan. Terlebih saat melawan Floyd Mayweather Jr. dan Manny Pacquiao. Tapi Mosley

mengaku skill dan kekuatannya masih melekat dan tak meredup sedikit pun. Mosley masih merasa dirinya, petinju yang sama di masa jayanya. “Pandangan umum biasanya berkata, skill petinju akan kian menghilang, seiring berjalannya waktu, tapi hal itu tidak terjadi kepada saya. Pengalaman, skill dan pengetahuian saya tentang tinju, takkan hilang begitu saja,” seru Mosley. “Sudah beberapa kali saya bertarung dengan petinju terbaik dunia, termasuk Oscar de la hoya dan Antonio Margarito,” tambahnya, sebagaimana dilansir Boxing Scene, Rabu (11/4).

“Saya sendiri sadar bahwa saya masih petarung yang sama, saat saya di atas ring dengan petinju-petinju hebat itu. Saya masih punya kecepatan dan power yang sama. Saya merasa lebih kuat dan saya tahu apa yang saya butuhkan untuk bisa menang,” pungkasnya. Pertarungan Mosley kontra Álvarez pada 5 Mei mendatang, memang akan memperebutkan titel dunia, tapi pertarungan keduanya hanya menjadi laga tambahan, yang bertajuk ‘Ring Kings’ HBO payper-view. Sementara, Main event akan menyajikan Miguel Cotto vs Floyd Mayweather Jr. (oz/int)

Bulls Bangkit Memastikan satu tiket playoff, tak menjadikan permainan Chicago Bulls, lembek kala menjamu New York Knicks di United Center. Sementara, Philadelphia 76ers akhirnya menutup paceklik keterpurukan dengan mengalahkan New Jersey Nets. Bulls yang bermain tanpa bintangnya, Derrick Rose, yang terkena cedera engkel kanan, tak kehabisan amunisi mumpuni untuk terus menggempur ring milik Knicks. Tapi, Bulls sempat dibikin bertekuk lutut di kuarter pertama, dengan kekalahan 22-25. Tapi, tanduk Bulls baru mulai unjuk kemampuan di kuarter

kedua. Knicks dibuat kocarkacir dan merebut kuarter kedua, dengan skor 47-35. Hingga akhirnya ditutup kuarter keempat, Bulls menunaikan targetnya untuk bertahan di puncak klasemen wilayah Timur, dengan kemenangan 98-86. Richard Hamilton dan Luo Deng, menjadi bintang Bulls, pagi ini (malam waktu setempat). Hamilton mengoleksi 20 poin, sementara Luo Deng mendulang 19 poin dan 10 rebound. Sedangkan di pihak Knicks, nampak Carmelo Anthony menjadi satu-satunya ‘New Yorker’ yang bisa membuat Bulls kesulitan dengan raihan 29 poin.

Beralih ke Prudential Center – kandang Nets, tak disangka 76ers mampu merebut kemenangan di markas lawan. 76ers juga akhirnya menghentikan catatan minor mereka di empat pertandingan terakhir. 76ers yang membawa serta pilar mereka – Kris Humphries, sempat mengimbangi tuan rumah di 25 menit pertama. Bahkan skor keduanya hingga kuarter pertama berakhir, berhenti di titik 20-20. Tapi keadaan yang berbeda jauh, terjadi di kuarter kedua. Dengan fantastis, 76ers mempermalukan si empunya stadion, dengan menutup 25 menit kedua dengan skor 52-43. (oz/int)












2 Man City







3 Arsenal







4 Tottenham H







5 Newcastle U







6 Chelsea







7 Everton












26 21 17

Van Persie Wayne Rooney Sergio Aguero

Arsenal Man United Man City


31 25





2 Barcelona

32 24





3 Malaga

31 15





4 Valencia

31 13





5 Levante

31 14





6 Atl Osasuna







7 Atl Madrid








39 37 20

Lionel Messi Ronaldo Higuaín

Barcelona Real Madrid Real Madrid


Milan Juventus Lazio Udinese Napoli Roma Inter

32 31 31 31 31 31 31

20 17 16 14 12 14 13

7 5 14 0 6 9 9 8 12 7 5 12 6 12

62-26 51-17 47-38 43-29 55-38 49-41 45-44

67 65 54 51 48 47 45

Real Madrid kini harus mulai was-was dan menyusun strategi guna menjauh diri dari kejaran rival abadinya, Barcelona yang terus mendekat dalam ajang La Liga. Usai mebungkam Getafe dengan skor telak 4:0 dalam lanjutan La Liga, Rabu (11/4) dini hari tadi, Barcelona berhasil memperkecil jarak menjadi satu angka dengan Madrid yang kini berada di puncak kelasmen.


adrid mengumpulkan 79 poin dan memuncaki klasemen La Liga, sementara Barca yang ada di posisi siap melancarkan kudeta dari posisi kedua dengan 78 poin. El Real -julukan Real Madrid- baru akan bisa menjauh lagi jika mampu memenangi duel dengan klub sekotanya, Atletico Madrid pada Kamis (12/4) dini hari tadi. Pada pertandingan dini hari tadi, sejak menit babak pertama Barca langsung mengurung tamunya. Messi Cs langsung mengejutkan Getafe lewat gol Alexis Sanchez yang sukses memperdaya kiper Miguel Moya pada menit ke-13. Barisan pertahanan Getafe yang bekerja keras, tak mampu membendung sontekan Sanchez setelah memanfaatkan umpan matang Mes-

si. 1:0 untuk tuan rumah. Gol ini semakin membuat anakanak Catalan kian bersemangat. Beberapa kali Messi nyaris menambah pundi-pundi golnya. Namun kiper Getafe, Moya dan pasukan lini belakang lainnya masih terlalu tangguh. Tapi kesabaran tuan rumah dalam membangun serangan kembali berbuah pada menit ke-44. Kali ini kerjasama satu dua Messi dengan Iniesta memaksa Moya memungut bola untuk kali kedua dari jalanya sendiri. Kedudukan menjadi 2:0 dan Messi mencatatkan namanya di papan skor. Gol ini menjadi penutup laga pertama. Memasuki babak kedua Barca tak menurunkan tempo serangan. Seolah tak ingin kehilangan momentum, mereka kembali memperma-

lukan tamu mereka pada menit ke73. Kali ini Sanchez kembali membuat gol lewat tandukannya setelah memanfaatkan umpan silang Isaac Cuenca. Skor menjadi 3:0 mmebuat Barca semakin di atas angin. Hanya berselang dua menit, Pedro Rodriguez kembali memperlebar keunggulan Barcelona. Berawal dari tendangan bebas yang dieksekusi Messi, Pedro sukses menyambut bola dan menghujamkannya ke gawang lawan. 4:0 untuk tuan rumah. Sementara itu Getafe yang telah tertinggal tetap tak mampu keluar dari cengkraman tuan rumah. Alhasil hingga wasit José Luis González González? meniup peluit panjang tanda permainan usai, skor 4:0 tak berubah. Selain perebutan tahta juara, rivalitas Barca dan Madrid juga berlanjut dalam perebutan pencetak gol terbanyak. Dengan satu gol di pertandingan ini Messi kini memimpin dengan 39 gol. Sementara saingannya, Cristiano Ronaldo, berada di posisi kedua dengan 37 gol.(jpnn)

„ Alexis Sanchez



Ambalutu Kandaskan BP Mandoge 23 20 19

Ibrahimovic Di Natale Cavani

Milan Udinese Napoli

PASIR MANDOGE- Tim tuan rumah PTPN IV Bandar Pasir (BP) Mandoge harus mengakui keunggulan lawannya PS PTPN III Ambalutu setelah dalam partai semifinal, Selasa (10/4) di stadion Pasir Mandoge dibantai 2-1. Pada babak I tim Ambalutu unggul 1-0 lewat gol indah Muklis. Awan kelabu yang menyelimuti kubu BP Mandoge berimbas kepada suporter. Belasan anak-anak yang bertugas sebagai anak bola


„ Tim PTPN IV Pasir Mandoge Asahan sebelum melakoni pertandingan semifinal. menagissedihdipinggirlapangan. Kekalahan di luar dugaan tersebut sungguh menyakitkan. BegituWasitSubiomeniuppluit pertanda dimulai pertandingan, pemain depan BP Mandoge langsung menekan. Maizar dan Andri langsungmembombardirgawang Ambalutu yang dikawal Chairul. Gencarnya serangan Mandoge membuat pemain bawah Amabalutu yang dikawal Herman dan Suriadi harus jatuh bangun. Kekurangtenangan membuat serangan Mandoge gampang dipatahkan. Cemerlangnya penampilan Chairul membuat frustrasi pemain Mandoge.

Lepas dari tekanan lawan, Ambalutu berhasil membuat serangan balik. Diki, mesin gol Amabaltu berhasil menguasai bola dan membawa ke kotak penalti lawan. Meski ditempel ketat, Diki mampu melewati tiga pemain bawah lawan. Begitu berhadapan satu lawan satu dengan kiper Mandoge, Diki mampu melesakkan tendangan keras ke sudut kiri gawang Mandoge. Gol pembuka ini berhasil membungkam ribuan penonton tuan rumah. Kedudukan 1-0 untuk kemenangan Ambalutu bertahan hingga babak pertama selesai. Memasuki babak kedua ma-

najer BP Mandoge Hanafi Purba didampingi pelatih Hamdani menginstruksikan agar pemain bermain cepat dengan umpanumpan pendek. Serangan yang dibangun pemain Mandoge berhasil menekan pemain bawah Ambalutu. Teriakan ribuan suporter tuan rumah berhasil membakar semangat tempur tim Mandoge. Namun dewi fortuna tidak berpihak kepada tim Mandoge dan serangan yang dilancarkan belum membuhkan hasil. Keasyikan menyerang, Mandoge lupa menjaga pertahanan. Muklis,strikerAmbalutuyanglolos

darijebakanoffsideberlarimenuju petahanan Mandoge. Tanpa menemui kesulitan Muklis berhasil manaklukkan kiper Mandoge dan skor berubah 2-0. Mandoge berhasilmemperkecilkekalahanmenjadi 2-1 lewat titik putih. Namun hingga wasit Subio meniup peluit akhir, kedudukan bertahan 2-1 untuk kemenangan Ambalutu. Dengan demikian, Ambalutu lolos partai final yang direncanakan digelar, Minggu (15/4) di tempat yang sama. Ambalutu tinggal menunggu pemenang PS PTPN IV Bah Jambi Simalungun melawan PS Pulau Mandi Asahan yang digelar, Kamis (12/4). (iwa/ara)

KAMIS, 12 APRIL 2012

Edisi 251 Tahun VIII

Bagas ‘Disunat Jin’

Gatot Janji segera Bahas Konsorsium Inalum Minta Jatah Inalum Harus Tegas JAKARTA- Hingga saat ini belum juga ada progres penting terkait model pengelolaan PT Indonesia Asahan Aluminium (Inalum) pasca 2013. Keinginan Pemprov Sumut dan 10 kabupaten/kota di sekitar Danau Toba untuk mendapatkan jatah saham, juga belum ditindaklanjuti secara konkrit. Dalam hal pembentukan Konsorsium Daerah misalnya, baru akan dibahas. Juru Bicara bupati/walikota 10 daerah di sekitar Danau Toba, Mangindar Simbolon, hanya menyebutkan bahwa Plt Gubernur Sumut Gatot Pujo Nugroho akan segera mengundang 10 bupati/walikota dimaksud, untuk

Baca Gatot...Hal 7

Basyrah Ajak Anak Buah Tolak Wakil jadi Bupati PALAS- Suasana politik di Kabupaten Padang Lawas memanas pasca pencopotan Basyrah Lubis sebagai Bupati oleh Mendagri. Kemarin, Basyrah mengajak anak buahnya menolak pengangkatan Wakil Bupati Ali Sutan Harahap (TSO) sebagai Bupati. Basyrah juga menyempatkan diri melantik sejumlah pejabat eselon. Kontan saja, aksi Basyrah ini menuai kontroversi. Dan, yang menjadi ‘tumbal politik’ adalah Arse Hasibuan. Sekretaris Dinas Pendapatan Daerah (Dispenda) Kabupaten Padang Lawas (Palas) ini, dicopot dari jabatannya oleh Basyrah Lubis, karena tidak mau menandatangani surat penolakan (TSO) sebagai Bupati Palas, Rabu (11/4). Menurut Arse Hasibuan, seluruh pimpinan SKPD pejabat eselon II dan III

Baca Basyrah...Hal 7

Cut Keke

Berharap Keluarga Baik-baik Saja


Takut terjadi tsunami, ketiga wanita di Kota Banda Aceh ini meninggalkan rumah sembari mengendong bayinya. Bayang-bayang tsunami masih terus menghantui masyarakat Aceh.

Tsunami Mini terjadi di Nias, Meulaboh, dan Sabang BANDA ACEH– Kepanikan melanda warga Aceh. Gempa berkekuatan 8,5 skala richter melanda Simeleu sekitar pukul 15.38 WIB. Lokasi gempa di koordinat 2.31 lintang utara, 92.67 bujur timur.

Kedalaman 10 kilometer di 346 kilometer barat daya Kabupaten Simeleu dengan durasi lima menit. Sebanyak 14 gempa bumi yang melanda wilayah Aceh dan sekitarnya diikuti tsunami mini. Tak

kurang tiga tsunami mini terjadi di Lahewa (Nias Utara), Meulaboh, dan Sabang. Demikian disampaikan Kepala Pusat Data Informasi

Baca Tsunami...Hal 2

Tahanan Tak Dikasih Pipis GEMPA juga membuat panik Pengadilan Negeri Sibolga di Jalan Padang Sidimpuan. Puluhan orang yang berada di lantai satu dan dua berhamburan ke luar. Persidangan terpaksa ditunda. Untungnya pengawalan tahanan oleh polisi tak kendur. Salah seorang tahanan yang sudah menahan sesak hendak buang air kecil selama mengikuti persidangan juga terpaksa tidak diberi izin untuk ke kamar mandi, melihat situasi yang tidak kondusif. Sebahagian dari mereka mengaku trauma dengan kejadian gempa dan tsunami yang pernah menghantam daerah sibolga 2005

Baca Tahanan...Hal 2

TUKKA- Awalnya Ariya Bagas Raya tidur-tidur di teras masjid di samping rumahnya di Lorong Gunung Tua, Desa Sipange, Kecamatan Tukka. Kemudian bocah 7 tahun ini bermainmain bersama temannya. Dan saat Bagas buang air Baca kecil, dia Hal... 2 terkejut ‘anunya’ tersunat.


Arya Bagas Raya di pangkuan ibunya.

Benarkah Jin Bisa Menyunat?


Walikota Sibolga mendatangi warga yang mengungsi akibat gempa. Pasca gempa yang mengguncang Aceh, Sibolga dan Tapteng sempat panik karena isu tsunami.

Warga Barus Panik! GEMPA yang susul menyusul pada pukul 17.53 Wib dengan kekuatan 8,5 SR di Simeuleu, NAD, juga terasa sangat kuat di Kecamatan Barus yang berbatasan langsung

dengan Provinsi NAD. Kota wisata iman ini pun sempat panik dan berhamburan ke luar rumah untuk

Baca Warga...Hal 2

KABAR terjadinya gempa di wilayah perairan Aceh, Rabu (11/4) sore, membuat Cut Keke, aktris berdarah Aceh ini, gelisah. Terlebih pihak Badan Meteorologi, Klimatologi, dan Geofisika sampai saat ini belum mencabut peringatan adanya tsunami. Cut Keke mengakui, kegelisahannya kian menjadi lantaran hingga saat ini ia

Didemo, Sukran Ngaku Dipelintir


PANDAN- Wakil Bupati Tapteng Sukran Jamilan Tanjung merasa pernyataannya soal dukungan akan perluasan wilayah Kota Sibolga saat malam puncak perayaan hari jadi Kota Berbilang Kaum itu dipelintir wartawan salahsatu media. Karena itulah ratusan massa Aliansi Masyarakat Tapteng Peduli Hukum mendemo mantan Anggota DPRD Sumut ini. “Pernyataan saya dipelintir dan lari kemana-mana. Waktu itu saya tidak ada sebutkan perluasannya ke mana, misalnya ke Sarudik atau ke Mela. Lalu, dalam pemberitaan dituliskan juga bahwa pernyataan saya itu atas nama Pemkab Tapteng,” bantah Sukran di hadapan sejumlah wartawan di ruang kerjanya, Rabu (11/4).

Baca Berharap...Hal 2

DEMO- Massa Aliansi Masyarakat Tapteng Peduli Hukum berdemonstrasi di depan Kantor Bupati Tapteng, Rabu (11/4) siang.

Baca Didemo...Hal 7

Dituding Massa Mau Jual Wilayah Tapteng

PAK Ustad, saya pernah dengar ada kasus anak-anak yang tiba-tiba saja sudah disunat dengan sendirinya, katanya disunat oleh Jin. Apa benar ada kejadian seperti ini? Apakah jin dapat menyunat manusia, apa tidak berbahaya nantinya? Lalu bagaimana dengan si anak? Apa perlu diruqyah?

Pertanyaan di atas dikutip dari salah satu blog di internet yang kemudian dijawab oleh ustad. Inilah jawaban dari pertanyaan itu. Memang banyak pengakuan masyarakat seperti itu dari berbagai daerah. Namun, saya

Baca Benarkah...Hal 2

Bukan Disunat Jin! FENOMENA sunat jin menjadi trend di kalangan masyarakat awam, padahal fenomena sunat jin adalah suatu kelainan bawaan pada penis yang disebut hipospadia. Tidak ada dalam dunia kedokteran anak sudah dikhitan sejak lahir, namun fenomena sunat jin

harus diluruskan secara medis. Secara medis, sunat jin adalah hipospadia di mana salah satu cirinya adalah kulit penis bagian bawah (kulup) tidak ada. Karena itulah penis tampak seperti sudah disunat,

Baca Bukan...Hal 2





April 2012



Berharap Keluarga Baik-baik Saja


Sambungan Halaman 1

Presiden Susilo Bambang Yudhoyono mengatakan, terkait gempa bumi di Aceh dengan kekuatan 8,5 skala Richter, dirinya telah berkomunikasi dengan panglima daerah militer serta kepala daerah Aceh. Kepala negara mengatakan, situasi di Aceh saat ini terkendali. “Sementara ini tidak ada laporan korban jiwa dan kerusakan yang berarti,” kata Presiden di sela-sela jumpa pers bersama Perdana Menteri Inggris David Cameron di Istana Merdeka, Jakarta, Rabu (11/4) Presiden mengatakan, sejauh ini tak ada ancaman tsunami. Sistem peringatan dini terkait bahaya tsunami telah bekerja

kesulitan menghubungi sanak saudaranya di Ulele, Banda Aceh. “Mudah-mudahan tidak parah dan tidak terjadi tsunami. Apalagi di sana lagi ramai-ramainya habis pemilihan gubernur,” ujarnya. Istri pengacara Malik Bawazir ini berharap semuanya berjalan aman dan tak terjadi apa-apa. Ia berdoa, kejadian tsunamipadatahun2004tidakterulangdanmembukaluka lama.MenurutCutKeke,sampaisaatinikeluarganyamasih merasakankehilanganyangmendalam.Pasalnya,beberapa anggota keluarga dari ayahnya menjadi korban. ”Aku telepon Mamah, tapi belum bisa. Mudahmudahan enggak ada apa-apa. Dulu banyak keluarga dari Papah yang jadi korban tsunami,” katanya. Bintang film Nyai Dasima ini berharap warga banyak belajar dari kejadian yang terdahulu sehingga bisa berlindung ke tempat aman dan tinggi. Ia juga berharap informasi terus diperbarui. “Mudah-mudahan tidak parah. Ini ujian dari Allah. Harus sabar, tawakal, pasrah diri, kuat, mudah-mudahan tidak parah, enggak kayak dulu banyak korban,” ungkapnya. (kdc)

Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Tapanuli, Metro Siantar, Metro Asahan, Metro Tabagsel) Chairman : Rida K Liamsi Komisaris Utama : Makmur Kasim Komisaris : Kadafi Direktur Utama : Marganas Nainggolan Direktur : Goldien Purba Pengasuh Pemimpin Umum/Penjab/GM : Marganas Nainggolan Wakil Pemimpin Umum : Goldian Purba Pimpinan Perusahaan : Maranatha Tobing Pimred Metro Tapanuli : Alvin Nasution Wapimred Metro Tapanuli : Daniel Simanjuntak Pimred Metro Siantar : Pandhapotan MT Siallagan Pimred Metro Tabagsel : Muhiddin Hasibuan Pimred Metro Asahan : Eva Wahyuni Tim Ombudsman : Vincent Wijaya DIVISI PRODUKSI Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Alvin Nasution, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana Metro Tapanuli: Syafruddin Yusuf, Kordinator Liputan Tapanuli: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus),Aristo Linghten Panjaitan (Tobasa), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO SIANTAR Dewan Redaksi:Marganas Nainggolan (ketua), Goldian Purba, Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana Metro Siantar: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Penanggungjawab Event & Bisnis: Jhon Damanik, Redaktur: Pholmer Saragih, Plidewatna, Nurjannah, Assisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba, Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi:Yanti Nurhapni METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Muhiddin Hasibuan, Redaktur Pelaksana Metro Tabagsel:.., Kordinator Liputan Tabagsel: Borneo Dongoran, Reporter : Parlindungan Pohan (Padangsidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar , (Palas),Mhd Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Eva Wahyuni, Hermanto Sipayung, Redaktur Pelaksana Metro Asahan: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Salomo Seven H Malau, Kabag: Ahmad Yasir, Staf Pracetak:Jamaluddin Sinaga, Amiruddin, Hedry Handoko, Jefree Putra, Andre Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kord Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Roy Amarta, Ismail, Efendi Tambunan, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico, Ardi, Erik Departemen Iklan Manager Iklan: Jamot S, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba PERWAKILAN METRO TAPANULI Ka Perwakilan Tapanuli/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah sari, Staf Pengembangan: Zulfiandi, Perwakilan Tabagsel Ka Perwakilan Tabagsel/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran Pematangsiantar : Jalan Sangnawaluh No.24 Komplek Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Pematangsiantar. e-mail : Perwakilan Jakarta: Jalan Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522 Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733

dengan baik. “Saya juga telah memerintahkan Kepala Badan Nasional Penanggulangan Bencana untuk segera terbang ke Aceh bersama tim untuk memastikan semuanya under control dan mengambil tindakan yang diperlukan,” kata Presiden. Menurut Presiden, ketika gempa terjadi, warga di sekitar Aceh memang panik. Namun, saat ini, warga Aceh telah berada di tempat yang aman. Sembilan gempa di antaranya terjadi di Simeulue. Gempa yang terjadi di Simelue dikatakan terasa paling keras. Berikut ini adalah sembilan gempa yang mengguncang Simeulue:

1. Pukul 15:38:33 Gempa Bumi sebesar 8,5 SR terjadi di 346 km Barat Daya Simeulue pada kedalaman 10 kilometer. Gempa ini diikuti potensi tsunami 2. Pukul 15:38:35 Gempa Bumi sebesar 8,3 SR terjadi di 341 km Barat Daya Simeulue pada kedalaman 42 kilometer 3. Pukul

Bagas ‘Disunat Jin’

Sambungan Halaman 1

Warga di sana pun heboh lalu beramai-ramai mengunjungi rumah Rusma boru Sitompul (30) dan Muksin Panggabean (38) yang notabena ayah dan ibu Bagas. Diceritakan ibu Bagas kepada koran ini, dia mengetahui anaknya disunat lewat teman anaknya bernamaMiji,Sabtu(7/4)sekira pukul 16.00 Wib. Kala itu Bagas seorang diri tidur-tiduran di teras masjid Taqwa yang berada di samping rumahnya. Setelah terbangun, Bagas bermain bersamaMijidanteman-temannyadi belakang rumah Miji. Nah, saat asyik bermain, Bagas ingin buang air kecil. Bagas pun melangkah ke dekat sebuah batu, lalu

buang air kecil. Tapi ternyata saat Bagas pipis, Miji melihat ‘anunya’ Bagas sudah disunat. Miji pun mengabari kepada temannya yang lain. “Setiap hari aku bekerja di sawah. Aku sempat terkejut melihat rumah ramaidikunjungiorang.Memangaku selalu meninggalkan Bagas sendiri di rumah. Suami saya juga setiap hari keluar rumah karena dia bekerja di sebagaikenekbangunan,”kataRusma sambilmenggendongputranya,Bagas. “Dan setelah saya masuk ke dalam rumah, dan melihat ‘anunya’ anak saya, saya lihat sudah disunat. Dan aneh nya tidak meninggalkan bekas luka. Bagas pun tidak menujukkan rasakesakitan.Sayapikir Bagashanya main-main,kemudianwargamenyu-

ruh saya mengoleskan minyak ke ‘anunya’,” sambung Rusma. “Ibu-ibu di sini juga bilang karna seringsayatinggalkanmakanyaBagas disunat,” timpalnya lagi. Rusma sempat kebingungan melihat fenomena yang terjadi pada anaknya. Kemudian dia menemui ‘orangpintar’.“Orangpintaritubilang kalau yang menyunat Bagas adalah opung kami. Orang pintar itu kemudian memberi makan siri dan disemburkan ke kemaluan Bagas,” katanya. Dikatakan nya Setelah ayah nya pulang bekerja dan mengetahui Bagas sudah disunat, ayah Bagas hanyamengatakaninisuatumukjizat. Kemudian keesokan harinya, Senin (9/4) Bagas dibawa ke Puskesmas

pada diri manusia dan juga bisa masuk dalam tubuh manusia, seperti dalam kisah Abu Hurairah, di mana ada jin yang mencuri gandumnya di gudang. Artinya jin bisa menyunat manusiaitumungkinsajaterjadi.Tapi apakah esensi dari jin menyunat manusia, tidak tahu. Yang perlu diketahui adalah tidak ada manfaat syar’i apapun dari anak yang disunat itu, jadi tidak penting untuk diketahui kenapajinmenyunatanakitu,karena sampai hari ini kita belum bisa mencerna. Kalau memang tidak ada yang menyunat, tiba-tiba ketika anak itu pulang dari main dan sudah tersunat, dibawa ke dokter, katanya sunatannya sangat bagus. Pertanyaannya,

siapa yang menyunat, itu masalahnya. Apakah anak tersebut harus diruqyah? Kalau setelah peristiwa itu, anak tersebut mempunyai masalah misalnya sakit, bertingkah laku aneh atau kemudian anak itu bisa melihat makhluk halus, maka ia harus diruqyah.Karenatujuandarijinterhadap anak ini adalah menyebarkan fitnah dan kemusyrikan di antara manusia, karena masyarakat akan mengagungkan anak yang dianggapnya ajaib ini. Namun,kalauiaberprilakunormal, maka tidak perlu diruqyah, yang penting orangtuanya rajin berdoa untuk keselamatan anaknya. Wallahua’lam. (int)

Sementara itu, jika istilah sunat jin terjadi pada anak seumuran SD, biasanya mereka mengalami paraphimosis. Paraphimosis dalam ilmu medis, phimosis atau kelainan bentuk penis yang terjadi akibat satu keadaan di mana preposium tidak bisa ditarik kebelakang sampai kepala dan leher penis. Kalaupun dipaksa ditarik sampai kebelakang dapat menimbulkan ‘paraphimosis’ atau gland penis dan colum terlihat sehingga terlihat seolah-olah seperti telah disunat. Kebanyakan terjadi lantaran penis sering dibuat main-main pada anak dan tidak bisa dikembalikan. Untuk paraphimosis, anak harus disunat untuk menghilangkan kulup yang menjerat penis. Dengan begitu, saat anak masih kecil, kepala penis sudah terlihat dan oleh

masyarakat biasanya dianggap sudah disunat oleh jin atau makhluk halus lainnya. Idealnya, usia anak dikhitan adalah antara umur 10-11 tahun, karena pada usia itu, si anak lebih mudah diajak berkomunikasi. Fungsi khitan membawa manfaat baik bagi kesehatan, selain menurunkan risiko terinfeksi HPV, khitan bermanfaat menghilangkan tumpukan kotoran akibat terhalang kulit sehingga mencegah peradangan kronis dan menurunkan risiko kanker penis. Jadi fenomena sunat jin semua itu kita serahkan kepada masyarakat, dan untuk mengubah sugesti masyarakat diperlukan waktu dan pembuktian, serta peran orangtua anak dan tentunya tenaga medis. (sumber: tempo interaktif)

Benarkah Jin Bisa Menyunat?

Sambungan Halaman 1 sendiri belum pernah menjumpai peristiwa seperti ini, baik diriwayatriwayat maupun di berbagai literatur tentang disunat oleh jin. Tetapi, kalau pertanyaannya mungkin atau tidak mungkin, maka pertanyaan itu akan mirip dengan pertanyaan yang disampaikan kepada para Ulama, misalnya mungkinkah manusia bisa memiliki keturunan dari jin? Cerita seperti inipun banyak terkenal di masyarakat, tetapi secara pengalaman di zaman sahabat Nabi belumpernahditemui.Kalauditanya mungkin, ya mungkin saja. Sesungguhnya, jin bisa menyentuh atau bisa melakukan apa saja

Bukan Disunat Jin!

Sambungan Halaman 1 ataupun kelainan bentuk penis yang diketahui sejak lahir dan tidak ada kaitannya dengan unsur ghaib. Pada kelainan tersebut, kulup penis tidak sempurna, hanya ada di bagian atas (dorsalhoot). Pada kelainan tersebut, lubang penis tidak terdapat di ujung, melainkan di bawah, samping, atau dasar penis. Penis juga membengkok. Bila bengkoknya berat dan tidak segera ditangani, penis penderita tidak bisa dibuat bersenggama bila sudah dewasa. Karena itu, hipospadia harus ditangani dengan operasi. Idealnya, operasi hipospadia dilakukan saat anak berusia 1-2 tahun. Penyebab hipospadia adalah terhentinya pertumbuhan pada penis.

NAFAS BERAT KARENAASMA KINI SEMBUH DENGAN SUSU memiliki kandungan gizi yang penyempitan karena MILKUMA

Hariyem, w a r g a Bakalan, T a m a n Agung, Muntilan, J a w a Tengah kini tak lagi merasakan derita sesak nafas. Ternyata, sudah 4 bulan ini ia minum Milkuma, minuman serbuk susu etawa yang diproses secara alami, tanpa pemanis buatan dan bahan pengawet. Bahan dasarnya adalah susu etawa segar dan gula aren. "Sudah 2 tahun saya menderita asma. Alhamdulillah setelah minum Milkuma, kini saya sudah sehat, nafas berat dan sesak karena asma sudah tidak kambuh lagi." Terang wanita berusia 50 tahun tersebut. Penyakit sesak nafas atau asma telah menjadi salah satu penyakit yang sangat familiar dengan rakyat Indonesia. Ketika asma menyerang, saluran nafas mengalami


hiperaktifitas terhadap rangsangan tertentu, yang menyebabkan peradangan. Penyempitan saluran pernafasan tersebut merupakan respon terhadap rangsangan yang pada paruparu normal tidak akan mempengaruhi saluran pernafasan. Penyempitan ini dapat dipicu oleh berbagai rangsangan, seperti serbuk sari, debu, bulu binatang, asap, udara dingin dan olahraga. Dengan tubuh yang sehat, kini nenek 1 orang cucu tersebut dapat menjalani aktifitasnya dengan nyaman. Ia pun mengajak orang lain untuk merasakan manfaat susu etawa ini, "Mari kita sehat bersama Milkuma." Ajak ibu rumah tangga tersebut. Sebenarnya, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu etawa. Berbeda dengan susu sapi, sesungguhnya susu etawa

lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Selain mengandung Riboflavin, vitamin B yang penting untuk produksi energi, susu etawa pun tidak menyebabkan alergi sehingga aman, dan bermanfaat untuk penderita asma. Satu gelas susu etawa memasok 20,0% dari nilai harian Riboflavin. Selain itu, mengkonsumsi Milkuma sebanyak 2 gelas sehari bermanfaat untuk menjaga daya tahan tubuh dan meningkatkan vitalitas. Fluorine yang terdapat dalam susu etawa bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan tidak menimbulkan dampak diare pada orang yang mengkonsumsinya. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Milkuma dikomposisikan dengan gula aren sehingga aman bagi penderita diabetes.

16:28:02 Gempa Bumi sebesar 6,5 SR terjadi di 510 km Barat Daya Simeulue pada kedalaman 10 kilometer 4. Pukul 16:48:03 Gempa Bumi sebesar 6,1 SR terjadi di 630 km Barat Daya Simeulue pada kedalaman 10 kilometer 5. Pukul 17:09:51 Gempa Bumi sebesar 6,1 SR terjadi di 492 km Barat Daya Simeulue pada kedalaman 10 kilometer 6. Pukul 17:21:27 Gempa Bumi sebesar 5,7 SR terjadi di 335 km Barat Daya Simeulue pada kedalaman 23 kilometer 7. Pukul 17:43:06 Gempa Bumi sebesar 8,8 SR terjadi di 483 km Barat Daya Simeulue pada kedalaman 10 kilometer. Gempa ini diikuti potensi tsu-

nami 8. Pukul 17:43:11 Gempa Bumi sebesar 8,1 SR terjadi di 454 km Barat Daya Simeulue pada kedalaman 24 kilometer 9. Pukul 18:04:45 Gempa Bumi sebesar 6,1 SR terjadi di 460 km Barat Daya Simeulue pada kedalaman 10 kilometer Menurut Sutopo, gempa sangat dirasakan hingga di Sumatera Barat. “Sementara itu, di Bengkulu, tepatnya di Kota Bengkulu, gempa terasa sedang. Di Kabupaten Muko-muko, gempa tidak dirasakan,” kata Sutopo pada jumpa pers di kantor BNPB, Rabu malam. Ditambahkannya, akibat gempa, jaringan listrik di provinsi Aceh padam. (yus/ron/dai/ rah)

Tukka. Dokter yang merawat membenarkan kalau Bagas sudah dikhitan atau disunat. “Hanya diberikan obat anti biotik untuk penyembuhan,” ucap Rusma. Ketika fenomena sunat ini ditanyakan kepada tokoh masyarakat setempat,TotalSilitong,mengatakan, di desanya baru kali pertama terjadi

anak tiba-tiba disunat. Sementara ustad setempat Syaripuddin Zega (34) mengatakan, sebagai umat Islam jangan sampai terjebak dengan hal-hal yang dapat menyebabkanmanusiamusyrik.“Ini kuasa Tuhan. Semuanya bisa terjadi kalau Tuhan berkehendak,” katanya. (aris)

Sambungan Halaman 1

yang ditemui di tepi pantai mengatakan pihak kecamatan tetap memantau perkembangan tsunami pasca gempa Simeuleu sore tadi. “Kita ke sini untuk memantau perkembangan isu potensi tsunami dan tetap berkomunikasi dengan BMKG agar dapat menginformasikan kepada warga. Kita menenangkan warga agar tidak panik, namun tetapwaspada,”kataHermanSuwito. Dampak gempa memang belum dapat diinventarisir secara keseluruhan. Namun pantauan koran ini, ada beberapa gedung dan rumah ibadah yang rusak. SyarfiImbauJanganPanik Isukalautsunamijugaakanmelanda Kota Sibolga dan Tapteng. “Jujur, saya traumadengantsunamiyangterjadidi Acehbeberapatahunyanglalu,sebab waktutsunamidiAcehsayaberadadi sana. Maka saat gempa tadi dan mendengarsumbernyadariAceh,saya langsung trauma dan mengungsi di GORAekParombunanSibolga,”tutur Herawati, warga Kalangan, Pandan, Tapteng,kepadaWaliKotaSibolga,Drs HM Syarfi Hutauruk yang meninjau sejumlah tempat-tempat pengungsian di Sibolga, Rabu (11/4) malamkemarin. Hal ini beralasan, katanya lagi, sebab sebelum tsunami melanda Aceh beberapa tahun lalu, diawali dengan adanya guncangan gempa yang sangat kuat, dan tak lama tibatiba saja air laut sudah meluap menghantam Aceh. “Yang pasti saya trauma dengan tsunami, sehingga kami memutuskan untuk mencari tempat yang tinggi dan aman dari bahaya tsunami. Sebab informasi kami dengar, Sibolga dan Tapteng akan dilanda tsunami dan kami tidak akan pulang malam ini sampai keadaan betul-betul tenang,” katanya. (mas)

Warga Barus Panik!

kemudian mengungsi. Amatankoranini,pascagempa8,1 SR dan 8,5 SR, ribuan warga Barus khususnya yang tinggal di sekitar pantai mengungsi ke tempat-tempat yang lebih tinggi seperti di Desa Siharbangan, Sihorobo, dan Hutaginjang Kecamatan Barus Utara. Ada yang berjalan kaki, naik sepedamotor, mobil dan juga truk. Mereka tak lupa membawa barangbarang berharga. Di pengungsian warga mendiami masjid dan gereja serta rumah-rumah warga. Namun sebagian besar warga tetap memilih bertahan di rumah masing-masing, tapi dalam kondisi siaga. Selebihnya ada yang menatap laut dari tepi pantai untuk mengamati apakah ada tanda-tanda tsunami. Camat Barus Drs Herman Suwito dan Kapolsek Barus Iptu Ferymon serta anggota Koramil 01 Barus Serda Abdullah Lubis juga terlihat di sekitar pantai Barus. Namun secara keseluruhan hingga pukul 20.30 Wib kemarin,wargamasihtetapbertahan di tempat pengusian. RidhamsalahseorangwargaBarus yang mengungsi mengaku takut sehingga dia mengungsi ke daerah yang lebih tinggi. Ridham juga membawa keluarganya karena takut terjadi tsunami apalagi, setahu Ridham, sudah ada peringatan tsunami dari Badan Metereologi Geofisika (BMG). “Kalau gempa yang pertama kita masih memilih bertahan, tetapi setelahterjadigempasusulandengan kekuatan yang lebih tinggi, saya dan keluarga menjadi takut dan memilih mengungsi ke tempat yang lebih aman,” katanya. Camat Barus Drs Herman Suwito

Tahanan Tak Dikasih Pipis Sambungan Halaman 1 lalu. Tetapi berbeda dengan JPU Desi Angeline S, SH yang kebetulan menjalankan pengadilan, Desi mengaku tidak takut karena sudah sering terjadi di Daerah Sibolga. “Ngapain takut, sudah biasa kok, lagian matikan hanya sekali”

jawabnya sambil tersenyum. DemikianjugaterjadidiSMKPGRI Sibolga. Para siswa-siuswi juga terpaksa dipulangkan lebih awal dari semestinya. Pada saat gempa tersebut,siswa-siswiyangsedangbelajar juga langsung berhamburan keluar dari ruangan. Mereka mengatakan sengajadipulangkanlebihawal.(fred)

Tsunami Mini terjadi di Nias, Meulaboh, dan Sabang Sambungan Halaman 1 dan Humas Badan Nasional Penanggulangan Bencana Sutopo Purwo Nugroho pada jumpa pers di kantor BNPB, Jakarta, Rabu malam. “Pada pukul 17.00 terdeteksi tsunami di Sabangsetinggi0,06meterdanpadapukul17.04 di Meulaboh setinggi 0,8 meter,” kata Sutopo mengutip data Badan Metereologi, Klimatologi, dan Geofisika (BMKG). Sementara itu, berdasarkan data dari Badan Koordinasi Survei dan Pemetaan Nasional, tsunami yang terjadi ini di Lahewa setinggi 1 meter. Ketika ditanya soal potensi gempa yang lebih tinggi, Sutopo mengatakan, pihaknya terus melakukan analisis. Pantauan Rakyat Aceh (grup Metro Tapanuli), akibat gempa warga berhamburan dan bahkan karena ketakutan esksodus ke tempat yang lebih tinggi. Warga di kawasan pesisir (pantai) keluar dari pemukiman dan eksodus menuju ke kawasan tinggi di Banda Aceh seperti ke kawasan Lambaro dan kawasan Jalan daerah tinggi lainnya. Warga di kawasan pesisir Peulangahan, Lampaseh, Kampung Jawa, menghindar menuju daerah lebih tinggi dengan menggunakan kendaraan bermotor roda dua dan empat serta jalankaki. HalinijugaterjadidiKabupatenAceh Barat Daya (Abdya) eksodus ke daerah lebih tinggi di kawasan pergunungan Blangpidie. Gelombang eksodus mulai terlihat 15 menit pasca gempa. Warga Susoh, dan sekitarnya dengan menggunakan sepedamotor dan

kendaraan roda empat bergerak menuju dataran tinggi Blangpidie hingga ke Guhang. Sedangkan warga pesisir Sangkalan dan Ujung Tanah berlarian ke arah Pergunungan di Bukit Hijau. Mareka membawa keluarga berhenti di depan kantor Bupati Abdya sambil menunggu informasi berikutnya. Ibu setengah baya warga Sangkalan dihubungi Rakyat Aceh saat sedang eksodus bersama suaminya mengaku ada orang yang melihat air laut sudah mulai surut. “Bang air laut surut makanya kami lari,” ujarnya sambil berlarian menggendong anaknya yang masih kecil. Hingga berita ini diturunkan, konsentrasi masa masih berada di daerah yang tinggi. Mareka belum berani pulang ke rumah takut air laut akan naik. “Kami tidak akan pulang dulu sampai betul butul aman,” ujar salah seorang warga saat berada di depan Kantor Bupati Abdya. Setelah gempa reda beberapa saat warga yang menghidar karena akan terjadi tsunami, membuat ruas jalan sangat padat warga yang mengungsi. Terlebih adanya sirene memungkinkan terjadi tsunami. Kepala BMG Aceh yang dihubungi Rakyat Aceh melalui saluran selular mengatakan, gempa memang cukup tinggi dan dirasakan di seluruh Aceh yakni di Banda Aceh, Meulaboh, Langsa, Bireuen, Singkil, Aceh Barat Daya (Abdya) bahkan hingga dataran tinggi Gayo Takengon. Getaran gempa ini juga dirasakan sampai Sumatera Utara, Sumatera Barat, Bengkulu, Lampung bahkan dilaporkan juga dirasakan hingga negara tetangga Malaysia.

“Belum ada laporan masuk kepada kita adanya kerusakan dan korban jiwa. Namun memang gempa berpotensi tsunami, karena itu kita telah membunyikan sirene peringatan dini (early warning) supaya warga waspada,” tukasnya yang mengaku saat itu berada di pendopo Pemprov Aceh Dikatakannya juga, gempa susulan terus dirasakan oleh warga. Dilaporkan gempa susulan berkekuatan 8,1 SR. “Saat ini beberapa gempasusulanterjadi.Inisaatkitatelpongempa cukup kuat juga terjadi,” tukasnya. Begitupun dari dataran Tinggi Gayo Takengon dilaporkan satu rumah warga ambruk yakni di di Kecamatan Jagong Aceh Tengah. “Satu rumah milik Pak Temin yang merupakan Kepala Dusun Kampung Paya Empan Kecamatan Jagong ambruk akibat gempa ini,” kata salah seorang Anggota DPRK Aceh Tengah, Bardan Sahidi, melalui pesan singkat yang diterima wartawan koran ini. Gempa dirasakan warga Abdya saat hujan deras. Hentakan keras dari “bawah bumi.” alhasil membuat warga berteduh dari guyuran hujan, berhamburan ke jalan dan mengakibatkan salah satu jalan protokol Kota Takengon menjadi macet. “Allahu Akbar – Allahu Akbar,” jerit sejumlah warga yang terlihat berlarian dan tak sedikit memegangpagarkarenamerasapeningberbaur rasaketakutan.Danbanyakpulaparapngendara mobildansepedamotormengentikankendaraan mereka karena takut tertimpa pohon dan tiang listrik yang dikhawatirkan akan tumbang. (yus/ ron/dai/rah)





Negeri Wisata Sejuta Pesona

Safran Siap Pimpin KNPI Tapteng P A N D A N Meskipun jadwal pela k s a n a a n musyawarah kabupaten (muskab) DPD Komite Nasional Pemuda Indonesia (KNPI) Tapanuli Tengah (Tapteng) belum ditetapkan, namun sejumlah nama kandidat KNPI 1 Tapteng itu sudah muncul ke permukaan. Salah satun„ Safran Matondang ya yakni, Safran Matondang SE, Ketua Al Wasliyah Tapteng yang juga mantan Ketua Panwaslu Tapteng ini menyatakan diri siap untuk bertarung dalam muskab KNPI yang bakal digelar dalam waktu dekat ini. “Saya siap maju dan bertarung dalam muskab KNPI mendatang, dan ini sekaligus menjawab keraguan dari masyarakat, khususnya kawankawan dari sejumlah elemen masyarakat dan elemen pemuda yang telah memberikan dukungan kepada saya untuk maju sebagai ketua KNPI Tapteng periode 2012-2015,” kata Safran kepada METRO, Selasa (10/4) kemarin di Pandan. MenurutSafran,sejakmunculnyasejumlahnama yangmenghiasibursakandidatKetuaKNPITapteng, dirinyasudahberencanauntukikutbertarungdalam meraih kursi Ketua KNPI Tapteng dalam muskab yang bakal digelar. “Namun semua itu butuh berbagai pertimbangan dan pemikiran yang matang, sebab saya tidak mau mencalonkan diri hanya untuk sekedar meramaikan bursa pencalonan ketua KNPI Tapteng,” pungkas pria yang juga menjabat sebagai Wakil Ketua KNPI Tapteng ini. Keseriusan menjadi pemimpin KNPI Tapteng ini, kata Safran, merupakan keterpanggilan dirinya untuk membenahi dan membawa sebuah perubahan di tubuh KNPI Tapteng, serta adanya dukungan sejumlah organisasi kepemudaan dan pimpinan kecamatan KNPI Tapteng. “Secara tegas saya nyatakan, saya siap maju menjadi Ketua KNPI Tapteng sesuai panggilan jiwa sebagi putra Tapteng. Dan saya cukup optimis dengan hal itu, ditambah adanya konsolidasi dan dukungan dari kawan-kawan pengurus OKP dan sejumlah pimpinan kecamatan KNPI di Tapteng,” tegas Safran lantas menyampaikan apresiasi dan terimakasih atas dukungan yang diberikan kepada dirinya. Pelaksanaan Muskab yang akan dilakukan nantinya, harap Safran, bisa dijadikan momentum KNPI kembali kepada kejayaannya. “Saya berharap, Muskab ini dapat dijadikan sebagai momentum konsolidasi kaum muda untuk memiliki daya tawar kepada Pemerintah Daerah. Sehingga kedepannya, KNPI diperhitungkan lagi oleh pemerintah dengan memunculkan suatu ide-ide atau gagasan mengenai pemerintahan dalam konteks membangun Tapteng untuk lebih maju lagi dan sekaligus sebagai wadah kontrol dalam program yang sedang digulirkan pemerintah. Namun disisi lain, KNPI juga harus bisa membantu pemerintah dalam meningkatkan pembangunan misalnya di bidang pariwisata dan infrastruktur yang sedang dicanangkan oleh Pemkab Tapteng dengan konsep negeri wisata sejuta pesona,” tukas Safran lalu menambahkan, tanpa dukungan pemuda dan elemen masyarakat lainnya, pemerintah tidak akan bisa melakukan pembangunan dengan maksimal. (tob/nasa)

Demokrat Tapteng Audensi ke Wabup

Bahtiar Sibarani Tak Diajak PANDAN- Jajaran pengurus DPC Partai Demokrat Tapteng, Rabu (11/4), melakukan audensi ke Wakil Bupati, Sukran J Tanjung, di ruang kerjanya Pemkab Tapteng. Dari keseluruhan rombongan itu, tak tampak wajah Ketua Komisi A DPRD Tapteng dari Partai Demokrat, Bahtiar Ahmad Sibarani. Bahtiar Sibarani sendiri diketahui merupakan salah satu penggagas lahirnya mosi tidak percaya 23 anggota DPRD Tapteng terhadap kepemimpinan Sintong Gultom sebagai Ketua DPRD Tapteng. Bahkan Bahtiar Sibarani juga terang-terangan menentang hasil Muscab Demokrat Tapteng yang menetapkan Sintong Gultom sebagai ketua menggantikan Tuani Lumban Tobing. Bahtiar Sibarani menegaskan bahwa muscab Demokrat yang digelar bulan Pebruari di Hotel Wisata Indah Sibolga itu illegal atau tak sah. Bahkan Bahtiar juga melaporkan dua petinggi Demokrat Pusat, Jonni Alen Marbun dan Sutan Bhatoegana, yang memimpin muscap tersebut ke Dewan Kehormatan Partai Demokrat. Terkait audiensi kemarin, Bahtiar Sibarani yang di-

hubungi METRO, mengaku tak diajak. “Tak diajak abang. Sudah dululah tak usah dulu bicara soal Demokrat. Abang lagi di pusat gempa Aceh, keluarga banyak disini,” ujar Bahtiar sembari menyudahi pembicaraan. Sementara di kesempatan audensinya dengan Wakil Bupati, Sintong Gultom selaku ketua DPC yang baru menyampaikan salinan SK kepengurusan partai yang telah disahkan oleh DPP. Sekaligus memperkenalkan jajaran pengurus yang baru. SK tersebut bernomor: 21.26/SK/DPP.PD/DPC/II/ 2012 tertanggal 18 Februari 2012. Ditandatanggani oleh Anas Urbaningrum selaku Ketua Umum DPP Partai Demokrat dan Sekretaris Jenderal Edhie Baskoro Yudhoyono MSc. Adapun para pengurus inti masa bakti 2012-2017 di


SERAHKAN SK- Ketua DPC Demokrat Tapteng, Sintong Gultom menyerahkan salinan SK kepengurusan yang baru kepada Wabup Tapteng Sukran J Tanjung, Rabu (11/4). antaranya Ketua Sintong Gultom SPak, Wakil Ketua I James L Purba BA, Wakil Ketua II Eno Mariono, Sekretaris Syafrizal Lubis serta VIII wakil sekretaris, Bendahara Herbinsar Sitanggang serta VIII wakil bendahara. Ditambah dengan para koordinator dan wakil koordinator segenap devisi. Sementara itu, Ketua Ma-

jelis DPC yakni H Abdul Wahab Situmeang, dengan sekretarisnya Chardin Lumbanturuan. Dan Dewan Kehormatan DPC masing-masing Ketua Drs Gandana Gultom STh dan sekretaris Raja Tua Situmeang. “Demokrat Tapteng siap mendukung program dan visi misi pemerintah daerah. Dengan catatan bahwa kami

Harga Sembako Belum Turun PANDAN- Kendati harga BBM per 1 April 2012 ditunda kenaikannya, namun harapan masyarakat akan turunnya harga sembako tak terealisasi. Pasalnya sejak kenaikan harga itu, sampai sekarang harga beberapa bahan pokok di Pasar Pandan tak juga turun. “Semenjak rencana kenaikan BBM itu, harga beberapa bahan pokok sudah mulai naik. Tetapi setelah kenaikan tersebut ditunda, harga bahan pokok bukannya turun, malah sebagian makin naik,” tutur Boru manurung salahsatu pedagang sembako di Pasar Pandan, Rabu (11/4) siang. Dijabarkannya, harga beras ADT (kuku balam) sebelumnya Rp9.000 per kg, tapi menjelang rencana kenaikan harga BBM, merangkak naik


PANDAN-Harga sembako di Pasar Swasta Pandan Belum turun menjadi Rp9.200 per kg. Dan harga itu terus bertahan. Kemudian beras kuku balam super sebelumnya Rp8.300 per kg naik menjadi Rp8.500 per kg. Begitu juga dengan beras Permaisuri sebelumnya Rp7.000 per kg naik menjadi Rp7.200 per kg.

Dan harga minyak goreng curah yang sebelumnya Rp11.500 per kg, naik menjadi Rp12.000 per kg. Yang paling melonjak adalah gula pasir, seperti gula pasir kristal yang sebelumnya Rp11.500 per kg, kini menjadi Rp12.500 per kg. Dan

tetap menjalankan tupoksi, termasuk para kader Demokrat di legislatif sebagai pengawas anggaran dan legislasi,” tutur Sintong mengisyaratkan sikap Demokrat sebagai partai pemerintah kini. Turut dalam audensi itu penasehat DPC Hot Taruli Lumbantobing, anggota DPRD dari Fraksi Demokrat

Parmulaan Saruksuk dan Devi Sari W Batubara, serta para pengurus DPC lainnya seperti Abednego Panjaitan dan Antonius Ginting. Di kesempatan itu, Wabup Sukran J Tanjung yang mewakili Bupati Tapteng (sedang berada di Jakarta,red) mengakui, bahwa SK kepengurusan DPC Demokrat Tapteng tentunya sudah sah dan berkekuatan hukum sesuai dengan aturan yang ada. Mantan mantan anggota DPRD Sumut itupun mengajak agar DPC Demokrat dapat bersinergi dan bekerjasama dengan Pemkab Tapteng demi mewujudkan pembangunan daerah ke arah yang lebih baik. “Saya ucapkan selamat kepada jajaran pengurus yang baru. Tentunya kita semua ingin Tapteng tetap dalam situasi yang kondusif. Silahkan berpolitik secara dewasa,” pungkas Sukran seraya meminta pengurus baru kiranya dapat segera menyelesaikan masalah internal di tubuh DPC Partai Biru itu, seperti yang terjadi belakangan ini. (mor/nasa)

Bantuan dari PT Sang Hyang Seri

gula pasir biasa yang sebelumnya Rp11.000 per kg, kini menjadi Rp12.000 per kg Sementara harga susu, daging ayam, ikan dan minyak tanah normal. Sedangkan harga telor dinilai menurun. Dari harga Rp29.000 per papan, turun menjadi Rp27.000 per papan. Diperkirakan, kenaikan harga bahan pokok semenjak isu kenaikan harga BBM sampai sekarang sekitar 2,3 persen. Demikian juga dikatakan Boru Lubis yang setiap harinya berbelanja di Pasar Pandan. “Dulu masih isu saja yang keluar, harga sembako sudah mulai naik, tapi sampai sekarang setelah ada penundaan itu, kok masih tetap saja, kenapa gak turun?” ketus Boru Lubis. (fred/nasa)

Belum Maksimal Buat Petani TAPTENG– Realisasi dana bantuan pertanian dari PT Sang Hyang Seri kepada petani di Tapteng masih sangat minim. Padahal ada Rp64 miliar yang dialokasikan perusahaan tersebut. “Sejumlah berkas permohonan petani melalui kelompok pertanian(poktan)masing–masing sudah kami kirimkan. Tapi kendalanya, manajemen perusahaanituadanyadiJakarta,”kata Kadis Pertanian dan Perikanan (Tannak) Tapteng, Dompak Simanjuntak kepada wartawan, Selasa (10/4), kemarin. Dikatakannya, program bantuan berupa pinjaman tersebut masih terbuka. Hanya saja, masih sedikit poktan yang mengusulkan permohonan. Permohonan diajukan Dinas

Pertanian Tapteng. “Masih banyak poktan yang belum mau mengajukan permohonan,” kata Dompak. Dijelaskannya, adapun jenis bantuan yang dapat dimohonkan diantaranya berupa pupuk, benih, obat–obatan, biaya pengolahan lahan dan biaya panen. Atau pihak perusahaan bersedia menyediakan bantuan dana sebesar Rp4 juta per hektar kepada petani. Dari sejumlah permohonan yang sudah realisasi, petani tidak hanyamengincardanatunai,tapi banyak juga yang mengambil pupuk, uang pengolahan lahan sebesar Rp800 ribu, atau uang panen Rp1 juta. “Nilai totalnya yang diambil tidak sampai Rp4 juta,” tuturnya. (mor/nasa)


PENGUMUMAN NOMOR : PENG- 04/WPJ.26/2012 TENTANG REGISTRASI ULANG PENGUSAHA KENA PAJAK TAHUN 2012 Dalam rangka meningkatkan pelayanan, penertiban administrasi, pengawasan dan untuk menguji pemenuhan kewajiban subjektif dan objektif Pengusaha Kena Pajak (PKP), dengan ini diberitahukan kepada seluruh Pengusaha yang telah terdaftar sebagai Pengusaha Kena Pajak (PKP) bahwa: 1. Kantor Pelayanan Pajak Pratama di Lingkungan Kanwil Direktorat Jenderal Pajak Sumatera Utara II sedang melaksanakan Kegiatan Registrasi Ulang untuk seluruh Pengusaha Kena Pajak Terdaftar. 2. Pengusaha Kena Pajak (PKP) adalah para pengusaha yang bergerak di bidang usaha industri, perdagangan dan jasa yang wajib memungut Pajak Pertambahan Nilai (PPN) atas barang dan/atau jasa yang mereka serahkan/ jual dengan omset satu tahun lebih dari Rp. 600 juta.

"SEKARANG STAMINA SAYA SUDAH PULIH" Sudah 11 t a h un lamany a, D o r I s t y s e r ingkalii merasakan h i d u p ny a tidak nyaman k a r e n a men de ri ta hipertensi, " K a l a u tekanan darah tinggi,saya jadi cepat lelah," cerita wanita berusia 54 tahun tersebut. Nenek 3 orang cucu ini menduga, faktor keturunan sebagai penyebab dirinya menderita hipertensi. Stress, faktor keturunan (genetik), usia, konsumsi garam yang tinggi, banyak pengawet, serta lemak dan daging yang tinggi memang merupakan faktor-faktor terjadinya hipertensi yang sering kita sebut dengan tekanan darah tinggi. Kepala terasa pusing, wajah memerah, tengkuk terasa pegal, mudah lelah, dll adalah gejala-gejala yang biasanya dirasakan oleh penderitanya. Kepercayaannya terhadap pengobatan yang alami akhirnya membuat wanita yang akrab disapaTiti ini tertarik untuk mencoba Gentong Mas, minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda) terbukti memiliki banyak manfaat untuk kesehatan.

Ternyata pilihannya itu tepat, "Saya bersyukur sekali, setelah minum Gentong Mas secara rutin selama 4 bulan, Puji Tuhan... Sekarang keluhan saya mulai berkurang, badan jadi terasa segar, dan stamina sudah pulih." Ungkap warga Perumahan Johor Indah Permai, Medan, Sumatera Utara ini dengan bahagia. Hipertensi (hypertension) adalah suatu keadaan di mana seseorang mengalami peningkatan tekanan darah di atas normal yang ditunjukkan oleh angka systolic (bagian atas) dan diastolic (angka bawah) pada pemeriksaan tensi darah. Nilai normal tekanan darah seseorang secara umum adalah 120/ 80 mmHg. Dalam aktifitas seharihari, tekanan darah bervariasi tetapi masih dalam kisaran normal. Tetapi secara umum, angka pemeriksaan tekanan darah menurun saat tidur dan meningkat diwaktu beraktifitas atau berolahraga. Dengan tubuh yang sehat, sekarang ibu rumah tangga ini dapat menjalani aktifitas sehari-harinya dengan nyaman. Ia pun tidak segan-segan membagi pengalaman baiknya itu dengan orang lain, "Mudah-mudahan pengalaman saya yang mendapat kesehatan dengan cara yang alami ini dapat bermanfaat bagi orang lain." Harapnya. Habbatussauda dalam Gentong Mas bermanfaat untuk memelihara

pembuluh darah dari endapan lemak dan pengapuran. Sementara Kayu manis yang juga dikandung dalam Gentong Mas berfungsi sebagai penormal tekanan darah. Sedangkan GulaAren selain rasanya manis dan lezat juga bermanfaat menurunkan penyerapan lemak. Untuk hasil maksimal, terapkan pola hidup sehat seperti menjalani diet rendah garam, kolesterol, dan lemak jenuh, stop konsumsi makanan dan minuman beralkohol, hindari stress, olahragateratur, dll. Manfaat yang hebat bagi kesehatan dan rasa yang lezat membuat semakin banyak masyarakat mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Untuk informasi lebih lanjut silahkan kunjung i www.gentongmas. com. Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/ toko obat terdekat atau hubungi: Medan : 081384777787 Sidikalang : 081384777787 Dolok Sanggul : 081384777787 Gunung tua : 081384777787 Batubara : 081384777787 Tobasa : 0813 8477 7787 Nias : 0813 8477 7787 Tebing Tinggi : 0813 2209 9495 Siantar : 082167538848 Binjai : 0813 9866 6166 Lbk Pakam : 082164659699 Karo : 0821 6753 8828 Langkat : 0812 6321 7797

3. Jangka waktu pelaksanaan Registrasi Ulang Pengusaha Kena Pajak dimulai sejak Pebruari 2012 sampai dengan 31 Agustus 2012. Demikian disampaikan untuk diketahui. Pematang Siantar, 13 Maret 2012 Kepala Kantor, Ttd

Harta Indra Tarigan NIP. 195808251980121001




April 2012




APA KATA MEREKA Saya tidak mau menyalakan lagi kompor yang sebenarnya sudah menyala. Karenanya, saya menegaskan, tidak benar saya mau jadi presiden! Saya tidak akan menanggapi siapapun ataupun partai politik jika adayang berencana mengusung saya.

Kepala daerah bisa meminta bantuan kepada TNI untuk memberi pengamanan jika ada konflik sosial. Undangundang juga menyebutkan jenis-jenis tugas TNI

Tuduhan aksi penolakan BBM merupakan upaya penjatuhan kekuasaan merupakan tuduhan yang salah. Perjuangan buruh murni dan tidak ada kepentingan politik sesaat.

Mendagri Gamawan Fauzi, Rabu (11/4)

Presiden K-SPSI Andi Gani Nena Wea, Rabu (11/4)

Menteri BUMN Dahlan Iskan, Rabu (11/4)

Kirim Opini Anda ke email: metrotapanuli Maksimal tulisan 5.000 karakter.

Sikap Kami Ketika Yang Mulia Menuntut Kesejahteraan Para hakim yang mulia, tiba-tiba resah lantaran gaji yang diperolehnya dirasakan tidak mencukupi kebutuhan hidup. Anehnya, protes para hakim baru dilakukan sekarang, saat praktik mafia hukum menjadi sorotan. Benarkah protes hakim sebagai bukti efektifnya pemberantasan mafia hukum di tubuh kehakiman? Bisa jadi iya. Kini, para hakim mulai pusing atau syukur kalau sampai takut, untuk melakukan praktik suap atau kongkalikong. Tapi, bisa juga tidak terkait dengan dalih pemberantasan mafia hukum. Sebab, kata mantan hakim Konsitusi Jimly Asshiddiqie, selama ini penghasilan hakim di Indonesia memang lebih redah dari gaji Pegawai Negeri Sipil (PNS). Padahal, menurut Jimly, status para hakim masih terkait dengan PNS dan hakim bekerja atas nama negara yang mengambil keputusan demi keadilan berdasarkan Ketuhanan Yang Maha Esa. Hakim ketika memutuskan vonis harus objektif dan berdasarkan pada Ketuhanan Yang Maha Esa, bukan berdasarkan arahan atasan yang seolah-olah bisa disetir. Meski demikian, sampai saat ini, hakim tak mendapatkan tunjangan seperti PNS yang cara kerjanya berdasarkan arahan atasan. Masih banyak juga hakim yang belum punya rumah meski tak sedikit yang punya rumah mewah di kota besar. Berkaca pada dua hal itu memang pemerintah harus arif dalam menyikapinya. Memikirkan kenaikan kesejahteraan para hakim perlu dilakukan. Tapi, yang lebih penting, pengawasan terhadap hakim harus jauh lebih diperketat. Jadi, hakim yang masih miskin perlu dikatrol pendapatannya, dan yang masih doyan “bermain” harus tegas mendapatkan sanksi. Jika sudah berjalan sistem, maka dengan sendirinya wibawa hakim yang dikatakan sebagai wakil tuhan juga bisa diwujudkan. (***)

Sisi Gelap Demokrasi Indonesia Edward Shils (1972) mengatakan bahwa praktek politik Indonesia bukan lahan subur untuk idealitas dan perjuangan. Meskipun banyak ilmuwan dan praktisi politik memiliki ide kebangsaan, namun mereka tidak berhasil membangun bangsanya sendiri.

Hamidulloh Ibda Kenyataannya, penampilan Indonesia sebagai negara demokrasi sepertinya belum ideal. Praktek KKN terus berlanjut, pembobolan bank belum berhenti, penyalahgunaan wewenang merajalela, mafia hukum dan peradilan semakin kasatmata, kekerasan semakin menghantui masyarakat. Tentu saja ada banyak faktor penyebab. Akan tetapi, inti persoalannya berada pada terabaikannya penataan ulang dan pembenahan kejiwaan bangsa. Dalam hal ini mencakup masalah ideologi, paham kenegaraan, serta perubahan paradigma pendekatan dalam penyelenggaraan negara yang kental dengan ”pragmatisme-reaksioner”. Dengan menempatkan secara tunggal bahwa demokrasi adalah segalanya, maka dengan mudah negara berdalih semua proses dan kebijakan negara adalah hasil dari aspirasi warga negara melalui berbagai hal termasuk wakilnya di parlemen. Inilah barangkali oleh para penyelengaara negara dijadikan legitimasi. Rasionalitas politik yang mencakup legislatif, eksekutif, dan yudikatif sesungguhnya mempunyai fungsi checks and balances dalam paket enam lembaga negara demokrasi yaitu: partai politik, pemilu, parlemen, eksekutif, peradilan, dan media bebas. Namun, kenyataannya publik sudah tidak percaya dengan pengejewantahan nilai-nilai demokrasi. Partai politik misalnya, sebagai salah satu instrumen demokrasi suatu negara sampai

hari ini kehilangan ruh sesungguhnya, yaitu tekad, semangat, jiwa dan citacita serta spirit perjuangan untuk membela kepentingan rakyat. Yang terjadi justru mereka lebih sibuk ngurus perutnya sendiri dan kelompoknya dengan menyedot uang negara melalui berbagai modus. Hal ini terbukti dengan berbagai kasus seperti Nazaruddin, hakim Syarifudin, Nunun Nurbaeti, Century, dan sebagainya. Demokrasi yang Haram Dalam sejarahnya, semua kekuasaan yang ada dalam masyarakat sedikit banyak memiliki andil menitipkan kepentingan pada negara. Namun, tak dapat dipungkiri ada kelompok yang dominan dibandingkan dengan kelompok lainnya sehingga kepentingan lebih banyak berhasil. Meskipun semrawut, proses demokratisasi di dunia masih terus berlanjut. Dengan dalih demokrasi, banyak politisi dengan mudahnya mereka menyalahgunakan posisinya. Dengan dalih demokrasi, mereka bisa berbuat sakarepe dewe. Dengan demokrasi, mereka berdalih untuk apa pun. Hampir semua negara di dunia ini meyakini demokrasi sebagai tolok ukur dari keabsahan politik. Keyakinan bahwa kehendak rakyat adalah dasar utama kewenangan pemerintah menjadi basis bagi tegak kukuhnya sistem politik demokrasi. Hal itu menunjukkan bahwa rakyat diletakkan pada posisi penting walaupun secara operasional implikasinya tidak demikian. Hukum Besi Dalam politik demokrasi, hal ini dikenal semacam black hole dalam tata politik, populer disebut the dark-side of democracy (sisi gelap demokrasi). Melalui proses yang demokratis, akan terjadi transformasi kedaulatan menjadi kewenangan. Kewenangan inilah yang dimanfaatkan oleh mafia di Indonesia untuk tidak berdemokrasi dengan baik. Akhirnya, hukum besi oligarki muncul. Penguasa oligarki ini berkuasa di

Negara ini atas nama rakyat yang tertindas, selalu berusaha melestarikan dan memonopoli kekuasaan dan ekonomi yang dipegangnya dengan selubung ideologi tertentu yaitu demokrasi. Dengan dalih konsensus Perserikatan Bangsa-Bangsa (PBB), penguasa oligarki ini menghancurkan setiap pihak yang menentang dan mempertanyakan legitimasinya dengan berbagai macam tuduhan dan fitnah. Lantas, di mana letak falsifikasi demokrasi. Sesuai dengan artinya, falsifikasi adalah teori yang gagal karena tidak dapat bertahan terhadap suatu eksperimen dan digantikan oleh teori spekulatif lain. Ini berarti, demokrasi berkembang melalui kesalahan dan kekeliruan yang telah secara tidak langsung diterapkan oleh Indonesia. Oleh karena itu, demokrasi sangat pantas untuk dikaji kembali guna ditemukan teori-teori baru yang baik untuk kemaslahatan umat manusia. Menurut Sadek, J. Sulaymân, dalam demokrasi terdapat sejumlah prinsip yang menjadi standar baku. Antara lain: Kebebasan berbicara setiap warga Negara, Pelaksanaan pemilu untuk menilai apakah pemerintah yang berkuasa layak didukung kembali atau harus diganti kekuasaan dipegang oleh suara mayoritas tanpa mengabaikan kontrol minoritas, Peranan parpol yang sangat penting sebagai wadah aspirasi politik rakyat, Pemisahan kekuasaan legislatif, eksekutif, dan yudikatif, supremasi hukum (semua harus tunduk pada hukum), semua individu bebas melakukan apa saja tanpa boleh dibelenggu. Jika prinsip tersebut telaksana, maka impian Indonesia menjadi bangsa yang bermartabat bukanlah sekadar mimpi. Sejak dini kita harus mereformasi pelaksanaan demokrasi di Indonesia. (***) Penulis adalah Ketua Umum Gerakan Pemuda Nusantara (GPN) Cabang Pati Jawa Tengah.





April 2012


Praktik Aborsi

Aktivis Perempuan

Aksi Bugil di Tempat Ibadah KIEV – Maraknya parktik aborsi terhadap perempuan, para aktivis perempuan dari kelompok FEMEN melakukan aksi bugil di tempat ibadah Kota Kiev. Sebanyak lima orang aktivis FEMEN memanjat ke balkon tanpa busana. Mereka mendesak Pemerintah Ukraina agar melarang praktik aborsi karena dianggap melanggar hukum dan rentan kematian perempuan. Masa aksi membawa spanduk bertulisan “Stop Praktik Aborsi”. Tempat ibadah tersebut terdapat di pusat Kota Kiev dan menjadi perhatian banyak warga. Kepolisian langsung bertindak saat mereka melihat lima orang perempuan pirang yang bertelanjang dada itu. Empat orang aktivis diciduk ke kantor polisi, namun satu orang berhasil melarikan diri, Rabu (11/4). Aktivis FEMEN tak sungkan-sungkan untuk bertelanjang dada di saat hawa dingin menyelimuti Ukraina. Mereka juga sudah terkenal dengan aksi protesnya yang bermotif politik di seluruh negara Eropa. Kebanyakan dari para aktivis itu ditahan dan akhirnya dibebaskan. Meski demikian, pada saat FEMEN melakukan unjuk rasa di Belarus, mereka dihadapkan dengan kelompok intelijen. Kelompok intelijen itu dikabarkan menculik para aktivis dan mengancam akan mencukur habis rambut para aktivis dengan menggunakan pisau. (oz)


„ Bayi yang dilempar dari atas Balkon hingga ketakutan.


Bayi Dilempar dari Atas Balkon

„ Aktivis FEMEN ketika melakukan aksi protes aborsi di

Pria Usia 92 Tahun Sopir Taksi

„ Jeremy Wuitschick mengisahkan aksi heroiknya ketika mengambil alih kemudi bus sekolah setelah sopir bus itu pingsan.

Sopir Pingsan

ABG Kemudikan Bus Sekolah MILTON-Mereka boleh jadi masih anak baru gede (ABG), namun Jeremy Wuitschick dan kawan-kawan berhasil menyelamatkan bus sekolah yang mereka tumpangi mengalami celaka. Jeremy (13) dalam perjalanan ke sekolah dengan 15 siswa lainnya di Milton, Washington, Amerika Serikat, Senin (9/4) ketika dia menyadari ada yang tidak beres.”Sopir bus itu kelihatan aneh. Matanya melotot dan dia bersandar, dan tangannya menggelepar-gelepar,” katanya.Ketika bus mulai membelok di trotoar, ABG itu langsung beraksi. “Saya langsung bangkit, dan meraih kemudi, dan mengarahkannya ke kanan lalu mencabut kunci kontaknya,” Jeremy berkisah.”Dan bus itu berhenti. Sungguh mengerikan,” ujarnya. Saat itu juga dia berteriak para teman-temannya untuk menelepon nomor darurat 911. Saat itulah terjadi aksi heroik dari ABG lain. John Wood, yang juga siswa kelas 7 seperti Jeremy, mengatakan, dia bisa memberi pernapasan buatan. Video dari kamera CCTV bus itu menunjukkan betapa para ABG itu bersikap tenang di tengah situasi yang menegangkan itu.”Saya melakukannya karena insting saja. Semua terjadi dengan cepat dan kejadiannya tidak seperti di film di mana orang-orang menjerit dan sebagainya,” Jeremy berkisah.Aparat berwenang berencana memberi penghargaan pada Jeremy karena kesigapannya. Kepala Kepolisian Milton, Bill Rhodes, mengatakan, “Saya puji kesigapannya. Dia melakukan hal yang tepat dan kami akan memberi dia sesuatu. Bocah itu pantas mendapat penghargaan.Pengemudi bus yang tidak diungkap identitasnya itu, langsung dilarikan ke rumah sakit terdekat dalam kondisi serius. (int)

MANHATTAN - Johnie Footman adalah seorang pria berumur 92 tahun yang masih bekerja sebagai supir taksi di jalan-jalan Manhattan. Pria dengan tubuhnya yang masih sigap itu sudah melakukan pekerjaannya selama kurang lebih 75 tahun. Sejak dulu selama bekerja, pria yang merupakan orang kulit hitam itu merasakan diskriminasi dari orang-orang kulit putih di kota New York. Rasisme saat itu menjadi masalah besar di New York. Orang kulit putih sering menghindar atau bahkan menolak untuk menaiki taksi yang dikemudikan oleh orang kulit hitam. Adanya diskriminasi itu, membuat dirinya sangat sulit untuk bertahan hidup dari hasil pekerjaannya. Sejak Franklin Roosevelt terpilih sebagai presiden Amerika Serikat, diskriminasi terhadap kelompok kulit hitam mulai berakhir. ”Franklin Roosevelt adalah presiden yang sangat baik hati. Ia lakukan banyak hal untuk membuat orang kulit hitam lebih mudah diterima di lingkungan bahkan untuk

mengejar waktu untuk keperluan penumpang, seperti pergi ke kantor. Dahulu, kecepatan taksi hanya 40 atau 50 mil per jam,” ujarnya. Selama bertahun-tahun, Footman telah mengangkut banyak penumpang, termasuk bintang film John Wayne dan Rock Hudson. Kini, dirinya tidak mampu bekerja setiap hari, ia hanya bekerja di akhir pekan. (oz)

„ Mobil Rolls-Royce yang berlapis emas 24 karat. bagai bagian seperti grille, kap mesin, bumper, foglamp, hingga side skirt dan lingkar peleknya. Warna ini didapat berkat sepuhan emas 24 karat.Sementara di interior, emas hadir mulai dari dasbor hingga ke panel pintu. Butuh waktu 1 tahun lamanya bagi Finace Milano untuk menyelesaikan sebuah Rolls-Royce


„ Seorang wanita ini saat menggunakan kosmetik menghabiskan Rp 6 Triliun.

Wanita Australia

Mobil Berlapis Emas Berharga Rp27 Miliar ITALIA-Sebuah Rolls-Royce berlapis emas 24 karat dikabarkan laku hingga US$ 3 juta atau sekitar Rp 27,5 miliar. Emas yang dilabur di mobil ini bisa dilihat dari eksterior hingga interiornya yang pasti akan membuat silau setiap orang yang melihat. Sebuah perusahaan asal Italia bernama Finace Milano yang dengan tekun melabur mobil mewah asal Inggris, Rolls-Royce Ghost. Dan yang pasti, ‘mobil emas’ ini bukanlah kali pertama dikerjakan oleh Finace Milano karena sudah ada beberapa mobil yang mereka laburi emas.Angka US$ 3 juta yang ditebus oleh seorang pembeli misterius pun terbilang jauh lebih tinggi dari prediksi Finace Milano semula. Mobil yang masuk dalam koleksi Rolls-Royce Ghost Diva ini mengambil basis Rolls-Royce Ghost yang memiliki mesin 6-liter twin-turbocharged yang mampu memberikan tenaga lebih dari 560 bhp dengan kecepatan puncak hingga 155 mph atau sekitar 250 km/jam.Namun, untuk kali ini kita tidak perlu lagi bicarakan mengenai dapur pacu yang diusungnya. Mari kita bicarakan warna silau yang menghiasi beragam tempat di tubuhnya. Di eksterior tampak cat warna ungu yang dipadu dengan di ber-

beberapa menit sebelum bayi bisa pulih dari guncangan. Ritual ini masih banyak dilakukan di desa Harangal, Parbhani, India. Ratusan orang telah menjadikan ini acara tahunan, yang diduga telah diikuti oleh umat Hindu dan Muslim di India selama 700 tahun. Dengan angka kematian anak yang tinggi, terutama di daerah pedesaan India, banyak orang memakai ritual ini untuk memastikan kesehatan anaknya. Selain itu, ritual ini juga diyakini akan membuat anak panjang umur, kuat serta membawa kesejahteraan bagi keluarga. “Ini menunjukkan kegagalan dari pemerintah daerah untuk mencegah praktik ini dan menciptakan kesadaran tentang kesadaran anak. Ini juga merupakan refleksi dari kurangnya akses ke pelayanan kesehatan, yang memaksa orang untuk berperilaku dengan cara yang tidak rasional,” jelas Ranjana Kumari, seorang aktivis hak-hak sipil di New Delhi, Rabu (11/ 4). Ritual ini sebenarnya sudah dilarang pada tahun 2011. Namun penduduk setempat cukup gigih dalam keyakinannya dan terlepas dari semua keributan yang dibesarkan oleh aktivis hak asasi manusia. Upacara tahun ini masih dilakukan seperti biasa. Ritual terbaru digelar pekan lalu di kuil Digameshwara di Desa Nagrala, Karnataka, India. (int)


„ Johnie Footman (92) ketika di foto saat parkir. mencari nafkah,” ujar Footman. Selain merasakan perubahan pada masyarakat New York, dia juga menjadi saksi hidup terhadap perubahan yang dialami salah satu kota terbesar di dunia itu. ”Banyak bangunan-bangunan yang telah berubah di kota New York, tapi jalan raya disini masih tetap sama seperti yang dulu. Sekarang, taksi-taksi berjalan sangat cepat, mereka

INDIA-Sebelum dilempar dari ketinggian 15 meter ke kain dibawahnya, bayi-bayi yang belum genap 2 tahun ini diguncang-guncangkan dulu badannya. Ada yang menangis, ada yang tegang, tapi semuanya selamat saat dilempar. Paling aneh menjatuhkan bayi dari atas balkon. Mengayun, mengguncang-guncang dan melemparkan bayi dari atas balkon merupakan acara tahunan yang sudah dilakukan sejak 700 Tahun lalu, yang dipercaya dapat membuat tubuh bayi kuat, sehat dan panjang umur. Pada saat melakukan ritual, sang bayi yang belum genap berusia 2 tahun akan diangkat di atas balkon, dipegang kaki dan tangannya, tampak seperti memegang keranjang, kemudian diayunayunkan ke udara. Yang mengejutkan, bayi kemudian dijatuhkan dari balkon dengan ketinggian sekitar 15 meter. Di bawah balkon, sudah ada 14 hingga 15 orang yang menunggu sambil menyerukan nyanyian berupa pujipujian kepada Tuhan. Bayi terlihat menjerit dan meratap, tapi tepat dibawahnya sekelompok orang tersebut menunggu dengan memegang kain selimut. Setelah memantul di atas selimut, bayi ditangkap oleh seorang pria dan diserahkan kepada ibunya. Dibutuhkan

Habiskan Rp6 Triliun untuk Kosmetik


Ghost Diva si pemesan. Namun, keberanian Fenice Milano untuk merombak dan memberikan penampilan baru pada Rolls-Royce ini langsung menimbulkan prokontra. Phillip Brooks yang merupakan seorang sejarawan Rolls-Royce menggambarkan mobil ini sebagai mobil yang aneh tapi juga spektakuler. (int)

ADELAIDE-Tahun lalu, wanita Australia menghabiskan lebih dari Rp 6 triliun guna mempercantik diri lewat tindakan kosmetika. Jumlah itu meningkat 15 persen daripada tahun sebelumnya. Dalam survei yang dilakukan Ikatan Dokter Kosmetika Australia (CPSA) terhadap 584 warga Australia, tindakan paling populer adalah perawatan guna mengurangi keriput, seperti botoks; menghilangkan rambut; serta perawatan untuk memuluskan kulit menggunakan laser dan intense pulsed light. Jajak pendapat ini juga menemukan bahwa warga Australia menjalani perawatan kosmetika pada usia lebih muda dibandingkan dengan negara lain karena tingginya kasus kerusakan kulit akibat sinar matahari. Rata-rata warga Australia menjalani perawatan kosmetika pada awal sampai pertengahan usia 30 tahun. Bagi

pria, perawatan yang banyak dilakukan adalah agar wajah tidak kelihatan lembek dan mengurangi rambut yang menipis. Sementara perawatan bagi wanita adalah mengurangi keriput dan mengatasi dagu yang menurun. Presiden CPSA Dr Gabrielle Caswell mengatakan, tersedianya teknologi baru dan tindakan yang tidak terlalu rumit membuat lebih banyak warga Australia mau menjalani perawatan kosmetika tersebut. “Usia 50 tahun sekarang sama seperti 40 tahun puluhan tahun lalu dan tindakan kedokteran kosmetika semakin umum. Kita juga hidup dan bekerja lebih lama. Saya kira mereka menjalani tindakan bukan ingin bersaing dengan generasi lebih muda, melainkan lebih untuk kepentingan diri sendiri. Jiwa mereka merasa masih muda dan mereka ingin menunjukkan lewat penampilan,” tutur Caswell. Kekhawatiran terbesar bagi pria dan wanita adalah warna kulit yang tidak rata, disusul berat badan. (int)



12 April 2012



Dijanjikan Pekerjaan

Remaja Diperkosa & Disekap SIDIKALANG- Setelah diiming-imingi akan diberikan pekerjaan, seorang gadis berusia 17 tahun diperkosa dan disekap satu malam di salah satu penginapan Jalan Sidikalang-Medan, Panji,Kecamatan Sitinjo, Dairi, Minggu (8/4). Tersangkanya adalah PFMS, pria berusia 32 tahun, warga Bakkal, Kecamatan Tigalingga.

(foto int)

„ Mamat Rais dan M Yusuf, bapak anak pemain organ tunggal yang mengeroyok pedagang hingga tewas.

Bapak & Anak Bunuh Pedagang Buah TAMANSARI- Pemain organ tunggal ditampar pedagang buah. Sang anak tidak terima saat mengetahui bapaknya ditampar. Lalu bapak dan anak kompak mengeroyok korban hingga tewas di arena musik dangdut Jalan Kali Besar Timur, Jakarta Barat, Senin (9/ 4) malam. Suparjianto alias Yanto (52) pedagang buah di kawasan Glodok, kelahiran Semarang, Jawa Tengah, menemui ajal saat mendapat pertolongan di RS Husada. Yanto menderita luka tusuk di dada dan lengan kiri. Tersangka Mamat Rais alias Glaso (51) dan anaknya M Yusuf alias Usuf (29) ditangkap Buser Polsek Tamansari di lokasi kejadian . Menurut Kapolsek Tamansari AKBP Wong Niti Harto Negoro, dari tersangka Mamat Rais disita sebilah badik yang dipakai menusuk korban. “Tersangka Yusuf membela bapaknya yang tidak bisa melihat jelas karena menderita katarak. Yusuf menyaksikan korban menampar bapaknya,” ujar kapolsek mengenai motif pengeroyokan tersebut. Peristiwa terjadi sekira pukul 23.30 WIB. Mamat Rais, sejak tahun 1998 mencari nafkah sebagai pengamen musik organ tunggal di Jalan Kali Besar Timur. Sedangkan Yanto kala itu sedang menyangi yang

diiringi tersangka. Yanto menyanyikan lagu dangdut album Megi Z berjudul ‘Cinta Hitam’. Di tengah lagu mengalun, mendadak musik organ tunggal berhenti karena kabel yang mengalirkan strum ke alat musik tersebut putus. Mamat Rais menyuruh istrinya Ny Sadiyah (48) memperbaiki kabel yang putus dan mengeceknya ke warung Mak Tegal, penjual minuman. Kelamaan menunggu, Yanto yang sudah mabuk minuman keras (miras), marah. Ia menampar Mamat Rais. Melihat ayahnya ditampar, putra pertama dari enam bersaudaranya itu dibakar amarah. Pemuda ini langsung memukul Yanto. “Saya mencabut badik dan mengayunkan sekenanya, ternyata mengenai dada korban,” jelas Mamat Rais. Korban terkapar di aspal lalu ditolong warga dibawa ke RS Husada. Yanto tak bisa diselamatkan lantaran kehabisan darah. Pengeroyokan itu dilaporkan ke Polsek Tamansari. Bapak dan anak itu ditangkap. “Saya dan anak pasrah. Mungkin ini ujian dari Tuhan,” tutur Mamat Rais. Yusuf menyatakan, kemana pun dia pergi tak pernah jauh dari bapaknya. “Di penjara nanti, saya akan menjaga Bapak,” ujar Yusuf. (pk/int)

Putus Cinta, Foto Bugil Kekasih Disebar SURABAYA- Modus memfoto pacar dalam keadaan bugil kemudian menyebarkannya via situs jejaring sosial, rupanya terus terjadi dan cenderung menjadi treng. Foto pasangan yang bugil akan disebar jika salah satu pasangan enggan diputus secara sepihak. Hal itu pula yang dilakukan Rahfi Purwandito terhadap mantan pacarnya yang seorang model, sebut saja Wulan. Tak terima diputus Wulan yang berpaling ke pria lain, Rahfi menyebar foto Wulan yang tanpa busana di facebook. Keluarga model yang baru berusia 17 tahun itu tak terima lalu melaporkan Rahfi ke polisi. “Tersangka dan korban memang sudah sering berhubungan layaknya suami istri,” ujar Kompol Suparti kepada wartawan, Rabu (11/4). Kasubbag Humas Polrestabes Surabaya itu mengatakan, kasus ini berawal saat Rahfi dan Wulan berpacaran pada Juli 2010 lalu. Rupanya pacaran yang mereka lakukan tidak sehat. Mereka nekad melakukan hubungan badan. Perbuatan mesum itu pertama kali mereka lakukan di sebuah hotel di Jalan Pasar Kembang. Untuk selanjutnya mereka lakukan di rumah nenek Wulan dan terus berpindah-pindah. “Pada salah satu hubungan, tersangka memfoto korban dalam keadaan bugil. Rupanya foto bugil itu digunakan sebagai ancaman untuk membuat malu korban dengan menyebarkannya jika sampai diputus,” tambah Suparti. Rupanya, pemutusan hu-

bungan itu terjadi juga. Pada Maret 2012 kemarin, Wulan yang masih duduk di bangku SMA itu memutuskan Rahfi. Dan ancaman Rahfi rupanya juga tak main-main, dia akhirnya menyebarkan foto itu via facebook. Agar tak dituduh dia yang menyebarkan, pemuda warga Krian, Sidoarjo, itu mengupload foto-foto bugil Wulan melalui akun facebook milik mantan pacar Wulan. “Sebelumnya tersangka membobol akun facebook korban,” lanjut Suparti. Setelah diselidiki, akhirnya diketahui jika yang mengupload 5 foto bugil ABG warga Kemlaten itu adalah Rahfi. Kepada wartawan, pria 25 tahun itu mengatakan bukan dia yang menyebarkan fotofoto tak senonoh itu. Rahfi memang mengaku mengupload foto tersebut ke akun facebooknya sendiri. Tetapi foto itu dibuat privat karena itu tak bisa diakses dan dilihat orang lain. “Cuma saya yang bisa melihat foto itu. Namun kemudian akun facebook saya dibobol dan tersebarlah foto itu,” ujar Rahfi. Tetapi pengakuan Rahfi terasa janggal, karena pada salah satu foto yang diupload di akun facebook Wulan, Rahfi menulis komentar yang menyatakan kesenangannya atas tersebarnya foto itu. Atas perbuatannya, Rahfi dijerat dengan pasal 81 ayat 2 UU RI nomor 23 tahun 2002 tentang perlindungan anak dan pasal 45 ayat 1 UU RI nomor 11 tahun 2008 tentang informasi dan transaksi elektronik. (dtc)

Kejadian bermula saat korban sebut saja Bunga (nama samaran), warga Desa Pandan II Kecamatan Siempat Nempu, diberangkatkan ibunya bersama tersangka yang sebelumnya menjanjikan bisa memberi pekerjaan di sebuah Perusahaan tempatnya bekerja. Sebelum berangkat, ibu kor-

ban sempat menyerahkan uang Rp200 ribu kepada tersangka, sebagai biaya administrasi memasukkan anaknya bekerja. Namun sesampainya di Sidikalang, pria itu beralasan hari sudah sore, sedangkan kantornya sudah tutup. Sekira pukul 19.00 WIB, PFMS mengajak

Bunga menginap di sebuah penginapan yang berada di Panji. Dengan berpura-pura mengantar korban ke kamar, Bunga yang masih di bawah umur itu dipaksa melakukan hubungan badan. Karena menolak, Bunga lalu diperkosa. Puas melampiaskan nafsu, sekira pukul 20.00 WIB, tersangka meninggalkan korban di kamar dan mengunci pintu dari luar. Pagi harinya, Senin (9/4) sekira pukul 08.00 WIB, saat karyawan penginapan hendak

melakukan pembersihan, kamar yang disewa tersangka masih terkunci. Sedangkan dari dalam kamar terdengar suara tangisan korban. Setelah dibuka menggunakan kunci serap, Bunga pun ditemukan sedang menangis. Ia kemudian menceritakan kejadian yang menimpanya kepada karyawan penginapan. Kapolres Dairi melalui Kasat Rekrim AKP Demak Ompusunggu yang dihubungi wartawan membenarkan adanya kasus pemerkosaan tersebut.

“Setelah dilaporkan korban bersama ibunya, Senin (9/4), kita langsung menindaklanjuti dan berhasil menangkap tersangka pada hari itu juga sekira pukul 21.00 WIB. Tersangka diamankan dari kilometer dua, persis di depan Polsek Kota, Jalan Tigalingga,” jelas Demak, Rabu (11/4). Ditambahkannya, dari hasil pemeriksaan, tersangka mengakui seluruh perbuatannya. Ia akan dijerat dengan pasal 81 ayat 1dan 2 serta pasal 82 UU No 23 tahun 2002 tentang perlindungan anak. (pmg)

Minta Uang Tak Dikasih

Pelajar SMP Tewas Lompat dari Tower JAKARTA- Seorang pelajar SMP di Kebon Jeruk, Subhan Fadilah (15) tewas setelah melompat dari sebuah tower telepon seluler di Jalan Wakaf Sukabumi Selatan, Jakarta Barat. Hingga kini jenazah korban masih berada di RS Medika Permata Hijau Kebon Jeruk. Menurut keterangan, putra ketiga dari empat bersaudara ini melompat dengan ketinggian sekitar 20-30 meter. Tubuh korban terhempas ke tanah, tangan dan kakinya patah. Warga yang melihat langsung memberi pertolongan dan membawanya ke rumah sakit terdekat. Diduga gara-gara korban minta uang untuk memperbaiki motornya, tak dikasih orangtua. Mungkin saat itu orangtuanya belum memiliki uang, lalu pelajar kelas III SMP ini bunuh diri. Kedua orangtua korban Bayu Hidayat dan Khairiyah, langsung histeris begitu mendapat kabar anaknya tewas bunuh diri. Keluarga korban sekarang berada di rumah sakit. Kasusnya masih ditangani Polsek Kebon Jeruk. (pk/int)

Salon Prostitusi Digerebek

11 Diamankan, Satu Sedang Indehoi Foto Faisal

TERCEBUR- Truk kontainer BK 8412 BA dievakuasi dari dalam laut Pelabuhan Belawan, Rabu (11/4). Sebelumnya mobil terperosok dan tercebur ke laut, menyebabkan supir tewas tenggelam.

Truk Terjun ke Laut, Supir Tewas Tenggelam

MEDAN- Riswan Simangunsong (35) warga Jalan Bawal XV Martubung, tewas di dasar laut setelah truk kontainer BK 8412 BA yang dikendarainya terperosok masuk air laut di dermaga Pelabuhan Belawan, Rabu (11/4) sekira pukul 01.00 WIB. Informasi yang dihimpun dari abang korban L Simangunsung (40), sebelum kejadian, Riswan pamit kepada istrinya Saidah Silalahi (30) untuk bekerja seperti biasa. Dimana ia melansir muatan yang dikirim dari kapal ke dermaga Pelabuhan Belawan. Namun saat Riswan dan beberapa rombongan mobil lainnya tiba di dermaga, mendadak mobil yang dikemudikan Riswan terperosok ke laut dan tenggelam.

Selanjutnya ayah tiga anak ini tak bisa keluar. Diduga ia sempat pingsan setelah terbentur stir mobil dan akhirnya tenggelam bersama kontainernya. “Sehari-hari dia menganggkut muatan kapal. Tapi setibanya di pelabuhan, mobilnya tercebur ke laut, dan akhirnya ia meninggal,” ucap Simangunsong. Istri korban Saidah Silalahi, hanya mampu menangis di mobil. Sebab ia tidak tahan melihat jenazah suami tercintanya yang sudah berpulang itu. “Istrinya di mobil saja. Kalau dia kemari (ruang jenazah), dia bisa histeris, kami nggak mau nanti di rumah sakit jadi ribut,” tandasnya. Riswan sendiri diketahui telah bekerja sebagi supir truk kontainer

selama 3,5 tahun di CV Belawan Indah. Ia merupakan tulang punggung keluarga. Dengan tewasnya Riswan, dipastikan anak-anak nya yang masih kecil akan mengalami kesulitan ekonomi di kemudian hari. Pasalnya istri korban selama ini hanya sebagai ibu rumah tangga. Dari pantauan wartawan di ruang jenazah, jasad korban tampak sudah membiru. Hal ini terjadi karena jenazah sudah cukup lama berada di air laut. Sedangkan wajahnya terdapat luka yang dipastikan akibat benturan yang terjadi ketika truk yang terperosok. Usai dilakukan visum di rumah sakit, jasad Riswan dimasukkan ke dalam peti jenazah, dan dibawa ke rumah duka untuk disemayamkan. (cr-3/hez)

MEDAN- Polisi menggerabek Salon Bali Spa di Komplek Asia Mega Mas Blok CC, Medan Area, Selasa (10/4) sekira pukul 17.00 WIB. Dari lokasi, sebanyakdelapanwanitadantigapriadiamankan. Informasi dihimpun, penggerebekan salon kecantikanyangjugadifungsikansebagaitransaksi seksualsecara terselubunginiberawaldari laporan warga yang resah dengan keberadaan salon. Selanjutnya polisi terjun ke lokasi guna memastikankebenaraninformasi.Setelahtimyang dipimpin Kanit Reskrim Polsek Medan Area AKP J Banjarnahor melakukan pengegrebekan, ditemukan tiga pria yang sedang berhubungan intim bersama teman wanitanya di salah satu kamar. Warga setempat yang mengetahui adanya penggerebekan, berramai-ramai mendatangi lokasi. Hal itu sempat membuat heboh suasana. Selanjutnya ke sebelas orang itu diboyong ke Posekta Medan Area guna pemeriksaan lebih lanjut. Menurut warga setempat A Yen (35), salon itu sudahsangatmeresahkanmasyarakatdikomplek. “Selama ini kami resah melihat salon itu. Kalau nanti kami kasitahu, jadi ribut nanti,” ucap wanita berkacamata ini. Sementara Kanit AKP J Banjarnahor yang dikonfirmasi menjelaskan, pihaknya telah mengamankansebelasorangdarisalonkecantikan yang diduga dijadikan tempat prostitusi. “Kita melakukan penggerebekan setelah adanya informasi masyarakat yang resah. Ternyata setelah kita buktikan, benar tempat itu dijadikan lokasi prostitusi,” jelas Banjarnahor. (gus/pmg)

Galakan yang Selingkuh GURU SD nempeleng murid, itu biasa. Tapi jika guru SD nempeleng istri, pasti bukan soal lalai mengerjakan PR. Apapun alasannya, kini Ktut Mayun (39) harus jadi terdakwa. Pasalnya, sang istri kemudian lapor polisi. “Mestinya saya yang marah karena dia selingkuh, kok malah jadi dia yang galakan,” kata istri selaku saksi korban. Istri cap apapun pasti tak suka suami membagi cintanya seperti kue lapis; sepotong untuk si anu, sepotong lagi untuk si ani. Mutlak harus untuk dirinya seorang. Karena itulah, dia akan marah jika menemukan suami punya WIL. Sebab dalam prakteknya, banyak lelaki yang kemudian meningkatkan statusnya sang WIL menjadi istri. Ibarat perguruan tinggi swasta, tadinya hanya terdaftar, menjadi disamakan. Paling celaka, dia kemudian juga menuntut “Sum-

bangan Pendidikan Mahasiswa” yang sama. Bertolak dari alasan inilah, wajar saja Ny Ayu Maruti (35) marah-marah saat tahu suaminya yang guru SD ini punya WIL. Semakin marah lagi, karena selingkuhannya juga seorang guru SD. Guru kok ketemu guru lagi. Sekarang sih enak dan asyik. Tapi coba jika sudah pensiun dalam usia 60 tahun mendatang, mereka akan sama-sama kena penyakit pengapuran, karena dulu biasa pegang.. kapur! Sebenarnya, kala itu Ayu Maruti warga Penarungan, Kecamatan Abiansemal, Kabupaten Badung, Bali, baru mendengar gosip dan sas-sus tentang perselingkuhan suami. Maka buru-buru dia mencoba klarifikasi. Jawab suami ternyata kopi paste dengan alasan Wamenkum Deny Indrayana dalam kasus penamparan sipir penjara.

“Apa saya ada potongan tukang selingkuh?” kata Ktut Mayun dengan berkacak pinggang. Melihat mimik suaminya, Ayu Maruti kemudian yakin bahwa “kutut’-nya Ktut tidak “nakal” mencari juwawut ke mana-mana. Namun ternyata ademnya hati ini hanya sebentar saja, kaena isu miring tentang suaminya makin santer masuk telinganya kanan kiri bahwa Ktut hakul yakin punya WIL, sosoknya tak berubah, ya guru SD sesama teman mengajar. Penasaran dengan kabar miring tersebut, Ayu Maruti tanpa pikir panjang segera melabrak ke sekolah tempat suami mengajar. Nah ini dia! Di ruang guru pas jam istirahat, Ayu Maruti melihat suaminya dan Mandasari (28) sang WIL-nya dalam ruangan yang sama. Makin curiga lagi karena mendadak perempuan

itu mengalah keluar buruburu. Langsung saja Ayu Maruti marah marah, ngomel-ngomel prat pret prottttt. Bisa ditebak, bagaimana malunya suami dilabrak istri di sekolah. Di samping malu dengan sesama teman guru, juga malu pada anak didik. Mana ada guru ngajari muridnya berantem dengan istri? Kurikulum menteri PDK kabinet mana tuh? Karena itulah Pak Guru Ktut Mayun menghentikan omelan istri dengan pukulan tangan ke muka, plak plak plokkkkk, sampai-sampai helm nya pun jatuh. Istrinya pulang sambil menangis. Tapi beberapa jam kemudian polisi datang dengan tuduhan KDRT. Ktut di-

gelandang ke Polsek Abiansemal, dan kini Pak Guru duduk di kursi pesakitan sebagai terdakwa di PN Denpasar. Legalah Ayu Maruti, karena suaminya sudah kena batunya. Cuma yang bikin gemas dia, Mandasari sebagai saksi terkesan selalu membela Ktut Mayun dengan alasan tidak tahu dan tidak tahu. Kok seperti Angelina Sondakh dalam sidang Tipikor saja. Tapi di sini kan tanpa “Apel Malang” dan Washington. (pk/int)




April 2012




Saling Klaim Tanah Incaran Pemko

Dinkes Periksa HB Anak SD

Sambungan Halaman 8

Sambungan Halaman 8 dilakukan dalam rangka meningkatkan kesehatan bagi anak SD di Kota Sibolga,” pungkas Yusuf seraya mengatakan tahun 2011 lalu pemeriksaan Hb ini juga dilakukan di 23 SD se Kota Sibolga. Menurut Yusuf, tujuan pemeriksaan Hb dan pemberian obat ini adalah untuk mencegah para siswa yang ada di kota Sibolga agar tidak terjangkit cacingan, sebab seorang siswa yang terkena penyakit cacingan akan berdampak terhadap kecerdasan, gangguan pertumbuhan dan masalah gizi. “Itu sebabnya cacingan pada anak jangan dianggap ringan sebab bisa mengganggu proses perkembangan anak, bahkan tingkat kecerdasan anak bisa menurun. Sebab ada beberapa jenis cacing penyakit yang menjadi penyebab cacingan yakni, cacing gelang, tambang, kremi dan tambuk,” beber Yusuf lantas menambahkan pemeriksaan Hb ini dilakukan pada seluruh siswa kelas VI dengan jumlah SD sebanyak 61. Dia menjelaskan, penyakit cacingan ini biasanya banyak ditemukan pada anak usia sekolah, khususnya yang masih duduk dibangku SD, sehingga bila tidak dicegah dari sekarang, maka akan berpengaruh negatif terhadap kecerdasan siswa. “Penyakitnya sering tidak terlihat, makanya banyak orang tua tidak mengetahui anaknya sudah terkena cacingan. Sayangnya masyarakat masih banyak menganggap sepele hal ini, padahal akibat cacingan anakanak akan memiliki tingkat kecerdasan yang rendah,” tandasnya seraya mengimbau agar para orang tua lebih peduli pada kesehatan anaknya dan waspada pada kemungkinan terjadinya cacingan pada anak-anak. Yusuf mengungkapkan, pemberian obat tersebut akan berpengaruh terhadap perkembangan cara berpikir seorang siswa. “Siswa yang cacingan tidak akan bisa berfikir, karena dampaknya adalah terhadap ketahanan tubuh dan semangat para siswa untuk belajar. Untuk itu kami meminta kepada seluruh orang tua siswa untuk memperhatikan kebersihan para anak. Sebab tanpa adanya perhatian yang khusus dari orang tua, maka penyakit akan banyak terkena kepada anak, apalagi anak usia SD rentan diserang penyakit cacingan,” ujarnya. Ia mengungkapkan, cacingan tidak hanya mempengaruhi keadaan kesehatan, gizi dan kecerdasan, tetapi juga dapat menurunkan produktivitas penderita yang secara ekonomi dapat menyebabkan kerugian. “Sebab cacing mengisap makanan dalam tubuh, seperti karbohidrat dan protein juga darah, sehingga menyebabkan menurunnya kualitas SDM,” katanya. Masih katanya, cacingan sangat sulit didiagnosis karena tidak menimbulkan gejala. Kecuali jika jumlahnya banyak, maka timbul mual, kembung dan diare pada anakanak sampai masalah anemia. “Akibat yang terburuk yakni terjadinya kurang gizi, mudah sakit, kurang aktif dan lemas sehingga berpengaruh pada IQ anak, bahkan cacing dapat menyumbat usus. Sementara di sekolah, otak mereka dituntut bekerja keras untuk berkonsentrasi menghafal, berpikir, mencerna, memahami, dan memecahkan masalah. Begitu juga di rumah, mereka harus mengerjakan berbagai tugas sekolah dan rumah tangga,” tandasnya. (tob/nasa)

akan dibeli oleh Pemko Sibolga. Pemilik: Herry Soetanto. Alamat: A. Jalan Sutomo No.25 Medan, B. Blok 112 Commonwealth Cresent # 09-308 Singapore 140122. Bukti

kepemilikan: No.1/AM/2033. Kepada instansi pemerintah militer, kepolisian dan pihak lain yang merasa berkepentingan atas transaksi jula beli tersebut dapat mengajukan keberatan kepada Camat Sibolga Selatan, Kadis

PKAD Sibolga, Kakan BPN Sibolga dan Sekretaris Dispenda Sibolga selambat-lambatnya 7 hari kerja setelah tanggal pengumuman ini. Baliho itu ditandai dengan dto Sekdakot Sibolga, Drs Mochammad Sugeng, dan Kasi Pengaturan

18 Atlet Pencak Silat Sibolga Siap Bertarung Sambungan Halaman 8 cewakan tetapi mampu meraih prestasi sebagaimana yang kita harapkan, yakni mengharumkan daerah Kota Sibolga sebagai gudangnya atlet berprestasi,” sebut Irsan diamini Sandri Jhon. Irsan menjelaskan, dalam rangka persiapan atlet mengikuti even bergengsi tingkat Sumut tahun ini, IPSI Kota Sibolga sudah menyiapkan sebanyak 18 orang peserta meliputi, at-

let laga putra sebanyak 9 orang, atlet laga putri sebanyak 7 orang, kemudian tunggal putra dan putri masingmasing 1 orang. Sementara itu, Wali Kota Sibolga Drs HM Syarfi Hutauruk didampingi wakilnya Marudut Situmorang mengaku sangat menyambut baik, pelaksanaan TC yang dilakukan IPSI Kota Sibolga dalam rangka penyiapan atlet pencak silat mengikuti Popdasu di Madina. “Kita juga

ambil alih pusat. “Kalau tidak bisa ditolong, terancam dilikuidasi. Bisa dengan daerah terdekat atau pusat,” ujar Ditjen Otonomi Daerah Djoehermansyah Johan, baru-baru ini. Djoehermansyah menambahkan pada 25 April mendatang akan diumumkan daerah mana saja yang dianggap terancam kolaps. Seperti diberitakan sebelumnya, Forum Indonesia Untuk Transparansi Anggaran (FITRA) merilis 291 kabupaten/kota yang memproyeksikan belanja pegawainya lebih dari 50 persen. Ironisnya, 11 di antara daerah-daerah tersebut memiliki belanja pegawai lebih dari 70 persen. Gara-gara itu, daerah tersebut terancam kolaps karena tidak lagi memiliki anggaran. Lebih lanjut Djoehermansyah menjelaskan kalau daerah tersebut tidak akan dilikuidasi begitu saja. Daerah yang terindikasi akan dilakukan pembinaan terlebih dahulu. Tahapannya adalah evaluasi, dipelajari pokok permasalahan, dibimbing dengan asistensi lantas peringatan dan terugaran kalau tetap tidak berubah. “Memang harus ada penalti yang tegas,” katanya. Dia enggan membocorkan data daerah mana saja yang masuk dalam rapor merah Kemendagri. Yang jelas, tindakan itu perlu dilakukan untuk menyelamatkan daerah otonomi. Harapan agar daerah mampu mengurus rumah tangganya sendiri, termasuk membiayai kepentingan operasional pemerintah, ternyata jauh dari harapan. Faktanya, daerah malah keteteran dalam mengatur keuangan.

Apalagi kalau masuk musim pilkada. Djoehermansyah menyebut, dana tersisa ikut tersedot ke pilkada. Padahal dana yang tersisa dari belanja pegawai tinggal sedikit. Ujung-ujungnya, pembangunan daerah bisa macet saat pilkada datang. “Saat ini tidak ada daerah yang belanja aparaturnya ideal,” terangnya. Ideal, lanjut Djoehermansyah, adalah alokasi belanja aparatur ‘hanya’ 40 persen dari belanja daerah. Tidak seperti sekarang yang bisa mencapai 76 persen untuk belanja pegawai. Beruntung, daerah-daerah tersebut dibantu pemerintah dengan Dana Alokasi Umum (DAU) sehingga roda pembangunan masih bisa berjalan. Tersedotnya APBD untuk belanja pegawai juga mendapat perhatian serius dari Komisi Keuangan DPR. Wakil Ketua Komisi XI DPR Harry Azhar Aziz mengatakan, satusatunya cara untuk mencegah tersedotnya APBD ke belanja pegawai adalah dengan merevisi UU No 33 Tahun 2004 tentang Perimbangan Keuangan antara Pemerintah Pusat dan Pemerintah Daerah.“Di situ harus diatur bahwa APBD yang dialokasikan untuk belanja pegawai maksimal 50 persen. Tidak boleh lebih,” ujarnya. Menurut Harry, besarnya anggaran yang tersedot untuk belanja pegawai di daerah kontraproduktif dengan upaya mendorong perekonomian daerah melalui dana transfer ke daerah yang tiap tahun dianggarkan ratusan triliun di APBN. “Kami inginnya, ada porsi anggaran yang cukup untuk membiayai belanja modal agar pembangunan di daerah lebih maju,” katanya.

gutan atas klaim kepemilikan oleh perusahaan tersebut. “Kita tunggu, kalau memang ada yang merasa berhak silahkan sampaikan gugatan. Kami juga akan buktikan secara hukum,” tutur Rekman. (mor/nasa)

Pak Wali Minta Muskot KNPI Fair Sambungan Halaman 8

senang, IPSI Kota Sibolga sudah melakukan persiapan bagi atlet jauh hari sebelum pertandingan digelar. Harapan kita, para atlet utusan kita nantinya sudah siap mental dan fisiknya dalam menghadapi pertandingan tersebut. Yang tak kalah penting, kita juga mengharapkan para atlet kita mampu mengukir prestasi dan mengharumkan nama daerah Kota Sibolga,” tandas Syarfi. (tob/nasa)

Psp Bakal Dibubarkan Sambungan Halaman 8

Instansi Pertanahan Nasional selaku Sekretaris, Sahruddin. Lebih lanjut, Penasehat Hukum PT Rimba Baru, H Rekman Basri SH MBA mengatakan, pihaknya menunggu jika memang ada pihak yang mengajukan gu-

Meski demikian, Harry mengakui, upaya menurunkan alokasi belanja pegawai di daerah juga bukan perkara gampang. Dia menyebut, ada dua cara yang bisa ditempuh, yakni mengurangi besaran gaji pegawai di daerah dan mengurangi jumlah pegawai di daerah. “Dua-duanya sulit. Pemotongan gaji pasti akan menimbulkan gejolak. Sedangkan pengurangan pegawai melalui pensiun dini, belum tentu diterima,” ucapnya. Namun, lanjut dia, opsi pensiun dini mungkin lebih rasional, asalkan pemerintah bisa memberikan pesangon yang layak, sebagaimana langkah perusahaan yang memberikan pesangon atau golden shake hand bagi karyawannya yang ikut program pensiun dini. Tapi, kata dia, harus dipikirkan juga, siapa yang akan membayar pesangon tersebut. Kalau pemerntah pusat yang harus membayar, maka anggaran DAU (dana alokasi umum) akan membengkak dan itu akan memberatkan APBN. Kalau yang membayar, pemerintah daerah, maka harus dicek dulu apakah mereka memiliki cukup anggaran untuk itu. “Saya akan usul, pensiun dini dibiayai bersama oleh pemerintah pusat dan daerah, tapi prosesnya bertahap, misalnya lima tahun, sehingga tidak memberatkan APBN dan APBD,” ujarnya. Karena itu, menurut Harry, pemerintah mesti segera duduk bersama dengan DPR untuk membicarakan hal tersebut agar permasalahan seperti ini tidak berlarut-larut. “Kami siap membahas revisi UU No. 33 Tahun 2004 itu segera,” ujarnya. (dim/owi/wan/kuh/jpnn)

KNPI sebagai induk organisasi kemasyarakatan pemuda di Kota Sibolga,” pungkas Syarfi. Sebelumnya, Ketua KNPI Sibolga Hendra Sahputra melaporkan, seluruh rangkaian termasuk persiapan pelaksanaan Muskot VIII KNPI Kota Sibolga telah dilakukan dengan baik. “Mudah-mudahan, jadwalnya nanti tidak akan molor yakni, pada minggu ketiga April 2012, di Aula Topaz Hotel Wisata Indah Sibolga,” kata Hendra lantas menambahkan, saat Muskot nantinya juga digelar debat antar kandidat balon ketua. Ketua OC Ulianto Hutagalung juga melaporkan, persiapan Muskot VIII KNPI Sibolga sudah mantap, hanya saja panitia pelaksana masih mengalami kendala berupa talangan kekurangan dana untuk pelaksanaan Muskot tersebut. Sementara itu, Ketua SC Djafanawar Tanjung mengungkapkan, pihaknya akan berupaya untuk melaksanakan Muskot VIII KNPI Sibolga tersebut dengan baik sebagaimana harapan Walikota Sibolga. “Kita juga mempersilahkan kepada seluruh balon ketua yang ingin maju, untuk mendaftarkan diri, dengan tenggat waktu hingga hari H sebelum pelaksanaan Muskot,” sebutnya. Djafanawar menambahkan, setiap balon ketua yang berkeingi-

nan ikut dalam perebutan kursi nomor satu di KNPI Sibolga harus memenuhi beberapa persyaratan dan kriteria di antaranya, pernah menjadi pengurus OKP, kemudian pernah menjadi pengurus Dewan Pengurus Kecamatan (DPK) KNPI, berusia maksimal 40 tahun 11 bulan pada saat Muskot digelar. “Syarat lainnya, setiap balon ketua harus berpendidikan minimal tamatan SMA sederajat, punya dedikasi, loyalitas dan tidak tercela (PDLT). Sementara, syarat bagi calon ketua atau setelah berhasil lolos dari proses penjaringan bakal calon (balon) ketua. Setiap calon harus mendapat dukungan minimal 20% suara dari jumlah peserta yang berhak memiliki suara. Kemudian mendapat rekomendasi dari DPD KNPI tingkat Kota atau kecamatan, menyampaikan Daftar Riwayat Hidup, Rencana Strategis (Renstra) serta visi dan misinya kepada masyarakat luas,” pungkas Djafanawar. Hadir dalam audiensi tersebut, Ketua DPD KNPI Sibolga Hendra Sahputra SE, Sekretaris Kartika Syahputra AMd, ketua OC Ulianto Hutagalung, ketua SC Djafanawar Tanjung, dan pengurus lainnya. Sementara, mendampingi Wali Kota Sibolga, Kadisbudparpora Drs Porman Bakara, Kakan Kesbang Linmas DT Tamba dan Budi MD Sibuea mewakili Kabag Humas Pemko Sibolga. (tob/nasa)

Harga Gula Aren Naik Sambungan Halaman 8 Sementaraitu,beberapajeniskomoditi lainnya yakni kemiri dan pinang juga mengalamipenurunanyangcukupdrastis. Namun lagi-lagi belum diketahui penyebabpenurunanhargatersebut. “Kemiri yang biasanya bisa kita kumpulkan hingga 20 ton perming-

gu juga mengalami penurunan dari Rp6.000 per kilogramnya menjadi Rp2.500 per kilogram. Sama halnya dengan pinang yang setiap minggunya bisa dikumpulkan sekitar 1- 2 ton harganya juga turun dari Rp6.000 menjadi Rp2.000, itupun sulit mendapatkan peminat,” terangnya. (ran/mer)

Lagi Main Game, 6 Pelajar Dijaring Sambungan Halaman 8 IBA siswa kelas II SMK II Sibuluan, dan AR siswa salah satu SMA swasta di Sibolga. Kepada petugas, para siswa ini mengungkapkan berbagai alasan mengapa dirinya bolos. Ada yang baju sekolah kotor, ada yang tidak mengarjakan PR (pekerjaan rumah),

dan adapula dengan alasan malas. Kasatpol PP Kota Sibolga, Singkat Sijabat S Sos melalui Kasi Ops dan Penyuluhan, Sahat M Manurung mengatakan, razia kasih sayang tersebut rutin dilakukan pihaknya guna mengindari tawuran antar pelajar, dan juga persiapan menjelang Ujian Nasional. (dungo/nasa)

Sambungan Halaman Satu Gatot Janji segera Bahas Konsorsium Inalum Sambungan Halaman 1 membahas pembentukan Konsorsium, dalam waktu dekat. Mangindar menyebutkan, rencana pembahasan pembentukan Konsorsium itu setelah 10 bupati/ walikota menyurati Gatot, agar masalah ini mendapat prioritas. Agar bukan sekedar rencana, agenda pembahasan pembentukan Konsorsium itu menjadi salah satu butir kesepakatan yang dituangkan dalam poin-poin penting hasil Rapat Manajemen Kawasan Danau Toba yang digelar di Medan, Selasa (10/11). “Di salah satu butir kesepakatan, agar segera ada langkah-langkah konkrit untuk persiapan pembentukan Konsorsium Daerah,” ujar Mangindar Simbolon saat dihubungi koran ini, kemarin (11/4). Gatot, sebagai Ketua Manajemen Kawasan Danau Toba, menyetujui butir dimaksud, termasuk Sekdaprov Sumut Nurdin Lubis. Bupati Samosir itu

mengatakan, rapat tersebut juga dihadiri Ketua Otorita Asahan, Effendi Sirait. Dijelaskan Mangindar, Effendi Sirait juga memberikan masukan penting ke pemda. Effendi minta agar Pemprov dan 10 kabupaten/kota, bersikap tegas. “Beliau (Effendi Sirait, red) mengatakan, tanpa ada konsep dan permintaan yang tegas dari daerah, sulit pemda mendapatkan saham,” kata Mangindar, menirukan saran Effendi. Lantas, apa langkah pemda agar bisa mendapat jatah saham Inalum? Mangindar menjelaskan tahapantahapan yang akan dikerjakan. Pertama, Pemprov dan 10 kabupaten/kota harus menyepakati dulu bisa tidaknya menggandeng perusahaan swasta yang punya pengalaman di bidang energi dan punya dana yang akan digunakan untuk membeli saham. “Ini harus ada kesepakatan dulu,” ujar satu-satunya bupati di wilayah Sumut yang dikirim pusat ikut studi singkat di Harvard University, AS,

beberapa waktu lalu, itu. Nah, kalau sudah disepakati, lanjutnya, barulah dibentuk Konsorsium Daerah. Begitu sudah terbentuk, Konsorsium ini barulah mengirim delegasi ke pusat untuk melakukan negosiasi. “Negosiasi untuk memastikan agar pemda tak hanya mendapatkan fee seperti yang selama ini, tapi harus ikut menjadi pemegang saham, punya hak suara, dan kalau untung mendapatkan deviden. Nego juga menyangkut persentase saham,” ulas Mangindar. Namun diakui, upaya pertama proses nego ke pusat adalah minta golden share. Tapi jika tawaran pertama ini gagal, maka model Konsorsium yang akan diperjuangkan. Mangindar mengatakan, sebelum kontrak perusahaan Jepang atas Inalum habis Oktober 2013, masalah angkaangka persentase saham harus sudah ada kepastian. “Termasuk berapa untuk pemprov dan berapa untuk kabupaten/ kota,” kata Mangindar.

Seperti diberitakan, Jenderal TNI (Purn) Luhut Panjaitan, pernah menyebutkan, pihaknya melalui PT Toba Sejahtera, telah menyiapkan US$ 700 juta atau setara Rp5,95 triliun (kurs Rp8.500 per US$) untuk mengakuisisi 58,88 persen saham PT Inalum. Keinginan akuisisi mayoritas saham yang selama ini dikuasasi NAA itu nantinya akan dilakukan bersama-sama Pemprov Sumut dan 10 kabupaten/ kota yang ada di sekitar Danau Toba. Sebelumnya, Direktur Ekesekutif Indonesian Resources Studies (IRES) Marwan Batubara pernah mengingatkan agar pemda tidak usah menggandeng swasta. “Tapi saya selalu mengingatkan, 10 kabupaten/kota itu, tak usahlah menggandeng swasta. Percayalah, pada akhirnya si jagoan (PT Toba Sejahtera) itu yang akan lebih banyak menikmati, bukan pemdanya,” ujar mantan anggota Dewan Perwakilan Daerah (DPD) itu. Bagaimana soal dana? Marwan

Didemo, Sukran Ngaku Diplintir Sambungan Halaman 1 Kata Sukran, adalah wajar di mana dirinya sebagai putra Sibolga mendukung perluasan. Namun, sebagai Wakil Bupati Tapteng, dirinya tetap berpegang pada mekanisme yang berlaku, serta mengedepankan aspirasi masyarakat di daerah perbatasan kedua daerah bertetangga itu. Selain itu, Sukran juga meluruskan opini sekelompok masyarakat bahwa dirinya ingin menjual wilayah Tapteng. “Bagaimana maksudnya atau caranya saya bisa menjual wilayah Tapteng. Mana mungkin itu, saya

tidak pernah menjual wilayah Tapteng. Kalau pun misalnya Sibolga inginkan perluasan, tentu ada aturan dan mekanismenya. Dan itu pun tergantung apakah masyarakat di perbatasan bersedia atau tidak,” terang Sukran. Di kesempatan itu, Sukran mengungkapkan bahwa Pemkab Tapteng sendiri sudah berinisiatif membentuk tim penegasan batas daerah Tapteng dengan kabupaten/ kota yang berbatasan. Surat pembentukan tim tersebut bahkan ditandatangani oleh Bupati Tapteng Raja Bonaran Situmeang, selaku ketua pengarah tim, dan Sukran

sebagai wakil ketua pengarah tim. “Jadi kami sudah mulai akan menginventarisir aset dan batas wilayah Tapteng dengan kabupaten/ kota yang berbatasan. Karena yang jelas batasannya itu masih dengan Kabupaten Humbang Hasundutan saja, dengan daerah lainnya belum,” terang Sukran. Penjelasan itu disampaikan Sukran sekaligus menyikapi tuntutan demonstarasi Aliansi Masyarakat Tapteng Peduli Hukum di depan Kantor Bupati Tapteng, siang itu juga. Di mana dalam orasinya, para demonstran menuding bahwa Sukran berniat menjual wilayah Tapteng. Itu karena pernyataannya di

malam hari jadi Kota Sibolga ke-312 di Lapangan Simaremare Sibolga tersebut. ”Tapi saya tetap bersyukur meski pun saya merasa difitnah begitu. Padahal saya sendiri yang mengarahkan agar di setiap kantor atau perusahaan di daerah Pondok Batu, Kecamatan Sarudik itu dipasangi foto kepala daerah Tapteng. Tujuannya untuk menunjukkan bahwa itu wilayah Tapteng. Bahkan, nama dan keberadaan PPN-TPI (Pelabuhan Perikanan Nusantara-Tempat Pelelangan Ikan) Sibolga itu saya ingin agar diganti. Karena namanya Sibolga tapi lokasinya di wilayah Tapteng,” papar Sukran. (mora)

meyakinkan, 10 kabupaten/kota tidak perlu takut mengalami kesulitan pendanaan. “Karena prospeknya bagus, tak sulit kok cari pinjaman. Minimal sahamnya 10 persen lah. Itu minimal. Toh kalau banyak-banyak juga butuh

dana besar. Daripada banyak-banyak, tapi yang menikmati si jagoan (swasta), ya lebih baik tak banyak tapi optimal dinikmati pemda,” terang Marwan saat itu. (sam)

Basyrah Ajak Anak Buah Tolak Wakil jadi Bupati Sambungan Halaman 1 dipaksa menandatangani surat yang isinya 3 poin. Yakni; mendukung pemerintahan Basyrah Lubis sebagai Bupati hingga habis masa priodenya. Kedua, apabila Basyrah Lubis dinonaktifkan, maka mohon penggantinya ditunjuk dari Provinsi Sumuatera Utara. Terakhir, apabila TSO diangkat jadi Bupati Palas, maka (kami) akan mengundurkan diri. “Saya tidak mau menandatangani itu. Sebab, UU dan peraturan sudah menggariskan bahwa PNS tidak boleh berpolitik dan dukung mendukung. Dan, yang terjadi saat ini menimpa Basyrah Lubis adalah amanat hukum dan konstitusi,” ujar Arse. Dijelaskannya, setiap upacara kesadaran nasional, Basyrah Lubis selalu mengingatkan agar PNS tidak boleh berpolitik. Apalagi Peraturan Pemerintah (PP) sudah ada yang mengaturnya, begitu juga UU Nomor 32 tentang Pemerintahan Daerah. “Ada disebutkan sanksi-sanksi bagi PNS yang makar dan melawan keputusan lembaga pemerintah, sehingga saya tidak mau menandatanganinya. Dan akhirnya saya dicopot dari jabatan saya selaku Sekretaris Dispenda,” ucapnya. Diterangkannya lagi, surat dukungan tersebut

dipelopori oleh Sekda Palas Gusnar Hasibuan dan untuk dikirim ke Plt Gubsu, Gatot Pujo Nugroho “Ini kan PNS sudah berpolitik dan melawan keputusan Mendagri, karena Mendagri sudah mencopotnya. Dan makanya saya tidak mau tandatangan, karena melawan pemerintah,” tukasnya. Tetap Lantik Pejabat Surat pemberhentian Basyrah Lubis sebagai bupati yang diterbitkan Mendagri tidak menyurutkan Basyrah untuk melantik 58 pejabat eselon III dan IV di Pemkab Palas. Alasannya, hingga saat ini Basyrah Lubis belum menerima SK pencopotannya dari Mendagri. Diutarakan Kepala Bidang (Kabid) Mutasi, Badan Kepegawaian Daerah (BKD) Kabupaten Palas, Zulkarnain Nasution, membenarkan ada pelantikan Rabu (11/4) di kantor Bupati Palas, langsung dilantik Basyrah Lubis. “Benar ada pelantikan pejabat eselon III dan IV hari ini (Rabu 11/4, red) langsung dilantik oleh Basyrah Lubis, pukul 9.30 WIB,” ucap Zulkarnain. Sementara informasi dari Kasubbag Humas dan Protokoler Pemkab Palas, Alianda Lubis, menyebutkan, hingga saat ini Pemkab Palas belum ada menerima secara tertulis dari Kemendagri terkait pemecatan Basyrah Lubis dari Bupati.(amr)


Harga Rp2.000



Perekat Masyarakat Kota Berbilang Kaum Popdasu 2012 di Kabupaten Madina

18 Atlet Pencak Silat Sibolga Siap Bertarung SIBOLGA-Ikatan Pencak Silat Indonesia (IPSI) Kota Sibolga saat ini tengah menyiapkan sebanyak 18 atlet andalannya menjadi utusan mengikuti Pekan Olahraga Pelajar Daerah Sumatera Utara (Popdasu) 2012 di Mandailing Natal. Pelatih IPSI Kota Sibolga Irsan Efendi Hutagalung mengaku optimis, para atlet utusan Sibolga nantinya dapat mengukir prestasi dan mendulang medali khususnya di cabang pencak silat di Popdasu di Madina awal Juni 2012 mendatang. “Saat ini, kita sedang serius melakukan trainning centre (TC) kepada seluruh calon atlet utusan kita, waktu kita juga cukup lama dimulai hari ini, hingga menjelang Popdasu awal Juni 2012 nanti,” ujar Irsan Efendi Hutagalung didampingi pelatih Sandri Jhon Simarmata dan wasit Rahmat Syaiful Hutagalung kepada METRO, Rabu (11/4) usai melakukan pertemuan dengan Wali Kota Sibolga Drs HM Syarfi Hutauruk dan Wakil Wali Kota Sibolga, Marudut Situmorang AP MSP di Kantor Wali Kota Sibolga. Irsan menjabarkan, TC yang dilakukan tersebut merupakan kerja sama IPSI Kota Sibolga dengan Dinas Budparpora Kota Sibolga serta mendapat dukungan penuh dari Walikota dan Wakil Walikota. “Mudahmudahan atlet kita nanti tidak menge-

‹ Baca 18 ‹


Atlet Pencak .Hal 7

ATLIT POPDASU, Wali Kota Sibolga Drs HM Syarfi Hutauruk dan Wakil Wali Kota Marudut Situmorang A P MSP, foto bersama para pelatih dan atlit utusan Sibolga yang akan mengikuti Popdasu 2012 di Madina, Rabu (11/4) kemarin.


PT Rimba Baru & Herry Soetanto

Psp Bakal Dibubarkan SIDIMPUAN- Ancaman keras datang dari Kementerian Dalam Negeri (Kemendagri) terhadap daerah-daerah yang terancam bangkrut. Institusi pimpinan Gamawan Fauzi itu bakal mengambil tindakan tegas yakni melikuidasi (membubarkan) daerah tersebut. Di Sumut, Kota Padangsidimpuan dalam posisi rawan. Selain mantan ibu kota Tapanuli Selatan itu ada beberapa daerah lain yang rawan. Daerah yang dimaksud adalah Kota Langsa (NAD), Kabupaten Kuningan (Jabar), Kota Ambon (Maluku), Kabupaten Ngawi (Jatim), Kabupaten Bantul (Jogjakarta), Kabupaten Bireuen (NAD), Kabupaten Klaten (Jateng), Kabupaten Aceh Barat (NAD), Kota Gorontalo (Gorontalo), dan Kabupaten Karanganyar (Jateng). Nah, opsinya, daerah bangkrut tersebut dimerger dengan daerah terdekat atau di-

‹ Baca Psp ‹

Saling Klaim Tanah Incaran Pemko SIBOLGA- PT Rimba Baru, Sibolga dan Herry Soetanto, warga Medan dan Singapura, saling mengklaim kepemilikan atas tanah seluas 1.171 m2 di Jalan Mojopahit, Kelurahan Aek Habil, Sibolga. Klaim dari kedua belah pihak tersebut muncul setelah Pemko Sibolga memampangkan baliho pengumuman akan membeli tanah tersebut.

Bakal .Hal 7


KLAIM- Pihak PT Rimba Baru memasang plank mengklaim kepemilikan tanah yang ingin dibeli oleh Pemko Sibolga, Rabu (11/4).

“PT Rimba Baru sudah menguasai fisik tanah itu sejak tahun 1990-an. Tanah itu merupakan aset perusahaan. Dulunya digunakan sebagai tempat penimbunan kayu. Sampai sekarang perusahaan masih bayar pajaknya,” tutur Penasehat Hukum PT Rimba Baru, H Rekman Basri SH MBA melalui selulernya, Rabu (11/4). Hari itu, pihak PT Rimba Baru memancangkan plank tanda

kepemilikan tanah. Pada plank tertera; Tanah ini milik PT Rimba Baru dibawah pengawasan kantor advokad, pengacara, penasehat hukum, law office H Rekman Basri SH MBA, HP no: 0811612093. Sementara itu, pada baliho pengumuman yang dibuat Pemko Sibolga tertanggal 2 April 2012 itu tertera; Pengumuman. Tanah ini

‹ Baca Saling ‹

.Hal 7

Pak Wali Minta Muskot KNPI Fair (F:METRO/IST)

G U L A A R E N-Seorang pembuat gula aren sedang mempersiapkan dagangannya untuk dijual ke pasar. Saat ini harga gula aren di Sipirok mengalami kenaikan sebesar Rp3.000 per kg.

HargaGulaArenNaik SIPIROK-Seminggu terakhir, harga gula aren mengalami kenaikan, namun harga kakao mengalami penurunan dan harga berbagai jenis kopi masih netral. Hal ini dikatakan pengumpul komoditas pertanian dan perkebunan di wilayah Sipirok, Kabupaten Tapsel, H Painan Siregar kepada METRO, Rabu (11/4). Dijelaskannya, gula aren naik sebesar Rp3,000 dari Rp12.000 menjadi Rp15.000 per kilogram. Harga kakao turun sebesar Rp4.000 dari Rp18.000 menjadi Rp14.000 per kilogram. Sedangakan harga berbagai jenis kopi masih netral, Asersa Rp17.000, Robusta Rp21.000 per kilogram, dan Kopi Ateng Rp22.000 per soluknya. “Untuk pastinya, saya belum mengetahui penyebab penurunan tersebut, soalnya begitulah permintaan toke,” katanya. Diungkapkannya, khusus gula aren kenaikan tersebut sangat membantu petani aren yang menyebar di wilayah Kecamatan Sipirok, Arse dan Saipar Dolok Hole (SDH). “Tentunya kenaikan ini akan sangat membantu ekonomi para petani dan pengrajin gula aren yang ada di 3 Kecamatan ini,” sebutnya.

‹ Baca Harga ‹

Gula .Hal 7

SIBOLGA-Wali Kota Sibolga Drs HM Syarfi Hutauruk meminta kepada panitia pelaksana Musyawarah Kota (Muskot) KNPI Sibolga untuk melaksanakan musyawarah secara fair. Panitia juga diharapkan memberikan peluang sebesar-besarnya kepada masingmasing kandidat bakal calon (balon) ketua yang ingin maju dalam musyawarah tersebut. “Pemko Sibolga menyambut

baik pelaksanaan Muskott VIII KNPI Sibolga, dan berharap musyawarah tersebut nantinya berjalan aman dan lancar untuk memilih kepengurusan yang baru,” sebut Walikota Syarfi Hutauruk saat menerima audiensi panpel Muskot VIII KNPI Sibolga, Rabu (11/4) di ruang kerjanya. Syarfi juga berharap, kepengurusan KNPI Sibolga yang baru hasil Muskot nantinya tetap dapat

bersinergi dengan Pemerintah Kota (Pemko) Sibolga terutama dalam menyukseskan program pembangunan Negeri Berbilang Kaum tersebut. “Satu hal yang tidak kalah penting, kami juga mengharapkan dalam Muskot KNPI Sibolga tersebut tetap terjalin silaturahmi dan menghindari adanya perpecahan di tubuh

‹ Baca Pak ‹

Wali .Hal 7

Main Game Online, 6 Pelajar Dijaring SIBOLGA- Sebanyak 6 pelajar dari berbagai sekolah terjaring razia kasih sayang yang dilakukan Satpol PP Sibolga dari beberapa warung internet (warnet) di Kota Sibolga, Rabu (12/4) sekira pukul 09.30 WIB. Razia ini bertujuan mengantisipasi tawuran antar pelajar sekaligus persiapan jelang Ujian Nasional. Keenam pelajar yang terjaring tersebut kemudian diboyong ke kantor Satpol PP Sibolga guna dilakukan pendataan dan pembinaan. Mereka yang terjaring masing-masing KJH siswa kelas II MTS Swasta AL-Maidar Pandan, EAP pelajar kelas II SMPN 1 Sarudik, PRH pelajar kelas II SMP Islamiah Sibolga, ANH siswa kelas II T Sanawiyah Islamiah Sibolga,

„ Para pelajar sedang didata di Kantor Satpol PP Sibolga.

‹ Baca Main ‹

Game .Hal 7


PERIKSA HB, Kadis Kesehatan Sibolga M Yusuf Batubara SKM dan jajarannya saat menyaksikan pemeriksaan HB di SDN 085115, Rabu (11/4) kemarin.

Dinkes Periksa HB Anak SD KOTA BERINGIN-Untuk mendeteksi anak-anak usia sekolah, khususnya yang masih duduk di bangku Sekolah Dasar (SD) terhindar dari penyakit cacing dan anemia, Dinas Kesehatan Kota Sibolga melalui tenaga analisis Puskesmas Sambas melakukan pemeriksaan Haemoglobin (Hb), Rabu (11/4) pagi kemarin di SDN 085115 Kota Beringin, Sibolga. Kepala Dinas Kesehatan (Kadinkes) Sibolga, M Yusuf Batubara SKM didampingi Kabid Yankes, Resdi Dorlince Sianturi SE dan Kepsek SDN 085115 Sibolga, Rosip

Lubis SPd kepada METRO mengatakan, anak usia sekolah dasar (SD) perlu pengawasan kesehatan atau tumbuh kembang yang teratur, sebab selama 5 hingga 6 hari dalam seminggu mereka pulang dan pergi ke sekolah melewati berbagai macam kondisi, misalnya lalu lintas dan lingkungan, polusi, sumber penyakit, bergaul erat dengan banyak anak. “Sehingga perlu dilakukan pemeriksaan Hb bagi siswa kelas VI SD di Kota Sibolga. Kegiatan ini juga

‹ Baca Dinkes ‹

.Hal 7

Teraktual dari Tarutung, Balige, Humbahas, dan Samosir





PAD Salib Kasih hanya Rp39 Juta Setahun TAPUT- Objek wisata Salib Kasih yang dianggap menjadi andalan Taput, ternyata jauh dari perkiraan. Wisata ini hanya mampu menghasilkan Pendapatan Asli Daerah (PAD) sebesar Rp39 juta lebih dalam setahun. Pendapatan itu berasal dari tiket masuk dan parkir.

Tahun ini, objek wisata rohani tempat Nommensen pertama sekali menatap rura silindung atau Kota Tarutung, akan dikucuri dana sebanyak lebih kurang Rp2 miliar. Dana itu diperuntukkan untuk memoles atau membenahi kawasan

„) Baca PAD Salib ..Hal 10

Foto/Bernad L Gaol

BERHAMBURAN: Warga Kota Tarutung berhamburan keluar rumah ketika gempa terjadi Rabu (11/4) sekira pukul 15.38 WIB.

Foto/ Bernad L Gaol

TERSANGKA: Erwinsya (pakai sweater warna hitam) diapit Kasat Reskrim Taput AKP Josua Tampubolon dan Kasubnit Pidum Polrestabes Surabaya, Ipda Ade Waroka dibantu Bripka Cucun Hariyanto.

Pelaku Pembobol ATM Dibekuk dari Hotel TARUTUNG- Polres Taput berhasil meringkus satu dari dua tersangka spesialis penipuan via ATM ( Automated Teller Machine), Erwinsya (28) warga Karya Setuju Medan, Sabtu (7/4) pukul 24.00 WIB. Tersangka digrebek dari salahsatu kamar di Hotel Parrona Siborongborong, Taput. Sementara rekan tersangka inisial Y (31) juga warga Me-

dan, yang diduga sebagai otak penipuan tidak berhasil dibekuk. Saat penggerebekan dilakukan, tersangka Y sudah terlebih dulu meninggalkan kamar hotel. Kedua tersangka merupakan DPO Polrestabes Surabaya. Karena para tersangka berhasil memperdaya korban

Gempa Akibatkan Listrik Padam TARUTUNG- Gempa 8,5 Skala Richter (SR) yang terjadi 510 kilometer barat daya perairan laut Nangroe Aceh Darussalam (NAD) tepatnya di Kabupaten Simeuleu, Rabu (11/4) sore sekitar pukul 15.38 WIB, terasa cukup kuat hingga ke Humbahas, Taput dan Tobasa. Bahkan gempa yang berlangsung sekitar 3 menit itu mengakibatkan listrik ke Taput defisit. Sehingga dua kecamatan di daerah itu padam. Yakni Kecamatan Sipoholon dan Parmonangan. “Kita tidak ada gangguan, tapi defisit dari pembangkit akibat gempa tadi,” kata Kepala PLN ranting Tarutung, Ramses Hutajulu. Meski pemadaman berlangsung hanya dua jam, mulai pukul 17.35

Foto:Metro/Horden Silalahi

KELUAR: Sejumlah karyawan bank dan warga Kota Doloksanggul saat keluar dari kantor dan rumah masing-masing pasca terjadinya gempa 8,5 SR Simeuleu.

hingga pukul 19.35 WIB, namun sempat membuat warga khawatir. Sementara itu, Kepala BPBD Taput, Tumbur Hutabarat dikonfirmasi

„) Baca Gempa ..Hal 10

„) Baca Pelaku ..Hal 10

24 Tenaga Honorer Masuk Nominasi Diangkat jadi CPNS Tenaga Honorer Kategori I yang Masuk Nominasi

Foto: Horden Silalahi

JUMPA PERS: Ketua DPC Partai Gerindra Humbahas, Saut Parlindungan Simamora (ketiga dari kanan) saat menggelar jumpa pers dengan wartawan.

10 PAC Gerindra Humbahas Akan Dilantik HUMBAHAS- Sebanyak 10 Pimpinan Anak Cabang (PAC) Partai Gerindra di Kabupaten Hmbahas akan dilantik, Jumat (13/4) di Wisma Katolik, Doloksanggul. Pelantikan itu akan dilakukan oleh pengurus DPD Gerindra Sumatera Utara, Ir Ramses Simbolon MSc. Demikian diungkapkan Ketua DPC Gerindra Humbahas, Saut Parlindungan Simamora didampingi Sekretaris Jimmi Togu Purba, Sekretaris Panitia

Pelantikan, Aslin Simamora dan Humas DPC Gerindra, Jahormat Lumban Gaol saat menggelar jumpa pers dengan sejumlah wartawan, Rabu (11/ 4) di Doloksanggul. Ketua DPC Partai Gerindra Humbahas, Saut Parlindungan Simamora mengatakan, sebelumnya, Ketua DPC Partai Gerindra Humbahas dijabat oleh Hasiholan Simamora yang

„) Baca 10 PAC ..Hal 10


No Nama

Unit Kerja

1. Sari Hotnida Manik 2. Bahtera Yudha S 3. Manaor Panjaitan 4. Mei Riama Munte 5. Pinta Simanjuntak 6. Helprida Simanjuntak 7. Riama E Siahaan 8. Fengki BE Siahaan 9. Hombar Napitupulu 10. Hotpangidoan Panjaitan 11. Jernita Panjaitan 12. Ricky MT Hutabarat 13. Amriko Napitupulu 14. Binner Panjaitan 15. Jorianta Napitupulu 16. Melati Lumban Raja 17. Cyrus M Siahaan 18. Sariaman Sihombing 19. Jon Roy Pangaribuan 20. Fetty Farida Tamba 21. Herlina Sitorus 22. Jonsi Silalahi 23. Roslina Marpaung

Dinas Pendidikan Nasional (Guru) Sekretariat Daerah Sekretariat Daerah Sekretariat Daerah Sekretariat Daerah Bagian Humas Setdakab Bagian Humas Setdakab Dinas Perindustrian dan Perdagangan Dinas Perindustrian dan Perdagangan Dinas Perindustrian dan Perdagangan Dinas Perindustrian dan Perdagangan Dinas Perindustrian dan Perdagangan Sekretariat DPRD Sekretariat DPRD Sekretariat DPRD Sekretariat DPRD Dinas Pasar Kebersihan & Pertamanan Dinas Pasar Kebersihan & Pertamanan Dinas Pasar Kebersihan &Pertamanan Dinas Pendidikan Nasional Dinas Pendidikan Nasional Dinas Pendidikan Nasional Pemberdayaan Masyarakat Desa & Perempuan Kecamatan

24. Perdian S Liber Hutapea

BALIGE- Dari 120 orang tenaga honorer kategori pertama yang diusulkan Badan Kepegawaian Daerah (BKD) Tobasa ke Badan Kepegawaian Negara (BKN) Pusat, hanya 24 orang yang memenuhi kriteria berdasarkan verifikasi dan validasi untuk diangkat menjadi CPNS. Hasil verifikasi dari Kementerian Pendayagunaan Aparatur Negara dan Reformasi Birokrasi itu diterima BKD Tobasa pada 4 April. Demikian dikatakan Kepala BKD Tobasa, Budianto Tambunan, Rabu (11/4) di kantornya. Hanya saja, ia menyayangkan pengangkatan tenaga honorer tersebut terlalu sedikit. Padahal yang diajukan lumayan banyak. “Hanya 24 orang tenaga honorer kategori pertama yang masuk nominasi dan memenuhi kriteria untuk diangkat jadi Calon Pegawai Negeri Sipil (CPNS),” ucapnya. Dikatakan, ke-24 tenaga honorer tersebut perlu diuji publik dan diketahui oleh masyarakat guna mendapat tanggapan dari masyarakat. Hal ini sesuai dengan surat edaran dari Menpan dan RB RI No 03 Tahun 2012. “Kita berikan waktu bagi masyarakat paling lama tanggal 15 April 2012 untuk diuji publik, dengan maksud apabila nama-nama honorer yang masuk

„) Baca 24 Tenaga ..Hal 10

Foto:Aristo Panjaitan

DIULOSI: Prof Achmad Sazidie ymewakili Dirjen Dikti dan Prof David Helak diulosi Ketua Dewan Pembinan Yayasan Del Jend (Purn) Luhut Panjaitan.

SMA Unggulan Del Laguboti Rekrut 128 Siswa LAGUBOTI- SMA Unggulan Del diyakini mampu ‘melahirkan’ manusia-manusia berkualitas yang bisa membawa perubahan untuk masyarakat sekitar, bangsa dan negara. Hal ini dikatakan Ketua Dewan Pembina Yayasan Del Sitoluama Laguboti, Jend (Purn) Luhut Binsar Panjaitan, Selasa (10/4) di selasela peletakan batu pertama pembangunan

„) Baca SMA Unggulan ..Hal 10




12 April 2012




Pelaku Galian C Wajib Bayar Retribusi

Foto: Horden Silalahi

PANTAU POS: Drs Tonny Sihombing MAP memberikan arahan kepada petugas pos pengendali Perda Retribusi Galian C di Desa Nagasaribu III, Lintongnihuta, tepatnya di perbatasan Humbahas-Taput. LINTONGNIHUTA- Guna mengoptimalkan pemungutan pajak dan penertiban usaha-usaha galian C ilegal, tim terpadu penegak Perda Pemkab Humbang Hasundutan

yang terdiri dari gabungan beberapa instansi, menyosialisasikan Perda No 25 Tahun 2005 tentang Galian C kepada wajib pajak. Selain untuk meningkatkan

PAD, tim terpadu juga menempatkan pos pemantau aktifitas pengangkutan mineral bukan logam dan batuan yang keluar dari Kabupaten Humbahas, tepatnya di Dusun Sijuguk, Desa Nagasaribu III, Kecamatan Lintongnihuta atau perbatasan Humbahas dengan Taput. Kadis Pendapatan, Pengelolaan Keuangan dan Aset Daerah (DPPKAD) Kabupaten Humbahas, Bona Santo Sitinjak SE, saat pelaksanaan sosialisasi Perda retribusi Galian C di Desa Nagasaribu III, Lintongnihuta, Selasa (10/4) mengatakan, tujuan sosialisasi tersebut, selain untuk mendukung peningkatan PAD, juga untuk menyadarkan para wajib pajak agar taat aturan. “Sosialisasi Perda No 25 ini bertujuan untuk meningkatkan PAD Humbahas tahun ini. Hendaknya melalui sosialisasi Perda ini, diharapkan masyarakat secara khusus pengusaha sadar terkait kewajib-

an yang harus dibayar,” kata Bona. Lebih lanjut, Bona mengatakan, untuk penertiban peredaran hasil Galian C dari daerah itu, pihaknya telah mendirikan pos pengendali di perbatasan Humbahas-Taput. ”Dari pos pengendali itu, nantinya akan diketahui berapa besar volume bahan galian C yang di keluarkan dari Humbahas dan retribusinya akan dibayarkan langsung di pos penjagaan,” ungkapnya. Sementara itu, Kepala Kantor Pertambangan dan Energi Humbahas, Ir N Sigalingging mengatakan, untuk sementara petugas yang ada di pos pengendali Galian C, tidak perlu mempertanyakan kepada pengemudi truk angkutan apakah muatan truk tersebut memiliki dokumen izin galian C atau tidak. Namun ke depan, pengusaha Galian C wajib untuk melengkapi dokumen Galian C yang dikeluarkan oleh pemerintah.

Sebelumnya, Asiten I Pemerintahan Humbahas Drs Tonny Sihombing MIP selaku ketua tim terpadu mengatakan, bahwa tujuan pelaksanaan kegiatan itu, adalah semata mata untuk memberikan pengarahan dan pedoman dalam pelaksanaan pengambilan hasil bumi yang berhubungan langsung dengan Perda. “Melalui sosialiasasi ini, diharapkan para pengusaha dapat mengetahui ketentuan dalam menjalankan usaha yang ditekuninya terutama galian golongan C yang ada di Humbahas, sesuai dengan Perda yang berlaku guna meningkatkan PAD Kabupaten Humbahas”, kata Tonny. Turut hadir dalam kegiatan sosialisasi Perda tersebut, Kepala Bagian Pemerintahan Desa, Drs E Simanungkalit MM, Kabag Humas Drs Hotman Hutasoit, beserta pegawai dari Dinas Perhubungan dan Dinas Kehutanan Humbahas.(hsl)

Pemkab Samosir Jalin Kerja Sama dengan LAN PANGURURAN- Pemerintah Kabupaten Samosir, menjalin kerja sama dengan Lembaga Administrasi Negara (LAN) Republik Indonesia dalam mewujudkan standar pelayanan minimal kepada masyarakat di wilayah setempat. “Kerja sama tersebut ditandai dengan MoU antara Bupati Samosir Mangindar Simbolon dengan Deputi Bidang Kinerja Kelembagaan dan Sumber Daya Aparatur, Sri Hadiati WK,” ujar Kabag Humas Pemkab Samosir, Amon Sormin di Pangururan, Rabu (11/4). Juru bicara Pemkab Samosir itu menyebutkan, ruang lingkup

kesepahaman yang disepakati antara lain program pengkajian, penelitian dan pengembangan peningkatan kapasitas kelembagaan SDM, seminar, lokakarya dan kegiatan sejenisnya. Selain itu, lanjutnya, perbantuan tenaga ahli dan kegiatan lainnya yang akan berlaku selama lima tahun guna meningkatkan Standar Pelayanan Minimal (SPM) kepada masyarakat, serta dengan keterbatasan dana yang tersedia, pemerintah daerah dapat mengaplikasikannya hingga dapat dirasakan masyarakat. “Skala prioritas dalam

mewujudkan SPM harus tertuang dalam Rencana Pembangunan Jangka Menengah (RPJM), Renstra dan capaian ke Dokumen Pelaksanaan Anggaran,” kata Amos. Sebelumnya, Wakil Bupati Samosir, Mangadap Sinaga mengatakan, para pimpinan Satuan Kerja Perangkat Daerah (SKPD), agar dapat bekerja keras dan menjalin kerja sama yang baik dengan tim dari LAN, terutama dalam pengumpulan data serta informasi yang dibutuhkan. Deputi Bidang Kajian Kinerja Kelembagaan dan Sumber Daya

Aparatur LAN RI, Sri Hadiati menyampaikan penghargaan dan apresiasi yang tinggi kepada Pemkab Samosir atas kesigapan dalam menyikapi peraturan pemerintah tentang SPM dimaksud. Dikatakannya, pihaknya akan membantu sepenuhnya hingga kesepakatan yang ditanda tangani tidak sekadar hanya tanda tangan, tetapi mempunyai dampak positif kepada masyarakat. Sekretaris Daerah Kabupaten Samosir, Hatorangan Simarmata menambahkan, SPM itu nantinya akan dilaporkan dalam Lembaran

Pertanggung Jawaban Pemerintah Daerah (LPPD). Menurut dia, RPJM dan SPM tiap-tiap SKPD akan menjadi modal pimpinan dalam memonitor kinerja masingmasing Kepala SKPD, dan mereka harus benar-benar serius dalam penyusunannya. Untuk tahun 2012 ini, kata dia, telah ditetapkan lima SPM yang harus diselesaikan, yaitu bidang Sosial, Pendidikan, Kesehatan, Lingkungan hidup dan Perumahan. “Sebanyak tiga belas SPM yang ditetapkan Pemerintah Pusat akan tuntas pada 2014,” kata Hatorangan. (ant/int)

Gempa Akibatkan Listrik Padam Sambungan Halaman 9 via selulernya membenarkan getaran gempa terasa kuat di Taput. Bahkan, getaran itu sempat membuat mereka khawatir dan langsung melakukan monitoring ke sejumlah kecamatan. Hingga tadi malam, pihaknya belum ada menerima laporan adanya kerusakan. Namun tiga kecamatan di daerah itu meliputi Pahae, Sipoholon, dan Tarutung diawasi ketat karena masuk dalam kategori rawan gempa dan longsor. Pasalnya topografi tiga kecamatan ini berpotensi mengalami gempa. Gempa susulan, sekitar pukul 17.45 WIB juga terasa di

tiga daerah ini. Lagi, warga langsung berhamburan keluar rumah untuk menyelamatkan diri dari kemungkinan terjadi kerusakan rumah. Kartini Siregar, warga Kota Doloksanggul mengatakan, gempa di Kota Doloksanggul sempat membuat warga panik hingga berhamburan keluar rumah. ”Kalau menit pertama gempa warga masih bertahan di dalam rumah masing-masing. Tapi karena gempanya cukup lama dan bertambah kuat, warga keluar dari rumah masing-masing,” kata Kartini. Sebab ketiga daerah itu terdapat rentetan patahan semangko dan daerah gembur yang tidak kuat untuk kondisi

getaran akibat pergeseran di dalam perut bumi. “Seluruh personel kita sudah memantau kawasan tebing. Kita juga sudah melakukan update data dari pihak BMKG termasuk terjadinya lima kali gempa susulan terakhir,” terangnya. Dia memaparkan, saat ini, kondisi bangunan pemerintah dan masyarakat juga dalam kondisi membaik. Termasuk sejumlah badan jalan di kawasan Jalinsum Pahae yang kerap mengalami kerusakan apabila terjadi gempa. “Kepada seluruh Camat dan Kades diminta agar tidak lengah memantau warganya. Serta seluruh daerah yang

berpotensi longsor untuk sementara dihindari dulu. Pasalnya, musibah bisa saja datang tanpa diduga,” paparnya. Ditambahkannya, kerugian materi masih dalam pendataan. Gempa ini dirasakan oleh warga ditaput dan sekitarnya, pihaknya juga masih melakukan pendataan. Dengan gempa sebesar itu, kondisi listrik di Pahae sempat Padam. “Soal data kita belum dapat dan akan disampaikan lebih lanjut,” ujarnya. Hingga gempa susulan pukul 17.45 WIB, tidak ada kerusakan rumah maupun korban jiwa terjadi di Humbahas akibat gempa. Namun, warga mengaku masih tetap waspada

untuk antisipasi gempa susulan. Amatan METRO, di pusat Kota Doloksanggul, saat terjadinya gempa, sejumlah karyawan bank dan pemilik rumah beton bertingkat berhamburan keluar dari rumah masingmasing. Warga mengaku, sangat was-was terjadi gempa kuat yang dapat merusak rumah mereka. Demikian juga Tarutung. Sejumlah pegawai kantoran sempat berhamburan keluar. Sebab gempa terasa cukup kuat dan menguncang hampir lebih kurang 3 menit. Warga juga mengaku sempat pusing akibat guncangan itu. (hsl/cr-01)

PAD Salib Kasih hanya Rp39 Juta Setahun Sambungan Halaman 9 salib kasih. Tujuannya untuk menarik perhatian agar pengunjung merasa bersimpatik ke wisata itu. Dengan demikian, bisa meningkatkan PAD. Kepala UPT Salib Kasih Siatas Barita, Helmy Siregar dikonfirmasi upaya apa yang

mereka lakukan guna mendatangkan pengunjung ke Salib Kasih mengatakan, saat ini, pengelola akan melakukan kerja sama dengan Badan Kerjasama Antar Gereja (BKAG) untuk menyediakan layanan konseling di kawasan itu. “Setelah kebaktian, pengunjung juga bisa mendapatkan

layanan conselling. Hal itu kita lakukan karena saat ini banyak masyarakat yang membutuhkan pelayanan,” ucapnya. Selain itu, pemkab akan membangun Auditorium tepat di belakang Salib Kasih sebagai tempat para rombongan retreat atau pelajar, juga bisa dijadikan sebagai tempat ke-

baktian selain di bawah kaki salib tersebut. Namun, untuk menunjang hal itu, pengelola salib kasih juga akan bekerja sama dengan Dinas Informasi dan Komunikasi (Kominfo) agar selalu menyajikan informasi melalui website pemkab. Sehingga acara maupun program yang

akan dilaksanakan di Salib Kasih dapat dilihat melalui internet. “Sehingga orang tahu apa saja acara yang akan dilaksanakan. Nah, apabila si pembaca itu merasa tertarik, dia bisa datang atau berkunjung ke tempat dimana kegiatan tersebut digelar,” ucapnya. (cr-02)

10 PAC Gerindra Humbahas Akan Dilantik Sambungan Halaman 9 selanjutnya duduk sebagai Dewan Penasehat Gerindra Humbahas. Ia menyebut, pelantikan 10 PAC Partai Gerindra itu merupakan bentuk komitmen pihaknya untuk memantapkan kaderisasi partai hingga ke tingkat ranting. ”Saat pelantikan itu, nanti akan kita un-

dang Unsur Pimpinan Daerah Humbahas, tokoh masyarakat, tokoh pemuda, tokoh agama dan tokoh adat,” ujar Saut Parlidungan Simamora yang akrab dipanggil SAPA itu. Ia menambahkan, 10 pengurus PAC Partai Gerindra yang bakal dilantik itu, semuanya telah melalui tahapan seleksi dari DPC. ”Kita menginginkan seluruh kader partai memiliki moralitas

yang baik. Jadi, pengurus PAC yang akan dilantik itu sudah kader terbaik kita saat ini,” ungkapnya. Guna memperbaiki mentalitas dan moralitas kader partai, sambung Saut Parlindungan, pihaknya akan mengirimkan para pimpinan PAC ke Hambalang, Bogor, Jawa Barat. ”Yang jelas, kita punya target menjadikan Partai Gerindra terbesar di Kabupaten Hum-

bahas,” katanya. Sedangkan Sekretaris DPC Partai Gerindra Humbahas, Jimmi Togu Purba mengatakan, sebelum dilaksanakan pelantikan 10 PAC, pihaknya akan menejunkan 400 kader Partai Gerindra di Humbahas untuk gotong royong membersihkan pusat Kota Doloksanggul. ”400 kader Partai Gerindra itu, kita datangkan dari

TOYOTA BARU ASTRA: Ready Avanza, innova, fortuner Hub. Purba 0813 9789 4633; 0813 9736 0333 PROMO MITSUBISHI: Pick Up L300 & T120ss. Colt Diesel Chassis & Dumptruck. Fuso, Triton, Pajero Sport. BB/BK >oke..! Kuning/Hitam>oke!! Diskon spesial Hubungi: VINA NAULI SIREGAR 0812 6036 0000 MITSUBISHI PROMO: DP RENDAH – BUNGA RINGAN T 120 SS, L300, Colt Diesel, Triton Pajero Sport, Dakar, Grandis. Hub. Pohan HP 0812.659.1867

MITSUBISHI BARU: Pajero Sport, Triton, Colt Diesel, Dump Truck, L300 FD, T230S. Suku bunga 0%, Ready stock Hub: Gultom Berlian, 0813 6169 4479 DIBUTUHKAN GURU TK-SD: di Tj. Piayu Batam & guru bimbel di Marindal Medan, wanita single 18-30 th, min SMU HP 0852 6177 6326, 0813 6432 3472, 0821 6404 3077

10 kecamatan yang ada di Humbahas,” ujar Jimmi Togu. Usai pelantikan, tandas Jimmi, pihaknya akan menggelar Rapat Kerja Cabang (Rakercab) guna membahas dua bidang komisi, yakni komisi organisasi dan politik, serta komisi KTA (kartu tanda anggota). ”Setelah itu, ke depan akan kita gelar rapat pimpinan partai,” tukasnya. (hsl)

24 Tenaga Honorer Masuk Nominasi Diangkat jadi CPNS Sambungan Halaman 9 nominasi itu keabsahan data honorernya diragukan,” tandas Budianto. Ditambahkan Budianto, honorer kategori pertama yang lolos verifikasi dan validasi dengan memenuhi kriteria Mahkamah Konstitusi (MK) atau yang tidak memenuhi kriteria berdasarkan PP 48 tahun 2005 jo PP No 43 Tahun

2007. Dikatakan, tahap verifikasi dan validasi data honorer kategori pertama untuk Kabupaten Tobasa, ketika itu dilaksanakan pada bulan November 2010 lalu. Hasil verifikasi dan validasi tenaga honorer itu sejak dikeluarkan, sudah diumumkan BKD di papan pengumuman dengan ditandatangani Wakil Kepala BKN, Eko Sutrisno. (cr-3)

SMA Unggulan Del Laguboti Rekrut 128 Siswa Sambungan Halaman 9 gedung Sekolah Menengah Atas (SMA) Unggulan Del di Desa Sitoluama Kecamatan Laguboti, Tobasa. Dikatakan Luhut, dengan dibukanya SMA Unggulan Del ini, semata-mata untuk meningkatkan kualitas pendidikan di Sumatera Utara khususnya di Tapanuli. Dengan harapan mampu melahirkan peneliti-peneliti berkualitas yang mampu membawa perubahan. Tennov Simanjuntak selaku Ketua Pelaksana Pengembangan SMA Unggul Del menjelaskan, SMA Unggulan Del tersebut direncanakanakanmulaiberoperasi tahun ajaran 2012/2013 dengan menerimasiswaperdanasebanyak 128 orang dengan penjaringannya melalui ujian yang ketat. Untuk tenaga pendidiknya sendiri sudah tersedia 29 orang, 9 orang di antaranya berstatus PNS yang perekrutannya melalui seleksi ketat melalui tahapan ujian tertulis, ujian Tofel Bahasa Inggris dan ujian praktek sesuai dengan kompetensinya. Sedangkan ruangan belajar SMA Unggulan Del tersebut sementara menggunakan ruangan Politeknik Informatika Del yang tidak jauh dari lokasi bangunan yang akan dibangun. Kketua Harian Yayasan SMA Unggulan Del, Ir Patuan Simatupang mengatakan, pendirian SMA Unggulan Del ini menjawab kerinduan para orang tua khususnya suku Batak, bahwa pendidikan

yang berkualitas itu sangat penting. “Pendirian SMA Unggulan Del ini untuk mengurangi kesenjangan kualitas pendidikan yang berpusat dikota-kota besar. SMA Unggulan Del ini dapat memberikan kesempatan kepada putraputri daerah ini untuk mengecampendidikan yang berkualitas,” ujar Patuan Simatupang. Pembangunan SMA Unggulan Del ini dimulai dengan ditandai peletakan batu pertama yang dilakukan langsung Ketua Dewan Pembina Yayasan Del Jend (Purn) Luhut Binsar Panjaitan, selanjutnya diikuti Bupati Tobasa Pandapotan K Simanjuntak, dan mewakili pucuk pimpinan HKBP Dr Binsar Nainggolan. Selain peletakan batu pertama pembangunan SMA Unggulan itu, dilakukan juga penandatanganan MoU penelitian dan pendidikan bidang Bioteknologi antara Cezk University Life of Science (CULS) Ceko yang diwakili Prof David Helak dan Direktur PI Del Dr Arlinta Barus serta Ketua Yayasan Del Patuan Simatupang. Dalam kesempatan itu, tampak hadir Bupati Taput Torang Lumban Tobing, Ketua DPRD Tobasa Sahat Panjaitan, Rektor Universitas Nommensen Medan Dr Jongker Tampubolon, Prof Dr Ir Achmad Sazidie yang mewakili Dirjen Dikti, serta Prof (HC) Willi Torsuta dari Asociated yang memberikan pemaparan tentang desain system penerapan pendidikan di SMA Unggulan Del dan program pendidikan D IV Del. (cr-3).

Pelaku Pembobol ATM Dibekuk dari Hotel Sambungan Halaman 9 Antonius Andy, warga Jalan Deltasari Indah Sidoarjo, Jatim. Pengusaha distributor rokok ini, menyetor uang sebesar Rp125 juta kepada pelaku melalui bank. Modusnya, pelaku meminta sejumlah uang kepada korban dengan berpura-pura sebagai pejabat tinggi polisi di Polda Jatim. Kapolres Taput melalui Kasat Reskrim AKP Josua Tampubolon mengatakan, keberadaan tersangka diketahui berdasarkan pengakuan adik perempuan Erwinsya berinisial E (23) yang lebih dulu ditangkap Satuan Reskrim di Bank BCA Cabang Pulo Brayan, Medan. Yang mengatakan, kedua tersangka berada di Siborongborong. Menindaklanjuti informasi tersebut, aparat Polres Taput dibantu Polsek Siborongborong melakukan penggrebekan di salahsatu kamar Hotel Parrona tempat mereka menginap. Ternyata benar. Dari kamar tersangka, polisi menyita sejumlah barang bukti berupa enam lembar kartu

ATM dari berbagai bank. Selain itu, Polisi juga menyita sejumlah uang tunai, slip setoran dan tas. “Tersangka Erwinsya kita tangkap saat berada di kamar. Sedangkan Y tidak ada di kamar itu lagi. Menurut keterangan Erwinsya, tersangka Y sudah lebih dulu keluar sebelum penggerebekan dilakukan,” terang Josua Tampubolon kepada METRO, Rabu (11/4) di Tarutung. Josua membeberkan, Taput diduga merupakan daerah operasi kejahatan para tersangka selanjutnya. Para tersangka merupakan sindikat penipuan antar provinsi. Modus yang sering digunakan, memanfaatkan kebingungan pemilik kartu ATM saat mengetahui kartu ATM terjebak di mesin. Pelaku sebelumnya telah menempelkan nomor telepon yang dapat dihubungi jika kartu ATM macet. “Ternyata nomor itu adalah nomor para pelaku. Selanjutnya korban dimintai nomor PIN. Setelah PIN didapat, tersangka lain sudah bebas menguras uang korban. Sebelumnya mereka telah mengintai para calon korban,” tandasnya. Tersangka Erwinsya akan dibawa ke Surabaya untuk penyelidikan selanjutnya. “Kita telah berkordinasi dengan AKBP Parman SIK selaku Kasat Reskrim Polrestabes Surabaya dan Kasat Reskrim Polresta Medan Kompol Yoris Marzuki SIK. Tersangka akan dibawa langsung oleh Ipda Ade Waroka, Kasubnit Pidum Polrestabes Surabaya dibantu Bripka Cucun Hariyanto,” sebut Josua. Ditambahkan, tersangka Erwinsya dan Y berhasil memperdaya korban Antonius Andy, Cina Khatolik, warga Jalan Deltasari Indah Sidoarjo yang juga pengusaha distributor rokok tertanggal 4 April. Total kerugian korban sebesar Rp125 juta rupiah. “Kita menduga, selain Antonius, masih banyak korban lain di luar sana. Dan saat ini masih kita kembangkan,” tandasnya. (cr-01)




April 2012





Tambah PNS Diam-diam

Kepala Daerah Bisa Dipenjara Malaysia Keluarkan Peringatan Tsunami KUALA LUMPUR- Otoritas Malaysia juga mengeluarkan peringatan tsunami menyusul gempa bumi berkekuatan 8,5 SR yang mengguncang Aceh. Penduduk di sepanjang pantai barat Malaysia diserukan untuk mengungsi ke tempat yang lebih aman. ”Kami telah mengumumkan peringatan tsunami di sepanjang pantai barat semenanjung Malaysia. Kami telah memerintahkan evakuasi segera untuk warga di sepanjang pantai negaranegara bagian Perlis, Kedah, Langkawi, Penang dan Perak,” kata seorang pejabat Departemen Meteorologi Malaysia kepada kantor berita AFP, Rabu (11/4). Sebelumnya,otoritasIndia,SriLankadanThailand juga telah mengeluarkan peringatan tsunami menyusul gempa 8,5 SR di Simeuleu, Aceh yang terjadi pada pukul 15.38 WIB. Peringatan tsunami di Thailand bahkan telah diperluas untuk 6 provinsi dari sebelumnya 2 provinsi saja. SementarapusatmanajemenbencanaSriLanka telah menyerukan penduduk pantai untuk bergerak ke daerah-daerah yang lebih tinggi. Ini sebagai pencegahan jika terjadi gelombang tsunami. (kmc/int)

JAKARTA - Kementerian Dalam Negeri (Kemendagri) menyiapkan formula lain agar daerah-daerah yang terancam bangkrut bisa bertahan. Kalau sebelumnya mengancam bakal ada likuidasi, kali ini yang ditekan adalah pemimpin daerahnya. Yakni, ancaman penjara kalau nekat menambah Pegawai Negeri Sipil secara diam-diam. Seperti diketahui, saat ini moratorium penghentian penerimaan PNS memang telah berjalan. Namun, Ditjen Otonomi Daerah (Otoda) Kemendagri Djoehermansyah Johan menyebut kepala daerah masih suka mengangkat pegawai secara diam-diam. Biasanya, diawali dengan mengangkat seseorang sebagai pegawai honorer. “Biasan-

ya untuk balas budi,” ujarnya kepada Jawa Pos. Lebih lanjut dia menjelaskan, kebanyakan yang diangkat oleh kepala daerah adalah tim suksesnya. Selama ini, tidak ada sanksi bagi kepala daerah yang nekat “menyelundupkan” pegawai baru itu. Sehingga beban keuangan daerah makin berat karena harus membayar pegawai

tersebut. Agar lebih bertaring, aturan pidana bagi kepala daerah tersebut bakal dijadikan undang-undang. Saat ini, Djoe mengatakan rancangan undang-undang (RUU) Pemerintah Daerah itu sudah disampaikan ke DPR. Namun, dia enggan menerangkan lebih detail tentang ancaman penjara itu. “Yang jelas, diancam pidana,” imbuhnya. Langkah tegas itu perlu diberlakukan supaya jumlah PNS tidak membludak. Opsi moratorium memang menurutnya paling logis saat ini, sebab kalau dipaksa pendistribusian ke beberapa daerah akan makan waktu. Apalagi, beberapa daerah juga disebutnya sudah ge-

muk pegawai. Seperti diberitakan sebelumnya, Forum Indonesia Untuk Transparansi Anggaran (FITRA) merilis 291 kabupaten/kota yang memproyeksikan belanja pegawainya lebih dari 50 persen. Nah, dari daerah itu terdapat 11 daerah yang memiliki belanja pegawai lebih dari 70 persen. Gara-gara itu, daerah tersebut kolaps karena tidak lagi memiliki anggaran. Sebelas daerah itu diantaranya Kota Langsa (NAD), Kabupaten Kuningan Jabar, Kota Ambon, Kabupaten Ngawi, Kabupaten Bantul, Kabupaten Bireuen (NAD), Kabupaten Klaten, Kabupaten Aceh Barat, Kota Gorontalo, Kabu-

Kapal New Lucky VII Tenggelam

6 WNI Hilang di Amami Oshima JEPANG- Enam warga negara Indonesia awak kapal New Lucky VII yang tenggelam di perairan Amami Oshima, Jepang, hingga Rabu (11/4) ini, belum ditemukan. Keadaan keenam WNI tersebut dijelaskan oleh Japan Coast Guard. “Japan Coast Guard telah mengumumkan kepada semua kapal yang melewati perairan daerah tersebut untuk membantu memberikan informasi apabila ada tanda keberadaan awak yang belum ditemukan tersebut,” kata juru bicara Kementerian Perhubungan, Bambang S Ervan, Rabu. Seperti dilansir laman KBRI Tokyo, kapal New Lucky VII berukuran 4.143 ton yang membawa kayu berangkat dari Rabaul-PNG tanggal 24 Maret 2012 pukul 17.00 waktu setempat menuju Shanghai, China. Kapal ini berbendera Hongkong dengan agen di Jinjiang, yaitu Taizhou International Shipping Agency Ltd. Pemilik kapal adalah Franbo Line Ltd, Hongkong. Kapal membawa 17 awak yang terdiri dari 1 kapten dan 16 awak lainnya. Sebanyak 13 orang adalah WNI dan 3 orang warga negara China. Pada 3 April 2012 pukul 07.20 GMT, kapal terkena badai dan ombak besar sehingga karam. Pada saat akan meninggalkan kapal, kapten sudah memastikan semua kru berada di sekoci dan rakit, yaitu 6 orang di sekoci dan 11 orang di rakit. Lalu, ada gelombang besar yang menghantam dansetelahredatersisa9orangdirakitdan2orang disekoci.Tanggal3April2012pukul11.00GMT,11 orang yang tersisa—8 orang di antaranya WNI— diselamatkan oleh JCG Area 10 Kagoshima dan dibawa ke kota Amami. Korban lalu dirawat di RS Kagoshima Kenritsu Oshima. (kmc/int)


PASCA GEMPA DPADANG-SUMBAR ; Masyarakat padang berlarian saat gempa 8,9 sr aceh yg drasakan d padang,Gempa lumayan terasa kencang dan tidak ada material yg rusak, pasien rumah sakit dr.m,djamil terpaksa d bwa keluar dri ruang bangsal dpadang.

Ratusan Warga Pesisir Pantai Kota Padang Mengungsi PADANG- Ratusan warga yang tinggal di pesisir pantai, tepatnya di Kelurahan Teluk Kabung Utara, Kecamatan Bungus Teluk Kabung, Kota Padang, Sumatera Barat, mengungsi ke daerah perbukitan terkait adanya peringatan status awas dari BMKG. ”Kita tadi ada mendengar suara sirine,makanyasekarangmengungsi dulu,” kata Nur Asma, seorang warga yang tinggal di Kelurahan Teluk Kabung Utara, Rabu (11/4). Nur bersama warga lainnya akan mengungsi untuk sementara ke daerah perbukitan yang sebelumnya pernah menjadi jalur

evakuasi waktu gempa pada 2009. Seperti diberitakan Kantor Berita Antara, warga yang mengungsi menuju daerah perbukitan tersebut, selain membawa keluarganya, ratusan warga itu juga membawa beberapa perlengkapan, seperti selimut dan tenda terpal. Hal yang sama juga dikatakan Adek, warga Cindakir Bungus Teluk Kabung. Dia menyebutkan untuk sementara lebih memilih mengungsi ke tempat yang selama ini sudah disiapkan menjadi jalur evakuasi tsunami. ”Kami sangat khawatir dengan peringatan dari BMKG tersebut,

apalagi kami tinggal di daerah pesisir pantai, jadi sangat dekat dengan laut,” katanya. Dari data BMKG, Gempa yang berkekuatan 8,5 Skala Richter (SR) berpusat di Aceh, Rabu, sekitar pukul 15.38 WIB juga menghentikan kegiatan para nelayan yang akan pergi melaut, dan lebih memilih kembali berkumpul dengan keluarganya. Lampung Barat Juga Siaga Tsunami Menyusul gempa besar di Nanggroe Aceh Darussalam, warga di wilayah pesisir Lampung Barat, Lampung, juga diminta sia-

Dampak Gempa Aceh

Tsunami Kecil Terjang Thailand BANGKOK-Tsunamikecilmenerjangwilayah Pantai Andaman, Thailand. Dilaporkan wilayah wisata tersebut diterjang gelombang tsunami setinggi10cmyangmerupakandampakdarigempa 8,5 SR yang melanda Aceh. ”Gelombang tsunami setinggi 10 cm yang dipicu oleh gempa pertama menerjang Koh Miang yang ada di wilayah lepas pantai Phang Nga,” ujar Direktur Pusat Penanggulangan Bencana Nasional Thailand, Somsak Khaosuwan, dalam tayangan televisi Thailand dan dilansir oleh AFP, Rabu (11/4). ”Tapi kita tak boleh lengah,” imbuhnya seraya menekankanbahwagempa-gempasusulandengankekuatancukupbesartelahterjadi.“Jadikami berusaha tetap waspada,” tegas Khaosuwan. Sebelumnya, Pusat Penanggulangan Bencana Nasional Thailand telah menginstruksikan bagi setiap warga yang berada dekat dengan wilayah Pantai Andaman untuk mengungsi ke lokasi yang lebih tinggi dan berusaha menjauhi wilayah pantai. Wilayah pantai yang ada di wilayah barat daya Thailand ini juga diterjang tsunami besar pada tahun 2004 lalu dan menewaskan sekitar 5.400 orang. Sejak saat itu, otoritas Thailand pun memasang sistem peringatan berteknologi tinggi yang mampu mendeteksi tsunami. Hal ini demi menjamin keselamatan para turis dan jalannya aktivitas bisnis di wilayah yang marak didatangi turis tersebut. (dtc/int)

„ Pemberia penghargaan Asia Media Award yang diumumkan pada Asia Publish 2012 Konvensi WAN-IFRA di BNDCC, Nusa Dua, Bali, Rabu (11/4).

Halaman Depan Jawa Pos Raih Best Design JAKARTA- Selain Kompas, Jawa Pos juga mendapatkan beberapa penghargaan Asia Media Award yang diumumkan pada Asia Publish 2012 Konvensi WAN-IFRA di BNDCC, Nusa Dua, Bali, Rabu (11/ 4) malam ini. Penghargaan yang diperoleh di antaranya dua desain halaman depan surat kabar terbaik. Halaman terbitan Jawa Pos tanggal 3 Desember 2011 mengenai “Century Jadi Target Utama” memperoleh emas. Sementara halaman depan “Petaka Teng-

garong” pada 27 November 2011 mendapatkan perak. Direktur Jawa Pos Azrul Ananda menerima penghargaan tersebut. Hadir juga pada gala dinner pemberian penghargaan itu Dahlan Iskan, ayah Azrul. PT Kompas Media Nusantara mendapatkan perunggu untuk kategori Community Service . Pemberian penghargaan dilakukan pada gala dinner Konvensi WAN-IFRA yang juga mengumumkan penghargaan Asian

Media Award di BNDCC, Nusa Dua, Bali, Rabu (11/4) malam ini.Community Service ini diberikan kepada Kompas cetak program Kompas Muda. Redaksi Pelaksana Kompas Budiman Tanuredjo maju ke panggung untuk menerima penghargaan. Sementara emas dan perak diraih Mid Day dan Manorama Weekly. Pada kategori Foto Sport, tiga wartawan foto Kompas meraih penghargaan emas, perak, dan perunggu. (kmc/int)

ga terhadap potensi tsunami. “Ya, statusnya awas dari tsunami di daerah Lampung pesisir. Gempa besar dan dangkal ini sangat berpotensi tsunami,” ujar M Nurhuda, Kepala Seksi Observasi dan Informasi Badan Meteorologi, Klimatologi, dan Geofisika Lampung, Rabu (11/4). Gempa berkekuatan 8,5 skala Richter mengguncang Simeulue, Aceh, sore ini pukul 15.38. Gempa ini tidak dirasakan di Lampung. Meskipun demikian, potensi tsunaminya masih membahayakan warga di pesisir barat Lampung. (kmc/int)

paten Karanganyar, dan Kota Padang Sidempuan (Sumatera Barat). Terpisah, Komisi Pemberantasan Korupsi (KPK) turut prihatin dengan minimnya anggaran daerah yang digunakan untuk kepentingan pelayanan masyarakat. Apalagi, komisi yang dipimpin Abraham Samad itu menegaskan kongkalikong antara pemkot dan DPRD dalam pembahasan anggaran daerah kini kian marak. “Dalam beberapa waktu terakhir kami banyak mengungkap praktekpraktek korupsi antara pemkot dan DPRD. Misalnya kasus Kabupaten Seluma, Semarang dan yang terakhir Riau,” kata juru bicara KPK Johan Budi kemarin (10/4). Pengungkapkan yang dibarengi dengan panangkapan para pejabat DPRD dan pemkot di beberapa daerah itu merupakan bukti bahwa KPK menganggap korupsi daerah merupakan permasalahan yang sangat serius. Menurut Johan, meski KPK memiliki keterbatasan sumber daya manusia, tapi pihaknya tidak akan surut berupaya memberantas korupsi di daerah. Pria yang pernah mencalonkann diri sebagai pimpinan KPK itu mengaku ada beberapa modus dalam praktek kongkalikong antara pemkot dan DPRD. Diantaranya adalah pemkot memberikan sejumlah uang pelican kepada DPRD guna untuk meloloskan pembahasan anggaran RAPBD dan untuk mengegolkan pembahasan peraturan daerah. “Korupsi jenis pasti dilakukan secara bersama-sama,” kata Johan. Dalam beberapa kasus, pemkot beralasan memberikan pelicin kepada legislatif karena terpaksa. Menurut pengakuan mereka, jika tidak menyetor pelicin, maka DPRD akan seenaknya mempersulit pembahasan perda dan pelolosan anggaran. Sehingga yang dirugikan adalah masyarakat. Namun bagaimana pun juga, lanjut Johan, itu adalah bentuk praktek suap yang jelas-jelas melanggar UU Pemberantasan Tindak Pidana Korupsi. Pelaku, baik penyuap maupun yang disuap sama-sama bisa dijerat pidana korupsi. KPK sebenarnya tidak tinggal diam. Selain terus menangkap para pelaku di daerah, lembaga yang bermarkas di Jalan Rasuna Said Jakarta itu kerap turun ke daerah untuk memberikan penguatan kepada DPRD dalam upaya pencegahan. “Kami terus turun ke daerah-daerah dengan mengandeng pihak-pihak terkait. Terutama Kemendagri,” kata dia. Pelatihan yang biasanya diberikan KPK kepada anggota DPRD adalah penguatan pemahaman fungus legistaif. Yakni pengawasan, pembuatan perda dan budgeting. Menurut dia, dua hal terakhir adalah kewenangan DPRD yang paling banyak disalahgunakan. Dalam upaya pencegahan, tentu saja KPK sangat menunggu laporan-laporan. KPK meminta masyarakat proaktif melaporkan kepada pihaknya jika memang mengetahui ada praktek korupsi di daerahnya. “Tentu saja harus membawa bukti-bukti yang cukup,” imbuhnya. (dim/kuh/agm/jpnn)

Demokrat Akan Telusuri Penyadap Pidato SBY JAKARTA- Anggota Dewan dari itu hanya untuk konsumsi partai Fraksi Partai Demokrat, Saan Mussemata. “Kami menyayangkan katopa, mengatakan, partainya akan lau benar itu bocor. Kalau benar menelusuri pemkami akan cari buat rekaman pimotifnya apa, kedato Presiden sengajaan atau Susilo Bambang ketidaksengaYudhoyono di jaan. Kalau ada hadapan penguyang mengeluarrus DPP Partai kan, kami akan Demokrat, 1 April cari motifnya,” lalu, yang bocor ujarnya. ke publik. Seperti diberitaPasalnya, kan, dalam pidato dalam rapat interitu Presiden SBY nal dengan penjamencurahkan gaan super ketat kekecewaannya di Kantor DPP secara gamblang Partai Demokrat atas dinamika di Kramat Raya, politik yang terjaJakarta Pusat, itu di, khususnya di tak ada orang luar „ Saan Mustopa sekretariat gabunselain kader gan. Meski menDemokrat dan Presiden SBY. yatakan setuju dengan pemerin“Kami akan coba mengklarifikatah, ternyata sejumlah partai koalsi. Kami mencoba tindak lanjuti isi, menurut dia, memiliki agendatentang kebenaran bocornya pidaagenda sendiri yang tersembunyi. to Pak SBY. Kalau memang benar, SBY juga menegaskan bahwa kelbocor itu dari mana,” ujar Saan di ompok-kelompok yang tidak Gedung Parlemen, Senayan, Jakarmenyetujui kenaikan harga BBM ta, Rabu (11/4). pada dasarnya bukan membela Ia menyayangkan jika benar rekepentingan rakyat. Namun, ingin kaman itu bocor, karena pidato menjatuhkan pemerintahan. Ketua Dewan Pembina Demokrat (kmc/int)





PureView 808 Smartphone dengan Kamera 41 MP Kehadiran Nokia cukup menjanjikan di ajang Mobile World Congress. Perusahaan asal Finlandia itu menampilkan beberapa perangkat yang cukup menarik perhatian, termasuk smartphone Belle Nokia PureView 808. Daya tarik utama dari Nokia PureView adalah kamera 41 megapixel (MP) yang tertanam di bagian belakang. Perusahaan telekomunikasi terbesar di dunia ini berjanji, smartphone ini akan memenuhi rak penjualan pada bulan Mei dengan kisaran USD590. Pada Selasa (10/4), manajemen Nokia belum

RIM Bantah BlackBerry Sedang Tenggelam Research in Motion atau RIM membantah apabila produk BlackBerry sedang anjlok. Buktinya, produk dari Kanada ini diklaim makin diminati oleh penggemar gadget seluruh dunia. Team Lead Developer RIM Sarim Aziz menjelaskan hingga akhir 2011 jumlah pengguna BlackBerry di seluruh dunia mencapai 77 juta. Jumlah tersebut naik 20 juta pengguna dibandingkan pada akhir tahun sebelumnya. “Pertambahan jumlah pengguna BlackBerry yang signifikan tersebut sekaligus membantah rumor kalau RIM tenggelam,” kata Sarim ketika ditemui pada perayaan Ulang Tahun Startup Lokal kedua di Gedung Multimedia Telkom Jakarta, kemarin. Di sisi lain, jumlah pengunduh aplikasi di perangkat BlackBerry juga naik. Rata-rata ada sekitar 6 juta aplikasi yang diunduh per hari atau rata-rata sekitar 177 juta per bulan, baik yang gratis maupun berbayar. Bahkan jumlah pengunduhan aplikasi di BlackBerry App World sempat mencatatkan unduhan tertinggi, yaitu sekitar 2 miliar unduhan aplikasi per bulan. Rekor tersebut pernah tercipta pada Januari 2012. “Menariknya, pengguna BlackBerry di Indonesia justru mengunduh aplikasi dua kali lebih banyak dibandingkan dengan pengguna yang menggunakan platform lain,” ujarnya. Dengan demikian, pihak RIM meyakinkan agar pengembang (developer) aplikasi untuk terus menciptakan aplikasi ke RIM. Dengan potensi tersebut, aplikasi yang ditawarkan ke BlackBerry App World akan dengan mudah diunduh oleh pengguna. Apalagi menurut pihak RIM skema bagi hasil di BlackBerry App World lebih banyak dan lebih mahal dibandingkan dengan Google Play (dulu Android Market) ataupun Apple App Store. “Kami terbesar kedua setelah Apple dalam membayarkan hak bagi hasil ke developer. Pembelian aplikasi di App World juga naik rata-rata 34 persen per tahun,” tuturnya. Perangkat BlackBerry saat ini sudah tersedia di 164 pasar di dunia, mendukung 14 bahasa untuk BlackBerry App World, 177 juta unduhan aplikasi per bulan dan didukung oleh 40 operator di 34 negara. (int/mer)

Mobil Tanpa Pengemudi Segera Menjadi Kenyataan! Mobil tanpa pengemudi atau driverless dikemudikan oleh komputer - semakin dekat dengan kenyataan. Saat ini, Continental AG sedang mengembangkan mobil yang bisa mengemudi sendiri menggunakan Volkswagen Passat. Untuk itu, pada mobil dipasang dipasang sensor radar, kamera video dan komputer onboard agar bisa melaju sendiri pada berbagai kondisi jalan. “Ini bukan fiksi ilmiah lagi, kami sudah keluar ldari aboratorium untuk mengujinya,” jelas Christian Schumacher, Direktur Sistem Mesin Continental Amerika Utara. Melalui fitur itu, nantinya bisa dimanfaatkan untuk membantu pengemudi yang terjebak dalam kemacetan. Pengujian yang dilakukan Continental, antara lain mempercepat lanjut, menentukan arah atau tujuan, mengerem dan menjaga mobil tetap dijalurkan pada kecepatan konstan 60 kpj. Menurut Schumacher, dibutuhkan biaya 100 dolar AS (Rp917.000) untuk setiap sensor plus kamera video. Untuk mobil yang sudah menggunakan sensor lane monitoring, cruise control dan blind spot monitoring, juga bisa dimanfaatkan. Teknologi driverless ini sebenarnya sudah dikembangkan sejak 2004, oleh Defense Advanced Research Projects Agency dengan mensponsori balap 260 km melalui Gurun Mojave dan tak satu pun yang berhasil. Selanjutnya pada 2007, enam mobil robot melakukan simulasi melalui jalan perkotaan di bekas pangkalan udara Victorville, California. (int/mer)

„ Mobil tanpa pengemudi.

menjelaskan di mana produk ini akan dirilis. Hal sama juga dilakukan untuk produk Lumia 610 dan versi internasional Lumia 900. Menurut laporan yang beredar, Lumia 900 dan 808 Pureview itu terlihat di Finlandia dan Italia. Sayangnya, Nokia memberikan harga yang selangit di kedua negara tersebut. Praktik sudah sering digunakan reseller untuk meningkatkan penjualan. MyNokiaBlog meriliskan informasi untuk beberapa toko online di Belanda sudah melakukan pre-order untuk Nokia 808 PureView, Nokia Lumia 900 and Nokia Lumia 610. (int/mer)

Nissan Invitation Diproduksi pada 2014 Nissan Motor Co Ltd dan Perdana Menteri Inggris, David Cameron mengumumkan akan memproduksi Nissan Invitation di pabriknya yang berada di Inggris, tepatnya di Sunderland pada pada 2014. Rencana itu diumumkan bersama saat Perdana Menteri Inggris tersebut berkunjung ke markas besar di Yokohama, Jepang dengan Chief Operating Officer (COO) Nissan Motor, Toshiyuki Shiga. Untuk itu, Nissan akan melakukan investasi baru 127 juta pounsterling ( Rp 1,86 triliun) untuk meningkatkan kapasitas pabrik di Sunderland tersebut.

Tak kalah menarik, untuk menopang pertumbuhan regional, pemerintah

Inggris memberikan bantuan 8,2 juta poundsterling (Rp 120 miliar) untuk pabrik baru tersebut. Dengan demikian, nanti pabrik Nissan di Sunderland akan menghasilkan mobil setengah juta unit lebih. Saat ini, pabrik Nissan di Sunderland merupakan satu-satunya perakitan yang memproduksi mobil di atas 400.000 unit. Nissan Invitation model konsepnya diperkenalkan di Geneva Motor Show bulan lalu, merupakan hatcback untuk pasar segmen-B (sub-kompak). Dijelaskan pula, dengan perluasan pabrik baru menciptakan 3.000 lapangan kerja baru di sektor otomotif Inggris dalam dua tahun ke depan plus 625 pemasok komponen. Saat ini, di pabrik itu diproduksi Qashgai, Note dan Juke. Tahun lalu produksi Nissan di pabrik tersebut mencapai 480.000 unit. Sekarang lagi mempersiapkan untuk melewati angka setengah juta unit untuk pertama kalinya. (int/mer)

iPad Terancam Jadi Kata Generik Perangkat Tablet „ Instagram

Popularitas iPad yang mendunia berhasil melekat kuat dalam ingatan banyak orang. Di satu sisi hal ini menguntungkan bagi Apple, tetapi juga mengancam karena Apple bisa kehilangan merek dagang iPad karena iPad bisa jadi kata generik/umum untuk penyebutan perangkat tablet. Di Eropa dan Amerika Serikat, ada sekelompok masyarakat, terutama para orangtua, yang menggunakan merek iPad sebagai kata generik mengacu pada produk komputer tablet. Dengan demikian, mereka menyebut semua tablet sebagai iPad meski produk tersebut sebenarnya adalah Samsung Galaxy Tab atau Amazon Kindle Fire. “Ketika saya berpikir tentang tablet,

yang terlintas di benak saya adalah sebuah iPad,” kata Maria Schmidt yang berusia 58 tahun asal AS. Ia bahkan tidak tahu nama produk tablet dari produsen lain. Hal semacam ini bisa menguntungkan dan merugikan untuk Apple. Menguntungkan karena Apple dinilai sukses memopulerkan produknya. Usaha Apple mengeluarkan jutaan dollar AS untuk pemasaran tidak sia-sia. Namun, di sisi lain, hal ini bisa membuat Apple kehilangan merek dagang iPad karena merek itu bisa saja menjadi kata generik. Menurut Michael Atkins, pengacara khusus merek dagang asal Seattle, AS, saat ini Departemen Hukum AS sedang bersitegang dengan Departemen Pemasaran AS terkait

merek yang akan dijadikan kata generik. Tak hanya iPad, produk iPod dari Apple juga sering disebut sebagai alat pemutar musik populer atau MP3 player. Tidak mengherankan karena iPod merupakan alat pemutar musik digital pertama di dunia yang dirilis pada 2001. Menelisik kasus merek dagang yang menjadi generik pada masa lalu, mereka yang dikorbankan adalah perusahaan yang menciptakan produk revolusioner. Sebuah merek dagang dinyatakan sebagai kata generik ketika ada perusahaan yang menuntut dan pengadilan federal mengizinkan semua produk serupa menggunakan kata generik tersebut. (int/mer)

Telepon Umum dengan Layar Sentuh Teknologi layar sentuh akan digunakan di setiap telepon umum di kota New York, Amerika Serikat (AS). Dengan trobosan tersebut, semakin mejadikan New York sebagai kota global terdepan. Sebagai bagian dari program percontohan, ratusan bilik telepon umum akan segera dilengkapi dengan layar sentuh. Dengan rencana ini, wisatawan yang akan berkunjung ke kota tersebut akan dimudahkan dengan fitur yang dapat memberikan petunjuk jalan dan menampilkan berita lokal terbaru. Telepon umum canggih yang dikembangkan sendiri oleh kota New York ini telah disetujui oleh Departemen Teknologi dan Telekomunikasi AS. Proyek ini memiliki tujuan untuk membawa up-to-the-minute public communication system ke kota New York. Perangkat secara berkala disemprot agar tetap bersih dan akan tahan terhadap air serta debu.

„ Telpon Umum layar sentuh. Diharapkan program percontohan ini dapat berjalan dengan baik. Dengan dukungan hotspot Wi-Fi, telepon umum ini memungkinkan pengguna mengirim email dan melakukan panggilan Skype. Telepon umum ini juga didukung lebih dari 10

bahasa. Program percontohan ini diharapkan dapat diakses secara gratis kedepannya, dengan layanan iklan yang disajikan di setiap unitnya, sehingga dapat membantu dalam pemeliharaan telepon umum canggih ini. (int/mer)

Instagram Mengancam, Instagram Digenggam Raksasa jejaring sosial Facebook mengejutkan banyak pihak dengan aksi akuisisi mencaplok sebuah start-up kecil yang menciptakan aplikasi mobile Instagram. Nilai akuisisi itu sebesar 1 miliar dollar AS (sekitar Rp 9,1 triliun) dalam bentuk tunai dan saham. Instagram masih terbilang muda, dan saat ini hanya diasuh oleh 13 orang karyawan. Aplikasi yang dibangun Kevin Systrom and Mike Krieger ini baru hadir di perangkat berbasis iOS pada 18 bulan lalu, tepatnya 6 Oktober 2010. Instagram berhasil menyerang kelemahan Facebook dalam hal berbagi foto. Meski Facebook telah menjadi situs jejaring sosial dengan jumlah unggahan foto terbesar, namun Facebook belum memberi fitur dan hal menarik yang memudahkan pengguna memajang fotonya. Instagram berhasil menawarkan kesederhanaan tersendiri, namun tetap mengasyikan bagi penggunanya yang gemar bersosial lewat smartphone. Sedangkan Facebook, meski telah memiliki versi mobile namun belum secara maksimal memberi kemudahan jika diakses melalui smartphone. Inilah yang sepertinya menjadi alasan utama Facebook mengakuisisi Instagram. Jadi sebelum dibeli, bisa dibilang Instagram adalah kompetitor yang mengancam Facebook. Ketimbang harus bersaing, Facebook memilih langkah “menggenggamnya” namun tentu dengan angka pembelian yang sangat fantastis. Menurut mantan analis Wall Street sekaligus pemodal ventura Mary Meeker, internet akan lebih sering diakses lewat perangkat mobile ketimbang dengan PC pada tahun 2013 nanti. (int/mer)

Merokok, Shahrukh Khan Terancam Dipenjara SHAHRUKH Khan terancam berurusan dengan hukum, lantaran tertangkap kamera sedang merokok di tempat umum. Bintang Bollywood itu terlihat merokok saat menyaksikan pertandingan IPL di Sawai Man Singh Stadium, Jaipur, India. Direktur Jaipur Cricket Academy, Anand Singh Rathore bahkan sudah mendatangi pengadilan setempat, Senin lalu untuk melaporkan tindakan megabintang India itu. Rathore telah menunjukkan bukti, berupa sebuah CD yang memerlihatkan

bintang Kuch Kuch Hotta Hei itu tengah merokok dengan jelas. “Saya telah menyerahkan sebuah CD dan beberapa foto dimana aktor itu terlihat sedang merokok,” ungkap Rathore dilansir dari Timesofindia, Rabu (11/4). Pihak pengadilan telah memelajari keluhan tersebut. Rencananya, sidang pertama akan dilaksanakan hari ini, Kamis (12/4). Pengawas stadion, Gheesaram Sharma juga berencana melaporkan kejadian tersebut ke pengadilan. (oz/int)

KAMIS, 12 April 2012


Hengkang dari Mahadewi LIMA tahun bergabung dengan Mahadewi di bawah naungan Republik Cinta Manajemen (RCM) membuat Tata jenuh. Alasan itulah yang membuat Tata hengkang dari Mahadewi. ”Aku sudah jenuh dengan lima tahun, dan kepengin berhenti,” ungkap perempuan bernama lengkap Shinta Dewi di Studio Vicky Sianipar, Jl. Saharjo, Jakarta Selatan, Rabu (11/4). Tata menegaskan, ia memang keluar karena ingin istirahat sejenak bukan lantaran

”Aku sudah jenuh dengan lima tahun, dan kepengin berhenti”

AKTRIS seksi Uli Auliani sedang patah hati. Impian Uli untuk menikah dengan kekasihnya yang berasal dari Amerika Serikat buyar. Reid Spancer Garrett, sang pacar yang beragama Yahudi tidak direstui keluarga Uli yang memeluk agama Islam. Padahal sang pacar sudah bermaksud melamar bintang film ‘Skandal’ itu. ”Belum lama ini pacarku dari Amerika datang ke Indonesia dengan maksud bertemu dengan orangtua aku untuk melamar. Tapi saat dia mau ke Bandung bersama dengan aku. Reid ditolak mentah-mentah dan dilarang untuk datang bertemu,” ujarnya saat ditemui di apartemennya di Jakarta, Selasa (10/4) malam. Hubungan yang baru dibinanya selama sebulan itu pun harus kandas. Apalagi

nasib Uli juga tak jauh beda dengan kekasihnya itu. Uli juga ditolak mentah-mentah oleh keluarga sang pacar karena perbedaan agama. ”Keluarga Reid juga ngelarang Reid menikahi aku, karena aku orang Islam. Saat Reid memberi tahu. Mereka langsung meminta dan melarang Reid berhubungan dengan aku,” katanya. Padahal sebelumnya, menurut Uli sang kekasih sudah mantap untuk melamarnya. Ia pun sudah merasa yakin dengan Reid karena sosok Reid begitu sempurna di matanya. (dtc/int)

Angel Lelga

Santai Dilaporkan ke Polisi

JANDA Rhoma Irama, Angel Lelga bersama Indra Brugman dilaporkan ke pihak berwajib oleh pedangdut Kumala Sari. Kedua artis itu dilaporkan Kumala yang juga sempat membintangi sinetron dengan dugaan penggelapan uang atas bisnis parfum. Saat ditanya soal laporan itu, tidak tampak kekhawatiran di mimik Angel Lelga. ”Kita Tim ARA (perusahaan Angel dan Indra) sangat percaya diri. Karena kita tahu ada di posisi yang benar. Kita nggak mau

latah selalu menanggapi omongan dia,” kata Angel saat ditemui di Studio RCTI, Kebon Jeruk, Jakarta Barat, Rabu (11/ 4). Laporan itu terjadi atas adanya kerjasama antara Angel, Indra dengan Kumala Sari. Kumala membeli produk parfum dari perusahaan kedua artis tersebut seharga Rp300 juta. Namun, Kumala menilai ia merasa dirugikan dari kerjasama tersebut. Baik Angel maupun Indra sudah tak mau ambil pusing dengan tudingan yang dituduhkan pada mereka. Keduanya sudah menyerahkan kasus ini kepada pihak kuasa hukum. ”Itu hak mereka untuk melaporkan. Itu sudah diurus pengacara, biar hukum berjalan,” ucap Indra. Adanya pelaporan tersebut, diakui Angel tidak mempengaruhi bisnis mereka. Hal ini pula yang membuat mereka tenang dan bisa bernapas lega. Namun, memang sempat banyak yang bertanya pada mereka soal kasus pelaporan itu. ”Banyak sih yang tanya, mulai dari keluarga, teman, semua menanyakan kasus ini. Cuma untungnya penjualan tidak berpengaruh,” ucap Indra lagi. (vnws/int)

berambisi menjadi penyanyi solo. “Aku keluar juga bukan pengen solo karir yah,” katanya. Namun Tata yang sudah mengambil langkah untuk tidak meneruskan kontrak dengan RCM tidak merasa menyesal. Ia sudah mememikirkan akan risikonya. “Ada enak dan nggak enaknya,” pungkasnya. Bahkan, keluar dari Mahadewi, Tata merasa bebas. Selama lima tahun bernyanyi di bawah naungan RCM, kini Tata merasa lebih nyaman. ”Sekarang merasa jadi diri sendiri. Nggak maksain. Apa saja yang penting nyaman. Aku lebih merasa bebas,” ucap Tata

di studio Vicky Sianipar, Jl. Dr. Saharjo, Jakarta Selatan, Rabu (11/4). Diakui oleh Tata, sebelum mengambil keputusan hengkang dari Mahadewi, ia telah lama memikirkan keputusannya dengan matang. Cewek bernama lengkap Shinta Dewi itu kini lebih memilih sendiri karena bisa mengembangkan diri. ”Bebas dan nyaman untuk mengembangkan diri dengan lagu mau diapakan. Harus banyak pertimbangannya juga kalau memang mau mengambil keputusan sekarang,” pungkasnya. (idc/int)

”Belum lama ini pacarku dari Amerika datang ke Indonesia dengan maksud bertemu dengan orangtua aku untuk melamar. Tapi saat dia mau ke Bandung bersama dengan aku. Reid ditolak mentahmentah dan dilarang untuk datang bertemu”


Tak Ingin Buru-buru Punya Anak Lagi

Satu anak memang tak pernah cukup. Setelah dikarunia anak pertama, pasangan Ashraf Sinclair dan Bunga Citra Lestari (BCL) pun berniat menambah momongan lagi. Tapi, mereka tak mau buru-buru. ”Sekarang sih belum (nambah anak) dalam waktu dekat,” ujar Ashraf saat ditemui acara Marc Jacobs SS12 Party, Epicentrum, Kuningan, Jakarta Selatan, Selasa (10/4) malam. ”Tapi kalau dikasih ya nggak apa-apa kita sih terima ya, nggak nolak juga,” tambahnya. Jika Ashraf seolah santai untuk punya anak lagi, bagaimana dengan BCL? Ehm, sepertinya pelantun ‘Hanya Untukmu’ itu masih berpikir dua kali untuk punya anak lagi. ”Kalau naik 25 kilo lagi saya nggak ngerti deh bagaimana lagi nuruninnya,” papar BCL. (dtc/int)

HOROSKOP HARI INI ARIES 19 Februari - 20 Maret Curahkan kreativitas Anda. Percaya diri sajalah.


(20 Januari - 18 Februari)

Kerja sama akan menguntungkan kedua belah pihak.


(23 September - 22 Oktober)

Jangan habiskan hari-hari hanya untuk memikirkan pekerjaan. Bisa jenuh.


(23 Oktober - 22 November)

Awas stres karena sedang tidak ada kesibukan atau pekerjaan. Lakukan sesuatu.


(23 Agustus-22 September)

Mainkan kartu dengan tepat, kamu pasti bisa maju.


(21 Desember -19 Januari)

Anda harus mengubah beberapa rencana. Seseorang yang kenal baik mempunyai beberapa sarana baik dan nasehat yang bisa membantu kamu.


( 23 November - 20 Desember)

Saatnya mendelegasikan wewenang. Jangan segala sesuatu Anda kerjakan sendiri.


19 Februari - 20 Maret

Gunakan sejumlah pemikiran rasional. Hadapi ketidakpastian hari esok dengan tenang dan percaya diri


(21 April - 20 Mei)

Jangan menumpuk pekerjaan, jika memang bisa Anda selesaikan hari ini.


(21 Mei - 20 Juni)

Kalau memungkinkan, selesaikan pekerjaan yang tertunda.


(21 Juni- 20 Juli)

Tim kerja membutuhkan seseorang yang bisa menjadi perencana yang baik.


(21 Juli-21 Agustus)

Jangan terlalu membayangkan hal-hal sempurna. Hasil akhir akan tetap positif kok.


14 KAMIS,12 APRIL 2012

Merasa tidak pernah didengarkan saat berkeluh-kesah, tidak ada ketika Anda sedang merasa kesepian, dan tidak peduli ketika Anda harus pulang larut dalam keadaan letih karena lembur kerja; sepertinya itu adalah bukti yang cukup kuat untuk melabeli pasangan Anda sebagai ‘tidak perhatian’.

Kebanyakan wanita bersikeras meminta pasangannya untuk berubah menjadi lebih perhatian. Namun tahu tidak, ternyata sifat perhatian ini adalah sifat bawaan sejak lahir yang akan sulit untuk diubah. Untung saja kita masih bisa membedakan seorang pria perhatian atau tidak dari

beberapa tanda. Para peneliti dari Amerika dan Kanada menemukan hal itu setelah mengadakan studi tentang bagaimana perhatian seorang pria pada wanita. Sebanyak 23 pasangan diminta mendengarkan curahan hati pasangannya tentang kesedihan dan masalah mereka. Momen ini direkam tanpa suara, kemudian video tersebut ditunjukkan pada orang yang sama sekali tidak mengenal mereka dan diminta untuk merangking seberapa baik, perhatian dan bisa diandalkan para pendengar dalam video tersebut. Sebelum proses perekaman, 23 pasangan ini menjalani uji genetik untuk melihat jenis gen reseptor oksitosin mereka. Gen reseptor jenis G terkait langsung dengan perilaku perhatian sementara jenis A terkait dengan sikap mementingkan diri sendiri dan skill sosial yang buruk. Seseorang bisa memiliki salah satunya, atau malah kombinasi keduanya.

Dari 10 orang yang dikategorikan tidak perhatian dan tidak bisa diandalkan oleh para pengamat, 9 di antaranya memiliki gen reseptor jenis A. Sementara mereka yang dikategorikan paling perhatian, yaitu dengan mengangguk dan tersenyum ketika mendengarkan curhatan, enam di antara 10 orang memiliki gen reseptor jenis G. So, jika Anda ingin tahu apakah pasangan Anda punya gen perhatian atau tidak, cobalah untuk curhat di depannya. Abaikan sarannya, tapi amati bagaimana dia memerhatikan dan mendengarkan cerita Anda. Mereka yang t e r l i h a t simpatik, tersenyum dan merespon cerita Anda sesekali bisa dipastikan memiliki gen perhatian yang m e m b u a t mereka menjadi pasangan yang bisa diandalkan. (kl/int)

Alasan Pasangan



Bahan: 6 buah pisang raja potong menyamping 6 lembar kulit lumpia 1 butir telur ayam kocok lepas keju parut untuk taburan minyak untuk menggoreng

Konsultasi Seks

Cara Membuat: 1. Gulingkan pisang dalam telur hingga rata, bungkus dengan kulit lumpia dan goreng hingga kering 2. Angkat kemudian taburi dengan keju selagi masih panas. Nikmati lumpia pisang keju selagi hangat dengan secangkir teh. Untuk 6 potong (kl/int)

Mendongeng untuk Anak

Berikut ini ada 7 alasan umum mengapa pasangan rela menemui dan membeberkan masalah paling intim dalam hubungan mereka. 1. Kurangnya hasrat Tak merasa ingin berhubungan? Hmm, Anda tak sendiri. “Rendahnya (lebih parahnya, hilangnya) hasrat seksual/ libido biasa disebut para pakar seks sebagai Hypoactive Sexual Desire Disorder (HSDD),” ujar Stephen Betchen, DSW yang menulis buku MAGNETIC PARTNERS. “Umumnya gangguan ini terjadi pada kaum wanita, namun ada juga para suami yang mengalaminya. Hal ini agak sulit ditangani, namun ketika ditemukan akar penyebab, biasanya masalah yang ada bisa selesai dengan cepat.” Faktor labilnya hormon, gangguan penyakit tertentu, hingga pengaruh obat-obatan yang dikonsumsi, semua itu memang bisa menjadi alasan hilangnya hasrat seseorang untuk berhubungan. Namun, jika kondisi medis bukanlah alasannya, maka saatnya untuk menemui pakarnya. Ingin tahu apakah Anda sedang kehilangan hasrat? Saran Dr. Betchen adalah pikirkan tentang seberapa frustrasinya Anda saat berada di luar kamar tidur. Itulah petunjuk bahwa ada sesuatu yang tidak beres dalam hubungan Anda dengan pasangan. 2. Aksi berat sebelah Pasangan ingin setiap hari, namun Anda merasa cukup dengan beberapa kali seminggu. “Sejauh ini, alasan paling sering dari pasangan yang berkonsultasi adalah perbedaan cara dan frekuensi dalam beraksi,” ujar Miriam Bellamy, LMFT, terapis keluarga dan pernikahan di Roswell, Georgia. Solusinya? Bellamy selalu membantu para pasiennya untuk memahami bahwa “adalah hal yang normal jika masing-masing pasangan memiliki perbedaan emosi dan keinginan tentang seberapa sering dan bagaimana aksi panas itu harus dilakukan.” Masalahnya di sini bukanlah seberapa besar perbedaan tersebut, namun bagaimana komunikasi satu sama lain, itu yang terpenting. Obatnya adalah dengan “mundur ke belakang dan menemukan kembali keseimbangan emosi yang mungkin telah hilang.” Contohnya, jika Anda termasuk tipe wanita berhasrat rendah, maka menghabiskan waktu menjauh dari suami, entah pergi berbelanja sendiri pada Minggu malam misalnya, mungkin bisa membantu hasrat dan kerinduan kembali meningkat. 3. Selingkuh

Usai salah satu pasangan ketahuan berselingkuh, biasanya banyak pernikahan berakhir tragis. Namun bagi mereka yang memutuskan untuk memaafkan, dan mencoba lagi, maka butuh waktu untuk membangun kepercayaan, termasuk soal ‘tempat tidur’. Faktanya, banyak terapis mengaku bahwa selingkuh merupakan alasan nomor 1 mengapa jasa mereka laris manis. “Untuk menyembuhkan hubungan yang telah rusak, pasangan yang telah berselingkuh harus bersedia untuk mengakhiri hubungan selingkuh mereka dan menjadi ‘buku terbuka’ bagi pasangannya,” ujar Barbara Bartlik, MD, konsultan seks di New York City. “Dia harus bersedia mengungkapkan detail rahasia seksual atau apapun yang dilakukan selama selingkuh. Hal ini penting sebab pasangan yang merasa dikhianati tentu saja tak semudah itu bisa percaya lagi. Butuh waktu dan keterbukaan untuk membangun kembali sebuah kepercayaan yang telah direnggut.” 4. Ragam masalah setelah punya anak Anak adalah berkah. Saat tak punya anak, banyak pasangan mengidamkannya. Namun tak jarang, banyak pula yang kemudian secara tak sadar ‘menyalahkan’ buah hati sebagai penyebab timbulnya masalah seksual dalam pernikahan mereka. Bangun tengah malam, menyusui, mengganti popok, menimang hingga si kecil berhenti menangis, semua itu melelahkan dan membuat pasangan tak lagi memiliki tenaga ekstra untuk bertempur. “Perubahan psikis dan emosional yang terjadi pasca kelahiran biasanya membawa dampak yang cukup kuat dalam hubungan,” ujar Scott Haltzman, MD, penulis THE SECRETS OF HAPPILY MARRIED MEN AND THE SECRETS OF HAPPILY MARRIED WOMEN. “Bagi wanita, perubahan hormonal sering membuat mereka tak memiliki hasrat, khususnya jika mereka sedang dalam tahap menyusui. Selain itu, bentuk tubuh yang tak lagi seindah dulu membuat mereka merasa tak nyaman. Sedangkan bagi pria, meskipun banyak yang tetap menyayangi pasangannya, namun perubahan

bentuk tubuh istri ternyata berpengaruh juga terhadap hasrat seksual mereka.” Saran para pakar seks untuk masalah ini adalah pasangan harus belajar untuk melihat diri mereka sebagai pasangan yang saling mencintai ketimbang dua orang tua yang kurang tidur akibat mengurusi anak kecil. Pasangan juga bisa mengunci pintu kamar untuk mengurangi kegelisahan kalau anak nyelonong masuk ketika mereka sedang beraksi, atau menyewa baby sitter sekali seminggu agar mereka bisa ‘berkencan’ dan bebas gangguan. Keintiman dan kerjasama yang dibangun di luar kamar tidur bisa menjadi dasar kuat untuk hubungan seks yang sehat. 5. Masalah orgasme Anda mungkin saat ini sedang prihatin dengan seputar orgasme yang terjadi dalam kamar tidur. “Masalah paling serong tentang orgasme adalah tak mampu untuk berorgasme sama sekali, biasanya kasus ini menimpa kaum wanita yang usianya lebih muda,” ujar Debby Herbenick, PhD, penulis BECAUSE IT FEELS GOOD. Untuk penanganannya, biasanya para pakar seks akan menolong para wanita ini untuk mengenal lebih jauh tentang tubuh mereka sendiri, termasuk bagian klitoris. “Banyak wanita tak tahu-menahu tentang hal ini dan bagaimana merangsangnya, misalnya lewat seks oral, masturbasi, atau posisi inter-

course tertentu. Setelah mengetahui dan berlatih menjelajahi area tersebut secara pribadi, maka kemungkinan untuk berorgasme juga terbuka semakin lebar, sehingga tak perlu lagi ada rasa malu atau tak tahu saat beraksi.” 6. Rasa sakit selama intercourse Memang dokter merupakan salah satu pakar yang harus ditemui bila hal ini terjadi sebab bisa jadi ada penyakit tersembunyi dalam organ kewanitaan yang tak terdeteksi sebelumnya. “Meski demikian, selain masalah medis, ada pula penyebab emosional yang menyebabkan hal ini mungkin terjadi. Dan konsultan seks bisa membantu pasangan untuk belajar berkomunikasi satu sama lain tentang rasa sakit yang timbul dan bagaimana hal tersebut mempengaruhi hubungan mereka.” ujar Dr. Herbenick. 7. Pornografi dan kecanduan seks lainnya Kecanduan seks - pornografi, virtual seks lewat komputer, masturbasi - bisa menghancurkan keintiman, kepercayaan, dan kepuasan seksual dalam pernikahan. “Langkah kesembuhan pertama biasanya adalah mengakui bahwa pasangan yang kecanduan sedang bermasalah. Kebanyakan karena merasa tertolak atau tak aman dengan tubuh/ organ seksual mereka,” ujar Dr. Betchen. Terapis biasanya bisa membantu pasangan yang ada untuk bisa berkomunikasi dengan baik dan jujur, tanpa perlu menyalahkan satu dengan lainnya. Apakah Anda merasa membutuhkan pakar seks? Jika hal itu bisa menyelamatkan pernikahan dan keluarga Anda, mengapa tidak? (kl/ int)

Dongeng adalah pengantar tidur yang baik, terutama untuk proses tumbuh kembang anak. Apakah Anda sudah sering membacakan dongeng untukbuahhatiAnda?Ataubelumsama sekali? Kesibukan orangtua usia produktif dan kurangnya waktu berkumpul bersamabuahhatimembuatparaorang tua melupakan kegiatan mendongeng sebelum tidur. Kadang terlalu sibuk dengan pekerjaan sehingga pulang ke rumah setelah si kecil tertidur lelap. Dari banyak pilihan kegiatan menyenangkan bersama buah hati, mendongeng adalah salah satunya. Kegiatan sederhana ini memang belum begitu banyak diminati para orang tua, khususnya di Indonesia. Padahal, mendongenguntuksikecilmemberikan banyak manfaat daripada Anda membiarkan mereka membaca sendiri buku-buku dongengnya. Agar Anda lebih termotivasi untuk rajin menjadi juru dongeng di depan buahhatiAnda,inilahmanfaatyangbisa Anda dapatkan dari mendongeng sebelum tidur. Imajinasi Berkembang Daripada menyajikan dongeng langsung dari televisi, imajinasi buah hati Anda akan berkembang jika Anda sendiri yang menjadi juru dongengnya. Anak-anak akan belajar untuk mengurutkan jalan cerita dan memvisualisasikan tokoh-tokoh yang dari cerita Anda. Dengan rajin mengembangkan imajinasi pada saat mendengar dongeng dari Anda, si kecil akan mudah berimajinasi di waktu yang lain. Anak yang cerdas adalah anak yang memiliki imajinasi tak terbatas. PengetahuanBertambah Berikan banyak pilihan dongeng dari berbagai daerah di Indonesia dan berbagai negara, otomatis buah hati Anda akan mempelajari banyak hal dengan sendirinya. Dia akan tahu perbedaan kebudayaan di negaranya dan negara lain. Semakin Anda jeli menggambarkan perbedaan lingkungan,semakindiaseringbertanya tentang banyak hal. Apa itu salju dalam kisahgadispenjualkorekapi,sepertiapa paus dalam kisah Pinokio, atau di mana

letak gunung tangkuban perahu dari kisah Sangkuriang. MenyerapKosakataMakin Banyak Semakin baik bila Anda sering mendongeng sejak buah hati masih dalam usia balita. Pada usia ini, anak lebih banyak menyerap kosakata. Bila Anda mendongeng, Anda bisa memilih sendiri kosakata yang cocok untuk diserap oleh buah hati Anda. Selain itu, si kecil akan semakin banyak menyerap katakata yang Anda tuturkan dan mengerti artinya d e n g a n sendirinya. Si kecil akan tahu apa itu raja, ratu, p e r d a n a menteri, dan lain sebagainya. Mengerti Akan Moral Biasanya dongeng selalu disisipi pesan moral, meskipun tidak selalu demikian. Di sinilah peran Anda sebagai juru dongeng untuk memberikan penjelasan mengenai moral yang disampaikan dalam dongeng yang Anda ceritakan. Biarkan si kecil mencerna moral yang akan berguna untuk perkembangannya. Ini tidak harus menjadi patokan Anda untuk memilih dongeng yang secara tegas mengajarkanmoral,karenadongengitu sendiri harus menyenangkan. MendekatkanHubunganAnak danOrangtua Tentu saja kegiatan ini akan mendekatkan Anda dan buah hati bila rutin dilakukan. Anak tidak akan takut bertanya pada Anda bila ada urutan cerita yang tidak dia mengerti, atau di akhir dongeng bisa saja dia mengeluarkan pendapat akan kisah yang Anda ceritakan. Ini akan membantu Anda untuk mengerti seperti apa pola pikir anak Anda. Dengan membiasakan si kecil berkomunikasi dua arah melalui dongeng,biladiatelahberanjakdewasa, buah hati Anda akan lebih mudah terbukauntukmencurahkanpemikiran dan isi hatinya.(kl/int)

All Sport


12 April 2012




Crutchlow Bisa Jadi Idola Baru Penampilan fantastis Cal Crutchlow yang finis keempat pada seri pembuka MotoGP di Qatar mendulang pujian dari bos Yamaha Factory Racing, Lin Jarvis. Jarvis yakin bila Cruthlow bisa meneruskan performa hebatnya ini maka pembalap asal Inggris tersebut bisa menjadi favorit para fans di masa depan. “Cal benar-benar berkarakter dan olah raga ini butuh orang berkarakter sepertinya. Valentino (Rossi) telah mendominasi beberapa tahun terakhir dan dia kini masih bersama-sama kita maka kita harus memanfaatkannya,” kata Jarvis seperti dikutip dari Motorcycle News, Rabu (11/4). “Tapi pada titik tertentu di masa depan dia akan melakukan hal lain dan kita harus menciptakannya menjadi bintang baru. Saya tidak mengatakan dia akan menggantikan Valentino tapi kita harus mempromosikan pembalap lain untuk disukai para penonton,” urai Jarvis. Penampilan mengesankan Crutchlow sepanjang 22 lap MotoGP Qatar menegaskan awal yang hebat ba-

„ Crutchlow gi era baru 1.000cc Yamaha. Crutchlow yang start dari baris terdepan untuk pertama kalinya sepanjang kariernya berhasil mencuri posisi keempat dari rekan setimnya yang jauh lebih berpengalaman Andrea Dovizioso pada lap ke-17. “Sejujurnya saya terkejut. Saya tidak memperkirakannya tapi sungguh menyenangkan melihatnya me-

masuki musim ini dengan awal yang sangat positif,” aku Jarvis. “Dia terlihat lebih senang dengan motornya. Ini merupakan tahun kedua baginya dalam tim. Saya penasaran melihat bagaimana dia akan perform. Saya pikir dia punya kesempatan memperoleh hasil-hasil yang top pada musim ini,” pungkas Jarvis. (oz/int)

„ Kebahagiaan para pemain Liverpool setelah meraih kemenangan dramatis atas Blacburn

Blackburn 2 vs 3 Liverpool

MENANG DRAMATIS Liverpool akhirnya bisa bangkit kembali setelah pekan lalu dipermalukan 1:0 oleh Sunderland pada ajang Liga Premier. Namun dalam laga Rabu (11/4) dini hari tadi, The Reds berhasil meraih kemenangan secara dramatis atas tuan rumah Blackburn Rovers. Meski harus bermain dengan 10 pemain saja, namun tim asuhan Kenny Daglish itu mampu membukukan kemenangan dengan skor 3:2 dan memantapkan posisinya di posisi delapan klasemen sementara. Bertandang ke markas Blackburn di Ewood Park, sejak menit-menit awal Liverpool mampu mendominasi laga. Pada menit ke-12, Maxi Rodríguez mencetak gol setelah memanfaatkan umpan cepat Craig Bellamy dari sayap kiri. Tanpa ampun bola menghujam ke jala Blackburn yang dijaga Paul Robinson, sehingga skor menjadi 0:1 untuk tim Liverpool.

Tak butuh waktu lama, empat kemudian Maxi mencetak gol kedua. Ia berhasil memaksa Robinson memungut bola dari jalanya sendiri untuk kali kedua. Maxi berhasil memanfaatkan bola liar yang tak mampu dihalau barisan pertahanan tuan rumah. Skor 2:0 untuk kemenangan Liverpool. Namun demikian dominasi Liverpool itu mulai luntur beberapa menit kemudian. Pada menit ke-25, wasit Anthony Taylor mengusir kiper Liverpool, Alexander Doni karena melanggar striker tuan rumah Junior Hoilett di kotak terlarang. Kartu merah itu sekaligus dilengkapi dengan tendangan

penalti. Daglish kemudian menarik keluar bek John Flanagan, agar kiper pengganti Brad Jones bisa menjaga gawang. Pilihan King Kenny ini rupanya tepat, karena Jones secara gemilang berhasil mementahkan eksekusi penalti Yakubu Aiyegbeni. Namun demikian, unggul satu pemain jelas membuat Blackburn berada di atas angin. Hasilnya terlihat pada menit ke 36, ketika tendangan bebas David Dunn berhasil disundul Yakubu yang membuat Jones tidak kuasa menjangkau bola. Skor 2:1 bertahan hingga turun minum. Memasuki babak kedua, Liverpool mencoba melupakan kurangnya jumlah pemain. Anak-anak kota pelabuhan ini melancarkan serangan ke jantung pertahanan tuan rumah. Namun tuan rumah yang unggul jumlah pemain mampu menghalau serangan Andy

Caroll dan kawan-kawan. Menit ke-61, Blackburn yang telah menemukan ritme permainan kembali mendapatkan hadiah penalti dari wasit. Penalti didapat karena Jones melanggar Yakubu di kotak dua belas pas. Tak mau mengulangi kesalahan, Yakubu sukses memperdaya Jones. Tuan rumah menyamakan keunggulan menjadi 2:2. Namun demikian disaat laga sepertinya akan berakhir imbang, Liverpool justru berhasil mengembalikan kemenangan. Pada masa injury time, tepatnya menit ke-91, sundulan Daniel Agger mampu dilesakkan dengan heading sempurna oleh Gol Andy Carroll. Liverpool pun kembali unggul menjadi 3:2 dan menutup laga dengan kemenangan dan menyisakan duka bagi tuan rumah. Kekalahan ini sendiri semakin membenamkan Blackburn di zona degradasi. (jpnn)

Jelang Saul Alvarez vs Shane Mosley

Mosley: Saya Tak Pernah Redup Mantan jawara tinju di tiga divisi, ‘Sugar’ Shane Mosley bakal kembali naik ring berebut titel kelas light-middleweight WBC melawan petinju yang 19 tahun lebih muda darinya, Saúl ‘Canelo’ Álvarez. Umur boleh saja berbeda jauh, tapi Mosley menolak laga ini akan hanya menjadi penghibur semata. Mosley tetap akan mengeluarkan kemampuan terbaiknya, meski usianya kini sudah menginjak 40 tahun. Memang tiga catatan pertarungan Mosley tak menggembirakan. Terlebih saat melawan Floyd Mayweather Jr. dan Manny Pacquiao. Tapi Mosley

mengaku skill dan kekuatannya masih melekat dan tak meredup sedikit pun. Mosley masih merasa dirinya, petinju yang sama di masa jayanya. “Pandangan umum biasanya berkata, skill petinju akan kian menghilang, seiring berjalannya waktu, tapi hal itu tidak terjadi kepada saya. Pengalaman, skill dan pengetahuian saya tentang tinju, takkan hilang begitu saja,” seru Mosley. “Sudah beberapa kali saya bertarung dengan petinju terbaik dunia, termasuk Oscar de la hoya dan Antonio Margarito,” tambahnya, sebagaimana dilansir Boxing Scene, Rabu (11/4).

“Saya sendiri sadar bahwa saya masih petarung yang sama, saat saya di atas ring dengan petinju-petinju hebat itu. Saya masih punya kecepatan dan power yang sama. Saya merasa lebih kuat dan saya tahu apa yang saya butuhkan untuk bisa menang,” pungkasnya. Pertarungan Mosley kontra Álvarez pada 5 Mei mendatang, memang akan memperebutkan titel dunia, tapi pertarungan keduanya hanya menjadi laga tambahan, yang bertajuk ‘Ring Kings’ HBO payper-view. Sementara, Main event akan menyajikan Miguel Cotto vs Floyd Mayweather Jr. (oz/int)

Jelang F1 GP China 2012

Vettel Antusias

„ Sebastian Vettel

Sempat bermuram durja karena frustrasi di Sepang, Malaysia, Sebastian Vettel akan kembali ke trek di GP China, dengan rona wajah yang sedikit cerah. Vettel antusias untuk turun ke sirkuit Shanghai yang dinilainya unik dari segi ukuran. Karakter Shanghai International circuit yang terkesan memanjang dan lebar, amat disukai Vettel, karena akan tercipta banyak kesempatan untuk melakukan salip-menyalip. Tentunya, Vettel akan menjanjikan pertarungan seru yang akan kem-

bali digelar, 14 April mendatang. “Trek di China, buat saya unik dari sisi ukurannya. Luasnya trek di sana akan meninggalkan ruang yang cukup untuk melakukan aksi overtake. Selain itu juga terdapat area luas untuk menggeber kecepatan,” ujar Vettel, seperti dikutip Planet-F1, Rabu (11/4). “Bahkan jika di area pit trek lain sempit, area pit stop di Shanghai terbilang cukup luas,” lanjut sang juara bertahan F1. Soal prestasi di negeri tirai bambu itu, Baby Schumi punya

catatan cukup bagus. Pertama kali mencapai puncak podium Shanghai, adalah saat Vettel tampil di musim 2009. Dan di tahun lalu, Vettel berada di podium kedua, setelah driver McLaren, Lewis Hamilton. “Saya punya hasil yang cukup bagus di China, kami mendulang hasil baik di tahun 2009 saat kami pertama kali menang di China. Musim lalu, saya finis di urutan kedua dan semoga, saya mendapat hasil yang memuaskan untuk mengoleksi banyak poin,” tuntasnya. (oz/int)

Olimpiade London 2012

Raih Emas, Bonus Rp 1,5 Miliar KONI menawarkan bonus Rp 1,5 miliar bagi semua atlet Indonesia, yang dapat merebut medali emas di Olimpiade 2012 London. KONI menargetkan Indonesia dapat melanjutkan tradisi merebut emas di olimpiade. “Tawaran bonus itu berlaku untuk semua atlet dari semua cabang olahraga. KONI berharap atlet dari semua cabang berjuang keras untuk merebut emas,” kata Tono Suratman, Ketua KONI, Rabu (11/4) di Jakarta.

Dana untuk bonus, kata Tono, disumbangkan oleh para pecinta olahraga Indonesia dan diberikan melalui KONI. Bonus itu akan diberikan untuk setiap medali emas yang direbut. Menurut Tono, sampai saat ini, cabang olahraga yang berpeluang merebut medali emas pada Olimpiade 2012 London adalah bulutangkis. Namun semua cabang lainnya terus didorong untuk meningkatkan kualitas atlet, agar dapat menyumbangkan emas bagi Indonesia. (kps/int)

„ Bulls 98-86 Knicks

Bulls Bangkit Memastikan satu tiket playoff, tak menjadikan permainan Chicago Bulls, lembek kala menjamu New York Knicks di United Center. Sementara, Philadelphia 76ers akhirnya menutup paceklik keterpurukan dengan mengalahkan New Jersey Nets. Bulls yang bermain tanpa bintangnya, Derrick Rose, yang terkena cedera engkel kanan, tak kehabisan amunisi mumpuni untuk terus menggempur ring milik Knicks. Tapi, Bulls sempat dibikin bertekuk lutut di kuarter pertama, dengan kekalahan 22-25. Tapi, tanduk Bulls baru mulai unjuk kemampuan di kuarter kedua. Knicks dibuat kocar-kacir dan merebut kuarter kedua, dengan skor 47-35. Hingga akhirnya ditutup kuarter keempat, Bulls menunaikan targetnya untuk bertahan di puncak klasemen wilayah Timur, dengan kemenangan 98-86. Richard Hamilton dan Luo

Deng, menjadi bintang Bulls, pagi ini (malam waktu setempat). Hamilton mengoleksi 20 poin, sementara Luo Deng mendulang 19 poin dan 10 rebound. Sedangkan di pihak Knicks, nampak Carmelo Anthony menjadi satu-satunya ‘New Yorker’ yang bisa membuat Bulls kesulitan dengan raihan 29 poin. Beralih ke Prudential Center – kandang Nets, tak disangka 76ers mampu merebut kemenangan di markas lawan. 76ers juga akhirnya menghentikan catatan minor mereka di empat pertandingan terakhir. 76ers yang membawa serta

pilar mereka – Kris Humphries, sempat mengimbangi tuan rumah di 25 menit pertama. Bahkan skor keduanya hingga kuarter pertama berakhir, berhenti di titik 20-20. Tapi keadaan yang berbeda jauh, terjadi di kuarter kedua. Dengan fantastis, 76ers mempermalukan si empunya stadion, dengan menutup 25 menit kedua dengan skor 52-43. Hingga kuarter ketiga dan keempat, Nets gagal untuk menyalip perolehan angka 76ers, hingga akhirnya, pertandingan ditutup dengan angka 107-88 untuk kemenangan tim tamu. (oz/int)

Hasil Lengkap NBA: New York Knicks 86-98 Chicago Bulls Philadelphia 76ers 107-88 New Jersey Nets Boston Celtics 115-107 Miami Heat Charlotte Bobcats 90-103 Cleveland Cavaliers Orlando Magic 85-93 Washington DC Wizards Sacramento Kings 100-110 Dallas Mavericks.












2 Man City







3 Arsenal







4 Tottenham H







5 Newcastle U







6 Chelsea







7 Everton







8 Liverpool







9 Fulham







10 Norwich City







11 Sunderland







12 Stoke City







13 WBA







14 Swansea City







15 Aston Villa







16 Bolton W







17 QPR







18 Blackburn R







19 Wigan Ath







20 Wolves











„ Alexis Sanchez

Real Madrid kini harus mulai was-was dan menyusun strategi guna menjauh diri dari kejaran rival abadinya, Barcelona yang terus mendekat dalam ajang La Liga. Usai mebungkam Getafe dengan skor telak 4:0 dalam lanjutan La Liga, Rabu (11/4) dini hari tadi, Barcelona berhasil memperkecil jarak menjadi satu angka dengan Madrid yang kini berada di puncak kelasmen.

26 21 17

Van Persie Wayne Rooney Sergio Aguero


Arsenal Man United Man City


31 25





2 Barcelona

32 24





3 Malaga

31 15





4 Valencia

31 13





5 Levante

31 14





6 Atl Osasuna







7 Atl Madrid







8 Sevilla







9 Espanyol







10 Getafe







11 Ath Bilbao

31 10





12 R Vallecano

31 12





13 Real Betis







14 Real Sociedad

32 10





15 Mallorca







16 Granada

31 10





17 Villarreal







18 Real Zaragoza







19 R Santander







20 Sporting Gijon







adrid mengumpulkan 79 poin dan memuncaki klasemen La Liga, sementara Barca yang ada di posisi siap melancarkan kudeta dari posisi kedua dengan 78 poin. El Real -julukan Real Madrid- baru akan bisa menjauh lagi jika mampu memenangi duel dengan klub sekotanya, Atletico Madrid pada Kamis (12/4) dini hari tadi. Pada pertandingan dini hari tadi, sejak menit babak pertama Barca langsung mengurung tamunya. Messi Cs langsung mengejutkan Getafe lewat gol Alexis Sanchez yang

sukses memperdaya kiper Miguel Moya pada menit ke-13. Barisan pertahanan Getafe yang bekerja keras, tak mampu membendung sontekan Sanchez setelah memanfaatkan umpan matang Messi. 1:0 untuk tuan rumah. Gol ini semakin membuat anakanak Catalan kian bersemangat. Beberapa kali Messi nyaris menambah pundi-pundi golnya. Namun kiper Getafe, Moya dan pasukan lini belakang lainnya masih terlalu tangguh. Tapi kesabaran tuan rumah dalam membangun serangan kembali ber-

STATISTIK BARCELONA 4 75 % 13 7 7 9 5

Gol Penguasaan Bola Tendangan Sudut Tendangan Tepat Tendangan Meleset Pelanggaran Offside Wasit: José Luis González González Asisten Wasit: José M. Sánchez Santos Jon Núnez Fernández

GETAFE 0 25% 5 0 2 10 2


buah pada menit ke-44. Kali ini kerjasama satu dua Messi dengan Iniesta memaksa Moya memungut bola untuk kali kedua dari jalanya sendiri. Kedudukan menjadi 2:0 dan Messi mencatatkan namanya di papan skor. Gol ini menjadi penutup laga pertama. Memasuki babak kedua Barca tak menurunkan tempo serangan. Seolah tak ingin kehilangan momentum, mereka kembali mempermalukan tamu mereka pada menit ke73. Kali ini Sanchez kembali membuat gol lewat tandukannya setelah memanfaatkan umpan silang Isaac Cuenca. Skor menjadi 3:0 mmebuat Barca semakin di atas angin. Hanya berselang dua menit, Pedro Rodriguez kembali memperlebar keunggulan Barcelona. Berawal dari tendangan bebas yang dieksekusi Messi, Pedro sukses menyambut bola dan menghujamkannya ke gawang lawan. 4:0 untuk tuan rumah. Sementara itu Getafe yang telah tertinggal tetap tak mampu keluar dari cengkraman tuan rumah. Alhasil hingga wasit José Luis González González? meniup peluit panjang tanda permainan usai, skor 4:0 tak berubah. Selain perebutan tahta juara, rivalitas Barca dan Madrid juga berlanjut dalam perebutan pencetak gol terbanyak. Dengan satu gol di pertandingan ini Messi kini memimpin dengan 39 gol. Sementara saingannya, Cristiano Ronaldo, berada di posisi kedua dengan 37 gol.(jpnn)

Pep Samai Rekor Rijkaard

39 37 20

Lionel Messi Ronaldo Higuaín

Barcelona Real Madrid Real Madrid

SERIA A ITALIA KLASEMEN SEMENTARA 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Milan Juventus Lazio Udinese Napoli Roma Inter Catania Chievo Siena Palermo Cagliari Atalanta Bologna Fiorentina Parma Genoa Lecce Novara Cesena

32 31 31 31 31 31 31 31 32 31 31 31 31 31 31 31 31 31 31 31

20 17 16 14 12 14 13 10 11 10 11 9 10 9 9 8 9 7 5 4

7 14 6 9 12 5 6 13 9 9 6 11 13 10 9 11 8 10 10 8

5 0 9 8 7 12 12 8 12 12 14 11 8 12 13 12 14 14 16 19

62-26 51-17 47-38 43-29 55-38 49-41 45-44 41-41 30-40 36-32 44-49 33-38 34-33 32-38 32-38 39-50 42-57 35-47 27-52 18-47


23 20 19

Ibrahimovic Di Natale Cavani


Milan Udinese Napoli

67 65 54 51 48 47 45 43 42 39 39 38 37 37 36 35 35 31 25 20

„ Guardiola

Pep Guardiola semakin mengukuhkan dirinya sebagai pelatih sukses Barcelona. Kemenangan 4-0 atas Getafe pada pertengahan pekan ini menempatkan Guardiola sebagai pelatih Barcelona kedua yang paling banyak menorehkan kemenangan. Kemenangan tersebut menjadi kemenangan ke-112 Guardiola bersama Barcelona di kompetisi La Liga Spanyol. Torehan itu menyamai rekor Frank Rijkaard yang mengarsiteki Barcelona selama medio 2003-2008. Keduanya hanya kalah dari arsitek legendaris Barca, Johan Cruyff, yang mengemas 183 kemenangan dari 306 laga La Liga. Meski terbilang masih jauh untuk bisa mengejar rekor Cruyff, mantan arsitek Barca B itu mampu memiliki persentase kemenangan terbaik

Barca di kancah La Liga. Guardiola mempunyai rata-rata kemenangan tertinggi 76,8 persen. “Angkanya jauh di atas Rijkaard yang memiliki persentase kemenangan 56,9 persen,’’ tulisnya. “(Itu) Raihan terbaik dibandingkan pelatih Barca manapun sepanjang sejarah klub.” Sentuhan Guardiola mampu membuat Lionel Messi dan kawankawan jadi klub berbahaya di liga domestik. Terbukti selama sekitar empat musim di Barca, Pep mampu meraih 112 kemenangan dari 146 laga La Liga. Catatannya terbilang impresif karena La Blaugrana hanya menelan 10 kekalahan dan 24 laga lainnya berakhir imbang. Barca versi Guardiola juga tampil produktif sejauh ini dengan mencetak 392 gol dan hanya kebobolan 103 gol. (int)


Ambalutu Kandaskan BP Mandoge PASIR MANDOGE- Tim tuan rumah PTPNIVBandarPasir(BP)Mandogeharus mengakui keunggulan lawannya PS PTPN III Ambalutu setelah dalam partai semifinal, Selasa (10/4) di stadion Pasir Mandoge dibantai 2-1. Pada babak I tim Ambalutu unggul 1-0 lewat gol indah Muklis. Awan kelabu yang menyelimuti kubu BP Mandoge berimbas kepada suporter. Belasan anak-anak yang bertugas sebagai anak bola menagis sedih di pinggir lapangan. Kekalahan di luar dugaan tersebut sungguh menyakitkan. Begitu Wasit Subio meniup pluit pertanda dimulai pertandingan, pemain depan BP Mandoge langsung menekan. Maizar dan Andri langsung membombardir gawang Ambalutu yang dikawal Chairul. Gencarnya serangan Mandoge membuatpemainbawahAmabalutuyang dikawal Herman dan Suriadi harus jatuh bangun. Kekurangtenangan membuat serangan Mandoge gampang dipatahkan.

CemerlangnyapenampilanChairulmembuat frustrasi pemain Mandoge. Lepas dari tekanan lawan, Ambalutu berhasil membuat serangan balik. Diki, mesin gol Amabaltu berhasil menguasai boladanmembawakekotakpenaltilawan. Meski ditempel ketat, Diki mampu melewati tiga pemain bawah lawan. Begitu berhadapan satu lawan satu dengan kiper Mandoge, Diki mampu melesakkan tendangan keras ke sudut kiri gawang Man-

doge. Gol pembuka ini berhasil membungkam ribuan penonton tuan rumah. Kedudukan 1-0 untuk kemenangan Ambalutu bertahan hingga babak pertama selesai. Memasuki babak kedua manajer BP Mandoge Hanafi Purba didampingi pelatih Hamdani menginstruksikan agar pemain bermain cepat dengan umpanumpan pendek. Serangan yang dibangun pemain Mandoge berhasil


„ Tim PTPN IV Pasir Mandoge Asahan sebelum melakoni pertandingan semifinal.

menekan pemain bawah Ambalutu. Teriakan ribuan suporter tuan rumah berhasil membakar semangat tempur tim Mandoge. Namun dewi fortuna tidak berpihak kepada tim Mandoge dan serangan yang dilancarkan belum membuhkan hasil. Keasyikan menyerang, Mandoge lupa menjaga pertahanan. Muklis, striker Ambalutu yang lolos dari jebakan offside berlari menuju petahanan Mandoge. Tanpa menemui kesulitan Muklis berhasil manaklukkan kiper Mandoge dan skor berubah 2-0. Mandoge berhasil memperkecilkekalahanmenjadi2-1lewat titik putih. Namun hingga wasit Subio meniup peluit akhir, kedudukan bertahan 2-1 untuk kemenangan Ambalutu. Dengan demikian, Ambalutu lolos partai final yang direncanakan digelar, Minggu (15/4) di tempat yang sama. Ambalutu tinggal menunggu pemenang PS PTPN IV Bah Jambi Simalungun melawan PS Pulau Mandi Asahan yang digelar, Kamis (12/4). (iwa/ara)


Terbesar, Terdepan Dan Terbaik Di Siantar-Simalungun
