Issuu on Google+





Kamis, 6 September 2012



Edisi 138 „ Tahun X

PT Allegrindo Tetap Buang Limbah ke Danau Toba

KelamaanMenungguDokter BayiPasienJampersalTewas

SIMALUNGUN- Mahasiswa Siantar-Simalungun yang tergabung dalam Sahabat lingkungan (Saling), segera mengadukan PT Allegrindo ke DPRD Simalungun. Hasil investigasi mereka menemukan, PT Allegrindo masih membuang limbahnya ke Danau Toba. „) Baca PT Allegrindo ...Hal 6


„ Danau Toba yang dicemari limbah Allegrindo.


SIANTAR- Bayi yang merupakan anak kedua Ellen Hong Damanik (28) warga Jalan Pematang, Kelurahan Simalungun, Kecamatan Siantar Selatan, meninggal dunia usai operasi di RSU Djasamen Saragih, Rabu (5/9) sekira pukul 11.00 WIB. Kepada METRO, Rabu (5/9) Hendrik (26) suami Ellen menjelaskan, pagi itu sekira pukul 08.00 WIB, Ellen mengadu kepadanya bahwa bayi yang ada dalam kadungannya sudah terasa sakit dan seperti ada tanda-tanda mau lahir. Mendapat kabar itu, Hendrik membawa istrinya naik becak menuju RSU Djaseman Saragih untuk dioperasi „) Baca Kelamaan ...Hal 7

„ Bayi yang tewas

Maruli Dinilai Takut Pada Hulman

SIANTAR- Hingga saat ini Ketua DPRD Kota Siantar belum melakukan pemanggilan terhadap Walikota Siantar, terkait PNS siluman yang sempat bekerja di pemko. Sikap tak acuh ini pun dinilai bahwa Ketua DPRD Marulitua Hutapea takut kepada Hulman Sitorus.

„ Supriyadi (42) ditangkap karena memiliki satu paket kecil sabusabu dan ganja 5 gram di perempatan Jalan Melanthon Siregar dan Jalan Farel Pasaribu, Rabu (5/9).

„) Baca Maruli Dinilai ...Hal 6


Hal 7


Adil: Copot Baren Purba! SIANTAR- Baren Purba yang berlatar belakang pendidikan Sarjana Hukum (SH), dipercaya sebagai Pj Wakil Direktur III RSUD dr Djasamen Saragih membidangi keuangan dan peningkatan SDM. Dikhawatirkan posisi Baren tidak efektif menjalankan tugas dan fungsinya. Walikota Siantar Hulman Sitorus, diharapkan professional dalam menempatkan orang untuk menduduki jabatan sesuai dengan ilmu pengetahuannya. “Masih banyak orang yang bisa ditempatkan menduduki jabatan Wadir III RSUD dr „) Baca Adil: Copot...Hal 6

Prangko Bergambar Mobil Listrik Diluncurkan JAKARTA– Koleksi prangko PT Pos Indonesia bertambah satu lagi. Sebuah prangko bergambar “Mobil Listrik” resmi diluncurkan Rabu (5/9) oleh Direktur Utama PT Pos Indonesia I Ketut Mardjana dan Menteri Negara Badan Usaha Milik Negara (BUMN) Dahlan Iskan. Peluncuran prangko “Mobil Listrik” ini terbilang unik, karena tidak dilakukan melalui acara resmi maupun waktu lazim. Meneg BUMN Dahlan Iskan memilih „) Baca Prangko ...Hal 6

Rakyat dan Pemerintah Harus Kompak Tolak TPL


SIMALUNGUN- Hingga saat ini, lahan pertanian masyarakat yang diserobot paksa PT Toba Pulb Lestari (TPL) belum dikembalikan. Sehingga banyak warga yang menghabiskan hari-harinya di rumah. Sebab tak ada lagi lahan pertanian yang bisa dikelola.Ketua Komisi III DPRD Simalungun Drs Johalim Purba mengatakan, kalau hanya sepihak rakyat yang menginginkan TPL ditutup, „) Baca Rakyat dan ...Hal 7

PNS Badan PIT Ditangkap Miliki Sabu dan Ganja SIANTAR- PNS di kantor Badan Pelayanan Izin Terpadu (PIT) Kota Siantar, Supriyadi (42) ditangkap karena memiliki satu paket kecil sabu-sabu dan ganja 5 gram. Dia diringkus di perempatan Jalan „ Menteri Negara BUMN Dahlan Iskan (kanan) dan Dirut PT Pos Indonesia.

Melanthon Siregar dan Jalan Farel Pasaribu, Selasa (4/9) pukul 13.00 WIB. Supriyadi masih diperiksa intensif untuk pengembangan penyelidikan. Informasi dihimpun METRO, penang-

kapan Supriyadi bermula dari informasi yang diterima polisi dari warga yang menyebutkan, Supriyadi diduga memiliki „) Baca PNS Badan ...Hal 6


„ Suasana rumah Dewi Shyaputri, siswa SMP yang tewas akibat minum racun, Rabu (5/9).


Tak Ada yang Kenal Bang Put SIMALUNGUN- Bang Put, penerima pesan singkat terakhir dari Dewi Shyaputri (14) warga Huta Manik Rejo, Nagori Silampuyang, Kecamatan Siantar, yang tewas karena minum racun, hingga saat ini belum diketahui siapa. Dedi sepupu korban mengatakan, bahwa dia adalah warga Nagori Silau Malaha, Kecamatan Siantar. Namun

beberapa warga Silau Malaha yang ditanyai METRO tak ada yang mengenal Bang Put. Kepada METRO, Rabu (5/9) Dedi mengatakan tidak tahu soal hubungan Bang Put dengan Dewi, karena dia tidak pernah melihat lelaki itu datang ke rumah. Dewi pun tidak pernah mengenalkan lelaki kepadanya. “Sebe„) Baca Tak Ada ...Hal 7

Aura Kasih

PILIH CARA TRADISIONAL DALAM banyak hal, cara-cara tradisional tak pernah ditinggalkan. Salah satunya untuk urusan perawatan kecantikan. Hal itu juga dilakukan oleh artis Aura Kasih. Mulai dari pijat, lulur sampai totok muka menjadi ‘obat’ pilihan Aura agar tetap terlihat cantik. Alhasil, biaya yang dikeluarkan pelantun ‘Mari Bercinta’ itu pun lebih murah dibanding perawatan modern. “Alhamdulillah nggak yang harus mahal-mahal, suntik „) Baca Pilih ...Hal 6



6 September 2012

Jalan Penghubung Silau Kahean Menuju Raya Amblas Jalan Menuju Sijambei Butuh PPerbaikan erbaikan

SILOU KAHEAN- Longsor di ruas jalan yang menghubungkan Kecamatan Silou Kahean dengan Kecamatan Raya, via kecamatan Raya Kahean, tepat di dekat kantor Pangulu Nagori Sinasih, semakin parah. Bahkan sebagian besar badan jalan sudah amblas hingga membentuk lubang sedalam 10 meter. Agar bisa dilewati kendaraan roda empat, warga terpaksa menutup parit di sisi sebelah jalan menggunakan batu padas. (Hardono/osi)

Bupati Simalungun terhormat, kondisi jalan ke Sijambei-Bah Sulung, Kecamatan Tapian Dolok sangat membutuhkan perbaikan. Mulai Negara Indonesia merdeka, jalan tersebut tidak pernah tersentuh pembangunan. 081362069xxx

Tertibkan PPungli ungli di PPasar asar Horas

WALI Kota Siantar terhormat, tolong ditertibkan pengutan tanpa karcis di Pasar Horas dan Pasar Dwikora. 08139682xxx

Jalan Ade Irma Langganan Banjir Pengawasan Proyek Ditingkatkan PENGAWASAN proyek harus lebih ditingkatkanm karena maraknya pekerjaan yang baru siap dibangun sudah langsung rusak. Itu dampak proyek yang dikerjakan asal jadi. (pra) Prindo Purba Mahasiswa

Terancam Putus Total Sudah 70 persen badan jalan tersebut amblas. Kalau dibiarkan berlarut-larut, jalan tersebut bisa mengalami putus total. (mua) Deny Gusman Warga

MENYEDIAKAN ANEKA HEWAN PELIHARAAN MAMMALIA Hamster panda, Syrian, Campbell, Dominan, Roborovski WF, Roborovski Normal, Tikus Putih, Mencit, Tikus Panda, Marmut Anggora, Landak Mini, Anakan Anjing Teckel, Anakan Mini Pincher, Dalmation Jantan Dewasa, Maltese Jantan Dewasa, Teckel Kaliko, Anakan Musang, Tu p a i K e l a p a , K e l i n c i , d l l NB: Ada juga menyediakan Ikan Hias/ Konsumsi, Burung Hias/Kicau, Reptil, Kura kura, Ulat Hongkong, Ulat Jerman, Jangkrik, Aksesoris Ikan/Burung, Kandang, dll


0878 6849 0858 0812 6332 0422

Jl. Thamrin Baru No. 71 Medan




Menerima Mahasiswa/i Baru T.A. 2012/2013 Program Study:

aw y Dr Luck

nit tu) U 1 (sa


Pendaftaran: 1 Mei 2012 s/d 30 September 2012

ia imed Mult uter Komp

Bagi Mahasiswa/i Baru TA. 2012/2013 Dapat Beasiswa dari Ketua Yayasan 25% uang Kuliah Setiap Tahun

Kami Ada Untuk Anda Senin-Jumat (08.00 s.d 17/00) Sabtu (08.00 s.d 14.00)


Jl. Asahan Komp. Megaland Blok A No.58-60 Telp. 0622 7070215 - 7553367 Pematangsiantar

Mutu dan Pelayanan Yang Utama & Unggul Kwalitas, Unggul Teknologi Ketua Yayasan dto


Direktur dto


Wali Kota Siantar terhormat, tolong diperhatikan jalan Ade Irma yang setiap datang hujan menjadi langganan banjir. Hal itu diakibatkan parit lebih tinggi dari badan jalan, sehingga air tergenang. 08216544xxx

Diusulkan Anggarannya Pada pembahasan PAPBD Kabupaten Simalungun tahun 2012 nanti, DPRD Simalungun akan mengusulkan kepada eksekutif agar dibuat anggaran perbaikan terhadap kerusakan jalan tersebut. (osi) Drs Johalim Purba Anggota DPRD Simalungun

Telepon Penting PMI (Palang Merah Indonesia) 118, 0622-433911 Alamat Jl Sutomo No. 248, Pematangsiantar Kantor Imigrasi Alamat: Jl. Raya Medan Km. 11,5 Pematang Siantar Telepon : (0622)465018, 465014 Samsat Dipendasu Jln Sangnawaluh No 37A 0622 7552345.

RS dr Djasamen Saragih Jln Sutomo No 230. 0622 (23824) Hotel Sapadia Jl.Diponegoro No.21 A P.Siantar Telp:0622-435922 Nice Trans Siantar-Medan Medan. (061) 4558844 Siantar (0622)7000200 085275144777


6 September 2012 “Dikhawatirkan bagi partai yang memiliki dana besar akan membuat ketentuan administrasi secara borongan lewat konsultan. Jelas, tertib administrasi tidak bisa jadikan jaminan akan menghasilkan DPR yang berkwalitas,” Ketua Umum Partai Nasional Indonesia Marhaenisme (DPP PNI Marhaenisme) DM Sukmawati Sukarno.

“Merepotkan (verifikasi). Tapi tetap dilaksanakan, walaupun ini sebagai sebuah kesalahan sejarah,”

Ketua Umum Partai Persatuan Pembangunan (PPP) Suryadharma Ali.

Ketua Komisi III, Gede Pasek Suardika.

“Badan Nasional Penanggulan Teroris (BNPT) harus melakukan pencegahan dan deradikalisasi, jangan hanya penindakan terus, itu yang harus dilakukan. Apalagi notabenenya pelaku teroris itu masih muda, ada yang belasan tahun lagi? Ini harus diselamatkan dan dibina,”

Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter

Sikap Kami Mengelola Musim HIDUP di dua musim seperti di Indonesia, yakni musim hujan dan panas, mestinya mendatangkan berkah. Kondisi demikian tidak membutuhkan antisipasi dan perlakuan sesulit negeri dengan empat musim atau lebih seperti di Eropa. Sayangnya, berkah dua musim itu kini tak pernah lagi dinikmati. Yang terjadi justru musibah akibat buruknya perencanaan. Ketika musim hujan tiba, banjir muncul di mana-mana. Ketika kemarau datang, kekeringan tidak bisa lagi dihindari. Ribuan hektare lahan pertanian kering, bahkan ratusan hektare di antaranya gagal panen. Wadukwadukyangmenjadiuratnadibagisawah,listrik,dan air bersih pun kering kerontang. Peristiwa terakhir menunjukkan susutnya air waduk membuat tiga pembangkit listrik tenaga air (PLTA) tidak beroperasi. Ketiga pembangkit listrik itu ialah PLTA Wadaslintang, PLTA Sempor, dan PLTA Pajengkolan yang semuanya berada di Kebumen, Jawa Tengah. Volume Waduk Wadaslintang, misalnya, kini tinggal 261,46 juta meter kubik. Padahal, isi maksimalnya mencapai 413,46 juta meter kubik. Kekeringan juga terus meluas. Di Kabupaten Magelang dan Temanggung di Jawa Tengah, Pasuruan, Jawa Timur, Karangasem, Bali, dan Kabupaten Kupang, Nusa Tenggara Timur, krisis air bersih sudah terjadi. Di Pasuruan, sedikitnya 20 desa di delapan kecamatan bahkan mengalami krisis air bersih. Ketersediaan air bersih di desa-desa tersebut tidak mampu memenuhi kebutuhan minimal 10 liter per hari per orang. Kenyataan tersebut menunjukkan masih buruknya antisipasi dan perencanaan pemerintah. Antisipasi bencana masih dilakukan dengan kebijakanreaktif,yaknimembagi-bagibantuanuang setelah musibah datang. Begitu bencana kekeringan pergi, semuanya kembali seperti sedia kala seolah tidak pernah terjadi apa-apa. Kebijakan yang bersifat preventif dan proaktif nyaris tidak banyak dilakukan. Akibat kebijakan dadakan itu, menurut hitunghitungan Institut Hijau Indonesia, terjadi potensi kerugian lebih dari Rp100 triliun. Padahal, jika yang dikedepankan ialah kebijakan antisipatif, dana yang dibutuhkan kurang dari Rp50 triliun. Bila penghentian penebangan hutan dan penyetopan konversi lahan pertanian menjadi permukiman dilakukan secara konsisten, bencana bisadihindari.Kerugianfinansiallebihbesarpunbisa diminimalkan. Kenyataannya, potensi kerugian malah kian bertambah karena dana yang digelontorkan untuk mengatasi kekeringan diserahkan kepada pemerintah daerah dengan pengawasan minimal. Tidak banyak yang tahu apakah bantuan itu sampai ke masyarakat atau tidak. Jika manajemen musim masih bertumpu pada pola-pola darurat seperti saat ini, dampak yang lebih buruk akan menjadi kenyataan. Kalau sekarang kita baru menghadapi krisis listrik dan air bersih akibat kekeringan, bukan tidak mungkin krisis pangan benar-benar menjadi kenyataan. Pada titik itu bangsa yang pernah gemilang di bidang agraris ini tinggal meratapi tragedi berkesinambungan. (**)

Revitalisasi Bulog dan Kebutuhan Masyarakat Kekayaan alam di negeri ini yang tak terhingga menjadikan negeri ini berbeda dari negara lainnya. Namun, dibalik kekayaan alam yang berlimpah ini, alangkah disayangkan jika pihak-pihak yang seharusnya mampu mengatasi permasalahan kebutuhan penduduknya, justru melahirkan sebuah permasalahan baru.

Oleh : Budi Prasetyo TAK sepatutnya luas wilayah daratan sekitar 1.922.570 km², masih kesulitan masalah pangan. Beberapa waktu lalu, kita dihibur dengan melambung tingginya harga kedelai dipasaran. Kenyataan ini, benar-benar di luar kewajaran dan telah mencapai angka klimaks. Bahkan, melebihi harga tertinggi tahun 1998. Tahun 1998, harga kedelai mencapai Rp7.050 per kg dan sekarang hampir menembus angka Rp8.000 per kg. Bukan itu saja, sejarah mencatat bahwa Indonesia yang dulu terkenal dengan negara agraris, sekarang ternyata sangat bergantung kepada pangan impor. Untuk memenuhi kebutuhan dalam negeri, sebanyak 60% pasokan pangan di Indonesia diimpor dari luar negeri. Tercatat beras selama 2 tahun terakhir yang diimpor hampir 2 juta ton, jagung 1,2 juta ton, kedelai hampir 30% dari kebutuhan, gula 30%, 50% garam konsumsi impor, susu 70%, dan gandum 100%. Akibatnya, angka inflasi mengalami naik selama April 2012 akibat harga pangan yang tinggi, ternyata di sisi lain adanya gejolak pangan di tingkat internasional saat ini. Badan Pusat Statistik (BPS) mengumumkan bahwa inflasi April 2012 naik dibandingkan bulan sebelumnya sebesar 0,21 %, sedangkan inflasi secara year on year tercatat sebesar 4,5%. Padahal, target inflasi dalam APBN-P 2012 adalah 6,8%. Tingkat inflasi tersebut didorong oleh kenaikan harga beberapa komoditas pangan sejak awal bulan. Di antaranya harga komoditas yang mengalami kenaikan tersebut adalah bawang putih, cabai rawit, gula pasir, bawang merah, dan minyak sawit. Untuk itu revitalisasi Bulog perlu dilakukan, tujuannya untuk memenuhi ketercukupan pangan. Menkopere-

konomian Hatta Rajasa mengeluarkan statment berkaitan revitalisasi Bulog. Dirinya setuju adanya revitalisasi dalam tubuh Bulog alasannya sangat penting untuk stabilisasi harga agar masyarakat tidak terbebani dengan kenaikan harga akibat kelangkaan bahan kebutuhan pangan pokok. Sejak wewenangnya dipangkas pemerintah atas tekanan IMF (Dana Moneter Internasional), 1998, Bulog hanya menangani beras. Komoditas pangan lainnya diserahkan sepenuhnya kepada mekanisme pasar. Alhasil, kebijakan ini merugikan masyarakat konsumen dan para petani sebagai produsen. Harga bahan kebutuhan pokok berfluktuasi tajam. Sudah sepatutnya, Badan Urusan logistik (Bulog) ditingkatkan perannya yang bertujuan untuk menjaga ketahanan pangan agar berjalan efektif. Jika Perum Bulog diberi peran tidak hanya menjalankan stabilisasi harga beras, namun juga menjaga stabilisasi harga sejumlah bahan pokok. Harga kebutuhan pokok sudah selayaknya dikontrol pemerintah, karena kebutuhan pokok ini merupakan kebutuhan strategis yang harus dilindungi sesuai amanat Undang-Undang Dasar 1945. Tujuan turut campurnya pemerintah dalam penentuan harga untuk mencegah terjadinya kelangkaan dan kelonjakan harga bahan pokok serta terjadinya monopoli pasar. Apalagi, kebutuhan pokok merupakan kebutuhan yang tak dapat dipisahkan dalam kehidupan siapapun di dunia ini. Jangankan manusia, hewan pun tidak akan bisa bertahan hidup, jika tidak ditopang kebutuhan pokok. kebutuhan pokok sering kali berada di tengah ancaman. Iklim menjadi ancaman terbesar atas ketersediaan kebutuhan pokok. Ancaman kelangkaan pangan yang kini melanda dunia, termasuk Indonesia menjadi pekerjaan tersendiri bagi pemerintah untuk melindungi kebutuhan dalam negeri. Meski secara geografis memiliki kekayaan alam yang melimpah, namun ancaman krisis pangan ini tetap dialami Indonesia sebagai dampak dari mata rantai kehidupan dunia. Apalagi kebutuhan akan konsumsi beras masyarakat Indonesia cukup tinggi dan merupakan yang terbesar di dunia dengan volume sebanyak 130 Kilogram (Kg) sampai 140 Kg per orang per tahun. Konsumsi itu mencapai dua kali dari masyarakat di kawasan Asia Tenggara yang hanya 65 kg sampai 70 kg. Untuk memenuhi kebutuhan tersebut, pemerintah


Menjual bahan bangunan Grosir penjualan kayu untuk bangunan Tersedia segala jenis ukuran

Jenis kayu sembarang hutan Meranti Hoting Duri dll

"Lang Dearan Bani Halak Dong Do Hita" Horas Simalungun Jaya Jl. H Ulakma Sinaga No. 45 Nagori Pamatang Simalungun Kec. Siantar Kabupaten Simalungun

Pengusaha na RM Br Simanjuntak Telp. 0622 - 7552445 HP 0821 6545 1004

melakukaan berbagai langkah strategis, diantaranya mengantisipasi kekurangan pangan melalui produksi optimal pengadaan beras. Tujuannya hanya satu, yaitu kebutuhan nasional tetap terjaga.Terkesan Bulog selama ini tidak diberi peran untuk menstabilitaskan harga komoditas selain beras. Padahal infrastruktur gudang, jaringan, maupun fasilitas lain dapat dimanfaatkan Bulog untuk mengatasi permasalahan pangan didalam negeri. Untuk itu bulog perlu di revitalisasikan. Penulis sependapat dengan apa yang disampaikan Hatta rajasa, dengan adanya revitalisasi ini. Bulog harus tetap mengacu kepada regulasi dan mengacu kepada stabilisasi supaya tidak menimbulkan distorsi terhadap mekanisme pasar. Kemampuan untuk tetap menjaga komoditas dan menstabilisasikan harga pada akhirnya menjadi tantangan tersendiri bagi bulog. Sebelumnya, Presiden Susilo Bambang Yudhoyono menginstruksikan agar Bulog direvitalisasi kembali fungsinya sebagai stabilisasi harga komoditas pangan yang dibutuhkan masyarakat, tidak hanya untuk beras. Menurutnya revitalisasi Bulog dibutuhkan mengingat tantangan stabilitas berbagai harga pangan yang terus meningkat, sementara kebutuhan pangan masyarakat yang juga terus naik. Untuk itu, Yudhoyono meminta segera dibentuk tim guna mengembalikan peran Bulog tersebut dan mengkaji komoditas-komoditas pangan yang akan menjadi tanggung jawab Bulog. Penulis berkeyakinan dengan adanya revitalisasi ini Bulog mampu memainkan perannya dalam memenuhi kebutuhan pokok masyarakat. Setidaknya revitalisasi ini, masyarakat tidak terbebani dengan adanya kenaikan harga, akibat kelangkaan bahan pokok. Selain memainkan perannya, fungsi Bulog diperkuat untuk melindungi konsumen dan produsen sekaligus. Setidaknya keuntungan yang didapat dari revitalisasi ini, konsumen dilindungi dari lonjakan harga kebutuhan pokok. Sedangkan produsen dilindungi dari penurunan harga panen. Pada saat panen pun harga bahan kebutuhan pokok melonjak dan keuntungan dari lonjakan harga itu tidak dinikmati petani, melainkan segelintir pedagang atau lebih banyak di nikmati tenkulak. (**) Penulis Merupakan Ketua Karang Taruna Rw 09 Kebon Jeruk Jakarta Barat dan Leader Samudera Down Hill Mountaine Bike Community


6 September 2012

2 Pulau Indonesia Dijual JAKARTA- Mantan Menteri Kelautan dan Perikanan Fadel Muhammad menegaskan Kementerian Kelautan dan Perikanan bertanggung jawab terhadap semua pulau-pulau di Tanah Air. Saat ada informasi penjualan 2 pulau di Indonesia, Fadel mengungkapkan kritik kepada Menteri Kelautan dan Perikanan saat ini, Sharif Cicip Sutardjo. ”Kementerian Kepulauan dan Perikanan menangani semua pulau-pulau di Indonesia. Pulau terluar waktu itu kita inventarisir ada 60 buah pulau dan kita tidak mau menyewakan apalagi menjual. Kita anggap lokasi strategis untuk menjaga keamanan negara di perbatasan,” kata Fadel, Rabu (5/9). Fadel mengingatkan agar Kementerian KP lebih jeli mengamankan pulau-pulau Indonesia. Jangan sampai pulau dijual tapi juga harus peka terhadap investasi. ”Nggak boleh kita menjual pulau kepada siapapun juga. Kita bikin kerja sama untuk investasi, kita undang investornya masuk dengan beberapa pertimbangan. Yang pertama kita bisa membangun holiday

resort, kita bisa bikin apakah 15 tahun ataukah 20 tahun perjanjian,” saran Fadel. Fadel lantas mengkritisi kinerja Kementerian KP setelah ditinggalkannya. Di bawah menteri yang baru tak lain adalah Wakil Ketua Umum Golkar Sharif C Sutardjo, dia mendengar ada hal yang menjadi tidak teratur. ”Saya dengar sekarang sudah nggak teratur. Ya saya banyak prihatinnya. Misalnya program kita menaikkan produksi ikan rakyat sudah ditiadakan, sekarang orientasinya industri. Dulu saya canangkan program itu agar kita nggak perlu impor ikan. Itu prinsip membangun ekonomi kerakyatan,” ingat Fadel yang juga menjabat Wakil Ketua Umum Golkar ini. Situs www. memasang iklan penjualan pulau Gambar di Laut Jawa dan pulau Gili Nanggu di Lombok, Nusa Tenggara Barat. Kementerian Kelautan dan Perikanan pun melakukan pengecekan kepemilikan pulau tersebut. Pulau Gambar menjadi salah satu

pulau yang dijual dalam situs penjualan pulau pribadi dunia tersebut. Harga yang ditawarkan tergolong murah yakni USD 725 ribu atau setara dengan Rp 6,8 miliar (kurs Rp 9.500). Dalam informasi penjualannya, pulau itu disebutkan berada di kawasan Laut Jawa dengan luas 2,2 hektar. Pulau Gambar dideskripsikan sebagai pulau unik yang masih ‘perawan’. Dengan pantai indah yang mengelilinginya, pulau ini layak dijadikan sebuah hunian pribadi. Air laut di sekitar pulau relatif tenang dan dangkal. Para pengunjung bisa menyelam, snorkelling dan memancing. Sejumlah ikan dan lobster bisa ditemukan di tepi pantai. Sementara pulau Gili Nanggu di Lombok yang memiliki luas 4,99 hektar itu ditawarkan dengan harga Rp 9,9 miliar. Lokasinya yang berada di laut Bali jadi daya jual tersendiri. Menurut situs tersebut, pemilik pulau menawarkan Gili Nanggu dengan sejumlah fasilitas. Di antaranya 10 unit cottage, 7 unit bungalow, 1 unit restoran, mini bar, kamar, dan area pengembangbiakan kura-kura. (dtc/int)


Beresiko Tinggi Meninggal Dunia JAKARTA- Tingkat kematian jemaah haji Indonesia pada 2011 mencapai 2,34 persen. Dari 223.395 jemaah pada tahun lalu, sebanyak 522 di antaranya meninggal dunia. Tingginya kematian jemaah disebabkan mayoritas jemaah telah memiliki risiko kematian tinggi sebelumnya, seperti mengidap penyakit kronis berat dan berusia lanjut. ”Jemaah haji Indonesia memang tergolong memiliki risiko kesakitan yang cukup tinggi,” ujar Dirjen Pengendalian Penyakit dan Penyehatan Lingkungan (Dirjen P2PL) Kemenkes Tjandra Yoga Aditama di Jakarta, Rabu (5/9). Lebih dari separuh dari total jemaah, menurut Tjandra, telah memiliki risiko tinggi terhadap kematian sebelum berangkat. Menurut inventaris Kemenkes, sekitar 50.58% atau

111.697 dari 223.395 jemaah yang bemenjalani ibadah, menurut dia, ada rangkat pada tahun lalu masuk dalam beberapa hal yang perlu dipersiapkelompok risiko tinggi. kan. Pertama, jemaah Tercatat jenis penyawajib memeriksakan kit yang paling banyak kesehatan ke dokter. diidap oleh jemaah haji Kedua, jika memang yang meninggal pada memiliki penyakit krotahun lalu adalah pennis, sebaiknya memastiyakit jantung dan pemkan persediaan logistik buluh darah. Selanjutobat terpenuhi. Selannya adalah penyakit jutnya jika memang megangguan pernapasan, miliki resiko kesehatan otak, masalah pada tinggi, yang bersangkusistem sirkulasi, entan bisa meminta surat dokrin metabolik, infekpengantar dari dokter. si, ginjal, masalah ”Surat tersebut bisa pencernaan, tumor, menjadi masukan bagi dan penyakit darah. dokter kloter yang bertuMengingat kelomgas dalam persiapan tinpok terbang (kloter) dakan yang perlu diampertama jemaah haji „ Tjandra Yoga Aditama bil nantinya,” imbuh 2012 akan berangkat Tjandra. pada akhir September, Tjandra menSelanjutnya jika berangkat bersama yarankan jemaah haji melakukan berorang lanjut usia, sambungnya, perbagai persiapan agar kesehatan dan siapan lebih rinci seperti pengeibadah mereka tidak terkendala. tahuan tentang menyewa kursi roda. Agar tubuh sehat dan bugar saat (mdc/int)

„ Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini mendatangi kantor KPK untuk menjalani pemeriksaan.

2 Perwira Polisi Diperiksa KPK Kasus Simulator SIM JAKARTA- Para perwira Polri harus wira wiri memenuhi panggilan penyidik KPK sebagai saksi kasus simulator SIM. Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini kali ini dimintai keterangan lagi. ”Keduanya dipanggil sebagai saksi dalam perkara pengadaan driving simulator di Korlantas Mabes Polri,” ujar Kabag Pemberitaan KPK, Priharsa Nugraha, ketika dikonfirmasi, Rabu (5/9). Setidaknya sampai pukul 09.30 WIB, dua perwira tersebut belum sampai di kantor KPK. Ini merupakan panggilan kedua bagi Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini.

KPK sebelumnya memeriksa AKBP Indra Darmawan Irianto dan AKBP Susilo Wardono. Sedangkan pada pekan lalu, KPK juga telah memeriksa empat perwira sebagai saksi untuk Irjen Djoko yakni AKBP Wandi Rustiwan, Kompol Ni Nyoman Sumartini, Kompol Endah Purwaningsih, dan AKBP Wisnu Buddhaya. Sebelumnya mereka sempat tak hadir dalam panggilan pertama karena ada masalah administrasi. Dalam kasus Simulator SIM ini, KPK menetapkan mantan Kakorlantas Irjen Djoko Susilo sebagai tersangka. KPK juga menetapkan bawahan Djoko, Brigjen Pol Didik Purnomo, Direktur Utama PT Inovasi Teknologi Indonesia, Sukotjo S. Bambang dan Direk-

tur PT Citra Mandiri Metalindo Abadi, Budi Santoso sebagai tersangka. Polri juga menetapkan status sama terhadap tiga nama terakhir tersebut. Tiga nama yang menjadi ‘tersangka bersama’ itu memicu persoalan. Sampai saat ini KPK dan Polri samasama ngotot untuk menangani kasus ini. Sampai saat ini belum ada titik temu antara dua lembaga penegah hukum tersebut. Polri telah melakukan gerak cepat dengan melakukan penahanan terhadap para tersangkanya, yang juga tiga di antaranya merupakan tersangka di KPK. Irjen Djoko juga telah dua kali diperiksa sebagai saksi. Sedangkan KPK masih hanya fokus memeriksa saksi dan berkas untuk Irjen Djoko. (dtc/int)


Perkuat Kerja Sama Pertahanan JAKARTA- Pertemuan bilateral antara Menteri Pertahanan RI Purnomo Yusgiantoro dan Menteri Pertahanan Australia Stephen Smith menghasilkan kesepakatan strategis dalam rangka memperkuat kerja sama kedua negara dalam bidang pertahanan, terutama sektor industri. ”Setidaknya kami sepakat dalam satu semangat yang sama yaitu memperkuat kerja sama pertahanan di antara kedua negara. Khusus untuk sektor industri pertahanan, tentu saja akan bergerak dalam wilayah untuk memperkuat pertahanan negara masing-masing,”

LOWONGAN KERJA Distributor mesin-mesin penggandaan / cetak di Sumut dn NAD, kantor pusat di Jakarta membutuhkan SEGERA tenaga Sales Representatif (SR) dan Teknisi (Tak) dengan persyaratan sbb: 1. Pria, usia max. 30 tahun untuk SR dan 23 tahun untuk Tek 2. Pendidikan min. D3 untuk SR dan SMK Elektronika untuk Tek 3. Dapat mengoperasikan komputer (Ms. Office) 4. Memiliki kendaraan sendiri SR 5. Berbadan sehat, ramah, pekerja keras dan tidak sedang kuliah 6. Untuk ditempatkan di P. Siantar Kami menawarkan status pegawi tetap, insentif, tunjangan kesehatan, asuransi, jamsostek dan peningkatan karir Surat lamaran lengkap pasphoto terakhir dapat langsung atau dikirim ke: Perwakilan PT SETIAWAN SEDJATI Jl. Bendungan No. 10 Kel. Aek Nauli, Siantar Barat Pematangsiantar Telp. 0622 - 435825; HP 0853 6298 2300 (Paul)

ujar Purnomo saat memberi keterangan pers di Kantor Kementerian Pertahanan di Jakarta, Rabu (5/9). Pertemuan yang merupakan lanjutan dari kunjungan Menhan Purnomo ke Darwin pada Mei 2012 lalu ini dilandasi semangat saling menghormati bagi kemajuan industri pertahanan kedua negara. “Soal detail seperti apa, tentu saja akan dibahas kemudian sambil berjalannya waktu,” jelasnya. Selain kerja sama memperkuat industri pertahanan, Purnomo menjelaskan lingkup kegiatan kerja sama pertahanan antara RI dan

KREDIT TANPA AGUNAN Anda Butuh Dana Tanpa Agunan : Syarat-syarat: 1. Fotocopy KTP 2. Fotocopy Kartu Kredit (limit minimal Rp5 juta, usia kartu minimal 12 bulan)

LOWONGAN KERJA Perusahaan yang bergerak di bidang Kredit TanpaAngunan (KTA) membutuhkan : A. ADMISTRASI - Wanita - Usia 21-30 tahun - Minimal lulusan Diploma - Mampu mengoperasikan komputer - Memiliki kendaraan roda dua + SIM C B. SALES EXEKUTIF - Pria/Wanita - Usia 20-35 tahun - Pengalaman di bidang sales/marketing (lebih diutamakan) - Berpenampilan menarik - Mampu berkomunikasi dengan baik - Memiliki kendaraan roda dua + SIM C Fasilitas: • Gaji Pokok • Komisi • Bonus Surat Lamaran + CV ditujukan kepada : Pimpinan Cabang

PT BERKAT BINTANG NUSANTARA (BBN) Jl. Durian No. 21 Pematangsiantar Telp. 0622 - 27501; HP 0821 6324 7654

Australia juga meliputi kebijakan pertahanan, hubungan antarinstansi, kontraterorisme, keamanan maritim, bantuan kemanusiaan dan pemulihan bencana, dukungan logistik militer dan pelayanan medis, pemeliharaan perdamaian, intelijen, industri pertahanan, material, ilmu pengetahuan dan teknologi. ”Juga pendidikan dan pelatihan di bidang pertahanan atau militer, tata kelola dan manajemen pertahanan, dan bidang lainnya yang menjadi kepentingan bersama kedua negara,” lanjut Purnomo. (dtc/int)




Punya kendaraan roda 2 (dua)? anda Pria/Wanita tamatan SLTA, bergabunglah bersama kami. Fasilitas yang didapat: • Insentive • Bonus • Karir • Komisi Kirimkan lamaran anda ke:

Harian METRO SIANTAR Jl. Sangnawaluh Komp. Megaland Blok A No. 24 P. Siantar

Tuliskan kode KARIR di sudut kanan amplop & cantumkan nomor Telp/HP yang bisa dihubungi


6 September 2012

PNS Badan PIT Ditangkap Miliki Sabu dan Ganja Sambungan Halaman 1 dan sering mengonsumsi sabu-sabu dan ganja. Mendengar ini, polisi lalu bergerak ke perempatan Jalan Melanthon dan Jalan Farel Pasaribu. Saat itu, Supriyadi baru saja keluar dari kantornya di Jalan Melanthon Siregar dan hendak pergi ke salah satu lokasi di Jalan Melanthon Siregar Ujung. Setelah menghentikan kreta Supriyadi, polisi lalu mengintrogasi tersangka. Namun Supriyadi sempat berkilah dan mengaku tidak memiliki sabu dan ganja. Polisi tidak kehabisan akal, polisi lalu menggeledah kreta Yamaha Xeon 5996 TAJ milik Supriyadi. Dari jok sepeda motornya polisi menemukan ganja sebanyak 5 gram. Polisi terus melakukan pengembangan, polisi lalu bergerak ke rumah Supriyadi dan menemukan satu paket kecil sabu-sabu di rumahnya Jalan Melati, Kelurahan Simarito, Siantar Barat. Sabu ini ditemukan di lantai II rumahnya. Dengan penemuan itu, polisi lalu menggiring Supriyadi ke Mapolres Siantar. Amatan METRO, dari pagi hingga sore, Supriyadi menjalani pemeriksaan di Unit Narkoba Polres Siantar. Saat diperiksa, Supriyadi sempat dijenguk istri dan keluarganya yang lain. Saat diwawancari METRO, Supriyadi mengaku sebagai PNS di Badan PIT Kota Siantar dan bertempat tinggal di Jalan Melati Kelurahan Simarito, Siantar Barat. Namun dia membantah memiliki sabu dan ganja tersebut. Menurutnya, ganja dan sabu itu ditempelkan di jok kretanya dan bukan milik dia. Namun dia mengakui, sebelumnya pernah memakai ganja dan sabu-sabu. “Memang saya pernah memakai sabu dan ganja, tapi itu dulu, sekarang tidak lagi. Saya PNS di PIT hampir lima tahun, sebelumnya honorer saja,” jelasnya. Dijumpai di Kantor Badan PIT Kota Siantar sekira pukul 13.00 WIB, Ester br Pakpahan dan salah satu staf di bagian penerimaan tamu di badan itu menyebutkan, Supriyadi merupakan staf di Kantor PIT Kota Siantar. Namun mereka tidak mengetahui penangkapan Supriyadi. Sementara Kepala PIT Rudi Dipo Silalahi dan Sekretaris PIT Fatimah Yanti Siregar sesuai penjelasan Ester, tidak bisa diganggu karena banyak tamu. Ditunggu hingga setengah jam di depan kantor itu, keduanya tidak kunjung bisa ditemui. Kasat Narkoba Polres Siantar AKP Sofyan membenarkan penangkapan tersebut. Dia mengatakan, Supriyadi masih diproses untuk kepentingan penyelidikan. Namun berdasarkan tes urine tersangka positif menggunakan sabu-sabu. Dari tangan Supriyadi disita ganja 5 gram dan satu paket kecil sabu-sabu. (ral)

Prangko Bergambar Mobil Listrik Diluncurkan Sambungan Halaman 1 menandatangani sampul peringatan Hari Kebangkitan Teknologi Nasional yang berisi prangko bergambar mobil listrik itu kemarin pukul 06.00 di lapangan Monumen Nasional (Monas). Terang saja acara menarik perhatian masyarakat yang sedang berolah raga pagi di kawasan Monas. “Waktunya sengaja dipilih pagi hari pada saat matahari sedang muncul di ufuk timur dan dilakukan di tengah masyarakat, sebagai simbol era baru transportasi yang ramah lingkungan dengan mobil listrik,” kata Awie Setiawan selaku koordinator acara di sela-sela acara peluncuran prangko terbaru PT Pos Indonesia. Sedangkan Dahlan menilai prangko bergambar mobil listrik yang dibanggakannya itu sangat menarik dan inovatif. “Karena ini merupakan wujud nyata gerakan menuju era transportasi listrik,” kata Dahlan sebelum membubuhkan tanda tangan pada sampul berukuran besar bertuliskan kalimat “Selamat Atas Terbitnya Prangko Baru Ini”. Menurutnya, saat ini pemerintah mengembangkan beberapa purwarupa mobil listrik. Karenanya, Dahlan berharap PT Pos membuat beberapa prangko berseri dengan gambar mobil listrik. “Saya usul, semua mobil listrik yang dikembangkan dibuat berseri sehingga masyarakat semakin mengenal berbagai model transportasi listrik,” cetusnya. Menanggapi permintaan Dahlan, Dirut PT Pos Indonesia I Ketut Mardjana langsung menyatakan kesanggupanya. Menurutnya, PT Pos Indonesia memang sudah siap memproduksi prangko seri transportasi listrik tersebut. “Produksinya akan dilakukan secara bertahap sesuai dengan kesiapan alat transportasinya dan momentum yang tepat,” ucapnya. Tanda tangan Dahlan Iskan tadi pagi menjadi puncak acara peluncuran perangko “Mobil Listrik” yang sebelumnya diawali di Kantor Pusat PT Pos Indonesia di Bandung pada 29 Agustus 2012 lalu. Acara dibandung itu juga dihadiri Ir Dasep Ahmadi yang dikenal sebagai pencipta mobil listrik.(aj/jpnn)

Maruli Dinilai Takut Pada Hulman Sambungan Halaman 1 Sebelumnya, beberapa anggota DPRD, seperti Rudel Sipayung dan Kennedy Parapat saat ditemui di ruangannya, Rabu (5/8) mengatakan, pihaknya akan memanggil Pemko Siantar. “Ya, kami Komisi I akan menyurati pemko, tapi surat itu harus izin dari pimpinan DPRD,” terang Kenedy Parapat. Ditanya apakah surat tersebut sudah dibuat dan dilayangkan, Kenedy Parapat mengatakan belum dibuat. Namun akan dibicarakan dulu di Komisi I dan kemudian suratnya akan dikeluarkan. Akan tetapi, Ketua DPRD Marulitua Hutapea terkesan lepas tangan. Ditemui METRO Rabu (5/9), Maruli tampak cuek dan tak peduli soal kasus yang mencoreng wajah Pemko Siantar ini. Maruli mengatakan, hal ini sudah sepenuhnya diserahkan kepada lembaga hukum, dalam hal ini kepolisian. Katanya biar polisi yang melakukan penanganan sepenuhnya. “Persolan tersebut sudah diserahkan pemko ke penegak hukum. Sudah saya katakan tidak ada pemanggilan kepada walikota,” katanya sembari berlalu. Sementara Wakil Ketua DPRD Zainal Purba juga tak bersedia dimintai keterangan. Saat dihubungi METRO, dia menolak melanjutkan perbincangan dan mengaku sedang mengikuti acara. Menanggapi ini, Ketua Lembaga Institut Trias Politica Republik Indonesia (ITPRI) Siantar-Simalungun Jekson Hutahaean,

Sambungan Halaman 1 SIANTAR- Pengutipan uang Bea Perolehan Hak atas Tanah dan Bangunan (BPHTB) yang dilakukan Pemko Siantar kepada masyarakat sejak Januari hingga juni 2012, diminta segera dihentikan. Sebab perdanya belum ada. Hal ini disampaikan Rudel Sipayung SPd anggota Komisi I DPRD, Rabu (5/9) di ruang kerjanya. Disebutkan sesuai amanah Permendagri nomor 22 tahun 2011 tetang pedoman penggunaan APBD 2011 menjelaskan, pengutipan BPHTB harus terlebih dulu memiliki Peraturan Daerah (Perda) sebagai payung hukumnya. Sejak Januari hingga Juni 2012, Pemko Siantar telah melakukan pengutipan BPHTB sebanyak Rp2.958.202.835 dan target tahun 2012 yang harus dikutip sebesar Rp6 miliar. “Ini sudah menyalahi aturan, sehingga diminta supaya pemko menghentikan sementara pengutipan tersebut hingga Perdanya dibuat,” sebutnya. Praktisi PDI-Perjuangan ini mengimbau

Sambungan Halaman 1 Djasamen yang berlatar belakang pendidikan tentang keuangan dan peningkatan SDM. Walikota pun harus professional menempatkan pejabat sesuai ilmu pengetahuannya. Baren harus dicopot, dan digantikan orang yang berlatar pendidikannya tentang keuangan dan SDM,” tegas Kordinator Simalungun Corruption Wacth (SCW) Adil Saragih ketika dihubungi METRO, Rabu (5/9). Dia menilai, masyarakat terkadang kurang puas dengan hasil pekerjaan pejabat di Pemko Siantar. Hal itu disebabkan banyaknya pejabat yang penempatannya tidak sesuai latar belakang pendidikannya. “Sarjana hukum tetapi mengurusi keuangan dan SDM. Apakah memang sudah tidak ada lagi orang di lingkungan Pemko Siantar yang paham dan bisa diandalkan mengurusi keuangan dan peningkatan SDM RSUD dr Djasamen. Sehingga orang yang sarjana hukum dipaksa menduduki jabatan tersebut. Mereka yang punya gelar sarjana ekonomi harusnya

dan bangunan adalah pajak yang dikenakan atas perolehan hak atas tanah dan bangunan. Perolehan hak atas tanah dan atau bangunan adalah perbuatan atau peristiwa hukum yang mengakibatkan diperolehnya atau dimilikinya hak atas tanah dan atau bangunan oleh orang perseorangan pribadi atau badan. Objek pajak BPHTB adalah perolehan hak atas tanah dan atau bangunan. Subjek BPHTB adalah orang pribadi atau badan yang memperoleh hak atas tanah dan atau bangunan. DPP/Dasar pengenaan Pajak BPHTB adalah Nilai Perolehan Objek Pajak (NPOP). NPOP dapat berbentuk harga transaksi dan nilai pasar. Jika nilai NPOP tidak diketahui atau lebih kecil dari NJOP PBB, maka NJOP PBB dapat dipakai sebagai dasar pengenaan pajak BPHTB. BPHTB yaitu merupakan pajak yang harus dibayar akibat perolehan hak atas tanah dan bangunan meliputi hak milik, hak guna usaha, hak guna bangunan, hak pakai, hak milik atas satuan rumah susun dan hak pengelolaan. (pra)

marah kepada walikota yang memberikan jatah kepada orang yang tidak tepat,” tegasnya. Menurutnya, dari penempatan orang yang tidak sesuai itu berdampak dengan kualitas dan kuantitas pekerjaan. Semisalnya, Baren Purba yang berlatar belakang pendidikann sarjana hukum, sangat rancu ketika mengurusi keuangan dan peningkatan SDM. Sebab, ilmu yang dibidangi Baren adalah sarjana hukum. “Meskipun Baren mempunyai pengetahuan tentang keuangan dan peningkatan SDM, itu hanya sedikit-sedikit saja dan hasilnya pun kurang maksimal. Tetapi ketika orang yang tepat dipakai di sana, hasilnya kemungkinan besar memuaskan dan pastinya sudah punya konsep program,” katanya. Disinggung soal kenaikan golongan Baren yang tidak sesuai peraturan, Adil mengatakan, memang ada aturannya bahwa kenaikan golongan itu bisa di bawah 4 tahun. Tetapi biasanya adalah golongannya sudah ingin mencapai 4 tahun dan atau sering disebut golongan senior. “Biasanya mereka yang naik golongan di

bawah 4 tahun itu adalah orang yang baru menduduki jabatan. Itu pun umur golongannya harus sudah mau mencapai 4 tahun, dan disebut percepatan kenaikan golongan untuk menyesuaikan dengan jabatannya. Namun kalau katanya berselang 1,6 tahun atau 2 tahun langsung naik golongan, itu sudah layak dicurigai keabsahannya. Di sana kita curiga ada permainan antara Baperjakat dan oknumnya,” ungkapnya. Menurutnya, gara-gara kenaikan golongan yang tidak sesuai waktunya, negara yang dirugikan. Di mana dengan kenaikan golongannya, gaji Baren setiap bulannya pastinya mengalami kenaikan. “Baren dan orang yang menaikkan golongan itu bisa dipidanakan. Mereka diduga telah berkolusi yang mengakibatkan kerugian negara,” tegasnya. Sementara Kepala Inspektorat Kota Siantar Pardamean Silaen MSi mengatakan, belum mempelajari jenjang kenaikan golongan Baren Purba. “Saya lihat dulu-lah jenjang kenaikan golongan Baren,” ujarnya singkat. (osi)

PT Allegrindo Tetap Buang Limbah ke Danau Toba Sambungan Halaman 1 Kordinator Saling, Johannes Sakti Sembiring mengatakan, hasil investigasi Saling yang melihat langsung PT Allegrindo membuang limbah ke Danau Toba segera dilaporkan ke DPRD Simalugun. Sebagaimana janji tim Panitia kerja (Panja) DPRD Simalungun untuk membentuk pansus pencemaran Danau Toba yang dilakukan PT Allegrindo. “Hasil temuan kita yang langsung didokumentasikan, segera diberikan kepada DPRD Simalungun. Kita berharap DPRD dapat mengambil sikap tegas,” ujar Johannes, Rabu (5/9). Masih kata Johannes, PT Allegrindo membuang limbahnya pada tengah malam

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel)

Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

kepada masyarakat untuk tidak membayar BPHTB kepada pemerintah. Dia mengatakan, hingga saat ini pemko belum membuat draf Perdanya yang diusulkan kepada DPRD untuk disahkan. Dia menambahkan, pemko seharusnya melaksanakan amanah Permendagri bahwa pengutipan uang BPHTP harus ada perdanya, baru bisa dikutip. Melihat hal tersebut, pemko diminta membuat Perdanya supaya masyarakat paham dan mengerti, bahwa segala sesuatu hal terkait pengutipan harus ada dasar hukum. Ditanya pendapatnya soal masyarakat yang sempat membayar uang BPHTB, Rudel memberikan beberapa opsi, yakni pemerintah harus mengembalikan uang kepada masyakat yang membayar uang BPHTB. Sedangkan opsi yang lain, uang tersebut untuk sementara diditipkan di Dinas Pendapatan dan tidak dapat dipergunakan sebelum Perdanya dibuat. BPHTB atau bea perolehan hak atas tanah

Adil: Copot Baren Purba!

Anggota SPS No: 438/2003/02/A/2007 Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba

keterangan resmi kepada DPRD selaku perwakilan rakyat, karena persoalan PNS siluman ini sudah menjadi perbincangan hangat di masyarakat. Masih kata Edi, walau Pemko Siantar sudah membuat laporan ke penegak hukum, bukan berarti serta merta DPRD harus diam dan tidak melakukan tugasnya. Sementara, Asni br Manurung yang disebut-sebut sebagai pelaku dalam melakukan pemalsuan PNS siluman tersebut tidak pernah lagi masuk kantor. Saat METRO menayakan kehadiran Asni yang merupakan PNS di Disdik Siantar, para pegawai mengatakan bahwa Asni tidak pernah masuk kantor tanpa alasan jelas. Bahkan Asni sudah berminggu-minggu tidak masuk kantor. Bahkan saat METRO mencoba menghubungi nomor teleponnya, sudah tidak aktif lagi. Padahal beberapa hari sebelumnya, nomor HP Asni masih aktif, hanya saja dia tidak diangkat saat dihubungi. Seperti pemberitaan sebelumnya, ada 12 orang PNS siluman dengan menggunakan SK palsu lolos terdaftar sebagai PNS di Kota Siantar. SK ke-12 orang tersebut diserahkan oleh Asni br Manurung kepada salah seorang staf di Dispenda bernama Robert Lumban Gaol. Dalam SK tersebut menyebutkan bahwa 12 orang tersebut adalah PNS dari Pemkab Simalungun yang mutasi ke Pemko Siantar. Lampiran SK tersebut ada tertulis SK dari Sekda, Waikota, SK dari BKD Siantar, Pemprovsu dan walaupun itu fotocopy tapi Rob-

Pemko Kutip BPHTB tanpa Perda

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pemimpin Perusahaan Metro Asahan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

menilai bahwa DPRD mandul, apalagi Marulitua selaku ketua. “Itu pernyataan konyol. Jadi, di mana fungsi pengawasan itu?” ujar Jekson. Dia menilai, sikap yang ditunjukkan Marulitua Hutapea ini menunjukkan bahwa dia takut kepada Hulman Sitorus. “Ini kasus berat. Sudah luar biasa Pemko Siantar kecolongan dalam hal ini. Tapi, walau begitu, Ketua DPRD tetap cuek. Ini jelas menunjukkan dia takut kepada Hulman,” tegas Jekson. Dia menambahkan, kalau DPRD tetap bersikap seperti ini, akan timbul kejadian yang sama, atau lebih parah. Karena pemko tak perlu takut lagi melakukan pelanggaran, sebab DPRD pun tidak berani bertindak. Edi Sihombing SH dari Lembaga Intelektual Community menambahkan, kasus ini sangat jarang terjadi di Indonesia. Menurutnya, Walikota Hulman Sitorus tidak melaksanakan tugasnya sesuai dengan amanah undang-undang. “Kepala daerah seharusnya bisa menjalankan roda pemerintahan sebaik mungkin, termasuk juga aktif dalam melakukan pengawasan terhadap jajarannya,” sebutnya. Dia juga mengatakan, DPRD semestinya langsung melakukan pemanggilan kepada Walikota Siantar untuk memberikan penjelasan di hadapan wakil rakyat. “DPRD adalah perwakilan rakyat dan pemerintah harus memberikan penjelasan kepada wakil rakyat tersebut. Bukannya memberikan komentar di mana-mana,” tambahnya lagi. Idealnya, kata Edi, walikota memberikan

pukul 24.00 WIB. Limbah tersebut dibuang lewat saluran pipa yang dibuat dari PT Allegrindo mengaliri sungai Salbe dan berakhir di Danau Toba. Setiap kali membuang limbah, warna air Danau Toba yang dialiri sungai Salbe berubah menjadi keruh. “Limbah perusahaan Allegrindo dibuang lewat sungai Salbe. Meski sudah melewati sungai Salbe, masih saja air limbahnya sangat kotor. Itu artinya memang sudah tidak ada pengolahan limbah pada perusahaan PMA itu,” ungkapnya. Lebih jauh, kata Johanner, PT Allegrindo juga harus bertanggungjawab dengan kesalahan mereka selama ini yang membuang limbah ke Danau Toba. Mereka harus membayar ganti rugi kepada pemerintah kawasan Danau Toba dan

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Chandro Purba, Nasa Putramaylanda, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Pala MD Silaban, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva

masyarakat sekitar Salbe yang setiap hari merasakan pencemaran tersebut. “Kita harapkan PT Allegrindo tidak lagi membuang limbahnya ke Sungai. Namun kalau masih membandal, perusahaannya sebaiknya ditutup. Sedangkan pencemaran selama ini harus dibayar ganti ruginya atau denda pencemaran,” tukasnya. Anggota Panja, Drs Johalim Purba mengatakan pihaknya belum menerima secara resmi laporan pengaduan dari Saling. Dia mengaku, telah menyaksikan langsung PT Allegrindo membuang limbah ke Danau Toba. “Setelah laporan karyawan dan masyarakat sekitar PT Allegrindo dituntaskan, kita juga akan proses masalah pembuangan limbah itu,” tegas Johalim. (osi)

Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Niko, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

ert memasukkan nama tersebut ke dalam database sebagai PNS di Pemko Siantar dan berhak mendapatkan gaji. Selanjutnya 12 orang tersebut pun bertugas di sejumlah dinas, kecamatan termasuk juga di kantor lurah dan satpol PP seperti PNS lainnya. Anehnya para kepala SKPD tersebut tidak mengetahui bahwa pegawai di lingkungannya ada yang ‘siluman’. Akhir Juli lalu, bagian pembendaharaan Dispenda Siantar pun mengeluarkan uang sebanyak Rp27.566.427 untuk gaji Agustus ke 12 PNS ‘siluman tersebut dan uang tersebut diserahkan kepada bendahara di instanis PNS ‘siluman tersebut ditempatkan. Pada akhir Agustus kemarin, keberadaan PNS ‘siluman’ tersebut pun mulai diperbincangan di lingkungan Pemko Siantar. Bahkan kasus tersebut mencuat ke publik. Akibatnya ke 12 PNS tersebutpun tiba-tiba menghilang dan tidak masuk kerja lagi. Dan yang paling unik, hampir seluruh pejabat di Pemko Siantar tidak mengetahui keberadaan 12 orang PNS ‘Siluman’ tersebut termasuk alamatnya. Setelah inspektorat melakukan penyelidikan, ditemukan kesimpulan bahwa SK PNS tersebut palsu dan hasilnya pun diserahkan kepada Walikota Siantar. Selanjutnya Pemko Siantar pun membuat pengaduan ke Mapolresta Siantar, Senin (3/9). Sementara itu sejumlah pejabat saat diwancarai termasuk Donver selaku Sekda Kota Siantar mengatakan, tidak ada terlibat dalam melakukan pemalsuan SK tersebut. (pra/ara)

Jaksa Minta Perkara 3 Pejabat KPUD Dilanjutkan MEDAN- Jaksa Penuntut Umum (JPU) dari Kejaksaan Negeri (Kejari) Pematangsiantar meminta Majelis Hakim tetap melanjutkan proses persidangan dari tiga orang terdakwa Ketua Komisi Pemilihan Umum (KPUD) Pematangsiantar Rajaingat Saragih priode 20092014, mantan Ketua KPUD Pematangsiantar Poltak Simaremare priode 2004-2009, serta mantan anggota KPUD Pematang Siantar Dilan Karno. Dalam persidangan beragendakan mendengarkanketeranganJPUataseksepsipenasehathukumketigaterdakwa,jaksamenilaidakwaanmereka tetap sah dan sesuai dengan ketentuan yang telah diaturdalamKUHPidana.MenurutJaksa,perkaratersebuttelahtepatdiajukanpadadomainpengadilan Tipikor,danbukandomainpengadilanadministrasi negarasepertiyangditerangkanpenasehathukum ketigaterdakwadalameksepsinya. “Perkara ini sudah tepat masuk domain pengadilan tipikor dan bukan merupakan domain administrasi negara seperti eksepsi yang diterangkan penasehat hukum terdakwa. Sebab tipikor sendiri berwenang mengadili dan memeriksa seluruh kegiatan yang berkaitan dengan kerugian negara,” ujar JPU Rizaldi, Rabu (5/9). Jaksa menilai, dengan adanya ketentuan tersebut maka apa yang disampaikan penasehat hukumketigaterdakwatidakberalasan.Pihaknya jugamemintamajelishakimtetapmelanjutkanpemeriksaaan pokok dakwaan terhadap tiga terdakwadugaankorupsidiKPUDPematangSiantar. Menanggapi pernyataan jaksa di persidangan, Kencana Tarigan selaku penasehat hukum dari terdakwa menjelaskan bahwa tanggapan jaksa terhadap eksepsi yang mereka ajukan tidak substansial. Ia mengaku, jaksa bukan membahas isi dari eksepsi yang mereka ajukan dan membahas persoalan lain. Selain itu, Kencana mengutarakan pihaknya melihat kasus ini bukanlah domain pengadilan tipikor melainkan domainhukumadministrasinegara.Sehinggajika pun ada ditemukan kesalahan tidak selalu seseorang langsung bisa dipidanakan. Usai mendengarkan tanggapan JPU atas eksepsi penasehat hukum terdakwa, Majelis Hakim yang diketuai P Simarmata menjelaskan, sidang akan ditunda hingga pekan depan, Rabu (12/9) dengan agenda mendengarkan putusan sela dari majelis hakim. Pada sidang yang berlangsung sekitar pukul 13.00 WIB, bertempat di ruang Cakra IV Pengadilan Negeri (PN) Medan, kedua belah pihak pun tetappadatanggapannya.DimanaJPUmengaku eksepsi penasehat hukum terdakwa tidak tepat dan meminta proses persidangan dilanjutkan, sementara penasehat hukum terdakwa tetap pada eksepsinya.(far)

PILIH CARA TRADISIONAL Sambungan Halaman 1 sana-sini, tradisional aja, pijit, lulur, totok muka, aku tradisional banget,” tuturnya usai mengisi acara musik ‘DahSyat’ di Studio RCTI, Kebon Jeruk, Jakarta Barat, Rabu (5/9). Selain dengan perawatan tradisional, Aura mengaku rajin minum jus agar wajahnya tetap fresh. Selain jus, ia juga tak pernah lupa untuk selalu minum air putih. “Jus aku bikin sendiri, yang mengandung vitamin C, sisanya minum air putih,” jelasnya. (int)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



6 September 2012

Kakek Cabuli Bocah .. Sambungan Halaman 8 beranggotakan Gabe Doris dan Adria Dwi Afanti. Menurutnya, terdakwa terbukti secara sah dan meyakinkan melakukan tipu muslihat atau membujuk anak untuk melakukan persetubuhan. Perbuatan terdakwa melanggar pasal 81 ayat 2 UU RI NO 23 tahun 2002 tentang Perlindungan anak jo pasal 64 ayat 1 KUHPidana. “Berdasarkan keterangan saksi dan keterangan terdakwa di persidangan terungkap peristiwa itu berlangsung Mei2012sekirapukul16.00WIB, Jumat(25/5),sekira pukul16.00WIB,Senin(28/5)sekirapukul16.00WIB. KaryawanPTPNVItersebutberhasilmelampiaskan nafsubejatnyadirumahkosongdiNagoriHutaParik dan di galian lubang pokok kelapa sawit Blok 97 Afdeling II Kebun Tinjowan I PTPN IV Tinjoan, Ujung Padang,” jelasnya. Menurut hakim, saat itu terdakwa melihat korban sedang pergi membeli jajanan ke warung sendirian.Melihatitu,terdakwapunmemanggildan mengajak korban ke perkebunan kelapa sawit yang tidak jauh dari perkampungan. Sambung Hakim Ramses, setelah terdakwa membuka resleting celananya dan menggendong saksi korban, lalu mencabuli korban. Akibat perbuatan yang berlangsung selama tiga kali itu, korban mengalami luka robek pada selaput darahnya pada sekitar jam 3-5. Sementara usai mendengarkantuntutanitupriayangmemilikiuban banyak tersebut memutuskan untuk pikir-pikir atas putusan hakim. (mua)

Divonis Penjara.. Sambungan Halaman 8 bertempatdikamar17,HotelBukitHijauJalanJamin GintingKm11Medanpada27Desember2011lalu. Hakimberpendapat,perbuatanterdakwatermasuk sadis yang membunuh kakak iparnya hanya untuk melampiaskan dendamnya dengan alasan, kakar iparnyamenjadiorangyangmengakibatkandirinya bercerai dengan sang istri. “Mengadili terdakwa atas namaAdiAryantodenganhukumanpenjaraseumur hidup.Halyangmemberatkanprilakuterdakwatidak berprikemanusiaan, dan tergolong sadis. Selain itu, terdakwa juga diketahui sudah kerap keluar masuk penjara,” ucap majelis hakim yang diketuai Nelson Marbun,kemarin(5/9). Dijelaskannya, terdakwa dikenakan pasal 340 KUHPidana,tentangpembunuhanberencana.Selain halyangmemberatkankarenaperbuatannyatergolongsadis,majelishakimpunmemberipertimbangan hal-hal yang meringankan terdakwa karena telah mengakui dan merasa bersalah atas perbuatannya sertaselamaprosespersidanganberprilakusopan. Menanggapi vonis hakim, terdakwa pun mengajukan banding. Langkah sama dilakukan JPU Nilma, yangmengakumengambillangkahbanding.KasusAdi sendiridiketahuibermulapadaSelasa27Desember2011 silamsekitarpukul15.30WIB,bertempatdikamar17 Hotel Bukit Hijau Jalan Jamin Ginting Km 11 Medan dengan sengaja membunuh Elida Hasibuan yang notabenekakakkandungmantanistrinya. SaatituterdakwamengundangElidakehotelberalasan untukmemberikansesuatubendaataukenang-kenangan kepadakorban.Namunnahas,niatnyaternyataberubah dan berusaha memperkosa korbannya di mana sebelumnyamengatakan“kakaksudahjandasementara akusudahduda,yaudahkitamelakukanpersetubuhan saja,”ujarnyasesuaiBAP. Sebelum membunuh korbannya, Adi juga terbukti meminta atau memaksa korban untuk melakukan persetubuhan dengan membuka paksa celana korban. AkantetapikorbanElidasaatitumelakukanperlawanandan berteriak minta tolong sehingga terdakwa menutup mulut korbandenganmenggunakancelanapanjangmilikkorban. Selain itu karena kalap, terdakwa menggunakan kainspraimengikattangankorbandanmenjambak korban dan langsung menggorok leher Elida secara berulang-ulangsampaikuranglebihlimakalitebas. Setelahitu,terdakwaberusahamembakarkorban denganmenyiramkanminyakbensinyangberasaldari sepedamotornya.(gib/pmg)

NYAWA SUHARDI MELAYANG Sambungan Halaman 8 yangdigelardiPNSimalungunyangdipimpinmajelis hakimRamsesPasaribuberanggotakanGabeDoris dan Adria Dwi Afanti , Rabu (5/9). Jaksa Penuntut Umum(JPU)JuliusButar-butardalamdakwaannya menyebutkanperistiwaituberlangsungpadaJumat (23/3)sekirapukul20.30WIB.“Sekirapukul15.30saksi Supriatin datang ke rumah korban Suhardi dan mengajaknya untuk minum tuak. Kemudian Supriatindankorbansepakatminuktuakdiwarung tuak Litawati. Mereka berangkat dengan mengendarai sepedamotor dan setibanya di sana mereka langsung memesan satu galon tuak,” sebutnya. Diamenerangkan,sambilminumtuakkeduanya pun bercerita sambil menikmati gorengan yang disediakan.Karenatuakyangsudahdipesanhabis, Supriatin pun kembali memesan tuak satu galon. Setelahitu,merekakembaliminumhinggaSupriatin melihat terdakwa datang dan langsung memesan tuakkepadapemilikwarung.Selanjutnyaterdakwa duduk di kursi lain dengan jarak empat meter dari korbandanSupriatin.“Setelahbeberapajam,tiba-

tibaterdakwaChristianmendatangimerekasambil membawagelasyangberisituakdanberdiritepatdi samping korban. Saat itu terdakwa tampak berbincang-bincang dengan korban, namun Supriatin tidak mendengar apa perbincangan mereka.Setelahbeberapamenitkemudianterdakwa mengambiltuakdaritekodanmenuangkannyake gelasSupriatindankorban,”ungkapjaksa. Sambungnya, setelah itu terdakwa mengajak Supriatin dan Suhardi untuk tos (laga gelas). Selanjutnya Supriatinmengangkatdanmelagakan gelasnyakegelasterdakwadanterdakwameminum tuaknya.SementaraSupriatinmembuangtuaknya ke bawah meja sambil berkata ‘sudah puas kau’. “Mendengar itu terdakwa meletakkan gelasnya di meja dan berkata kepada Supriatin ‘apanya kau’ sambil menolak dada saksi Supriatin. Saat itu, Supriatinmendekatiterdakwadankorbanlangsung berdiridanmeleraisaksiSupriatindanterdakwa.Saat itu korban melerai dengan menghalangi badan terdakwa. Akan tetapi terdakwa saat itu tidak mau dihalang-halangiolehkorbandandenganspontan korbanpunmenolakdadaterdakwa,”terangButarbutar.

Katanya,Supriatinpunmelihatantaraterdakwa dankorbansalingmenolakdanakhirnyaSupriatin mengajakkorbanuntukpulang.KemudianSupriatin berjalan menuju tempat sepedamotornya diparkirkan di samping warung tuak dekat pohon coklat.Sementarakorbantampakberjalanmenuju arah coklat, sedangkan terdakwa berjalan cepat menujusepedamotordanmengambilpisaubelati daribagasikeretanya. “SaatSupriatinpunberniatmenghampirikorban sambilmendorongkeretanya.Akantetapilagi-lagi terdakwadankorbansalingdorong-dorongan.Tidak beberapa lama terdakwa pun langsung membacokkan perut korban hingga usus korban terburai. Usai melakukan aksinya terdakwa pun melarikan diri dan meninggalkan korban dalam keadaanbersimbahdarah,”ungkapnya. Sementara itu, usai mendengarkan dakwaan jaksa, kuasa hukum terdakwa, Omri Gultom memutuskan tidak mengajukan eksepsi dan meminta agar hakim langsung melanjutkan ke dalam pokok perkara. Selanjutnya hakim pun memutuskanmenundapersidangankarenasaksi belumhadir.(mua)

awalnya Kijang Innova, belakangan diketahui dikemudikanMasri(51),wargaDusunTampal,Desa Penghidupan, Kecamatan Kampar Kiri, Kampar ini melaju dari arah Parapat menuju Siantar, dengan kecepatantinggi.Laludariarahberlawananjugamelaju BusWisataIndah.“Suarabenturannyasangatkeras, bahkansempatterdengarkerumahsayaini,”kataSilalahi. Mendengarsuarabenturanitu,wargaberbondongbondongmengecekkeTKP.“Saat inikamimencoba menolonglalusaatkamitanyamerekakatanyamereka barusajapulangpestapernikahandariPerumnasBatu Enam, Kelurahan Lestari, Kecamatan Siantar Simalungun,”katanya. Tak berapa lama kemudian, petugas Unit Laka Lantas Polsek Tiga Dolok datang ke lokasi dan

langsungmengevakuasiparakorbankeRumahSakit VitaInsaniSiantar.Untukkepentinganpenyelidikan lebihlanjut,keduabusnaasitudiamankandiPolsek Tiga Dolok dan bus Wisata Indah ini diamankan di PolsekTigaBalata. Terpisah,KaposlantasPolsekTigaDolokAipdaH Ompungsunggu,ketikaditemuiMETRO,Rabu(5/ 9), diruangannyamenyebutkan,penyebabkejadian inikarenaminibusKijangInnovainimelajudengan kecepatantinggi.Kemudiankondisijalanyanglicin saathujaninididugakuatmenjadipenyebabmobil kijanginovainisleprem.”Setelahkitaperiksasupir minibusKijangInovainislepremsaatkejadianlalu diamenabrakbuswisataIndahitu,”ujarnya. (mag02)

celanakorban.Kemudianterdakwapunmembuka celananya sendiri dan langsung menyetubuhi korbanlayaknyahubungansuamiistrihinggapuas,” ungkapnya. Sambung hakim Ramses, kejadian berikutnya berlangsungpadaAgustus,sekirapukul15.00WIB. Terdakwa kembali datang ke rumah korban dan mendekatikorbanyangsaatitusedangtidur-tiduran diruangTV.Kemudianterdakwamembukacelananyadanlangsungmemasukkankemaluannya.Saat itu, korban langsung menjerit dan berkata ‘jangan tulang’.Akantetapiterdakwasaatituhanyadiamsaja sambil tetap melakukan aksinya. “Setelah puas, terdakwapunlangsungmemberikanuangRp2ribu terhadapkorban.Peristiwaituberlangsunghingga limakalidanakhirnyaorangtuakorbanmengetahui

perbuatantersebut.Korbanseringmenangiskarena kemaluannyaterasasakit,”teranghakim. Untuk hal memberatkan, perbuatan terdakwa merusak masa depan korban. Seharusnya terdakwa melindungi korban karena masih saudara. Sementara hal meringankan terdakwa merasabersalahdanselaputdarahkorbanmasih normal. Sehingga berdasarkan pertimbangan itu maka majelis hakim yang mengadili perkara tersebut menyatakan terdakwa terbukti secara sah dan meyakinkan melakukan persetubuhan terhadap anak dibawah umur. Sementara usai mendengarkan hukuman itu terdakwahanyatampakterdiamsambiltertunduk. Terdakwamengakumenerimaputusanyangdijatuhkanolehmajelishakim.(mua)

semenjakibunyameninggaldunia. Puncak,stresnyaMusaditambahdirinyadipecat dari pekerjaan sebagai angkat-angkat barang di JalanPutriHijau. Hal senada juga dikatakan, Mahmud. Musa dikenalnyasukamasukkerumahorangmengambil makanan, bahkan sampai mengambil uang. “Memangdiasukamasukkerumahorang,kalaudia lapar.Diamasukajakerumahorangmintamakan,” katanya membuka pembicaraan pada Posmetro Medan. Dikatakannya pria yang berjualan bunga di bundaran Jalan Adam Malik, ini jenazah korban ditemukankalipertamapenjualescream.“Penjuales creamyangnemukandiapertamakali,habisituntah kemanadia,”katanya. Menurutceritawarga,rumah orangtuanyatelahdisewakanAhmadkepadaorang lain, hingga Musa tak tahu tinggal dimana. “Rumahnyadisewakanabangnya,tinggalnyanggak

tentu-tentugitu,”celotehwarga. Saat ditemui, tim olah tempat kejadian perkara mengatakankalaukorbanmurnibunuhdiri.“Tidak semua yang tergantung lidahnya keluar. Bisa juga ditahanolehgigi,tapitadispermakeluar,”ucapnya serayaberjalankeluardaritkp. Menurutnya, korban murni tewas bunuh diri. “Murniinibunuhdiri,karenaditubuhnyatidakada tanda-tandakekerasan,”sambungnyalagi. KapolsektaMedanBaratKompolNasrunPasaribu Siksaatdikonfirmasidilokasikejadian,mengatakan kalaumotifdarigantungdirikorbankarenamengalami stresibunyatelahmeninggal2tahunlalu. Gunaprosespenyelidikan,jenazahkorbanpun dibawakeRS.PirngadiMedan.Sedangkanbarang buktiberupa,akarpohonyangdigunakankorban untuk menggantung dirinya serta sandal jepit korban kini diamankan ke Polsekta Medan Barat. (eza/pmg)

Kosti dan Relme Patah Kaki, Delapan Orang Luka Ringan Sambungan Halaman 8

Panribuan, Simalungun, Rabu (5/9), sekira pukul 16.30WIB.Akibatkejadianitu,duapenumpangbus Wisata Indah Kosti Marpaung dan Relme Silalahi mengalamipatahkaki,sementaradelapanpenumpanglainnyamengalamilukaringan(selengkapnya, bacaMetroSiantar). Informasidihimpun,busyangdikemudikanBanuar MarudutSinaga(40),wargaParapat,KecamatanGirsang Sipangan Bolon, itu membawa rombongan pesta pernikahan dari kawasan Perumnas Batu Enam, KelurahanLestari,KecamatanSiantarini. WargasekitaryangmelihatkejadianiniPSilalahi(43), saatditemuiMETRO,dilokasikejadianinimenyebutkan

Paman Cabul Dihukum Delapan Tahun Penjara

Sambungan Halaman 8 keterangansaksidanketeranganterdakwadipersidangan terungkap perbuatan terdakwa melanggar pasal81ayat1UURINomor23Tahun2002tentang PerlindunganAnak.Terdakwaberhasilmencabuli Mawar sebanyak lima kali dengan iming-iming memberikanuangRp2ribu,”sebutnya. Diamenerangkan,peristiwaituberlangsungpada (16/4)sekirapukul16.30WIB.Saatitu,korbanbertemu denganterdakwadidepanrumahkorban. Selanjutnya,terdakwamengajakMawarmasuk ke rumahnya. Setelah berada di rumah korban, terdakwalangsungmenidurkankorbandiatastikar didepanruangTV.“Setelahkorbantergeletakdiatas tikar,tanpabasabasiterdakwalangsungmembuka

Musa Tewas Tergantung di Pohon Rambutan

Sambungan Halaman 8 KelurahanSeiAgul,KecamatanMedanBarat. Motif tewasnya warganya Jalan Sekata Gang Mawarinididugakarenastressibunyameninggal dunia2tahunsilam.Sehinggamembuatprialajang inikerapmeminta-mintamakanankepadawarga sekitar,bahkantaksegan-seganmencuri,Rabu(5/ 9)sekitarpukul11.30WIB. PenemuanmayatMusasontakmembuatwarga sekitarberhamburankelokasikejadian. Menurut keterangan warga sekitar, seluruhnya mengenalpriayangtergantungtersebut.Diaadalah MusaDaulay,yangmengalamigangguanjiwasejak ibunya meninggal dunia. “Si Musa itu, si Musa gantung diri,” celoteh para ibu-ibu saat di lokasi kejadian. Menurut salahseorang wanita berumur 40-an tahun ini, Musa mengalami gangguan kejiwaan

Penganiaya Istri.. Sambungan Halaman 8 PPA Polres Siantar menolak hal ini karena proses perdamaian belum tercapai diantara keduanya. “Permohonan penangguhan penahanan tersangka kitatolakkarenakeduabelahpihakbelumberdamai. Korban dan tersangka belum ada kata damai hingga sekarang.Tersangkatidakbisaditangguhkansebelum adasuratperdamaiandarikeduabelahpihak,”jelasnya. Disebutkannya, pada Selasa (4/9) lalu, keluarga korbanmendatangiPolresSiantardandipertemukan dengantersangka.Namunhasilpertemuanitu,tidak ada kesepakatan sama sekali antara keluarga korban dengan tersangka. Sehingga penahanan tersangka tetapdilanjutkan. Sebelumnya,kasusiniterjadipada Kamis2Agustus, sekira pukul 19.37 WIB. Saat itu, tersangka pulang mabuk ke rumahnya di Jalan Pendeta JW Saragih, KomplekPerumahanBersatuMaju,SiantarMartoba. Setibanyatersangkadirumah,istrinyamenanyakan kepada tersangka tentang masalah wanita selingkuhannya selama ini yang berada di Tebing Tinggi. Sebab korban pernah melihat suaminya berduaandenganwanitatersebutdisalahsatutempat diKotaSiantar. Menanggapi itu, tersangka langsung memukuli korban sehinga tangan kanan korban lembam dan mukanya bengkak. Atas perlakuan suaminya ini korbantetapsabardantetapberadadirumahhingga pagiharinya. Selanjutnya,Jumat3Agustusataukeesokanharinya, korban dengan menggendong anaknya yang masih kecildatangmelaporkePolresSiantar.Selanjutnya,10 Agustus, korban berhasil ditangkap di rumahnya di Perumahan Bersatu Maju dan langsung ditahan di PolresSiantar.(ral)

Anak Yatim.. Sambungan Halaman 8

Sekira pukul 21.00 WIB tadi malam, METRO menyambangi Kelurahan Banjar, Siantar Barat, tempat jenazah korban disemayamkan. Jenazah korban disemayamkan di salahsatu rumah warga di sanadisebabkanrumahkorbansendirimemangtidak adalagidiKelurahanBanjar.Begitujugakeluarganya, tak ada lagi di Kota Siantar. Hanya saja, abang kandungnyaIlhamPulungan(30),Minggu(2/9)sore tiba di Kota Siantar dan sempat menjaga adiknya tersebut. Tokoh masyarakat Kelurahan Banjar Ahmad AR menyebutkan,sejakMinggupagi,korbandipindahdari ruangCIIkeruangICURSUDjasamenSaragih.Korban sempatdirawatdisanahinggaRabupukul18.10WIB. Korbansilihbergantidikunjungiwargayangprihatin dengannasibkorban.“Korbantidakmemilikirumah lagi di Siantar ini, keluarganya memang dulu mengontrakdisini.Ayahdanibunyasudahmeninggal. Keluarganya cuma si Ilham itu. Jenazah korban disemayamkan di rumah warga, dan besok dimakamkandipekuburanumum,”ujarnya. Atas nama seluruh warga Kelurahan Banjar, dia meminta agar pelaku pengeroyokan menyerahkan diri. Kepada polisi untuk segera menangkap dan mencari pelaku pengeroyokan yang menyebabkan korban tewas. Tokoh masyarakat Kelurahan Banjar lainnya Alousius Sihite, meminta kepada aparat kepolisian untuk segera menangkap pelaku pengeroyokan terhadap korban. Sebab, perbuatan para pelaku ini telah menghilangkan nyawa orang lain dan tidak menghargai hukum yang ada di Kota Siantar. Kapolsek Siantar Barat AKP Indra Sakti belum memberikan keterangan yang jelas terkait identitas dari pelaku pengeroyokan ini. Saat dihubungi, suara Indra Sakti tidak jelas. Sementara dihubungi melalui pesan pendek, Indra Sakti tidak kunjung membalas pesan pendek yang dikirimkan. Pemberitaan sebelumnya, Aca, pemuda kurang warasdipukulisekawananOTKdidepanstasiunkereta apiKotaSiantarJalanKartini,Jumat(31/8)pukul04.00 WIB. Akibat kejadian ini warga Jalan Bola Kaki KelurahanBanjar,SiantarBaratinimengalamikomadan dirawatdiRSUDjasamenSaragih. (ral)

Sambungan Halaman Satu RAKYAT DAN PEMERINTAH HARUS KOMPAK TOLAK TPL Sambungan Halaman 1 sangat jauh peluangnya perusahaan yang bergerak dalam penanaman kayu eucalyptus ditutup. Masyarakat dan pemerintah harus kompak menolak keberadaan TPL di Kabupaten Simalungun. “Alasan masyarakat dan Pemkab Simalungun menolak TPL sudah jelas, karena tidak menguntungkan masyarakat dan pemerintah daerah. Masyarakat semakin miskin karena lahan pertaniannya diserobot paksa, dan pemkab merugi dalam hal kekayaan alamnya dirusak TPL,” tegas Johalim, Rabu (5/9). Menurutnya, dalam hal penolakan tersebut DPRD Simalungun sebagai lembaga perwakilan rakyat, pada prinsipnya pro rakyat. Sepanjang yang diperjuangkan masyarakat masih berjalan sesuai koridor

peraturan perundang-undangan, DPRD Simalungun tetap menjadi garda terdepan. “Kita DPRD Simalungun harus pro rakyat. Negara ini terbentuk atas nama rakyat, dan pemerintahnya dibentuk untuk kepentingan rakyat. Rakyat melarat adalah kegagalan pemerintah yang tidak mampu mensejahterahkan rakyatnya,” katanya. Lebih jauh, kata Johalim, pihaknya bukan tidak setuju investor datang ke Simalungun menanamkan modalnya. Tetapi ketika investor tersebut sudah membuat masyarakat melarat, tidak tertutup kemungkinan investornya harus dipaksa angkat kaki dari Kabupaten Simalungun. “Buat apa banyak investor datang ke Simalungun kalau masyarakatnya melarat. Harusnya semakin banyak investor datang datang ke Simalungun, masyarakatnya pun semakin

sejahtera. Masyarakat sekitar sudah bisa ditampung untuk kerja di perusahaan tersebut. Tetapi kenyataannya, kedatangan investor pemilik TPL ke Simalungun, malah membuat masyarakat petani melarat. Kalau begitu, sebaiknya TPL angkat kaki dari Kabupaten Simalungun,” tegasnya. Lebih jauh, Johalim mengutarakan rasa prihatinnya melihat nasip warga Nagori Pondok Bulu, Kecamatan Dolok Pangribuan yang rata-rata lahan pertaniannya diserobot paksa TPL. Mereka terpaksa hanya di rumah tanpa aktifitas. Sementara untuk ingin melamar kerja ke perusahaan, mereka sudah tidak diterima lagi karena usia sudah tergolong tua. Rata-rata warga yang menganggur itu berusia antara 35-60 tahun. J Nainggolan (60), salah seorang warga di sana mengatakan, sejak lahan pertaniannya diserobot paksa

TPL pada tahun 2005, dirinya terpaksa di rumah saja. Untuk kebutuhan sehari-harinya, dirinya ditanggung anaknya yang masih punya ladang di Pondok Bulu. “Lahan pertanian anak saya itu pun kemarin sempat mau diserobot TPL. Tetapi karena ada dilakukan perlawanan, hanya sebagian saja yang sempat ditanami eukaliptus,” ucapnya. Sementara itu, Direktur PT TPL Leo Hutabarat mengatakan, banyak masalah yang timbul oleh masyarakat itu sendiri. Di mana, lahan TPL banyak yang digarap masyarakat. Sementara lahan tersebut sudah diserahkan pemerintah untuk dikelola TPL. “Pada akhirnya, kita mengelola lahan kita, salah di mata masyarakat. Kita mau tau juga lahan mana yang katanya diserobot di Dolok Panribuan. Dalam waktu dekat kita akan turun ke lapangan,” katanya. (osi)

Tak Ada yang Kenal Bang Put Sambungan Halaman 1 narnya aku tidak kenal sama Bang Put itu, tapi dengar-dengar Bang Put itu warga Silau Malaha,” ujar Dedi. Jul, yang juga keluarga Dewi menambahkan, setelah kejadian tersebut, dia mencoba memeriksa isi kamar korban guna mencari tahu kecurigaan kematian korban. Di lemari perlengkapan kosmetik Dewi, Jul menenukan racun hama merk Matador. “Setelah kepergian korban, saya mencoba memeriksa isi kamarnya. Dari dalam lemari tempat kosmetiknya saya meneumukan racun hama Matador,” kata Jul. Sementara beberapa warga sekitar kediaman Dewi, mengaku bahwa Dewi memang orang yang cantik dan modis dalam bergaya. Warga pun yakin bahwa pasti banyak lelaki yang suka kepada Dewi, walau masih duduk di bangku SMP. “Saya yakin dia disukai banyak lelaki dan

sudah punya pacar. Jadi ketika mendapat kabar Dewi meninggal dunia akibat bunuh diri, anggapan saya dia bunuh diri karena ditinggal pacarnya,” kata warga sekampung korban yang tidak mau menyebutkan namanya. Terpisah, saat awak METRO mencoba mencari tahu keberadaan Bang Put di Silau Malaha, beberapa warga sekitar mengaku tidak mengenal orang yang bernama Put, karena nama itu bukan nama asli atau hanya nama singkatan. Ditanya apakah ada lelaki yang sering disapa Put, mereka juga mengatakan tidak ada. Sementara, informasi diperoleh METRO dari RS Harapan, salah seorang pegawai mengaku sempat mendengar dari perbincangan keluarga bahwa pacar korban berada di Brastagi. “Kabar itu saya dapat saat korban masih mendapat penanganan dokter,” ujar salah seorang perawat. (mag-4)

Kelamaan Menunggu Dokter Bayi Pasien Jampersal Tewas Sambungan Halaman 1 menggunakan Jampersal. Sekira pukul 20.30 WIB, mereka tiba di sana, nanun tak seorang pun dokter yang menangani persalinannya yang saat itu sudah berada di ruangan operasi. Mengetahui hal tersebut, Hendrik bersama keluraga yang mendapinginnya mencoba menanyakan perawat di sana soal kedatangan dokter. Jawaban yang mereka terima, katanya akan datang sebentar lagi. Karena dibilang sebentar lagi,

Hendrik bersama keluarga lainnya mencoba menunggu dokter. Sudah satu jam, mulai pukul 09.00 WIB sampai 10.00 WIB, dokter tak juga kunjung datang, sementara Ellen yang hendak melahirkan sudah meraung kesakitan. Tak tahan melihat kondisi Ellen, Hendrik meminta agar Ellen dibawa ke rumah sakit lain, tapi pihak rumah sakit tidak menyetujuinya dengan alasan sebentar lagi dokter akan datang. Lama menunggu, dokter baru tiba sekira pukul 10.30 WIB dan langsung membawa Ellen ke ruang

persalinan. Tak lama, sekira pukul 11.00 WIB, Hendrik mendapat informasi kalau bayi yang dikandung istrinya sudah meninggal dunia, sejak masih dalam kadungan. Hendrik yang sudah dua jam panik melihat kondisi istrinya, seakan tak terima mendapat informasi tersebut. Dia sangat kesal atas pelayanan pihak rumah sakit, di mana dokter baru datang setelah istrinya meraung kesakitan sudah hampir berjam-jam. “Aku sadar kalau aku orang miskin, makannya istriku kubawa kemari (RSU Djasamen Saragih) dengan

membawa kartu Jampersal. Tapi pelayanan yang kuterima sangat jauh berbeda dengan apa yang kuharapkan. Istriku telantar dua jam di ruang persalinan, hanya karena menunggu dokter datang,” kesal Hendrik. Yang lebih kesalnya lagi, setelah mendapat informasi putriku meninggal, dokter yang menangani langsung meniggalkan ruang persalinan seakan tidak mempedulikan pasiennya. “Selesai operasi, dokternya langsung pergi. Dan yang mengurus

istriku ke ruang rawat adalah perawatparawat di sana,” katanya. Sementara Humas RS Djasamen Saragih dr Andi Rangkuti, saat dikonfirmasi melalui ponselnya mengatakan, soal kematian bayi saat melahirkan adalah hal biasa. Kejadian itu tidak dapat dipublikasikan kepada pihak pers karena melanggar kode etik rumah sakit. “Kamatian bayi sesaat setelah dilahirkan adalah hal biasa. Namun hal itu tidak diperkenankan untuk diberi tahu kepada pers karena melanggar kode etik rumah sakit,” ujar Andi.

Ketika ditanya soal keterlambatan dokter menangani pasien, dr Andin menjawab, dokter tidak hanya menangani satu rumah sakit saja melainkan beberapa rumah sakit. “Siapa yang lebih dulu menghubunginya, maka pasien tersebut yang ditangani. Seperti salah satu contoh, dokter sudah lebih dulu mendapat informasi di rumah sakit swasta akan menangani pasien itu lebih dulu, walau tak lama kemudian dia mendapat informasi harus operasi di RSU Djasamen Saragih,” ujarnya. (mag-4)



Niat Melerai

Nyawa Suhardi Melayang SIMALUNGUN– Niat Suhardi alias Adik untuk melerai Supriatin dengan Christian Siregar alias Cipet (30) yang cekcok di warung tuak milik Litawati di Kampung Bandar Syahkuda, Kelurahan Kerasaan I, Kecamatan Pematang Bandar berujung maut. Suhardi akhirnya tewas dibacok oleh terdakwa di bagian perutnya lantaran terdakwa tidak senang karena dilerai.


DISEMAYAMKAN- Jenazah Basrian Syahputra Pulungan alias Aca saat disemayamkan di rumah salahsatu warga di Kelurahan Banjar, Siantar Barat, Rabu (5/9).


ANAK YATIMPIATU TEWAS SIANTAR- Basrian Syahputra Pulungan alias Aca (28) akhirnya tewas di RSU Djasamen Saragih, Rabu (5/9) pukul 18.10 WIB. Pemuda kurang waras yang dipukuli segerombol pemuda, Jumat (31/8) lalu di depan stasiun kereta api ini tewas setelah sempat dirawat enam hari di rumah sakit.

„) Baca Anak Yatim-Piatu ..Hal 7

Hal itu terungkap di persidangan

„) Baca Nyawa ..Hal 7

DIAMANKAN- Bus Wisata Indah trayek SIANTAR - PARAPAT diamankan di Mapolsek Tiga Balata setelah bertabrakan, Rabu (5/9).


BATU GAJAH– Bus wisata Indah BK 1517 LI bertabrakan dengan Kijang Innova BM 1251 ZM, di jalan umum Siantar-Parapat Km 21–22

Nagori Parmonangan, Kecamatan Dolok

„) Baca Linda ..Hal 7

SIANTAR- Unit PPA Polres Siantar menolak menangguhkan penahanan tersangka Sariaman Saragih (32), terkait kasus Kekerasan Dalam Rumah Tangga (KDRT) terhadap istrinya Ramiatik br Sembiring (28). Kesepakatan damai juga belum ada antara kedua belah pihak. Tapi Sariaman meminta

penangguhan sejak Selasa (4/9). Kanit PPA Aiptu Malon Siagian, Rabu (5/9) menyebutkan, Sariaman Saragih, tersangka kasus KDRT meminta penangguhan penahanan atas penahanannya saat ini di Polres Siantar. Namun pihak

„) Baca Penganiaya ..Hal 7

Musa Tewas Paman Cabul Dihukum Delapan Tahun Penjara Tergantung di Pohon Rambutan

Foto Gibson

„ Adi Aryanto, terdakwa kasus pembunuhan saat mendengarkan putusan hakim di PN Medan.


Divonis Penjara Seumur Hidup „) Baca Divonis ..Hal 7

Penganiaya Istri ‘Merengek‘ Mohon Penangguhan


Kosti dan Relme Patah Kaki Delapan Orang Luka Ringan

MEDAN- Majelis hakim akhirnya menjatuhkan vonis penjara seumur hidup kepada terdakwa Adi Aryanto (35), yang membunuh dan memerkosa kakak iparnya sendiri

„ Christian Siregar

Foto Reza

„ Musa tewas tergantung di pohon rambutan, Rabu (5/9).

SIMALUNGUN– Paman cabul Adi Sofian Sinaga (33), warga Huta Labuhan Nagori Tigaras, Kecamatan Dolok Pardamean, dihukum delapan tahun penjara di PN Simalungun, Rabu (5/9). Itu setelah terdakwa terbukti bersalah dan meyakinkan mencabuli keponakannya yang masih berusia lima tahun sebut saja Mawar. Putusan terhadap terdakwa dibacakan majelis hakim dipimpin Ramses Pasaribu beranggotakan Gabe Doris dan Siti Hajar. “Berdasarkan

MEDAN- Musa Daulay ditemukan penjual es cream dengan kondisi tergantung, leher terjerat akar-akaran di pohon rambutan. Saat ditemukan, pria berusia 26 tahun itu ditemukan telah tewas di pohon setinggi sekitar 5 meter di Jalan Sei Deli,

„) Baca Musa Tewas ..Hal 7

„ Adi Sofian Sinaga

„) Baca Paman ..Hal 7

Kakek Cabuli Bocah SD Dihukum 11 Tahun Penjara SIMALUNGUN - Siblon Sirait (54) warga Afdeling II Tinjoan Nagori Huta Parik, Kecamatan Ujung Padang tertunduk lesu setelah dihukum 11 tahun penjara dan denda Rp100 juta di PN Simalungun, Rabu (5/9). Pria yang biasa dipanggil Oppung Rait itu terbukti bersalah mencabuli Bunga (9) yang masih duduk di bangku kelas V SD. Hal itu disampaikan majelis hakim yang dipimpin Ramses Pasaribu

„) Baca Kakek ..Hal 7

„ Siblon Sirait


6 September 2012

Kadis Pariwisata Diganti Tak Fasih Bahasa Inggris SIMALUNGUN- Pergantian pejabat eselon II Pemkab Simalungun kembali berlangsung, Selasa (4/9) yang dilantik oleh Sekda Gideon Purba. Jarinsen Saragih yang sebelumnya menjabat Kepala Dinas Pariwisata diganti karena tidak fasih berbahasa Inggris. Dia digantikan oleh Rizal Edi Praja Saragih, yang sebelumnya menjabat sebagai staf ahli. Informasi dihimpun METRO, pergantian ini didasari oleh adanya rencana kedatangan Walikota Madaba, Yordania ke Simalungun. Agar komunikasi berjalan lancar, dikabarkan Bupati JR

SIANTAR- Warga Jalan Sriwijaya Gang Hasanah Kelurahan Melayu, Siantar Utara, protes terhadap pengerjaan PNPM. Menurut mereka, proyek itu tak tepat sasaran. Sebab pengerjaan ditujukan untuk membongkar jalan yang notebenenya masih bagus.


BANJIR- Warga Jalan Kenanga Kelurahan Simarito, memandangi kediamannya yang digenangi banjir beberapa waktu lalu.

Kejadian bermula saat dua tukang datang ke Gang Hasanah dan membongkar jalan di gang tersebut. Masih sedikit yang

Tembok Tidak Diperbaiki

Warga Kenanga Kebanjiran

Baca Jalan ... Hal 10

SIANTAR– Hujan deras yang mengguyur Kota Siantar, Rabu sore (5/9) kembali membuat sungai di Jalan Kenanga, Kecamatan Siantar Barat meluap lagi. Akibatnya puluhan rumah kembali terendam karena debit sungai naik hingga 4 meter. Hujan deras sekitar 3 jam tersebut, memaksa warga harus mengeluarkan

Baca Kadis ... Hal 10

barang-barangnya dari rumah. Hujan yang turun mulai pukul 15.30 hingga pukul 18.00 WIB menjadikan debit sungai di Kelurahan Simarito naik hingga 3 meter. Akibatnya rumah warga di sekitar sungai tersebut pun dimasuki air hingga setinggi 30 cm.

Baca Warga ... Hal 10

Puluhan Hektar Sawah Kering

Pemkab Didesak Perbaiki Irigasi


Salah satu spanduk Balon Gubsu di Jalan Medan, Siantar Martoba.

SIDAMANIK- Warga Huta Silau Manik Nagori Tiga Bolon, Kecamatan Sidamanik, Simalungun, meminta Pemkab Simalungun yang dalam hal ini Dinas Pengairan, segera melakukan perbaikan saluran irigasi yang tertimbun longsor. Sebab akibat lambannya

Baliho & Spanduk Balon Gubsu Marak

Wajah Kota Siantar Semrawut SIANTAR- Meski pemilihan Gubernur Sumatera Utara (Gubsu) masih terbilang lama, namun Kota Pematangsiantar sudah dipenuhi spanduk dan baliho yang menampilkan orang-orang yang diperkirakan menjadi Balon (bakal calon) Gubsu. Itu bisa dilihat di beberapa titik dan ruas jalan dalam kota. Pada beberapa baliho, terlihat iklan ucapan hari besar keagamaan dan imbauan-imbauan dari Balon. Namun tak jarang beberapa oknum menyatakan secara terang-terangan dirinya Balon Gubsu.

Baca Wajah ... Hal 10

penanganan dari pemerintah, 70 hektare sawah mereka kekeringan. Menurut warga L Manik (41) dan M Simarmata (43), yang ditemui METRO di kampungnya, se-

Baca Pemkab ... Hal 10



PROTES- Warga Jalan Sriwijaya Kelurahan Melayu memerotes pembuatan paving blok di Gang Hasanah, Rabu (5/9). Pasalnya, proyek PNPM itu dinilai tak tepat sasaran.

Proyek Jalan Pakai BBM Subsidi

Pemerintah Diminta Turun ke Lokasi SIMALUNGUN- Adanya dugaan pemakaian BBM (Bahan Bakar Minyak) subsidi untuk pengerjaan proyek peningkatan Jalan Pangalbuan, Solok Silau, masyarakat meminta pemerintahan Kabupaten Simalungun turun ke lokasi.

Baca Pemerintah ... Hal 10

SEPI- Salah satu kantor di Komplek SKPD Pemkab Simalungun yang terlihat sepi. Sebab hampir semua pejabat dan PNS ikuti halal bihalal bersama di Bandar Masilam.

Bupati Halal Bihalal Kantor SKPD Sepi RAYA- Kantor SKPD di Pematang Raya tampak sepi seolah tak berpenghuni. Itu setelah seluruh pejabat dan PNS Pemkab Simalungun mengikuti halal bihal di Bandar Tinggi, Kecamatan Bandar Masilam. Amatan METRO Rabu (5/9) tampak komplek perkantoran SKPD kosong melompong. Di Setiap SKPD hanya

tampak beberapa staf saja. “Semuanya berangkat ke Bandar Masilam untuk halal bihalal bang. Kami enggak berangkat karena piket sampe sore,” katanya. Keadaan terparah berada di kantor Badan Lingkungan Hidup (BLH) dan

Baca Bupati ... Hal 10

*simPATI “The Best Prepaid Brand”

Paket Internet Terbaik dengan Koneksi Tercepat SIANTAR- Guna memenuhi kebutuhan pelanggan terhadap akses internet berkualitas, Telkomsel menghadirkan paket data simPATI dengan kuota 2 GB yang memiliki koneksi tercepat hingga 7.2 Mbps. Paket terbaru simPATI ini dapat diperoleh seharga Rp60.000 dengan masa berlaku 45 hari. Untuk mendukung promo tersebut, Telkomsel menggelar kompetisi Dance Like Agnes yang bisa diikuti oleh para talenta berbakat Indonesia.

Baca Paket ... Hal 10 Manejer graPARI Telkomsel Siantar, Eko Admaja foto bersama dengan para mitra telkomsel saat launching paket data simPATI dengan kuota 2 GB yang memiliki koneksi tercepat hingga 7.2 Mbps.


6 September 2012

Pemkab Didesak ... Sambungan Halaman 9 jak longsor pada dua pekan lalu hingga saat ini, pihak Dinas Pengairan belum juga mengambil peranan guna memperbaiki saluran irigasi itu. ”Sudah berulangkali kami melaporkan kondisi saluran irigasi ini. Tapi belum juga ada tanggapan sampai sekarang,” kata Manik yang diamini M Simarmata. Akibatnya, banyak petani di desa mereka yang terpaksa mengurungkan niatnya menanam padi setelah panen bulan lalu. ”Padahal ini sudah saatnya musim tanam, tetapi karena tidak ada air rekan-rekan kami tidak ada yang berani menanam padi,” tambahnya. Dilanjutkannya, kejadian longsor yang melanda saluran irigasi Silau Manik ini merupakan kali kedua setelah awal tahun 2012 silam. Namun longsor kali ini merupakan yang terbesar, hingga warga perlu bantuan alat berat. ”Kami sudah berusaha bergotong royong, tapi tak bisa. Harus pakai alat berat, biar longsoran dan bongkahan bisa terangkat,” tukasnya. Terpisah, Ketua Lembaga Pecinta Tani (LPT) Simalungun Hasnul Siregar (35) mengatakan, kinerja Dinas Pengairan Pemkab Simalungun lamban. Bahkan kondisi ini beresiko akan merusak tanaman padi di kawasan Simalungun. Ditambahkannya, selain untuk lahan pertanian, air dari saluran irigasi juga dipakai untuk mandi, mencuci dan kakus. ”Harusnya pemerintah memikirkan kondisi ini. Soalnya saluran irigasi ini multifungsi. Makanya kami mendesak agar dinas terkait segera memperbaiki irigasi ini,” katanya. (mag-02/hez)

Wajah Kota... Sambungan Halaman 9 Menurut warga, hal itu merupakan strategi politik untuk mengenalkan diri kepada masyarakat sebelum kampanye berlangsung. Pantauan METRO pada beberapa spanduk dan baliho, beberapa nama yang tampil itu adalah, RE Nainggolan, Gus Irawan, Mayjen Purn Cornel Simbolon, Chairuman Harahap. Di antara mereka, ada juga yang menyatakan langsung seruan politiknya pada spanduk dan baliho. Menurut aktivis Edi Sihombing menyebutkan, spanduk dan baliho itu harus segera diinventarisir petugas satpol PP. Temasuk melakukan pengawasan terhadap ijinnya dan pajaknya. Ia menyebutkan, penempatan spanduk dan baliho tetap memiliki aturan dan tidak asal letak. “Pemerintah harus tetap memelihara keindahan kota dengan tidak membiarkan orang-orang berkampanye terselubung dengan mengotori wajah Kota Siantar,” terangnya. Dikatakannya, warga Siantar sudah jenuh dengan pencitraan serta seruan politik yang mengatasnamakan kesejahteraan rakyat. Itu dikarenakan, para pemimpin yang saat ini menjabat, sebelumnya juga menebarkan janji-janji kepada masyarakat, namun tak satupun terpenuhi. “Balon saja belum ditetapkan. Namun lewat spanduk ini, mereka berusaha berkampanye dengan seruan-seruan politik,” ujarnya. Akibat penempatan baliho yang tidak memiliki aturan ini, banyak pengguna jalan tertanggu. Bahkan baliho juga dipasang pada fasilitas umum. Sementara menurut sorang mahasiswa di Kota Siantar Dorman Purba, pemerintah harus mengambil tindakan terhadap maraknya baliho dan spanduk ini. “Kenapa pemerintah tidak menertibkan saja balihonya? Kurasa warga Siantar tidak akan terpengaruh soal pencitraan diri. Masyarakat sudah bosan dengan kata-kata!” ujar Dorman. Ditambahkannya, para Balon Gubsu nantinya, harus turun langsung ke lapangan dan bertemu dengan rakyat. Sebab dengan banyaknya baliho yang menyebar, membuat wajah Kota Siantar semrawut dan bisa mengganggu kenyamanan masyarakat. Menyikapi hal itu, Kakan Satpol PP Julham Sitomorang yang dikonfirmasi lewat pesan singkat (SMS) mengatakan pihaknya akan segera bertindak. (pra/hez)

Jalan Masih Bagus Dibongkar Sambungan Halaman 9 berhasil dibongkar, warga langsung datang dan meminta supaya tukang memberhentikan aktifitasnya. Menurut warga, jalan mereka masih bagus dan belum ada yang rusak. Jika dibongkar dengan alasan untuk dibangun kembali, itu sangatlah tidak tepat. Bahkan mereka meng-

anggap pengerjaan PNPM tersebut tidak tepat sasaran. Sebab masih banyak infrasturktur yang harus diperbaiki. Akibat warga protes, kedua pekerja tersebut pergi dan meninggalkan pekerjaan mereka. Menurut Lisna br Pasaribu yang ditemui di lokasi menyebutkan, pembongkaran jalan di gang itu ditolak dan tidak disetujui oleh sejumlah warga. “Ini masih bagus, lalu kenapa dibongkar.

Sementara parit yang sudah tersumbat tidak diperbaiki. Makanya kami protes,” sebut Lina. Sementara Riduan selaku pelaksana pembangunan pengerjaan tersebut mengatakan, dana pembangunan itu bersumber dari PNPM sebanyak Rp10 Juta. Dana itu diperuntukkan membongkar jalan sepanjang 82 meter dengan lebar 1,2 meter. Ia mengatakan, bahan yang akan dibuat

Bupati Halal Bihalal, Kantor SKPD Sepi Sambungan Halaman 9 PU Bina Marga. Di kantor BLH, hampir semua pegawai tak terlihat di kantor tersebut. Sementara di Dinas PU Bina Marga, terlihat dua staf yang berada di kantor. Menurut salah seorang penarik ojek yang biasa menjual jasa mengantar pegawai dari Simpang Perkantoran SKPD, J Purba, seperti biasa ia selalu mendapat banyak pegawai yang minta diantar ke dinas-dinas. “Mulai pagi sampe jam 12, belum ada penumpang yang kuantar. Katanya banyak pegawai yang tidak hadir, berhubung ada kegiatan di Bandar Masilam. Aku juga

enggak tahu mereka mau ngapain ke sana,” katanya. Sementara seorang pejabat eselon II yang dihubungi melalui telepon selulernya mengaku ia sedang mengikuti halal bihalal di Bandar Tinggi, Kecamatan Bandar Masilam. “Usai lebaran, kegiatan halal bihalal ini dilakukan untuk menjalin silaturrahmi,” katanya. Ketika ditanya mengenai minimnya staf yang berada di setiap kantor SKPD, ia menolak untuk berkomentar. “Jangan tanya saya, bukan kapasitas saya yang menjawabnya. Kami berangkat ke Bandar Masilam karena ada undangan

untuk mendampingi bupati,” ujarnya dari seberang. Sementara itu Pengamat Pemerintahan Frenki D Sinaga kepada METRO mengatakan, mengikuti acara halal bihalal merupakan hal yang wajar. Hanya saja kata Frenki, setiap pegawai jangan mengabaikan tugas untuk memberikan pelayanan kepada masyarakat. “Kantor dinas-dinas itukan kantor pelayanan masyarakat. Jadi jangan karena alasan halal bihalal, jadi ditinggalkan begitu saja. Hal ini bisa berdampak menurunnya kepercayaan masyarakat kepada pemerintah,” kata Frenki. (hot/hez)

Kadis Pariwisata Diganti Sambungan Halaman 9 Saragih pun membulatkan tekad menempatkan Kepala Dinas Pariwisata yang benar-benar fasih berbahasa Inggris, dan akhirnya dia memilih Rizal Edi Praja Saragih. Sebelumnya, pada Sabtu (1/9) Bupati JR Saragih juga telah mengungkapkan bahwa dia berniat melakukan pergantian Kadis Pariwisata sebagai persiapan untuk kedatangan tamu dari Yordania. Jarinsen Saragih kini mengisi jabatan baru sebagai Kadis Perdagangan dan Perindustrian (Kadisperindag). Sementara, Jansardion Purba yang sebelumnya menjabat Kadisperindag kini ditempatkan sebagai staf ahli menggantikan Rizal Edi Praja Saragih. Terpisah, beberapa PNS yang menyaksikan pelantikan itu menyebutkan, Jansardion menangis saat jabatannya sebagai Kadisperindag dicabut dan dia dipindahkan menjadi staf ahli. Sementara Kabag Humas Pemkab Simalungun Andreas Simamora membenarkan bahwa salah satu alasan Jarinsen Saragih dipindahkan dari jabatan Kepala Dinas

Pariwisata karena tidak fasih berbahasa Inggris. “Ya, itu salah satu alasannya, dan masih banyak faktor-faktor lain. Orang yang tepat memang harus ditempatkan pada posisi yang tepat. The right man on the right place,” ujar Andreas. PNS Eselon III dan IV Dimutasi Sementara 49 PNS lain yang bertugas di berbagai Dinas di Pemkab Simalungun, dimutasi menjadi staf di beberapa kantor camat. Beberapa dari mereka adalah pejabat eselon IV dan III. Menurut seorang PNS yang dimutasi dan tak mau menyebut namanya kepada METRO, Rabu (5/9), mengatakan, alasan pencopotan jabatan dan mutasi yang dilakukan BKD adalah karena 49 PNS itu tidak lulus saat ujian pengadaan barang dan jasa yang digelar Pemkab Simalungun. Ujian itu dilaksanakan pada tanggal 11 hingga 14 Juli 2012, dengan 93 peserta dari seluruh kantor SKPD. Setelah diumumkan pada 3 September lalu, hanya 44 orang yangdinyatakan lulus. Sebagai konsekwensinya, 49 PNS itu dimutasi menjadi staf di berbagai kantor

camat se Kabupaten Simalungun. “Beberapa orang di antara kami itu, sebelumnya menjabat kasubbid, kepala seksi, bahkan ada juga pejabat eselon III seperti kepala bidang. Sekarang mereka hanya menjadi staf biasa di kantor camat. Ya, apa boleh buat, pasrah sajalah!” katanya. Menurutnya, sejak dimutasikan ke kantor camat berdasarkan Surat Keputusan Bupati JR Saragih tertanggal 3 September, ia langsung melapor ke kantor camat yang ditetapkan sebagai tempatnya menjadi staf. “Ada Beberapa teman yang kasihan. Sebab mereka ditempatkan di kantor camat yang jauh dari rumahnya,” katanya. Sementara Kepala Bidang Pengembangan BKD Raya Ginting yang dikonfirmasi, membenarkan pemutasian 49 PNS yang tidak lulus saat ujian pengadaan barang dan jasa. Namun saat ditanya lebih detail tentang proses mutasi, Raya enggan berkomentar. “Saya sedang di Bandar Tinggi, ada halal bihalal bersama bupati. Untuk lebih jelasnya, tanyakan langsung ke humas saja ya,” ujarnya sambil menutup telepon selulernya. (ara/hot/hez)

jalan jenis paving blok atau tidak dicor lagi. Sebab juklak-nya diperuntukkan untuk pembangunan jalan dan konsepnya adalah pengerjaan jalan di Gang Hasanah. Sementara Lurah Melayu Makdin Sagala mengatakan, pihaknya tidak bisa mengintervensi soal letak pengerjaan PNPM. Menurutnya pihaknya hanya sebatas mengetahui saja. (pra/hez)

Warga Kenanga... Sambungan Halaman 9 Sebelumnya,sungaitersebutjugapernahmeluap pada Minggu (28/8) lalu. Banjir kala itu mengakibatkan tembok di pinggir sungai roboh. Bahkan puluhan rumah terendam dan sedikitnya 5 unit rumah hancur disapu air. Banjir itu mengakibatkan warga sekitar menjadi trauma bahkan saat tujun hujan mereka menjadi was-was. Rabu kemarin, mereka terpaksa harus mengangkati barang-barangnya, sebab sungai tersebut sudah meluap hingga masuk ke rumah warga. Di sekitar lokasi, para warga pun terlihat hanya bisa menyasikkan debit air yang semakin lama semakin tinggi. Sementara itu tembok yang sebelumnya tumbang akibat banjir pertama hingga saat ini belum diperbaiki. Alhasil setiap hujan deras, maka sungai tersebut pasti meluap. Bahkan solusi dari pemerintah mengatasi agar sungai tersebut tidak meluap lagi saat hujan, hingga saat ini belum ada. Sukartini warga setempat berharap supaya pemerintah secepatnya membangun kembali tembok yang sudah runtuh. (pra)

Pemerintah Diminta... Sambungan Halaman 9 Sebab pemakaian BBM subsidi untuk pengerjaan proyek merupakan tindakan yang merugikan Negara. Tak tanggung-tanggung, jumlahnya diperkirakan ratusan juta rupiah. Parahnya lagi, kegiatan yang diduga dilakukan karyawan rekanan berinisial JS itu telah melukai hati masyarakat Simalungun. Karena solar bersubsidi yang dipergunakan itu adalah hak warga Simalungun yang direnggut rekanan. Seperti yang diketahui, untuk pengerjaan proyek selama satu minggu, dibutuhkan sedikitnya 20.000 liter solar yang digunakan untuk alat berat. Dari jumlah itu, hanya 6000 liter solar industri yang dipasok dari Medan. Sisanya, diduga solar subsidi yang di pasok oleh aparat. Assisten II Zannas Malau yang dikonfirmasi mengatakan, Bupati JR Saragih akan segera turun ke lokasi untuk memantau pengerjaan proyek tersebut. “Minggu depan, rencananya bupati akan turun ke lokasi,” ujarnya. (SP/hez)

Paket Internet Terbaik dengan Koneksi Tercepat Sambungan Halaman 9 Launching produk ini juga dilaksanakan di Kota Siantar, Rabu (5/9) kemarin di Rumah Makan Garuda yang dipimpin manejer graPARI Siantar Eko Admaja didampingi Manejer Sales Yogi dan karyawan lainnya. Acara tersebut dihadiri Mitra dan para Outlet. Pelanggan juga bisa menikmati paket internetan sebesar 500 MB hanya dengan Rp 20.000 untuk 30 hari. Dengan kedua pilihan paket tersebut, kini pelanggan simPATI dapat melakukan asyiknya chatting, browsing, social networking, email, upload, dan download di ponsel cukup dengan mengakses *999#. Kartu perdana simPATI terbaru hadir dengan harga yang lebih terjangkau, yakni Rp 3.000 sudah termasuk kuota akses 3G sebesar 100 MB selama 30 hari sejak diaktifkan. Sebagai bagian yang tidak terpisahkan dalam kehidupan sehari-hari, simPATI

berkomitmen untuk selalu menghadirkan keceriaan guna mendukung kebutuhan komunikasi dan akses internet para penggunanya. Bentuk keceriaan tersebut diwujudkan melalui penggelaran kompetisi Dance Like Agnes yang merupakan kompetisi dance untuk mencari 20 pemenang di tingkat nasional. Mereka yang terpilih akan ikut menjadi dancer pada konser Agnes Monica di bulan Desember 2012 mendatang. Untuk mengikuti kompetisi ini, peserta cukup mengakses Pada proses berikutnya, mereka diminta untuk mengunggah (upload) hasil karya video dance mereka sendiri. Video dance yang mereka kirim merupakan video yang dikreasikan dengan beberapa gerakan Agnes Monica yang muncul pada iklan simPATI di televisi. Peserta dapat mulai mengirim video dance pada 5 September 2012. Dari seluruh video yang masuk, Agnes Monica akan memilih 200 video terbaik yang akan dipilih oleh publik melalui microsite Head of Marketing Communications Group Telkomsel Irlamsyah Syam mengatakan, “Telkomsel menyadari bahwa jumlah pengguna mobile internet di Indonesia terus bertambah seiring dengan semakin tingginya kebutuhan masyarakat terhadap akses informasi maupun hiburan terkini. Kompetisi Dance Like Agnes merupakan salahsatu tools bagi kami untuk memberikan gambaran wujud keceriaan dan gaya hidup penuh mobilitas, yang diidentikkan dengan karakteristik pengguna simPATI.” Nantinya sebanyak 20 pemenang dengan vote/like terbanyak akan mengikuti proses pelatihan bersama Agnes Monica dan NEZindaHOOD di Jakarta. Selain itu, masing-masing pemenang juga akan mendapatkan berbagai hadiah berupa Samsung Galaxy S3, uang tunai Rp 10 juta, saldo TCash sebesar Rp 5 juta, pulsa simPATI senilai Rp 5 juta, dan paket internet 1 GB/ bulan selama 1 tahun.

“Beragam aktivitas yang saya jalani seharihari tentu harus diimbangi dengan akses komunikasi yang mampu memberi solusi maksimal. Kebutuhan akses internet untuk mengirim video, browsing, chatting, kirim email, dan download lagu melalui handset mutlak terpenuhi guna mendukung rutinitas pribadi. Oleh karenanya, kehadiran simPATI sangat memudahkan saya dalam berkomunikasi data karena produk ini memiliki kecepatan akses tinggi yang mencapai 7.2 Mbps,” ujar Agnes Monica selaku brandambassadorproduksimPATI. Aktivitas mobile lifestyle pelanggan simPATI semakin optimal berkat dukungan jaringan terluas berkualitas Telkomsel. Lebih dari 50.000 Base Transceiver Station (BTS) termasuk di antaranya 13.000 Node B (BTS 3G) telah tersebar di seluruh wilayah Indonesia. Telkomsel juga telah menyiapkan akses bandwidth internet berkapasitas 20 Gbps demi menjamin kelancaran akses komunikasi data. (leo)



6 September 2012

Daihatsu dan Toyota Hadirkan Mobil Murah JAKARTA–Kedua pabrikan besar Toyota dan Daihatsu akan kembali berkolaborasi menggarap mobil murah. Kali ini mobil dengan genre city car tersebut kemungkinan besar akan meluncur 19 September mendatang. DTA Collaboration ini pernah diungkapkan oleh Presiden Direktur PT Toyota Astra Motor (TAM) Johnny Darmawan dan

Head Domestic Marketing Division PT Astra Daihatsu Motor (ADM) Rio Sanggau. Keduanya membenarkan ka-

lau kolaborasi antara Toyota dan Daihatsu akan kembali terjadi seperti sebelumnya yang berkolaborasi memproduksi Toyota Rush dan Daihatsu Terios serta Toyota Avanza dan Daihatsu Xenia. Namun perpaduan ini akan menyasar ke segmen mobil murah. “19 September itu Daihatmemang ada acara, tapi sifat-

nya saat ini masih rahasia. Tunggu saja undangannya dan nanti pada waktunya akan kami beritahu,” elak Head Domestic Marketing Division PT Astra Daihatsu Motor (ADM) Rio Sanggau, Rabu (5/9). Sementara itu, dari kabar yang beredar, acara pada 19 September mendatang merupakan konferensi pers menge-

nai kolaborasi antara Daihatsu dan Toyota. Keduanya akan mempresentasikan mobil kolaborasinya yang akan menyasar ke kelas city car. “Acaranya hanya konferensi pers saja. Kemungkinan soal kolaborasi antara Daihatsu dan Toyota,” cetus sumber tersebut. (oz/nik)

„ Sony Tablet Xperia

Sony Jual Tablet Xperia SONY mengungkap tidak akan tertarik untuk ikut berkompetisi dalam hal harga tablet. Meskipun, saat ini berbagai model dari produsen lain dibanderol dengan harga murah. Sony sebentar lagi akan mulai menjual tablet Xperia besutannya di Amerika Serikat. Tepatnya, tablet tersebut akan mulai meluncur pada 7 September mendatang.Tablet ini akan dibanderol USD399 untuk versi 16GB, harga tersebut setara dengan yang ditawarkan Samsung untuk produk serupa dengan resolusi yang sama. Se-

PELUNCURAN: Pasbrikan besar Toyota dan Daihatsu kembali berkolaborasi menggarap mobil murah. Dalam waktu dekat dilakukan peluncuran

Kemendag Kembangkan Kerajinan Rotan dan Bambu JAKARTA-Kementerian Perdagangan saat ini gencar menggalakan kampanye promosi pengembangan rotan dan bambu Indonesia, menyusul kebijakan tentang penutupan ekspor bahan baku rotan. Direktur Jenderal Pengembangan Ekspor Nasional, Gusmardi Bustami mengatakan, dengan diselenggarakan kompetisi rotan dan bambu diharapkan akan semakin mendorong pertumbuhan industri rotan dan bambu agar lebih berdaya saing dan siap ekspor. “Dihasilkannya logo, tagline serta desin yang kreatif, diharapkan konsumen luar negeri akan semakin mengenal dan mengetahui tentang keunikan dan kekhasan produk rontan dan bambu Indonesia,” kata saat mengumumkan pemenang kompetisi logo dan tagline rotan dan bambu yang diikuti 152 peserta di Kementerian Perdagangan, Rabu (5/9). Pihaknya gencar melakukan kampanye, tentangIndonesia tidak hanya sebagai penghasil bahan baku rotan dan bambu saja. Tetapi juga penghasil produk jadi rotan dan bambu terbaik di dunia. (in/nik)

ROTAN: Perajin membuat kursi rotan untuk dipasarkan dalam negeri . Menyusul kebijakan penutupa ekspor.

DIBUTUHKAN Karyawan/ti untuk ditempatkan sebagai:

SALES SPD MOTOR Persyaratan: • Tamatan minimal SMA sederajat • Memiliki kendaraan sendiri • Memiliki SIM C • Rajin, gigih dan jujur Lamaran diantar ke:

YAMAHA HORAS MOTOR II Jl. Kartini No. 56 F PEMATANGSIANTAR Telp. 0622 - 22109

Persaingan Komputer Tablet Makin Sengit

JAKARTA-Persaingan yang ketat dalam bisnis komputer tablet akan dimulai tahun 2012 ini. Tablet bisa menjadi perangkat yang membawa perubahan besar dalam aktivitas menggunakan komputer. Tablet bukan lagi sebuah komputertipisdalamgenggaman,yang dinavigasi melalui sentuhan jari. Perusahaanteknologiramai-ramai memperluas definisi tablet. Ada perusahaan yang terobsesi memanfaatkan tablet sebagai buku digital. Ada pula yang memaksimalkannya untuk menunjang produktivitas. Tak heran jika di masa depan tablet akan disertai dock papan ketik (keyboard). Berikut adalah perusahaan-perusahaan teknologi yang terlibat “perang” besar bisnis tablet tahun ini. Steve Jobs pernah menolak ide pembuatan tablet berukuran 7 atau 8 inci. Namun persidangan Apple vs Samsung di Amerika Serikat, mengungkap fakta bahwa Jobs telah merestui tablet yang lebih kecil ukurannya. Di akhir tahun ini, kuat diduga Apple bakal meluncurkan tablet iPad Mini yang berukuran di bawah 8 inci. iPad Mini akan dijual dengan harga yang terjangkau, untuk menjangkau segmen konsumen menengah. Google selaku pemilik sistem operasi mobile Android, telah

KEYBOARD: Penutup sekaligus keyboard dan touchpad untuk tablet Surface besutan Microsoft membuat tablet berukuran 7 inci bernamaNexus7.SelainmodelWiFi, Google akan membuat Nexus 7 dalam versi 3G. Google ingin agar pengguna Nexus 7 memakai layanan webnya secara maksimal, seperti GMail, Google+, dan toko online multimedia Google Play, yang di dalamnya mencakup konten buku, video, musik dan aplikasi. Tak hanya Google, Microsoft pun membuat tablet sendiri bernama Surface. Ia berjalan dengan sistem operasi Windows 8 (untuk tablet berarsitektur prosesor Intel) dan Windows 8 RT (untuk tablet berarsitektur prosesor ARM). Untuk menunjang produktivitas kerja, Microsoft membekali Surface dengan dock papan ketik (keyboard). Para mitra Microsoft seperti Sony, HP, Dell, dan Samsung, juga membuat tablet Windows 8

yang dibekali dock keyboard. Dock keyboard seakan menjadi jawaban atas kegelisahan para profesional yang kurang nyaman dengan fungsi layar sentuh tablet selama ini. Tablet Kindle Fire besutanAmazonmemangtakmasuk pasar Indonesia. Tapi di Amerika Serikat, Kindle Fire meraih pangsa pasarcukupbesar,bahkanmampu bersaing dengan iPad. Amazon memfokuskan fungsi Kindle Fire sebagai buku digital. PerusahaanyangdidirikanolehJeff Bezos ini menyediakan banyak konten buku elektronik (e-book) di situs webnya, mereka seakan menyediakan perpusatakaan digital besar untuk pengguna. Selain itu, Amazon juga menyediakan konten musik, video dan game.Denganlayananlengkapini, bisnis online Amazon tetap terjaga. (kps/nik)

mentara itu, iPad 2 versi 16GB besutan Apple juga dikabarkan akan dibanderol dengan harga sama. ”Kami tidak mempertimbangkan untuk melakukan persaingan dari sisi harga,” ujar seorang vice president eksekutif Sony, Kunimasa Suzuki. Tablet terbaru dari Sony, seperti pada smartphone besutannya, akan diberi label Xperia sebagai bagian dari upaya untuk menyatukan perangkat genggamnya di bawah satu nama. Tablet ini akan masuk ke pasar tablet yang semakin ramai persaingan. (oz/nik)

Emas Antam Rp563 Ribu per Gram JAKARTA- Emas PT Aneka Tambang Tbk (Antam) pada, Rabu (5/9) stagnan, dengan harga logam mulia ukuran 1 gram berada di level Rp563.000. Berdasarkan daftar harga yang dilansir hari ini, semua stok emas batangan tersedia pada Unit Bisnis Pengolahan dan Pemurnian (UBPP) PT Antam. Menurut daftar harga yang dirilis pada pukul 08.20 WIB, harga emas ukuran 1 gram tidak berubah di level Rp563.000. Demikian pula harga beli kembali (buy back) emas yang stagnan di level Rp503.000 per gram. Harga emas batangan 2 gram tetap di level Rp1.086.000; Harga emas batangan 2,5 gram bertahan di level Rp1.347.500 dan harga emas batangan 3 gram tidak berubah di level

Rp1.609.000; Tidak berbeda dengan harga emas batangan 4 gram yang stabil di level Rp2.132.000; Kemudian harga emas batangan 5 gram yang tetap di level Rp2.665.500, emas batangan 10 gram yang tetap di Rp5.290.000 dan harga emas batangan 25 gram yang bertahan di level Rp13.150.000. Sementara harga emas batangan 50 gram juga stabildi level Rp26.235.000; Sedangkan emas batangan 100 gram stagnan di level Rp52.420.000 dan emas batangan 250 gram tetapdi level Rp130.950.000. Sedangkan harga emas internasional menurut pada pukul 08.25 WIB terpantau melemah US$1,50 (0,09%) ke level US$1.692,1 per ons. [oz/ nik]

STABIL: Emas Antam mengalami stabil.


KAMIS 6 September 2012




Jl. Jawa (Simpang Mayat) Pematangsiantar


HP 0852 7020 6105

Sebuah rumah permanen di Jalan Seram, Gg Pertama no 8 Kel. Bantan, P. Siantar, LT 8 x 19 M, LB 7 x 17 M. Fasilitas: Tanah Bersertifikat Hak Milik, Listrik & PDAM Tirtauli. Rp 200 Juta (Nego)

Harga Mulai

Rp 15 Jt

Peluang Usaha

Mengadakan Segala Jenis Sparepart Depot Air Minum Ayo Buruan......................

Berminat hubungi pemilik rumah

• Depot Air Minum • RO & Mineral • Air Minum Dalam Kemasan (AMDK)


HP 0821 7236 2869 M br GIRSANG

HP 08217236279

Tersedia LAPTOP ACER , DELL , HP , COMPAQ , TOSHIBA , AXIOO dll (Bergaransi Resmi Nasional)

CASH & KREDIT Tinta Printer Canon & Epson ( Beli 4 Gratis 1) Modem Gsm Flash, Xl,vodafone, Smartfren , Super Murah!! Printer Canon & Epson Tinta Infus Tabung Besar! Wowww!!!! Assesoris Komputer Dengan Harga Super Murah Kredit Komputer Dan Laptop (proses Cepat) Tanpa Dp !!!!!!!




Jl. Merdeka No.188 P. Siantar (Depan Showroom Honda)

A. Untuk Refleksi dan Massage B. Umur 30-45 tahun (pria/wanita) C. Berpenampilan rapi, menarik, sopan, jujur dan rajin D. Pengalaman tidak diutamakn E. Mengikuti peraturan dan perintah dengan baik Kirim surat lamaran, photocopy KTP, daftar riwayat hidup dan pasphoto anda ke: RAJA OUKOP, Jl. Merdeka No. 118 P. Siantar. Telp. 0823 6765 9999; 0622 - 432993 (Tidak Melayani SMS)

• HP Baru layar warna Rp 150 rb • HP China Rp 159 rb • BB 8520 Rp 1.499 rb h& Casedit r K


0852 7551 8062 Khusus Pematangsiantar sekitarnya

Nokia 1280 Rp. 195.000

Nokia X1-01 Rp. 380.000 + MMC 2 Gb

Nokia X2-02 Rp. 705.000 + MMC 2 Gb

Nokia C1-01 Rp. 485.000 + MMC 2 Gb

Nokia C2-03 Rp. 820.000 + MMC 2 Gb

Nokia X2-01 Rp. 685.000 + MMC 2 Gb

Nokia N100 Rp. 240.000

Nokia X2.00 Rp. 890.000 + MMC 2 Gb

Nokia N101 Rp. 325.000 + MMC 2 Gb

lus aP a u n Sem erda si P an Gar Coy al ion s a N



Ahlinya JUAL SEWA BELI Properti Lahan - Rumah - Ruko - Gudang

Alamat kantor

Jl. Melanthon Siregar No. 44 P. Siantar Telp. 0622 - 430946; HP 0821 6336 6709 Aman, Cepat & Terpercaya


Peter Refleksi

Dibutuhkan wanita tamatan SD, SMP, SMA sederajat, Akper untuk di didik dan di pekerjakan menjadi: • Baby Sister • KakakAsuh • Perawat Jompo

SinShe Aciu / Aling

Gaji Rp 700 rb s.d 1.300 rb / bulan bersih

Hubungi: YAYASAN MUTIARA HATI Jl. Binjai KM 10.8 Komp. Villa Mulia Mas Blok A 1/3 Medan Telp. 061 - 76220497; 0813 7707 4679


Obat kuat terbaru saat ini paten, membuat ereksi lebih lama, tanpa efek samping isi 10 tablet tanpa bekas


Terobosan terbaru obat VIMAX menambah ukuran alat vitl secara permanent sekaligus menambah kejantanan pria, isi 30 capsule

PUSAT PELANGSING HERBAL PELANGSING SUPER CEPAT Cukup 1 pak Fatloss langsung terbukti turun berat badan 8 - 12 Kg dalam jangka 1 Minggu, 100& alami dan tanpa efek samping, dijamin CREAM PYDR + VACUUM 100% original import 1 kali pakar langsung terbukti besar, kencang, padat dan mengembalikan payudara, baik gadis atau ibu-ibu dijamin PENINGGI BADAN SUPER




Spontan kuat keras dan tahan lama 3 X lebih kuat dari obat kuat lainnya, aman di konsumsi tanpa efek samping


Sekali semprot ampuh tambah gairah seks pria tanah lama, tanpa menimbulkan rasa kebas, panas, aman dan tanpa TERSEDIA: •Gemuk Badan •Obat Jerawat •Pemerah Bibir •Pembesar Pantat •Sedia aneka kondom antik r efek samping a Ant IS !Melayani pesanan luar kota dan kebutuhan sex P/W dewasa AT Via Transfer - Paket Kilat GR PIN BB 295597B6 Capsul USAtelah dan terbukti meninggikan badan dengan cepat, memperkuat daya ingat, 1-2 minggu bertambah tinggi 5 - 8 CM pasti (semua umur)

ASEN HP 0852 7558 7299 HERBAL

Jl. Tanah Jawa No. 83 (depan ruko baru, Simp Jl Cokro) ) P. Siantar Jl. Cokro No. 349 Simp. Malik Kisaran Jl. Sirandorung NO, 63 Simp. Jl. Pardamean Rantau Prapat

TERCECER / HILANG Telah tercecer surat tanah nomor 593/76/ An. Asik Atima Sinaga dengan luas tanah + 6.885 M, yang terletak di Huta III Silau Bayu, Kecamatan Gunung Maligas Kabupaten Simalungun. Hilang pada Selasa, 21 Desember 2010 di sekitar Dusun Gunung Maligas - Silau Bayu Kecamatan Gunung Maligas Kabupaten Simalungun. Bagi yeng menemukan hub: HP 0823 6451 8424. Tidak dituntut tapi diberikan imbalan yang sepantasnya. LOWONGAN KERJA 1. Driver 2. Resepsionis

3. Cleaning Servis 4. Security

Dengan syarat: • Pria (1, 4) / wanita (2, 3) • Penampilan menarik (1- 4) • Min. tamatan SMAsederajat (1-4) • Jujur, tekun dan bertanggung jawab (1-4) • Memiliki minimal SIMA(1) • Diutamakan lulusan SMK perhotelan (2, 3) • Mampu mengoperasikan komputer (2, 3) Lamaran langsung diantar ke:

Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0813 6017 0199; 0852 7695 4557

Melayani pengobatan Full Body Refleksi Khaki Terapi Lilin Kop / Bekam

Hotel Sing A Song

Buka : Jam 09.00 - 21.00 WIB NB:Lagi membutuhkan beberapa anggota di peter refleksi yang berpengalaman di Bidang Refleksi

Jl. Asahan No. 02 KM 2,5 PEMATANGSIANTAR

LOWONGAN KERJA Dibutuhkan karyawan / karyawati untuk ditempatkan di sebuah perusahaan Karaoke Keluarga sebagai: • Capten • Waiter • Kasir • Bar • Cooked • Security Persyaratan: a. Pria atau wanita b. Usia min 19 tahun c. Tamatan SLTAsederajat d. Penampilan menarik Lamaran diantar ke:

Jl. Merdeka No. 208 Pematangsiantar HP 0819 6727 28 Lamaran diantar dari pukul 14.00 s.d 18.00 WIB


6 September 2012


Raffi Ahmad

Tak Kapok Naik Moge

ARTIS serba bisa Raffi Ahmad ikut prihatin atas musibah yang menimpah beberapa temannya dalam menggendarai Motor gede, Raffi mengatakan bahwa kecelakaan bisa menimpa siapa aja, bahkan kepada pejalan kaki sekalipun, yang penting harus berhatihati saja. ”Saya turut prihatin dengan kejadian yang menimpa beberapa teman saya, salah satunya Rezky, buat saya yang paling penting sih dalam mengendarai Motor khususnya Motor Gede kita harus hati-hati dan harus saling menghormati sesama pengendara motor,” ungkap Raffi saat ditemui di Studio RCTI, Kebon Jeruk, Jakarta Barat, Rabu (5/8). Bagi Raffi hobby dirinya naik motor akan terus ditekuni, dirinya tidak terpengaruh dengan kejadian-kejadian yang menimpa beberapa teman-temannya. Bahkan dalam jangka waktu dekat ini dirinya bersama teman-temannya akan melakukan Touring Makassar-Toraja. ”Enggak lah enggak kapok, dan dalam waktu dekat ini saya juga mau Touring ke Makassar neh dan saya sih naik motor gede selalu mematuhi peraturan dan menggenakan safety raiders. Lagian saya naik motor gede lebih kepada menikmati pemandangan alam dan juga berbakti terhadap sesama,” tambahnya. Disinggung soal kekhawatiran Yuni Shara mengenai hobby Raffi dalam menggendarai Motor Gedenya, Raffi hanya bisa menjelaskan kepada sang kekasih bahwa naik motor gede ngak terlalu berbahaya. “Iya Yuni memang sering khawatir, tapi saya harus menjelaskan kepadanya bahwa saya naik motornya kan hati-hati,” pungkasnya. (abu/jpnn)

cha Septriasa adalah salah satu aktris yang selalu tampil total di film. Hal ini kembali Acha buktikan saat beradu akting dengan Reza Rahardian di film “Test Pack” produksi Starvision. Mungkin penikmat film Indonesia masih ingat dengan fill “Love Is Cinta” yang dibintangi Acha bersama Irwansyah. Saat itu keduanya tampil cukup romantis. Di masa itu Acha dan Irwansyah adalah sepasang kekasih, sementara di film ini Acha dan Reza bukanlah pasangan kekasih di dunia nyata. ”Sebagai pemain itulah tantangannya. Kalau pasangannya beda itu tantangan, karena harus bikin chemistry yang beda lagi,” kata Acha di Planet Hollywood Jakarta Selatan. Film “Test Pack” menceritakan perjalanan pasangan suami istri Rahmat (Reza Rahardian) dan Tata (Acha Setriasa). Konflik kemudian muncul karena

pasangan ini tak dikaruaniahi anak meski telah tujuh tahun menikah. Test Pack juga menyajikan adegan kemesraan antara Reza dan Acha yang berjuang untuk memperoleh anak. Acha mengungkapkan dirinya tak merasa

Entah karena apa, belakangan ini Nikita Mirzani jadi sering membicarakan dan menyebut-nyebut nama Aming. Setelah mengklaim pacaran dengan komedian itu, kini ia membuat pengakuan baru lagi. Kali ini, artis yang kerap tampil seksi itu seolah menyangkal pernyataannya sendiri sebelumnya. Kini ia mengaku hanya berteman, dan menginginkan pendamping seperti Aming. ”Sebenernya gini, Nikita itu temen deketnya dia (Aming). Kalau orang kan salah menginterpretasikannya,” tuturnya saat berbincang melalui ponselnya, Rabu (5/9). ”Kalau aku suka dia itu, pengen yang jadi pendampingku nanti seperti dia, kepribadiannya, sifatnya dan

canggung beradegan mesra dengan Reza. ”Saya langsung dapat gimana nyender sama dia, gimana pegang tangan dia, dia cium saya. Karena ceritanya hubungan suami istri,” ungkap Acha. Saat pertama kali menerima tawaran film ini, Acha tidak tahu akan bermain dengan Reza Rahardian. Selain Reza aktor lain seperti Winky Wiryawan dan Christian Sugiono sempat ditawarkan ”Akhirnya terpilih Reza Rahadian. Umur saya enggak jauh beda dan belum pernah punya istri, jadi saya lebih bebas berekspresi saya,” terangnya. (abu/ jpnn)

semuanya,” tambahnya. Nikita mengaku bingung kenapa gosip hubungannya dengan Aming menjadi ramai diberitakan. Menurutnya, pacar Aming yang sebenarnya sempat terganggu dengan kabar tersebut. ”Aming nggak marah sih, ketawa aja. Dia orangnya asik, tapi pacarnya ngambek,” paparnya. (dc/int)

AKTRIS yang juga model cantik Renata Kusmanto terus dikait-kaitkan punya hubungan khusus dengan Fachri Albar. Tapi pemeran Shinta dalam film “Test Pack” juga terus membantah hubungannya dengan Fachri Albar. ”Enggak tahu deh, temenan sih. Tergantung orangnya aja melihatnya mau seperti bagaimana,” kata Renata di Planet Hollywood Jakarta Selatan. Renata juga terkesan berhatihati jika ditanya tentang Fachri Albar. “Enggak tahu deh saya, seperti dia apa adanya. Saya melihat dia sebagai seorang pria,” ujar Renata.

PENYANYI Alexa Key termasuk artis yang peduli pada pendidikan. Ia pun mengaku lebih mengutamakan sekolah ketimbang kariernya. Alexa Key memang tak memungkiri banyak tawaran manggung datang. Namun, kembali lagi ke jadwal, ia akan mempertimbangkan tawaran itu ketika tak sibuk sekolah. ”Pendidikan nomor satu, Papa juga bilang sekolah nggak boleh ditinggalkan,” ungkapnya saat ditemui di acara HUT TVRI ke-50 di Jalan Gerbang Pemuda, Senayan, Jakarta Selatan, Rabu (5/9). Sebelumnya, Alexa menimba ilmu di Bali. Tapi, tampaknya sekolah di sana tak efisien dalam segi waktu. Ia pun memilih tinggal di Jakarta. ”Waktu di Bali diprotect orangtua, sekarang dikasih kepercayaan, tapi kontek setiap hari. Jaga diri, jangan lupa sekolah, mereka orangtua yang ketat dan protektif, tapi aku sudah dewasa dan dikasih kebebasan. Aku di Jakarta sama asisten,” tuturnya. (dtc/int)

Renata saat ini tidak menargetkan diri kapan akan menikah. Namun Renata juga tidak mau menutup diri, jika saja dirinya menemukan pria yang cocok untuknya.”Saya mau fokus dikerjaan aja. Waktunya sih enggak ada, kalau memang ketemunya pas banget ya sudah enggak dibatasi, yang penting pas aja dan cocok,” kata Renata. Aktris yang akan merayakan ulang tahun ke-30 pada 7 November mendatang ini mengaku orang tuanya tidak terlalu mendesak untuk menikah. “Dia cuma nyanya aja bagaimana, tapi terserah sama aku, yang penting cocok,” jelasnya. (abu/jpnn)

14 15


6 September 2012


ASURANSI ATLET: Presdir PT BCA Jahja Setiaatmadja di dampingi ketua KOI Rita Subowo dan Ketua Kontingen Olimpiade Indonesia Erick Tohir usai pemberian penghargaan. „ Kate Middleton

Tolak Bersalaman dengan Kate Middleton

Dua atlet angkat besi Eko Yuli Irawan dan Triyanto kembali mendapatkan penghargaan. Peraih medali di Olimpiade 2012 itu diberi jaminan asuransi kesehatan untuk jangka waktu yang sangat lama. Angkat besi adalah satu-satunya cabang yang menyumbangkan medali bagi kontingen Indonesia di Olimpiade lalu. Eko Yuli Irawan meraih medali perunggu,

sementara Triyatno menyabet medali perak. Sebagai wujud kepedulian atas prestasi yang diraih dua atlet angkat besi tersebut, Bank Cen-

Ahsan Mulai dari Awal Lagi YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 / bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari YAYASAN MAHAGA SEJAHTERA: membutuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515 1742 DIBUTUHKAN SEGERA: Pengajar Bhs. Inggris, Matematika, IPA,, alamat Jl. Menambin No. 8 Kel. Timbang Galung P. Siantar, Sumut, HP 0813 3814 0437; 0853 2638 7586 DIBUTUHKAN SEGERA: Tenaga kerja wanita usia 17-40 Tahun dengan posisi sbb:Baby Sister,Perawat jompo/Pribadi, PRT, syarat fc.ijazah, KTP, KK, gaji bersih 700rb s.d 1.500rb/ bulan + bonus + THR, makan, asrama, dijemput loket, gratis. hub YYS Marel Mandiri. Jl.Cengkeh Raya No 18.C Medan HP 0813 6199 9211: 0878 6968 7879. LOWONGAN KERJA: Perusahaan yang bergerak dibidang distributor membutuhkan karyawan/ti, usia max 32 tahun, pendidikan SMA/SMK sederajat, D1, D3 dan S1 (semua jurusan) untuk posisi Adm, Staf Gudang, Marketing, Pengawas, OB/OG, Asmen dan Kabag, bawa lamaran langsung test ke: CV Sentosa Abadi Jl. Medan KM 6.0 No. 58 (+ 5 M dari Simp. HKBP / Radio Diakoni Bongbongan) P. Siantar. Fasilitas: Gaji pokok, jenjang karir, komisi, mess (tempat tinggal) dan bonus DICARI: Tukang pangkas rambut, tempat depan Station Kereta Api, Cafe Obaja, diberikan Rp 25.000/hari, rame bagi dua, hub. GP 0813 9702 5775

DICARI: Karyawan wanita, yang berpenampilan menarik, sopan, jujur, ramah tamah, buat jaga ponsel, hub. HP 0821 6488 0068, lamaran diantar ke: KPM Jaya Ponsel Jl. Persatuan No. 58 Parluasan (Samp. Loket Karya Agung) YAYASAN SEPA HUSADA: Menerima tenaga kerja khusus wanita, baik gadis/janda, dengan usia 17 s/d 45 tahun, untuk dilatih & dipekerjakan sebagai perawat jompo/orang tua sakit, baby sitter. Syarat: Ijasah asli, KTP/Kartu Keluarga, gaji berkisar Rp. 1.000.000 s/d 1.700.000/bulan. Lamaran diantar langsung ke Jl. Pasar 3 no. 45 A Krakatau, Hub. 0811 602 145; 0852 6114 3441 DIBUTUHKAN SEGERA: 1 Pembantu RT wanita, berusia 20-50 tahun, dipekerjakan Jl. Melanthon Siregar P. Siantar, bersedi tinggal di rumah dan berikan gaji 1 jt/bln, yang berminat hub. Ny. Sitohang HP 0853 6107 9998; 0853 6059 4005

tral Asia (BCA) memberikan penghargaan berupa perlindungan asuransi kesehatan. “Pemberian penghargaan ini merupakan bukti nyata kepedulian BCA terhadap peningkatan jaminan kepada atlet di masa depan. Karena kami turut bersyukur dan bangga atas prestasi dan pencapaian mereka,” ujar Presiden Direktur BCA,

PEMAIN ganda putra Indonesia Mohammad Ahsan harus memulai perjuangan dari titik awal untuk kembali ke elite dunia setelah memutuskan berpisah dengan pasangannya Bona Septano. Keduanya sepakat berpisah setelah samasama mengevaluasi diri dari pencapaian prestasi. Keduanya memang masuk dalam elite dunia dalam peringkat 10 besar dunia. Namun, keduanya kerap kesulitan meraih gelar ketika berhadapan dengan empat ganda kuat dunia dari China, duo Korea

Jahja Setiaatmadja, di Planet Hollywood, Jakarta, Rabu (5/9). Perlindungan asuransi tersebut tertanggung hingga usia 75 tahun. Rinciannya adalah perawatan rumah sakit kelas VIP, perlindungan 34 macam penyakit kritis dan perlindungan kecelakaan. Selain itu, pemberian jaminan perlindungan kematian sampai usia 99

„ M Ahsan

PROMO KHUSUS HONDA DIJUAL CEPAT: Kijang kapsul, tahun 2002, biru matalik, BK Medan, sangat mulus, siap pakai, harga 100 jt (TP), hub. 0812 6011 5556 (Darwin Simanjuntak) DIJUAL: TOYOTA KIJANG LGX TAHUN 2004 1.8 EFI, HUB. HP 0853 7078 6233 (NO SMS) CASH & CREDIT: Menyediakan rumah dan tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

DAIHATSU PAKET MURAH 100% DP Angsuran • All N Xenia 24 jt 4.440.000 • Terios 24 jt 4.981.000 • Luxio 20 jt 4.902.000 • Pick up 11 jt 2.600.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0821 6308 7454. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio


• All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya

CAPELLA PEMATANGSIANTAR • All New Xenia Ready stok • Terios Ready stok • Luxio Dp 15%(hadiah menarik) • Sirion Dp 15 % • Pick up Dp 15 % • Mini Bus Dp 15 % hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Proses cepat data dijemput. Menyediakan TEST DRIVE!!


· All New Avanza ..Ready Stock ! Bonus Lengkap ! · All New Avanza VELOZ ... Bonus Lengkap !! · YARIS...Ready Stok,Diskon besar, Buruan !! · New Rush ..... Ready Stok !! · Grand New Innova .... Ready Stock !! · Grand New Fortuner ... Ready Stock !! · Hilux S-Cab/D-Cab .... Bensin/Diesel !! HUB. HUB. RICKY. M - 0853 7199 9499- 0812 6505 3191 SALES EXECUTIVE TOYOTA SIANTAR. Data dijemput, Cash/Credit PROSES ASTRA DAIHATSU 100% BARU CEPAT..!!

MENYAMBUT RAMADHAN • All New Xenia Dp 15% •Terios Dp 15% •Luxio Dp 15% •Pick Up Dp 15% •Grand Max Dp 15% Pastikan Anda Lebaran Mudik Dengan Mobil Baru Hub : Daud 0853 6123 3733 SUZUKI 100% BARU PT. Trans Sumatera Agung • Carry Pick Up 95,6Jt • APV Pick Up 105,6Jt • APV GL Arena 149,3Jt • APV Luxury 177,6Jt • Ertiga 155,2Jt • Splash 152,8Jt • Karimun Estillo 120,3Jt • Swift 181Jt • SX4 Cross Over 213,3Jt • Grand Vitara 305,3Jt Cash & Credit, Data dijemput David Sinaga, 0813 6132 4071

READY STOCK ALL TYPE HONDA • Honda Brio • Honda Jazz • Honda Freed • Honda CRV • Honda City • Honda Civic • Honda Accord • Honda Odyssey Dapatkan promo khusus Honda CRV bunga 0% sampai 3 tahun. Hub: (Sales Executive Honda Arista Perwakilan Siantar) 0813 7076 1561 (Aidil A).

LESTARI MOTOR: Menjual segala jenis sepeda motor Honda, Suzuki, Yamaha dan second, cash n kredit: • Honda Absolute Revo • Honda SX 125 • Scoopy, Vario Techno • Mio, Mio Soul • Jupiter Z • Satria FU, Spin, hub. 0622 - 22305; 24077; HP 0853 7070 9507; 0852 7601 5848. Jl. Merdeka No. 330 P. Siantar

DIJUAL: Yamaha VGR 06-2008, kondisi 90%, hitam, harga 6,3 jt, satu tangan, hub. HP 0813 9746 8674 DIJUAL: Ruko tingkat 2, luas 441 M2, SHM, cocok untuk Bank, Kantor, Usaha, tempat strategis (lokasi) Jl, Melanthonn Siregar 31 B Pematngsiantar, parkir luas, isi peralatan bengkel di lelang, hub, HP 0813 6176 6036; 0852 7502 6059 (TP) CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 150 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan. Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 tahun + Rp 16 jt per bulan selama 15 tahun + Rp 1,3 jt per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Rp 100 jt, DP 20 jt, angsuran selama 10 thn + Rp 1 jt per bulan, selama 15 thn + 800 rb per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar. CASH & CREDIT: 10 x 21,8 m Rp 76 jt, 20 x 22 m Rp 154 jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar Pasang Iklan Anda Hub. Hub.: 0622 -


tahun. Jahja menambahkan, dengan diberikan asuransi kesehatan itu diharapkan dapat memberikan rasa aman bagi Eko dan Triyanto saat berlaga maupun saat pensiun. “Dengan adanya penghargaan ini, diharapkan menjadi acuan dan motivasi para atlet agar terus bekarya,” tukasnya. (int)

ATLET paralimpiade asal Iran, Mehrdad Karam Zadeh, menjadi perbincangan di Eropa setelah menolak menjabat tangan istri Pangeran William, Kate Middleton, yang merupakan keluarga kerajaan, di ajang Paralimpiade 2012 di London. Atlet tolak peluru ini menolak bersalaman tangan dengan Duchess of Cambridge setelah penyerahan medali perak. Middleton sebelumnya mendapat sambutan hangat dari peraih medali emas, Alec Davies dari Inggris Raya dan peraih perunggu, Lezheng Wang dari Cina.Namun saat Middleton mengalungkan medali perak kepada Karam, atlet berusia 40 tahun itu tidak menjulurkan tangan seperti dua atlet sebelumnya. Ia hanya meletakkan kedua tangannya di depan dada seperti salam yang biasa dilakukan orang Thailand. Bagi orang-orang Eropa kejadian tersebut dianggap sangat menghebohkan, bahkan dikaitkaitkan dengan sentimen politik. Padahal pastinya, Karam tak berjabatan tangan dengan sang putri lantaran hal itu

Selatan, dan Denmark. Hasil mengecewakan pada Olimpiade London 2012 juga menjadi pertimbangan terakhir mereka untuk berpisah. “Kami pikir kita sudah waktunya berpisah. Permainan kita berdua sudah mentok dan kami butuh suasana baru,” kata Ahsan dalam jumpa pers di pelatnas Cipayung Jakarta, Rabu (5/9). Selanjutnya Ahsan akan berpasangan dengan Hendra Setiawan yang merupakan juara Olimpiade Beijing. Hendra sendiri

CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Rp 200 jt, Dp Rp 50 jt, angsuran selama 10 thn + 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan. Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Rp 200 jt, DP 50 jt, angsuran selama 10 thn + Rp 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan, Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 5 x 20 m Rp 17 jt, 10 x 20 m Rp 34 jt, 15 x 20 m Rp 51 jt, 20 x 20 m Rp 68 jt. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Rp 175 jt, DP 40 jt, angsuran selama 10 thn + Rp 2 jt per bulan, selama 15 thn + 1,6 jt per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: 1.908 M2 Rp 300 jt, cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No. Telp. 0813 7612 2445; 0812 6207 631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Rp 150 jt, DP 30 Jt, angsuran selama 10 thn + 1,7 juta per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

bertentangan dengan ajaran Islam. Dengan kata lain sang putri bukan muhrimnya. Juru bicara Istana St James, yang merupakan tempat sang putri bermarkas, sebelumnya mengatakan pihaknya telah memberi tahu Kate agar tak menjabat tangan atlet Iran tersebut. “Atlet pria dari negara Islam tidak berjabat tangan dengan perempuan yang tidak memiliki hubungan keluarga atau muhrimnya,” ujar perwakilan Kerajaan Inggris, seperti dilansir Daily Mail. Delegasi Iran mengatakan, tindakan Kahram sama sekali tak punya sentimen politik, dan semata-mata hanya untuk menjalankan ajaran agama Islam. “Jika atlet putri yang mendapat medali, pasti akan berjabatan tangan dengan sang putri.” Tahun lalu, tim voli putra Iran dikecam di negaranya setelah berjabatan tangan dengan wasit perempuan usai pertandingan melawan Afghanistan. Sejumlah media menyebut tindakan tersebut sangat memalukan, dan tak pantas dilakukan. (int)

sebelumnya juga menyatakan berpisah dengan Markis Kido setelah dipanggil kembali ke pelatnas Cipayung. Seusai menyalami Bona yang disaksikan pelatihnya Herry IP yang didampingi kepala pelatih ganda Christian Hadinata, Ahsan mengungkapkan dirinya akan berupaya keras untuk kembali ke jajaran elite dunia. “Kami akan memulai lagi setahap demi setahap. Mudah-mudahan prestasi kami lebih bagus,” kata Ahsan. (int)

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Rp 95 jt, Dp 20 jt, angsuran selama 10 tahun + Rp 950 rb per bulan, selama 15 tahun + Rp 752 rb per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 47 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; 7070442 P. Siantar

KAVLING AMELYA: Dijual persil uk. 20 x 18 M (360 M) harga 68 jt (Rp 188.000 / M2) di Jl. Medan Pasar 7 Kel. Sinaksak, Kec. Tapian Dolok (Masuk 700 M dari Samp. Restoran Burung Goreng Sinaksak) harga sudah termasuk suratsurat, pajak, Sertifikat Hak Milik (SHM), An. pembeli, lebar jalan kavling 6,5 M hub R br Purba HP 0852 7539 0076; Naibaho HP 0813 9781 8088 (Ukuran 10 x 18 M = 35 jt) CASH & CREDIT TANAH: 5 x 25 m Rp 25 jt, 5 x 20 m Rp 20 jt, cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar DIJUAL TANAH KAVLING: • luas tanah 224 m2; 114 m2; 106 m2; 117 m2, lokasi di Dusun Tambunan Jl. Parapat KM 4,5 P. Siantar (masuk dari depan Flora In) surat Camat, posisi tanah depan jalan uk. 4 m, harga nego, hub. Br Simanjuntak HP 0852 9635 8913 Peter Refleksi SinShe Aciu / Aling: Mengobati segala penyakit •Asam lambung •Asam urat •Ambeian •Gula •Kolestrol dll Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0852 7695 4557; 0813 6017 0199 Buka : Jam 09.00 21.00 WIB

REMBANG KATIKA UD JORENA: Menyediakan minyak karo yang dapat menyembuhkan •Gigitan binatang berbisa •Segala jenis luka bakar •Gegar otak dll, hub. SD Tarigan HP 0852 6290 3828 JL. Mangga No. 11 P. Siantar PIJAT DAN LULURAN “MBAK SARI”: Jika Anda Capek, Pegal, Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan Badan, Urut Bayi, Terkilir serta Luluran. Hub: kami di Jl. Usgara No. 1 (Masuk dari Jl. Bali samp. SMK Negeri) P. Siantar HP. 0812 635 5430 PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852.7600 0031; 0813.9688 9800. PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar Hp. 0813 7658 8917

Pijat dan Luluran “ IBU RESTU” Jika anda capek, Pegel Linu , Lesuh, Lelah Kurang bergairah, turun perut,Menyegarkan badan,Urut bayi,terkilir,serta luluran. Jl. Simpang Viyata Yudha Komplek kelapa 2 dekat sekolah RK Katolik Asisi Pematangsiantar HP 0821 6681 7943. PELUANG USAHA AIR MINUM: Pemasangan Depot Air Minum • Air Pegunungan (Mineral) • Sistem RO Oxsygen dan Grosir Peralatan • Depot Air Minum GRACE WATER Jl. Cengkeh Raya P. Simalingkar HP. 081370107352 Melayani pemasangan dalam dan luar kota ULI DE ANGEL TOUR & TRAVEL: Melayani jasa penjualan online: •Tiket pesawat domestik dan internasional •Paket wisata dan hotel •Paket Ziarah Lourdes & holy land • Rental mobil (Avanza, Xenia, Innova dll), hub. Uli Gultom HP 0812 1059 0815; Daniel Samosir HP 0852 7565 0001. BUTIK OLYA: Menjual segala jenis pakaian jadi pria, wanita dan aneka ragam corak batik jenis kain katun, sanwos. Semua pakaian jadi dan bahan batik langsung berasal dari Solo, harga terjangkau dan kelas menengah kebawah, alamat. Jl. Melanthon Siregar Gg. PD P. Siantar HP 0812 6339 2197 ARMADA SARANA TEHNIK: Service perbaikan, isi freon •AC •Kulkas •Dispenser •Frezer •Mesin cuci, hub. Armada Purba, HP 0812 6406 6568 Jl. Handayani No. 8 P. Siantar HASMIDA SALON: Diskon besar-besaran: • Make up/sanggul 30 rb - 50 rb •Rias pengantin 500 rb - 700 rb •Perawatan rambut 25 rb - 50 rb • Smoting 100 rb = 150 rb • Bonding 80 rb - 100 rb dan menerima rangkaian bunga, bunga salib dan juga menerima anak kost wanita. Jl. Rakkuta Sembiring No. 156 P. Siantar hub. HP 0852 6203 4593 GOODS MEUBEL: Promo besar-besaran/cuci gudang. Menjual: Perabotan rumah tangga dll, alamat Jl. Sutomo No. 11 -13 (Depan Bank Mandiri Sutomo) Telp. 0622 - 433788; 0813 9744 8215 HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” TANAM GAHARU INVESTASI MELEBIHI EMAS! Jual bibit gaharu aquilaria malaccensis tinggi mulai 20-100 CM, sedia fusarium ingul dan teknik mokulasi, sedia bibit kemenyan toba dll. Jl. Viyata Yudha Pematangsiantar. hub. HP 0813 1476 2472; 0812 2756 8840 LA ROSS SALON & FLORIST: Menerima: Make up dan sanggul, Rias pengantin, perawatan rambut, shomoting rambut. Juga menerima Roncean melati, Bunga tangan, Bunga papan, Bunga saub, Dekorasi pelaminan dll. Jl. Sisingamangaraja No. 324 Telp.08126382759

HORISON PHOTO: Spesial: •Pengadaan mesin

photo copy, servis spare parts Fotocopy Rp 125/ lbr •Pasphoto/cetak photo. Jl. Justin Sihombing (Simp. Jl. Pantai Timur) No. 7 B P. Siantar HP 0813 6100 1200 (Jhon Purba) AMANAH TOURS AND TRAVEL: Tiket promo, Medan - Jakarta - Singapura - Bangkok dll. Garuda, Lion, Batavia, Sriwijaya, dll. Hotel Promo Domestik dan Internasional. Tiket taman hiburan universal studio dll. Info: Jl. Patuan Anggi No. 159 P. Siantar. Telp. 0622 - 22115; 0813 6443 2665 dan menerima agen tiket

KAMIS 6 September 2012

Di-Bully Fans Lawan Wenger Sudah Kebal LONDON- Tak sekali dua kali Arsene Wenger mendapat teriakan olok-olok dari suporter lawan sepanjang 16 tahun melatih Arsenal. Apakah ia gentar dengan itu semua? The Professor menjawab tegas, tidak.

M „ Wenger

arkas Tottenham Hotspur, White Hart Lane, dan kandang Stoke City, Britannia Stadium, disebut Wenger sebagai tempattempat di mana ia pernah mendapat olok-olok. Presiden Arsenal, Peter Hill-Wood, bahkan

menyebut para suporter yang terus menyerang Wenger dengan sebutan ‘menjijikkan’. Tetapi Wenger tak peduli dengan hal tersebut. Meski tak menyukainya, pelatih 62 tahun tersebut merasa lebih baik fokus pada pertandingan daripada

meladeni ulah para suporter seperti itu. “Saya pribadi tak menyukai olok-olok suporter lawan, tetapi saya tak pernah takut. Ketika anda menjadi manajer. anda harus fokus pada pertandingan, bukan omongan suporter kepada anda,” tukasnya di Soccernet. Perjalanan waktu disebut Wenger telah mengajarkannya untuk tidak mempedulikan apa yang terjadi di tribun penonton dan fokus dengan apa yang ada di

atas lapangan. “Percayalah, jika saya menanggapi komentarkomentarsuporterlawandalam15 tahunlebihmasakepelatihansaya, sejak dulu saya sudah keluar dari sepakbola Inggris.” “Seiring berjalannya waktu, anda akan kebal dengan sendirinya dengan komentarkomentar tersebut. Setiap orang bisa saja berperilaku tidak sopan terhadap orang lain, tetapi anda tak boleh terpengaruh,” tuntasnya. (int)

Pulih Cedera, Aguero Bakal Kembali di Timnas Argentina BUENOS AIRES- Setelah absen sekitar dua pekan, Sergio Aguero akan segera comeback. Tapi laga pertamanya nanti bukan bersama Manchester City, melainkan dengan timnas Argentina di Kualifikasi Piala Dunia. Manchester City dan pelatih RobertoMancinimemprediksikan Aguero baru akan bisa kembali dimainkan pasca laga internasional sepanjang akhir pekan ini dan tengah pekan depan. Setelah mengalami cedera di pekan pembuka Premier League, Mancio tak mau anak didiknya buru-buru comeback yang justru bisa meng-

hadirkan risiko lebih besar. Tapi keinginan Mancini agar pemainnya itu beristirahat lebih lama hampir dipastikan tidak akan terwujud. Aguero yang sudah mulai pulih terlanjur bertekad tampil bersama timnas Argentina saat menghadapi Peru di Kualifikasi Piala Dunia 2014. “Saya di sini untuk laga kontra Peru,” seru Aguero seperti diberitakan Skysports. “Lutut saya masih sakit saat ini dan itu terasa mengganggu, tapi mungkin dalam dua atau tiga hari kondisinya akan berubah. Saya tidak akan bertemu dengan doktor

Spalletti: Milan Bukan Favorit di Grup C STPETERSBURG-PelatihZenit Saint Petersburg Luciano Spalletti, tak gentar meski timnya harus bertemu dengan AC Milan di fase grup Liga Champions. Spalletti juga tidak menganggap Rossoneri sebagai tim favorit. Hasil undian pada pekan lalu menempatkan Zenit dan Milan di Grup C. Mereka akan ditemani oleh Anderlecht dan Malaga.

„ Spalletti

Spalletti menilai, grup ini seimbang dan tak ada tim yang benar-benar lebih diunggulkan untuk melaju ke babak berikutnya, termasuk Milan. “Apakah Milan favorit? Saya memprediksi grup yang seimbang, dimana itu akan membuat segalanya jadi lebih rumit,” ungkap Spalletti kepada Sky Sport Italia. “Saat saya bekerja di Rusia, kami telah menunjukkan kamampuan kami dan mampu memenangi beberapa trofi,” sambungnya. “DiLigaChampions,kamiharus bekerja lebih keras. Itulah kenapa kami merekrut Hulk dan Alex Witsel karena mereka merupakan tambahan pemain yang penting untuk skuat yang telah ada,” kata eks pelatih Udinese dan AS Roma ini. (int)

Balzaretti Absen Satu Bulan „ Federico Balzaretti

menyisakannamaRodrigoTaddei. Dodo yang direkrut di jendela transfer musim panas ini masih belum bisa dimainkan karena masih dalam masa pemulihan cedera.

PELUMAS MOTOR Jl. Merdeka No. 1027, Perdagangan

Akibat cedera ini, Balzaretti juga harus meniggalkan pemusatan latihan timnas Italia. Dia tak bisa memperkuat Gli Azzurri di laga kualifikasi Piala Dunia melawan Bulgaria(7/9)danMalta(11/9/).(int)

Jaminkan BPKB Motor anda Proses Cepat - Aman - Mudah - Tepat DANA LANGSUNG CAIR HP 0821 6069 2290; 0853 7312 4777 (Hendrik Surya) Dapatkan cashback Rp 200.000 Menjual Segala jenis Sepeda Motor Baru dan Bekas Dengan Menjaminkan BPKB anda CASH & KREDIT ke PELUMAS MOTOR Jl.Merdeka No .1027 Perdagangan Bebas Adm dan Kendaraan di Assuransikan Juga SOLUSI DANA TUNAI SUPER CEPAT !!! Buktikan Dengan Anda Mengunjungi Dealer kami * Khusus kredit Spd Motor Mendapat Gratis OLI Selama Setahun dengan ketentuan Bayar Angsuran Tepat waktu

KAMPAR- Meski resminya PON XVIII dimulai 9 September, tapi cabang olahraga sepakbola akan mulai dipertandingan hari Kamis(6/9)besokdiBangkinang, Kabupaten Kampar, Riau. Di Kampar akan dikonsentrasikanGrupCyangterdiridariRiau, Sumatera Barat (Sumbar), Jawa Tengah (Jateng), Kalimantan Selatan(Kalsel)/Kalimantan Timur (Kaltim). Tuan rumah Riau akan membuka perhelatan melawan Sumbar. “Khusus untuk Kaltim dan Kalsel masih menunggu keputusanPBPON,siapayangakan bertanding. Karena keduanya lagi ada masalah,” kata Ketua Harian Sub Pengurus Besar (PB) PON KE XVIII Kabupaten Kampar, Azwan, kepada wartawan dalam konferensi pers, di Kantor Sekretariat Sub PB PON Kabupaten Kampar, di Jalan Pramuka, di Bangkinang, Rabu (5/9). “Untuk partai berikutnya yang mempertemukan Kalimantan Timur/Kalimantan Selatan de-

ngan Jawa Tengah yang dijadwalkan akan berlangsung pada malam harinya, dengan kick-off pada pukul 19.00 WIB. Tapi untuk Kalsel dan Kaltim masih menunggukeputusanPBPONtadi,” ujarnya. Ada tiga grup di PON kali ini. Grup A ditempati Papua, Nusa Tenggara Barat, Sulawesi Tengah,danJami.Grupinibermain di Rengat, Kabupaten Indragiri Hulu. Grup C dihuni Jawa Timur, Jawa Barat, Sumatera Utara, dan Gorontola, dipusatkan di stadion Taluk Kuantan, Kabupaten Kuantan sengingi. (int)

„ Neymar

timnas Argentina,” lanjut dia. Pelatih Argentina, Alejandro Sabella, sudah memasukkan nama Aguero dalam daftar pemain untuk laga tersebut. Namunjikakondisipemaindepan berusia 24 tahun itu tidak membaik, Sabella diyakini tidak akan memaksakan Aguero untuk tampil. “Selalu menyenangkan untuk berada di sini bersama teman-teman. Kami sudah saling kenal sejak usia di bawah 20 tahun dankarenaitulahkamimerupakan grup yang bagus, dan kami harus terus melanujutkannya,” lugas Aguero. (int)

„ Aguero

COVERCIANO- AS Roma tak akan bisa menggunakan tenaga Federico Balzaretti selama satu bulan ke depan. Akibat cedera paha, Balzaretti harus absen selama satu bulan. Balzaretti mulai mengalami masalahsaatRomabertandangke markas Inter Milan akhir pekan lalu dalam lanjutan Liga Italia. Di laga yang dimainkan di Giuseppe Meazzaitu,Balzarettiharusditarik keluar di menit ke-56 dan digantikan oleh Rodrigo Taddei. DilansirdariFootballItalia,hasil pemeriksaan menunjukkan bahwa Balzaretti mengalami cedera paha yang tingkat keparahannya berkisar pada level pertama dan kedua. Karena itu, eks pemain Palermo itu harus menepi hingga satu bulan. Dengan cederanya Balzaretti, posisi bek kiri Roma tinggal

Hari Ini, Sepakbola PON XVIII Riau Versus Sumbar

* Syarat Dan Ketentuan Berlaku

MU Dikabarkan Tawar Neymar, Santos Membantah SAO PAULO- Manchester United diisukan telah mengajukan penawaran besar untuk Neymarmenjelangbursatransfer ditutup. Sang klub, Santos membantahnya karena sejauh ini tak pernah ada kontak dari MU. Menurutlaporanyangberedar kubu “Setan Merah” menawarkan 38 juta poundsterling (sekitar Rp 576 miliar) di hari terakhir bursa transfer. Neymar sendiri sudah lama dikait-kaitkan dengan kepindahan ke Eropa dan klubklub top seperti Barcelona dan Real Madrid siap bertarung untuk memperebutkan tanda tangannya. Tapi pesepakbola 20 tahun itu berniat tetap di Brasil hingga gelaran Piala Dunia 2014. MU mengalihkan bidikannya ke Neymar usai gagal menggaet

kompatriotnya Lucas Moura yang akhirnya hijrah ke Paris St. Germain dengan nilai transfer besar: 38 juta pounds. Bagaimanapun, isu tersebut ternyata hanyalah isapan jempol belaka.Santosmenegaskantidak pernah menerima kontak dari klub Inggris tersebut. “Saya tidak tahu kabar itu berasal dari mana, tapi itu tidak benar,” tegas Felipe Faro, direktur sepakbola Santos kepada Globo Esporte yang dilansir Sky Sports. Bantahan juga diungkapkan ayah sekaligus agen si pemain, Neymar Santos. “Neymar juga sudahterjualpadaduatahunlalu tapi kami masih disini,” cetusnya sembari menyindir soal kencangnya kabar kepindahan putranya ke Eropa beberapa waktu lalu. (int)

PELUMAS MOTOR Jl. Merdeka No. 1027, Perdagangan HP 0821 6069 2290; 0823 6516 1890 Anda SIBUK? Cukup Hubungi Kami , Kami siap MENJEMPUT Berkas Anda!

Pastikan BPKB dan uang Anda Bermanfaat Bagi Keluarga Anda! Bunga ringan dan terjangkau serta dealer terpercaya

Ayooo… Buruan !!! Segera Kunjungi dealer kami PELUMAS MOTOR PERDAGANGAN Dapatkan Segera THR Lebaran Ini

KAMIS 6 September 2012

ENGLISH PREMIER LEAGUE No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

„ Ronaldo

Team Chelsea Swansea City West Brom Man City Man United Everton West Ham Arsenal Wigan Newcastle Fulham Stoke City Sunderland Tottenham Norwich City Reading Aston Villa Liverpool QPR Southampton

M 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 2 3 3 3 3

M 3 2 2 2 2 2 2 1 1 1 1 0 0 0 0 0 0 0 0 0

S 0 1 1 1 0 0 0 2 1 1 0 3 2 2 2 1 1 1 1 0

K 0 0 0 0 1 1 1 0 1 1 2 0 0 1 1 1 2 2 2 3

SG 8-2 10-2 6-1 8-5 6-5 4-3 4-3 2-0 4-4 3-4 7-6 3-3 2-2 3-4 2-7 3-5 2-5 2-7 2-9 4-8

Nilai 9 7 7 7 6 6 6 5 4 4 3 3 2 2 2 1 1 1 1 0

TOP SCORER Kamu memiliki cinta dari kami, dan kami juga akan membantu apapun yang kamu butuhkan. Kita akan berbicara lebih banyak lagi setelah laga uji coba internasional. Tapi satu yang harus kamu ingat, kami selalu ada untuk mendengarkan dan menolongmu.”

Gol 4 4 3

Nama Klub Michu Swansea City R. van Persie Manchester United C. Tévez Manchester City

Jose Mourinho

MADRID - Kesedihan yang dirasakan Cristiano Ronaldo membuat gusar beberapa penggawa Real Madrid. Tak terkecuali Jose Mourinho, yang menyebut kalau semua orang di El Real mencintainya.


onaldo mengejutkan banyak pecinta sepakbola dengan mengatakan sedang bersedih pasca duel melawan Granada di La Liga, akhir pekan kemarin. Salah satu rumor menyebutkan, eks winger Manchester United itu sudah tak betah lagi di Santiago Bernabeu. Real Madrid tentu tak ingin pemain termahalnya itu hengkang lantaran ada sesuatu yang membuatnya sedih. Takut hal yang tak diinginkan terjadi, Mourinho meyakinkan Ronaldo kalau orang-orang di Madrid masih mencintainya. Pria Portugal itu juga meminta pemain termahal dunia itu berbagi ‘misteri’ kesediahannya. “Kau adalah pemain spesial di sini (Real Madrid). Saya sama sekali tak ragu akan hal tersebut. Kita harus bicara, kau sangatdihargaidanbutuhdicintai,”ujarMoudalamsebuah percakapan yang dilansir Marca. “Kamu memiliki cinta dari kami, dan kami juga akan membantu apapun yang kamu butuhkan. Kita akan berbicara lebih banyak lagi setelah laga uji coba internasional. Tapi satu yang harus kamu ingat,kami selalu ada untuk mendengarkan dan menolongmu,” tuntas Mourinho. Banyak rumor berkembang terkait kesedihan yang dirasakan pesepakbola 27 tahun tersebut. Selain masalah uang dan kontrak baru, kabar lain menyebut ada ketidakcocokan dengan rekan setim. Meski mantan pemain terbaik dunia itu sudah menyangkal kalau kesedihannya berlatar belakang uang, masalah apa yang sebenarnya terjadi dengan CR7 masih tetap misteri. (int)

„ Vieri

No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Team M Barcelona 3 Mallorca 3 Málaga 3 Rayo Vallecano 3 Real Valladolid 3 Deportivo 3 Sevilla 3 Getafe 3 Atlético Madrid 2 Levante 3 Real Madrid 3 Real Betis 2 Real Sociedad 3 Real Zaragoza 3 Celta de Vigo 3 Athletic Club 3 Valencia 3 Granada 3 Espanyol 3 Osasuna 3

M 3 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0

S 0 1 1 1 0 2 2 1 1 1 1 0 0 0 0 0 2 1 0 0

K 0 0 0 0 1 0 0 1 0 1 1 1 2 2 2 2 1 2 3 3

SG 8-2 4-2 3-1 3-1 3-2 6-4 3-2 4-4 5-1 4-5 5-3 6-5 3-7 2-3 3-3 5-9 4-5 1-5 4-7 1-6

Nilai 9 7 7 7 6 5 5 4 4 4 4 3 3 3 3 3 2 1 0 0

TOP SCORER Gol 4 3 3

Nama L. Messi R. Falcao T. Hemed

Klub Barcelona Atlético Madrid Mallorca

Pippo Inspirasi Falcao

Ini Alasan Inter Mata-matai Vieri MILAN- Akibat memata-matai kehidupan pribadi Christian Vieri, Inter Milan diperintahkan pengadilan untuk membayar denda besar.ApaalasanLaBeneamatamemata-matai mantan bombernya itu? Seperti diberitakan sebelumnya, Vieri berang ketika tahu Inter Milan menyadap teleponnya. Ia pun mengajukan gugatan dan gugatan tersebut dimenangkan pengadilan. Bukan hanya Inter yang digugat oleh Vieri, tetapi juga perusahaan komunikasi Telecom Italia. Keduanya dituding Vieri telah melakukan penyadapan pada teleponnya lantaran Inter ingin memantau kehidupan pria yang kerap disapa Bobo itu. Seperti diberitakan kantor berita ANSA, Vieri akhirnya mendapatkan ganti rugi sebesar 1 juta euro (Rp 12 miliar). Meski angka yang dia minta sebagai ganti rugi lebih besar dari itu. Vieri mengajukan gugatan tersebut lantaran masalah tersebut telah mengganggu kehidupan pribadinya dan imbasnya berpengaruh pada permainannya di lapangan. Tapi, hal itu dibantah oleh Inter. “Kami jelas terkejut dengan tudingannya dan kami akan melakukan banding. Kami yakin bahwa kami tidak bersalah,” ujar pengacara Inter, Marco Fassone, di Football Italia. “Dalam pengadilan olahraga, kasus yang diperbincangkan ini sudah dikubur. Masa kasusnya sudah kadaluarsa.” “Jika penjelasan itu tidak cukup, tudingan yang diajukan juga tidak mungkin memengaruhi karier si pemain. Jadi, tak mungkin juga kasus itu merusak citranya. Kami tetap tenang dan akan mengajukan banding.” Lalu, mengapa juga Inter memilih untuk menyadap dan memata-matai Vieri? “Sebuah biro penyelidikan disewa untuk memantau apakah Vieri berlaku sesuai dengan peraturan internal Inter atau tidak,” lugas Fassone. (int)


juga punya idola. Ia menyebut Pippo telah menginspirasinya hingga dapat bermain seperti sekarang. Kepada rekan senegaranya di Kolombia, Mario Yepes, yang juga sempat merasakan menjadi rekan satu tim Inzaghi di AC Milan, Falcao bahkan meminta tolong agar Pippo bersedia menandatangani kostum Rossoneri untuknya. “Apakah kabar itu benar, bahwa saya menyuruh Mario Yepes agar Inzaghi menandatangani kostum Milan saya? Tentu saja itu benar,” tukas striker 26 tahun tersebut di Soccerway.

“Inzaghi adalah striker yang sangatsayakagumikarenainstingnya dalam mencetak gol. Dia menginspirasisayadengancaranya bermain.” Pasca memutuskan pensiun akhir musim lalu, Pippo kini tengah merintiskariersebagaipelatihditim junior di Milan. Selama lebih dari 10 tahun membela Il Diavolo, Pippo sukses meraih dua Scudetto, satu Coppa Italia, dua trofi Liga Champions, dua trofi Piala Super Eropa, dan satu trofi Piala Dunia Antarklub. (int)

Rooney: Sir Alex Punya Standar Tinggi

‘Jangan Tandemkan Cassano dengan Milito’

MANCHESTER- Wayne Rooney menyebut bahwa Sir Alex Ferguson punya standar tinggi. Saking tingginya standar itu, Rooney sampai mengaku takut untuk membuat kesalahan. Sir Alex memang dikenal begitu. Cerita bahwa dia suka menyemprot pemainnya —dikenal dengan hair dryer-treatment— ketika Manchester United bermain buruk, adalah cerita yang banyak diketahui orang. Sudah bukan rahasia. Menurut Rooney, tekanan itu akan lebih besar kepada para penyerang. Kalau tidak tampil bagus, ada kemungkinan si pemain bakal dicadangkan (atau tidak dimainkan sama sekali) pada pertandingan berikutnya. “Sebagai penyerang, saya harus bekerja keras setiap waktu. Saya harus tetap tajam, yang artinya kebugaran saya harus terjaga supaya saya bisa terus bermain bagus. Jika saya tidak bugar, maka itu akan terlihat jelas,” ujarnya seperti dilansir Sportinglife.”Mungkin akan berbeda jika seandainya saya adalah seorang full-back. Saya bisa sedikit bersembunyi, membuat beberapa lari pendek ke depan dan sudah dimaklumi.” “Sebagai penyerang Manchester United, tak ada pemakluman sama

MILAN - Legenda Inter Milan Sandro Mazzola, punya catatan untuk mantan klubnya itu. Ia menyebut, pertandingan melawan AS Roma adalah bukti bahwa Antonio Cassano dan Diego Milito tak bisa ditandemkan. Pada pertandingan yang dihelat di Stadion Giuseppe Meazza tersebut, Inter kalah 1-3. Satu gol La Beneamata disumbangkan oleh Cassano.MantanpemainACMilan itudimainkanberbarenganbersama Milito sejak awal. Namun ia kemudiandigantikanolehRodrigoPalacio di menit ke-50. “Itu adalah bukti bahwa Cassano tidak bisa ditandemkan dengan Milito. Tapi, mencadangkandiaakanmenjadihinaan kepadasepakbola,”ucapMazzoladi Football Italia. “Kita lihat saja nanti seperti apa jadinyadiakhirmusim.” Di sisi lain, Mazzola mengatakan bahwaRomadibawaharahanZdenekZemanmenunjukkanstartyang bagus pada pertandingan itu. Sedangkan Inter, menurutnya, masih butuh waktu lagi. “InterterdesakdengancaraRoma bermain. Giallorossi memulai dengan baik, seperti yang kerap dilakukan tim-tim arahan Zdenek Zeman.”(int)

„ Radamel Falcao

JAKARTA- Radamel Falcao kini bisa jadi dianggap sebagai salah satu striker terbaik di dunia. Siapakah pemain yang menjadi inspirasinya? Striker Atletico Madrid tersebut menjawab, Filippo Inzaghi. Naluri gol Falcao memang tengah menggila. Terakhir ia mencetak trigol ke gawang juara Liga Champions musim lalu, Chelsea, pada laga Piala Super Eropa. Los Colchoneros pun dibawanya menang 4-1. Layaknya pesepakbola lain, ia

„ Wayne Rooney sekali. Saya harus bekerja sekeras mungkin, jika tidak manajer akan menariksayadarilapanganatausaya ditinggalkan pada pertandingan berikutnya.” “Tak ada ruang untuk membuat kesalahan atau menjadi yang terbaik kedua di klub ini,” papar Rooney. Penyerang berusia 26 tahun itu pun memberikan contoh, yakni ketika dirinya pergi makan malam bersama beberapa rekan setim dan pasangan-pasangan mereka pada Boxing Day 2011. Ketika itu MU baru sajamenang5-0.Rooneymengirahal itu boleh-boleh saja. Tapi, ternyata tidak. Bagi Sir Alex, keluar malam-

malamenamharimenjelangpertandingan penting tidak bisa ditolerir. Keesokan harinya, manajer asal Skotlandia itu memanggil Rooney dan mengatakan bahwa dirinya tidak senang. “Saya didenda dan ada yang lebih buruk lagi; saya ditinggalkan untuk pertandingan melawan Blackburn pada malam tahun baru.” “Banyak klub tidak akan peduli pemain-pemainnya pergi malammalam enam hari sebelum pertandingan. Tapi, itulah bedanya di Manchester United dan itu adalah tandatingginyastandardantuntutan dari manajer,” tukasnya. (int)

ITALIAN SERIE A 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Juventus Napoli Lazio Sampdoria Roma Catania Torino Genoa Internazionale Milan Fiorentina Chievo Parma Cagliari Udinese Bologna Palermo Pescara Atalanta Siena

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

2 2 2 2 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0

0 0 0 0 1 1 1 0 0 0 0 0 0 1 0 0 0 0 1 1

TOP SCORER Gol 3 3 2

Nama S. Jovetiæ G. Pazzini G. Bergessio

Klub Fiorentina Milan Catania

0 0 0 0 0 0 0 1 1 1 1 1 1 1 2 2 2 2 1 1

6-1 5-1 4-0 3-1 5-3 5-4 3-0 4-3 4-3 3-2 3-3 2-2 2-2 1-3 2-6 1-5 0-6 0-6 1-2 1-2

6 6 6 5 4 4 3 3 3 3 3 3 3 1 0 0 0 0 -1 -5






Edisi 51 „ Tahun IX


Keluarga Menduga Wanda Dibunuh MINTA RUDOLF SITUMEANG DITAHAN Barang-barang Wanda Dijemput Keluarga

Wanda Janda Brimob, Beranak Satu PIHAK keluarga Wanda br Panjaitan (27) mengaku kalau korban adalah janda beranak

satu. Mantan suaminya adalah ‹ ‹ Baca

Wanda..Hal 7

PANDAN- Keluarga Sri Rahayu alias Wanda (27) meminta agar petugas Kepolisian menangkap dan menahan Rudolf Situmeang, oknum Ketua Partai Hanura Tapteng yang disebut-sebut orang terdekat korban. Keluarga menduga cewek berparas manis yang ternyata Boru Panjaitan ini dibunuh, bukan bunuh diri. “Hal ini beralasan, sebab kami dari pihak keluarga khawatir kalau Rudolf Situmeang akan melarikan diri terkait kasus yang menimpa saudara kami Wanda yang ditemukan tewas di kamar 304 Hotel Bumi Asih Pandan beberapa waktu lalu,” kata Burhanuddin Hasibuan, salah

KAKAK dan abang kandung serta keponakan almarhum Sri Rahayu br Panjaitan alias Wanda, Rabu (5/9) kemarin, mendatangi Mapolsek Pandan. Selain ingin mengetahui langusung perihal kematian korban, mereka juga memberikan keterangan kepada penyidik.


Keluarga Hal...6 „ Burhanuddin Hasibuan

‹ ‹ Baca

Barang..Hal 7


„ Suasana ketegangan antara massa denga warga di Desa Telo yang sempat terjadi aksi lemparan.


MASSA LEMPAR BATU, POLISI LETUSKAN TEMBAKAN source Martabe, Rabu (5/9), berlangsung ricuh. Massa dan petugas keamanan yang siaga di areal tersebut saling dorong. Tak hanya itu, massa yang emosi juga me-

ngan petugas keamanan yang telah disiagakan. Untuk diketahui, ribuan warga berdemo di tiga tempat. Lokasi demo pertama berada di Simpang Tiga areal PTPN 3 Batangtoru sekitar 1 kilometer dari

Milik Negara (BUMN) Dahlan Iskan. Peluncuran prangko “Mobil Listrik” ini terbilang unik, karena tidak dilakukan melalui acara resmi maupun waktu ‹ ‹ Baca

Prangko..Hal 7

‹ ‹ Baca

MASSA..Hal 7

Truk TPL Rusak Jembatan Aek Simare


JEMBATAN : Truk mitra PT Toba Pulp Lestari yang bermuatan kayu gelondongan saat melintas dari proyek jembatan sementara Aek Simare.

TOBASA-Proyek jembatan sementara Aek Simare di Jalan Lintas Sumatera (jalinsum) Kecamatan Laguboti, Kabupaten Toba Samosir yang terbuat dari batang kelapa, kini semakin rusak. Kondisi jembatan itu diduga disebabkan kelebihan tonase (muatan) ratusan truk pengangkut kayu gelodongan milik pabrik bubur kertas (pulp) PT Toba Pulp Lestari (TPL). Sebelumnya, akibat kerusakan itu pelbagai pihak mengarahkan tanggungjawab hanya kepada pihak kontraktor pelaksana pembangunan jembatan berbiaya miliaran tersebut. Namun Ketua LSM GATAL (Gerakan Abdi Tuhan Allah) Jonny ‹ ‹ Baca

Truk..Hal 7

Prangko Bergambar Mobil Listrik Diluncurkan JAKARTA – Koleksi prangko PT Pos Indonesia bertambah satu lagi. Sebuah prangko bergambar “Mobil Listrik” resmi diluncurkan Rabu (5/9) oleh Direktur Utama PT Pos Indonesia I Ketut Mardjana dan Menteri Negara Badan Usaha

Pasar Batangtoru menuju Hutaraja. Di sini, massa hanya berorasi dan tidak ada blokade petugas. Demo berlangsung dari

KIEV - Jawa Pos (grup METRO TABAGSEL) lagi-lagi mendapat perhatian khusus di ajang tingkat internasional. Pada hari kedua World Newspaper Congress Ke-64 yang dihelat WAN-IFRA di Ukrainian House, Kiev, Selasa (4/9), ruang redaksi Jawa Pos dipilih sebagai The

Coolest Newsroom.Ruang redaksi tersebut, yang terletak di lantai 4 gedung Graha Pena Jawa Pos Surabaya, merupakan salah satu di antara lima newsroom yang dibahas khusus. Tepatnya dalam sesi World Editors Forum yang dipimpin Juan Senor, pakar koran kelas dunia dari

Innovation Media Consulting Group Inggris. Sesi itu merupakan bagian dari rangkaian kongres yang terus memi‹ ‹ Baca

Krisis..Hal 7

Pilih..Hal 7


„ Menteri Negara BUMN Dahlan Iskan (kanan) dan Direktur Utama PT Pos Indonesia, I Ketut Mardjana saat peluncuran perangko mobil listrik sebagai salah satu agenda peringatan Hari Kebangkitan Teknologi Nasional 2012.

lempari petugas dengan batu. Untuk meredakan situasi, polisi meletuskan tembakan peringatan. Dorr…. Pantauan METRO, aksi lempar sempat terjadi dua kali antara ribuan warga de-

‹ ‹ Baca

BATANGTORU- Unjuk rasa ribuan warga berbagai desa di Kecamatan Muara Batangtoru, Kabupaten Tapanuli Selatan, yang menolak pemasangan pipa limbah perusahaan tambang emas milik PT G Re-



6 September 2012

Trauma, Santri Pilih Pulkam daripada Ujian

Foto: Masril Rambe

GOTONGROYONG: Warga dari Barus dan Barus Utara kompak melakukan gotong royong memperbaiki saluran irigasi Sitangkurak. Mereka juga berharap agar penebangan hutan di daerah itu dihentikan.

Stop Perambahan Hutan di Barus BARUS- Sejumlah petani di Kecamatan Barus dan Barus Utara meminta kepada oknum tertentu untuk menghentikan perambahan hutan di register 74 di Dusun Molhum, Desa Hutaginjang, Barus, Tapteng. Kata mereka, sejak adanya warga yang merambah hutan register 74 dan menjadikannya kebun karet, arus sungai Aek Sirahar sering banjir dan menghantam tanggul irigasi Sitangkurak. “Kami minta kepada warga yang merambah hutan register 74 di Dusun Molhum, Desa Hutaginjang, Kecamatan Barus Utara agar segera dihentikan. Karena, penyebab ambruknya tanggul irigasi Sitangkurak disebabkan arus sungai Sirahar sering banjir,” kata D Limbong diamini J Purba, U Tanjung dan A Rambe kepada METRO saat melakukan gotongroyong beberapa waktu lalu. Warga menduga, hutan register 74 di Dusun Molhum sudah gundul sehingga tidak bisa lagi menahan air yang ada di gunung tersebut. “Sebelum ada warga yang merambah hutan register 74 ini, Aek Sirahar tidak sering banjir. Hal itu bisa dibuktikan dengan tanggul irigasi Sitangkurak yang dibangun tahun 2001 tidak pernah rusak. Namun sejak beberapa tahun terakhir ini, ada sejumlah warga yang merambah hutan itu dan mengakibatkan Aek Sirahar sering banjir,” ucapnya. “Bahkan kalau pun tanggul itu bisa dibangun dengan beton, kami rasa tidak akan dapat bertahan sepanjang ma-

sih ada warga yang merambah hutan di register 74 tersebut. Sebab arus sungai Aek Sirahar akan setiap saat meluap karena hutan di register 74 sudah gundul,” tandas warga. Petani di Barus ini juga mengisahkan penderitaan mereka selama satu tahun sejak tanggul irigasi Sitangkurak jebol akibat dihantam arus sungai. Ribuan hektare persawahan warga di dua kecamatan itu menjadi kekeringan. Sebagian petani mengalihkannya ke tanaman palawija dan sebagian lagi membiarkan begitu saja seperti lapangan bola kaki. Warga juga berharap kepada saudarasaudara mereka yang merambah hutan register 74 agar tetap memikirkan orang lain yang ada di Barus dan Barus Utara. Sebab, warga juga perlu makan. “Sudah hampir setahun kami tidak turun ke sawah karena tanggul jebol akibat dihantam arus sungai. Beberapa hari yang lalu Bupati Tapteng telah membantu kawat bronjong dan alat berat untuk memperbaiki tanggul tersebut menunggu pembangunannya dianggarkan di APBD. Tetapi kami yakin, itu tidak akan lama bertahan sepanjang hutan register 74 di gunduli,” kata warga lainnya. (mas)

PTUN Kabulkan Gugatan 4 Anggota KPU

TAPTENG- Pengadilan Tata Usaha Negara (PTUN) Medan mengabulkan gugatan empat anggota KPU Tapteng. Hal itu dibuktikan dengan dikeluarkannya surat keterangan inkracht Van gewijsde (berkekuatan hukum tetap) yang ditanda tangani oleh Ketua PTUN Medan Simon Pangondian Sinaga SH dengan nomor W1TUN1/808/AT.02.07/VIII/2012 tertanggal 30 Agustus 2012. Adapun empat anggota KPU yang melayangkan gugatan sebelumnya yakni, Kabul Lumban Tobing (Ketua), Maruli Firman Lubis SH (anggota), Syahrial Sinaga (anggota), Irwanner Muda Ritonga (anggota). Dimana keempatnya keberatan dipecat KPU Provinsi sebagai panitia dan mengajukan gugatan ke PTUN Medan, karena diduga melanggar kode etik.

Menurut anggota KPU Provinsi Sumut bagian Divisi Tehnis Turunan B Gulo dikonfirmasi METRO, Selasa (4/9) usai acara sosialisasi pendaftaran verifikasi calon partai politik peserta Pemilu di Hotel Prima Indah Sibolga mengatakan, hingga saat ini, dia belum membaca surat keputusan dari Pengadilan Tata usaha Negara (PTUN) Medan tersebut. “Sebab jika surat itu masuk ke KPU Provinsi Sumut, tentunya kami bisa melihat dengan jelas apa isi keputusan dan bagaimana bentuk keputusan itu. Apakah status keputusan tersebut. Itu semua akan dikaji untuk selanjutnya diplenokan KPU Sumut, terutama dalam mengambil suatu kebijakan terkait hal itu,” kata Gulo. Jika surat dari PTUN itu sampai ke KPU Provinsi Sumut, lanjutnya, tentunya akan dikaji, dilihat dan dipelajari terlebih dulu keputusan itu, apa dan bagaimana dasar hukumnya untuk selanjutnya diambil kebijakan. Sementara itu, Maruli Firman Lubis SH, salah seorang Anggota KPU Tapteng yang mengajukan gugatan ke PTUN Medan, Rabu (5/9) melalui telepon selulernya mengatakan, awalnya mereka mengajukan gugatan karena keempatnya diberhentikan dari KPU Tapteng se-

bagai ketua dan anggota pada tanggal 3 Agustus 2011 sesuai SK nomor 1648/KPTS/KPUPROP-002/2011 dengan dugaan pelanggaran kode etik pada waktu pelaksanaan Pemilukada sesuai rekomendasi Bawaslu No.131/BAWASLU/III/2011. Dimana empat anggota KPU Tapteng diberhentikan atas dugaan pelanggaran kode etik. Sedangkan satu orang lagi yaitu diberhentikan karena memiliki KTP ganda. “Karena Persoalan itu, 23 Agustus 2011 melalui kuasa hukum mengajukan gugatan ke PTUN Medan dan hasilnya 30 Agustus keluar keputusan yang menyatakan Inkrach. Yakni, mengabulkan gugatan para penggugat seluruhnya dan surat keputusan pemecatan terhadap kami dinyatakan batal dan memerintahkan kepada tergugat yaitu KPU Provinsi Sumut untuk mencabut surat keputusan tergugat Ketua KPU Provinsi Sumut No. 1648/ KPTS/KPU-PROV-002/2011 tanggal 3 Agustus 2011,” jelas Maruli. Dalam putusan PTUN Medan juga disebutkan, memerintahkan kepada tergugat untuk merehabilitasi nama baik para penggugat dengan memulihkan hak para penggugat dalam kemampuan, kedudukan dan harkat serta martabatnya. (son)

Warga Protes Proyek PNPM 120 Mahasiswa Akper Tapteng Gelar Pengenalan Jalan Masih Bagus Dibongkar Program Studi TAPTENG- Akademi Keperawatan (Akper) Tapteng menggelar Pengenalan Program Studi (PPS) angkatan ke-6 tahun ajaran 2012/2013 terhadap 102 mahasiswa baru di halaman Akper, Jalan AR Surbakti, Sihaporas, Kelurahan Sibuluan Indah, Kecamatan Pandan, Rabu (5/9). Acara PPS ini dibuka Direktur melalui Pudir (Pembantu Direktur) Bagian Kemahasiswaan Arianto Sembiring Skep Ns. Arianto dalam sambutannya mengatakan, tujuan kegiatan PPS ini adalah untuk lebih mengenalkan pada mahasiswa-mahasiswi tentang program studi dan pengenalan kampus dalam membina mental, moral, disiplin, etika dan spiritual. “Pelaksanaan kegiatan yang berlangsung selama 4 hari ini mulai 5 hingga 8 September diharapkan dapat

dimanfaatkan para mahasiswa secara baik untuk dapat lebih dekat dengan kampus dan mengenal lebih dalam tentang program studinya masing-masing,” jelasnya. Dalam kegiatan yang melibatkan seluruh para senior mahasiswa Akper ini, juga melibatkan seluruh tenaga pengajar dan staf di kampus yang tergabung dalam panitia, kiranya dapat bekerja semaksimal mungkin. “Setelah proses yang dilalui, maka terjaring lah 102 mahasiswa usai mengikuti ujian test tertulis yang dipimpin langsung dari Dinas Kesehatan Provinsi Sumut serta uji test kesehatan dari RSUD Pandan. Tentunya sudah menguras kemampuan para peserta PPS. Namun kegiatan ini harus dapat dimanfaatkan mahasiswa dengan sebaik-baiknya,” imbaunya. (son)

SIANTAR- Warga di Jalan Sriwijaya Gang Hasanah Kelurahan Melayu, Siantar Utara, protes terhadap pengerjaan PNPM. Menurut mereka, proyek itu tak tepat sasaran. Sebab pengerjaan ditujukan untuk membongkar jalan yang notebenenya masih bagus. Kejadian bermula saat dua tukang datang ke Gang Hasanah dan membongkar jalan di gang tersebut. Masih sedikit yang berhasil dibongkar, warga langsung datang dan meminta

supaya tukang memberhentikan aktifitasnya. Menurut warga, jalan mereka masih bagus dan belum ada yang rusak. Jika dibongkar dengan alasan untuk dibangun kembali, itu sangatlah tidak tepat. Bahkan mereka menganggap pengerjaan PNPM tersebut tidak tepat sasaran. Sebab masih banyak infrasturktur yang harus diperbaiki. Akibat warga protes, kedua pekerja tersebut pergi dan meninggalkan pekerjaan mereka.

„ Jalan Sriwijaya gang Hasanah yang hendak dibongkar.

Menurut Lisna br Pasaribu yang ditemui di lokasi menyebutkan, pembongkaran jalan di gang itu ditolak dan tidak disetujui oleh sejumlah warga. “Ini masih bagus, lalu kenapa dibongkar. Sementara parit yang sudah tersumbat tidak diperbaiki. Makanya kami protes,” sebut Lina. Sementara Riduan selaku pelaksana pembangunan pengerjaan tersebut mengatakan, dana pembangunan itu bersumber dari PNPM sebanyak Rp10 Juta. Dana itu diperuntukkan membongkar jalan sepanjang 82 meter dengan lebar 1,2 meter. Ia mengatakan, bahan yang akan dibuat jalan jenis paving blok atau tidak dicor lagi. Sebab juklak-nya diperuntukkan untuk pembangunan jalan dan konsepnya adalah pengerjaan jalan di Gang Hasanah. Sementara Lurah Melayu Makdin Sagala mengatakan, pihaknya tidak bisa mengintervensi soal letak pengerjaan PNPM. Menurutnya pihaknya hanya sebatas mengetahui saja. (pra/hez)

MADINA- Sejumlah santri korban kebakaran asrama putri Pondok Pesantren (Pontren) Musthafawiyah Purba di Kecamatan Lembah Sorik Merapi, Kabupaten Mandailing Natal (Madina) trauma. Mereka memilih pulkam alias pulang kampung dan tidak ikut ujian. Pimpinan Pontren Musthafawiyah KH Musthafa Bakhri Nasution melalui Sekretaris Potren Muklis Lubis SPdI didampingi pengasuh asrama putri Hj Hannah Caniago, kepada wartawan, Rabu (5/9), mengatakan pasca kebakaran yang menghanguskan empat kamar ini, sejumlah santri minta izin pulang karena dijemput orangtua masing-masing. “Sebagian santri yang tinggal di kamar itu minta izin pulang dijemput orangtua masing-masing. Maklum lah kejadian seperti ini baru pertama kali terjadi sehingga santri trauma” sebut Mukhlis. Kata Mukhlis, meskipun saat ini para santri di Pontren Musthafawiyah sedang mengikuti ujian semester, khusus bagi santri yang terkena musibah itu diberikan kelonggaran berupa ujian ulang setelah mereka kembali ke asrama dari kampung masing-masing. Dalam situasi ini pihak Pontren tidak bisa memaksakan untuk mengikuti ujian apalagi santri yang berada di dua kamar yang habis terbakar dan sebagian dua kamar lain juga ikut terbakar itu trauma. “Kebanyakan mereka masih anak-anak usia tingkat SMP. Wajar saja mereka trauma atas musibah ini, makanya kita berikan kelonggaran,” ujarnya. Khusus bagi kamar yang sudah terbakar, kata Mukhlis, pihak Pontren sudah mulai diperbaiki agar bisa digunakan

kembali karena yang terbakar hanya ada dua kamar, yaitu di kamar 1 dan kamar 8. Dan ada dua lagi yang sebagian isi kamar ikut terbakar yaitu kamar 2 dan kamar 7. “Jumlah semua kamar di gedung Mawar itu ada 8 kamar dan dalam 1 kamar biasanya menampung 60-70 orang,” ujarnya. Untuk saat ini, santri yang tinggal di kamar terbakar tapi tetap mengikuti ujian dipindahkan ke kamar asrama yang lain yang masih kosong, sementara untuk pakaian sekolah santri yang pakaiannya sudah ludes meminjam pakaian santri yang masuk sore. “Santri yang tinggal di kamar terbakar sudah dipindahkan ke kamar lain. Dan pakaian mereka untuk sementara meminjam pakaian temannya yang memiliki lebih dari satu seragam sekolah untuk bisa mengikuti ujian. Artinya kita tidak lagi membebani pikiran mereka dengan ujian. Siapa yang tetap ingin mengikuti ujian bisa (diikutkan) siapa yang minta izin boleh,” tambahnya. Lalu, ibu pengasuh asrama putri, Hj Hanna Chaniago menceritakan kebakaran terjadi sekitar pukul 07.30 WIB pagi ketika itu semua santri putri yang tinggal di asrama sedang melakukan tugas kebersihan pekarangan asrama dan tibatiba terdengar suara ledakan. Dan saat itu juga muncul api dan asap dari dalam ruangan kamar 1 Mawar, sontak santri putri yang berada di dalam kamar minta tolong. Sampai saat ini, kata Hanna, belum diketahui penyebab kebakaran. “Kami tidak tahu pasti penyebabnya, yang kami pikirkan saat ini bagaimana agar mental santri tidak terganggu atas musibah ini,” pungkasnya. (wan)

„ Warga mengerumuni puing-puing bangunan di lokasi kebakaran.

Baru Selesai 4 Bulan

Proyek Miliaran Rupiah Mulai Hancur PURBA- Proyek Pemeliharaan Jalan Berkala TigarungguSeribudolok tahun 2012 yang dikerjakan PT Gidion Indah Perkasa, beralamat di Kota Medan dengan biaya lebih dari Rp3,6 Miliar, mulai hancur. Padahal pengerjaannya baru selesai 4 bulan lalu. Pantauan METRO, beberapa titik jalan yang mulai hancur terlihat di depan SD Negeri Tigarunggu dan di Huta tongah. Menurut warga, cepatnya kerusakan pada jalan disebabkan akibat pekerjaannya asal jadi. Sebelumnya saat proses pekerjaan ini berlangsung beberapa bulan lalu, banyak masyarakat yang menilai pekerjaan

asal jadi dan tak jelas. Sebab pembangunan parit pasangan di sisi jalan tak jelas, serta pemadatan perengan asal ada. “Memang waktu dikerjakan, kami seolah yakin hasilnya kurang bagus. Soalnya pengerjaannya terkesan asal jadi saja,” ujar seorang pria yang tak menyebut nama dan menetap di sekitar lokasi. Warga lainnya mengatakan, pihak PT Gidion Indah Perkasa harusnya mengerjakan proyek sesuai juknis yang sudah diatur. “Jika saja pengerjaannya sesuai dengan juknis dan menggunakan material standar, pasti jalan akan bertahan lama,” Katanya. (SP/hez)

„ Proyek pemeliharaan jalan Tigarunggu-Seribudolok yang mulai hancur.


6 September 2012 “Dikhawatirkan bagi partai yang memiliki dana besar akan membuat ketentuan administrasi secara borongan lewat konsultan. Jelas, tertib administrasi tidak bisa jadikan jaminan akan menghasilkan DPR yang berkwalitas,” Ketua Umum Partai Nasional Indonesia Marhaenisme (DPP PNI Marhaenisme) DM Sukmawati Sukarno.

Kirim Opini Anda ke email: metrotapanuli Maksimal tulisan 5.000 karakter

Sikap Kami Mengelola Musim HIDUPdi dua musim seperti di Indonesia, yakni musim hujan dan panas, mestinya mendatangkan berkah. Kondisi demikian tidak membutuhkan antisipasi dan perlakuan sesulit negeri dengan empat musim atau lebih seperti di Eropa. Sayangnya,berkahduamusimitukinitakpernahlagidinikmati. Yang terjadi justru musibah akibat buruknya perencanaan. Ketika musim hujan tiba, banjir muncul di mana-mana. Ketika kemarau datang, kekeringan tidak bisa lagi dihindari. Ribuanhektarelahanpertaniankering,bahkanratusanhektare di antaranya gagal panen. Waduk-waduk yang menjadi urat nadi bagi sawah, listrik, dan air bersih pun kering kerontang. Peristiwa terakhir menunjukkan susutnya air waduk membuat tiga pembangkit listrik tenaga air (PLTA) tidak beroperasi. Ketiga pembangkitlistrikituialahPLTA Wadaslintang,PLTA Sempor,dan PLTA Pajengkolan yang semuanya berada di Kebumen, Jawa Tengah. VolumeWadukWadaslintang,misalnya,kinitinggal261,46juta meterkubik.Padahal,isimaksimalnyamencapai413,46jutameter kubik. Kekeringan juga terus meluas. Di Kabupaten Magelang dan Temanggung di Jawa Tengah, Pasuruan, Jawa Timur, Karangasem, Bali, dan Kabupaten Kupang, Nusa Tenggara Timur, krisis air bersih sudah terjadi. Di Pasuruan, sedikitnya 20 desa di delapan kecamatan bahkan mengalami krisis air bersih. Ketersediaan air bersih di desa-desa tersebut tidak mampu memenuhi kebutuhan minimal 10 liter per hari per orang. Kenyataan tersebut menunjukkan masih buruknya antisipasi dan perencanaan pemerintah. Antisipasi bencana masih dilakukandengankebijakanreaktif,yaknimembagi-bagibantuan uang setelah musibah datang. Begitu bencana kekeringan pergi, semuanya kembali seperti sedia kala seolah tidak pernah terjadi apa-apa. Kebijakan yang bersifat preventif dan proaktif nyaris tidak banyak dilakukan. Akibat kebijakan dadakan itu, menurut hitung-hitungan Institut Hijau Indonesia, terjadi potensi kerugian lebih dari Rp100 triliun.Padahal,jikayangdikedepankanialahkebijakanantisipatif, dana yang dibutuhkan kurang dari Rp50 triliun. Bila penghentian penebangan hutan dan penyetopan konversi lahan pertanian menjadi permukiman dilakukan secara konsisten, bencana bisa dihindari. Kerugian finansial lebih besar pun bisa diminimalkan. Kenyataannya,potensikerugianmalahkianbertambahkarena dana yang digelontorkan untuk mengatasi kekeringan diserahkan kepada pemerintah daerah dengan pengawasan minimal. Tidak banyak yang tahu apakah bantuan itu sampai ke masyarakat atau tidak. Jika manajemen musim masih bertumpu pada pola-pola darurat seperti saat ini, dampak yang lebih buruk akan menjadi kenyataan. Kalau sekarang kita baru menghadapi krisis listrik dan air bersih akibat kekeringan, bukan tidak mungkin krisis pangan benar-benar menjadi kenyataan. Pada titik itu bangsa yang pernah gemilang di bidang agraris ini tinggal meratapi tragedi berkesinambungan. (**)

“Merepotkan (verifikasi). Tapi tetap dilaksanakan, walaupun ini sebagai sebuah kesalahan sejarah,”

Ketua Umum Partai Persatuan Pembangunan (PPP) Suryadharma Ali.

Ketua Komisi III, Gede Pasek Suardika.

“Badan Nasional Penanggulan Teroris (BNPT) harus melakukan pencegahan dan deradikalisasi, jangan hanya penindakan terus, itu yang harus dilakukan. Apalagi notabenenya pelaku teroris itu masih muda, ada yang belasan tahun lagi? Ini harus diselamatkan dan dibina,”

Revitalisasi Bulog dan Kebutuhan Masyarakat Kekayaan alam di negeri ini yang tak terhingga menjadikan negeri ini berbeda dari negara lainnya. Namun, dibalik kekayaan alam yang berlimpah ini, alangkah disayangkan jika pihak-pihak yang seharusnya mampu mengatasi permasalahan kebutuhan penduduknya, justru melahirkan sebuah permasalahan baru.

Oleh : Budi Prasetyo TAK sepatutnya luas wilayah daratan sekitar 1.922.570 km², masih kesulitan masalah pangan. Beberapa waktu lalu, kita dihibur dengan melambung tingginya harga kedelai dipasaran. Kenyataan ini, benar-benar di luar kewajarandantelahmencapaiangka klimaks. Bahkan, melebihi harga tertinggi tahun 1998. Tahun 1998, harga kedelai mencapai Rp7.050 per kg dan sekarang hampir menembus angka Rp8.000 per kg. Bukan itu saja, sejarah mencatat bahwa Indonesia yang dulu terkenal dengan negara agraris, sekarangternyatasangatbergantung kepada pangan impor. Untuk memenuhi kebutuhan dalam negeri, sebanyak 60% pasokan pangan di Indonesiadiimpordariluarnegeri. Tercatat beras selama 2 tahun terakhiryangdiimporhampir2juta ton, jagung 1,2 juta ton, kedelai hampir 30% dari kebutuhan, gula 30%, 50% garam konsumsi impor, susu 70%, dan gandum 100%. Akibatnya, angka inflasi mengalaminaikselamaApril2012akibat harga pangan yang tinggi, ternyata di sisi lain adanya gejolak pangan di tingkat internasional saat ini. Badan Pusat Statistik (BPS) mengumumkanbahwainflasiApril2012 naik dibandingkan bulan sebelumnya sebesar 0,21 %, sedangkan inflasi secara year on year tercatat sebesar4,5%.Padahal,targetinflasi dalam APBN-P 2012 adalah 6,8%. Tingkatinflasitersebutdidorong oleh kenaikan harga beberapa komoditas pangan sejak awal bulan. Di antaranya harga komoditas yang mengalami kenaikan tersebut adalah bawang putih, cabai rawit, gula pasir, bawang merah, dan minyak sawit. Untuk itu revitalisasi Bulog perlu dilakukan, tujuannya untuk memenuhi ketercukupan pangan. Menkoperekonomian Hatta Ra-

jasa mengeluarkan statment berkaitan revitalisasi Bulog. Dirinya setuju adanya revitalisasi dalam tubuh Bulog alasannya sangat pentinguntukstabilisasihargaagar masyarakat tidak terbebani dengan kenaikan harga akibat kelangkaan bahan kebutuhan pangan pokok. Sejak wewenangnya dipangkas pemerintah atas tekanan IMF (Dana Moneter Internasional), 1998, Bulog hanya menangani beras. Komoditas pangan lainnya diserahkan sepenuhnya kepada mekanisme pasar. Alhasil, kebijakan ini merugikan masyarakat konsumen dan para petani sebagai produsen. Harga bahan kebutuhan pokok berfluktuasi tajam. Sudah sepatutnya, Badan Urusan logistik (Bulog) ditingkatkan perannya yang bertujuan untuk menjaga ketahanan pangan agar berjalan efektif. Jika Perum Bulog diberiperantidakhanyamenjalankan stabilisasi harga beras, namun juga menjaga stabilisasi harga sejumlah bahan pokok. Harga kebutuhan pokok sudah selayaknya dikontrol pemerintah, karena kebutuhan pokok ini merupakan kebutuhan strategis yang harus dilindungi sesuai amanat Undang-UndangDasar1945.Tujuan turut campurnya pemerintah dalam penentuan harga untuk mencegah terjadinya kelangkaan dan kelonjakan harga bahan pokok serta terjadinya monopoli pasar. Apalagi, kebutuhan pokok merupakan kebutuhan yang tak dapat dipisahkan dalam kehidupan siapapun di dunia ini. Jangankan manusia, hewan pun tidak akan bisa bertahan hidup, jika tidak ditopang kebutuhan pokok. kebutuhan pokok sering kali berada di tengah ancaman. Iklimmenjadiancamanterbesar


• Tes Kadar Lemak Perut SESUDAH • Pemeriksaan Kepadatan tulang • Pemeriksaan Usia sel • Pemeriksaan Kadar air • Pemeriksaan Kepadatan tulang • Pemeriksaan massa otot dan ranting fisik

Suplemen yang terbuat dari nutrisi buah-buahan dan sayur-sayuran 100% NUTRISI LENGKAP

• Dapat menurunkan Berat Badan 3-10kg/bulan • Dapat Menaikan Berat Badan • Menambah Nutrisi Tubuh

Hubungi EFFENDY MANALU HP 0812 6307 414; 0813 7068 2243; 0852 7774 2645

Buka setiap hari SENIN s/d SABTU (Jam 08.00 - 21.00 WIB)


atas ketersediaan kebutuhan pokok. Ancaman kelangkaan pangan yang kini melanda dunia, termasuk Indonesia menjadi pekerjaan tersendiri bagi pemerintah untuk melindungi kebutuhan dalam negeri. Meski secara geografis memiliki kekayaan alam yang melimpah, namun ancaman krisis pangan ini tetap dialami Indonesiasebagaidampakdarimatarantai kehidupan dunia. Apalagi kebutuhan akan konsumsi beras masyarakat Indonesia cukup tinggi dan merupakan yang terbesar di dunia dengan volume sebanyak 130 Kilogram (Kg) sampai 140 Kg per orang per tahun. Konsumsi itu mencapai dua kali dari masyarakat di kawasan Asia Tenggara yang hanya 65 kg sampai 70 kg. Untuk memenuhi kebutuhan tersebut, pemerintah melakukaan berbagai langkah strategis, diantaranya mengantisipasi kekurangan pangan melalui produksi optimal pengadaan beras. Tujuannya hanya satu, yaitu kebutuhan nasional tetap terjaga.Terkesan Bulog selama ini tidak diberi peran untuk menstabilitaskan harga komoditas selain beras. Padahal infrastruktur gudang, jaringan, maupun fasilitas lain dapat dimanfaatkan Bulog untuk mengatasi permasalahan pangan didalam negeri. Untuk itu bulog perlu di revitalisasikan. Penulis sependapat dengan apa yang disampaikan Hatta rajasa, dengan adanya revitalisasiini.Bulogharustetapmengacu kepada regulasi dan mengacu kepada stabilisasi supaya tidak menimbulkan distorsi terhadap mekanisme pasar. Kemampuan untuk tetap menjaga komoditas dan menstabilisasikan harga pada akhirnya menjadi tantangan tersendiri bagi bulog. Sebelumnya, Presiden Susilo Bambang Yudhoyono menginstruksikan agar Bulog direvitalisasi kembali fungsinya sebagai stabilisasi harga komoditas pangan yang dibutuhkan masyarakat, tidak hanya untuk beras. Menurutnya revitalisasi Bulog dibutuhkan mengingat tantangan stabilitas berbagai harga pangan yang terus meningkat, sementara kebutuhan pangan masyarakat

yang juga terus naik. Untuk itu, Yudhoyono meminta segera dibentuk tim guna mengembalikan peranBulogtersebutdanmengkaji komoditas-komoditas pangan yang akan menjadi tanggung jawab Bulog. Penulis berkeyakinan dengan adanya revitalisasi ini Bulog mampu memainkan perannya dalam memenuhi kebutuhan pokok masyarakat. Setidaknya revitalisasi ini, masyarakat tidak terbebani dengan adanya kenaikan harga, akibat kelangkaan bahan pokok. Selain memainkan perannya, fungsi Bulog diperkuat untuk melindungi konsumen dan produsen seka-

ligus. Setidaknya keuntungan yang didapat dari revitalisasi ini, konsumen dilindungi dari lonjakan harga kebutuhan pokok. Sedangkan produsen dilindungi dari penurunan harga panen. Pada saat panen pun harga bahan kebutuhan pokok melonjak dan keuntungan dari lonjakan harga itu tidak dinikmati petani, melainkan segelintir pedagang atau lebih banyak di nikmati tenkulak. (**) PenulisMerupakanKetua KarangTarunaRw09Kebon JerukJakartaBaratdan Leader Samudera Down Hill Mountaine Bike Community



6 September 2012


NYAWA SUHARDI MELAYANG SIMALUNGUN– Niat Suhardi alias Adik untuk melerai Supriatin dengan terdakwa Christian Siregar alias Cipet (30) yang cek-cok di warung tuak milik Litawati di Kampung Bandar Syahkuda, Kelurahan Kerasaan I, Kecamatan Pematang Bandar berujung maut. Suhardi „ Christian Siregar akhirnya tewas dibacok oleh terdakwa di bagian perutnya lantaran terdakwa tidak senang karena dilerai. Hal itu terungkap di persidangan yang digelar di PN Simalungun yang dipimpin majelis hakim Ramses Pasaribu beranggotakan Gabe Doris dan AdriaDwiAfanti,Rabu(5/9).JaksaPenuntutUmum (JPU) Julius Butar-butar dalam dakwaannya menyebutkan peristiwa itu berlangsung pada Jumat (23/3) sekira pukul 20.30 WIB. “Sekira pukul 15.30 saksi Supriatin datang ke rumah korban Suhardi dan mengajaknya untuk minum tuak. Kemudian Supriatin dan korban sepakat minuk tuak di warung tuak Litawati. Mereka berangkat dengan mengendarai sepedamotor dan setibanya di sana mereka langsung memesan satu galon tuak,” sebutnya. Dia menerangkan, sambil minum tuak keduanya pun bercerita sambil menikmati gorengan yang disediakan. Karena tuak yang sudah dipesan habis, Supriatin pun kembali memesan tuak satu galon. Setelah itu, mereka kembali minum hingga Supriatin melihat terdakwa datang dan langsung memesan tuak kepada pemilik warung. Selanjutnya terdakwa duduk di kursi lain dengan jarak empat meter dari korban dan Supriatin. “Setelah beberapa jam, tiba-tiba terdakwa Christian mendatangi mereka sambil membawa gelas yang berisi tuak dan berdiri tepat di samping korban. Saat itu terdakwa tampak berbincangbincang dengan korban, namun Supriatin tidak mendengar apa perbincangan mereka. Setelah beberapa menit kemudian terdakwa mengambil tuak dari teko dan menuangkannya ke gelas Supriatin dan korban,” ungkap jaksa. Sambungnya, setelah itu terdakwa mengajak Supriatin dan Suhardi untuk tos (laga gelas). Selanjutnya Supriatin mengangkat dan melagakan gelasnya ke gelas terdakwa dan terdakwa meminum tuaknya. Sementara Supriatin membuang tuaknya ke bawah meja sambil berkata ‘sudah puas kau’. “Mendengar itu terdakwa meletakkan gelasnya di meja dan berkata kepada Supriatin ‘apanya kau’ sambil menolak dada saksi Supriatin. Saat itu, Supriatin mendekati terdakwa dan korban langsung berdiri dan melerai saksi Supriatin dan terdakwa. Saat itu korban melerai dengan menghalangi badan terdakwa. Akan tetapi terdakwa saat itu tidak mau dihalang-halangi oleh korban dan dengan spontan korban pun menolak dada terdakwa,” terang Butar-butar. Katanya, Supriatin pun melihat antara terdakwa dan korban saling menolak dan akhirnya Supriatin mengajak korban untuk pulang. Kemudian Supriatin berjalan menuju tempat sepedamotornya diparkirkan di samping warung tuak dekat pohon coklat. Sementara korban tampak berjalan menuju arah coklat, sedangkan terdakwa berjalan cepat menuju sepedamotor dan mengambil pisau belati dari bagasi keretanya. “Saat Supriatin pun berniat menghampiri korban sambil mendorong keretanya. Akan tetapi lagi-lagi terdakwa dan korban saling dorong-dorongan. Tidak beberapa lama terdakwa pun langsung membacokkan perut korban hingga usus korban terburai. Usai melakukan aksinya terdakwa pun melarikan diri dan meninggalkan korban dalam keadaan bersimbah darah,” ungkapnya. Sementara itu, usai mendengarkan dakwaan jaksa, kuasa hukum terdakwa, Omri Gultom memutuskan tidak mengajukan eksepsi dan meminta agar hakim langsung melanjutkan ke dalam pokok perkara. Selanjutnya hakim pun memutuskan menunda persidangan karena saksi belum hadir.(mua)


Divonis Penjara Seumur Hidup MEDAN- Majelis hakim akhirnya menjatuhkan vonis penjara seumur hidup kepada terdakwa Adi Aryanto (35), yang membunuh dan memerkosa kakak iparnya sendiri bertempat di kamar 17, Hotel Bukit Hijau Jalan Jamin Ginting Km 11 Medan pada 27 Desember 2011 lalu.

Foto Reza

„ Musa tewas tergantung di pohon rambutan, Rabu (5/9).

Musa Tewas Tergantung di Pohon Rambutan MEDAN- Musa Daulay ditemukan penjual es cream dengan kondisi tergantung, leher terjerat akar-akaran di pohon rambutan. Saat ditemukan, pria berusia 26 tahun itu ditemukan telah tewas di pohon setinggi sekitar 5 meter di Jalan Sei Deli, Kelurahan Sei Agul, Kecamatan Medan Barat. Motif tewasnya warganya Jalan Sekata Gang Mawar ini diduga karena stress ibunya meninggal dunia 2 tahun silam. Sehingga membuat pria lajang ini kerap meminta-minta makanan kepada warga sekitar, bahkan tak segan-segan mencuri, Rabu (5/9) sekitar pukul 11.30 WIB. Penemuan mayat Musa sontak membuat warga sekitar berhamburan ke lokasi kejadian. Menurut keterangan warga sekitar, seluruhnya mengenal pria yang tergantung tersebut. Dia adalah Musa Daulay, yang mengalami gangguan jiwa sejak ibunya meninggal dunia. “Si Musa itu, si Musa gantung diri,” celoteh para ibu-ibu saat di lokasi kejadian. Menurut salahseorang wanita berumur 40-an tahun ini, Musa mengalami gangguan kejiwaan semenjak ibunya meninggal dunia. “Memang ada stres, stresnya anak itu,” ujarnya. Dikatakannya, sifat Musa kerap meminta-minta makanan kepada warga sekitar. “Sering minta-minta makanan disini, minta uang pun sering dia,” sambungnya. Puncak, stresnya Musa ditambah dirinya dipecat dari pekerjaan sebagai angkat-angkat barang di Jalan Putri Hijau. “Habis itu, dipecat pula lagi dia dari kerjaannya. Makin menjadi lah,” jelas wanita yang memakai jilbab ini pada Posmetro Medan. Hal senada juga dikatakan, Mahmud. Musa dikenalnya suka masuk ke rumah orang mengambil makanan, bahkan sampai mengambil uang.

“Memang dia suka masuk ke rumah orang, kalau dia lapar. Dia masuk aja ke rumah orang minta makan,” katanya membuka pembicaraan pada Posmetro Medan. Menurut pria berumur sekitar 50 an tahun ini, Musa juga kerap mengambil uang warga. “Mencuri suka juga,” sambungnya. Dikatakannya pria yang berjualan bunga di bundaran Jalan Adam Malik, ini jenazah korban ditemukan kali pertama penjual es cream. “Penjual es cream yang nemukan dia pertama kali, habis itu ntah kemana dia,” katanya. Warga sekitar pun yang penasaran lalu melihatnya, ternyata mayat yang tergantung itu adalah Musa Daulay. “Pernah juga kerja dengan saya, masukin tanah ke pot bunga. Cuma kalau dia lapar, dia masuk aja kerumah orang,” ucap pria yang sudah beruban ini. Namun, kondisi Musa tergantung di pohon rambutan lidahnya tidak menjulur. Dengan menggunakan baju kaos hitam, celana Lea warna biru kotoran Musa berceceran di kakinya bahkan tubuh korban sudah banyak dikerumuni semut. Selang beberapa menit, tim olah tempat kejadian perkara (tkp) pun tiba dilokasi. Usai melakukan olah tempat kejadian perkara, jenazah korban dibawa dengan menggunakan mobil patroli Polsekta Medan Barat. Hingga jenazah dibawa, abang kandung korban bernama Ahmad tak kunjung datang kelokasi kejadian. Menurut cerita warga, rumah orangtuanya telah disewakan Ahmad kepada orang lain, hingga Musa tak tahu tinggal dimana. “Rumahnya disewakan abangnya, tinggalnya nggak tentu-tentu gitu,” celoteh warga. Saat ditemui, tim olah tempat kejadian perkara mengatakan kalau

korban murni bunuh diri. “Tidak semua yang tergantung lidahnya keluar. Bisa juga ditahan oleh gigi, tapi tadi sperma keluar,” ucapnya seraya berjalan keluar dari tkp. Menurutnya, korban murni tewas bunuh diri. “Murni ini bunuh diri, karena ditubuhnya tidak ada tandatanda kekerasan,” sambungnya lagi. Kapolsekta Medan Barat Kompol Nasrun Pasaribu Sik saat dikonfirmasi di lokasi kejadian, mengatakan kalau motif dari gantung diri korban karena mengalami stres ibunya telah meninggal 2 tahun lalu. “Motifnya kita duga stres, karena ibunya meninggal dunia 2 tahun lalu,” katanya membuka pembicaraan. Menurutnya, korban tewas tergantung di pohon rambutan sekitar 8 jam lamanya. “Diperkirakan kejadian ini 8 jam lalu,” sambungnya. Menurutnya, Musa murni bunuh diri di pohon setinggi 5 meter tersebut. “Murni bunuh diri, karena tidak ditemukan tanda-tanda penganiayaan dari tubuh korban,” ucapnya. Dikatakannya, korban diketahui kerap meminta-minta makanan kepada warga sekitar. “Korban ini mengalami stres, jadi sering memintaminta makanan kepada warga sekitar sini. Dan dia kerap bermain-main dilokasi sini,” tandas perwira satu melati emas dipundaknya ini. Guna proses penyelidikan, jenazah korban pun dibawa ke RS. Pirngadi Medan. Sedangkan barang bukti berupa, akar pohon yang digunakan korban untuk menggantung dirinya serta sandal jepit korban kini diamankan ke Polsekta Medan Barat. “Mayatnya kita bawa ke rumah sakit Pirngadi dahulu, menunggu keluarganya datang,” pungkas orang nomor satu di Polsekta Medan Barat ini mengakhiri perbincangan pada Posmetro Medan. (eza/pmg)

Tempo Setengah Jam, Ibu & Anak Digarap Sekaligus TENGKU Syamsul (32), benar-benar peselingkuh yang paripurna. Kenyang mengumpul-keboi ibunya yang masih istri orang, anaknya pun juga dikumpul-gondeki. Paling gila, dalam tempo setengah jam dia berhasil menggarap ibu dan anak sekaligus, sehingga suami/bapak para wanita malang itu mencak-mencak dibuatnya. Dalam masyarakat di Jawa yang terkenal Jago-Wayang, dikenal istilah “satriya lananging jagad”, yakni lelaki yang mampu mengawini dan menggauli banyak wanita. Harjuna dapat gelar itu, karena bininya banyak, meski dengan resiko dengkul keropos. Namun di Aceh, ternyata ada juga lelaki yang berkelakuan semacam ini, tapi apa pula namanya untuk di sana? Entahlah! Yang jelas, Tengku Syamsul dari Desa Pasi Teugoh, Kaway XVI bisa disebut Sang Penakluk. Soalnya, dengan lihainya dia bisa menaklukan dua wanita emak dan anak, yang jelas-jelas masih bini orang. Apalagi di rumah Ny Zuraida

(40), memang tak dipasang CCTV sebagaimana di DPR Senayan, sehingga dengan leluasa dia bisa menuntaskan birahinya. Yang penting, suami daripada Ny Zuraida, pas tak di rumah. Asal syarat itu dipenuhi, pasti mulus itu barang. Syamsul dan Zuraida memang bertetangga, sementara suami wanita itu juga pekerja sibuk. Dus karena itu, dia tak pernah curiga dan mempermasalahkan ketika istrinya nampak akrab dengan lelaki tetangga. Dikiranya sekadar pergaulan antar tetangga biasa, padahal aslinya di situ ada juga adegan gaul-menggauli. Ibarat partai, mereka tak sekadar koalisi, tapi juga sudah sampai tahap “eksekusi”. Pekerjaan sehari-hari Tengku Syamsul adalah sopir merangkap pedagang musiman. Karenanya dia tahu persis kapan beli barang murah dan kapan harus menjualnya dengan harga mahal. Lantaran sudah terlatih di lahan bisnis, Syamsul kemudian juga tahu, kapan suami Zuraida pergi dan kapal pula

istri tetangga itu harus digauli. Ny Zuraida memang sosok wanita yang kesepian. Sebab suaminya, Muhtar (45), lelaki yang selalu sibuk dengan pekerjaannya. Berangkat pagipagi, pulang kembali baru pukul 21.00. Setelah mandi dan makan, lupa deh dengan tugas lain sebagai suami. Meski diingatkan bahwa istrimu adalah ladangmu, Muhtar suka melupakannya. Akibatnya, ladang gembur bebas gambut itu ja-

rang dicangkul dan disirami dengan air cinta kasih. Sepertinya Tengku Syamsul tahu persis gejolak batin wanita tetangga itu. Padahal Zuraida ini meski usia sudah kepala empat, tapi masih STNK (Setengah Tua Namun Kenyal) juga. Maka sebagai makhluk sosial yang sialan, dia ingin sekali memberikan pertolongan. Maklumlah, sebagai lelaki yang tipis iman, Syamsul punya prinsip: meskipun nggak jadi

Hakim berpendapat, perbuatan terdakwa termasuk sadis yang membunuh kakak iparnya hanya untuk melampiaskan dendamnya dengan alasan, kakar iparnya menjadi orang yang mengakibatkan dirinya bercerai dengan sang istri. “Mengadili terdakwa atas nama Adi Aryanto dengan hukuman penjara seumur hidup. Hal yang memberatkan prilaku terdakwa tidak berprikemanusiaan, dan tergolong sadis. Selain itu, terdakwa juga diketahui sudah kerap keluar masuk penjara,” ucap majelis hakim yang diketuai Nelson Marbun, kemarin (5/9). Dijelaskannya, terdakwa dikenakan pasal 340 KUHPidana, tentang pembunuhan berencana. Selain hal yang memberatkan karena perbuatannya tergolong sadis, majelis hakim pun memberi pertimbangan hal-hal yang meringankan terdakwa karena telah mengakui dan merasa bersalah atas perbuatannya serta selama proses persidangan berprilaku sopan. Menanggapi vonis hakim, terdakwa pun mengajukan banding. Langkah sama dilakukan JPU Nilma, yang mengaku mengambil langkah banding. Pantauan POSMETRO (grup Koran ini), sikap Adi Aryanto berbeda jauh pada saat sidang tuntutan sebelumnya. Hari itu ia tampak tenang, hal berbeda ia tunjukkan pada sidang tuntutan beberapa waktu lalu, di mana ia mengamuk dan menantang semua pengawas sel tahanan sementara Pengadilan Negeri (PN) Medan, ditengarai sebuah sendok makan. Duduk manis di bangku pesakitan ruang utama PN Medan, Adi yang mengenakan baju putih dibalut baju tahanan bernomor punggung 06 berwarna orange, Adi pun terlihat dengan seksama mendengarkan dakwaan dan tuntutan yang dirangkum dan dibacakan majelis sebelum memvonisnya. Pada persidangan yang dimulai sekitar pukul 16.00 WIB hari itu, suasana persidangan pun tampak berbeda. Hal itu terlihat adanya lima orang anggota kepolisian yang berada di ruang persidangan, sementara satu orang pengawal tahanan tampak ber-

diri sigap di sebelah meja Jaksa Penuntut Umum (JPU) Nilma. Diketahui pula, tuntutan JPU Nilma terhadap Adi, yang tinggal di Desa Karang Sari Gang UBS Kecamatan Medan Polonia ini, disahkan oleh majelis hakim yang mengenakan terdakwa pasal 340 KUHPidana, tentang pembunuhan berencana. Kasus Adi sendiri diketahui bermula pada Selasa 27 Desember 2011 silam sekitar pukul 15.30 WIB, bertempat di kamar 17 Hotel Bukit Hijau Jalan Jamin Ginting Km 11 Medan dengan sengaja membunuh Elida Hasibuan yang notabene kakak kandung mantan istrinya. Saat itu terdakwa mengundang Elida ke hotel beralasan untuk memberikan sesuatu benda atau kenang-kenangan kepada korban. Namun nahas, niatnya ternyata berubah dan berusaha memperkosa korbannya di mana sebelumnya mengatakan “kakak sudah janda sementara aku sudah duda, ya udah kita melakukan persetubuhan saja,” ujarnya sesuai BAP. Sebelum membunuh korbannya, Adi juga terbukti meminta atau memaksa korban untuk melakukan persetubuhan dengan membuka paksa celana korban. Akan tetapi korban Elida saat itu melakukan perlawanan dan berteriak minta tolong sehingga terdakwa menutup mulut korban dengan menggunakan celana panjang milik korban. Selain itu karena kalap, terdakwa menggunakan kain sprai mengikat tangan korban dan menjambak korban dan langsung menggorok leher Elida secara berulang-ulang sampai kurang lebih lima kali tebas. Setelah itu, terdakwa berusaha membakar korban dengan menyiramkan minyak bensin yang berasal dari sepeda motornya. Mau Pukul Wartawan Ketika terdakwa keluar dari ruang sidang utama, dia sempat mengancam wartawan yang ingin mengabadikan fotonya. “Dia sempat mau mukul wartawan yang ngambil fotonya, dia sempat melirik tajam ke arah wartawan dan mengepal tangannya ke arah salahsatu wartawan,” jelas salahsatu pengawal tahanan. (gib/pmg)

Foto Gibson

„ Adi Aryanto, terdakwa kasus pembunuhan saat mendengarkan putusan hakim di PN Medan. amal, tapi kan beroleh yang kenyal-kenyal! Diam-diam dia mendekati Zuraida, dan ternyata gayung pun bersambut. Maka di kala Muhtar tak di rumah, seringkali Syamsul menyetubuhi Zuraida bagaikan istri sendiri. Selama ini selalu berlangsung mulus. Bahkan pernah, ketika dia belum puas dengan pelayanan Zuraida, dia pindah ke kamar Farida (18), putri sulung Muhtar. Awalnya menolak, tapi berkat pendekatan persuasif dan kreatif, gadis itu pasrah saja. Gila nggak, sekali tepuk Syamsul dapat dua lalat. Tapi praktik kumpul kebo dan gondek (anak kerbau) itu tak selamanya mulus. Setelah berhasil menggauli Farida sebanyak 4 kali, gadis ABG itu mengadu pada ayahnya bahwa sering digauli sopir Syamsul. Wah, sudah barang tentu si ayah marah sekali, sehingga dilaporkan ke polisi. Dalam pemeriksaan terungkap bahwa Syamsul memang sudah biasa menggarap ibu dan anak. Makin terkejut lagi si ayah. (int)

Telat Pulang, Istri Dipukuli MEDAN- Hanya karena terlambat pulang ke rumah, Abdul Rohim (32) nekat memukuli istrinya Melisa (29). Akibatnya, warga Jalan Marwar, Medan Polonia ini memilih membuat pengaduan ke Polresta Medan. Atas kejadian tersebut paha, tangan dan betisnya korban mengalami memar karena dipukuli sang suami, Rabu (5/9) siang. Laporan Kekerasan Dalam Rumah Tangga (KDRT) di Unit Perlindungan Perempuan dan Anak (UPPA) Polresta Medan itu tertuang dalam No Laporan:R/499/XI/2012/SPKT RESTA MDN. Kepada petugas, korban mengaku, kejadian pemukulan itu terakhir kali Senin (3/9), saat itu korban yang baru pulang dari tempatnya bekerja di Jalan Brigjen Katamso/Kampung Baru pulang ke rumah, Selasa (4/9), sekitar pukul 22.30 WIB. Sesampainya di rumah, ia lang-

sung dimaki-maki suaminya dan menudingnya telah mangkal sebelum tiba di rumah. Mendengar itu, korban pun tidak terima dan menjawab semua perkataan suaminya, hingga tersangka pun kalap menunjangi istrinya sampai tersungkur. Beruntung, aksi main hakim sendiri itu tak berlangsung lama. Pasalnya, anak bungsunya terbangun dari tidurnya hingga pertengkaran mereka terhenti. Diketahui, sejak setahun terakhir, suaminya memang kerap memukulinya, tepat semenjak dirinya bekerja di Jalan Brigjen Katamso. Karena takut aksi main hakim sendiri itu berulang-ulang, korban akhirnya memilih membuat pengaduan ke Mapolresta Medan atas kejadian tersebut yang kini kasus KDRT tersebut masih dalam penyelidikan oleh unit PPA, Polresta Medan. (eza/ pmg)



6 September 2012

Truk TPL Rusak Jembatan Aek Simare Sambungan Halaman 1 Tambunan, kepada METRO baru-baru ini mengatakan, kerusakan tersebut bukan hanya tanggungjawab pihak kontraktor. Akan tetapi juga menjadi tanggungjawab PT TPL. “Pihak TPL juga harus bertanggungjawab, truk mitranya kerap membawa tonase melewati batas yang ditentukan. Lihat saja sepanjang jalan ini, disana-sini berlobang dan bergelombang. Jangankan jembatan itu, robot juga hancur jika digilas truk TPL,” kata Jonny. Ia juga menegaskan, Pemkab Toba Samosir juga harus ikut bertanggungjawab atas kerusakan jalan dan jembatan Aek Simare. “Pemda kan punya Dinas Perhubungan, dimana mereka..? Kenapa truk-truk mitra TPL itu tidak ditindak? Saya menduga mereka sudah dinina bobokan TPL sehingga tidak berkutik,” imbuhnya. Espon Simanjuntak, selaku Kepala Dinas Perhubungan Pemkab Toba Samosir, ketika diminta tanggapannya seputar over tonase truk mitra TPL dan kerusakan jembatan sementara Aek Simare melalui sambungan short messege service (SMS) ponselnya, tidak memberi jawaban. Disebut Raja Jalanan Truk pengangkut kayu ekaliptus dan kayu alam milik PT Toba Pulp Lestari yang melintas di sepanjang ruas jalinsum yang ada di Kabupaten Humbang Hasundutan, Tapanuli Utara dan Toba Samosir disebut “raja jalanan”. Pasalnya, truk-truk mitra TPL kerap memakan badan jalan hingga melewati garis pembatas arah berlawanan. Tak pelak, sejumlah pengendara roda dua dan roda empat sering terganggu akibat kehadiran truk mitra PT TPL di jalan raya. ”Kalau sudah sore dan malam hari, jalan dari Kota Dolok Sanggul, Kabupaten Humbahas menuju Kota Siborongborong, Kabupaten Taput akan dipenuhi truk mitra TPL. Kalau mau mendahului truk itu, terpaksa mobil saya sering masuk ke beram jalan. Karena supir truk mitra TPL itu takkan mau ke pinggir Karena takut terbalik akibat muatan kayu gelondongan yang sangat banyak,” kata L Tarihoran (46) salah satu pengemudi truk, Selasa (4/9) di Dolok Sanggul. Ia menyebut, bahwa pada Tahun 2010, truk yang dikemudikannya pernah terperosok ke pinggir jalan akibat berusaha mendahului truk pengangkut kayu milik TPL. ”Tahun 2010 truk saya sudah pernah masuk beram karena berusaha mendahului truk mitra TPL. Waktu itu, disekitar Desa Silaban saya sudah membunyikan klakson untuk mendahului, tapi setelah berusaha lewat, truk mitra TPL itu tak mau keluar dari jalur pembatas jalan. Akibatnya, truk saya terporosok untuk mengantisipasi kecelakaan,” papar Tarihoran. Humas PT TPL, Lambertus Siregar, saat dihubungi METRO, Rabu (5/9) melalui ponselnya berkilah bahwa penyebab kerusakan jembatan Aek Simare tidak serta merta akibat truk mitra TPL. ”Kan dari sana juga banyak kendaraan lain lewat. Termasuk truk, bus angkutan, pokoknya semua kendaraanlah,” kilah Lambertus. Namun, ditanya berapa banyak truk mitra PT TPL yang lewat membawa 20 ton lebih kayu gelondongan, Lambertus justru mengaku terdapat sekitar 100 lebih truk pegangkut kayu perusahaan pulp itu setiap hari. ”Kalau jumlah truk mitra kita adalah sekitar seratus truk setiap hari yang lewat dari jembatan itu,” imbuhnya. Sedangkan terkait pengemudi truk mitra TPL yang kerap “memborong” ruas Jalinsum Siborongborong-Dolok Sanggul, Lambertus mengatakan, bahwa pihaknya selama ini sudah sering mengimbau para pengemudi truk pengangkut kayu milik TPL untuk taat aturan dan tertib berlalu lintas. “Supir sudah sering kita ingatkan agar mentaati tertib lalu lintas, termasuk kita imbau juga kepada pemilik truk,” katanya.(bram/hsl/nasa)

Pilih Cara Tradisional Sambungan Halaman 1 Dalam banyak hal, cara-cara tradisional tak pernah ditinggalkan. Salah satunya untuk urusan perawatan kecantikan. Hal itu juga dilakukanolehartisAuraKasih.Mulaidaripijat, lulur sampai totok muka menjadi ‘obat’ pilihan Auraagartetapterlihatcantik.Alhasil,biayayang dikeluarkan pelantun ‘Mari Bercinta’ itu pun lebih murah dibanding perawatan modern. “Alhamdulillah nggak yang harus mahalmahal,suntiksana-sini,tradisionalaja,pijit,lulur, totokmuka,akutradisionalbanget,”tuturnyausai mengisi acara musik ‘DahSyat’ di Studio RCTI, KebonJeruk,JakartaBarat,Rabu(5/9).(int)

Keluarga Menduga Wanda Dibunuh Sambungan Halaman 1 seorang keluarga korban usai diperiksa petugas Polsek Pandan, Rabu (5/9) di Mapolsek Pandan. Pria yang tinggal di Kotanopan, Kabupaten Mandailing Natal (Madina) itu menyebutkan, meskipun status Rudolf dalam perkara ini ditetapkan masih sebatas saksi, namun tidak tertutup kemungkinan Rudolf terlibat dalam kasus tewasnya Wanda. “Bahkan kami menduga, kalau Rudolf bukan saja hanya sebatas terlibat, namun kemungkinan besar dialah pelaku yang menyebabkan tewasnya Wanda,” ujar pria yang mengaku

mereka (Wanda dan Rudolf, red) juga sudah saling mengenal. “Logikanya, tak mungkin Wanda bisa masuk ke kamar hotel yang dipesan orang lain tanpa ada kunci di tangannya. Itu berarti, Rudolf dan Wanda saat itu ada di kamar itu atau minimal Rudolf pasti mengetahui kedatangan Wanda saat itu,” jelasnya. Untuk itu, kata Burhanuddin, sebaiknya polisi melakukan penahanan terhadap Rudolf guna mencegah Rudolf melarikan diri di saat penyidikan sedang berjalan. “Apalagi kalau hasil penyidikan mulai mengarah kepada Rudolf sebagai pelaku, tentunya ia akan mempersiapkan skenario bagaimana

suami Wanda bertugas di Papua sekitar 7 tahun lalu tidak pernah memberikan kabar kepada kami, terlebih kepada Wanda sebagai istrinya,” tukasnya lantas menambahkan dirinya jarang berkomunikasi dengan Wanda sejak mereka menikah. Namun demikian, sambungnya, meskipun hingga saat ini mereka tidak pernah mengetahui kabar dan keberadaan suami Wanda, namun mereka yakin kalau suami Wanda tersebut masih hidup. “Kami yakin dia (suami Wanda,red) masih hidup, meskipun kami tak lagi mengetahui dimana dia berada dan bagaimana kabarnya. Kamipun tak tahu apa alasannya dia tak mau memberitahukan kabarnya hingga saat ini,” tandasnya sambil sesekali mengisap rokok mildnya. Ia mengaku, terakhir kali bertemu dengan Wanda saat lebaran 2 tahun lalu di Langsa, dimana hampir seluruh keluarga besar mereka berkumpul saat

itu. “Disitulah aku terakhir ketemu adik saya Wanda, saat merayakan lebaran di kampung halaman. Sampai akhirnya beberapa hari lalu aku mendengar kalau Wanda ditemukan tewas di salah satu kamr hotel di Pandan,” tandasnya. Ia mengatakan, Wanda anak ke 6 dari 10 bersaudara itu merupakan anak yang ramah, mudah bergaul, manja, periang dan sedikit tomboy serta tidak cengeng. “Itu makanya kedua orangtua kami shock mendengar kematian Wanda. Apalagi saat ini umur ayah sudah 80 tahun dan ibu umurnya sekitar 70 tahun, tak percaya kalau Wanda sudah pergi untuk selamanya meninggalkan kami,” ucapnya lirih. Amatan METRO, selain rasa letih menghiasi wajah mereka, rasa kesedihan juga masih terlihat di wajah keluarga korban yang datang ke Mapolsek Pandan dengan mengendarai mobil Daihatsu Xenia dengan nomor polisi BK 1323 QH.(tob/nasa)

tadinya mau dibawa ke Langsa untuk anak Wanda. Tapi tidak sempat,” tuturnya dengan mata berkaca-kaca. Sementara itu abang sepupu Wanda, Burhanuddin Hasibuan menuturkan, pakaian milik almarhum memang sengaja diambil untuk dikuburkan. Sedangkan televisi dan digitalnya, loudspeaker aktif dan DVD akan dibawa ke Langsa. “Sementara barang-barang lainnya, seperti tilam, kipas angin dan lemari box plastik dan barang-barang lainnya direlakan saja, enggak perlu dibawalah,” ujar Burhanuddin.

“Yang kesalnya kenapa dibilang bunuh diri, padahal kalau melihat fotofotonya itu seperti bukan orang yang bunuh diri. Dari foto-foto itu, kami melihat ada bekas memar di bahu, di pundak, di kepala. Karena itu kuat indikasinya dia dianiaya dulu, lalu digantung setelah meninggal,” tukas Adi. Ditanya apakah adiknya itu pernah bercerita tentang masalah dalam kehidupannya belakangan ini, Adi membenarkan. Hanya seperti apa masalah itu, Wanda tidak mau terbuka secara detail menceritakan. “Dia itu orangnya tertutup kalau soal masalah pribadinya. Paling kompak curhat sama kakak perempuan yang paling sulung yang tinggal di Langsa. Kemudian kepada kakak perempuan nomor tiga dan adik perempuan nomor sembilan yang juga tinggal di Langsa. Katanya Wanda pernah ngeluh sedang ada masalah, cuma dia tidak cerita detail apa masalahnya itu,” tukas Adi. Selain kepada kakak dan adik perempuannya itu, Wanda juga pernah curhat kepada salahsatu sahabatnya yang tinggal di Langsa. Sahabatnya itu seorang pria yang sehari-hari bekerja sebagai penjual buah. Saat itu Wanda mudik Lebaran ke Langsa. Bahkan, sambung Adi, Wanda pernah mengajak temannya itu ikut ke Sibolga. Nanti balik lagi ke Langsa pada Lebaran ke-10. Tapi teman Wanda itu menolaknya. “Temannya itu cerita ke saya, kalau Wanda memang pernah curhat dan dia bilang sedang ada masalah. Cuma tak tahu juga apa masalah pastinya. Nanti kalau bersedia, temannya itu akan kami bawa juga untuk memberi keterangan kepada polisi di sini. Temannya itu juga ngaku sempat diajak ikut ke Sibolga, jalan-jalan. Nanti balik pada lebaran ke-10. Tapi temannya itu enggak mau. Ternyata memang benar, Wanda benar-benar “pulang” (meninggal dunia) pada lebaran ke-11,” timpal Adi. Apakah ada kecurigaan kalau Wanda mati dibunuh, Adi menjawab bisa jadi. Pihak keluarga sendiri curiga persoalan Wanda adalah karena ia tengah hamil. Lalu, Wanda meminta pertanggungjawaban kepada orang yang menghamilinya. Tapi, karena kehamilan itu tidak diinginkan, maka Wanda dibunuh. “Memang sepintas kehamilannya tidak begitu kelihatan, karena memang Wanda bertubuh agak gemuk. Bawaannya pun ceria saja. Jadi tidak bisa diterka,” pungkasnya. (mor/nasa)

Wanda Janda Brimob, Beranak Satu

Sambungan Halaman 1 seorang personel brimob yang sejak 7 tahun lalu pindah tugas ke Papua. “Adik saya itu sudah menikah dan telah memiliki seorang putri dari hasil hubungan mereka. Saat ini usianya sudah 10 tahun dan berada di Langsa bersama kedua orangtua kami. Wanda ditinggal pergi suaminya sejak 7 tahun lalu karena menjalankan tugasnya sebagai anggota Brigadir Mobil (Brimob) di Papua,” terang Faisal Fadli alias Adi, abang kandung Wanda usai di periksa di Mapolsek Pandan, Rabu (5/9) di Pandan. Menurut Adi, hubungan antara Wanda dengan suaminya memang sudah bercerai sesuai dengan ajaran Islam. Dimana suami Wanda selama 7 tahun tidak pernah memberikan kabar, termasuk memberikan nafkah lahir batin kepada Wanda. “Hubungan mereka dalam ajaran Islam disebut masa iddah. Sebab, sejak

Barang-barang Wanda Dijemput Keluarga

Sambungan Halaman 1 Mereka yang dimintai keterangan yakni kakak korban bernama Nur Baiti alias Metty, abangnya Faisal Fadli alias Adi, dan abang sepupunya Burhanuddin Hasibuan. “Kami ke sini untuk memberikan keterangan. Kami harap polisi serius menangani kasus kematian adik kami ini. Sejauh ini kami lihat polisi serius. Semoga cepatlah ini. Nanti kami balik lagi setelah ada hasil otopsi,” ujar Metty singkat, di halaman Mapolsek usai memberi keterangan, Rabu (5/9) malam sekira pukul 19.30 WIB. Informasi lebih dalam diutarakan abang kandung Wanda, Adi. Menurut Adi, pihak keluarga mendapat kabar kematian Wanda dari salahseorang personel Polres Tapteng yang sekampung dengan mereka di Kota Langsa Aceh Timur pada Jumat (31/8) siang. Dimana polisi itu memberitahukan korban ditemukan tewas tergantung di lis tirai jendela kamar 304 Lantai III Hotel Bumi Asih Pandan. “Awalnya kami memang enggak yakin, enggak nyangka begitu. Tapi itu sudah terjadi, jadi harus sabarlah. Kalau kerluarga di rumah shock berat waktu mendengar kabar itu,” tukas Adi yang sejak beberapa tahun terakhir tinggal di Idi, Aceh Timur atau berjarak sekitar 24 km dari Langsa. Sedangkan soal kedatangan mereka ke Polsek Pandan, selain atas permintaan polisi untuk memberi keterangan, mereka juga ingin mengambil barang-barang pribadi milik Wanda yang masih tersimpan di kamar kos-nya di Gang Eks Hotel Sarina/Pabrik Roti Jalan S Parman, Kelurahan Pasar Belakang, Kecamatan Sibolga Kota, Kota Sibolga. “Dari Langsa, semalam sore (Selasa, 4/9) kami sampai di Medan. Kemudian kami lanjut ke Sibolga dengan mobil pribadi rentalan. Sampainya tadi sekitar jam 4 subuh (Rabu, 5/9). Kami sempat beristirahat sejenak di dalam mobil. Kemudian ke tempat kos almarhum dan ke rumah salah seorang kerabat di Pandan. Baru siang ini ke polsek,” tutur Adi. Adapun barang-barang yang diambil seperti 1 unit televisi lengkap dengan digitalnya, sekoper besar pakaian milik almarhum, dua unit loudspeaker aktif dan 1 unit DVD. Yang menarik, Metty terlihat membawa sebuah boneka beruang berwarna pink dan lampu belajar dari dalam kamar itu. “Boneka dan lampu belajar ini

Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan : Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

sebagai keponakan orangtua Wanda tersebut. Menurut Burhanuddin, kecurigaan pihak keluarga Wanda atas terlibatnya Rudolf salah satunya dibuktikan dengan nama pemesan kamar 304 di lantai III Hotel Bumi Asih yakni Rudolf Situmeang. “Bahkan kami mendengar selentingan, kalau almarhumah Wanda berteman dengan Rudolf. Sementara Wanda ditemukan tewas dalam kondisi tak wajar di dalam kamar yang dipesan Rudolf Situmeang,” tukasnya. Berdasarkan hal itu, lanjutnya, pihak keluarga meyakini kejadian ini tidak terlepas dari Rudolf Situmeang, sebab

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Amatan METRO, di rumah koskosan itu ada lima kamar. Lantainya papan, dindingnya triplek dan papan. Rumah kos-kosan di atas laut itu berada tepat di belakang rumah induk, yang juga rumah pengelola kos. Wanda tinggal sendirian di kamar yang ditempatinya sebelum meninggal dunia. Tapi anehnya, saat pengamabilan barang-barang itu, tak satupun penghuni kos lainnya yang terlihat. Bahkan kamar kos lainnya dalam keadaan tertutup. Menurut Ibu Kos, Ida, sehari setelah kematian Wanda, para penghuni kos lainnya jarang pulang. Bahkan, sebagian dari mereka memilih pindah kos. “Iya, saya rasa mereka pada takut. Ada yang enggak pulang, ada yang pindah kos,” aku Ida, ibu kos korban. Ida mengatakan, almarhum Wanda sudah setahun ngekos di sana. Biaya kos dan listrik Rp300 ribu sebulan. Sekilas, menurut Ida, Wanda adalah sosok anak yang baik dan ramah. Karena itu Ida mengaku tidak menyangka sebegitu tragisnya kematian Wanda. Kesan terakhir dengan anak kos-nya itu, bahwa sebelum pergi keluar pada hari Rabu (29/9) sore, Wanda masih sempat mencicipi kue dan sirup buatan Ida. “Waktu itu saya sempat tanya dia soal uang kos. Karena sudah telat pembayarannya. Dia jawab belum ada uang. Karena katanya dia baru bagusin kreta-nya dan kena Rp350 ribu. Itu saja, lalu dia bawa kue dan sirupnya ke kamarnya. Sorenya dia pergi keluar,” tukas Ida yang mengaku amat kaget saat mendengar kabar kematian Wanda. Ditanya bagaimana perasaan pihak keluarga atas kematian Wanda, abang korban, Adi mengakui bahwa ada kejanggalan. Melihat dari foto-foto dokumentasi yang diterima pihak keluarga, mereka meragukan kalau Wanda bunuh diri.

Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana:... Kordinator Liputan Ridwan Butarbutar, Asisten Kordinator Liputan (Bonapasogit): Horden Silalahi. Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Marihot Simamora, Freddy Tobing, Masril Rambe , Rinawati Marbun (koresponden barus), Jonter (Humbahas), Bernard Lumbangaol, Hengki Tobing (Taput), Hermanto Turnip, Brams Situmorang (Tobasa) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel),

untuk menyelamatkan diri, salah satunya dengan melarikan diri atau menghilangkan jejak ke suatu tempat,” tandasnya. Menurut Burhanuddin, pihak keluarga juga mensinyalir Wanda memang sengaja dihabisi nyawanya untuk menghilangkan sebuah barang bukti terkait hubungan Rudolf dan Wanda. “Kemungkinan bisa saja Wanda sudah hamil lalu minta pertanggungjawaban kepada Rudolf. Terus Rudolf kalap mendengar hal itu, sehingga terpikir bagaimana menghilangkan aib itu dengan cara membunuh Wanda. Begitupun, kita serahkan dan kita percayakanlah kepada petugas kepolisian untuk mengungkap tabir kematian Wanda. Kami berharap pelakunya bisa dihukum seberatberatnya,” harapnya. Saat ditanya sejauh mana mengenal Wanda, Burhanuddin mengaku tidak begitu mengenal Wanda dibandingkan kakak atau abang korban yang lain. “Mereka ada 10 bersaudara, dan secara pribadi aku tidak begitu mengenal Wanda. Namun kalau abangabangnya dan kakak-kakaknya yang lain saya kenal, sebab setahu saya, Wanda itu anak ke 6 dari 10 bersaudara,” tandasnya. Terpisah, Kapolsek Pandan AKP HE Edi Sidauruk SH membenarkan bahwa kedatangan pihak keluarga almarhum Wanda untuk dimintai keterangan terkait hubungan kekeluargaan. “Ya, kita mintai keterangan sebagai pihak keluarga korban,” ujar Kapolsek singkat di Mapolsek, Rabu (5/9). Amatan METRO, Rudolf Situmeang sebagai pemesan kamar itu juga terlihat di Mapolsek dan dimintai keterangan sebagai saksi. Penyidik juga memeriksa saksi-saksi lainnya seperti beberapa pagawai Lapo Harambir. Sebab, Rudolf Situmeang juga sempat berada di kafe milik Hotel Bumi Asih Pandan itu sebelum check in pada Rabu (29/8) malam. Lalu, terlihat juga beberapa kolega Rudolf Situmeang, di antaranya Patricius Rajagukguk dan seorang pengacara asal Balige Tobasa, Timbul Tambunan bersama seorang lagi te-

mannya. “Semua yang kita mintai keterangan masih sebatas saksi-saksi,” tukas Kapolsek. Sebelumnya, Rudolf dan dua temannya Timbul Tambunan dan yang seorang lagi datang dengan mengendarai mobil pribadi jenis Toyota Avanza berwarna hitam plat B 1812 TQN sekitar pukul 13.00 WIB. Tapi anehnya, beberapa jam kemudian, Timbul Tambunan dan seorang temannya itu pergi meninggalkan Mapolsek dengan mengendarai mobil itu. Tapi, tanpa Rudolf Situmeang yang terlihat masih menjalani pemeriksaan di salahsatu ruangan di Mapolsek itu. Saat coba dikonfirmasi METRO terkait kedatangannya lagi ke Mapolsek, Rudolf terkesan cuek. Padahal, kemarin ketua DPC Partai Hanura itu sudah berjanji kepada METRO untuk memberikan pernyataan terkait keterlibatannya dalam kasus kematian Wanda. Jasad Wanda Dikebumikan di Langsa Setelah selesai diotopsi oleh Tim Labfor Poldasu di RSU Pirngadi Medan, jasad Wanda telah dikebumikan di kampung halamannya pada Sabtu (1/9) malam. Pihak keluarga juga menggelar tahlilan pada Jumat (31/8) malam di Langsa, tepatnya pada hari Wanda didapati tewas tergantung di kamar 304 Lantai III Hotel Bumi Asih Pandan, Tapteng. “Jasadnya sudah dikebumikan Sabtu malam lalu. Begitu sampai di rumah setelah selesai diotopsi di Medan, langsung dibawa ke kampung dan dikebumikan malam itu juga. Jasadnya sempat disholatkan lalu dikebumikan. Tapi malam sebelumnya sudah digelar tahlilan,” kata abang kandung almarhum, Faisal Fadli alias Adi di Polsek Pandan, Rabu (5/9). Pihak keluarga, masih Adi, juga berencana mengadakan tahlilan tujuh hari setelah kematian Wanda. “Ya, kami juga mau mengadakan tahlilan malam ke tujuh kematian almarhum, makanya ini kami buru kalau bisa cepat pulang ke Langsa dulu untuk ikut tahlilan itu,” pungkas Adi. (mor/tob/nasa)


„ Suasana ketegangan antara massa dengan petugas di pintu gerbang PT G-Resources Martabe.

MASSA LEMPAR BATU, Polisi Letuskan Tembakan Sambungan Halaman 1 pukul 10.00 WIB hingga 13.00 WIB. Dalam waktu bersamaan demo juga terjadi di Desa Telo atau sekitar enam kilometer dari Pasar Batangtoru. Di lokasi ini lah tempat terjadinya aksi saling dorong dan lempar batu. Dari pukul 10.00 WIB hingga pukul 12.00 situasi memanas. Massa dan petugas keamanan terlibat saling dorong dan lempar batu. Ketegangan antara warga dengan petugas keamanan baru reda ketika Wakapolres Tapsel Kompol Zainuddin dan perwakilan warga berbicara dari mobil dengan pengeras suara. “Saudara-saudara harus tenang, aso hita buat kesepakatan (agar kita bisa membuat kesepakatan),” kata Wakapolres. “Madung hami pareso langsung inda dong dope anggo pemasangan pipa i (kami sudah tinjau langsung bahwa pemasangan pipa belum ada),” kata salah seorang perwakilan warga dari atas mobil polisi. Namun, setengah jam kemudian, massa yang terdiri dari ibu-ibu, remaja putri, dan bapak-bapak yang memenuhi simpang tiga menyusul ke Desa Telo. Mereka terus menyuarakan keberatan atas rencana pemasangan pipa pembuangan tambang emas itu yang akan dialirkan ke sungai Batang Toru. Dan beberapa saat tanpa dikoman-

Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan

doi, massa bergerak cepat menuju areal tambang yang berjarak sekitar 1,5 km dengan berjalan kaki dan naik sepeda motor serta becak. Dan lagilagi ribuan warga yang bermaksud memasuki areal tambang dihadang ratusan personil keamanan, dan ketegangan kembali terjadi antara massa dan petugas. Bahkan, massa berteriak bakar tambang emas tersebut. Mendengar teriakan ini, polisi melepaskan tembakan peringatan sebanyak satu kali. Akhirya sekitar 20 perwakilan warga yang ada di lingkar tambang diperbolehkan masuk untuk berdialog bersama pihak perusahaan. Namun hasil perbincangan masih belum mencapai kesepakatan hingga menjelang sore kemarin. Beberapa warga yang dimintai keterangan terhadap tujuan utama mengelar aksi tersebut mengaku keberatan jika limbah tambang dibuang ke sungai Batang Toru yang merupakan sumber kehidupan dan penghidupan ribuan warga di pinggirannya. “Sesuai dengan sosialisasi 2008 lalu limbah tambang direncanakan akan dibuang ke laut. Kenapa justru dibuang ke sungai Batang Toru. Padahal ribuan warga memanfaatkan aliran sungai tersebut termasuk untuk minum,” tegas beberapa warga dengan setengah berteriak menjawab pertanyaan METRO. (ran)

Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



6 September 2012

Sosialiasi Pemilu KPU Tapteng Diabaikan 15 Parpol Sambungan Halaman 8 parpol untuk dapat segera melaksanakan pendaftaran di kantor KPU Tapteng, selain untuk memperlancar proses pendaftaran, perlu diperhatikan tenggat waktu pendaftaran dan masa untuk melakukan perbaikan kelengkapan berkas persyaratan,” kata Ketua Komisi Pemilihan Umum (KPU) Tapteng, Ir Dewi Eilfriana dalam sambutannya di acara yang dibuka secara resmi oleh Bupati Tapteng, Raja Bonaran Situmeang SH MHum. Ketua KPU Tapteng ini juga mengharapkan parpol tidak mendaftar di saat-saat akhir (injury time), karena akan dapat merugikan partai itu sendiri yang tidak memiliki waktu lagi untuk melengkapi kekurangan jumlah berkas-berkas persyaratan. Menurutnya, hanya pada parpol yang menyerahkan berkas secara lengkap, verifikasi administrasi akan dilakukan dan hanya pada parpol yang lolos verifikasi administrasi dilakukan verifikasi faktual. “Pada pelaksanaannya nanti, kami akan melakukan verifikasi administrasi daftar nama parpol dan kartu tanda anggota (KTA), verifikasi faktual kepengurusan dan kantor parpol tingkat Kabupaten dan Kecamatan, serta verifikasi faktual keanggotaan parpol. Dan yang juga penting adalah keterwakilan perempuan sebanyak 30% pada kepengurusan parpol,” sebut Dewi. Adapun jadwal verifikasi di Kabupaten/Kota, verifikasi faktual 4 – 24 Oktober 2012, pemberitahuan hasil verifikasi faktual kepengurusan dan keanggotaan 25 – 30 Oktober 2012, perbaikan 31 Oktober – 7 November 2012, verifikasi hasil perbaikan 8 – 21 November 2012, penyusunan berita acara 22 – 25 November 2012 dan penyampaian hasil verifikasi kepada KPU propinsi 26 – 30 November 2012. Sementara itu, Bupati Tapteng Raja Bonaran Situmeang SH MHum saat memberikan kata sambutan sekaligus membuka secara resmi acara sosialisasi juga berharap kepada seluruh parpol untuk mengikuti segala ketentuan dan kelengkapan berkas administrasi sesuai ketentuan perundangundangan dan peraturan KPU. “Saya yakin dan percaya, KPU juga akan melakukan verifikasi dengan sebaik-baiknya,” ujar Bonaran. Sebelumnya, Sekretaris KPUD Tapteng, Nur Halijah dalam laporannya menyampaikan, acara sosialisasi dilaksanakan sesuai amanat UU No 8 tahun 2012 tentang Pemilu anggota DPR, DPD dan DPRD serta peraturan KPU No 07 Tahun 2012 tentang tahapan, program dan jadwal penyelenggaraan Pemilu anggota DPR, DPD dan DPRD tahun 2014 dan peraturan KPU No 08 tahun 2012 tentang pendaftaran, verifikasi dan penetapan parpol peserta pemilu anggota DPR, DPRD propinsi dan DPRD Kabupaten/Kota. Pantauan METRO, turut hadir diacara itu selain Ketua KPU Tapteng Ir Dewi Eilfriana, dan empat anggota KPU Tapteng lainnya Siti Syarifah Simanjuntak, Ir Halomoan F Lumbantobing, Makmur Panggabean dan Juaja Hutajulu BA, para ketua dan sekretaris parpol se-Tapteng, pimpinan Satuan Kerja Perangkat Daerah (SKPD) Pemkab Tapteng dan anggota KPU Propinsi Sumut Turunan Gulo SP MSP, yang memberikan penjelasan secara mendetail terkait sosialisasi tahapan pemilu, pendaftaran dan verifikasi parpol menjadi peserta pemilu anggota DPR dan DPRD tahun 2014 tersebut. Dalam salah satu pokok paparan, Turunan menjelaskan beberapa syarat parpol menjadi peserta pemilu beberapa diantaranya yang paling penting untuk daerah adalah memiliki kantor dan alamat tetap (keabsahan kantor), memiliki keanggotaan sekurang-kurangnya 1000 orang atau 1/1000 dari jumlah penduduk pada kepengurusan parpol di Kab/Kota dibuktikan dengan kepemilikan Kartu Tanda Anggota (KTA). (tob)

Talud Hancur Sibolga Tercemar Sambungan Halaman 8 terang Swito kepada METRO, Rabu (5/9) di Sibolga. Namun yang pasti, sambungnya, masyarakat yang bermukim di daerah pondok reformasi sudah sangat resah, sebab kondisi itu telah menimbulkan bau busuk diakibatkan terjadinya tumpukan sampah di lokasi Talud.

“Kenapa itu terjadi, karena puing-puing bangunan Talud telah menutup atau menyumbat kelancaran aliran air parit menuju ke laut. Sampah baru akan terlepas dan menghilangkan aroma busuk, bila telah terjadi air pasang laut. Tapikan, air pasang laut tidak terjadi secara terus menerus,” tukasnya. Disinggung kapan Talud itu

rusak, Kepling I Kelurahan Kota Beringin mengaku kurang mengetahui persis kerusakan itu dan apa penyebabnya. “Tapi, saya yakin, Talud itu rusak parah atau hancur seperti itu pada tahun ini. Soalnya, pada tahun lalu, kerusakan belum seperti itu walaupun kerusakannya sudah terlihat,” beber Swito. Kepala Dinas (Kadis) Pekerjaan Umum Daerah (PUD)

Pemko Sibolga, Ir Thamrin Hutagalung yang dihubungi mengaku belum mengetahui informasi mengenai kerusakan Talud itu. “Nanti kita akan coba cek, guna dapat diprogramkan pada TA 2013 mendatang,” tandasnya. Pantauan METRO, Talud tersebut terdiri dari dua dinding bangunan dan menjorok sampai ke pantai. Talud ini satu

rangkaian dengan bangunan drainase (parit pembuangan) yang berada di wilayah jalan KH Zainul Arifin. Polusi udara berupa bau busuk timbul karena bukan hanya sampah dan kotoran rumah tangga masyarakat kota Beringin yang bermuara ke Talud tersebut, melainkan juga sampah dan kotoran yang berasal dari pasar kota Beringin. (tob/nasa)

Paket Internet Istri Wamen Pertanian Kunjungi Tapteng Lihat Kesiapan GPTP Terbaik 2 GB Dengan Koneksi Tercepat

Sambungan Halaman 8

anak rantau putra Tapteng Manca Hutagalung, kepala BPPT DKI Jakarta, serta dari Dinas Pertanian dan BPTP Sumatera Utara. Dalam rakor persiapan di ruang rapat Cendrawasih Pemkab Tapteng yang dipimpin Bupati Tapteng Raja Bonaran Situmeang, diungkapkan bahwa Tapteng siap mensukseskan kegiatan berskala nasional tersebut. Hadir Ketua TP PKK Tapteng, Ny Normaida br Simatupang, Waket TP PKK Ny Evealina MS, Kadis Kehutanan Darmi Siahaan sebagai koordinator panitia daerah, jajaran pimpinan SKPD, para camat dan perwakilan organisasi perempuan dan instansi vertikal terkait. Direncanakan, 10 lokasi penanaman di lahan kritis. Di antaranya di sekitar kawasan PLTA Sipan Sihaporas Kecamatan Pandan, sekitar areal Terminal Terpadu Pandan di Jalan M Panggabean/Jalan Baru. Kemudian di Desa Sipange Kecamatan Tukka, di Bukit Anugrah Kecamatan Sitahuis, di

kawasan pemandangan Hajoran Kecamatan Pandan, di areal PLTU Labuan Angin Kecamatan Tapian Nauli, sekitar Asrama Haji Kecamatan Pinangsori, kawasan SMP Negeri 1 Sibuni-buni Kecamatan Sarudik, dan di kawasan hutan Pulau Mursala Kecamatan Tapian Nauli. Total bibit pohon yang bakal ditanam sebanyak 32.500 batang. Terdiri dari pohon jabon, mangga, tanjung, jengkol, petai, melinjo, cemara laut, kelapa, surian/ingul, durian, karet, manggis, gaharu dan trembesi. Kegiatan itu nantinya akan dipusatkan di Pantai Kahona Pandan. Ditandai dengan penyerahan bibit secara simbolis lalu menyebar ke tiap lokasi yang direncanakan. Hadir Ketua TP PKK Tapteng, Ny Normaida br Simatupang, Waket TP PKK Ny Eealina MS, Kadis Kehutanan Darmi Siahaan sebagai koordinator panitia daerah, jajaran pimpinan SKPD, para camat dan instansi perwakilan vertikal terkait. GPTPP merupakan gerakan yang diprakarsai 7 organisasi pe-

rempuan di Indonesia. Di antaranya, Solidaritas Istri Kabinet Indonesia Bersatu (SIKIB) yang diketuai oleh Ny Silvia Agung Laksono. Kemudian Kowani (Kongres Wanita Indonesia) yang diketuai oleh Ny Dewi Motik Pramono, Dharma Pertiwi yang diketuai oleh Ny Tetty Agus Suhartono (istri Panglima TNI), Bhayangkari yang diketuai oleh Ny Henny Timoer Pradopo (istri Kapolri). Lalu, Aliansi Perempuan untuk Pembangunan Berkelanjutan (APPB) yang diketuai oleh Ny Yeni Sapta, Dharma Wanita Persatuan yang diketuai oleh Ny Nila Moeloek, dan TP PKK Pusat yang diketuai oleh Ny Vita Gamawan Fauzi (istri Mendagri). Kehadiran Ibu Negara Ani Yudhoyono akan didampingi Menteri Pemberdayaan Perempuan & Perlindungan Anak, Menteri Pariwisata Ekonomi Kreatif, Menteri Bappenas, dan Menteri Kehutanan, bersama para istri menteri Kabinet Indonesia Bersatu akan hadir. Beserta para pengurus ketujuh organisasi perempuan yang tergabung di GPTPP. (mor/nasa)

Jangan Ber-HP Saat Mengemudi Sambungan Halaman 8 perangkat telekomunikasi saat mengemudikan kendaraan. Meski angka tertinggi terjadi di perkotaan. Tidak hanya pengendara mobil, ternyata pengendara sepeda motor pun menggunakan HP saat berkendara, sehingga konsentrasi si pengendera pecah. Selain itu, akibat pengemudi mengantuk juga salah satu faktor terjadinya kecelakaan. “Data yang kami peroleh, pada 2009- 2010 jumlah kecelakaan meningkat 1.200 persen akibat menggunakan telepon seluler (ponsel/hp). Karena itu SMS broadcast mengenai safety road diluncurkan. Pesannya jangan gunakan perangkat telekomunikasi saat mengemudikan kendaraan, karena dapat

menyebabkan kecelakaan lalu lintas. Layanan pesan imbauan itu juga telah dikoordinasikan dengan seluruh penyelenggara telekomunikasi,” timpalnya. Terpisah, Kasat Lantas Polres Tapteng, AKP Eddy Sudrajad SH menyatakan bahwa kasus lakalantas akibat penggunaan seluler belum pernah terjadi. Tapi, tindakan keliru itu melanggar

aturan dan tidak disarankan. “Di UU No. 22 Tahun 2009 Tentang Lalu Lintas dan Angkutan Jalan, pengunaan perangkat telekomunikasi saat mengemudikan kendaraan ada sanksinya. Bisa ditilang itu. Tapi kalau di Tapteng kecelakaan karena menggunakan perangkat telekomunikasi saat mengemudikan belum pernah terjadi,” ucap Eddy. (mor/nasa)

Sambungan Halaman 8 lainnya. Acara tersebut dihadiri Mitra dan para Outlet. Pelanggan juga bisa menikmati paket internetan sebesar 500 MB hanya dengan Rp 20.000 untuk 30 hari. Dengan kedua pilihan paket tersebut, kini pelanggan simPATI dapat melakukan asyiknya chatting, browsing, social networking, email, upload, dan download di ponsel cukup dengan mengakses *999#. Kartu perdana simPATI terbaru hadir dengan harga yang lebih terjangkau hanya Rp 3.000 sudah termasuk kuota akses 3G sebesar 100 MB selama 30 hari sejak diaktifkan. Sebagai bagian yang tidak terpisahkan dalam kehidupan seharihari, simPATI berkomitmen untuk selalu menghadirkan keceriaan guna mendukung kebutuhan komunikasi dan akses internet para penggunanya. Bentuk keceriaan tersebut diwujudkan simPATI melalui penggelaran kompetisi Dance Like Agnes yang merupakan kompetisi dance untuk mencari 20 pemenang di tingkat nasional. Mereka yang terpilih akan ikut menjadi dancer pada konser Agnes Monica di bulan Desember 2012 mendatang. Untuk mengikuti kompetisi ini, peserta cukup mengakses Pada proses berikutnya, mereka diminta untuk mengunggah (upload) hasil karya video dance mereka sendiri. Video dance yang mereka kirim merupakan video yang dikreasikan dengan beberapa gerakan Agnes Monica yang muncul pada iklan simPATI di televisi. Peserta dapat mulai mengirim video dance pada 5 September 2012. Dari seluruh video yang masuk, Agnes Monica akan memilih 200 video terbaik yang akan dipilih oleh publik melalui microsite Head of Marketing Communications Group Telkomsel Irlam-

syah Syam mengatakan, “Telkomsel menyadari bahwa jumlah pengguna mobile internet di Indonesia terus bertambah seiring dengan semakin tingginya kebutuhan masyarakat terhadap akses informasi maupun hiburan terkini. Kompetisi Dance Like Agnes merupakan salah satu tools bagi kami untuk memberikan gambaran wujud keceriaan dan gaya hidup penuh mobilitas, yang diidentikkan dengan karakteristik pengguna simPATI.” Nantinya sebanyak 20 pemenang dengan vote/like terbanyak akan mengikuti proses pelatihan bersama Agnes Monica dan NEZindaHOOD di Jakarta. Selain itu, masing-masing pemenang juga akan mendapatkan berbagai hadiah berupa Samsung Galaxy S3, uang tunai Rp 10 juta, saldo T-Cash sebesar Rp 5 juta, pulsa simPATI senilai Rp 5 juta, dan paket internet 1 GB/ bulan selama 1 tahun. “Beragam aktivitas yang saya jalani sehari-hari tentu harus diimbangi dengan akses komunikasi yang mampu memberi solusi maksimal. Kebutuhan akses internet untuk mengirim video, browsing, chatting, kirim email, dan download lagu melalui handset mutlak terpenuhi guna mendukung rutinitas pribadi. Oleh karenanya, kehadiran simPATI sangat memudahkan saya dalam berkomunikasi data karena produk ini memiliki kecepatan akses tinggi yang mencapai 7.2 Mbps,” ujar Agnes Monica selaku brand ambassador produksimPATI. Aktivitas mobile lifestyle pelanggan simPATI semakin optimal berkat dukungan jaringan terluas berkualitas Telkomsel. Lebih dari 50.000 Base Transceiver Station (BTS) termasuk di antaranya 13.000 Node B (BTS 3G) telah tersebar di seluruh wilayah Indonesia. Telkomsel juga telah menyiapkan akses bandwidth internet berkapasitas 20 Gbps demi menjamin kelancaran akses komunikasi data. (leo)


Trauma, Santri Pilih... Sambungan Halaman 1 hanguskan empat kamar ini, sejumlah santri minta izin pulang karena dijemput orangtua masing-masing. “Sebagian santri yang tinggal di kamar itu minta izin pulang dijemput orangtua masingmasing. Maklum lah kejadian seperti ini baru pertama kali terjadi sehingga santri trauma” sebut Mukhlis. Kata Mukhlis, meskipun saat ini para santri di Pontren Musthafawiyah sedang mengikuti ujian semester, khusus bagi santri yang terkena musibah itu diberikan kelonggaran berupa ujian ulang setelah mereka kembali ke asrama dari kampung masingmasing. Dalam situasi ini pihak Pontren tidak bisa memaksakan untuk mengikuti ujian apalagi santri yang berada di dua kamar yang habis terbakar dan sebagian dua kamar lain juga ikut terbakar itu trauma. “Kebanyakan mereka masih anakanak usia tingkat SMP. Wajar saja mereka trauma atas musibah ini, makanya kita berikan kelonggaran,” ujarnya. Khusus bagi kamar yang sudah terbakar, kata Mukhlis, pihak Pontren sudah mulai diperbaiki agar bisa digunakan kembali karena yang terbakar hanya ada dua kamar, yaitu di kamar 1 dan kamar 8. Dan ada dua lagi yang sebagian isi kamar ikut terbakar yaitu kamar 2 dan kamar 7. “Jumlah semua kamar di gedung Mawar itu ada 8 kamar dan

dalam 1 kamar biasanya menampung 60-70 orang,” ujarnya. Untuk saat ini, santri yang tinggal di kamar terbakar tapi tetap mengikuti ujian dipindahkan ke kamar asrama yang lain yang masih kosong, sementara untuk pakaian sekolah santri yang pakaiannya sudah ludes meminjam pakaian santri yang masuk sore. “Santri yang tinggal di kamar terbakar sudah dipindahkan ke kamar lain. Dan pakaian mereka untuk sementara meminjam pakaian temannya yang memiliki lebih dari satu seragam sekolah untuk bisa mengikuti ujian. Artinya kita tidak lagi membebani pikiran mereka dengan ujian. Siapa yang tetap ingin mengikuti ujian bisa (diikutkan) siapa yang minta izin boleh,” tambahnya. Lalu, ibu pengasuh asrama putri, Hj Hanna Chaniago menceritakan kebakaran terjadi sekitar pukul 07.30 WIB pagi ketika itu semua santri putri yang tinggal di asrama sedang melakukan tugas kebersihan pekarangan asrama dan tiba-tiba terdengar suara ledakan. Dan saat itu juga muncul api dan asap dari dalam ruangan kamar 1 Mawar, sontak santri putri yang berada di dalam kamar minta tolong. Sampai saat ini, kata Hanna, belum diketahui penyebab kebakaran. “Kami tidak tahu pasti penyebabnya, yang kami pikirkan saat ini bagaimana agar mental santri tidak terganggu atas musibah ini,” pungkasnya.(wan)

Sambungan Halaman 1 mahal-mahal, suntik sanasini, tradisional aja, pijit, lulur, totok muka, aku tradisional

banget,” tuturnya usai mengisi acara musik ‘DahSyat’ di Studio RCTI, Kebon Jeruk, Jakarta Barat, Rabu (5/9).

Selain dengan perawatan tradisional, Aura mengaku rajin minum jus agar wajahnya tetap fresh. Selain jus, ia juga tak pernah lupa untuk selalu minum

air putih. “Jus aku bikin sendiri, yang mengandung vitamin C, sisanya minum air putih,” jelasnya. (int)

Koran Akan Abadi asal Terus Beradaptasi Sambungan Halaman 1 saya, yang lebih menakutkan adalah sebuah newsroom yang berantakan. Para jurnalis tertidur di sembarang tempat. Kertas-kertas menumpuk tak beraturan di meja. Itu mengerikan,” ujar Senor, mantan presenter Wall Street Journal TV dan CNBC Europe. Sebuah produk jurnalistik yang bagus, papar Senor, tidak bisa dihasilkan bila rumah tempat pembuatnya sudah tidak keruan. “Logikanya, jika ingin membuat koran yang bagus, harus diciptakan integritas yang seimbang antara hardware, dalam hal ini ruangnya, dan software, dalam hal ini orangorangnya,” tuturnya. “Dan menimbang itu semua, saya menobatkan ruang redaksi Jawa Pos sebagai yang terkeren, the coolest, jika dibandingkan dengan newsroom media lain di seluruh dunia,” tegas dia. Dalam sesi itu, di layar lebar ditampilkan video tentang suasana ruang redaksi Jawa Pos. Bagaimana sebuah ruang besar itu terasa sangat terbuka, dilengkapi peralatan gym dan olahraga, studio musik, serta meja meeting melingkar yang memudahkan interaksi dan komunikasi.

“Newsroom Jawa Pos tak ubahnya seperti arena playground (bermain, Red) besar. Itu contoh ideal suasana menyenangkan untuk membuat surat kabar,” tambah Senor. Ruang redaksi lain yang mendapat pujian milik Le Journal de Montreal (Kanada), sebagai newsroom dengan pembagian space terbaik. Gelar newsroom paling modern di benua Amerika diberikan kepada koran Venezuela, Cadena Capriles, serta harian Peru, El Comercio. Di Asia, ruang redaksi paling modern adalah milik India Today Multiplex yang baru saja selesai dibangun. Panelis Masa Depan Koran Pada sesi sore hari, dalam diskusi panel Print Plus tentang masa depan surat kabar, Jawa Pos juga mendapat kesempatan untuk tampil. Direktur Utama PT Jawa Pos Koran Azrul Ananda dipilih sebagai salah satu panelis bersama beberapa pakar senior kelas dunia. Di panggung utama konferensi itu, duduk pula Mario Garcia (CEO dan pendiri Garcia Media, Amerika Serikat), Raul Dharival (CEO The Times of India), Rainer Esser (CEO Die Zeit, Jerman), dan Claire Boonstra (co-founder dan business de-

velopment director Layar, Belanda). Diskusi itu dimoderatori Eamonn Byrne, salah seorang konsultan koran paling terkenal dari Inggris (The Byrne Partnership). Dalam sesi tersebut, pada dasarnya disepakati krisis koran hanya terjadi di Amerika Utara. Di Eropa dan Amerika Latin, koran masih menunjukkan pertumbuhan positif. Baik dalam sirkulasi maupun pemasukan iklan. Asia lebih hebat lagi, tumbuh paling baik. Byrne juga menunjukkan hasil riset yang memperlihatkan kalau masa depan online justru lebih berat. Pemasukan (revenue) online tidak tumbuh dalam beberapa tahun terakhir dan diprediksi tidak akan tumbuh dalam beberapa tahun ke depan. Bahwa ada koran yang tidak tumbuh dalam beberapa tahun terakhir, maka itu adalah akibat dari perbuatan koran itu sendiri. Khususnya di Amerika Serikat. “Dalam beberapa tahun terakhir, koran telah mengalokasikan begitu banyak biaya untuk memikirkan online. Tapi, bukan itu yang mematikan koran. Yang mematikan adalah: Dalam beberapa tahun terakhir, koran telah mengalokasikan

begitu banyak brainpower (orang dan pikiran) untuk online. Padahal, online terbukti kurang menghasilkan. Seandainya brainpower itu fokus ke koran, hasilnya mungkin berbeda,” jelas Byrne. Mario Garcia menambahkan, “Kalau orang masuk kerja di koran tidak happy dan merasa korannya akan punah, apa yang dia takutkan itu justru akan terwujud. Beda kalau kita masuk kerja dengan penuh semangat.” Garcia menegaskan, koran bukan hanya akan bertahan 10 sampai 20 tahun lagi. “Koran akan abadi asalkan bisa terus beradaptasi,” ucapnya. Setelah diskusi panel, Azrul punya kesimpulan lanjutan. “Intinya adalah fokus. Kalau korannya fokus mengembangkan koran, maka ia akan terus berkembang. Die Zeit yang terbesar di Jerman membuktikan itu. Ada koran Swedia yang juga membuktikan itu. Mereka di Eropa, tapi bisa tumbuh dengan strategi fokus ke print. Sama persis dengan yang dilakukan Jawa Pos selama bertahun-tahun,” paparnya. Secara pribadi, Azrul mengaku bangga sekaligus canggung berada di panggung tersebut. “Saya ini anak kemarin

sore. Kalah kelas jauh sama pembicara yang lain. Tapi, bangga juga karena ada koran Indonesia yang diminta duduk di sana. Dan itu Jawa Pos,” ucap pria 35 tahun tersebut. Pendapat bahwa industri koran sebenarnya hanya krisis di Amerika Utara sebenarnya juga sudah disinggung dalam berbagai sesi sehari sebelumnya (Senin, 3/9). Dan Asia ditegaskan sebagai pendorong baru pertumbuhan koran. “Sirkulasi koran kini kembali naik. Pertumbuhan positif itu diprediksi berlanjut hingga akhir tahun ini,” kata Larry Kilman, deputy CEO dan executive director of communication and public affairs WANIFRA (asosiasi koran dunia). Dari data yang ada, disebutkan beberapa negara Asia mengalami pertumbuhan signifikan, baik secara bisnis maupun oplah. Khususnya di Tiongkok, India, dan Indonesia. “Koran-koran di Asia Pasifik harus diakui lebih bergairah. Tidak hanya didukung oleh pertumbuhan ekonomi, tapi koran di negara-negara tersebut telah berevolusi dengan kreativitas masing-masing,” pungkas Kilman. (ayi/iro/c11)


6 September 2012


RAKOR- Istri Wamen Ny Umi Rusman Heryawan (kiri) bersama Bupati Bonaran Situmeang dan Ketua TP PKK Ny Normaida Br Simatupang memimpin rakor persiapan Tapteng sebagai tuan rumah GPTP, Selasa (4/9).

Istri W amen PPertanian ertanian K unjungi TTapteng apteng Lihat K esiapan GPTP Wamen Kunjungi Kesiapan PANDAN- Istri Wakil Menteri Pertanian RI Ny Umi Rusman

Heryawan beserta rombongan datang ke Tapteng, Selasa (4/9). Kedatangannya guna melihat

kesiapan Tapteng sebagai tuan rumah Gerakan Perempuan Tanam & Pelihara Pohon (GPTPP) pada 13-

14 Oktober mendatang. Turut dalam rombongan, Staf Ahli Kementrian Pertanian RI

Bidang Kebijakan Pembangunan Pertanian Prof Pantjar Simatupang,

‹ ‹ Baca

Istri Wamen ...Hal 7

Talud Hancur, Sibolga Tercemar SIBOLGA- Satu unit Talud atau lazimnya disebut bangunan pemecah ombak yang berada di perairan sekitar kawasan Pondok Reformasi, Kelurahan Kota Beringin, Kecamatan Sibolga Kota, Kota Sibolga hancur. Hal itu menimbulkan keresahan bagi warga sekitar, pasalnya puingpuing pecahan bangunan Talud telah menutup aliran air laut sehingga menimbulkan pencemaran lingkungan berupa polusi udara (bau busuk, red). Kepala Lingkungan (Kepling) I, Kelurahan Kota Beringin, Swito, membenarkan hal itu sembari mengatakan telah melaporkan kerusakan

ini ke pemerintah kota (Pemko) Sibolga melalui pihak Kelurahan bahkan telah membawakannya juga kedalam musyawarah perencanaan

pembangunan (Musrembang) tingkat Kelurahan Tahun 2012 agar dapat diprogramkan dan dananya dapat ditampung di Anggaran Pendapatan dan Belanja Daerah (APBD) Tahun Anggaran (TA) itu juga. “Bukti berupa foto-foto dokumentasi kerusakan bangunan itu telah kita kumpulkan dan laporkan (serahkan), namun saya tidak tahu apakah pemko Sibolga ada merealisasikan anggaran perbaikan/ pembangunannya Talud tersebut tahun ini atau tidak,” ‹ ‹ Baca

Talud Hancur ...Hal 7

Jangan Ber-HP Saat Mengemudi (FOTO:RIDWAN)

TALUD HANCUR- Bangunan talud yang sudah hancur di kawasan Pondok Reformasi, Kelurahan Kota Beringin. Akibatnya warga menjadi resah dan berharap agar hal itu diperhatikan pemerintah.

Sosialiasi Pemilu KPU Tapteng Diabaikan 15 Parpol PANDAN- Sebanyak 15 dari 38 partai politik (parpol) yang terdata dan terdaftar di Komisi Pemilihan Umum Daerah (KPUD) Kabupaten Tapanuli Tengah (Tapteng) diluar partai Nasional Demokrat (NasDem), tidak hadir mengikuti sosialisasi tahapan pemilu, pendaftaran dan verifikasi parpol menjadi peserta pemilu anggota DPR dan DPRD tahun 2014 yang diselenggarakan di


MEMAPARKANAnggota KPU Propinsi Sumut Turunan Gulo memaparkan tahapan pemilu, pendaftaran dan verifikasi Ballroom Hotel Bumi Asih Pandan, Rabu (5/9).

Alasan ketidakhadiran ke 15 parpol yang dihadiri langsung

TAPTENG- Kadishub Kominfo Tapteng, Binton Simorangkir mengimbau agar pengendara tidak menggunakan handphone saat berkendara. Tindakan itu akan mengganggu konsentrasi dan dapat berpotensi terjadi kecelakaan. “Baru-baru ini Kementerian Komunikasi dan Informatika (Kemenkominfo) mencanangkan pengiriman SMS broadcast untuk mengimbau tidak menggunakan perangkat komunikasi saat me-

ngemudi. Hal tersebut dilakukan untuk mengurangi jumlah kecelakaan pada saat melakukan perjalanan arus mudik dan balik akibat menggunakan perangkat telekomunikasi saat berkendara,” tukas Binton di Pandan, Tapteng, Rabu (5/8). Menurutnya, dari data nasional, banyak kasus kecelakaan lalulintas yang salahsatunya disebabkan penggunaan

oleh anggota KPU Propinsi Sumatera Utara (Sumut) Turunan Gulo SP MSP, selaku pembicara di acara sosialisasi itu tidak diketahui secara pasti. Sementara itu, sesuai jadwal, pendaftaran seluruh parpol ke kantor penyelenggara Pemilu di daerah itu akan berakhir pada 7 September 2012 ini. “Kami mengimbau, seluruh ‹ ‹ Baca

Sosialiasi ...Hal 7


Paket Internet Terbaik 2 GB Dengan Koneksi Tercepat

„ Head of Marketing Communications Group Telkomsel Irlamsyah Syam, Brand Ambassador simPATI Agnes Monica, Head of Strategic Marketing Group Telkomsel Ririn


SIANTAR- Guna memenuhi kebutuhan pelanggan terhadap akses internet berkualitas, Telkomsel menghadirkan paket data simPATI dengan kuota 2 GB yang memiliki koneksi tercepat hingga 7.2 Mbps. Paket terbaru simPATI ini dapat diperoleh seharga Rp60.000 dengan masa berlaku 45 hari. Untuk mendukung promo tersebut, Telkomsel menggelar

kompetisi Dance Like Agnes yang bisa diikuti oleh para talenta berbakat Indonesia. Launching produk ini juga dilaksanakan di Kota Siantar, Rabu (5/9) kemarin di Rumah Makan Garuda yang dipimpin manejer graPARI Siantar Eko Admaja didampingi Manejer Sales Yogi dan karuawan ‹ ‹ Baca



Paket Internet ...Hal 7

Mega permata

‹ ‹ Baca

Jangan ...Hal 7




Kamis 6 September 2012

Teraktual dari Tarutung, Balige, Humbahas dan Samosir METRO TAPANULI

Edisi 51 „ Tahun IX

390 Personel Amankan Sinode Godang TARUTUNG- Polres Taput menggelar rapat koordinasi (Rakor) lintas sektoral pengamanan Sinode Godang (SG) HKBP 2012. Sebanyak 390 personel diturunkan untuk mengamankan Sinode Godang. Dalam rakor dibahas di antaranya, persiapan personel serta langkah-langkah pengamanan keamanan dan ketertiban masyarakat. Dalam rapat tersebut dipaparkan sejumlah persiapan yang akan dilakukan Polres dalam pengamanan Sinode Godang HKBP yang akan digelar pada 10 hingga 16 September ini. “Dalam pengamanan itu nantinya kita menurunkan 250 personil dan dibantu 30 Personil Pengendali Huru-hara (PHH) dari Brimob Poldasu dan 10 orang Zibom. Selain itu, kita juga mendatangkan personel dari Polres Humbang Hasundutan sebanyak 30 orang serta 30 orang dari TNI, 30 dari Satpol PP dan 10 orang dari Dinas Perhubungan. Total personel pengamanan Sinode Godang HKBP sebanyak 390 orang,” kata Kapolres AKBP Wijadmika SIK usai rapat koordinasi. Lebih lanjut Kapolres menyebutkan, pengamanan didukung Pemda, TNI, instansi terkait pelaksanaan Sinode Godang dengan mengedepankan kegiatan preemptif, preventif, penegakan hukum, represif yang didukung dengan kegiatan deteksi dini atau

„) Baca 390 Personel..Hal 10


Jangan Persulit Penganut Parmalim Urus e-KTP JAKARTA- Pemerintah Daerah di Sumatera Utara kembali diingatkan agar jangan mempersulit warga penganut aliran kepercayaaan Parmalim, untuk mengurus Kartu Tanda Penduduk Elektronik (eKTP). Termasuk di wilayah Taput, Tobasa dan sekitarnya. Sebab merupakan hak setiap warga negara yang telah berusia di atas 17 tahun maupun yang telah menikah, untuk memperoleh e-KTP. Penegasan tersebut kembali dikemukakan Kepala Pusat Penerangan Kementerian Dalam Negeri (Kapuspen Kemendagri) Reydonnyzar Moenek di Sumedang, Rabu (5/9). Ia menilai hal ini perlu disampaikan, agar tindakan Pemerintah Kabupaten


Bupati Tobasa Diadukan ke KPK

„) Baca Jangan Persulit ..Hal 10

Gigitan Hewan Rabies di Taput Capai 225 Kasus MEDAN- Sepanjang Januari hingga Agustus 2012, terjadi 2.314 kasus Gigitan Hewan Penular Rabies (GHPR) di 33 kabupaten/kota di Sumatra Utara. Dari 2.314 itu, sebanyak 225 kasus terdapat di Kabupaten Taput. Plt Kabid Penanggulangan Masalah Kesehatan (PMK) Dinas Kesehatan Sumatra Utara Sukarni di Medan Selasa (4/9) mengatakan berdasarkan data yang ada, Kabupaten Dairi menempati urutan tertinggi dengan 327 kasus gigitan anjing, disusul Kota Medan (235 kasus), dan Tapanuli Utara dengan 225 kasus. Banyaknya kasus GHPR di tiga kabupaten/ kota itu menurut dia lebih disebabkan karena masih banyaknya hewan penular rabies seperti anjing liar yang berkeliaran dan tidak pernah disuntik vaksin rabies. “Kemungkinan besar daerah itu masih banyak

„) Baca Gigitan Hewan ..Hal 10

FOTO Bernad L Gaol

„ Kapolres Taput AKBP Wijadmika memimpin Rakor Pengamanan Sinode Godang HKPB 2012.


Walsa Tampubolon saat berada di pelataran gedung KPK di Jakarta saat mengajukan aduan ke KPK Agustus lalu.

BALIGE- Masyarakat Toba Samosir di berbagai tempat kini ramai membincangkan tentang dilaporkannya Bupati Tobasa Kasmin Pandapotan Simanjuntak ke Komisi Pemberantasan Korupsi (KPK) Agustus lalu. Aduan itu terkait pembebasan tanah proyek Asahan III di Kecamatan Pintu Pohan Meranti serta dugaan pemalsuan ijazah yang digunakan Kasmin pada Pemilukada 2010 lalu. Proyek PLTA Asahan III saat ini telah distop pembangunannya karena berada di kawasan hutan sesuai penelusuran Dinas Kehutanan Provinsi. Sebelumnya, Kasmin diduga terlibat dalam jual beli lahan tersebut makanya pembangunan itu bisa terlaksana. Pengaduan itu dibenarkan Ketua DPP LSM Masyarakat Peduli Tobasa (MAPETOS) Walsa Tampubolon. Kepada

SMPN 6 Ranggitgit Tak Punya Guru PNS TAPUT- SMP Negeri 6 Ranggitgit, Taput ternyata belum memiliki guru PNS. Seluruh guru di sana masih berstatus honorer. Hal ini dinilai salahsatu kelemahan Dinas Pendidikan yang belum maksimal bekerja. Instansi ini sepertinya masih banyak PR untuk meningkatkan mutu pendidikan dan masalah legalitas anak didik. Jika sebelumnya, sebanyak 22 sekolah dasar di daerah itu belum memiliki kepala sekolah dengan kurun yang lama yakni setahun lebih yang mengakibatkan keabsahan ijazah anak didik diper-

tanyakan, kali ini upaya peningkatan mutu dan kualitas pendidikan patut dipertanyakan. Seperti SMPN 6 Ranggitgit, Parmonangan,Taput. Seluruh guru di sekolah ini masih berstatus honorer. Terkait tidak adanya tenaga pendidik yang sudah PNS di SMP Negri 6 itu, Sekretaris Dinas Pendidikan Tapanuli Utara Pajok Simanullang yang dikonfirmasi melalui selulernya, Rabu( 5/9) membenarkan. Menurutnya, hal itu

„) Baca SMPN 6 ..Hal 10

„) Baca Bupati ..Hal 10 (Foto Hermanto Turnip)

„ Bangunan screen house berbiaya Rp.320 Juta di Land Bow Kecamatan Laguboti tidak berfungsi dan dalam kondisi rusak.

BALITA HISTERIS DOKTER AMBIL SAMPEL DARAH HINGGA 5 CUCUKAN DOLOKSANGGUL- Benoid Tobing, balita usia setahun itu menangis histeris ketika dokter mengambil sampel darah hingga lima kali cucukan. Balita itu meronta menahan sakit. Perbuatan dokter umum RSUD Doloksanggul LFB tersebut dinilai berlebihan dan kurang serius menjalankan tugasnya. “Gimana anak saya tidak menjerit. Bayangkan, mengambil sampel darah saja sampai 5 kali cucukan di kaki dan tangan. Sementara panas anak saya saat itu sudah 38 derajat celcius. Melihat anak saya seolah kurang

diperhatikan, saya minta agar dirujuk ke Rumah Sakit Sidikalang,” beber Tobing, ayah Benoid. Bukan itu saja, kata Tobing, penyampaian hasil diagnosa juga dinilai salah. “Saya sangat kasihan melihat Denoit (anaknya, red) waktu pengambilan sampel darah ada 4-5 cucukan jarum pada bagian tangan hingga kaki, sampai-sampai anakku menjerit histeris. Untung tidak sampai dia menggigit lidahnya,” ujar Tobing. Ditambahkanya, satu hal yang tidak dapat diterimanya ketika dokter LFB mengatakan bahwa anaknya

menderita gejala tipes. “Dengan penyampaian yang kurang pas, saya berusaha mencari tau sakit yang sebenarnya dialami anakku,” ujarnya. Penanganan pasien yang sangat buruk dengan melukai beberapa tangan untuk mengambil sampel darah dari nadi anaknya, membuat dia merasa tidak nyaman berobat di RSUD Doloksanggul lagi. Berbeda di Rumah Sakit Umum Sidikalang. Di sana dalam pengambilan sampel darah hanya beberapa detik. “Hanya sekali cucuk pada

„) Baca Balita ..Hal 10

Screen House Pertanian Senilai Rp325 Juta Telantar TOBASA- Bangunan Screen House Dinas Pertanian Tobasa berbiaya Rp325 juta di Land Bow Kecamatan Laguboti dibiarkan begitu saja. Proyek yang didanai APBD Tahun 2011 itu, bagian atap sudah rusak. Anehnya, sudah hampir setahun selesai dikerjakan tak ada satu pun tanaman yang bernilai ekonomis bagi rakyat. Justru tempat itu ditumbuhi ilalang. Pantauan METRO di lapangan, hampir seluruh bagian atap

screen house terbuka. Sementara atapnya tampak berserakan di samping bangunan. Lokasi bangunan juga sudah ditumbuhi semak belukar. Penduduk setempat sangat menyayangkan bangunan tersebut tidak berfungsi dan terkesan buang buang uang rakyat. “Pompanya saja sudah berkarat, mungkin karena tak difungsikan,” ujar salah seorang warga Land Bow.

„) Baca Screen ..Hal 10


6 September 2012

Sekolah Pemkab Sosialisasikan Pemberantasan Korupsi SMPN 6 Ranggitgit Tak Punya Guru PNS Harus Peduli Lingkungan Hidup PANGURURAN- Pemerintah Kabupaten Samosir telah melaksanakan sosialisasi pelatihan sekolah peduli dan berbudaya lingkungan melalui program Adiwiyata. Menurut Staf Ahli Bupati Samosir Bidang Pemerintahan Melani Butarbutar di Pangururan, baru-baru ini mengatakan, program itu untuk mewujudkan pelajar yang bertanggung jawab terhadap perlindungan dan pengelolaan lingkungan hidup dalam mendukung pembangunan yang berkelanjutan. “Badan Lingkungan Hidup Penelitian dan Pengembangan (BLHPP) menyelenggarakan kegiatan tersebut berdasarkan Undang-Undang Nomor 18 Tahun 2008 tentang pengelolaan sampah serta Undang-Undang Nomor 32 Tahun 2009 tentang Perlindungan dan Pengelolaan Lingkungan Hidup,” katanya. Selain itu, kata dia, juga dilatarbelakangi Peraturan Menteri Negara Lingkungan Hidup Nomor 02 Tahun 2009 tentang Pedoman Pelaksanaan Program Adiwiyata dan Keputusan bersama antara Kementerian Lingkungan Hidup dengan Kementerian Pendidikan Nasional Nomor 03/MENLH/02/2010 dan Nomor 01/II/KB/2010 tentang Lingkungan Hidup. Sebab, lanjutnya, pembangunan berkelanjutan telah menjadi komitmen dan tanggung jawab bersama masyarakat dunia guna menyelamatkan bumi dari kerusakan dan kehancuran akibat pembangunan yang tidak memperhatikan kelestarian lingkungan. Menurut dia, kebijakan pendidikan lingkungan hidup telah disepakati empat instansi/ kementerian, yakni Kementerian Negara Lingkungan Hidup, Kementerian Kebudayaan dan Pariwisata, Kementerian Agama dan Kementerian Dalam Negeri sebagai dasar arahan bagi para pemangku kepentingan dalam pelaksanaan dan pengembangan pendidikan lingkungan hidup di Indonesia. Hal dimaksud, kata Melani, juga sebagai salah satu solusi dalam upaya meningkatkan pengetahuan dan pemahaman manusia tentang perlindungan dan pengelolaan lingkungan hidup dalam pembangunan melalui dunia pendidikan. Dia mengatakan, pelestarian lingkungan harus digalakkan guna mendukung visi Kabupaten Samosir menjadi tujuan wisata lingkungan yang inovatif dan pendidikan tentang lingkungan jangan terintegrasi hanya pada mata pelajaran sekolah, namun dapat menjadi muatan lokal yang mempunyai kriteria ketuntasan minimal (KKM). “Dengan terselenggaranya Adiwiyata dimaksud, diharapkan kesadaran masyarakat akan pelestarian lingkungan dapat ditingkatkan,” katanya. (ant/int)

Gigitan Hewan Rabies di Taput Capai 225 Kasus Sambungan Halaman 9 orang yang memelihara anjing, ditambah lagi dengan banyaknya anjing liar yang tidak dipelihara berkeliaran,” katanya. Ia mengatakan rabies merupakan penyakit infeksi akut dengan menyerang sistem saraf pusat yang disebabkan oleh virus rabies. Virus rabies yang masuk ke tubuh manusia melalui gigitan hewan, katanya, akan berkembang di otot sekitar gigitan, kemudian menyerang susunan syaraf tepi, lalu bergerak ke otak. Setelah sampai di otak, virus yang termasuk ke dalam famili Rhabdovirus dan genus Lyssa virus itu, akan menyebar ke jaringan-jaringan lain secara cepat sehingga kebanyakan korban tak menyadarinya. “Penularan penyakit ini oleh gigitan binatang terutama anjing, kucing, dan kera. Ini karena sifatnya yang zoonosis artinya dapat menular dari hewan ke manusia,” katanya. Ia menganjurkan pemerintah setempat dalam hal ini Dinas Pertenakan harus kerja keras dalam mencegah meningkatkan kasus rabies. “Anjing-anjing itu harus divaksin agar tidak menularkan rabies, begitu juga dengan masyarakat diharapkan jika terkena gigitan anjing untuk cepat mendatangi puskesmas, atau Dinkes setempat,” katanya. (ant/int)

DIBUTUHKAN SEGERA Wa n i t a ( G a d i s / J a n d a ) dipekerjakan di Medan untuk jaga anak, perawat orang sakit, gaji Rp 700.000 s.d 1.2 jt/bulan (bersih) + bonus, asrama + makan gratis. Hubungi: CAHAYA 2 Jl. Gatot Subroto / Ayahanda 44 E Telp. 0813 6262 7635; 0852 6207 9555

Sampai di Medan (Terminal kami siap menjemput)

DIBUTUHKAN SEGERA Delivery officer / supir • Laki – laki • Umur 20 s.d 40 tahun • Memiliki SIMA&B Lamaran dikirim langsung ke

PT Tapteng Jaya

Dealer Elpiji Pertamina Jl. Mesjid No.10 Kel. Pasar Baru Kec. Sibolga Kota Lamaran diterima paling lama 15 september 2012

PANGURURAN- Jajaran Pemerintah Kabupaten Samosir menggelar sosialisasi percepatan pemberantasan korupsi di lingkungan pemerintah daerah setempat, guna meningkatkan upaya pengawasan dan pembinaan aparatur serta pencegahan kebocoran keuangan negara. “Korupsi merupakan kejahatan berat yang harus segera diberantas, karena implikasi yang ditimbulkannya sangat luas yakni merusak sistem ekonomi, politik dan sosial masyarakat, sekaligus menghancurkan masa depan bangsa,” kata Plh Bupati Samosir Hatorangan Simarmata di Pangururan, Selasa (4/9). Menurut dia, sosialisasi itu bertujuan agar para peserta mengetahui seluruh diktum umum maupun diktum khusus yang terkandung di dalam Inpres Nomor 5/2004 tentang peningkatan upaya pengawasan serta pembinaan aparatur untuk meniadakan perilaku korupsi. Selain itu, kata Hatorangan, juga untuk mencegah berbagai kebocoran dan pemborosan penggunaan keuangan Negara, baik yang bersumber dari APBN maupun APBD

serta mencegah terjadinya praktik-praktik KKN di lingkup Pemerintah Kabupaten Samosir. Seluruh pejabat penyelenggara pemerintah daerah setempat, lanjut dia, diharapkan melaporkan kekayaannya kepada KPK dan setiap aparat lingkup Pemkab Samosir harus mampu mengembangkan strategi yang tepat dalam meningkatkan kualitas pelayanan publik yang muaranya untuk mewujudkan pemerintahan yang baik dan bersih (good governance). “Nilai-nilai pemerintahan yang baik, meliputi partisipasi, supremasi hukum, transparansi, akuntabilitas, responsive, efektivitas dan efisiensi harus senantiasa dikembangkan,” katanya. Hatorangan menyebutkan, fakta integritas yang ditandatangani, merupakan sebuah terobosan yang diharapkan menjadi pendorong terwujudnya tata kelola pemerintahan yang baik, serta akan dicerminkan kondisi birokrasi yang bersih dan bebas KKN. Dia juga mengajak seluruh jajaran Pemkab Samosir untuk terus meneguhkan komitmen dengan memulai langkah-langkah dukung-

an upaya pemberantasan korupsi, sebab keberhasilan upaya percepatan pemberantasan korupsi sangat tergantung pada komitmen bersama dalam mewujudkannya. Sementara itu, Kepala Bagian Ortala Setdakab Samosir Hotmariani Simbolon menambahkan, kegiatan yang dilaksanakan selama dua hari (3-4 September 2012) itu diikuti seluruh pejabat Eselon II, III serta seluruh pejabat yang wajib lapor harta kekayaan Pejabat Penyelenggara Negara lingkup Pemkab Samosir. Dikatakannya, guna menyampaikan materi tentang perkembangan kebijakan Pemerintah tentang pemberantasan korupsi, pihaknya mengundang Kabid Fasilitas Pengembangan Program Anti Korupsi, Deputi Bidang Pengawasan dan Akuntabilitas Aparatur Kementerian PAN dan RB, Rois Solihin, MAP sebagai narasumber. “Strategi nasional tentang pencegahan dan pemberantasan korupsi, mulai dari Inpres Nomor 5 tahun 2004 tentang percepatan Pemberantasan Korupsi hingga Perpres Nomor 55 tahun 2012 akan dipaparkan,” kata Hotmariani. (ant/int)


Jadi Staf di Kantor Camat RAYA- Sebanyak 49 pegawai negeri sipil (PNS) yang selama ini bertugas di berbagai Dinas di Pemkab Simalungun, dimutasi menjadi staf di beberapa kantor camat. Beberapa dari mereka adalah pejabat eselon IV dan III. Menurut seorang PNS yang dimutasi dan tak mau menyebut namanya kepada METRO, Rabu (5/9), mengatakan, alasan pencopotan jabatan dan mutasi yang dilakukan BKD adalah karena 49 PNS itu tidak lulus saat ujian pengadaan barang dan jasa yang digelar Pemkab Simalungun. Ujian itu dilaksanakan pada tanggal 11 hingga 14 Juli 2012, dengan 93 peserta dari

seluruh kantor SKPD. Setelah diumumkan pada 3 September lalu, hanya 44 orang yang dinyatakan lulus. Sebagai konsekwensinya, 49 PNS itu dimutasi menjadi staf di berbagai kantor camat se Kabupaten Simalungun. “Beberapa orang di antara kami itu, sebelumnya menjabat kasubbid, kepala seksi, bahkan ada juga pejabat eselon III seperti kepala bidang. Sekarang mereka hanya menjadi staf biasa di kantor camat. Ya, apa boleh buat, pasrah sajalah!” katanya. Menurutnya, sejak dimutasikan ke kantor camat berdasarkan Surat Keputusan Bupati JR Saragih tertanggal 3 September, ia lang-

sung melapor ke kantor camat yang ditetapkan sebagai tempatnya menjadi staf. “Ada Beberapa teman yang kasihan. Sebab mereka ditempatkan di kantor camat yang jauh dari rumahnya,” katanya. Sementara Kepala Bidang Pengembangan BKD Raya Ginting yang dikonfirmasi, membenarkan pemutasian 49 PNS yang tidak lulus saat ujian pengadaan barang dan jasa. Namun saat ditanya lebih detail tentang proses mutasi, Raya enggan berkomentar. “Saya sedang di Bandar Tinggi, ada halal bihalal bersama bupati. Untuk lebih jelasnya, tanyakan langsung ke humas saja ya,” ujarnya sambil menutup telepon selulernya. (hot/hez)

390 Personel Amankan Sinode Godang Sambungan Halaman 9 penyelidikan, guna mewujudkan kondisi kamtibmas yang kondusif. “Sehingga peserta dapat melaksanakan seluruh rangkaian agenda Sinode Godang dengan rasa aman dan nyaman tanpa ada gangguan,” kata Kapolres. Kapolres juga menuturkan, sebelum acara digelar, sterilisasi akan dilakukan sehari sebelum hari H pelaksanaan Sinode dan telah mendirikan enam Pos Pam di kawasan

Auditorium tempat Acara Sinode berlangsung. “Di setiap Pos nantinya akan dijaga oleh petugas selama 24 jam sejak sehari sebelum hari sejak pelaksanaan SG hingga selesai. Semuanya itu dilakukan untuk antisipasi halhal yang tidak diinginkan terjadi,” terangnya. Rapat yang berlangsung di Balai Data Mapolres setempat, Rabu (5/9) selain dihadiri Dandim 210 TU Letkol V Tampubolon, Kapolres Taput AKBP Wijadmika SIK Hikler Tumanggor dari

Kementerian Agama Pdt MP Hutauruk dari BKAG juga dihadiri Asisten II Pemkab Taput dan sejumlah perwakilan instansi terkait. Wijadika menjelaskan, pihaknya juga akan mengawasi kondisi lalulintas yang masuk ke kawasan lokasi tempat digelarnya Sinode ini. “Anggota Satlantas juga akan ditempatkan untuk mengawasi jalan-jalan umum di lokasi tempat acara SG dan anggotanya akan berjaga di seluruh persimpangan sehingga masyarakat dan peserta sinode lebih dekat mendapatkan pelayanan,” tutupnya. (cr-01)

Bupati Tobasa Diadukan ke KPK Sambungan Halaman 9 METRO, Walsa mengatakan, terkait masalah itu, pihaknya telah membuat pengaduan ke KPK tertanggal 8 Agustus 2012 dengan Nomor 2012-08-000169 yang dintadatangani Walsa sebagai pelapor dan diterima pegawai KPK Rani Arbagustinah. “Benar, kami telah melaporkan Kasmin Simanjuntak ke KPK pada bulan Agustus lalu,” kata Walsa di kantornya, Selasa (5/9) diamini Ketua LSM Gerakan Abdi Tuhan ALLAH Tobasa Jonny Tambunan. “Mengapa kami melaporkan masalah pemalsuan ijazah itu? Karena kami menilai Kasmin telah melakukan pembohongan publik. Kami punya bukti, makanya masalah itu telah kami serahkan ke KPK. Dimana ketika Kasmin mencalonkan diri pada pemilihan kepala desa (Pilkades) Pardomuan Kecamatan Silaen tahun 2003,” ujarnya. Saat itu, sambung Walsa, dalam tahapan pemberkasan Kasmin melampirkan syaratsyarat yang sungguh spektakuler. Kasmin melalui riwayat pendidikannya mengaku berpendidikan terakhir S-3 dengan gelar Doktor dan mendapat sertifikat Kehormatan (Promovendus) sebagai profesor. Kedua gelar itu diperolehnya dari Chicago Internasional University juga di tahun yang

TOYOTA PEMATANGSIANTAR Authorized Toyota Dealer • All new Avanza ready !!! • Veloz accesories full !!! • Grand new innova ready !!!! • Yaris bonus paling lengkap dan full discount • New Rush ready !!! Hub. David Maruhawa, HP 0813 9648 7188; 0831 9355 3180. PIN BB 26C3BF8D (Sales Executive). Data dijemput !!! proses cepat !!!. NB: Harga Siantar sama dengan harga Medan

sama. Entah karena faktor gelarnya itu atau bukan, yang jelas Kasmin memenang pada Pilkades di desanya. Di tengah perjalanan karirnya jadi Kepala Desa Pardomuan berkali-kali Kasmin mengeluarkan surat resmi. Salah satunya adalah sebuah profosal kepada PT Toba Pulp Lestari dengan mencantumkan gelar yang dimilikinya (Prof Dr K Simanjuntak MBA). Tanpa mencantumkan gelar S-1, keunikan pun muncul di tahun 2009. Pada saat proses pencalonannya sebagai Anggota DPRD Tobasa periode 2009-2014, Kasmin secara sadar mendegradasikan sendiri latar belakang pendidikannya. Sang intelektual lulusan Negeri Adidaya AS itu, ternyata hanya berani mengaku sebagai lulusan SMA saja. Sesuai dengan buku profil Anggota DPRD yang dikeluarkan oleh KPU tahun 2009. Nasib baik, sambung Walsa, masih juga hinggap kepada Kasmin Simanjuntak. Dia lolos dari tahapan verifikasi Komisi Pemilihan Umum (KPU), bahkan akhirnya sukses menduduki kursi anggota legislatif. Selanjutnya, tahun 2010, dia mencalonkan diri sebagai Bupati Tobasa dengan menggandeng Liberty Pasaribu sebagai wakilnya. Mereka pun maju dengan nama kampaye Kaliber dengan misi LURUSKAN. Lagi-lagi, dia begitu merendah dengan

LOWONGAN KERJA Daerah operasional : Tobasa, Taput, Humbahas, Sibolga dan Tapteng. Dibutuhkan beberapa orang untuk ditempatkan pada posisi : 1. Sales 3. Sales Promotion Girl 2. Merchandiser 4. Sales Representative Persyaratan : 1. Pria (1, 2, 4) wanita (3, 4) 2. Berorientasi target (1, 2, 3, 4) 3. Pendidikan min. SMA sederajat (1, 2, 3) D3 (4) 4. Usia max 30 tahun (1, 2, 3, 4) 5. Memiliki sepeda motor (1, 2, 4) 6. Memiliki SIM C (1, 2, 4) 7. Bersedia menjalani masa training (1, 2, 3, 4) 8. Jujur dan Bertanggung Jawab (1, 2, 3, 4) 9. Berpenampilan menarik (3, 4) 10. Menguasai Ms. Office dan Internet (4)



Jl. Suprapto No. 74 B Sibolga - Jl. Pemuda No. 8 G Balige

Informasi lebih lanjut hubungi Bpk. Siswandi HP 0819 880 881

BUTUH EXTRA INCOME !!! KERJA SAMPINGAN / FULL TIME !!! MNC LIFE ( MNC GROUP ) media terbesar di Indonesia, membutuhkan beberapa FINANCIAL CONSULTANT / AGENCY MANAGER yang handal untuk berkarir dan berpenghasilan lebih. Jika anda serius dan membutuhkan informasi tentang syarat-syarat dan proses selanjutnya, segera hubungi bagian Rekruitmen kami : IBU WATI Hp.0823 6888 4343

hanya mengaku sebagai lulusan SMEA Negeri Balige. Tapi kemujuran selalu berpihak kepadanya. Kasmin dan Liberty sukses menyingkirkan empat pasangan lainnya dan menduduki kursi bupati. “Nah, itu alasan kami mengatakan Kasmin membohongi publik. Kita menilai dia telah merugikan negara miliaran rupiah,” paparnya sembari menunjukkan sehelai kertas dimana dalam kertas tersebut dituliskan tanda bukti penerimaan laporan atau informasi dugaan tindak pidana korupsi tertanggal 8-8-2012 bernomor 2012-08-000169 yang dintada tangani Walsa sebagai pelapor dan dari KPK ditandatangani penerima laporan atas nama Rani Arbagustinah K. Terkait laporan ini, Bupati Tobasa Kasmin Pandapotan Simanjuntak yang dihubungi METRO guna meminta tanggapannya melalui telepon selulernya tidak berhasil karena tidak aktif. Kabag Humas Protokol Pemkab Tobasa Elisber Tambunan yang juga dihubungi handphone-nya mengaku pihaknya belum mengetahui adanya laporan LSM tersebut. ”Kami tidak mengetahui laporan itu, untuk itu kami no comment,” singkatnya. Ditanya keberadaan orang nomor satu di Tobasa itu, Elisber mengatakan, yang bersangkutan berada di luar kota dalam rangka menjalankan tugas. (brams)

Sambungan Halaman 9

dikarenakan kurangnya tenaga sehingga membuat tenaga pengajar yang dialokasikan ke sekolah itu hanyalahguruhonorer. “Itu memang benar kalau disana yang mengajar hanya guru PTT (pegawai tidak tetap). Dikarenakan kitakekurangantenaga.Tetapibagaimanalah,bukan kita yang menentukan untuk menambah tenaga sepertipenerimaanCPNS,“ujarnya. Melihat kondisi itu, Dinas Pendidikan sepertinya tidaktakutkalaumutuataukualitasanakdidikkurang bagus.MenurutPajok,meskipunhanyaseorangguru PTT,merekadinilainyamemilikikompetensi. ”WalaupunmerekahanyaPTT, tetapikanmereka memiliki kompetensi. Pada tahun pertama gurunya hanya tiga, kalau sekarang mungkin sudah bertambah,” ucapnya. Dihubungisecaraterpisah,AnggotaKomisiADPRD Taput yang membidangi pendidikan, Charles Simanungkalit kepada METRO mengaku belum mengetahuilebih jelasnyahaltersebut. Namun, Charles sempat mengatakan bahwa jika nantinyaadapenerimaanCPNStenagapendidik,maka sebaiknyaCPNStersebutdialokasikanuntukmengajarkesekolahtersebut. ”Tetapi demikian kita dari Komisi A akan membicarakanuntukmengisikekosonganitudengandinas pendidikan,”katanya. Sementara itu, salah seorang orangtua siswa SMP Negeri6SatuatapRanggitgitDManalukepadaMETRO mengatakan, sebagai orangtua, dia mengucapkan terimakasihsejaksekolahituhadirdidaerahitusejak tahunajaran2011/2012. “Apabilasekolahitutakada,makaanakkamiakan sekolahkedesalainyangmakanwaktudanbiayalebih banyak.Tetapikitasedikitkhawatirkarenagurudisana seluruhnyamasihhonorer.Bagaimananantikualitas pendidikananakkami?”tandasnya.(cr-02)

Screen House Pertanian Senilai Rp325 Juta Telantar Sambungan Halaman 9 Pimpinan proyek Screen House Teddy Panjaitan ketika dikonfirmasi mengatakan bahwa proyek tersebut sudah diserah terimakan dari rekanan ke Dinas Pertanian. Teddy juga mengaku bahwa proyek tersebut memang sudah mengalami kerusakan dibagian atap meski usianya baru setahun. Sementara untuk perbaikan, masih menunggu jawaban dari rekanan yang memenangkan proyek tersebut. Namun, kata Teddy, rekanan yang disebut untuk melakukan perbaikan belum mendapat jawaban. “Sudah kami surati dari dua minggu lalu, tapi belum ada jawaban dari mereka. Mereka wajib melakukan perbaikan karena ada dana pemeliharaan sebesar 5 persen,” kata Teddy, Rabu (5/ 9) dan mengatakan lupa nama perusahaannya kemudian menyebut nama Kristopel Pasaribu sebagai Direktur di perusahaan itu. Meski proyek tersebut dikelola oleh Dinas Pertanian, screen house ini akan diserahkan ke Dinas Kehutanan dan Perkebunan. “Coba tanya Dinas Kehutanan dan Perkebunan lah,” ujarnya. Tidak digubrisnya surat yang mereka layangkan kepada rekanan, Teddy menduga dibackup anggota dewan. Bahkan Teddy menyebut anggota dewan berinisial FS. “Karena sudah beberapa kali kami surati tapi tidak mendapat tanggapan. Memang saya tanya ke pihak bank Sumut dana tersebut belum dicairkan,” tuding Teddy. Dikonfirmasi lewat ponsel, anggota DPRD Tobasa berinisial FS mengatakan proyek tersebut tidak ada sangkut pautnya dengan dirinya. Bahkan FS balik bertanya siapa yang mengatakan demikian. “Tidak ada (terkait) tapi saya yang mengatakan kepada mereka agar rekanan itu diberi pekerjaan. Asa adong ulaon nasida (agar ada kerjaan mereka),” kata FS. Dikonfirmasi terpisah, Kepala Bidang Perkebunan, Dinas Kehutanan dan Perkebunan Mittar Manurung mengaku, screen house yang disebut tersebut belum diserahkan. Sebut Mittar, dia hanya tahu bahwa proyek tersebut sudah selesai dikerjakan. “Belum (diserahkan),” ujar Mittar. Rencananya, screen house tersebut untuk penyediaan bibit perkebunan yang akan disalurkan kepada masyarakat. “Belum diserahkan jadi bagaimana,” paparnya. Belum diserahkannya screen house tersebut kepada pihaknya, sejumlah program perkebunan tahun ini tidak direncanakan lagi. “Program bibit tahun ini untuk lokasi yang ada disana tidak kita buat lagi, karena belum bisa kita gunakan,” tandasnya. (cr-03)

Balita Histeris Dokter Ambil Sampel Darah.. Sambungan Halaman 9 bagian tangan sudah selesai,” ucapnya. Akan tetapi masih menurutnya, hasil laboratoriumRSUSidikalangjustruberbeda.drElisabet Tariganyang menanganisaatitumenyampaikan

pasien demam biasa (Observasi febris OD/-ISK danThypoipfever)denganhasiltesurinepasien. Terkait kinerja dokter umum tersebut, Direktur RSUD Doloksanggul Elisabeth D Manalu melalui stafnya Erikson Manalu, Rabu (5/9) mengatakan, hasil diagnosa dari kedua

rumah sakit tersebut sama-sama mengarah pada penyakit tipus. ”Hasil diagnosa keduanya sama, mengarah pada tipus. Hanya saja penulisan dan penyampaian dokter kita pada pasien kurang tepat,” ujar Erikson. (jona)

Jangan Persulit Penganut Parmalim Urus e-KTP Sambungan Halaman 9 Kuninganyangmenghentikanpembuatane-KTP pengikut Ahmadiyah di Desa Manislor, KecamatanJalaksana,KabupatenKuningan,Jawa Barat,tidakmeluashinggakedaerah-daerahlain. Meskipun alasan penghentian, untuk menjaga kondusifitas, setelah adanya protes sebuah organisasikeagamaan. “StatemanSekda(SekretarisDaerah)Kuningan menghentikansementarae-KTP,itusamasekali tidak benar,” ungkap Kapuspen yang setiap saat memberiketerangankepadaparawartawanini. Menurutnya sesuai dengan Peraturan Pemerintah Nomor 37 tahun 2012 tentang administrasi kependudukan, sangat jelas dikemukakan. Bahwa e-KTP merupakan hak

semuawarganegarayangberdomisiliIndonesia. Dansamasekalitidakmempersoalkanagama. “Formulir untuk kolom agama, itu kan hanya boleh diisi dengan salah satu dari enam agama yang diakui negara. Tapi misalnya aliran kepercayaan seperti Parmalim ingin mencantumkan dari salah satunya bisa. Tapi tidak boleh dengan nama aliran kepercayaan tersebut. Karena pilihannya hanya ada hanya enam.Tapikalaunggakmau,itubisadikosongkan kolom tersebut,” ungkapnya. Olehsebabdalamkesempatankaliini,Donny tidak saja hanya mengingatkan Pemkab Kuningan. Namun juga Pemda Sumut, dan sejumlah pemerintah daerah lainnya. “Karena untuk soal keyakinan, negara tidak bisa ikut campur. Dan kalau pun untuk kolom agama itu

dikosongkan, itu hak warga negara tersebut. Itu boleh dan dibenarkan. Tapi kalau diisi di luar enam, tidak boleh. Saya sudah kontak dengan Pemkab, kita sudah ingatkan bahwa itu tidak benar,” tegasnya. Sementara terhadap masyarakat sendiri, Donny secara khusus juga mengharapkan agar setiap warga masyarakat yang telah cukup usia untuksegeramenguruse-KTP.Alasannyasangat sederhana. “Karena setiap warga negara (yang usianya telahcukup),ituwajib.Apalagiper1Januari2013 mendatang, e-KTP telah berlaku sebagaimana diaturdalamPeraturanPresidennomor67tahun 2011.Jadirugikalautidakuruse-KTP.Karenabasis data semua menggunakan e-KTP,” tandasnya. (gir)


6 September 2012


Presiden Mesir Mohamed Morsi

Presiden Mesir

Serukan Assad Mundur KAIRO- Presiden baru Mesir Mohamed Morsi kembali menyerukan rezim Presiden Suriah Bashar al-Assad untuk mengundurkan diri. Ditegaskan Morsi, resolusi untuk krisis Suriah merupakan tanggung jawab Arab. ”Saya katakan pada rezim Suriah bahwa masih ada peluang untuk menghentikan pertumpahan darah,” kata Morsi dalam pertemuan para menteri luar negeri (menlu) Liga Arab di Kairo, Mesir. ”Jangan mengambil langkah yang benar di waktu yang salah... karena itu akan menjadi langkah yang keliru,” tutur Morsi seperti dilansir kantor berita AFP, Rabu (5/9). ”Sekaranglah waktunya untuk perubahan,” tegas Morsi seraya mengingatkan rezim Assad untuk “memetik pelajaran dari sejarah baru-baru ini.” Dalam pertemuan tersebut, Morsi mendesak para diplomat Arab untuk bergerak cepat guna menyelesaikan konflik Suriah. “Darah rakyat Suriah sedang ditumpahkan siang dan malam, kita bertanggung jawab atas ini,” cetus Morsi. “Kita tak bisa tidur sementara darah rakyat Suriah ditumpahkan,” imbuhnya. ”Saya mendesak Anda para menlu Arab, untuk bekerja keras menemukan solusi cepat atas tragedi di Suriah,” tutur Morsi. “Jika kita tidak bergerak, dunia tak akan bergerak dengan serius,” tandasnya. (dtc/int)

Beresiko Tinggi Meninggal Dunia JAKARTA- Tingkat kematian jemaah haji Indonesia pada 2011 mencapai 2,34 persen. Dari 223.395 jemaah pada tahun lalu, sebanyak 522 di antaranya meninggal dunia. Tingginya kematian jemaah disebabkan mayoritas jemaah telah memiliki risiko kematian tinggi sebelumnya, seperti mengidap penyakit kronis berat dan berusia lanjut. ”Jemaah haji Indonesia memang tergolong memiliki risiko kesakitan yang cukup tinggi,” ujar Dirjen Pengendalian Penyakit dan Penyehatan Lingkungan (Dirjen P2PL) Kemenkes Tjandra Yoga Aditama di Jakarta, Rabu (5/9). Lebih dari separuh dari total jemaah, menurut Tjandra, telah memiliki risiko tinggi terhadap kematian sebelum berangkat. Menurut inventaris Kemenkes, sekitar 50.58% atau

111.697 dari 223.395 jemaah yang bemenjalani ibadah, menurut dia, ada rangkat pada tahun lalu masuk dalam beberapa hal yang perlu dipersiapkelompok risiko tinggi. kan. Pertama, jemaah Tercatat jenis penyawajib memeriksakan kit yang paling banyak kesehatan ke dokter. diidap oleh jemaah haji Kedua, jika memang yang meninggal pada memiliki penyakit krotahun lalu adalah pennis, sebaiknya memastiyakit jantung dan pemkan persediaan logistik buluh darah. Selanjutobat terpenuhi. Selannya adalah penyakit jutnya jika memang megangguan pernapasan, miliki resiko kesehatan otak, masalah pada tinggi, yang bersangkusistem sirkulasi, entan bisa meminta surat dokrin metabolik, infekpengantar dari dokter. si, ginjal, masalah ”Surat tersebut bisa pencernaan, tumor, menjadi masukan bagi dan penyakit darah. dokter kloter yang bertuMengingat kelomgas dalam persiapan tinpok terbang (kloter) dakan yang perlu diamTjandra Yoga Aditama bil nantinya,” imbuh pertama jemaah haji 2012 akan berangkat Tjandra. pada akhir September, Tjandra menSelanjutnya jika berangkat bersama yarankan jemaah haji melakukan berorang lanjut usia, sambungnya, perbagai persiapan agar kesehatan dan siapan lebih rinci seperti pengeibadah mereka tidak terkendala. tahuan tentang menyewa kursi roda. Agar tubuh sehat dan bugar saat (mdc/int)

Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini mendatangi kantor KPK untuk menjalani pemeriksaan.

Kapal Tanker Singapura

Dibajak Perompak ABUJA- Sebuah kapal tanker minyak milik Singapura dibajak oleh perompak di Pelabuhan Lagos, Nigeria. Pembajakan ini merupakan yang ketiga kalinya terjadi dalam 2 minggu terakhir di wilayah Teluk Guinea, Afrika. Menurut Biro Maritim Internasional (IMB), kapal yang membawa 23 awak tersebut dibajak perompak pada Selasa (4/9) sore waktu setempat. Kapal bermuatan bahan bakar tersebut digiring oleh para perompak ke wilayah laut lepas. Namun pusat informasi pembajakan yang bermarkas di Kuala Lumpur, Malaysia tersebut tidak menjelaskan secara detail bagaimana kapal tersebut bisa dibajak. ”Kami telah memberitahu otoritas Nigeria yang telah mengambil tindakan,” ujar Kepala IMB, Noel Choong, kepada AFP, Rabu (5/ 9). Menurut Noel, para awak kapal mengunci diri mereka dalam ruangan aman. “Kami mengkhawatirkan keselamatan mereka dan aksi-aksi kekerasan yang bisa saja terjadi,” imbuhnya. Para bajak laut membajak dan menjarah dua tanker minyak di dekat Togo pada bulan Agustus lalu. Kedua kapal dan seluruh awak kapal kemudian dibebaskan. Noel menuturkan, kemungkinan besar ada sindikat pelaku kriminal yang berada di balik pembajakan ini. Hal ini bisa dilihat dari modus operasi pembajakan yang nyaris sama. ”Mereka akan menguasai kapal tersebut selama 5 hari — kemudian merangsek masuk ke dalam kabin awak kapal dan menyedot minyak ke kapal perompak lainnya,” terang Noel. Noel menyatakan, pihaknya telah berulang kali memperingatkan kapal-kapal yang berlayar di dekat Teluk Guinea, dekat pantai barat Afrika, untuk lebih berhati-hati dan waspada. IMB juga meminta otoritas setempat untuk meningkatkan patroli keamanan di wilayah perairan yang tahun lalu disebut sebagai ‘hot spot’ pembajakan. Diketahui bahwa di wilayah tersebut sudah terjadi 37 kali serangan pembajakan, termasuk penculikan dan pembunuhan sepanjang tahun 2012 ini. Para perompak tersebut biasanya mengincar kapal-kapal kargo yang berlayar di kawasan tersebut. Mereka akan memindahkan barang-barang muatan kapal tersebut dan kemudian menjualnya di pasar gelap. (dtc/int)

Israel Akan Serang Iran Sebelum Pemilihan Presiden AS WASHINGTON- Israel terus melancarkan retorika perangnya terhadap Iran terkait program nuklirnya. Namun anggota senior Kongres AS, Mike Rogers yakin bahwa Israel akan menunggu untuk menyerang Iran sampai pemilihan presiden AS pada November mendatang. Hal tersebut disampaikan Rogers dalam Konvensi Nasional Partai Republik di Tampa, Florida seperti dilansir surat kabar Israel, Haaretz, Rabu (5/9). Dikatakan Ketua Komite Intelijen DPR AS tersebut, para pemimpin Israel seperti Perdana Menteri Benjamin Netanyahu menganggap dukungan Amerika merupakan syarat penting bagi aksi militer mereka. ”Saya pikir mereka percaya bahwa mungkin setelah pemilihan mereka bisa berbicara dengan AS untuk bekerjasama,” tutur Rogers yang merupakan politikus Partai Republik tersebut. Beberapa waktu lalu, Menteri Pertahanan Israel Ehud Barak mengatakan, akhir musim panas akan menjadi kesempatan terakhir untuk melakukan aksi militer terhadap fasilitasfasilitas nuklir Iran. Namun pejabat-pejabat pemerintah AS telah berulang kali mengingatkan Israel bahwa Washington tidak akan mendukung serangan Israel terhadap Iran. (dtc/int)

Purnomo memberikan keterangan pers terkait rencana kerja sama dengan Australia.


Perkuat Kerja Sama Pertahanan JAKARTA- Pertemuan bilateral antara Menteri Pertahanan RI Purnomo Yusgiantoro dan Menteri Pertahanan Australia Stephen Smith menghasilkan kesepakatan strategis dalam rangka memperkuat kerja sama kedua negara dalam bidang pertahanan, terutama sektor industri. ”Setidaknya kami sepakat dalam satu semangat yang sama yaitu memperkuat kerja sama pertahanan di antara kedua negara. Khusus untuk sektor industri pertahanan, tentu saja akan bergerak dalam wilayah untuk memperkuat pertahanan negara masing-masing,” ujar Purnomo saat memberi keterangan pers di Kantor Kementerian Pertahanan di Jakarta, Rabu (5/9). Pertemuan yang merupakan lanjutan dari kunjungan Menhan Purnomo ke Darwin pada Mei 2012 lalu ini dilandasi semangat saling menghormati

bagi kemajuan industri pertahanan kedua negara. “Soal detail seperti apa, tentu saja akan dibahas kemudian sambil berjalannya waktu,” jelasnya. Selain kerja sama memperkuat industri pertahanan, Purnomo menjelaskan lingkup kegiatan kerja sama pertahanan antara RI dan Australia juga meliputi kebijakan pertahanan, hubungan antarinstansi, kontraterorisme, keamanan maritim, bantuan kemanusiaan dan pemulihan bencana, dukungan logistik militer dan pelayanan medis, pemeliharaan perdamaian, intelijen, industri pertahanan, material, ilmu pengetahuan dan teknologi. ”Juga pendidikan dan pelatihan di bidang pertahanan atau militer, tata kelola dan manajemen pertahanan, dan bidang lainnya yang menjadi kepentingan bersama kedua negara,” lanjut Purnomo. (dtc/int)



2 Perwira Polisi Diperiksa KPK Kasus Simulator SIM JAKARTA- Para perwira Polri harus wira wiri memenuhi panggilan penyidik KPK sebagai saksi kasus simulator SIM. Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini kali ini dimintai keterangan lagi. ”Keduanya dipanggil sebagai saksi dalam perkara pengadaan driving simulator di Korlantas Mabes Polri,” ujar Kabag Pemberitaan KPK, Priharsa Nugraha, ketika dikonfirmasi, Rabu (5/9). Setidaknya sampai pukul 09.30 WIB, dua perwira tersebut belum sampai di kantor KPK. Ini merupakan panggilan kedua bagi Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini.

KPK sebelumnya memeriksa AKBP Indra Darmawan Irianto dan AKBP Susilo Wardono. Sedangkan pada pekan lalu, KPK juga telah memeriksa empat perwira sebagai saksi untuk Irjen Djoko yakni AKBP Wandi Rustiwan, Kompol Ni Nyoman Sumartini, Kompol Endah Purwaningsih, dan AKBP Wisnu Buddhaya. Sebelumnya mereka sempat tak hadir dalam panggilan pertama karena ada masalah administrasi. Dalam kasus Simulator SIM ini, KPK menetapkan mantan Kakorlantas Irjen Djoko Susilo sebagai tersangka. KPK juga menetapkan bawahan Djoko, Brigjen Pol Didik Purnomo, Direktur Utama PT Inovasi Teknologi Indonesia, Sukotjo S. Bambang dan Direk-

tur PT Citra Mandiri Metalindo Abadi, Budi Santoso sebagai tersangka. Polri juga menetapkan status sama terhadap tiga nama terakhir tersebut. Tiga nama yang menjadi ‘tersangka bersama’ itu memicu persoalan. Sampai saat ini KPK dan Polri samasama ngotot untuk menangani kasus ini. Sampai saat ini belum ada titik temu antara dua lembaga penegah hukum tersebut. Polri telah melakukan gerak cepat dengan melakukan penahanan terhadap para tersangkanya, yang juga tiga di antaranya merupakan tersangka di KPK. Irjen Djoko juga telah dua kali diperiksa sebagai saksi. Sedangkan KPK masih hanya fokus memeriksa saksi dan berkas untuk Irjen Djoko. (dtc/int)

JAKARTA- Mantan Menteri Kelautan dan Perikanan Fadel Muhammad menegaskan Kementerian Kelautan dan Perikanan bertanggung jawab terhadap semua pulau-pulau di Tanah Air. Saat ada informasi penjualan 2 pulau di Indonesia, Fadel mengungkapkan kritik kepada Menteri Kelautan dan Perikanan saat ini, Sharif Cicip Sutardjo. ”Kementerian Kepulauan dan Perikanan menangani semua pulau-pulau di Indonesia. Pulau terluar waktu itu kita inventarisir ada 60 buah pulau dan kita tidak mau menyewakan apalagi menjual. Kita anggap lokasi strategis untuk menjaga keamanan negara di perbatasan,” kata Fadel, Rabu (5/9). Fadel mengingatkan agar Kementerian KP lebih jeli mengamankan pulau-pulau Indonesia. Jangan sampai pulau dijual tapi juga harus peka terhadap investasi. ”Nggak boleh kita menjual pulau kepada siapapun juga. Kita bikin kerja sama untuk investasi, kita undang investornya masuk dengan beberapa pertimbangan. Yang pertama kita bisa membangun holiday resort, kita bisa bikin apakah 15 tahun ataukah 20 tahun perjanjian,” saran Fadel. Fadel lantas mengkritisi kinerja Kementerian KP setelah ditinggalkannya. Di bawah menteri yang baru tak lain adalah Wakil Ketua Umum Golkar Sharif C Sutardjo, dia mendengar ada hal yang menjadi tidak teratur. ”Saya dengar sekarang sudah nggak teratur. Ya saya banyak prihatinnya. Misalnya program kita menaikkan produksi ikan rakyat sudah ditiadakan,

sekarang orientasinya industri. Dulu saya canangkan program itu agar kita nggak perlu impor ikan. Itu prinsip membangun ekonomi kerakyatan,” ingat Fadel yang juga menjabat Wakil Ketua Umum Golkar ini. Situs www. memasang iklan penjualan pulau Gambar di Laut Jawa dan pulau Gili Nanggu di Lombok, Nusa Tenggara Barat. Kementerian Kelautan dan Perikanan pun melakukan pengecekan kepemilikan pulau tersebut. Pulau Gambar menjadi salah satu pulau yang dijual dalam situs penjualan pulau pribadi dunia tersebut. Harga yang ditawarkan tergolong murah yakni USD 725 ribu atau setara dengan Rp 6,8 miliar (kurs Rp 9.500). Dalam informasi penjualannya, pulau itu disebutkan berada di kawasan Laut Jawa dengan luas 2,2 hektar. Pulau Gambar dideskripsikan sebagai pulau unik yang masih ‘perawan’. Dengan pantai indah yang mengelilinginya, pulau ini layak dijadikan sebuah hunian pribadi. Air laut di sekitar pulau relatif tenang dan dangkal. Para pengunjung bisa menyelam, snorkelling dan memancing. Sejumlah ikan dan lobster bisa ditemukan di tepi pantai. Sementara pulau Gili Nanggu di Lombok yang memiliki luas 4,99 hektar itu ditawarkan dengan harga Rp 9,9 miliar. Lokasinya yang berada di laut Bali jadi daya jual tersendiri. Menurut situs tersebut, pemilik pulau menawarkan Gili Nanggu dengan sejumlah fasilitas. Di antaranya 10 unit cottage, 7 unit bungalow, 1 unit restoran, mini bar, kamar, dan area pengembangbiakan kura-kura. (dtc/int)

Sidang Angelina Dipimpin Hakim Sudjatmiko JAKARTA- Angelina Sondakh bakal duduk di kursi pesakitan pada Kamis (6/9). Sidang perdana politisi Partai Demokrat itu dipimpin ketua majelis hakim Sudjatmiko. Sidang Angie dijadwalkan digelar sekitar 09.00 WIB. ”Anggota majelis hakimnya ada Marsudin Nainggolan, Avi Antara, Hendra Yospin dan Aleks Marwata dan panitera T Umar,” ujar Sudjatmiko ketika dikonfirmasi, Rabu (5/9). Sedangkan tim jaksa penuntut umum dari KPK akan dipimpin oleh jaksa Agus Salim. Sudjatmiko selama ini sudah beberapa kali memimpin persidangan di pengadilan Tindak Pidana Korupsi Jakarta di antaranyamengadili Nyoman Suisnaya, terdakwa kasus

Angelina Sondakh memasuki ruang persidangan sebagai saksi kasus Nazaruddin. suap PPID di Kemenakertrans, dan menjatuhi hukuman tiga tahun penjara.

Hakim yang juga menjadi jubir Pengadilan Negeri Jakarta Pusat ini juga menjadi ketua majelis hakim

yang menjatuhkan hukuman 2,5 tahun untuk Nunun Nurbaetie. Angie menjadi tersangka kasus

suap pembahasan anggaran pengadaan alat laboratorium di 17 perguruan tinggi negeri di Kementerian Pendidikan serta pembangunan Wisma Atlet SEA Games Palembang di Kementerian Pemuda dan Olahraga. KPK menduga Angie telah menerima suap Rp 6 miliar. Suap terhadap Angie ini terungkap dari pengembangan kasus suap Wisma Atlet. Terpidana Wisma Atlet, Mindo Rosalina Manulang, mengatakan pernah berhubungan melalui pesan BlackBerry dengan Angie. Isi percakapan tersebut membahas berbagai proyek di perguruan tinggi. Namun Angie membantahnya. Dia bahkan mengaku tidak memiliki BlackBerry saat itu. (kmc/int)


6 September 2012

Interaktif Tapanuli Perbaiki Lampu Jalan Pak Bupati yang terhormat tolong perbaiki lampu jalan khususnya di gang-gang termasuk di Sibuluan 3. Karena lampu-lampu tersebut sudah banyak yang tidak berfungsi. Hal ini guna meminimalisir kecelakaan lalu-lintas yang mungkin akan terjadi. Terimakasih. Pengirim: 08776744XXX

Kinerja KUA Sibolga Selatan Tak Becus Kepada Wali Kota Sibolga yang terhormat. Pegawai KUA (Kantor Urusan Agama) Sibolga Selatan tidak menjalankan pelayanan yang sebagaimana mestinya. Karena buka pukul 09.00 WIB dan tutup pukul 11.00 WIB. Kalau siang buka pukul 15.00 WIB dan tutup pukul 15.45 WIB. Kami warga Sibolga Selatan berharap Pak Wali menindaklanjutinya. Terimakasih. Pengirim: 085261539XXX

Air Terjun Silak-silak Sangat Berpotensi Bupati Tapteng yang terhormat. Tolong diperhatikan tempat wisata air terjun yang ada di daerah Silak-lak Tapteng. Lokasi ini sangat berpotensi menjadi objek wisata andalan. Terimakasih. Pengirim: 087891509XXX

Pasar Tarutung Bau Busuk PASAR tradisional Tarutung, Kabupaten Taput beberapa bulan terakhir terlihat jorok dan menimbulkan bau busuk yang menyengat. Aroma ini sangat terasa di balairong penjual daging kerbau dan ikan basah. Bahkan di sekeliling balairong tersebut terdapat banyak sampah dan kondisinya sangat becek. Akibat dari kondisi yang sangat memprihatinkan itu, tidak tertutup kemungkinan akan terjadi wabah penyakit seperti ispa, gatal-gatal, dan diare d lokasi tersebut. Selain wajah pasar terlihat kumuh, selokan yang dibangun beberapa tahun lalu di tengah pasar sudah berubah menjadi tempat sampah. Saluran air di sekeliling pasar selain kotor dengan tumpukan sampah juga kebanyakan sudah rusak. Ini artinya bahwa Dinas Pasar dan Kebersihan Taput tutup mata. Karena pemandangan

ini terjadi sudah sangat lama. Demikian antara lain celoteh warga dan pengunjung pasar tardisional tardisional Tarutung kepada METRO Rabu (5/9). Kondisi tersebut sangat memprihatinkan karena jauh dari kebersihan dan menimbulkan bau busuk. Diharapkan petugas kebersihan pasar serius memperhatikan limbah penjualan pedagang. Warga sebenarnya tidak menyalahkan petugas pasar. Namun, warga meminnta dicarikan solusi terkait saluran parit dan sampah menumpuk itu. Jika dibiarkan, kondisi ini dikhawatirkan akan memicu penyakit. (cr-01)

“JIKA tidak segera diambil tindakan dikhawatirkan Pasar Tarutung akan sangat kumuh. Kita meminta pemerintah daerah khususnya petugas kebersihan pasar mencari solusi mengangkut sampah-sampah tersebut,” ujarnya sembari mengaku sering berkunjung ke Pasar Tarutung. Ditambahkannya, kondisi tersebut merupakan salah satu indikasi, bahwa petugas kebersihan pasar perlu meningkatkan kinerja dan diharapkan warga sekitar baik pedagang tidak membuang sampah secara sembarangan. “Semua pihak harus peduli dalam penataan pasar, selain dibutuhkan peran petugas kebersihan, juga diperlukan turun tangan masyarakat untuk peduli kebersihan dan jangan cuma berharap petugas saja yang membersihkan,” ketusnya. Selain terlihat jorok dan bau, penataan lokasi juga terlihat amburadul. Bangunan kios tempat jualan daging sudah terlihat rusak dan rapuh. Sebahagian asbes dan plafon bangunan sudah bolong, atapnya bocor, dan dindingnya retak-retak.(***) Tongam Parapat Ketua Asosiasi Wartawan Indonesia (AWDI) Taput

FOTO // Bernad L Gaol

„ Lokasi balairong penjual daging kerbau jauh dari kebersihan dan kurang perawatan sehingga terlihat kumuh.

ANEH TAPI NYATA Minum ASI Istri Untuk Atasi Disfungsi Ereksi

GANTI NAMA: Toko Pakaian Hitler di Ahmadabad, Gujarat, India akhirnya berganti nama setelah mendapat banyak protes dan kecaman dari warga.

Gunakan Nama HITLER

Toko Pakaian Diprotes NEW DELHI- Untuk apalah arti sebuah nama. Istilah ini yang dialamatkan Toko Pakaian Hitler di Ahmadabat Negara Bagian Gujarat, India setelah mendapat protes dari warga. Pasalnya, nama itu dianggap diktator Jerman Adolf Hitler dan penuh masalah. Nama Hitler dipampang besar-besar di depan Toko milik Rajesh Shah itu dan tak lupa titik di atas huruf “I” dilengkapi lambang swastika Nazi yang terkenal itu. Pemilik Tokoh Manish Chandani mengatakan, nama Hitler dipilihnya untuk mengenang sang kakek yang membesarkan anak-anaknya dengan disiplin tegas sehingga kerap dijuluki Hitler. Memang nama toko itu menarik perhatian, tetapi sekaligus cercaan yang datang dari komunitas Yahudi yang tinggal di Ahmadabad. Tak hanya masyarakat Yahudi biasa yang mengajukan protes, Konsulat Jenderal Israel di Mumbai bahkan meminta pemerintah negara bagian untuk turun tangan. Manish Chandani, salah seorang pemilik toko ini, mengaku mendapatkan banyak telepon

dan permintaan untuk segera mengganti nama tokonya itu. ”Saya berencana untuk mengganti nama toko secepat mungkin,” ujar Chandani. ”Kami menerima banyak desakan dari komunitas Yahudi dan pemerintah untuk mengganti nama toko ini,” tambah dia. ”Kami tak menyadari Hitler bertanggung jawab atas kematian enam juta orang Yahudi di masa Perang Dunia II,” aku Chandani. Kasus terkait Hitler dan lambang-lambang Nazi sudah beberapa kali terjadi. Pada 2006 lalu, sebuah restoran di Mumbai bernama Hitler Cross memicu kemarahan warga. Restoran itu kemudian mengganti namanya setelah mendapatkan protes dari Kedutaan Israel, Jerman, dan Liga Antifitnah Amerika Serikat. (kps/nik)

Badai Isaac Melanda AS

Ribuan Bangkai Tikus Penuhi Mississippi TUPELO - Puluhan ribu tikus mati akibat terjangan badai isaac melanda Amerika Serikat (AS). Saat ini, bangkai-bangkai tikus itu tersapu oleh badai dan memenuhi pantai Mississippi. Badai Isaac menciptakan wabah banjir di Louisiana, pada saat yang sama, tikus-tikus pun terbawa arus air yang mengalir hingga Mississippi. Bangkai dari puluhan ribu tikus dapat disaksikan di garis pantai Mississippi. Pada Selasa kemarin, para petugas kontraktor menemukan 16 ribu bangkai tikus di Hancock County. Mereka pun terpaksa mengangkut bangkai-bangkaiitudengan menggunakan sekop dan garpu tanah. ”Kami akan menggelar acara yang bernama “Pesiar Pantai” pada Oktober mendatang, dipastikan 30 ribu hingga 40 ribu orang akan datang ke pantai

ini. Kami harus segera membersikan pantai ini,” ujar salah seorang pejabat di Hancock County, Rabu (5/9). Bau busuk pun tercium di sekitar pantai Mississippi, meski bangkai-bangkai itu tidak akan menyebabkan gangguan kesehatan, bangkai itu terlihat menjijikkan. Pantai di Mississippi terlihat amat kotor untuk saat ini. Mississippi juga sempat bergelut dengan masalah bangkai tikus di saat Badai Katrina dan Gustav menyerang wilayah tersebut. Pantai itupun ditutup untuk publik karena pengunjung-pengunjung tidak akan kuat dengan bau bangkai itu. Selain bangkai tikus, para pekerja kontraktor juga menemukan bangkai hewan-hewan lain. Hewan itu adalah babi, rusa, rubah, ular dan kelinci. (oz/nik)

AMERIKA SERIKAT-Air Susu Ibu (ASI) diakui banyak manfaatnya untuk kesehatan bayi, baik mengatasi masalahnya. Karena bernafaat besar, suami Michelle yakni Jeff di AS meminumnya untuk mengatasi masalah disfungsi ereksi yang di alaminya. Jeff memintahalitudirahasiakan karena aktivitas menyusui itu ke dalam rutinitas hubungan seksual keduanya sejak beberapa bulan setelah kelahiran anak pertama mereka.Kinianakpertamamereka yang berkelamin perempuan itu berusia 2 tahun dan telah berhenti menyusu kepada ibunya, namun kini istrinya Michelle (27) juga tengah memproduksi ASI untuk anak laki-laki mereka yang berusia 8 bulan. Jeff pun mengaku meminum susu Michelle ‘langsung dari sumbernya’. Keduanya tak hanya menganggap hal itu sangat erotis namun Jeff juga mengaku kebiasaan ini mampu mengurangi gejala-gejala disfungsi ereksi yang dialaminyasecarasignifikan.Meski begitu, kedua anak mereka selalu mendapatkan prioritas untuk urusan ASI Michelle, catat Jeff. Keduanya pun diperbolehkan tampil dalam sebuah acara TV di AS yang memaparkan berbagai macam seks unik dan aneh berjudul Strange Sex. Meski begitu awalnya pasangan ini berharap dimasukkan ke dalam salah satu jenis seks aneh yaitu vampirisme. “Vampirisme itu persis seperti apa yang selama ini kita dengar, namun saya tak membutuhkan darah,”kataJeffsepertidilansirdari huffingtonpost. Bagi Michelle dan Jeff sendiri, vampirisme bukan berarti pengalaman seks yang berdarah-darah. Gigitan yang

diberikan Jeff akan membuat Michelle merasa seperti lututnya tergores dengan jumlah darah yang keluar sangat sedikit. LagipulakataJeff,vampirismeini mengurangigejala-gejaladisfungsi ereksi yang dialaminya. Namun pasangan ini memutuskan untuk tidak melakukannya terlalu sering, sebagian karena khawatir dengan risiko luka yang bisa ditimbulkan. Ketika Michelle mulai menyusui anak mereka maka aktivitas vampirisme itu harus berhenti karena payudara Michelle telah menjadi target gigitan Jeff. Kemudian keduanya menemukan gagasan untuk membuat eksperimen dengan menyusui Jeff. Keduanya pun menganggap hal ini sebagai transisi alami. Stasiun TV yang akan menyiarkan acara ini awalnya juga menolak aplikasi Michelle dan Jeff yang menunjukkan vampirisme. Namun ketika pasangan ini mengirimkan aplikasi kembali, kali ini dengan menyebutkan kata menyusui,akhirnyastasiunTVitupun bersediamenampilkanpengalaman keduanya di acara mereka. Jeffmengakuingintampildiacara tersebut agar bisa mendorong parapriayangmungkinmenderita disfungsi ereksi untuk mencoba berbagai hal baru dengan pasangannya. Jeff merasa bahwa para pria bisa saja menemukan sesuatu yang bisa membantunya, sama halnya dengan yang terjadi padanya. Jeff menekankan bahwa gejala disfungsi ereksinya belum benarbenar sembuh. Namun menyusu pada Michelle membuat gejala disfungsi ereksinya jauh lebih ringan dan telah terbukti mampu meningkatkan kehidupan seksualnya. (int/nik)


6 September 2012


Raffi Ahmad

Tak Kapok Naik Moge

Artis serba bisa Raffi Ahmad ikut prihatin atas musibah yang menimpah beberapa temannya dalam menggendarai Motor gede, Raffi mengatakan bahwa kecelakaan bisa menimpa siapa aja, bahkan kepada pejalan kaki sekalipun, yang penting harus berhatihati saja. ”Saya turut prihatin dengan kejadian yang menimpa beberapa teman saya, salah satunya Rezky, buat saya yang paling penting sih dalam mengendarai Motor khususnya Motor Gede kita harus hati-hati dan harus saling menghormati sesama pengendara motor,” ungkap Raffi saat ditemui di Studio RCTI, Kebon Jeruk, Jakarta Barat, Rabu (5/8). Bagi Raffi hobby dirinya naik motor akan terus ditekuni, dirinya tidak terpengaruh dengan kejadian-kejadian yang menimpa beberapa teman-temannya. Bahkan dalam jangka waktu dekat ini dirinya bersama teman-temannya akan melakukan Touring Makassar-Toraja. ”Enggak lah enggak kapok, dan dalam waktu dekat ini saya juga mau Touring ke Makassar neh dan saya sih naik motor gede selalu mematuhi peraturan dan menggenakan safety raiders. (abu/jpnn)

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober) Di hari ini hampir tidak ada gangguan yang berarti yang akan membikin kacau. Karena suasana dan situasi cukup mendukung bisnis Anda, maka jangan ragu untuk melakukan manuver-manuver yang berbahaya sekalipun.


(21 Desember -19 Januari)

Tak perlu ragu untuk mencoba memulai hal baru, walaupun semua itu memang berat untuk di awalnya, akan tetapi yang terpenting jalani dulu semua itu. Resiko dan hambatan di kemudian hari sebaiknya dipikir sambil jalan.


(20 Januari - 18 Februari)

cha Septriasa adalah salah satu aktris yang selalu tampil total di film. Hal ini kembali Acha buktikan saat beradu akting dengan Reza Rahardian di film “Test Pack” produksi Starvision. Mungkin penikmat film Indonesia masih ingat dengan fill “Love Is Cinta” yang dibintangi Acha bersama Irwansyah. Saat itu keduanya tampil cukup romantis. Di masa itu Acha dan Irwansyah adalah sepasang kekasih, sementara di film ini Acha dan Reza bukanlah pasangan kekasih di dunia nyata. ”Sebagai pemain itulah tantangannya. Kalau pasangannya beda itu tantangan, karena harus bikin chemistry yang beda lagi,” kata Acha di Planet Hollywood Jakarta Selatan. Film “Test Pack” menceritakan perjalanan pasangan suami istri Rahmat (Reza Rahardian) dan Tata (Acha Setriasa). Konflik kemudian muncul karena

pasangan ini tak dikaruaniahi anak meski telah tujuh tahun menikah. Test Pack juga menyajikan adegan kemesraan antara Reza dan Acha yang berjuang untuk memperoleh anak. Acha mengungkapkan dirinya tak merasa

AKTRIS yang juga model cantik Renata Kusmanto terus dikait-kaitkan punya hubungan khusus dengan Fachri Albar. Tapi pemeran Shinta dalam film “Test Pack” juga terus membantah hubungannya dengan Fachri Albar. ”Enggak tahu deh, temenan sih. Tergantung orangnya aja melihatnya mau seperti bagaimana,” kata Renata di Planet Hollywood Jakarta Selatan. Renata juga terkesan berhati-hati jika ditanya tentang Fachri Albar. “Enggak tahu deh saya, seperti dia apa adanya. Saya melihat dia sebagai seorang pria,” ujar Renata. Renata saat ini tidak menargetkan diri kapan akan menikah. Namun

canggung beradegan mesra dengan Reza. ”Saya langsung dapat gimana nyender sama dia, gimana pegang tangan dia, dia cium saya. Karena ceritanya hubungan suami istri,” ungkap Acha. Saat pertama kali menerima tawaran film ini, Acha tidak tahu akan bermain dengan Reza Rahardian. Selain Reza aktor lain seperti Winky Wiryawan dan Christian Sugiono sempat ditawarkan ”Akhirnya terpilih Reza Rahadian. Umur saya enggak jauh beda dan belum pernah punya istri, jadi saya lebih bebas berekspresi saya,” terangnya. (abu/ jpnn)

Renata juga tidak mau menutup diri, jika saja dirinya menemukan pria yang cocok untuknya.”Saya mau fokus dikerjaan aja. Waktunya sih enggak ada, kalau memang ketemunya pas banget ya sudah enggak dibatasi, yang penting pas aja dan cocok,” kata Renata. Aktris yang akan merayakan ulang tahun ke30 pada 7 November mendatang ini mengaku orang tuanya tidak terlalu mendesak untuk menikah. “Dia cuma nyanya aja bagaimana, tapi terserah sama aku, yang penting cocok,” jelasnya. (abu/jpnn)

PENYANYI Alexa Key termasuk artis yang peduli pada pendidikan. Ia pun mengaku lebih mengutamakan sekolah ketimbang kariernya. Alexa Key memang tak memungkiri banyak tawaran manggung datang. Namun, kembali lagi ke jadwal, ia akan mempertimbangkan tawaran itu ketika tak sibuk sekolah. ”Pendidikan nomor satu, Papa juga bilang sekolah nggak boleh ditinggalkan,” ungkapnya saat ditemui di acara HUT TVRI ke-50 di Jalan Gerbang Pemuda, Senayan, Jakarta Selatan, Rabu (5/9). Sebelumnya, Alexa menimba ilmu di Bali. Tapi, tampaknya sekolah di sana tak efisien dalam segi waktu. Ia pun memilih tinggal di Jakarta. ”Waktu di Bali diprotect orangtua, sekarang dikasih kepercayaan, tapi kontek setiap hari. Jaga diri, jangan lupa sekolah, mereka orangtua yang ketat dan protektif, tapi aku sudah dewasa dan dikasih kebebasan. Aku di Jakarta sama asisten,” tuturnya. (dtc/int)

Teruslah berupaya meraih hasil yang terbaik. Tidak perlu menyerah dengan keadaan karena ibarat orang berjalan pasti tidak akan selalu mulus jalannya, maka dari itu tetaplah optimis dan yakin.


19 Februari - 20 Maret

Waspadalah, omongan yang berhembus itu anggaplah angin lalu. Tak perlu ditanggapi toh nantinya akan hilang dengan sendirinya ditiup angin. Cobalah lebih konsentrasi pada apa yang sedang Anda hadapi. Tak perlu memikirkan yang bukan-bukan.


(21 Maret - 20 April)

Entah karena apa, belakangan ini Nikita Mirzani jadi sering membicarakan dan menyebut-nyebut nama Aming. Setelah mengklaim pacaran dengan komedian itu, kini ia membuat pengakuan baru lagi. Kali ini, artis yang kerap tampil seksi itu seolah menyangkal pernyataannya sendiri sebelumnya. Kini ia mengaku hanya berteman, dan menginginkan pendamping seperti Aming. ”Sebenernya gini, Nikita itu temen deketnya dia (Aming). Kalau orang kan salah menginterpretasikannya,” tuturnya saat berbincang melalui ponselnya, Rabu (5/9). ”Kalau aku suka dia itu, pengen yang jadi pendampingku nanti seperti dia, kepribadiannya, sifatnya dan semuanya,” tambahnya. Nikita mengaku bingung kenapa gosip hubungannya dengan Aming menjadi ramai diberitakan. Menurutnya, pacar Aming yang sebenarnya sempat terganggu dengan kabar tersebut.

Peluang yang tinggi sebaiknya bisa diimbangi juga dengan kerja keras jangan sampai loyo ataupun tidak ada peningkatan dalam prestasi kerjanya. Di hari ini peruntungan cukup mujur sehingga selalu ada saja jalan setiap menemui suatu permasalahan.


(21 April - 20 Mei)

Tak ada gunanya mengobral janji kalau akhirnya hanya akan membuat beban Anda saja di kemudian hari. Bicaralah terus terang dan tak perlu menutup-tutupi kesulitan yang lagi Anda hadapi saat ini.


(21 Mei - 20 Juni)

Peruntungan cukup mujur sehingga sangat baik untuk digunakan menyelesaikan masalah yang terkatungkatung itu. Hanya saja jangan mudah percaya dengan orang lain sebelum Anda melihat sendiri buktinya.


(21 Juni- 20 Juli)

Optimis memang perlu tetapi untuk saat ini sebaiknya jangan terlalu berambisi karena situasi di sekitar Anda sulit untuk Anda prediksi. Lebih baik Anda melangkah dengan sabar tetapi sangat terencana agar kesuksesan tetap dapat Anda raih.


(21 Juli-21 Agustus)

Apapun resiko yang akan muncul sebaiknya keyakinan tetap tidak boleh bergeser, untuk itu hindari membicarakan persoalan pada orang lain agar pikiran dan visi Anda tidak sampai terganggu.

Gisel Libra

(23 Agustus-22 September)

.Tetaplah melangkah maju karena

sudah kepalang tanggung untuk melangkah mundur. Lebih baik yang ada dijalani dengan kesungguhan dan kemantapan hati.


(23 Oktober - 22 November)

Jangan biarkan kecerobohan mengganggu kinerja dan kelangsungan bisnis Anda, apalagi kompetitor tampak selalu memperhatikan setiap gerak-gerik Anda.


( 23 November - 20 Desember)

Jangan hanya diam saja melihat sikap orang lain meremehkan kemampuan diri Anda. Segera lakukan gebrakan karena bagaimanapun juga mereka ternyata tidak bisa dihadapi dengan halus.

Sejak berita kecelakaan pesinetron, Rezky Aditya tersebar luas di media, Gissel ‘Idol mengaku jadi takut. Sinden Opera Van Java ini pun merasa ngeri boncengan motor bersama kekasihnya, Gading Marten. Gissel takut karena membayangkan ia bersama Gading akan mengalami kecelakaan seperti yang dialami oleh Rezky Aditya. “Baru mau mulai seru-seruan, baru beli jaket, kok malah kayak gini. Keder sih, makanya aku selalu ngomong ke Gading, aku kan selalu bilang, pokoknya pake helm

pake jaketnya yang lengkap. Meski pun ngebut, ngebutnya hati-hati,” kata Gissel di RCTI, Kawasan Kebon Jeruk, Jakarta Barat, Rabu (5/9). Menurut Gissel sebenernya ia agak khawatir juga dengan kekasihnya, meskipun Gading sudah bisa naik motor. Namun mengendarai motor gede (moge) itu baru bagi Gading. “Makanya aku khawatir banget, cerewet banget. Bukannya nggak suka dia naik motor, tapi khawatir,” ujarnya. Gissel sadar jika naik motor gede pasti

larinya kenceng, nggak mungkin pelan. Makanya ia bilang ke Gading agar selalu pakai pelindung motor yang banyak. “Mobilkan banyak pengamannya. Kalau motor langsung badan, langsung kepala,” ujarnya. Karena ketakutannya ini pula Gissel harus memupus angannya bisa naik moge seperti motor polisi. “ “Tapi kok kayak gininya. Jadi biarlah itu jd angan-angan belaka. Sekarang jadi parno, ntar-ntar ajalah,” tandasnya. (tr/int)

Pengen yang jadi pendampingku nanti seperti dia, kepribadiannya ”Aming nggak marah sih, ketawa aja. Dia orangnya asik, tapi pacarnya ngambek,” paparnya. (dc/int)



6 September 2012

Pedrosa Cetak Rekor di Aragon


ASURANSI ATLET: Presdir PT BCA Jahja Setiaatmadja di dampingi ketua KOI Rita Subowo dan Ketua Kontingen Olimpiade Indonesia Erick Tohir usai pemberian penghargaan.

Dua atlet angkat besi Eko Yuli Irawan dan Triyanto kembali mendapatkan penghargaan. Peraih medali di Olimpiade 2012 itu diberi jaminan asuransi kesehatan untuk jangka waktu yang sangat lama. Angkat besi adalah satu-satunya cabang yang menyumbangkan medali bagi kontingen Indonesia di Olimpiade lalu. Eko Yuli Irawan meraih medali perunggu,

sementara Triyatno menyabet medali perak. Sebagai wujud kepedulian atas prestasi yang diraih dua atlet angkat besi tersebut, Bank Cen-

tral Asia (BCA) memberikan penghargaan berupa perlindungan asuransi kesehatan. “Pemberian penghargaan ini merupakan bukti nyata kepedulian BCA terhadap peningkatan jaminan kepada atlet di masa depan. Karena kami turut bersyukur dan bangga atas prestasi dan pencapaian mereka,” ujar Presiden Direktur BCA,

Jahja Setiaatmadja, di Planet Hollywood, Jakarta, Rabu (5/9). Perlindungan asuransi tersebut tertanggung hingga usia 75 tahun. Rinciannya adalah perawatan rumah sakit kelas VIP, perlindungan 34 macam penyakit kritis dan perlindungan kecelakaan. Selain itu, pemberian jaminan perlindungan kematian sampai usia 99

Ahsan Mulai dari Awal Lagi

Pemain ganda putra Indonesia Mohammad Ahsan harus memulai perjuangan dari titik awal untuk kembali ke elite dunia setelah memutuskan berpisah dengan pasangannya Bona Septano. Keduanya sepakat berpisah setelah sama-sama mengevaluasi diri dari pencapaian prestasi. Keduanya memang masuk dalam elite dunia dalam peringkat 10 besar dunia. Namun, keduanya kerap kesulitan meraih gelar ketika berhadapan dengan empat ganda kuat dunia dari China, duo Korea Selatan, dan Denmark. Hasil mengecewakan pada Olimpiade London 2012 juga menjadi pertimbangan terakhir mereka untuk berpisah. “Kami pikir kita sudah waktunya berpisah. Permainan kita berdua sudah mentok dan kami butuh suasana baru,” kata Ahsan dalam jumpa pers

„ M Ahsan di pelatnas Cipayung Jakarta, Rabu (5/9). Selanjutnya Ahsan akan berpasangan

dengan Hendra Setiawan yang merupakan juara Olimpiade Beijing. Hendra sendiri sebelumnya juga menyatakan berpisah dengan Markis Kido setelah dipanggil kembali ke pelatnas Cipayung. Seusai menyalami Bona yang disaksikan pelatihnya Herry IP yang didampingi kepala pelatih ganda Christian Hadinata, Ahsan mengungkapkan dirinya akan berupaya keras untuk kembali ke jajaran elite dunia. “Kami akan memulai lagi setahap demi setahap. Mudah-mudahan prestasi kami lebih bagus,” kata Ahsan. (int)

tahun. Jahja menambahkan, dengan diberikan asuransi kesehatan itu diharapkan dapat memberikan rasa aman bagi Eko dan Triyanto saat berlaga maupun saat pensiun. “Dengan adanya penghargaan ini, diharapkan menjadi acuan dan motivasi para atlet agar terus bekarya,” tukasnya. (int)

„ Kate Middleton

buat balapan selanjutnya dan mari kita lihat apa yang bisa kita dapattkan dari motor ini,” tandas The Little Spaniard (julukan Pedrosa). Lorenzo sendiri harus puas menempati peringkat kedua, sedangkan Ben Spies menempati peringkat ketiga dengan selisih waktu +0.664 detik dari Pedrosa. Kemudian disusul Stefan Bradl (+1.587 detik) dan Jonathan Rea (+2.696 detik), yang akan sementara mengggantikan posisi Stoner Tes MotoGP Aragon selanjutnya akan berlangsung pada Rabu waktu setempat. Sementara itu, Ducati mengadakan tes pribadi di Sirkuit Mugello, pekan ini. (int)

mampu menang set pertama 6-1. Di set kedua, Trosur mampu membalas dengan memetik kemenangan 6-4. Duel sengit kembali terjadi di set ketiga. Kedua petenis tampil ngotot dan pertandingan berjalan alot. Tapi Stosur tampaknya harus mengakui keunggulan lawannya itu. Azarenka berhasil menutup set ketiga dengan 7-6(5). Kemenangan ini membuat petenis Belarusia itu berhak melaju ke babak semifinal. Di babak ini, Azarenka akan menghadapi antara Maria Sharapova atau marion Bartolli. Sharapova diketahui menjadi unggulan ketiga di turnamen ini. Sedangkan Bartolli merupakan unggulan kesebelas. (int)

Alonso: Grosjean Minta Maaf lewat Telepon

Pembalap Ferrari, Fernando Alonso, tak menaruh dendam terhadap pebalap Lotus, Romain Grosjean, yang menggagalkan usahanya untuk merebut poin di GP Belgia, akhir pekan lalu. Pebalap asalSpanyolinimengatakandirinya sudah memaafkan pebalap Perancis tersebut, yang telah mengakui kesalahannya meskipun melalui telepon. “Ya,kamisudahmengadakan kontak, karena kami memiliki hubungan yang baik,sertakamimerupakan teman kelas pada 2009. Saya mengirimkan SMS untuk menjelaskan bahwa dia tidak memperhitungkan jarak, dan dia sudah meminta maaf atas insiden itu. Saya mengatakan kepadanya bahwa tak ada masalah lagi,” jelas Alonso, seperti dikutip T o p sportracing, Rabu (5/ 9).

Tolak Bersalaman dengan Kate Middleton berjabat tangan dengan perempuan yang tidak memiliki hubungan keluarga atau muhrimnya,” ujar perwakilan Kerajaan Inggris, seperti dilansir Daily Mail. Delegasi Iran mengatakan, tindakan Kahram sama sekali tak punya sentimen politik, dan semata-mata hanya untuk menjalankan ajaran agama Islam. “Jika atlet putri yang mendapat medali, pasti akan berjabatan tangan dengan sang putri.” Tahun lalu, tim voli putra Iran dikecam di negaranya setelah berjabatan tangan dengan wasit perempuan usai pertandingan melawan Afghanistan. Sejumlah media m e n y e b u t tindakan tersebut s a n g a t memalukan, dan tak pantas dilakukan. (int)

„ Dani Pedrosa

Azarenka Tekuk Juara Bertahan

PETENIS unggulan pertama, Victoria Azarenka sukses menghentikan langkah juara bertahan, Samantha Stosur di babak perempat final Grand Slam AS Terbuka, Selasa, 4 September 2012 (Rabu dinihari WIB). Azarenka memenangi laga lewat duel tiga set 6-1, 4-6, 7-6 (5). Kemenangan ini tidak diperoleh dengan mudah oleh petenis 23 tahun itu. Stosur yang berstatus juara bertahan memberikan perlawanan sengit. Dalam laga yang digelar di Arthur Ashe Stadium ini, Azarenka

Mehrdad Karam Zadeh

ATLET paralimpiade asal Iran, Mehrdad Karam Zadeh, menjadi perbincangan di Eropa setelah menolak menjabat tangan istri Pangeran William, Kate Middleton, yang merupakan keluarga kerajaan, di ajang Paralimpiade 2012 di London. Atlet tolak peluru ini menolak bersalaman tangan dengan Duchess of Cambridge setelah penyerahan medali perak. Middleton sebelumnya mendapat sambutan hangat dari peraih medali emas, Alec Davies dari Inggris Raya dan peraih perunggu, Lezheng Wang dari Cina.Namun saat Middleton mengalungkan medali perak kepada Karam, atlet berusia 40 tahun itu tidak menjulurkan tangan seperti dua atlet sebelumnya. Ia hanya meletakkan kedua tangannya di depan dada seperti salam yang biasa dilakukan orang Thailand. Bagi orang-orang Eropa kejadian tersebut dianggap sangat menghebohkan, bahkan dikait-kaitkan dengan sentimen politik. Padahal pastinya, Karam tak berjabatan tangan dengan sang putri lantaran hal itu bertentangan dengan ajaran Islam. Dengan kata lain sang putri bukan muhrimnya. Juru bicara Istana St James, yang merupakan tempat sang putri bermarkas, sebelumnya mengatakan pihaknya telah memberi tahu Kate agar tak menjabat tangan atlet Iran tersebut. “Atlet pria dari negara Islam tidak

Dani Pedrosa terus melanjutkan performa gemilangnya. Pedrosa menjadi pembalap tercepat mengalahkan rivalnya Jorge Lorenzo dalam sesi tes di Aragon, Selasa (4/9) kemarin waktu setempat. Lorenzo yang mencatat kemenangan dalam balapan terakhir di Brno, tidak mampu membendung keperkasaan Pedrosa. Pembalap Repsol Honda itu unggul 0.488 detik dari rivalnya tersebut. Pedrosa yang fokus di suspensi dan elektronik, mampu melahap sekitar 35 lap dengan mencatatkan waktu terbaik 1m 47.983 detik. Catatan yang diraih pembalap asal Spanyol itu, melampaui rekor yang pernah dibuat oleh Casey Stoner di Aragon. “Kami fokus untuk mengerjakan suspensi untuk meningkatkan performa grip bagian depan khususnya. Kami hanya berusaha untuk membuat motor lebih lembut lagi,” ungkap Pedrosa, dikutip dari Crash, Rabu (5/9). Saat itu, ia berhasil mencatat rekor 1m 49.046 detik saat perlombaan dan 1m 48.451 detik, ketika meraih pole position pada sesi kualifikasi. Keduanya diraih saat masih menggeber mesin 800cc. “Ini tes resmi terakhir, jadi sangat penting untuk memanfaatkan keuntungan

„ Victoria Azarenka

Memang, Alonso harus menerima kenyataan pahit pada balapan tersebut.Saatlampumerahpadam tanda balapan dimulai, dia ikut menjadi korban tabrakan beruntun yang disebabkan oleh Grosjean, yang lebih dulu menyenggol mobil Lewis Hamilton, sebelum menghantam Sergio Perez, dan akhirnyaikutmenyeretmobilAlonso yang mengalami rusak berat. Akibat kegagalan dalam lomba ini, Alonso tak mampu mendapatkan poin, meskipun dia tetap memimpin klasemen sementara. Akan tetapi, posisinya sudah mulai mendapatkan ancaman dari pebalapRedBullRacing,Sebastian Vettel, yang menjadi runner-up setelah finis di belakang pebalap McLaren, Jenson Button. Kini, Alonso hanya unggul 24 poin atas juaradunia2010dan2011tersebut. Namun Alonso tak mau larut dalam kekecewaan akibat insiden, yang tidak ingin dijadikan persoalan. Mantan pebalap Renault dan McLaren ini mengaku siap menghadapi seri selanjutnya di Monza, Italia, pada akhir pekan ini. Apalagi, balapan tersebut akan berlangsung di kandang Ferrari. “Saya baik-baik saja, dan dalam kondisi 100 persen, serta siap melanjutkan pertarungan. Memang, kejadian hari Minggu itu menyakitkan, tetapi tidak menghancurkan. Setelah bangun, saya sudah dalam kondisi 100 persen. Saya sudah bisa berolahraga, bekerja di simulator, dan semuanya sempurna,” ujar juara dunia 2005 dan 2006 ini. Alonso bekerja secara intensif di Maranello,untukmempersiapkan diri menghadapi balapan akhir pekan ini di Monza. Dia bertelad menebus kegagalan di Belgia dengan kemenangan di harapan publik Ferrari. “Mobilbisamemimpin kami untuk berarung memperebutkan gelar juara dunia. Meskipun dengan banyak kesulitan, kami tetap memiliki keuntungan. Monza merupakan trek spesial bagi kami dan harapannya pasti tinggi. Kami tidak boleh mengecewakan para tifosi sehingga harus memberikan 110 persen,” jelasnya. (int)

KAMIS 6 September 2012

Di-Bully Fans Lawan Wenger Sudah Kebal LONDON- Tak sekali dua kali Arsene Wenger mendapat teriakan olok-olok dari suporter lawan sepanjang 16 tahun melatih Arsenal. Apakah ia gentar dengan itu semua? The Professor menjawab tegas, tidak.

M „ Wenger

arkas Tottenham Hotspur, White Hart Lane, dan kandang Stoke City, Britannia Stadium, disebut Wenger sebagai tempattempat di mana ia pernah mendapat olok-olok. Presiden Arsenal, Peter Hill-Wood, bahkan

menyebut para suporter yang terus menyerang Wenger dengan sebutan ‘menjijikkan’. Tetapi Wenger tak peduli dengan hal tersebut. Meski tak menyukainya, pelatih 62 tahun tersebut merasa lebih baik fokus pada pertandingan daripada

meladeni ulah para suporter seperti itu. “Saya pribadi tak menyukai olok-olok suporter lawan, tetapi saya tak pernah takut. Ketika anda menjadi manajer. anda harus fokus pada pertandingan, bukan omongan suporter kepada anda,” tukasnya di Soccernet. Perjalanan waktu disebut Wenger telah mengajarkannya untuk tidak mempedulikan apa yang terjadi di tribun penonton dan fokus dengan apa yang ada di

atas lapangan. “Percayalah, jika saya menanggapi komentarkomentarsuporterlawandalam15 tahunlebihmasakepelatihansaya, sejak dulu saya sudah keluar dari sepakbola Inggris.” “Seiring berjalannya waktu, anda akan kebal dengan sendirinya dengan komentarkomentar tersebut. Setiap orang bisa saja berperilaku tidak sopan terhadap orang lain, tetapi anda tak boleh terpengaruh,” tuntasnya. (int)

Pulih Cedera, Aguero Bakal Kembali di Timnas Argentina BUENOS AIRES- Setelah absen sekitar dua pekan, Sergio Aguero akan segera comeback. Tapi laga pertamanya nanti bukan bersama Manchester City, melainkan dengan timnas Argentina di Kualifikasi Piala Dunia. Manchester City dan pelatih RobertoMancinimemprediksikan Aguero baru akan bisa kembali dimainkan pasca laga internasional sepanjang akhir pekan ini dan tengah pekan depan. Setelah mengalami cedera di pekan pembuka Premier League, Mancio tak mau anak didiknya buru-buru comeback yang justru bisa meng-

hadirkan risiko lebih besar. Tapi keinginan Mancini agar pemainnya itu beristirahat lebih lama hampir dipastikan tidak akan terwujud. Aguero yang sudah mulai pulih terlanjur bertekad tampil bersama timnas Argentina saat menghadapi Peru di Kualifikasi Piala Dunia 2014. “Saya di sini untuk laga kontra Peru,” seru Aguero seperti diberitakan Skysports. “Lutut saya masih sakit saat ini dan itu terasa mengganggu, tapi mungkin dalam dua atau tiga hari kondisinya akan berubah. Saya tidak akan bertemu dengan doktor

Spalletti: Milan Bukan Favorit di Grup C „ Spalletti

STPETERSBURG-PelatihZenit Saint Petersburg Luciano Spalletti, tak gentar meski timnya harus bertemu dengan AC Milan di fase grup Liga Champions. Spalletti juga tidak menganggap Rossoneri sebagai tim favorit. Hasil undian pada pekan lalu menempatkan Zenit dan Milan di Grup C. Mereka akan ditemani oleh Anderlecht dan Malaga. Spalletti menilai, grup ini seimbang dan tak ada tim yang benar-benar lebih diunggulkan untuk melaju ke babak berikutnya, termasuk Milan. “Apakah Milan favorit? Saya memprediksi grup yang seimbang, dimana itu akan membuat segalanya jadi lebih rumit,” ungkap Spalletti kepada Sky Sport Italia. “Saat saya bekerja di Rusia, kami telah menunjukkan kamampuan kami dan mampu memenangi beberapa trofi,” sambungnya. “DiLigaChampions,kamiharus bekerja lebih keras. Itulah kenapa

kami merekrut Hulk dan Alex Witsel karena mereka merupakan tambahan pemain yang penting untuk skuat yang telah ada,” kata ekspelatihUdinese dan AS Roma ini. (int)

timnas Argentina,” lanjut dia. Pelatih Argentina, Alejandro Sabella, sudah memasukkan nama Aguero dalam daftar pemain untuk laga tersebut. Namunjikakondisipemaindepan berusia 24 tahun itu tidak membaik, Sabella diyakini tidak akan memaksakan Aguero untuk tampil. “Selalu menyenangkan untuk berada di sini bersama teman-teman. Kami sudah saling kenal sejak usia di bawah 20 tahun dankarenaitulahkamimerupakan grup yang bagus, dan kami harus terus melanujutkannya,” lugas Aguero. (int)

„ Aguero

Balzaretti Absen Satu Bulan COVERCIANO- AS Roma tak akan bisa menggunakan tenaga Federico Balzaretti selama satu bulan ke depan. Akibat cedera paha, Balzaretti harus absen selama satu bulan. Balzaretti mulai mengalami masalahsaatRomabertandangke markas Inter Milan akhir pekan lalu dalam lanjutan Liga Italia. Di laga yang dimainkan di Giuseppe Meazzaitu,Balzarettiharusditarik keluar di menit ke-56 dan digantikan oleh Rodrigo Taddei. DilansirdariFootballItalia,hasil pemeriksaan menunjukkan bahwa Balzaretti mengalami cedera paha yang tingkat keparahannyaberkisarpada level pertama dan kedua. Karena itu, eks pemain Palermo itu harus menepi hingga satu bulan. Dengan cederanya Balzaretti, posisi bek kiri Roma

„ Federico Balzaretti

tinggal menyisakan nama Rodrigo Taddei. Dodo yang direkrut di jendela transfer musim panas ini masih belum bisa dimainkan karena masih dalam masa pemulihan cedera. Akibat cedera ini, Balzaretti juga harus meniggalkan pemusatan latihan timnas Italia. Dia tak bisa memperkuat Gli Azzurri di laga

kualifikasi Piala Dunia melawan Bulgaria (7/9) dan Malta (11/9/). (int)

Hari Ini, Sepakbola PON XVIII Riau Versus Sumbar KAMPAR- Meski resminya PON XVIII dimulai 9 September, tapi cabang olahraga sepakbola akan mulai dipertandingan hari Kamis(6/9)besokdiBangkinang, Kabupaten Kampar, Riau. Di Kampar akan dikonsentrasikanGrupCyangterdiridariRiau, Sumatera Barat (Sumbar), Jawa Tengah (Jateng), Kalimantan Selatan(Kalsel)/Kalimantan Timur (Kaltim). Tuan rumah Riau akan membuka perhelatan melawan Sumbar. “Khusus untuk Kaltim dan Kalsel masih menunggu keputusanPBPON,siapayangakan bertanding. Karena keduanya lagi ada masalah,” kata Ketua Harian Sub Pengurus Besar (PB) PON KE XVIII Kabupaten Kampar, Azwan, kepada wartawan dalam konferensi pers, di Kantor Sekretariat Sub PB PON Kabupaten Kampar, di Jalan Pramuka, di Bangkinang, Rabu (5/9). “Untuk partai berikutnya yang mempertemukan Kalimantan Timur/Kalimantan Selatan de-

ngan Jawa Tengah yang dijadwalkan akan berlangsung pada malam harinya, dengan kick-off pada pukul 19.00 WIB. Tapi untuk Kalsel dan Kaltim masih menunggukeputusanPBPONtadi,” ujarnya. Ada tiga grup di PON kali ini. Grup A ditempati Papua, Nusa Tenggara Barat, Sulawesi Tengah,danJami.Grupinibermain di Rengat, Kabupaten Indragiri Hulu. Grup C dihuni Jawa Timur, Jawa Barat, Sumatera Utara, dan Gorontola, dipusatkan di stadion Taluk Kuantan, Kabupaten Kuantan sengingi. (int)

MU Dikabarkan Tawar Neymar, Santos Membantah

„ Neymar SAO PAULO- Manchester United diisukan telah mengajukan penawaran besar untuk Neymarmenjelangbursatransfer ditutup. Sang klub, Santos membantahnya karena sejauh ini tak pernah ada kontak dari MU. Menurutlaporanyangberedar kubu “Setan Merah” menawarkan 38 juta poundsterling (sekitar Rp 576 miliar) di hari terakhir bursa transfer. Neymar sendirisudahlama dikaitkaitkan dengan

kepindahan ke Eropa dan klubklub top seperti Barcelona dan Real Madrid siap bertarung untuk memperebutkan tanda tangannya. Tapi pesepakbola 20 tahun itu berniat tetap di Brasil hingga gelaran Piala Dunia 2014. MU mengalihkan bidikannya ke Neymar usai gagal menggaet kompatriotnya Lucas Moura yang akhirnya hijrah ke Paris St. Germain dengan nilai transfer besar: 38 juta pounds. Bagaimanapun, isu tersebut ternyata hanyalah isapan jempol belaka.Santosmenegaskantidak pernah menerima kontak dari klub Inggris tersebut. “Saya tidak tahu kabar itu berasal dari mana, tapi itu tidak benar,” tegas Felipe Faro, direktur sepakbola Santos kepada Globo Esporte yang dilansir Sky Sports. Bantahan juga diungkapkan ayah sekaligus agen si pemain, Neymar Santos. “Neymar juga sudah terjual pada dua tahun lalu tapi kami masih disini,” cetusnya sembari menyindir soal kencangnya kabar kepindahan putranya ke Eropa beberapa waktu lalu. (int)

Javi: City Klub Terbaik Inggris & Aku Siap Berjuang MANCHESTERRekrutan anyar Manchester City, Javi Garcia, memuji klub barunya tersebut. Selain itu, ia mengaku siap untuk bertarung memperebutkan posisi. Javi didatangkan dari Benfica dengan nilai transfer mencapai 15 juta poundsterling. Pemain berusia 25 tahun itu pun mengaku senang bisa bermain dengan sederet pemain top lainnya. “Tak diragukan lagi, aku berada di klub terbesar di Inggris dan salah satu klub terbesar di Eropa saat ini,” ujarnya seperti dilansir Soccernet. “Jadi, aku sangat bangga dan aku sadar bakal bermain bersama tim yang dipenuhi pemain top.” Dengan banyaknya pemain-pemain kelas satu di skuat The Citizens, Javi sadar bahwa tidak mudah untuk masuk ke dalam starting XI. Javi biasa beroperasi sebagai

gelandang tengah, tetapi ia mengaku lebih nyaman bermain sebagai gelandang bertahan yang berdiri di depan duet bek tengah. Di City, posisi tersebut biasa dilakoni oleh Yaya Toure, Gareth Barry ataupun Nigel De Jong—yang kini sudah hengkang ke AC Milan. Namun, Toure punya peran lain. Ia kerap maju ke depan untuk membantu serangan. “Posisi naturalku adalah gelandang tengah, berada tepat di depan bek tengah. Terkadang, aku juga dimainkan sebagai bek tengah darurat ketika dibutuhkan di Benfica.” “Tapi, aku merasa nyaman bermain sebagai holding midfielder yang berdiri tepat di depan garis pertahanan. Aku harus berjuang keras untuk mendapatkan tempat di starting XI karena untuk mencapainya adalah sesuatu yang lebih berat dibandingkan di klub-klub lain.” (int)

Ada Fletcher di Skuad Liga Champions MU MANCHESTER-Duabulanlalu DarrenFletcherterancampensiun dini dari sepakbola akibat sakit yang dia alami. Seiring kondisinya yang terus pulih, dia dimasukkan Sir Alex Ferguson dalam skuad Manchester United di Liga Champions. Gara-gara penyakit pada ususnya, Fletcher absen memperkuat MU dari November 2011 lalu. Bukan itu saja, gelandang asal Skotlandia itu malah sempat dikhawatirkan akan menepi selamanya karena diprediksi tidak akan bisa

benar-benar pulih. Namun kondisi Fletcher kini sudahjauhmembaik.Setelahtampil dalam dua pertandingan eksebisi pada pertengahan Agustus lalu, namanya kini dimasukkan Fergie dalam skuat The Red Devils yang akan berlaga di Liga Champions.DemikiandikutipdariGuardian. “Darren bisa dengan mudah masuk dalam skuat 25 pemain dengan mudah, tanpa harus mengorbankan pemain lain yang tidak harus kami daftarkan karena mereka adalah pemain akademi

sepakbola kami. Itu sebuah keuntungan. Dia berlatih sangat baik dan bermain dengan sangat baik beberapa waktu lalu bersama tim U21,”sahutFergusonmengomentari kondisi pemainnya pekan lalu. Selain Fletcher, nama lain yang dimasukkan Fergie adalah para pemain baru ‘Setan Merah’ seperti Shinji Kagawa, Robin van Persie dan Nick Powell serta Alexander Buttner. Dua nama yang disebut terakhir sama sekali belum pernah dimainkan Fergie di awal msuim ini. (int)


KAMIS 6 September 2012

ENGLISH PREMIER LEAGUE No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

„ Ronaldo

Team Chelsea Swansea City West Brom Man City Man United Everton West Ham Arsenal Wigan Newcastle Fulham Stoke City Sunderland Tottenham Norwich City Reading Aston Villa Liverpool QPR Southampton

M 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 2 3 3 3 3

M 3 2 2 2 2 2 2 1 1 1 1 0 0 0 0 0 0 0 0 0

S 0 1 1 1 0 0 0 2 1 1 0 3 2 2 2 1 1 1 1 0

K 0 0 0 0 1 1 1 0 1 1 2 0 0 1 1 1 2 2 2 3

SG 8-2 10-2 6-1 8-5 6-5 4-3 4-3 2-0 4-4 3-4 7-6 3-3 2-2 3-4 2-7 3-5 2-5 2-7 2-9 4-8

Nilai 9 7 7 7 6 6 6 5 4 4 3 3 2 2 2 1 1 1 1 0

TOP SCORER Kamu memiliki cinta dari kami, dan kami juga akan membantu apapun yang kamu butuhkan. Kita akan berbicara lebih banyak lagi setelah laga uji coba internasional. Tapi satu yang harus kamu ingat, kami selalu ada untuk mendengarkan dan menolongmu.”

Gol 4 4 3

Nama Klub Michu Swansea City R. van Persie Manchester United C. Tévez Manchester City

Jose Mourinho

MADRID - Kesedihan yang dirasakan Cristiano Ronaldo membuat gusar beberapa penggawa Real Madrid. Tak terkecuali Jose Mourinho, yang menyebut kalau semua orang di El Real mencintainya.


onaldo mengejutkan banyak pecinta sepakbola dengan mengatakan sedang bersedih pasca duel melawan Granada di La Liga, akhir pekan kemarin. Salah satu rumor menyebutkan, eks winger Manchester United itu sudah tak betah lagi di Santiago Bernabeu. Real Madrid tentu tak ingin pemain termahalnya itu hengkang lantaran ada sesuatu yang membuatnya sedih. Takut hal yang tak diinginkan terjadi, Mourinho meyakinkan Ronaldo kalau orang-orang di Madrid masih mencintainya. Pria Portugal itu juga meminta pemain termahal dunia itu berbagi ‘misteri’ kesediahannya. “Kau adalah pemain spesial di sini (Real Madrid). Saya sama sekali tak ragu akan hal tersebut. Kita harus bicara, kau sangatdihargaidanbutuhdicintai,”ujarMoudalamsebuah percakapan yang dilansir Marca. “Kamu memiliki cinta dari kami, dan kami juga akan membantu apapun yang kamu butuhkan. Kita akan berbicara lebih banyak lagi setelah laga uji coba internasional. Tapi satu yang harus kamu ingat,kami selalu ada untuk mendengarkan dan menolongmu,” tuntas Mourinho. Banyak rumor berkembang terkait kesedihan yang dirasakan pesepakbola 27 tahun tersebut. Selain masalah uang dan kontrak baru, kabar lain menyebut ada ketidakcocokan dengan rekan setim. Meski mantan pemain terbaik dunia itu sudah menyangkal kalau kesedihannya berlatar belakang uang, masalah apa yang sebenarnya terjadi dengan CR7 masih tetap misteri. (int)

„ Vieri

No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Team M Barcelona 3 Mallorca 3 Málaga 3 Rayo Vallecano 3 Real Valladolid 3 Deportivo 3 Sevilla 3 Getafe 3 Atlético Madrid 2 Levante 3 Real Madrid 3 Real Betis 2 Real Sociedad 3 Real Zaragoza 3 Celta de Vigo 3 Athletic Club 3 Valencia 3 Granada 3 Espanyol 3 Osasuna 3

M 3 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0

S 0 1 1 1 0 2 2 1 1 1 1 0 0 0 0 0 2 1 0 0

K 0 0 0 0 1 0 0 1 0 1 1 1 2 2 2 2 1 2 3 3

SG 8-2 4-2 3-1 3-1 3-2 6-4 3-2 4-4 5-1 4-5 5-3 6-5 3-7 2-3 3-3 5-9 4-5 1-5 4-7 1-6

Nilai 9 7 7 7 6 5 5 4 4 4 4 3 3 3 3 3 2 1 0 0

TOP SCORER Gol 4 3 3

Nama L. Messi R. Falcao T. Hemed

Klub Barcelona Atlético Madrid Mallorca

Pippo Inspirasi Falcao

Ini Alasan Inter Mata-matai Vieri MILAN- Akibat memata-matai kehidupan pribadi Christian Vieri, Inter Milan diperintahkan pengadilan untuk membayar denda besar.ApaalasanLaBeneamatamemata-matai mantan bombernya itu? Seperti diberitakan sebelumnya, Vieri berang ketika tahu Inter Milan menyadap teleponnya. Ia pun mengajukan gugatan dan gugatan tersebut dimenangkan pengadilan. Bukan hanya Inter yang digugat oleh Vieri, tetapi juga perusahaan komunikasi Telecom Italia. Keduanya dituding Vieri telah melakukan penyadapan pada teleponnya lantaran Inter ingin memantau kehidupan pria yang kerap disapa Bobo itu. Seperti diberitakan kantor berita ANSA, Vieri akhirnya mendapatkan ganti rugi sebesar 1 juta euro (Rp 12 miliar). Meski angka yang dia minta sebagai ganti rugi lebih besar dari itu. Vieri mengajukan gugatan tersebut lantaran masalah tersebut telah mengganggu kehidupan pribadinya dan imbasnya berpengaruh pada permainannya di lapangan. Tapi, hal itu dibantah oleh Inter. “Kami jelas terkejut dengan tudingannya dan kami akan melakukan banding. Kami yakin bahwa kami tidak bersalah,” ujar pengacara Inter, Marco Fassone, di Football Italia. “Dalam pengadilan olahraga, kasus yang diperbincangkan ini sudah dikubur. Masa kasusnya sudah kadaluarsa.” “Jika penjelasan itu tidak cukup, tudingan yang diajukan juga tidak mungkin memengaruhi karier si pemain. Jadi, tak mungkin juga kasus itu merusak citranya. Kami tetap tenang dan akan mengajukan banding.” Lalu, mengapa juga Inter memilih untuk menyadap dan memata-matai Vieri? “Sebuah biro penyelidikan disewa untuk memantau apakah Vieri berlaku sesuai dengan peraturan internal Inter atau tidak,” lugas Fassone. (int)


juga punya idola. Ia menyebut Pippo telah menginspirasinya hingga dapat bermain seperti sekarang. Kepada rekan senegaranya di Kolombia, Mario Yepes, yang juga sempat merasakan menjadi rekan satu tim Inzaghi di AC Milan, Falcao bahkan meminta tolong agar Pippo bersedia menandatangani kostum Rossoneri untuknya. “Apakah kabar itu benar, bahwa saya menyuruh Mario Yepes agar Inzaghi menandatangani kostum Milan saya? Tentu saja itu benar,” tukas striker 26 tahun tersebut di Soccerway.

“Inzaghi adalah striker yang sangatsayakagumikarenainstingnya dalam mencetak gol. Dia menginspirasisayadengancaranya bermain.” Pasca memutuskan pensiun akhir musim lalu, Pippo kini tengah merintiskariersebagaipelatihditim junior di Milan. Selama lebih dari 10 tahun membela Il Diavolo, Pippo sukses meraih dua Scudetto, satu Coppa Italia, dua trofi Liga Champions, dua trofi Piala Super Eropa, dan satu trofi Piala Dunia Antarklub. (int)

Rooney: Sir Alex Punya Standar Tinggi

‘Jangan Tandemkan Cassano dengan Milito’

MANCHESTER- Wayne Rooney menyebut bahwa Sir Alex Ferguson punya standar tinggi. Saking tingginya standar itu, Rooney sampai mengaku takut untuk membuat kesalahan. Sir Alex memang dikenal begitu. Cerita bahwa dia suka menyemprot pemainnya —dikenal dengan hair dryer-treatment— ketika Manchester United bermain buruk, adalah cerita yang banyak diketahui orang. Sudah bukan rahasia. Menurut Rooney, tekanan itu akan lebih besar kepada para penyerang. Kalau tidak tampil bagus, ada kemungkinan si pemain bakal dicadangkan (atau tidak dimainkan sama sekali) pada pertandingan berikutnya. “Sebagai penyerang, saya harus bekerja keras setiap waktu. Saya harus tetap tajam, yang artinya kebugaran saya harus terjaga supaya saya bisa terus bermain bagus. Jika saya tidak bugar, maka itu akan terlihat jelas,” ujarnya seperti dilansir Sportinglife.”Mungkin akan berbeda jika seandainya saya adalah seorang full-back. Saya bisa sedikit bersembunyi, membuat beberapa lari pendek ke depan dan sudah dimaklumi.” “Sebagai penyerang Manchester United, tak ada pemakluman sama

MILAN - Legenda Inter Milan Sandro Mazzola, punya catatan untuk mantan klubnya itu. Ia menyebut, pertandingan melawan AS Roma adalah bukti bahwa Antonio Cassano dan Diego Milito tak bisa ditandemkan. Pada pertandingan yang dihelat di Stadion Giuseppe Meazza tersebut, Inter kalah 1-3. Satu gol La Beneamata disumbangkan oleh Cassano.MantanpemainACMilan itudimainkanberbarenganbersama Milito sejak awal. Namun ia kemudiandigantikanolehRodrigoPalacio di menit ke-50. “Itu adalah bukti bahwa Cassano tidak bisa ditandemkan dengan Milito. Tapi, mencadangkandiaakanmenjadihinaan kepadasepakbola,”ucapMazzoladi Football Italia. “Kita lihat saja nanti seperti apa jadinyadiakhirmusim.” Di sisi lain, Mazzola mengatakan bahwaRomadibawaharahanZdenekZemanmenunjukkanstartyang bagus pada pertandingan itu. Sedangkan Inter, menurutnya, masih butuh waktu lagi. “InterterdesakdengancaraRoma bermain. Giallorossi memulai dengan baik, seperti yang kerap dilakukan tim-tim arahan Zdenek Zeman.”(int)

„ Radamel Falcao

JAKARTA- Radamel Falcao kini bisa jadi dianggap sebagai salah satu striker terbaik di dunia. Siapakah pemain yang menjadi inspirasinya? Striker Atletico Madrid tersebut menjawab, Filippo Inzaghi. Naluri gol Falcao memang tengah menggila. Terakhir ia mencetak trigol ke gawang juara Liga Champions musim lalu, Chelsea, pada laga Piala Super Eropa. Los Colchoneros pun dibawanya menang 4-1. Layaknya pesepakbola lain, ia

„ Wayne Rooney sekali. Saya harus bekerja sekeras mungkin, jika tidak manajer akan menariksayadarilapanganatausaya ditinggalkan pada pertandingan berikutnya.” “Tak ada ruang untuk membuat kesalahan atau menjadi yang terbaik kedua di klub ini,” papar Rooney. Penyerang berusia 26 tahun itu pun memberikan contoh, yakni ketika dirinya pergi makan malam bersama beberapa rekan setim dan pasangan-pasangan mereka pada Boxing Day 2011. Ketika itu MU baru sajamenang5-0.Rooneymengirahal itu boleh-boleh saja. Tapi, ternyata tidak. Bagi Sir Alex, keluar malam-

malamenamharimenjelangpertandingan penting tidak bisa ditolerir. Keesokan harinya, manajer asal Skotlandia itu memanggil Rooney dan mengatakan bahwa dirinya tidak senang. “Saya didenda dan ada yang lebih buruk lagi; saya ditinggalkan untuk pertandingan melawan Blackburn pada malam tahun baru.” “Banyak klub tidak akan peduli pemain-pemainnya pergi malammalam enam hari sebelum pertandingan. Tapi, itulah bedanya di Manchester United dan itu adalah tandatingginyastandardantuntutan dari manajer,” tukasnya. (int)

ITALIAN SERIE A 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Juventus Napoli Lazio Sampdoria Roma Catania Torino Genoa Internazionale Milan Fiorentina Chievo Parma Cagliari Udinese Bologna Palermo Pescara Atalanta Siena

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

2 2 2 2 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0

0 0 0 0 1 1 1 0 0 0 0 0 0 1 0 0 0 0 1 1

TOP SCORER Gol 3 3 2

Nama S. Jovetiæ G. Pazzini G. Bergessio

Klub Fiorentina Milan Catania

0 0 0 0 0 0 0 1 1 1 1 1 1 1 2 2 2 2 1 1

6-1 5-1 4-0 3-1 5-3 5-4 3-0 4-3 4-3 3-2 3-3 2-2 2-2 1-3 2-6 1-5 0-6 0-6 1-2 1-2

6 6 6 5 4 4 3 3 3 3 3 3 3 1 0 0 0 0 -1 -5







KAMIS, 6 September 2012 Edisi 239 „ Tahun IV


BLH Sumut SegeraTurun

„ Massa di Desa Telo saat terlibat aksi lempar-lemparan batu dengan petugas yang siaga di sana.

Demo Penolakan Pemasangan Pipa Limbah Tambang Emas Ricuh

MASSA LEMPAR BATU Polisi Letuskan Tembakan Massa dan petugas keamanan yang siaga di areal tersebut saling dorong. Tak hanya itu, massa

BATANGTORU- Unjuk rasa ribuan warga berbagai desa di Kecamatan Muara Batangtoru, Kabupaten Tapanuli Selatan, yang menolak pemasangan pipa limbah perusahaan tambang emas milik PT G Resource Martabe, Rabu (5/9), berlangsung ricuh.

‹ ‹ Baca


„ Suasana ketegangan antara massa dengan petugas di pintu gerbang PT G-Resources Martabe.

BADAN Lingkungan Hidup (BLH) Sumatera Utara (Sumut) diminta turun tangan langsung ke Tapanuli Selatan (Tapsel), untuk memeriksa dan mengawasi limbah tambang emas yang akan dibuang PT G-Resource Martabe dapat mengganggu pencemaran lingkungan. Perintah itu dikeluarkan Sekretaris Daerah Provinsi Sumut (Sekdaprovsu), Nurdin Lubis, kepada wartawan di Kantor Gubernur, Sumut Jalan Pangeran Diponegoro, Medan (5/9). “Informasi itu (penolakan warga) sudah kami terima. Sudah kami tugaskan BLH provinsi untuk ke sana,” tegas Nurdin. Mantan Kepala Inspektorat Provinsi ‹ ‹ Baca

BLH Sumut ...Hal 6

Ayo Dukung Nomor 4 SIDIMPUAN- Hj Sarkiah Siregar, Ketua Perwiridan ibu-ibu Lingkungan I atau Kampung Mandailing, Kelurahan WEK V, Kecamatan Padangsidimpuan (Psp) Selatan, Kota Psp berharap agar masyarakat samasama mendukung pasangan Calon Walikota dan Wakil Walikota Psp Nomor Urut 4, Dedi Jaminsyah Putra Harahap SSTP MSP-H Affan Siregar SE di pemilukada 18 Oktober mendatang. ‹ ‹ Baca

Ayo ...Hal 6

Pasca Asrama Putri Pontren Musthafawiyah Purba Terbakar

Trauma, Santri Pilih Pulkam daripada Ujian MADINA- Sejumlah santri korban kebakaran asrama putri Pondok Pesantren (Pontren) Musthafawiyah Purba di Kecamatan Lembah Sorik Merapi, Kabupaten Mandailing Natal (Madina) trauma. Mereka me(Foto: Rodrigo Bonilla for Jawa Pos)

„ Ariyanti Kurnia, Anabel Hernandez, Leak Kustiya, dan Agung Kurniawan saat wawancara dengan penerima Golden Pen of Freedom.

Krisis Surat Kabar hanya Terjadi di Amerika Utara KIEV - Jawa Pos (grup METRO TABAGSEL) lagi-lagi mendapat perhatian khusus di ajang tingkat internasional. Pada hari kedua World Newspaper Congress Ke-64 yang dihelat WAN-IFRA di Ukrainian House, Kiev, Selasa (4/9), ruang redaksi Jawa Pos dipilih sebagai The Coolest Newsroom.Ruang redaksi tersebut, yang terletak di lantai 4 gedung Graha Pena Jawa Pos Surabaya, merupakan salah satu di antara lima newsroom yang dibahas khusus. Tepatnya dalam sesi World Editors Forum yang dipimpin Juan

asrama putri Hj Hannah Caniago, kepada wartawan, Rabu (5/9), mengatakan pasca kebakaran yang meng‹ ‹ Baca

Trauma...Hal 7

Prangko Bergambar Mobil Listrik Diluncurkan JAKARTA – Koleksi prangko PT Pos Indonesia bertambah satu lagi. Sebuah prangko bergambar “Mobil Listrik” resmi diluncurkan Rabu (5/9) oleh Direktur Utama PT Pos Indonesia I Ketut Mardjana dan Menteri Negara Badan Usaha Milik Negara (BUMN) Dahlan Iskan. Peluncuran prangko “Mobil

Senor, pakar koran kelas dunia dari Innovation Media Consulting Group Inggris. Sesi itu merupakan bagian dari rangkaian kongres yang terus memikirkan bagaimana koran bisa terus mengembangkan diri di masa mendatang. Juga, bagi Juan Senor, lulusan Oxford University, bentuk dan suasana ruang redaksi punya peran tak kalah penting. “Semua orang mengkhawatirkan masa depan surat kabar. Tapi, bagi ‹ ‹ Baca

milih pulkam alias pulang kampung dan tidak ikut ujian. Pimpinan Pontren Musthafawiyah KH Musthafa Bakhri Nasution melalui Sekretaris Potren Muklis Lubis SPdI didampingi pengasuh

‹ ‹ Baca

Prangko...Hal 6 FOTO: JPMC

„ Menteri Negara BUMN Dahlan Iskan menandatangani prangko mobil listrik.

Koran...Hal 7

‹ ‹ Baca

DALAM banyak hal, caracara tradisional tak pernah ditinggalkan. Salah satunya untuk urusan perawatan kecantikan. Hal itu juga dilakukan oleh artis Aura Kasih. Mulai dari pijat, lulur sampai totok muka menjadi ‘obat’ pilihan Aura agar tetap terlihat cantik. Alhasil, biaya yang dikeluarkan pelantun ‘Mari Bercinta’ itu pun lebih murah dibanding perawatan modern. “Alhamdulillah nggak yang harus ‹ ‹ Baca

Pilih...Hal 7

Prangko...Hal 6






6 September 2012

BPBD Butuh 4 Truk Damkar Baru MADINA-Badan Penanggulangan Bencana Daerah Kabupaten Mandailing Natal (BPBD Madina) sangat membutuh penambahan truk pemadam kebakaran (damkar) yang baru. Pasalnya, akhir-akhir ini sering terjadi bencana kebakaran dan lokasinya terkadang sulit dijangkau damkar yang berpusat di Panyabungan Kendala utama yang menyebabkan kinerja BPBD kurang maksimal, adalah minimnya sarana dan fasilitas yang ada seperti truck damkar. Instansi ini membutuhkan minimal 4 armada lagi. “Kita sangat membutuhkan penambahan fasilitas pemadam kebakaran berupa damkar baru. BPBD juga membtuhkan alat pemadam manual di beberapa titik untuk memudahkan jarak jangkau petugas,” sebut Kepala BPBD Madina, Rispan Zulyardi didampingi Kabid Pencegahan, Kesiapsiagaan dan Damkar, Pandapotan Matondang kepada METRO, Rabu (5/9) Disebutkan Rispan, untuk jarak efektif, truk damkar ini seharusnya berada di radius 7,5 kilometer untuk satu armada. Dilihat dari wilayah Madina, kata Rispan efektifnya dibutuhkan minimal 4 truk armada lagi. ”Minimal 4 armada lagi, yang akan kita tempatkan 1 unit di Kecamatan Natal, 1 unit di Kecamatan Linggabayu, 1 unit di Siabu dan 1 unit di Kecamatan Kotanopan karena jarak dari pusat Panyabungan ke empat lokasi itu paling dekat 30 kilometer bahkan jika ke Natal ada

ratusan kilometer, jarak tempuh yang sangat jauh” tambahnya Dikatakan Rispan, belajar dari pengalaman, selama ini ketika terjadi kebakaran pihaknya selalu disalahkan oleh masyarakat. Misalnya, Damkar tidak bermanfaat sebab setelah api padam baru tiba di lokasi. ”Banyak sekali tudingan dan kalimat pedas bagi petugas kami di lapangan. Bahkan truk damkar sudah hal yang biasa dilempari warga. Mereka karena kesal karena petugas tiba setelah api berhasil dipadamkan warga,” kata Rispan. Dia menegaskan, apa yang ditudiuhkan masyarakat ini sudah resiko yang harus mereka tanggung. Belum lagi, adanya telepon gelap ke pihak mereka yang memberikan info terlah terjadi kebakaran, ternyata setelah petugas ke lokasi yang dimaksud penelefon, ternyata tak ada yang kebarakan. ”Kita hanya memiliki truk damkar 6 unit dan yang bisa digunakan hanya 5 unit saja, karena 1 unit sudah rusak. Dan, ketika terjadi kebakaran, kami akan merasa kesulitan, apalagi wilayah Madina jarak tempuh yang jauh,” ungkapya lagi. (wan/mer)

Areal Persawahan di Labuhanbatu Berkurang RANTAU– Jumlah areal persawahan ada di Labuhanbatu berkurang. Sesuai data yang dimiliki Dinas Pertanian dan Tanaman Pangan Pemkab Labuhanbatu Kasubdis Program Dinas Pertanian dan Tanaman Pangan Pemkab Labuhanbatu Ishak Jaya Negara, Senin (3/9) mengatakan, total areal persawahan yang ada saat ini berkisar 24.318hektar.Itusesuaipendataan terakhir yang dilakukan pihaknya. ArealpersawahandiLabuhanbatuitu tersebardiKecamatanRantauUtara 160hektare,RantauSelatan440hektare,BilahBarat717hektare,BilahHulu 10hektare,BilahHilir2.853hektare, PanaiHulu4.153hektare,PanaiHilir 5.846hektare,Pangkatan160hektare sertaKecamatanPanaiTengahsekitar5.980hektare. Saat disinggung berapa persen angka peralihan tanaman padi kepada pohon kelapa sawit, Ishak mengaku belum menghitungnya. “Inilah masih mau didata ulang. Datainikansetelahdimekarkandan belum kita kroscek kembali. Kalau dahulusebelumdimekarkansebanyak 53 ribuan hektare,” kata Ishak. Sementara, sejumlah kelompok tani tanaman keras maupun padi yang ditemui di sekitaran areal persawahan di Kelurahan Aek Paing, Kecamatan Rantau Utara men-

gaku kini areal persawahan di Aek Paing hanya 63 hektare. Untuk itu, pihaknya berharap agar Pemkab Labuhanbatu segera melakukan revisi jumlah areal persawahan yang ada. Terpisah, para petani mengaku heran dengan data yang dimiliki DinasPertanian Labuhanbatu. “Kalau memang Rantau Utara sebanyak 160 hektar, kita mau turun kelapangan dengan pemerintah sama-sama mengukur, karena itu sangat digelembungkan. Hampir seratus hektar perbedaannya,” kata sejumlah petani yang minta namanya dirahasiakan. Begitu juga anggota kelompok tani yang ada di Kecamatan Bilah Barat. Para petani di sana merasa heranjika disanaarealpersawahan disebutkan mencapai 717 hektare. “Dimana areal sawahnya itu. Paling banyak pun sawah di sini sekitar 200 hektar, itu sudah ditambah-tambahi. Tidak benar data pemerintah itu,” ujar para petani. Menanggapihalitu,Basirseorang pengamatpetanimengatakanhingga kini nasib petani tidak ada yang patut dibanggakan. Sebabnya pemerintah tidak benar-benar mendukungpetani,baikdalampemberian bantuan hingga penyuluhan yang didukung dengan kebutuhan mutlak petani.(cr1)


PEMADAM-Salasatu peristiwa kebakaran yang terjadi di Indonesia. Terlihat petugas pemadam kebakaran dengan truk damkar dengan bersusah payah berusaha memadamkan api. Di Madina, sangat dibutuhkan 4 truk damkar yang baru.

KPU Buka Seleksi Pendaftaran PPK dan PPS PALAS-Komisi Pemilihan Umum (KPU) Padang Lawas (Palas) membuka seleksi pendaftaran, panitia pemilihan kecamatan (PPK), dan panitia pemilihan suara (PPS) untuk desa pada Pilgubsu TA 2013 mendatang. Pendaftaran PPK dibuka sejak tanggal 5-7 September mendatang. Untuk PPS dibuka pendaftaran mulai tanggal 15 -17 September mendatang. Demikian diutarakan Ketua Pokja Tim Seleksi (Timsel) PPK dan PPS Pilgubsu TA 2013 KPUD Palas, A Siregar di Kantor

KPUD Palas Rabu (5/9). Dijelaskannya, PPK dan PPS diangkat dan dipilih KPUD Palas. Yanga menjadi persyaratan anggota PPK dan PPS adalah, WNI, usia minimal 25 tahun, pendidikan minimal SLTA sederajat. Selanjutnya, surat keterangan sehat jasmani dan rohani,surat pernyataan tidak pernah dipidana penjara, berdasarkan pu-

tusan pengadilan yang telah memperoleh kekuatan hokum tetap, karena melakukan tindak pidana yang diancam dengan pidana penjara 5 tahun atau lebih, dan surat keterangan sehat jasmani dan rohani dari puskesmas atau rumah sakit. Dan seterusnya, surat lamaran bermaterai 6000 yang ditujukan kepada Ketua KPUD Palas, dengan melampirkan pas-

poto warna terbaru ukuran 3 kali 4 sebanyak 4 lembar. Dijelaskannya, untuk PPK setiap kecamatan dibutuhkan 5 orang, dan tempat pendaftaran bagi PPK dilakukan di kantor camat masing-masing, atau langsung ke Kantor KPUD Palas di Jalan listrik Sibuhuan. Sementara untuk tes wawancara bagi PPK dilakukan pada tanggal 17-18 September mendatang. Dan tanggal 20 September akan langsung diumumkan, nama-nama PPK yang lulus. Kemudian untuk PPS, dibu-

tuhkan 3 orang per desa, dan wawancara akan dilakukan tanggal 21-27 September mendatang, di kantor kepala desa dan kecamatan masing-masing dan akan dibagi per zona. Sementara pengumuman namanama yang lulus diumumkan akhir September. “Dan pada awal Oktober, baik PPK dan PPS akan dilantik oleh KPUD Palas nantinya. Demikianlah jadwal penerimaan anggota PPK dan PPS untuk Pilgusbu TA 2013 mendatang,” jelasnya. (amr/mer)

Anggota DPRD Labuhanbatu Malas Ngantor (F:METRO/AMRAN PIKAL SIREGAR)

SAMBUTAN-Ketua PC Himmah Palas Irham Habibi Harahap ketika memberikan kata sambutan.

Himmah Minta Maaf Kepada Masyarakat Palas PALAS-Himpunan Mahasiswa Al Washliyah (Himmah) Cabang Kabupaten Padang Lawas(Palas) menyampaikan permintaan maaf kepada seluruh masyarakat, baik dalam ucapan maupun perbutan selama tahun ini. Pasalnya Himmah Palas, sebagai organisasi mahasiswa sebagai kontrol sosial dalam bertindak, baik dalam kritik kontribusi pemikiran dan sumbangan secara moral, terkadang ada yang suka, ada yang sepaham dan yang tidak sepaham. Himmah yang merupakan bagian dari masyarakat Palas, dengan berbagai program kerja yang ada, mengajak masyarakat untuk dan

menopang program pemerintah sehingga apa yang kita cita-citakan dapat terwujud masyarakat yang sejahtera. Demikian diutarakan Ketua PC Himmah Palas Irham Habibi Harahap didampingi Ketua Panitia Zuldaud Nasution, dalam halal bilhalal Himmah Palas di Aula MTSN Sibuhuan, Selasa (4/9) lalu. Tema yang diangkat yakni ‘Bersatu Kita Sekata Perpadu Berjaya untuk Bersama-sama Berkreasi Membangun Palas yang Bercahaya’. Dalam sambutannya, Irham Habibi Harahap menyampaikan, seiring perjalanan Himmah Palas, yang terbentuk tahun 2010 lalu, dalam pengaplikasian pro-

gram- program Himmah, banyak yang kurang berkenan di hati masyarakat. “Saya secara pribadi maupun organisasi, saya selaku Ketua Himmah Palas mengucapkan Minal Aidin Walfaizin. Mohon Maaf lahir dan batin. Kami mengajak seluruh masyarakat mengucapkan rasa syukur karena kurang lebih sebulan lalu, kita merayakan hari jadi Kabupaten Palas,” ucap Irham. Hal senada juga disampaikan ketua PD Al Washliyah Kabupaten Palas, Ir Samson Fareddy Hasibuan. Katanya, selaku pembina dalam organisasi ini, dia ikut memohon maaf kepada seluruh lapisan masyarakat baik pe-

merintah daerah atas kesalahan-kesalahan yang dilaksanakan PC Himmah Palas, organisasi induk mahasiswa atau orangtua dari Himmah. Kegiatan tersebut, dihadiri berbagai kalangan, di antaranya anggota DPRD Palas yang juga sekretaris DPC PPP Palas, Erwin H Pane SH MH, Kepala Kemenag Palas Drs Dahman Hasibuan, dan sejumlah SKPD di Pemkab Palas. Hadir juga, Ketua DPD KNPI Palas Irmansyah Nasution, tokoh masyarakat, ulama, mahasiswa, pemuda, pers dan berbagai lapisan masyarakat, yang dihadiri 300-an undangan lebih. (amr/mer)

Puskesmas Batu Tunggal jadi Lokasi Praktek Umum Dinkes Diminta Tegur Kepala Puskesmas BATU TUNGGAL– Puskesmas pembantu di Desa Batu Tunggal Kecamatan NA IX-X menjadi lokasi praktek umum kepalapuskesmas.Halinimenjadi perbincangan yang hangat di tengah-tengah warga. Pemkab Labuhanbatu melalui instansi terkait yakni Dinas Kesehatan diminta melakukan teguran kepada dr Fachrul Ahyar selaku kepala puskesmas. Misno (36) warga Batu Tunggal, Rabu (5/9) menyebutkan, tindakan kepala puskesmas tak layak ditiru. Misno menilai lep-

alapuskesmastakberhakmenjadikan fasilitas umum untuk kantor praktek pribadi. “Sudah bertahun-tahun ruangan itu dijadikan tempat praktek sama kepala puskesmas, kalau rusak bangunan tersebut kan uang negara juga digunakan untuk memperbaikinya. Kalau kepala puskesmas mau buka ruangan praktek, jangan lah memakai fasilitas umum,” kata Misno. Senada disampaikan warga Batu Tunggal lainnya, Candra (24), Leo (28) dan Muliadi (30).

Menurut ketiga warga ini, puskesmas tersebut juga jarang dibuka, apa lagi pada hari jumat. “Saya sering lihat puskes itu setiap hari jumat jarang buka, bahkan pelayanan bagi masyarakat pun juga terkesan dibeda-bedakan dibanding jika berobat langgsung dengan dokter Fachrul Ahyar selaku kepala puskesmas. Sehingga masyarakat jarang berobat ke puskesmas dan memilih berobat ke ruang praktek dr Fachrul,” terang ketiganya. Sementara, Kabag Humas Lembaga Pengawasan Super-

masiHukumRepublikIndonesia (LPSHRI) Ali sahbana Siregarmengatakan,tindakanyang dilakukan oleh Kepala Puskesmas Batu Tunggal merupakan tindakan yang salah. “Inikan namannya pembodohan kepada masyarakat,” kata Ali. Saat hal ini coba dikonfirmasi kepada Kepala Puskesmas Batu Tunggal dr Fachrul Ahyar, menurut beberapa pegawai dr Fachrul sedang tidak berada di puskesmas. Para pegawai puskesmas mengaku tidak mengetahuikemanadrFachrul pergi. (cr2)

RANTAU- Masyarakat Labuhanbatu kecewa dengan kinerja anggota DPRD yang sesuka hatinya masuk ke kantor. Akibat ulah para anggota Dewan ini, warga jadi kelusitan untuk menyampaikan aspirasinya. Pasalnya saat warga datang ke kantor DPRD, banyak ruangan di kantor DPRD yang kosong. Kekesal itu disampaikan pengurus Forum Masyarakat Peduli Labuhanbatu (FMPL), Rabu (5/9) kepada wartawan. Menurut Yudha selaku pengurus FMPL, Senin (3/9) saat mereka datang ke kantor DPRD untuk menyampaikan aspirasi terkait tentang limbah pabrik di desa mereka, ternyata anggota DPRD tak ada yang masuk kantor. Saat itu mereka hanya menemukan ruangan kosong dan tak bisa bertemu dengan anggota Dewan. Akibatnya mereka tak bisa mengadu soal limbah pabrik yang dibuang sembarangan di desa mereka. Yudha mengatakan, dengan kejadian ini menunjukkan bahwa DPRD Labuhanbatu tak pedulidengannasibmasyarakat.Terbuktidengan tidak adanya anggota DPRD yang ditemukan di kantor pada jam kerja. “Kami datang mau membuat pengaduan mengenai masalah limbah yang dibuang sembarangandidesakami.Tetapisaatkamidatang ke kantor DPRD, tak ada satu pun anggota DPRD yang kami temui di kantor tersebut. Bagaimana mereka bisa menyelesaikan masalah masyarakat jika mereka sendiri sesuka hati ngantor. Tapi jika ada sidang membahas anggaran, semua anggota DPRD pasti hadir. Mereka lah salah satu lembaga yang membuat negara kita hancur,” ucap Yudha. Pantauan METRO, ruang kerja anggota DPRD memang sering terlihat kosong. Saat ditanya seorang pegawai yang meminta agar namanya jangan dikorankan, pegawai itu mengaku bahwa anggota DPRD belum ada yang datang. (cr2)


„ Ruangan anggota DPRD tampak kosong. Tidak ada satu pun anggota DPRD yang nampak pada jam kerja. Foto dijepret, Senin (3/9) sekitar pukul 10.00 WIB.



6 September 2012


NYAWA SUHARDI MELAYANG SIMALUNGUN– Niat Suhardi alias Adik untuk melerai Supriatin dengan terdakwa Christian Siregar alias Cipet (30) yang cek-cok di warung tuak milik Litawati di Kampung Bandar Syahkuda, Kelurahan Kerasaan I, Kecamatan Pematang Bandar berujung maut. Suhardi akhirnya tewas dibacok oleh terdakwa di bagian perutnya lantaran terdakwa tidak senang karena dilerai. HalituterungkapdipersidanganyangdigelardiPN Simalungun yang dipimpin majelis hakim Ramses Pasaribu beranggotakan Gabe Doris dan Adria Dwi Afanti,Rabu(5/9).JaksaPenuntutUmum(JPU)Julius Butar-butar dalam dakwaannya menyebutkan peristiwa itu berlangsung pada Jumat (23/3) sekira pukul 20.30 WIB. “Sekira pukul 15.30 saksi Supriatin datang ke rumah korban Suhardi dan mengajaknya untukminumtuak.KemudianSupriatindankorban sepakatminuktuakdiwarungtuakLitawati.Mereka berangkat dengan mengendarai sepedamotor dan setibanya di sana mereka langsung memesan satu galon tuak,” sebutnya. Dia menerangkan, sambil minum tuak keduanya pun bercerita sambil menikmati gorengan yang disediakan. Karena tuak yang sudah dipesan habis, Supriatin pun kembali memesan tuak satu galon. Setelah itu, mereka kembali minum hingga Supriatin melihat terdakwa datang dan langsung memesan tuak kepada pemilik warung. Selanjutnya terdakwa duduk di kursi lain dengan jarak empat meter dari korban dan Supriatin. “Setelah beberapa jam, tiba-tiba terdakwa Christian mendatangi mereka sambil membawa gelas yang berisi tuak dan berdiri tepat di samping korban. Saat itu terdakwa tampak berbincangbincang dengan korban, namun Supriatin tidak mendengar apa perbincangan mereka. Setelah beberapa menit kemudian terdakwa mengambil tuak dari teko dan menuangkannya ke gelas Supriatin dan korban,” ungkap jaksa. Sambungnya, setelah itu terdakwa mengajak Supriatin dan Suhardi untuk tos (laga gelas). Selanjutnya Supriatin mengangkat dan melagakan gelasnya ke gelas terdakwa dan terdakwa meminum tuaknya. Sementara Supriatin membuang tuaknya ke bawah meja sambil berkata ‘sudah puas kau’. “Mendengar itu terdakwa meletakkan gelasnya di meja dan berkata kepada Supriatin ‘apanya kau’ sambil menolak dada saksi Supriatin. Saat itu, Supriatin mendekati terdakwa dan korban langsung berdiri dan melerai saksi Supriatin dan terdakwa. Saat itu korban melerai dengan menghalangi badan terdakwa. Akan tetapi terdakwa saat itu tidak mau dihalang-halangi oleh korban dan dengan spontan korban pun menolak dada terdakwa,” terang Butar-butar. Katanya, Supriatin pun melihat antara terdakwa dan korban saling menolak dan akhirnya Supriatin mengajak korban untuk pulang. Kemudian Supriatin berjalan menuju tempat sepedamotornya diparkirkan di samping warung tuak dekat pohon coklat. Sementara korban tampak berjalan menuju arah coklat, sedangkan terdakwa berjalan cepat menuju sepedamotor dan mengambil pisau belati dari bagasi keretanya. “Saat Supriatin pun berniat menghampiri korban sambil mendorong keretanya. Akan tetapi lagi-lagi terdakwa dan korban saling dorong-dorongan. Tidak beberapa lama terdakwa pun langsung membacokkan perut korban hingga usus korban terburai. Usai melakukan aksinya terdakwa pun melarikan diri dan meninggalkan korban dalam keadaan bersimbah darah,” ungkapnya. Sementara itu, usai mendengarkan dakwaan jaksa, kuasa hukum terdakwa, Omri Gultom memutuskan tidak mengajukan eksepsi dan meminta agar hakim langsung melanjutkan ke dalam pokok perkara. (mua)


Divonis Penjara Seumur Hidup MEDAN- Majelis hakim akhirnya menjatuhkan vonis penjara seumur hidup kepada terdakwa Adi Aryanto (35), yang membunuh dan memerkosa kakak iparnya sendiri bertempat di kamar 17, Hotel Bukit Hijau Jalan Jamin Ginting Km 11 Medan pada 27 Desember 2011 lalu.

„ Musa tewas tergantung di pohon rambutan, Rabu (5/9).

Foto Reza

Musa Tewas Tergantung di Pohon Rambutan MEDAN- Musa Daulay ditemukan penjual es cream dengan kondisi tergantung, leher terjerat akar-akaran di pohon rambutan. Saat ditemukan, pria berusia 26 tahun itu ditemukan telah tewas di pohon setinggi sekitar 5 meter di Jalan Sei Deli, Kelurahan Sei Agul, Kecamatan Medan Barat. Motif tewasnya warganya Jalan Sekata Gang Mawar ini diduga karena stress ibunya meninggal dunia 2 tahun silam. Sehingga membuat pria lajang ini kerap meminta-minta makanan kepada warga sekitar, bahkan tak segan-segan mencuri, Rabu (5/9) sekitar pukul 11.30 WIB. Penemuan mayat Musa sontak membuat warga sekitar berhamburan ke lokasi kejadian. Menurut keterangan warga sekitar, seluruhnya mengenal pria yang tergantung tersebut. Dia adalah Musa Daulay, yang mengalami gangguan jiwa sejak ibunya meninggal dunia. “Si Musa itu, si Musa gantung diri,” celoteh para ibu-ibu saat di lokasi kejadian. Menurut salahseorang wanita berumur 40-an tahun ini, Musa mengalami gangguan kejiwaan semenjak ibunya meninggal dunia. “Memang ada stres, stresnya anak itu,” ujarnya. Dikatakannya, sifat Musa kerap meminta-minta makanan kepada warga sekitar. “Sering minta-minta makanan disini, minta uang pun sering dia,” sambungnya. Puncak, stresnya Musa ditambah dirinya dipecat dari pekerjaan sebagai angkat-angkat barang di Jalan Putri Hijau. “Habis itu, dipecat pula lagi dia dari kerjaannya. Makin menjadi lah,” jelas wanita yang memakai jilbab ini pada Posmetro Medan.

Hal senada juga dikatakan, Mahmud. Musa dikenalnya suka masuk ke rumah orang mengambil makanan, bahkan sampai mengambil uang. “Memang dia suka masuk ke rumah orang, kalau dia lapar. Dia masuk aja ke rumah orang minta makan,” katanya membuka pembicaraan pada Posmetro Medan. Menurut pria berumur sekitar 50 an tahun ini, Musa juga kerap mengambil uang warga. “Mencuri suka juga,” sambungnya. Dikatakannya pria yang berjualan bunga di bundaran Jalan Adam Malik, ini jenazah korban ditemukan kali pertama penjual es cream. “Penjual es cream yang nemukan dia pertama kali, habis itu ntah kemana dia,” katanya. Warga sekitar pun yang penasaran lalu melihatnya, ternyata mayat yang tergantung itu adalah Musa Daulay. “Pernah juga kerja dengan saya, masukin tanah ke pot bunga. Cuma kalau dia lapar, dia masuk aja kerumah orang,” ucap pria yang sudah beruban ini. Namun, kondisi Musa tergantung di pohon rambutan lidahnya tidak menjulur. Dengan menggunakan baju kaos hitam, celana Lea warna biru kotoran Musa berceceran di kakinya bahkan tubuh korban sudah banyak dikerumuni semut. Selang beberapa menit, tim olah tempat kejadian perkara (tkp) pun tiba dilokasi. Usai melakukan olah tempat kejadian perkara, jenazah korban dibawa dengan menggunakan mobil patroli Polsekta Medan Barat. Hingga jenazah dibawa, abang kandung korban bernama Ahmad tak kunjung datang kelokasi kejadian. Menurut cerita warga, rumah

orangtuanya telah disewakan Ahmad kepada orang lain, hingga Musa tak tahu tinggal dimana. “Rumahnya disewakan abangnya, tinggalnya nggak tentu-tentu gitu,” celoteh warga. Saat ditemui, tim olah tempat kejadian perkara mengatakan kalau korban murni bunuh diri. “Tidak semua yang tergantung lidahnya keluar. Bisa juga ditahan oleh gigi, tapi tadi sperma keluar,” ucapnya seraya berjalan keluar dari tkp. Menurutnya, korban murni tewas bunuh diri. “Murni ini bunuh diri, karena ditubuhnya tidak ada tanda-tanda kekerasan,” sambungnya lagi. Kapolsekta Medan Barat Kompol Nasrun Pasaribu Sik saat dikonfirmasi di lokasi kejadian, mengatakan kalau motif dari gantung diri korban karena mengalami stres ibunya telah meninggal 2 tahun lalu. “Motifnya kita duga stres, karena ibunya meninggal dunia 2 tahun lalu,” katanya membuka pembicaraan. Menurutnya, korban tewas tergantung di pohon rambutan sekitar 8 jam lamanya. “Diperkirakan kejadian ini 8 jam lalu,” sambungnya. Menurutnya, Musa murni bunuh diri di pohon setinggi 5 meter tersebut. “Murni bunuh diri, karena tidak ditemukan tanda-tanda penganiayaan dari tubuh korban,” ucapnya. Dikatakannya, korban diketahui kerap meminta-minta makanan kepada warga sekitar. “Korban ini mengalami stres, jadi sering meminta-minta makanan kepada warga sekitar sini. Dan dia kerap bermainmain dilokasi sini,” tandas perwira satu melati emas dipundaknya ini. Guna proses penyelidikan, jenazah korban pun dibawa ke RS. Pirngadi Medan. (eza/pmg)

Hakim berpendapat, perbuatan terdakwa termasuk sadis yang membunuh kakak iparnya hanya untuk melampiaskan dendamnya dengan alasan, kakar iparnya menjadi orang yang mengakibatkan dirinya bercerai dengan sang istri. “Mengadili terdakwa atas nama Adi Aryanto dengan hukuman penjara seumur hidup. Hal yang memberatkan prilaku terdakwa tidak berprikemanusiaan, dan tergolong sadis. Selain itu, terdakwa juga diketahui sudah kerap keluar masuk penjara,” ucap majelis hakim yang diketuai Nelson Marbun, kemarin (5/9). Dijelaskannya, terdakwa dikenakan pasal 340 KUHPidana, tentang pembunuhan berencana. Selain hal yang memberatkan karena perbuatannya tergolong sadis, majelis hakim pun memberi pertimbangan hal-hal yang meringankan terdakwa karena telah mengakui dan merasa bersalah atas perbuatannya serta selama proses persidangan berprilaku sopan. Menanggapi vonis hakim, terdakwa pun mengajukan banding. Langkah sama dilakukan JPU Nilma, yang mengaku mengambil langkah banding. Pantauan POSMETRO (grup Koran ini), sikap Adi Aryanto berbeda jauh pada saat sidang tuntutan sebelumnya. Hari itu ia tampak tenang, hal berbeda ia tunjukkan pada sidang tuntutan beberapa waktu lalu, di mana ia mengamuk dan menantang semua pengawas sel tahanan sementara Pengadilan Negeri (PN) Medan, ditengarai sebuah sendok makan. Duduk manis di bangku pesakitan ruang utama PN Medan, Adi yang mengenakan baju putih dibalut baju tahanan bernomor punggung 06 berwarna orange, Adi pun terlihat dengan seksama mendengarkan dakwaan dan tuntutan yang dirangkum dan dibacakan majelis sebelum memvonisnya. Pada persidangan yang dimulai sekitar pukul 16.00 WIB hari itu, suasana persidangan pun tampak berbeda. Hal itu terlihat adanya lima orang anggota kepolisian yang berada di ruang persidangan, sementara satu orang pengawal tahanan tampak ber-

diri sigap di sebelah meja Jaksa Penuntut Umum (JPU) Nilma. Diketahui pula, tuntutan JPU Nilma terhadap Adi, yang tinggal di Desa Karang Sari Gang UBS Kecamatan Medan Polonia ini, disahkan oleh majelis hakim yang mengenakan terdakwa pasal 340 KUHPidana, tentang pembunuhan berencana. Kasus Adi sendiri diketahui bermula pada Selasa 27 Desember 2011 silam sekitar pukul 15.30 WIB, bertempat di kamar 17 Hotel Bukit Hijau Jalan Jamin Ginting Km 11 Medan dengan sengaja membunuh Elida Hasibuan yang notabene kakak kandung mantan istrinya. Saat itu terdakwa mengundang Elida ke hotel beralasan untuk memberikan sesuatu benda atau kenang-kenangan kepada korban. Namun nahas, niatnya ternyata berubah dan berusaha memperkosa korbannya di mana sebelumnya mengatakan “kakak sudah janda sementara aku sudah duda, ya udah kita melakukan persetubuhan saja,” ujarnya sesuai BAP. Sebelum membunuh korbannya, Adi juga terbukti meminta atau memaksa korban untuk melakukan persetubuhan dengan membuka paksa celana korban. Akan tetapi korban Elida saat itu melakukan perlawanan dan berteriak minta tolong sehingga terdakwa menutup mulut korban dengan menggunakan celana panjang milik korban. Selain itu karena kalap, terdakwa menggunakan kain sprai mengikat tangan korban dan menjambak korban dan langsung menggorok leher Elida secara berulang-ulang sampai kurang lebih lima kali tebas. Setelah itu, terdakwa berusaha membakar korban dengan menyiramkan minyak bensin yang berasal dari sepeda motornya. Mau Pukul Wartawan Ketika terdakwa keluar dari ruang sidang utama, dia sempat mengancam wartawan yang ingin mengabadikan fotonya. “Dia sempat mau mukul wartawan yang ngambil fotonya, dia sempat melirik tajam ke arah wartawan dan mengepal tangannya ke arah salahsatu wartawan,” jelas salahsatu pengawal tahanan. (gib/pmg) YAYA S A N SEP A PA HUSADA : Menerima tenaga

kerja khusus wanita, baik gadis/ janda, dengan usia 17 s/d 45 tahun, untuk dilatih & dipekerjakan sebagai perawat jompo/orang tua sakit, baby sitter. Syarat: Ijasah asli, KTP/Kartu Keluarga, gaji berkisar Rp. 1.000.000 s/d 1.700.000/bulan. Lamaran diantar langsung ke Jl. Pasar 3 no. 45 A Krakatau Medan. Hubungi: 0 8 1 1 602 145 ; 0852 6114 3441 PELUANG USAHA AIR MINUM

Pemasangan Depot Air Minum Air Pegunungan (Mineral) Sistem RO Oxsygen dan Grosir Peralatan Depot Air Minum GRACE WATER: Jl. Cengkeh Raya P. Simalingkar. HP. 0813 7010 7352. *) Melayani pemasangan dalam dan luar kota

RIZKI PONSEL Jalan Merdeka, Kota Padangsidimpuan. Menerima HP bekas dengan harga tinggi. Blackberry, Nokia, Samsung, Sony Erikson, dll. Dengan syarat lengkap dan baik. Hubungi IRWANTO: Hp 0813

6215 1119





6 September 2012


Presiden Mesir Mohamed Morsi

Presiden Mesir

Serukan Assad Mundur KAIRO- Presiden baru Mesir Mohamed Morsi kembali menyerukan rezim Presiden Suriah Bashar al-Assad untuk mengundurkan diri. Ditegaskan Morsi, resolusi untuk krisis Suriah merupakan tanggung jawab Arab. ”Saya katakan pada rezim Suriah bahwa masih ada peluang untuk menghentikan pertumpahan darah,” kata Morsi dalam pertemuan para menteri luar negeri (menlu) Liga Arab di Kairo, Mesir. ”Jangan mengambil langkah yang benar di waktu yang salah... karena itu akan menjadi langkah yang keliru,” tutur Morsi seperti dilansir kantor berita AFP, Rabu (5/9). ”Sekaranglah waktunya untuk perubahan,” tegas Morsi seraya mengingatkan rezim Assad untuk “memetik pelajaran dari sejarah baru-baru ini.” Dalam pertemuan tersebut, Morsi mendesak para diplomat Arab untuk bergerak cepat guna menyelesaikan konflik Suriah. “Darah rakyat Suriah sedang ditumpahkan siang dan malam, kita bertanggung jawab atas ini,” cetus Morsi. “Kita tak bisa tidur sementara darah rakyat Suriah ditumpahkan,” imbuhnya. ”Saya mendesak Anda para menlu Arab, untuk bekerja keras menemukan solusi cepat atas tragedi di Suriah,” tutur Morsi. “Jika kita tidak bergerak, dunia tak akan bergerak dengan serius,” tandasnya. (dtc/int)

Beresiko Tinggi Meninggal Dunia JAKARTA- Tingkat kematian jemaah haji Indonesia pada 2011 mencapai 2,34 persen. Dari 223.395 jemaah pada tahun lalu, sebanyak 522 di antaranya meninggal dunia. Tingginya kematian jemaah disebabkan mayoritas jemaah telah memiliki risiko kematian tinggi sebelumnya, seperti mengidap penyakit kronis berat dan berusia lanjut. ”Jemaah haji Indonesia memang tergolong memiliki risiko kesakitan yang cukup tinggi,” ujar Dirjen Pengendalian Penyakit dan Penyehatan Lingkungan (Dirjen P2PL) Kemenkes Tjandra Yoga Aditama di Jakarta, Rabu (5/9). Lebih dari separuh dari total jemaah, menurut Tjandra, telah memiliki risiko tinggi terhadap kematian sebelum berangkat. Menurut inventaris Kemenkes, sekitar 50.58% atau

111.697 dari 223.395 jemaah yang bemenjalani ibadah, menurut dia, ada rangkat pada tahun lalu masuk dalam beberapa hal yang perlu dipersiapkelompok risiko tinggi. kan. Pertama, jemaah Tercatat jenis penyawajib memeriksakan kit yang paling banyak kesehatan ke dokter. diidap oleh jemaah haji Kedua, jika memang yang meninggal pada memiliki penyakit krotahun lalu adalah pennis, sebaiknya memastiyakit jantung dan pemkan persediaan logistik buluh darah. Selanjutobat terpenuhi. Selannya adalah penyakit jutnya jika memang megangguan pernapasan, miliki resiko kesehatan otak, masalah pada tinggi, yang bersangkusistem sirkulasi, entan bisa meminta surat dokrin metabolik, infekpengantar dari dokter. si, ginjal, masalah ”Surat tersebut bisa pencernaan, tumor, menjadi masukan bagi dan penyakit darah. dokter kloter yang bertuMengingat kelomgas dalam persiapan tinpok terbang (kloter) dakan yang perlu diamTjandra Yoga Aditama bil nantinya,” imbuh pertama jemaah haji 2012 akan berangkat Tjandra. pada akhir September, Tjandra menSelanjutnya jika berangkat bersama yarankan jemaah haji melakukan berorang lanjut usia, sambungnya, perbagai persiapan agar kesehatan dan siapan lebih rinci seperti pengeibadah mereka tidak terkendala. tahuan tentang menyewa kursi roda. Agar tubuh sehat dan bugar saat (mdc/int)

Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini mendatangi kantor KPK untuk menjalani pemeriksaan.

Kapal Tanker Singapura

Dibajak Perompak ABUJA- Sebuah kapal tanker minyak milik Singapura dibajak oleh perompak di Pelabuhan Lagos, Nigeria. Pembajakan ini merupakan yang ketiga kalinya terjadi dalam 2 minggu terakhir di wilayah Teluk Guinea, Afrika. Menurut Biro Maritim Internasional (IMB), kapal yang membawa 23 awak tersebut dibajak perompak pada Selasa (4/9) sore waktu setempat. Kapal bermuatan bahan bakar tersebut digiring oleh para perompak ke wilayah laut lepas. Namun pusat informasi pembajakan yang bermarkas di Kuala Lumpur, Malaysia tersebut tidak menjelaskan secara detail bagaimana kapal tersebut bisa dibajak. ”Kami telah memberitahu otoritas Nigeria yang telah mengambil tindakan,” ujar Kepala IMB, Noel Choong, kepada AFP, Rabu (5/ 9). Menurut Noel, para awak kapal mengunci diri mereka dalam ruangan aman. “Kami mengkhawatirkan keselamatan mereka dan aksi-aksi kekerasan yang bisa saja terjadi,” imbuhnya. Para bajak laut membajak dan menjarah dua tanker minyak di dekat Togo pada bulan Agustus lalu. Kedua kapal dan seluruh awak kapal kemudian dibebaskan. Noel menuturkan, kemungkinan besar ada sindikat pelaku kriminal yang berada di balik pembajakan ini. Hal ini bisa dilihat dari modus operasi pembajakan yang nyaris sama. ”Mereka akan menguasai kapal tersebut selama 5 hari — kemudian merangsek masuk ke dalam kabin awak kapal dan menyedot minyak ke kapal perompak lainnya,” terang Noel. Noel menyatakan, pihaknya telah berulang kali memperingatkan kapal-kapal yang berlayar di dekat Teluk Guinea, dekat pantai barat Afrika, untuk lebih berhati-hati dan waspada. IMB juga meminta otoritas setempat untuk meningkatkan patroli keamanan di wilayah perairan yang tahun lalu disebut sebagai ‘hot spot’ pembajakan. Diketahui bahwa di wilayah tersebut sudah terjadi 37 kali serangan pembajakan, termasuk penculikan dan pembunuhan sepanjang tahun 2012 ini. Para perompak tersebut biasanya mengincar kapal-kapal kargo yang berlayar di kawasan tersebut. Mereka akan memindahkan barang-barang muatan kapal tersebut dan kemudian menjualnya di pasar gelap. (dtc/int)

Israel Akan Serang Iran Sebelum Pemilihan Presiden AS WASHINGTON- Israel terus melancarkan retorika perangnya terhadap Iran terkait program nuklirnya. Namun anggota senior Kongres AS, Mike Rogers yakin bahwa Israel akan menunggu untuk menyerang Iran sampai pemilihan presiden AS pada November mendatang. Hal tersebut disampaikan Rogers dalam Konvensi Nasional Partai Republik di Tampa, Florida seperti dilansir surat kabar Israel, Haaretz, Rabu (5/9). Dikatakan Ketua Komite Intelijen DPR AS tersebut, para pemimpin Israel seperti Perdana Menteri Benjamin Netanyahu menganggap dukungan Amerika merupakan syarat penting bagi aksi militer mereka. ”Saya pikir mereka percaya bahwa mungkin setelah pemilihan mereka bisa berbicara dengan AS untuk bekerjasama,” tutur Rogers yang merupakan politikus Partai Republik tersebut. Beberapa waktu lalu, Menteri Pertahanan Israel Ehud Barak mengatakan, akhir musim panas akan menjadi kesempatan terakhir untuk melakukan aksi militer terhadap fasilitasfasilitas nuklir Iran. Namun pejabat-pejabat pemerintah AS telah berulang kali mengingatkan Israel bahwa Washington tidak akan mendukung serangan Israel terhadap Iran. (dtc/int)

Purnomo memberikan keterangan pers terkait rencana kerja sama dengan Australia.


Perkuat Kerja Sama Pertahanan JAKARTA- Pertemuan bilateral antara Menteri Pertahanan RI Purnomo Yusgiantoro dan Menteri Pertahanan Australia Stephen Smith menghasilkan kesepakatan strategis dalam rangka memperkuat kerja sama kedua negara dalam bidang pertahanan, terutama sektor industri. ”Setidaknya kami sepakat dalam satu semangat yang sama yaitu memperkuat kerja sama pertahanan di antara kedua negara. Khusus untuk sektor industri pertahanan, tentu saja akan bergerak dalam wilayah untuk memperkuat pertahanan negara masing-masing,” ujar Purnomo saat memberi keterangan pers di Kantor Kementerian Pertahanan di Jakarta, Rabu (5/9). Pertemuan yang merupakan lanjutan dari kunjungan Menhan Purnomo ke Darwin pada Mei 2012 lalu ini dilandasi semangat saling menghormati

bagi kemajuan industri pertahanan kedua negara. “Soal detail seperti apa, tentu saja akan dibahas kemudian sambil berjalannya waktu,” jelasnya. Selain kerja sama memperkuat industri pertahanan, Purnomo menjelaskan lingkup kegiatan kerja sama pertahanan antara RI dan Australia juga meliputi kebijakan pertahanan, hubungan antarinstansi, kontraterorisme, keamanan maritim, bantuan kemanusiaan dan pemulihan bencana, dukungan logistik militer dan pelayanan medis, pemeliharaan perdamaian, intelijen, industri pertahanan, material, ilmu pengetahuan dan teknologi. ”Juga pendidikan dan pelatihan di bidang pertahanan atau militer, tata kelola dan manajemen pertahanan, dan bidang lainnya yang menjadi kepentingan bersama kedua negara,” lanjut Purnomo. (dtc/int)



2 Perwira Polisi Diperiksa KPK Kasus Simulator SIM JAKARTA- Para perwira Polri harus wira wiri memenuhi panggilan penyidik KPK sebagai saksi kasus simulator SIM. Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini kali ini dimintai keterangan lagi. ”Keduanya dipanggil sebagai saksi dalam perkara pengadaan driving simulator di Korlantas Mabes Polri,” ujar Kabag Pemberitaan KPK, Priharsa Nugraha, ketika dikonfirmasi, Rabu (5/9). Setidaknya sampai pukul 09.30 WIB, dua perwira tersebut belum sampai di kantor KPK. Ini merupakan panggilan kedua bagi Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini.

KPK sebelumnya memeriksa AKBP Indra Darmawan Irianto dan AKBP Susilo Wardono. Sedangkan pada pekan lalu, KPK juga telah memeriksa empat perwira sebagai saksi untuk Irjen Djoko yakni AKBP Wandi Rustiwan, Kompol Ni Nyoman Sumartini, Kompol Endah Purwaningsih, dan AKBP Wisnu Buddhaya. Sebelumnya mereka sempat tak hadir dalam panggilan pertama karena ada masalah administrasi. Dalam kasus Simulator SIM ini, KPK menetapkan mantan Kakorlantas Irjen Djoko Susilo sebagai tersangka. KPK juga menetapkan bawahan Djoko, Brigjen Pol Didik Purnomo, Direktur Utama PT Inovasi Teknologi Indonesia, Sukotjo S. Bambang dan Direk-

tur PT Citra Mandiri Metalindo Abadi, Budi Santoso sebagai tersangka. Polri juga menetapkan status sama terhadap tiga nama terakhir tersebut. Tiga nama yang menjadi ‘tersangka bersama’ itu memicu persoalan. Sampai saat ini KPK dan Polri samasama ngotot untuk menangani kasus ini. Sampai saat ini belum ada titik temu antara dua lembaga penegah hukum tersebut. Polri telah melakukan gerak cepat dengan melakukan penahanan terhadap para tersangkanya, yang juga tiga di antaranya merupakan tersangka di KPK. Irjen Djoko juga telah dua kali diperiksa sebagai saksi. Sedangkan KPK masih hanya fokus memeriksa saksi dan berkas untuk Irjen Djoko. (dtc/int)

JAKARTA- Mantan Menteri Kelautan dan Perikanan Fadel Muhammad menegaskan Kementerian Kelautan dan Perikanan bertanggung jawab terhadap semua pulau-pulau di Tanah Air. Saat ada informasi penjualan 2 pulau di Indonesia, Fadel mengungkapkan kritik kepada Menteri Kelautan dan Perikanan saat ini, Sharif Cicip Sutardjo. ”Kementerian Kepulauan dan Perikanan menangani semua pulau-pulau di Indonesia. Pulau terluar waktu itu kita inventarisir ada 60 buah pulau dan kita tidak mau menyewakan apalagi menjual. Kita anggap lokasi strategis untuk menjaga keamanan negara di perbatasan,” kata Fadel, Rabu (5/9). Fadel mengingatkan agar Kementerian KP lebih jeli mengamankan pulau-pulau Indonesia. Jangan sampai pulau dijual tapi juga harus peka terhadap investasi. ”Nggak boleh kita menjual pulau kepada siapapun juga. Kita bikin kerja sama untuk investasi, kita undang investornya masuk dengan beberapa pertimbangan. Yang pertama kita bisa membangun holiday resort, kita bisa bikin apakah 15 tahun ataukah 20 tahun perjanjian,” saran Fadel. Fadel lantas mengkritisi kinerja Kementerian KP setelah ditinggalkannya. Di bawah menteri yang baru tak lain adalah Wakil Ketua Umum Golkar Sharif C Sutardjo, dia mendengar ada hal yang menjadi tidak teratur. ”Saya dengar sekarang sudah nggak teratur. Ya saya banyak prihatinnya. Misalnya program kita menaikkan produksi ikan rakyat sudah ditiadakan,

sekarang orientasinya industri. Dulu saya canangkan program itu agar kita nggak perlu impor ikan. Itu prinsip membangun ekonomi kerakyatan,” ingat Fadel yang juga menjabat Wakil Ketua Umum Golkar ini. Situs www. memasang iklan penjualan pulau Gambar di Laut Jawa dan pulau Gili Nanggu di Lombok, Nusa Tenggara Barat. Kementerian Kelautan dan Perikanan pun melakukan pengecekan kepemilikan pulau tersebut. Pulau Gambar menjadi salah satu pulau yang dijual dalam situs penjualan pulau pribadi dunia tersebut. Harga yang ditawarkan tergolong murah yakni USD 725 ribu atau setara dengan Rp 6,8 miliar (kurs Rp 9.500). Dalam informasi penjualannya, pulau itu disebutkan berada di kawasan Laut Jawa dengan luas 2,2 hektar. Pulau Gambar dideskripsikan sebagai pulau unik yang masih ‘perawan’. Dengan pantai indah yang mengelilinginya, pulau ini layak dijadikan sebuah hunian pribadi. Air laut di sekitar pulau relatif tenang dan dangkal. Para pengunjung bisa menyelam, snorkelling dan memancing. Sejumlah ikan dan lobster bisa ditemukan di tepi pantai. Sementara pulau Gili Nanggu di Lombok yang memiliki luas 4,99 hektar itu ditawarkan dengan harga Rp 9,9 miliar. Lokasinya yang berada di laut Bali jadi daya jual tersendiri. Menurut situs tersebut, pemilik pulau menawarkan Gili Nanggu dengan sejumlah fasilitas. Di antaranya 10 unit cottage, 7 unit bungalow, 1 unit restoran, mini bar, kamar, dan area pengembangbiakan kura-kura. (dtc/int)

Sidang Angelina Dipimpin Hakim Sudjatmiko JAKARTA- Angelina Sondakh bakal duduk di kursi pesakitan pada Kamis (6/9). Sidang perdana politisi Partai Demokrat itu dipimpin ketua majelis hakim Sudjatmiko. Sidang Angie dijadwalkan digelar sekitar 09.00 WIB. ”Anggota majelis hakimnya ada Marsudin Nainggolan, Avi Antara, Hendra Yospin dan Aleks Marwata dan panitera T Umar,” ujar Sudjatmiko ketika dikonfirmasi, Rabu (5/9). Sedangkan tim jaksa penuntut umum dari KPK akan dipimpin oleh jaksa Agus Salim. Sudjatmiko selama ini sudah beberapa kali memimpin persidangan di pengadilan Tindak Pidana Korupsi Jakarta di antaranyamengadili Nyoman Suisnaya, terdakwa kasus

Angelina Sondakh memasuki ruang persidangan sebagai saksi kasus Nazaruddin. suap PPID di Kemenakertrans, dan menjatuhi hukuman tiga tahun penjara.

Hakim yang juga menjadi jubir Pengadilan Negeri Jakarta Pusat ini juga menjadi ketua majelis hakim

yang menjatuhkan hukuman 2,5 tahun untuk Nunun Nurbaetie. Angie menjadi tersangka kasus

suap pembahasan anggaran pengadaan alat laboratorium di 17 perguruan tinggi negeri di Kementerian Pendidikan serta pembangunan Wisma Atlet SEA Games Palembang di Kementerian Pemuda dan Olahraga. KPK menduga Angie telah menerima suap Rp 6 miliar. Suap terhadap Angie ini terungkap dari pengembangan kasus suap Wisma Atlet. Terpidana Wisma Atlet, Mindo Rosalina Manulang, mengatakan pernah berhubungan melalui pesan BlackBerry dengan Angie. Isi percakapan tersebut membahas berbagai proyek di perguruan tinggi. Namun Angie membantahnya. Dia bahkan mengaku tidak memiliki BlackBerry saat itu. (kmc/int)


6 September 2012

MASSA LEMPAR BATU Polisi Letuskan Tembakan

Jangan Persulit Penganut Parmalim Urus e-KTP JAKARTA-PemerintahDaerahdiSumatera Utara kembali diingatkan agar jangan mempersulit warga penganut aliran kepercayaaan Parmalim, untuk mengurus KartuTandaPendudukElektronik(e-KTP). Sebabmerupakanhaksetiapwarganegara yangtelahberusiadiatas17tahunmaupun yangtelahmenikah,untukmemperoleheKTP. Penegasan tersebut kembali dikemukakan Kepala Pusat Penerangan Kementerian Dalam Negeri (Kapuspen Kemendagri)ReydonnyzarMoenekdiSumedang, Rabu (5/9). Iamenilaihaliniperludisampaikan,agar tindakan Pemerintah Kabupaten Kuningan yang menghentikan pembuatan eKTP pengikut Ahmadiyah di Desa Manislor, Kecamatan Jalaksana, Kabupaten Kuningan, Jawa Barat, tidak meluas hingga ke daerah-daerah lain. Meskipun alasan penghentian, untuk menjaga kondusifitas, setelah adanya protes sebuah organisasi keagamaan. “Stateman Sekda (Sekretaris Daerah) Kuningan menghentikan sementara e-KTP, itu sama sekali tidak benar,”ungkap kapuspen yang setiap saat memberi keterangan kepada para wartawan ini. Menurutnya sesuai dengan Peraturan Pemerintah Nomor 37 tahun 2012 tentang administrasi kependudukan, sangat jelas dikemukakan. Bahwa e-KTP merupakan hak semua warga negara yang berdomisili Indonesia.Dansamasekalitidakmempersoalkan agama. “Formulir untuk kolom agama, itu kan hanya boleh diisi dengan salah satu dari enam agama yang diakui negara. Tapi misalnya aliran kepercayaan seperti Parmalim ingin mencantumkan dari salah satunya bisa. Tapi tidak boleh dengan nama aliran kepercayaan tersebut. Karenapilihannyahanyaadahanyaenam. Tapikalaunggakmau,itubisadikosongkan kolom tersebut,”ungkapnya. Oleh sebab dalam kesempatan kali ini, Donny tidak saja hanya mengingatkan Pemkab Kuningan. Namun juga Pemda Sumut, dan sejumlah pemerintah daerah lainnya. “Karena untuk soal keyakinan, negara tidak bisa ikut campur. Dan kalau pun untuk kolom agama itu dikosongkan, itu hak warga negara tersebut. Itu boleh dan dibenarkan. Tapi kalau diisi diluar enam, tidak boleh. Saya sudah kontak dengan Pemkab, kita sudah ingatkan bahwa itu tidak benar.” Sementaraterhadapmasyarakatsendiri, Donny secara khusus juga mengharapkan agar setiap warga masyarakat yang telah cukup usia untuk segera mengurus e-KTP. Alasannyasangatsederhana.“Karenasetiap warganegara(yangusianyatelahcukup),itu wajib.Apalagiper1Januari2013mendatang, e-KTP telah berlaku sebagaimana diatur dalamPeraturanPresidennomor67tahun 2011.Jadirugikalautidakuruse-KTP.Karena basisdatasemuamenggunakane-KTP.”(gir)

BLH Sumut Segera Turun Sambungan Halaman 1 Sumut (Provsu) ini, juga meminta Bupati Tapsel Syahrul Pasaribu, aktif memfasilitasi dan memediasi warga yang keberatan dengan kehadiran perusahaan tambang emas tersebut. Tujuannya, untuk meminimalisir konflik dan mencegah korban dan kerugian materil. Sejak awal, lanjutnya, Pemprovsu sudah menekankan pihak perusahaan untuk memperhatikan secara serius dampak lingkungan yang diakibatkan perusahaan tambang emas tersebut. Karena aliran limbah nantinya akan dibuang ke Sungai Batangtoru. DalambeberapakalipertemuandenganBupati Tapsel dan pihak perusahaan, pihaknya sudah diyakinkan bahwa limbah sebelum dibuang ke sungai akan diolah terlebih dulu hingga kembali netraldantidakmencemarisungai.KarenaSungai Batangtoru masih dimanfaatkan sebagian besar warga untuk untuk kebutuhan sehari-hari. Untuk itu, Pemprovsu akan mencari tahu terlebih dulu sebelum mengambil sikap. Karena perlumendapatkaninformasiberimbangbaikdari warga yang keberatan maupun dari pihak perusahaan. Pihak perusahaan wajib memenuhi komitmennya, untuk meminimalisir dampak lingkungan yang diakibatkan aktivitas pertambangan. “Itu komitmen bersama yang dituangkan dalam MoU antara gubernur, Bupati Tapsel dan perusahaan,” kata Nurdin. Pembahasan menurutnya sudah berulangkali dilakukan dengan pihak direktur perusahaan dari Hongkong. Selain masalah pencemaran, juga diingatkan mengenai corporate social responsibility (CSR) yang melibatkan masyarakat sekitar perusahaan. Selain itu telah disepakati kepemilikan saham sebesar 5 persen diserahkan untuk daerah. Dari jumlah tersebut untuk provinsi 70 persen dan Tapanuli Selatan (Tapsel) 30 persen. Untuk itu dibentuk sebuah konsorsium BUMD untuk terlibat di dalamnya. (ari)

Sambungan Halaman 1 yang emosi juga melempari petugas dengan batu. Untuk meredakan situasi, polisi meletuskan tembakan peringatan. Dorr…. Pantauan METRO, aksi lempar sempat terjadi dua kali antara ribuan warga dengan petugas keamanan yang telah disiagakan. Untuk diketahui, ribuan warga berdemo di tiga tempat. Lokasi demo pertama berada di Simpang Tiga areal PTPN 3 Batangtoru sekitar 1 kilometer dari Pasar Batangtoru menuju Hutaraja. Di sini, massa hanya berorasi dan tidak ada blokade petugas. Demo berlangsung dari pukul 10.00 WIB hingga 13.00 WIB. Dalam waktu bersamaan demo juga terjadi di Desa Telo atau sekitar enam kilometer dari Pasar Batangtoru. Di lokasi ini lah tempat

Ayo Dukung Nomor 4 Sambungan Halaman 1 “Mulai sekarang, mulai niatkan dalam hati kita kalau ingin perubahan. Perubahan itu mungkin bukan untuk kita tapi untuk anak cucu kita nanti. Pada tanggal 18 mari lah samasama ke TPS kita dukunglah Dedi-Affan nomor urut 4,” ucapnya di hadapan lebih seratusan masyarakat Kampung Mandailing, Selasa (4/9) malam lalu. Dia juga berharap pasangan Dedi-Affan akan menjadi seorang pemimpin dan menjadi panutan masyarakat di Kota Psp. “Di tanggal 18 Oktober supaya kita sama-sama memenangkan Dedi-Affan,” pungkasnya. Diutarakannya, ia bermarga Siregar sama dengan ibundanya Dedi yaitu Hj Yusra Siregar, dan suaminya bermarga Harahap sama dengan ayahanda Dedi yaitu Drs H Rahudman Harahap MM. “Betul-betullah anak ini kita perjuangkan sampai pada yang diharapkan,” terangnya. Dedi Jaminsyah Putra Harahap di hadapan masyarakat menegaskan pasangan DediAffan tidak akan memberikan janji-janji, namun terpenting bagi mereka, visi-misi yang

mereka tuangkan ditegakkan, dilaksanakan dan direalisasikan ketika diamanahkan rakyat memimpin Psp periode 2013-2018 mendatang. “Kedatangan kami ingin membawa perubahan ke Psp ini. Bagaimana Psp ini ke depan, itu kembali kepada masyarakat. Apakah akan mau tetap atau mau berubah ke arah yang lebih baik ke depan itu kembali ke masyarakat. Kalau soal pilihan itu ada di hati masing-masing masyarakat. Kami yakin kita berkumpul di sini atas dasar keikhlasan. Masyarakat lah yang menilai kami,” ucap Dedi dihadapan masyarakat. Ditegaskannya kalau masyarakat tahu siapa calon pemimpinnya. Di pemilukada ini tidak ada yang disebut incumbent, fair play. “Kami tidak gentar apapun dalam pemilukada ini, ketika saya dekat dengan masyarakat dan dengan Allah SWT. Pemilukada ini ada yang kalah dan ada yang menang. Dan pasangan nomor urut 4 ikut di pemilukada ini bukan untuk kalah tapi untuk menang,” tegasnya. Disampaikannya, lebih enak masyarakat itu menjatuhkan pilihan kepada mereka dengan

keikhlasan, dan dirinya optimis kalau masyarakat sudah tahu siapa calon pemimpinnya masing-masing. “Hidup itu adalah pilihan, hitam atau putih, dan bukan abu-abu. Jangan pernah ragu-ragu dalam menentukan pilihannya, yakinkan dalam hati. Kita sebenarnya kalau memang betul-betul ingin pembangunan bagus harus kompak, jangan saling fitnah,” pungkasnya. Untuk menilai seseorang itu dia berharap masyarakat menilainya setelah bertemu, bagaimana orangnya dan mengenalnya baru memberikan penilaian. “Jangan menilai seseorang sementara belum mengenalnya. Alangkah baiknya kita berbaik sangka,” ajaknya. Dia juga mengajak masyarakat untuk membuang pikiran bahwa siapapun nantinya yang terpilih kondisi Psp akan sama, fikiran itu harus ditepis dan dihilangkan. Karena dalam ajaran Islam dikatakan bahwa Allah SWT tidak akan berubah nasib suatu kaum sebelum kaum itu sendiri bersungguh-sungguh merubahnya. “Tapi lihatlah juga pemimpinnya, jangan salah memilih pemimpin. Pemimpinlah yang

bisa mengubah suatu wilayah,” sebutnya. Alumni S2 Magiter Studi Pembangunan (MSP) ini juga mengajak masyarakat jangan sampai tidak tidak menggunakan hak pilih, tapi gunakan hak pilih dengan baik serta sampaikan harapan masyarakat kepada calon pemimpin. “Dan saya berikrar bahwa saya akan menjadi seorang pemimpin yang takut kepada Allah SWT dan menjadi pemimpin yang sayang kepada rakyatnya,” tegasnya. Tokoh masyarakat setempat, H Basrah Batubara mengucapkan terima kasih atas kunjungan Dedi Jaminsyah Putra dan rombongan ke tempat mereka yang ingin bertemu dan bertatap muka dengan masyarakat. “Sebenarnya memang, kalau kita ingin perubahan maka pilihlah pemimpin yang pas, yang peduli kepada masyarakat dan takut kepada Allah SWT,” sebutnya. Dia berharap dengan pertemuan tersebut masyarakat sudah bisa menanamkan niatnya, karena sesungguhnya segala sesuatu itu diawali dengan niat, dan tidak akan goyang hingga 18 Oktober mendatang. (neo)

Prangko Bergambar Mobil Listrik Diluncurkan Sambungan Halaman 1 Listrik” ini terbilang unik, karena tidak dilakukan melalui acara resmi maupun waktu lazim. Meneg BUMN Dahlan Iskan memilih menandatangani sampul peringatan Hari Kebangkitan Teknologi Nasional yang berisi prangko bergambar mobil listrik itu kemarin pukul 06.00 di lapangan Monumen Nasional (Monas). Terang saja acara menarik perhatian masyarakat yang sedang berolah raga pagi di kawasan Monas. “Waktunya sengaja dipilih pagi hari pada saat matahari sedang muncul di ufuk timur dan dilakukan di tengah masyarakat, sebagai simbol era baru transportasi yang ramah lingkungan dengan mobil listrik,” kata Awie Setiawan selaku koordinator acara di sela-sela acara peluncuran prangko terbaru PT Pos Indonesia. Sedangkan Dahlan menilai prangko bergambar mobil listrik yang dibanggakannya itu sangat menarik dan inovatif. “Karena ini merupakan wujud nyata gerakan menuju era transportasi listrik,” kata Dahlan sebelum membubuhkan tanda tangan pada sampul

Koran Kebanggaan Orang Tabagsel

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel )

Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Muhiddin Hasibuan Pandapotan MT Siallagan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

ada di lingkar tambang diperbolehkan masuk untuk berdialog bersama pihak perusahaan. Namun hasil perbincangan masih belum mencapai kesepakatan hingga menjelang sore kemarin. Beberapa warga yang dimintai keterangan terhadap tujuan utama mengelar aksi tersebut mengaku keberatan jika limbah tambang dibuang ke sungai Batang Toru yang merupakan sumber kehidupan dan penghidupan ribuan warga di pinggirannya. “Sesuai dengan sosialisasi 2008 lalu limbah tambang direncanakan akan dibuang ke laut. Kenapa justru dibuang ke sungai Batang Toru. Padahal ribuan warga memanfaatkan aliran sungai tersebut termasuk untuk minum,” tegas beberapa warga dengan setengah berteriak menjawab pertanyaan METRO. (ran)


Anggota SPS No.: 438/2003/02/A/2007 Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba

yang terdiri dari ibu-ibu, remaja putri, dan bapak-bapak yang memenuhi simpang tiga menyusul ke Desa Telo. Mereka terus menyuarakan keberatan atas rencana pemasangan pipa pembuangan tambang emas itu yang akan dialirkan ke sungai Batang Toru. Dan beberapa saat tanpa dikomandoi, massa bergerak cepat menuju areal tambang yang berjarak sekitar 1,5 km dengan berjalan kaki dan naik sepeda motor serta becak. Dan lagi-lagi ribuan warga yang bermaksud memasuki areal tambang dihadang ratusan personil keamanan, dan ketegangan kembali terjadi antara massa dan petugas. Bahkan, massa berteriak bakar tambang emas tersebut. Mendengar teriakan ini, polisi melepaskan tembakan peringatan sebanyak satu kali. Akhirya sekitar 20 perwakilan warga yang

„ Dedi Jaminsyah Putra berfoto dengan ibu-ibu di Kampung Mandailing, Selasa (4/9) malam.

METRO TABAGSEL Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh : Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tabagsel : Pj. Pimred Metro Tapanuli : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

terjadinya aksi saling dorong dan lempar batu. Dari pukul 10.00 WIB hingga pukul 12.00 situasi memanas. Massa dan petugas keamanan terlibat saling dorong dan lempar batu. Ketegangan antara warga dengan petugas keamanan baru reda ketika Wakapolres Tapsel Kompol Zainuddin dan perwakilan warga berbicara dari mobil dengan pengeras suara. “Saudara-saudara harus tenang, aso hita buat kesepakatan (agar kita bisa membuat kesepakatan),” kata Wakapolres. “Madung hami pareso langsung inda dong dope anggo pemasangan pipa i (kami sudah tinjau langsung bahwa pemasangan pipa belum ada),” kata salah seorang perwakilan warga dari atas mobil polisi. Namun, setengah jam kemudian, massa

berukuran besar bertuliskan kalimat “Selamat Atas Terbitnya Prangko Baru Ini”. Menurutnya, saat ini pemerintah mengembangkan beberapa purwarupa mobil listrik. Karenanya, Dahlan berharap PT Pos membuat beberapa prangko berseri dengan gambar mobil listrik. “Saya usul, semua mobil listrik yang dikembangkan dibuat berseri sehingga masyarakat semakin mengenal berbagai model transportasi listrik,” cetusnya. Menanggapi permintaan Dahlan, Dirut PT Pos Indonesia I Ketut Mardjana langsung menyatakan kesanggupanya. Menurutnya, PT Pos Indonesia memang sudah siap memproduksi prangko seri transportasi listrik tersebut. “Produksinya akan dilakukan secara bertahap sesuai dengan kesiapan alat transportasinya dan momentum yang tepat,” ucapnya. Tanda tangan Dahlan Iskan tadi pagi menjadi puncak acara peluncuran perangko “Mobil Listrik” yang sebelumnya diawali di Kantor Pusat PT Pos Indonesia di Bandung pada 29 Agustus 2012 lalu. Acara dibandung itu juga dihadiri Ir Dasep Ahmadi yang dikenal sebagai pencipta mobil listrik.(aj/jpnn)

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN


„ Menteri Negara BUMN Dahlan Iskan (kanan) dan Direktur Utama PT Pos Indonesia, I Ketut Mardjana saat peluncuran perangko mobil listrik sebagai salah satu agenda peringatan Hari Kebangkitan Teknologi Nasional 2012, yang berlangsung di lapangan Monumen Nasional Jakarta Pusat, Rabu 5 September 2012.

Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotland Dolok Saribu, Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


6 September 2012

Tidak Malu dan Sungkan

BSM Pererat Silaturahmi... Sambungan halaman 8 Ditahun 2015 mendatang tuturnya, BSM bercita-cita masuk dalam Top Ten sebagai bank terbesar di Indonesia. Dan sampai saat ini, BSM terus berbenah memenuhi fasilitas pelayanan transaksinya, sehingga nasabah bisa semakin terlayani dengan baik disetiap tempat. Dicontohkannya, bagaimana saat ini calon penumpang pesawat Garuda bisa melakukan transaksi booking tiket yang pembayarannya melalui BSM secara online. “Kami besar karena bapak-bapak dan ibu-ibu. Terima kasih atas kepercayaannya selama ini. Bila ada pelayanan kami yang kurang mohon sampaikan langsung kepada kami,” pungkasnya. Dalam acara yang sederhana dan penuh kekeluargaan tersebut, juga digelar lucky draw, bagibagi hadiah untuk nasabah yang beruntung. Mewakili nasabah juga mengucapkan terima kasih kepada BSM. Pasalnya, acara tersebut merupakan apresiasi yang tinggi kepada mereka sebagai nasabah BSM khususnya masyarakat Tionghoa di Psp ini. “BSM merupakan bank dengan konsep syariah Islam yang tidak membatasi golongan tertentu untuk menabung di BSM,” kata perwakilan nasabah tersebut. (neo/mer)

Istri Wamen... Sambungan halaman 8 Ny Normaida br Simatupang, Waket TP PKK Ny Evealina MS, Kadis Kehutanan Darmi Siahaan sebagai koordinator panitia daerah, jajaran pimpinan SKPD, para camat dan perwakilan organisasi perempuan dan instansi vertikal terkait. Direncanakan, 10 lokasi penanaman di lahan kritis. Di antaranya di sekitar kawasan PLTA Sipan Sihaporas Kecamatan Pandan, sekitar areal Terminal Terpadu Pandan di Jalan M Panggabean/ Jalan Baru. Kemudian di Desa Sipange Kecamatan Tukka, di Bukit Anugrah Kecamatan Sitahuis, di kawasan pemandangan Hajoran Kecamatan Pandan, di areal PLTU Labuan Angin Kecamatan Tapian Nauli, sekitar Asrama Haji Kecamatan Pinangsori, kawasan SMP Negeri 1 Sibuni-buni Kecamatan Sarudik, dan di kawasan hutan Pulau Mursala Kecamatan Tapian Nauli. Total bibit pohon yang bakal ditanam sebanyak 32.500 batang. Terdiri dari pohon jabon, mangga, tanjung, jengkol, petai, melinjo, cemara laut, kelapa, surian/ingul, durian, karet, manggis, gaharu dan trembesi. Kegiatan itu nantinya akan dipusatkan di Pantai Kahona Pandan. Ditandai dengan penyerahan bibit secara simbolis lalu menyebar ke tiap lokasi yang direncanakan. Hadir Ketua TP PKK Tapteng, Ny Normaida br Simatupang, Waket TP PKK Ny Eealina MS, Kadis Kehutanan Darmi Siahaan sebagai koordinator panitia daerah, jajaran pimpinan SKPD, para camat dan instansi perwakilan vertikal terkait. GPTPP merupakan gerakan yang diprakarsai 7 organisasi perempuan di Indonesia. Di antaranya, Solidaritas Istri Kabinet Indonesia Bersatu (SIKIB) yang diketuai oleh Ny Silvia Agung Laksono. Kemudian Kowani (Kongres Wanita Indonesia) yang diketuai oleh Ny Dewi Motik Pramono, Dharma Pertiwi yang diketuai oleh Ny Tetty Agus Suhartono (istri Panglima TNI), Bhayangkari yang diketuai oleh Ny Henny Timoer Pradopo (istri Kapolri). Lalu, Aliansi Perempuan untuk Pembangunan Berkelanjutan (APPB) yang diketuai oleh Ny Yeni Sapta, Dharma Wanita Persatuan yang diketuai oleh Ny Nila Moeloek, dan TP PKK Pusat yang diketuai oleh Ny Vita Gamawan Fauzi (istri Mendagri). Kehadiran Ibu Negara Ani Yudhoyono akan didampingi Menteri Pemberdayaan Perempuan & Perlindungan Anak, Menteri Pariwisata Ekonomi Kreatif, Menteri Bappenas, dan Menteri Kehutanan, bersama para istri menteri Kabinet Indonesia Bersatu akan hadir. Beserta para pengurus ketujuh organisasi perempuan yang tergabung di GPTPP. (mor/nasa)

Sambungan halaman 8 kami jatuh hati dan membulatkan tekad untuk mendoakan dan memilih pasangan nomor urut 3 ini,” ujar para pedagang di selasela kunjungan pasangan AMIN dipasar inpres Padangmatinggi, Rabu (5/9), pagi. Menurut Deliana Dhalimunthe (52), cerminan kedekatan dan keakraban yang ditunjukkan pasangan AMIN merupakan salah satu bukti jika kedua figur tersebut sangat layak memimpin Kota Psp priode 2012-2018. “Melihat senyum dan raut wajah sejuk (borgo) serta ketidaksungkanannya menjabat tangan serta merangkul kami yang bau

amis sudah membuat hati terpikat, belum lagi tata kramanya yang ramah dan sopan, sangat tidak benar rasanya jika tidak memilih AMIN,” terangnya. Hal senada dikatakan Masnah Harahap (53), yang mengaku merasakan adanya aura pemimpin dalam raut wajah pasangan nomor urut 3 itu. “Jujur, dari lima pasangan lain yang tebar pesona, hanya dalam diri Andar-Isnanlah, saya temukan aura kepemimpinan, semoga Allah SWT meridhoi niat tulusnya memimpin kota ini,” katanya. Disinggung harapannya kepada pasangan Amin, Masnah dengan singkat mengatakan, agar kondisi bangunan dan fasilitas di pasar

inpres Padangmatinggi dapat diperbaiki. “Mohon jika nanti terpilih, fasilitas bangunan di pasar inpres Padangmatinggi diperbaiki agar para pedagang dan konsumen merasa nyaman berjualan dan membeli dipasar ini,” pintanya. Selain itu, Masnah mengingatkan agar jangan pernah lupa kepada arus bawah karena selama ini banyak figur yang ketika belum mendapatkan jabatan dekat dengan masyarakat namun setelah keinginan didapatkan malah lupa. “Jangan seperti figur-figur pemimpin lain, jadilah diri sendiri yang bijaksana dan pengayom masyarakat lemah,” imbuhnya.

Menanggapi masukan para pedagang itu, Calon Walikota Psp, Andar Amin Harahap mengungkapkan kebahagian dan rasa terimakasihnya atas dukungan para pedagang pasar inpres. “Doakan dan dukung kami agar diberi kesempatan memimpin kota ini, yakinlah dengan kebersamaan dan dukungan ibu-ibu dan bapak-bapak, kita akan mampu mewujudkan kesejahteraan di kota salak ini,” terangnya. Dalam kunjungan itu, para pedagang yang didominasi kalangan ibu-ibu itu, berebut agar bisa diabadikan dengan kedua pasangan yang dikenal dekat dengan masyarakat arus bawah itu. (phn/mer)

Puluhan Hektare...

Talud Hancur Sibolga Tercemar Sambungan halaman 8 kan anggaran perbaikan/pembangunannya Talud tersebut tahun ini atau tidak,” terang Swito kepada METRO, Rabu (5/9) di Sibolga. Namun yang pasti, sambungnya, masyarakat yang bermukim di daerah pondok reformasi sudah sangat resah, sebab kondisi itu telah menimbulkan bau busuk diakibatkan terjadinya tumpukan sampah di lokasi Talud. Disinggung kapan Talud itu rusak, Kepling I Kelurahan Kota Beringin mengaku kurang

mengetahui persis kerusakan itu dan apa penyebabnya. “Tapi, saya yakin, Talud itu rusak parah atau hancur seperti itu pada tahun ini. Soalnya, pada tahun lalu, kerusakan belum seperti itu walaupun kerusakannya sudah terlihat,” beber Swito. Kepala Dinas (Kadis) Pekerjaan Umum Daerah (PUD) Pemko Sibolga, Ir Thamrin Hutagalung yang dihubungi mengaku belum mengetahui informasi mengenai kerusakan Talud itu. “Nanti kita akan coba cek, guna dapat diprogramkan pada TA 2013 mendatang,”

tandasnya. Pantauan METRO, Talud tersebut terdiri dari dua dinding bangunan dan menjorok sampai ke pantai. Talud ini satu rangkaian dengan bangunan drainase (parit pembuangan) yang berada di wilayah jalan KH Zainul Arifin. Polusi udara berupa bau busuk timbul karena bukan hanya sampah dan kotoran rumah tangga masyarakat kota Beringin yang bermuara ke Talud tersebut, melainkan juga sampah dan kotoran yang berasal dari pasar kota Beringin. (tob/nasa)

PPL Harus Berbagi Ilmu dengan Petani Sambungan halaman 8 bagai ujung tombak diharap bisa efektif menciptakan pengetahuan, demi peningkatan harkat martabat masyarakat petani di Tapsel. Karena petani di Simalungun dalam hal ini sudah sukses menerapkannya. “Menularkan ilmu dari petugas kepada warga petani sangat-sangat diharapkan demi mengejar peningkatan ekonomi petani. yakinlah, tanpa ilmu semua pekerjaan bisa jalan ditempat,” tutur Bupati. Kemudian, Syahrul mengimbau kepada semua petugas pertanian untuk lebih focus

terhadap kinerjanya sesuai tugas pokok dan fungsi (tufoksi) yang dimiliki, rajin-rajin jemput bola ke bawah dan jangan menunggu bola. Dia juga mengingatkan PPL untuk membuat laporan data perkembangan pertanian melalui data dan dokumentasi yang jelas dan akurat, agar perkembangan tidak mengambang. “Data dan dokumentasi itu penting guna mendorong sudah sejauh mana peningkatan sector pertanian selama 2 tahun kepemimpinan saya,” ujarnya seraya menyebut bantuan pertanian banyak turun ke Tapsel dari hasil ke pemerintah provinsi dan pusat.

Sebelumnya, Ketua Forum Komunikasi Pembangunan Pertanian Tapsel, Hamdan Nasution SP melaporkan, halal bi halal bertujuan mempererat hubungan silaturrahmi di antara pejabat, seluruh staf dan petugas jajaran pertanian Pemkab Tapsel. Selain itu katanya, mereview apa yang telah dikerjakan guna peningkatan kinerja ke depan. Kegiatan dimulai dengan pembacaan ayat suci Alquran oleh Samsul Pasaribu, dimana tausyiah disampaikan Al Ustadz Drs Zulfan Hasibuan Sag yang dihadiri unsur DPRD, para pejabat eselon, staf, dan ratusan PPL di lingkungan Pemkab Tapsel. (neo/mer)

*simPATI “The Best Prepaid Brand” Sambungan halaman 8 Launching produk ini juga dilaksanakan di Kota Siantar, Rabu (5/9) kemarin di Rumah Makan Garuda yang dipimpin manejer graPARI Siantar Eko Admaja didampingi Manejer Sales Yogi dan karuawan lainnya. Acara tersebut dihadiri Mitra dan para Outlet. Pelanggan juga bisa menikmati paket internetan sebesar 500 MB hanya dengan Rp 20.000 untuk 30 hari. Dengan kedua pilihan paket tersebut, kini pelanggan simPATI dapat melakukan asyiknya chatting, browsing, social networking, email, upload, dan download di ponsel cukup dengan mengakses *999#. Kartu perdana simPATI terbaru hadir dengan harga yang lebih terjangkau hanya Rp 3.000 sudah termasuk kuota akses 3G sebesar 100 MB selama 30 hari sejak diaktifkan. Sebagai bagian yang tidak terpisahkan dalam kehidupan sehari-hari, simPATI berkomitmen untuk selalu menghadirkan keceriaan guna mendukung kebutuhan komunikasi dan akses internet para penggunanya. Bentuk keceriaan tersebut diwujudkan simPATI melalui penggelaran kompetisi Dance Like Agnes yang merupakan kompetisi dance untuk mencari 20 pemenang di tingkat nasional. Mereka yang terpil-

ih akan ikut menjadi dancer pada konser Agnes Monica di bulan Desember 2012 mendatang. Untuk mengikuti kompetisi ini, peserta cukup mengakses Pada proses berikutnya, mereka diminta untuk mengunggah (upload) hasil karya video dance mereka sendiri. Video dance yang mereka kirim merupakan video yang dikreasikan dengan beberapa gerakan Agnes Monica yang muncul pada iklan simPATI di televisi. Peserta dapat mulai mengirim video dance pada 5 September 2012. Dari seluruh video yang masuk, Agnes Monica akan memilih 200 video terbaik yang akan dipilih oleh publik melalui microsite Head of Marketing Communications Group Telkomsel Irlamsyah Syam mengatakan, “Telkomsel menyadari bahwa jumlah pengguna mobile internet di Indonesia terus bertambah seiring dengan semakin tingginya kebutuhan masyarakat terhadap akses informasi maupun hiburan terkini. Kompetisi Dance Like Agnes merupakan salah satu tools bagi kami untuk memberikan gambaran wujud keceriaan dan gaya hidup penuh mobilitas, yang diidentikkan dengan karakteristik pengguna simPATI.” Nantinya sebanyak 20 pemenang dengan vote/like terbanyak akan mengikuti proses pel-

atihan bersama Agnes Monica dan NEZindaHOOD di Jakarta. Selain itu, masing-masing pemenang juga akan mendapatkan berbagai hadiah berupa Samsung Galaxy S3, uang tunai Rp 10 juta, saldo T-Cash sebesar Rp 5 juta, pulsa simPATI senilai Rp 5 juta, dan paket internet 1 GB/ bulan selama 1 tahun. “Beragam aktivitas yang saya jalani sehari-hari tentu harus diimbangi dengan akses komunikasi yang mampu memberi solusi maksimal. Kebutuhan akses internet untuk mengirim video, browsing, chatting, kirim email, dan download lagu melalui handset mutlak terpenuhi guna mendukung rutinitas pribadi. Oleh karenanya, kehadiran simPATI sangat memudahkan saya dalam berkomunikasi data karena produk ini memiliki kecepatan akses tinggi yang mencapai 7.2 Mbps,” ujar Agnes Monica selaku brand ambassadorproduksimPATI. Aktivitas mobile lifestyle pelanggan simPATI semakin optimal berkat dukungan jaringan terluas berkualitas Telkomsel. Lebih dari 50.000 Base Transceiver Station (BTS) termasuk di antaranya 13.000 Node B (BTS 3G) telah tersebar di seluruh wilayah Indonesia. Telkomsel juga telah menyiapkan akses bandwidth internet berkapasitas 20 Gbps demi menjamin kelancaran akses komunikasi data. (rel/leo)

Sambungan halaman 8 ma tersebut. Namun disebutkan, serangan hama itu sudah berlangsung sejak tahun 2010. “Saya tidak tahu apa penyebabnya. Tapi virus itu sudah menyerang tanaman kako sejak tiga tahun lalu. Akibat virus itu, buah tak jadi alis busuk. Dari kulit luar justru menghitam,” ujarnya. Selain buah tidak bisa dipanen dan daun berlubang, batang pohon juga berwarna putih karena diserang jamur. Katanya, akibat hama itu produksi menurun drastis. “Biasa produksi perminggunya buah kakao saya rata rata 2 kaleng atau sekitar 30 kilogram, namun kini hanya 1 liter atau sekitar 4 kilogram saja. Tidak hanya milik saya, tetapi petani lain juga mengalami hal serupa,” sebutnya. Ditambahkan, dengan timbulnya penyakit buah kakao itu membuat petani terpuruk dan pesimis mendapatkan hasil yang memuaskan dalam musim panen tahun ini. Apalagi Penyuluhan Pertanian Lapangan (PPL) seolah tak peduli dengan hama yang menyerang kakao masyarakat. Senada disebutkan Julfot Tambunan (27) petani klainya di Desa Lumbangaraga Pahae Julu. Ia mengakui, penyakit tanaman itu sudah cukup meresahkan. Karena menurutnya buah kakao mencapai 50 persen diserang penyakit. “Buah kakao yang diserang penyakit umumnya mendekati masa panen, kemudian berguguran. Namun bila diteliti, di dalam buah itu terdapat ulat sebesar lalat warna putih dan hitam. hampir semua petani mengalami hal yang sama dan menimbulkan kerugian yang cukup besar,” ujarnya. Tanaman kakao, menurut Julfot, merupakan tanaman primadona di daerah Pahae meliputi Pahae Julu, Pahae Jae, Simangumban dan Purba Tua Taput. Boleh dikatakan, setiap rumah tangga memiliki tanaman kakao. “Dirata-ratakan, setiap rumah tangga di Pahae memiliki tanaman kakao seluas 0,5 hingga 2 hektar,” tandasnya. Kepala Badan Pelaksana Penyuluhan Pertanian Perikanan dan Kehutanan (BP4K) Taput Sabam Nainggolang mengatakan, serangan hama pada tanaman kakao disebabkan keengganan petani merawat dan melakukan pemangkasan daun. Akibatnya, sinar matahari tidak leluasa menerobos ke pohon karena tertahan rimbunnya dedaunan. Serangan hama yang terjadi saat ini, jika tidak dikendalikan akan berdampak negatif pada penghasilan petani. Jadi petani diimbau agar menjaga jarak tanam sehingga sinar matahari masuk dan mengurangi kelembaban. Suhu yang lembab merupakan suhu yang ideal bagi perkembangan hama penggerek. Pantauan METRO sebagian tanaman kakao di Kecamatan Purba Tua diserang penyakit sehingga tidak bisa dipanen. Hama membuat daging buah kakao mengeras, biji serta daunnya menghitam. Beberapa pohon kakao tampak berlubang pada daun. (cr-01/des)


Trauma, Santri Pilih... Sambungan Halaman 1 hanguskan empat kamar ini, sejumlah santri minta izin pulang karena dijemput orangtua masing-masing. “Sebagian santri yang tinggal di kamar itu minta izin pulang dijemput orangtua masingmasing. Maklum lah kejadian seperti ini baru pertama kali terjadi sehingga santri trauma” sebut Mukhlis. Kata Mukhlis, meskipun saat ini para santri di Pontren Musthafawiyah sedang mengikuti ujian semester, khusus bagi santri yang terkena musibah itu diberikan kelonggaran berupa ujian ulang setelah mereka kembali ke asrama dari kampung masingmasing. Dalam situasi ini pihak Pontren tidak bisa memaksakan untuk mengikuti ujian apalagi santri yang berada di dua kamar yang habis terbakar dan sebagian dua kamar lain juga ikut terbakar itu trauma. “Kebanyakan mereka masih anakanak usia tingkat SMP. Wajar saja mereka trauma atas musibah ini, makanya kita berikan kelonggaran,” ujarnya. Khusus bagi kamar yang sudah terbakar, kata Mukhlis, pihak Pontren sudah mulai diperbaiki agar bisa digunakan kembali karena yang terbakar hanya ada dua kamar, yaitu di kamar 1 dan kamar 8. Dan ada dua lagi yang sebagian isi kamar ikut terbakar yaitu kamar 2 dan kamar 7. “Jumlah semua kamar di gedung Mawar itu

ada 8 kamar dan dalam 1 kamar biasanya menampung 60-70 orang,” ujarnya. Untuk saat ini, santri yang tinggal di kamar terbakar tapi tetap mengikuti ujian dipindahkan ke kamar asrama yang lain yang masih kosong, sementara untuk pakaian sekolah santri yang pakaiannya sudah ludes meminjam pakaian santri yang masuk sore. “Santri yang tinggal di kamar terbakar sudah dipindahkan ke kamar lain. Dan pakaian mereka untuk sementara meminjam pakaian temannya yang memiliki lebih dari satu seragam sekolah untuk bisa mengikuti ujian. Artinya kita tidak lagi membebani pikiran mereka dengan ujian. Siapa yang tetap ingin mengikuti ujian bisa (diikutkan) siapa yang minta izin boleh,” tambahnya. Lalu, ibu pengasuh asrama putri, Hj Hanna Chaniago menceritakan kebakaran terjadi sekitar pukul 07.30 WIB pagi ketika itu semua santri putri yang tinggal di asrama sedang melakukan tugas kebersihan pekarangan asrama dan tiba-tiba terdengar suara ledakan. Dan saat itu juga muncul api dan asap dari dalam ruangan kamar 1 Mawar, sontak santri putri yang berada di dalam kamar minta tolong. Sampai saat ini, kata Hanna, belum diketahui penyebab kebakaran. “Kami tidak tahu pasti penyebabnya, yang kami pikirkan saat ini bagaimana agar mental santri tidak

Sambungan Halaman 1 mahal-mahal, suntik sanasini, tradisional aja, pijit,

lulur, totok muka, aku tradisional banget,” tuturnya usai mengisi acara musik ‘DahSyat’ di Studio RCTI,

Kebon Jeruk, Jakarta Barat, Rabu (5/9). Selain dengan perawatan tradisional, Aura mengaku

rajin minum jus agar wajahnya tetap fresh. Selain jus, ia juga tak pernah lupa untuk selalu minum air putih.

“Jus aku bikin sendiri, yang mengandung vitamin C, sisanya minum air putih,” jelasnya. (int)

Koran Akan Abadi asal Terus Beradaptasi Sambungan Halaman 1 saya, yang lebih menakutkan adalah sebuah newsroom yang berantakan. Para jurnalis tertidur di sembarang tempat. Kertaskertas menumpuk tak beraturan di meja. Itu mengerikan,” ujar Senor, mantan presenter Wall Street Journal TV dan CNBC Europe. Sebuah produk jurnalistik yang bagus, papar Senor, tidak bisa dihasilkan bila rumah tempat pembuatnya sudah tidak keruan. “Logikanya, jika ingin membuat koran yang bagus, harus diciptakan integritas yang seimbang antara hardware, dalam hal ini ruangnya, dan software, dalam hal ini orang-orangnya,” tuturnya. “Dan menimbang itu semua, saya menobatkan ruang redaksi Jawa Pos sebagai yang terkeren, the coolest, jika dibandingkan dengan newsroom media lain di seluruh dunia,” tegas dia. Dalam sesi itu, di layar lebar ditampilkan video tentang suasana ruang redaksi Jawa Pos. Bagaimana sebuah ruang besar itu terasa sangat terbuka, dilengkapi peralatan gym dan

olahraga, studio musik, serta meja meeting melingkar yang memudahkan interaksi dan komunikasi. “Newsroom Jawa Pos tak ubahnya seperti arena playground (bermain, Red) besar. Itu contoh ideal suasana menyenangkan untuk membuat surat kabar,” tambah Senor. Ruang redaksi lain yang mendapat pujian milik Le Journal de Montreal (Kanada), sebagai newsroom dengan pembagian space terbaik. Gelar newsroom paling modern di benua Amerika diberikan kepada koran Venezuela, Cadena Capriles, serta harian Peru, El Comercio. Di Asia, ruang redaksi paling modern adalah milik India Today Multiplex yang baru saja selesai dibangun. Panelis Masa Depan Koran Pada sesi sore hari, dalam diskusi panel Print Plus tentang masa depan surat kabar, Jawa Pos juga mendapat kesempatan untuk tampil. Direktur Utama PT Jawa Pos Koran Azrul Ananda dipilih sebagai salah satu panelis bersama beberapa pakar senior kelas dunia. Di panggung utama kon-

ferensi itu, duduk pula Mario Garcia (CEO dan pendiri Garcia Media, Amerika Serikat), Raul Dharival (CEO The Times of India), Rainer Esser (CEO Die Zeit, Jerman), dan Claire Boonstra (cofounder dan business development director Layar, Belanda). Diskusi itu dimoderatori Eamonn Byrne, salah seorang konsultan koran paling terkenal dari Inggris (The Byrne Partnership). Dalam sesi tersebut, pada dasarnya disepakati krisis koran hanya terjadi di Amerika Utara. Di Eropa dan Amerika Latin, koran masih menunjukkan pertumbuhan positif. Baik dalam sirkulasi maupun pemasukan iklan. Asia lebih hebat lagi, tumbuh paling baik. Byrne juga menunjukkan hasil riset yang memperlihatkan kalau masa depan online justru lebih berat. Pemasukan (revenue) online tidak tumbuh dalam beberapa tahun terakhir dan diprediksi tidak akan tumbuh dalam beberapa tahun ke depan. Bahwa ada koran yang tidak tumbuh dalam beberapa tahun terakhir, maka itu adalah akibat dari perbuatan koran itu sendiri. Khususnya di

Amerika Serikat. “Dalam beberapa tahun terakhir, koran telah mengalokasikan begitu banyak biaya untuk memikirkan online. Tapi, bukan itu yang mematikan koran. Yang mematikan adalah: Dalam beberapa tahun terakhir, koran telah mengalokasikan begitu banyak brainpower (orang dan pikiran) untuk online. Padahal, online terbukti kurang menghasilkan. Seandainya brainpower itu fokus ke koran, hasilnya mungkin berbeda,” jelas Byrne. Mario Garcia menambahkan, “Kalau orang masuk kerja di koran tidak happy dan merasa korannya akan punah, apa yang dia takutkan itu justru akan terwujud. Beda kalau kita masuk kerja dengan penuh semangat.” Garcia menegaskan, koran bukan hanya akan bertahan 10 sampai 20 tahun lagi. “Koran akan abadi asalkan bisa terus beradaptasi,” ucapnya. Setelah diskusi panel, Azrul punya kesimpulan lanjutan. “Intinya adalah fokus. Kalau korannya fokus mengembangkan koran, maka ia akan terus berkembang. Die Zeit yang ter-

besar di Jerman membuktikan itu. Ada koran Swedia yang juga membuktikan itu. Mereka di Eropa, tapi bisa tumbuh dengan strategi fokus ke print. Sama persis dengan yang dilakukan Jawa Pos selama bertahun-tahun,” paparnya. Secara pribadi, Azrul mengaku bangga sekaligus canggung berada di panggung tersebut. “Saya ini anak kemarin sore. Kalah kelas jauh sama pembicara yang lain. Tapi, bangga juga karena ada koran Indonesia yang diminta duduk di sana. Dan itu Jawa Pos,” ucap pria 35 tahun tersebut. Pendapat bahwa industri koran sebenarnya hanya krisis di Amerika Utara sebenarnya juga sudah disinggung dalam berbagai sesi sehari sebelumnya (Senin, 3/9). Dan Asia ditegaskan sebagai pendorong baru pertumbuhan koran. “Sirkulasi koran kini kembali naik. Pertumbuhan positif itu diprediksi berlanjut hingga akhir tahun ini,” kata Larry Kilman, deputy CEO dan executive director of communication and public affairs WANIFRA (asosiasi koran dunia). Dari data yang ada, disebu-


6 September 2012

PPL Harus Berbagi Ilmu dengan Petani SIDIMPUANdaerah ini mePetugas Penyuluh ningkat dari tahun Lapangan (PPL) ke tahun,” ucap harus pro aktif Bupati Tapsel, H berbagi ilmu keSyahrul M Pasapada masyarakat ribu di acara halal petani di Kabupabi halal 1433 H/ ten Tapanuli Sela2012 M di Lingtan (Tapsel). Tukungan Dinas Perjuannya, melalui tanian, Dinas Keilmu tersebut dihuatan, Badan Peharapkan petani nyuluh dan Dinas di Tapsel semakin Perkebunan dan Syahrul Pasaribu Peternakan Kabumampu menggali potensi sumber paten Tapsel, berdaya alam Tapsel yang kaya. tempat di aula Kampus III “Kita mengetahui, sekitar UGN Psp, Rabu (5/9) pagi. 80 persen masyarakat Tapsel Demi mencapai target tertergantung pada pertanian sebut ucap Bupati, PPL sedan sektor perkebunan. Kita Baca PPL ... Hal 7 ingin kesejahteraan petani

Tidak Malu dan Sungkan Pedagang Doakan Pasangan AMIN SIDIMPUAN- Para pedagang kaki lima dan kios di Pasar Inpres Padangmatinggi sangat salut dengan sikap pasangan pasangan Calon Walikota dan Wakil Walikota, Andar Amin Harahap SSTP MSI-Muhammad Isnandar Nasution Ssos (AMIN). Pasalnya, mereka tidak malu dan sungkan turun ke pasar berjumpa dengan kaum kecil. Karena sikap pasangan AMIN ini, pedagang di Pasar Inpres Padangmatinggi mendoakan dan merestui pasangan AMIN untuk menjadi pemenang pada Pemilihan Kepala Daerah (Pilkada) Kota Padangsidimpuan (Psp) pada 18 Oktober 2012 mendatang. “Kami salut dan bangga melihat figur pasangan AMIN yang tidak malu dan sungkan menyambangi para pedagang di Pasar Inpres ini. Karenanya, sangat beralasan jika

Baca Tidak Malu... Hal 7


HAMA: Tanaman kakao yang terserang hama mengakibatakan buah busuk dan menghitam.


BERDIALOG-Para pedagang terlihat antusias berdialog dengan pasangan Andar-Isnan di Pasar Inpres Padangmatinggi, Rabu (5/9).

BSM Pererat Silaturahmi dengan Nasabah Etnis Tionghoa

Puluhan Hektare Tanaman Kakao Diserang Hama TAPUT- Puluhan hektar tanaman kakao di Desa Bona Nidolok, Kecamatan Purbatua, Tapanuli Utara, gagal panen akibat terserang hama yang menyerang buah dan daun. Luas lahan gagal panen mencapai 75 persen dari total 30 hektare lahan kakao. Kondisi itu membuat petani terancam kehilangan hasil panen. “Saat ini hasil panen kami

sudah menurun drastis. Bila hama itu tidak segera ditanggulangi kami akan kehilangan hasil panen. Kita ingin pemerintah mencari solusi antisipasi penyebaran virus tersebut,” kata Manihar M Sitompul, petani kakao kepada METRO, Selasa (4/9). Dia mengaku tidak tahu apa penyebab serangan ha-

Baca Puluhan Hal 7

Istri Wamen Pertanian Kunjungi Tapteng

Lihat Kesiapan GPTP PANDAN- Istri Wakil Menteri Pertanian RI Ny Umi Rusman Heryawan beserta rombongan datang ke Tapteng, Selasa (4/9). Kedatangannya guna melihat kesiapan Tapteng sebagai tuan rumah Gerakan Perempuan Tanam & Pelihara Pohon (GPTPP) pada 13-14 Oktober mendatang. Turut dalam rombongan, Staf Ahli Kementrian Pertanian RI Bidang Kebijakan Pembangunan Pertanian

Prof Pantjar Simatupang, anak rantau putra Tapteng Manca Hutagalung, kepala BPPT DKI Jakarta, serta dari Dinas Pertanian dan BPTP Sumatera Utara. Dalam rakor persiapan di ruang rapat Cendrawasih Pemkab Tapteng yang dipimpin Bupati Tapteng Raja Bonaran Situmeang, diungkapkan bahwa Tapteng siap mensukseskan kegiatan berskala nasional tersebut. Hadir Ketua TP PKK Tapteng,

Baca Istri Hal 7


BERFOTO-Pimpinan dan karyawan BSM berfoto dengan nasabah.

Talud Hancur Sibolga Tercemar SIBOLGA-Satu unit Talud atau lazimnya disebut bangunan pemecah ombak yang berada di perairan sekitar kawasan Pondok Reformasi, Kelurahan Kota Beringin, Kecamatan Sibolga Kota, Kota Sibolga hancur. Hal itu menimbulkan keresahan bagi warga sekitar, pasalnya puingpuing pecahan bangunan Talud telah menutup aliran air laut sehingga menimbulkan pencemaran lingkungan berupa polusi udara (bau busuk, red). Kepala Lingkungan (Kepling) I, Kelurahan Kota Beringin, Swito, membenarkan hal itu sembari mengatakan telah melaporkan kerusakan

ini ke pemerintah kota (Pemko) Sibolga melalui pihak Kelurahan bahkan telah membawakannya juga kedalam musyawarah perencanaan pembangunan (Musrembang) tingkat Kelurahan Tahun 2012 agar dapat diprogramkan dan dananya dapat ditampung di Anggaran Pendapatan dan Belanja Daerah (APBD) Tahun Anggaran (TA) itu juga. “Bukti berupa foto-foto dokumentasi kerusakan bangunan itu telah kita kumpulkan dan laporkan (serahkan), namun saya tidak tahu apakah pemko Sibolga ada merealisasi-

Baca Talud Hal 7

*simPATI “The Best Prepaid Brand” Paket Internet Terbaik 2 GB Dengan Koneksi Tercepat


LAUNCHING: Launching produk *simPATI “The Best Prepaid Brand” di Kota Siantar, Rabu (5/9) kemarin di Rumah Makan Garuda yang dimpim Eko Admaja.

SIANTAR- Guna memenuhi kebutuhan pelanggan terhadap akses internet berkualitas, Telkomsel menghadirkan paket data simPATI dengan kuota 2 GB yang memiliki koneksi tercepat hingga 7.2 Mbps. Paket terbaru simPATI ini dapat diperoleh seharga Rp60.000 dengan masa berlaku 45 hari. Untuk mendukung promo tersebut, Telkomsel menggelar kompetisi Dance Like Agnes yang bisa diikuti oleh para talenta berbakat Indonesia.

Baca simPATI ...Hal 7

SIDIMPUAN- Untuk mempererat silaturahmi antara pimpinan dan manajemen Bank Syariah Mandiri (BSM) Cabang Psp dengan nasabah, bank ini, akhir bulan lalu di Warung Kopi Kok Tong, di pusat perbelanjaan City Walk menggelar Priority Ghatering dengan nasabah masyarakat etnis Tionghoa. Pimpinan Cabang (Pinca) BSM Psp, Basrah Siregar, di acara tersebut mengatakan kegiatan sebagai salah satu ungkapan terima kasih BSM kepada nasabah, atas kepercayaannya menabung di BSM. Siregar mengapresiasi nasabah yang begitu antusias menghadiri

undangan silaturahmi yang mereka gelar. Dalam kesempatan itu, Basrah memaparkan tentang posisi BSM di Indonesia, yaitu sudah memiliki kantor pelayanan sebanyak 600-an. Untuk wilayah Tabagsel ini, BSM telah memiliki kantor pelayanan, bahkan di Tapsel sudah memiliki 2 Kantor Pelayanan Cabang Pembantu yaitu di Sipirok Kecamatan Sipirok dan di Batang Toru, Kecamatan Batang Toru serta 1 unit Sales Outlet di Pargarutan, Kecamatan Angkola Timur.

Baca BSM Hal 7


6 September 2012

Pemimpin Itu (FOTO:BORNEO)

„ Dedi Jaminsyah Putra mengajak ibu-ibu untuk memenangkan Dedi-Affan dengan santun.

Dedi-Affan: Ibu-ibu Harus Menjadi Pejuang Sejati SIDIMPUAN-Pasangan Calon Walikota dan Wakil Walikota Padangsidimpuan (Psp) Nomor Urut 4, Dedi Jaminsyah Putra Harahap SSTP MSP-H Affan Siregar SE mengajak timnya yang merupakan khusus kaum ibu-ibu dari seluruh lingkungan se-Kecamatan Psp Utara dan Psp Selatan untuk menjadi pejuang sejati. Menjadi pejuang sejati te-


SIDIMPUAN-Pemimpin itu adalah parhobas atau orang yang bekerja untuk melayani masyarakatnya.

“Jadi pemimpin itu bukannya malah untuk dipuji-puji dan mengharapkan penghormatan dari masyarakatnya, tetapi malah kebalikannya, pemimpin itu adalah orang yang bekerja melayani masyarakat,” ungkap pasangan Calon Walikota dan Wakil Walikota Padangsidimpuan (Psp), Ir Rusydi

Nasution MM-Ir Riswan Daulay MM dengan nomor urut 2 di pilkada Kota Psp 18 Oktober mendatang. Dengan begitu, kata RusydiRiswan, pemimpin yang bekerja pasti akan hanya memikirkan bagaimana membangun daerah dan rakyat yang

‹ Baca Pemimpin ...Hal 10

rang Dedi yaitu berjuang dengan sepenuh hati dan ikhlas, mengajak masyarakat untuk sama-sama memenangkan Dedi-Affan di pemilukada ini tanpa pernah menjelek-jelekkan pihak lain. “Yakinkan dalam diri dan kepada masyarakat bahwa Dedi-Affan ikut di pemilukada ini untuk menjadi seorang

„ Andar-Isnan

Kaum Muda Gantungkan Asa Pada AMIN SIDIMPUAN-Dukungan kepada calon walikota/ wakil wakil walikota Padangsidimpuan (Psp) nomor urut 3, Andar Amin Harahap-Muhammad Isnandar Nasution (AMIN) mengalir deras. Kali ini, datangnya dari kalangan muda. “Saya simpati sama calon pemimpin AMIN. Dimana mereka ramah, cakep, rendah diri, bersahaja, tutur katanya sederhana, tanpa banyak janji-

‹ Baca Dedi ...Hal 10

‹ Baca Kaum ...Hal 10

„ Jokowi makan nasi goreng di warung pinggir jalan.

Pemilih Jokowi Dinilai jadi Korban Pencitraan JAKARTA - Strategi pasangan calon Jokowi-Ahok dalam menjual dirinya kepada warga Jakarta dinilai hanya mengedepankan pencitraan belaka. Pasangan calon nomor urut 3 ini dipandang tidak memiliki program nyata untuk memecahkan persoalan Jakarta. Pengamat ekonomi politik, Agung Nur Farah mengatakan, pencitraan Jokowi-Ahok mulai dari penggunaan kostum kemeja kotak-kotak yang menjadi ciri khas pasangan cagub itu.

Selain itu Jokowi-Ahok juga dinilai selalu mencitrakan diri sebagai pihak korban yang teraniyaya dalam setiap permasalahan yang muncul. “Warga terkelabui dengan simbol - simbol seperti itu, meskipun tanpa harus memiliki program-program kerja,” ujar Agung dalam keterangannya di Jakarta, Selasa (4/9). Agung menjelaskan, strategi seperti ini sudah terbukti

‹ Baca Pemilih ...Hal 10

„ Ray Rangkuti

KPU Dinilai 22 Parpol Resmi Daftar Peserta Pemilu 2014 Lalai Tangani Isu SARA (FOTO:PARLIN POHAN)

„ Pasangan Calon Walikota dan Wakil Walkota Psp dengan nomor urut 2, Rusydi Nasution-Riswan Daulay.

JAKARTA - Masa pendaftaran verifikasi partai politik (parpol) peserta pemilu 2014 akan berakhir dua hari lagi. Hingga siang ini, Komisi Pemilihan Umum (KPU) RI sudah menerima berkas pendaftaran dari 22 parpol. Berdasarkan siaran pers dari KPU RI, 22 parpol itu terdiri dari partai lama pemilik kursi di parlemen dan partai baru yang sudah disahkan oleh Kementerian Hukum dan HAM (Kemenkumham). Ke-22 parpol tersebut yakni

Partai Demokrasi Kebangsaan (PDK), Partai Nasional Demokrat (Nasdem), Partai Pemuda Indonesia (PPI), Partai Demokrasi Indonesia Perjuangan (PDIP), Partai Kesatuan Demokrasi Indonesia (PKDI), Partai Kongres, Partai Serikat Independen (SRI), Partai Kebangkitan Bangsa (PKB), Partai Indonesia Sejahtera (PIS), dan Partai Bulan Bintang (PBB). Selanjutnya ada Partai Pemersatu

‹ Baca 22 Parpol ...Hal 10

JAKARTA - KPU DKI Jakarta dinilai tidak melakukan upaya untuk mencegah peredaran isu SARA pada Pemilukada DKI putaran kedua. Akibatnya, penggunaan isu SARA semakin meluas dan terangterangan. “Sudah dari awal. Kinerja penyelenggaraan pemilu ini agak minus sejak putaran pertama, karena mereka bekerja seperti mesin” ujar pengamat politik dari Lingkaran Madani Indonesia (LIMA), Ray Rangkuti dalam acara diskusi di RM

‹ Baca KPU ...Hal 10


6 September 2012

Anas Sebut Obama jadi Capres Demokrat JAKARTA - Beberapa partai pemilik kursi parlemen telah terang-terangan mengumumkan calon presiden yang akan diusung pada pemilu 2014. Namun tidak demikian dengan Partai Demokrat yang menjadi pemenang pemilu 2009 lalu. Partai binaan Susilo Bambang Yudhoyono ini masih enggan mengungkapkan figur yang akan didukungnya pada 2014. Hal ini tercermin dalam jawaban Ketua Umum Partai Demokrat Anas Urbaningrum saat ditemui usai mendaftar verifikasi parpol di kantor KPU RI, Jalan Imam Bonjol, Jakarta Pusat, Rabu (5/9). Ketika ditanya mengenai capres dari Partai Demokrat, Anas malah melucu. “Calon Presiden Demokrat adalah Barack Obama. Ya, hari ini Partai Demokrat telah resmi mencalonkan Barack Obama sebagai Presiden tapi itu di Amerika,” ujar Anas, Rabu (5/9). Menurut Anas, saat ini Partai Demokrat belum menentukan capres yang akan dijagokan. Bahkan pembicaraan mengenai itu pun belum ada. Anas berkilah bahwa partainya hanya akan fokus pada tahapan pemilu 2014 yang sedang berlangsung. Karena itu Demokrat baru akan menentukan capres setelah berlangsung pemilihan legislatif (pileg). Anas menilai masih terlalu dini untuk membicarakan capres sebelum melihat hasil pileg. “Kami sabar, kami ingin pastikan sukses pileg, baru secara definitif bicarakan siapa capres dan cawapres demokrat 2014. Bahasa Inggrisnya, ora kesusu,” kata mantan anggota KPU RI ini. (dil/jpnn)

Kaum Muda Gantungkan Asa Pada AMIN Sambungan Halaman 9 janji, pantas untuk didudukung dan dipilih pada Pemilukada 18 Oktober 2012,” ujar Nurhidayah (20), warga Jalan Bhakti ABRI. Menurut, cewek manis berkulit putih yang mengaku lama di Jakarta ini, dirinya simpati sosok pasangan AMIN, setelah mengikuti perkembangan hari ke hari Pilkada Psp dari media massa. Program AMIN katanya merakyat dan tidak muluk-muluk. Tidak terlalu jual kecap, atau terlalu over ackting (berlebihan) dalam merebut simpati masyarakat. “Kami kalangan muda berharap kelak Psp semakin sukses, sejahtera, maju dan sehat di tangan AMIN dan pendidikan bisa gratis semua,” katanya optimis. Harapan senada dilontarkan Sigit (19), warga Jalan Harahap. Lima tahun Psp di tangan AMIN diharap dapat membuat satu perubahan yang signifikan. “AMIN pemimpin muda masa depan Psp. Dengan displin ilmu dan sejumlah pengalaman dimiliki, yakin, AMIN dapat membidani Psp sesuai dengan asa (harapan) masyarakat Psp,” sebut Sigit sembari berharap agar AMIN kelak memikirkan nasib para penuntut ilmu di luar daerah Psp. Demikian halnya harapan Siti Mardyna (19) mahasiswi di Medan, warga Kelurahan Wek II ini berharap, AMIN kelak dapat membuka peluang kerja bagi generasi muda Psp serta peka atas kepentingan publik. Mardyna yang mengaku siap memilih dan memenangkan AMIN. Ia juga berharap, jika AMIN diamanahkan menduduki kursi salak 1 dan salak 2, tetaplah seperti sekarang ini, rendah diri, bersahaja, tidak banyak komentar tetapi selalu berbuat dan berjiwa membangun serta sosialis tinggi. (phn)

22 Parpol Resmi Daftar Peserta Pemilu 2014 Sambungan Halaman 9 Bangsa (PPB), Partai Hati Nurani Rakyat (Hanura), Partai Amanat Nasional (PAN), Partai Golongan Karya (Golkar), Partai Karya Republik (Pakar), Partai Nasional Republik (Nasrep), Partai Keadilan Sejahtera (PKS), Partai Gerakan Indonesia Raya (Gerindra), Partai Demokrasi Pembaruan (PDP), Partai Buruh, Partai Keadilan dan Persatuan Indonesia (PKPI), dan Partai Pelopor. Rabu (5/9), Partai Pelopor mendaftarkan diri ke KPU. Ketua Badan Pemenangan Pemilu (Bappilu) Pusat Partai Pelopor, Bambang Saroso mengaku bahwa pihaknya tak percaya diri karrena menilai persyaratan pendaftaran sangat berat. Meski begitu, Partai Pelopor tetap mendaftar untuk menunjukkan kesiapannya bersaing dengan partai lain di Pemilu 2014. “Intinya kami siap meskipun kami belum percaya diri karena persyaratannya sangat berat,” ujar Bambang. KPU DKI akan menutup pendaftaran verifikasi parpol peserta pemilu 2014 pada tanggal 7 September 2012. Dari 9 besar partai besar peraih kursi anggota dewan, tinggal Partai Demokrat yang belum mendaftar. (dil/jpnn)

Capres PKS di Tangan Majelis Syuro

„ Prijantooto

Serang Foke, Prijanto Dituding Berkoalisi Jokowi JAKARTA - Mundurnya Prijanto dari jabatan Wakil Gubernur DKI Jakarta diduga berkaitan dengan Pilkada DKI 2012. Prijanto diduga sengaja mundur untuk mencoreng citra calon gubernur incumbent, Fauzi Bowo. Hal ini disampaikan pengamat politik, Agung Nur Farah dalam keterangan persnya di Jakarta, Selasa (4/9). Agung menduga, ada sebuah rencana sistematis untuk menjatuhkan elektabilitas Fauzi dimata masyarakat. “Tudingantudingan dan alasan yang diberikan Prijanto bahwa dia tidak bisa bekerja sama dengan Foke di akhir-akhir masa jabatannya membuat runyam Foke, seperti diciptakan bahwa ada pecah kongsi di dalam Pemprov DKI,” kata Agung. Dosen Sekolah Tinggi Ilmu Ekonomi dan Perbankan Indonesia (Stekpi) itu

berspekulasi, cara ini dilakukan demi mendongkrak popularitas dan elektabilitas calon gubernur Joko Widodo atau Jokowi. Alasannya, menurut Agung, Prijanto memiliki kedekatan dengan PDIP yang menjadi partai pengusung Jokowi. Kecurigaan Agung bertambah karena waktu pengunduran Prijanto yang terlalu dekat dengan waktu pencalonan Jokowi sebagai calon gubernur oleh PDIP. Menurutnya, terlalu banyak kebetulan dalam peristiwa ini untuk tidak mencurigai motif Prijanto. “Sejak awal sebenarnya Foke berada di atas angin. Semua hal itu menjadi runyam buat Foke ketika Prijanto melakukan langkah-langkah pembusukan terhadap Foke. Saya melihat ada keterkaitan antara mundurnya Prijanto, tuduhan-tuduhan Prijanto terhadap Foke dan pencitraan

terhadap Jokowi yang terjadi bersamaan,” ujar Agung. Absennya Prijanto dalam pertarungan Pilkada DKI juga dinilai sebagai sebuah strategi. Menurut Agung, Prijanto akan kesulitan maju dalam Pilkada DKI karena posisinya sebagai wakil Foke. Apabila maju sebagai cagub, motif pengunduran diri mantan perwira tinggi TNI itu akan dipertanyakan. Dengan alasan ini Prijanto pun dijadikan sebagai tumbal pembuka jalan bagi Jokowi melenggang di Pilkada DKI. “Prijanto menjadi tidak nyaman bila dia yang maju dan akhirnya dia bersedia dijadikan martir oleh PDIP. Ini politik, pasti langkah apapun ada hitung-hitungannya, tidak mungkin terjadi begitu saja,” tandasnya. (dil/jpnn)

JAKARTA - Keputusan akhir tentang figur yang akan diusung Partai Keadilan Sejahtera (PKS) sebagai calon presiden 2014 nanti bukan ditentukan oleh DPP PKD. Sebab, kewenangan untuk memutuskan capres dari PKS ada di tangan Majelis Suyuro. Anggota Majelis Syuro PKS, Salim Segaf AlJufri, menyatakan, sah-sah saja jika jika ada pihak-pihak di PKS yang mengusulkan namanama tertentu untuk diusung sebagai capres. “Kalau di PKS sendiri kan demokratis itu pasti akan terus berjalan. Saya pikir boleh-boleh saja tapi nanti finalnya di Majelis Syuro,” katanya, Rabu (5/9), kepada wartawan, di gedung parlemen, di Jakarta. Dia menegaskan, Majelis Syuro dalam menentukan keputusan juga memertimbangkan elektabilitas calon yang diusung. “Pasti elektabilitasnya juga, itu salah satunya,” tegasnya. Kader PKS yang dipercaya sebagai Menteri Sosial itu menegaskan, saat ini baru ada satu nama, yakni Presiden PKS Luthfi Hasan yang disebut-sebut akan diusung sebagai capres. Namun Segaf tidak menampik kemungkinan akan munculnya nama-nama lain yang diwacanakan sebagai capres PKS. “Saat ini memang nama-nama lain itu belum ada. Majelis Syuro PKS juga belum membahas soal pencalonan presiden,” bebernya.(boy/ jpnn) Kader PKS ingin Luthfi Capres Sekjen PKS Anis Matta, mengakui di internal partainya tengah melakukan pembahasan siapa figur yang akan diusung sebagai calon presiden. Dia menegaskan, nama Presiden PKS Luthfi Hasan berpeluang paling besar untuk dijagokan sebagai capres dari partainya. “Ada desakan dari bawah, supaya capres PKS yang akan datang berasal dari kader internal PKS sendiri. Dalam hal ini pak Luthfi Hasan Ishaq sebagai presiden partai tentunya yang mempunyai peluang paling tinggi,” kata Anis, kepada wartawan, Selasa (4/9), di gedung parlemen, di Jakarta. Soal elektabilitas Luthfi, kata Anis, itu lebih kepada masalah teknis. Yang jelas, tegasnya, desakan utama dari kader supaya capres ke depan berasal dari PKS sendiri. (boy/jpnn)

Dedi-Affan: Ibu-ibu Harus Menjadi PPP Himpun Tokoh Menangkan Foke-Nara Pejuang Sejati JAKARTA Partai Persatuan Pembangunan (PPP) terus memberikan dukungan penuh kepada calon gubernur DKI Jakarta, Fauzi Bowo-Nahrowi Ramli, di putaran kedua nanti. Bentuk dukungannya, PPP menggalang dan memengaruhi tokohtokoh memilih pasangan berakronim FokeNara itu. “Tentu untuk membantu bang Foke dan Nara agar menang di pilkada putaran kedua. Yang dilakukan PPP sekarang adalah menghimpun tokoh-tokoh agar mereka juga memberikan partisipasi dalam menggalang dukungan bagi Foke-Nara. Itu yang kita lakukan” kata Ketua Umum PPP, Suryadharma Ali, kepada wartawan, Rabu (5/9), di gedung parlemen, di Jakarta. Pria yang juga menjabat menteri agama ini memastikan bahwa semua kader dan internal partainya di Jakarta mendukung penuh incumbent. Bahkan, kata dia, menurut hasil survei lebih dari 75 persen konstituen PPP memilih Foke-Nara. Karenanya, dia memercayai, Suryadharma memercayai sebelum dan pada hari pemilihan nanti, seluruh kader PPP akan mendukung Foke-Nara. “Itu tertinggi presentase dibandingkan yang lain. Dan saya yakin yang 25 persen juga akan terus berkurang dan akan memilih Foke,” katanya.

„ Fauzi BowoNahrowi Ramli

Suryadharma mengatakan PPP sekarang ini sudah memerbesar dan memerkuat jaringan untuk mendukung Foke. Lebih jauh dia mengakui, sebelumnya PPP bersama Partai Golkar dan Partai Damai Sejahtera mengusung pasangan Alex Noerdin-Nono Sampono namun sekarang mendukung Foke-Nara. Menurutnya, itu adalah masalah

yang biasa dalam politik. “Ya begitu, politik tuh ya begitu,” tegasnya. Dia menegaskan, tidak ada pragmatis dalam penentuan pilihan ini. “Jadi setelah itu kan ada dua pilihan begitu. Jadi kalau ada dua pilihan kalau dituduh kemana pun, bisa saja dituduh pragmatis. Tidak ada itu,” bantahnya. (boy/jpnn)

Pemimpin Itu Parhobas Sambungan Halaman 9 dipimpinnya dan tidak mengharapkan pujian dan imbalan, karena niatnya adalah untuk bekerja membangun daerah dan masyarakatnya. “Pemimpin yang benar-benar mau membangun tidak menerima aspirasi atau keluhan dan persoalan rakyatnya dari belakang meja atau mendapatkan laporan, tetapi harus turun dan melihat langsung ke lapangan dan dari warganya sendiri apa sebenarnya persoalan yang ada, kemudian dicarikan solusinya. Jadi Insya Allah jika kami diamanahkan memimpin Kota Psp, hal ini akan kami terapkan tanpa harus melalui protokeler yang membuat masyarakat malah menjadi sulit menyampaikan apa

keluhannya,” tutur keduanya. Ditambahkannya, komitmen dan keinginan yang sama untuk memajukan Kota Psp dengan bersih dan bisa merakyat dengan masyarakatnya serta berani untuk mengambil keputusan untuk membawa perubahan kearah yang lebih baik dimasa mendatang. Ditambahkan Riswan Daulay yang merupakan Mantan Kepala Bappeda Tapsel di era Bupati, Ongku P Hasibuan ini menegaskan, alasan dirinya maju mendampingi Rusydi Nasution adalah ingin membuat perubahan yang lebih baik di Kota Psp. Ditegaskan pria yang ramah dan mudah senyum ini, bahwa saat ini diperlukan sosok pemimpin yang bersih, berani dan merakyat serta mempunyai konsep yang jelas dan

bukan semata-mata hanya ingin mengejar kekuasaan belaka. “Kehadiran kami di pilkada ini bukanlah sebagai penggembira atau hanya meramaikan pilkada ini saja, tetapi untuk memberik bukti bahwa kami bukanlah orang-orang gila jabatan, tetapi murni karena keterpanggilan hati nurani membangun di tanah kelahiran kami ini. Akhirnya kami mengajak seluruh lapisan masyarakat kota Psp untuk bersama-sama menggunakan hati nurani dalam memilih pemimpin di Kota Psp ini. Bukan karena sesuatu yang dijanjikan atau sesuatu yang lain, tetapi ingat dan tatap masa depan anak dan cucu serta generasi muda dimasa mendatang. Jangan hanya memikirkan kepentingan sesaat,” ingat keduanya. (phn)

KPU Dinilai Lalai Tangani Isu SARA Sambungan Halaman 9 Dapur Selera, Jalan Dr.Soepomo, Jakarta Selatan, Selasa (4/9). Menurut Ray, KPU DKI hanya sibuk mengurusi aspek teknis dari pilkada. Sementara suasana yang berkembang di masyarakat diacuhkan begitu saja. Padahal, seharusnya hal ini juga dikawal oleh KPU DKI. Karenanya Ray mempertanyakan usaha KPU DKI dalam meredakan isu SARA. Pasalnya, selama ini tidak ada langkah konkrit yang diambil berkaitan dengan peredaran isu SARA. “Mereka tanggapannya biasa-biasa saja, itu yang saya kritik. Ada nggak pernyataan KPUD yang memprihatinkan soal SARA?

Saya belum pernah dengar. Jadi seolah-olah itu di luar dirinya, yang penting bagi dirinya surat suara sudah ada belum, kartu pemilih sudah dibagikan belum. Suasananya ga penting,” ujar pengamat politik yang biasa tampil berpeci ini. Kritikan tak hanya mengarah ke KPU. Panwaslu DKI Jakarta juga dikritik karena tidak dapat bertindak tegas terhadap penyebar isu SARA. Usaha Panwaslu dengan mencopot spanduk bernada SARA dinilai tidak cukup. “Jangan hanya mengamankan spandukspanduk saja tapi juga harus ngejar isu sara dari siapa?” imbuh Ray. Ia menyadari bahwa Panwaslu tidak mampu membereskan masalah peredaran

isu SARA sendirian. Oleh karenanya, ia berharap Panwaslu aktif meminta bantuan kepada pihak kepolisian untuk melakukan pengusutan. Selain itu Panwaslu DKI diminta aktif mengedukasi warga bahwa tindakan penyebaran isu SARA menciderai demokrasi. Hal ini, menurut Ray, tidak dilakukan oleh Panwaslu DKI saat menyikapi kasus ceramah berbau SARA yang dilakukan Rhoma Irama. “Rhoma memang tidak bersalah secara undang-undang tapi harus diingatkan dan diungkapkan kepada warga DKI bahwa tindakan seperti itu dapat mengancam demokrasi kita. Itu yang tidak dilakukan Panwaslu,” pungkas Ray. (dil/jpnn)

Sambungan Halaman 9 calon pemimpin yang siap membawa perubahan baru di Kota Psp ini ke arah yang lebih baik kedepan,” ujar Dedi dihadapan lebih 130-an ibu-ibu, di acara silaturahmi Dedi-Affan dengan timnya bertempat di aula Hotel Samudra, Minggu (2/9) lalu. Dedi juga berpesan agar ibu-ibu jangan sampai memunculkan perpecahan ditengah-tengah masyarakat, harus meraih simpatik masyarakat dengan santun, dan berdayakan semua potensi untuk memenangkan Dedi-Affan di tanggal 18 Oktober mendatang. “karena tanpa ibu-ibu kami juga tidak bisa berbuat apa-apa. Kita harus kompakkompak untuk meraih cita-cita bersama menuju Psp yang lebih baik kedepan,” terangnya. Semakin dekatnya hari H pemilukada, pasangan birokrat murni ini juga mengajak timnya untuk lebih gencar meraih suara rakyat untuk Dedi-Affan. “Pandai-pandailah mengambil dan mengajak masyarakat untuk memenangkan Dedi-Affan,” pungkasnya. (neo)

Pemilih Jokowi Dinilai jadi Korban Pencitraan Sambungan Halaman 9 berhasil dimasa lalu. Menurutnya, kesuksesan Presiden SBY dua kali memenangkan pemilihan presiden merupakan bukti keampuhan jurus pencitraan. Namun, sambung Agung, pencitraan seperti yang dilakukan Jokowi Ahok dan Presiden SBY tidak akan mampu mengatasi masalah. Justru dengan mengedepankan pencitraan akan menambah masalah baru. Agung menilai pencitraan membuat demokrasi Indonesia tidak dewasa sebab masyarakat akan semakin dijauhkan dari persoalan yang nyata dan harus diatasi. Agung menilai bahwa alasan pihak JokowiAhok menggunakan strategi ini karena menyadari banyak warga Jakarta yang sudah muak bahkan frustasi dengan kondisi Jakarta. Rasa Frustasi yang mengelabui akal sehat inilah yang dimanfaatkan Jokowi-Ahok untuk mempengaruhi warga ibukota. “Bosan, muak, jenuh dan marah terhadap kondisi Jakarta sekarang yang membuat warga tak lagi berpikir jernih. Faktor-faktor itu yang dimanfaatkan pasangan JokowiAhok,” ujarnya. Padahal, menurut Agung, jika berbicara program maka pasangan cagbub incumben jelas lebih baik. Pasangan Fauzi Nachrowi dianggap lebih teruji dan memiliki langkahlangkah konkrit untuk membenahi Jakarta. Bahkan, Jokowi sempat menyatakan akan melanjutkan blue print pembangunan Jakarta yang telah dibangun Fauzi Bowo. “Masyarakat tidak memilih Foke. Ini sematamata karena Jokowi dikesankan pribadi yang polos dan bersih,” pungkas Agung. (dil/ jpnn)


6 September 2012 “Dikhawatirkan bagi partai yang memiliki dana besar akan membuat ketentuan administrasi secara borongan lewat konsultan. Jelas, tertib administrasi tidak bisa jadikan jaminan akan menghasilkan DPR yang berkwalitas,” Ketua Umum Partai Nasional Indonesia Marhaenisme (DPP PNI Marhaenisme) DM Sukmawati Sukarno.

“Merepotkan (verifikasi). Tapi tetap dilaksanakan, walaupun ini sebagai sebuah kesalahan sejarah,”

Ketua Umum Partai Persatuan Pembangunan (PPP) Suryadharma Ali.

Ketua Komisi III, Gede Pasek Suardika.

“Badan Nasional Penanggulan Teroris (BNPT) harus melakukan pencegahan dan deradikalisasi, jangan hanya penindakan terus, itu yang harus dilakukan. Apalagi notabenenya pelaku teroris itu masih muda, ada yang belasan tahun lagi? Ini harus diselamatkan dan dibina,”

Kirim Opini Anda ke email: metrotabagsel Maksimal tulisan 5.000 karakter

Sikap Kami Mengelola Musim HIDUP di dua musim seperti di Indonesia, yakni musim hujan dan panas, mestinya mendatangkan berkah. Kondisi demikian tidak membutuhkan antisipasi dan perlakuan sesulit negeri dengan empat musim atau lebih seperti di Eropa. Sayangnya, berkah dua musim itu kini tak pernah lagi dinikmati. Yang terjadi justru musibah akibat buruknya perencanaan. Ketika musim hujan tiba, banjir muncul di mana-mana. Ketika kemarau datang, kekeringan tidak bisa lagi dihindari. Ribuan hektare lahan pertanian kering, bahkan ratusan hektare di antaranya gagal panen. Waduk-waduk yang menjadi urat nadi bagi sawah, listrik, dan air bersih pun kering kerontang. Peristiwa terakhir menunjukkan susutnya air waduk membuat tiga pembangkit listrik tenaga air (PLTA) tidak beroperasi. Ketiga pembangkit listrik itu ialah PLTA Wadaslintang, PLTA Sempor, dan PLTA Pajengkolan yang semuanya berada di Kebumen, Jawa Tengah. Volume Waduk Wadaslintang, misalnya, kini tinggal 261,46 juta meter kubik. Padahal, isi maksimalnya mencapai 413,46 juta meter kubik. Kekeringan juga terus meluas. Di Kabupaten Magelang dan Temanggung di Jawa Tengah, Pasuruan, Jawa Timur, Karangasem, Bali, dan Kabupaten Kupang, Nusa Tenggara Timur, krisis air bersih sudah terjadi. Di Pasuruan, sedikitnya 20 desa di delapan kecamatan bahkan mengalami krisis air bersih. Ketersediaan air bersih di desa-desa tersebuttidakmampumemenuhikebutuhanminimal10literperhari per orang. Kenyataan tersebut menunjukkan masih buruknya antisipasi dan perencanaan pemerintah. Antisipasi bencana masih dilakukan dengan kebijakan reaktif, yakni membagi-bagi bantuan uang setelah musibah datang. Begitu bencana kekeringan pergi, semuanya kembali seperti sedia kala seolah tidak pernah terjadi apa-apa. Kebijakan yang bersifat preventif dan proaktif nyaris tidak banyak dilakukan. Akibat kebijakan dadakan itu, menurut hitung-hitungan Institut Hijau Indonesia, terjadi potensi kerugian lebih dari Rp100 triliun. Padahal,jikayangdikedepankanialahkebijakanantisipatif,danayang dibutuhkan kurang dari Rp50 triliun. Bila penghentian penebangan hutan dan penyetopan konversi lahan pertanian menjadi permukiman dilakukan secara konsisten, bencana bisa dihindari. Kerugian finansial lebih besar pun bisa diminimalkan. Kenyataannya, potensi kerugian malah kian bertambah karena dana yang digelontorkan untuk mengatasi kekeringan diserahkan kepada pemerintah daerah dengan pengawasan minimal. Tidak banyak yang tahu apakah bantuan itu sampai ke masyarakat atau tidak. Jika manajemen musim masih bertumpu pada pola-pola darurat seperti saat ini, dampak yang lebih buruk akan menjadi kenyataan. Kalau sekarang kita baru menghadapi krisis listrik dan air bersih akibat kekeringan, bukan tidak mungkin krisis pangan benar-benar menjadi kenyataan.Pada titik itu bangsa yang pernah gemilang di bidang agraris ini tinggal meratapi tragedi berkesinambungan. (**)

Revitalisasi Bulog dan Kebutuhan Masyarakat Kekayaan alam di negeri ini yang tak terhingga menjadikan negeri ini berbeda dari negara lainnya. Namun, dibalik kekayaan alam yang berlimpah ini, alangkah disayangkan jika pihak-pihak yang seharusnya mampu mengatasi permasalahan kebutuhan penduduknya, justru melahirkan sebuah permasalahan baru.

Oleh : Budi Prasetyo TAK sepatutnya luas wilayah daratan sekitar 1.922.570 km², masih kesulitan masalah pangan. Beberapa waktu lalu, kita dihibur dengan melambung tingginya harga kedelai dipasaran. Kenyataan ini, benar-benar di luar kewajaran dan telah mencapai angka klimaks. Bahkan, melebihi harga tertinggi tahun 1998. Tahun 1998, harga kedelai mencapai Rp7.050 per kg dan sekarang hampir menembus angka Rp8.000 per kg. Bukan itu saja, sejarah mencatat bahwa Indonesia yang dulu terkenal dengan negara agraris, sekarang ternyata sangat bergantung kepada pangan impor. Untuk memenuhi kebutuhan dalam negeri, sebanyak 60% pasokan pangan di Indonesia diimpor dari luar negeri. Tercatat beras selama 2 tahun terakhir yang diimpor hampir 2 juta ton, jagung 1,2 juta ton, kedelai hampir 30% dari kebutuhan, gula 30%, 50% garam konsumsi impor, susu 70%, dan gandum 100%. Akibatnya, angka inflasi mengalami naik selama April 2012 akibat harga pangan yang tinggi, ternyata di sisi lain adanya gejolak pangan di tingkat internasional saat ini. Badan Pusat Statistik (BPS) mengumum-

kan bahwa inflasi April 2012 naik dibandingkan bulan sebelumnya sebesar 0,21 %, sedangkan inflasi secara year on year tercatat sebesar 4,5%. Padahal, target inflasi dalam APBN-P 2012 adalah 6,8%. Tingkat inflasi tersebut didorong oleh kenaikan harga beberapa komoditas pangan sejak awal bulan. Di antaranya harga komoditas yang mengalami kenaikan tersebut adalah bawang putih, cabai rawit, gula pasir, bawang merah, dan minyak sawit. Untuk itu revitalisasi Bulog perlu dilakukan, tujuannya untuk memenuhi ketercukupan pangan. Menkoperekonomian Hatta Rajasa mengeluarkan statment berkaitan revitalisasi Bulog. Dirinya setuju adanya revitalisasi dalam tubuh Bulog alasannya sangat penting untuk stabilisasi harga agar masyarakat tidak terbebani dengan kenaikan harga akibat kelangkaan bahan kebutuhan pangan pokok. Sejak wewenangnya dipangkas pemerintah atas tekanan IMF (Dana Moneter Internasional), 1998, Bulog hanya menangani beras. Komoditas pangan lainnya diserahkan sepenuhnya kepada mekanisme pasar. Alhasil, kebijakan ini merugikan masyarakat konsumen dan para

petani sebagai produsen. Harga bahan kebutuhan pokok berfluktuasi tajam. Sudah sepatutnya, Badan Urusan logistik (Bulog) ditingkatkan perannya yang bertujuan untuk menjaga ketahanan pangan agar berjalan efektif. Jika Perum Bulog diberi peran tidak hanya menjalankan stabilisasi harga beras, namun juga menjaga stabilisasi harga sejumlah bahan pokok. Harga kebutuhan pokok sudah selayaknya dikontrol pemerintah, karena kebutuhan pokok ini merupakan kebutuhan strategis yang harus dilindungi sesuai amanat Undang-Undang Dasar 1945. Tujuan turut campurnya pemerintah dalam penentuan harga untuk mencegah terjadinya kelangkaan dan kelonjakan harga bahan pokok serta terjadinya monopoli pasar. Apalagi, kebutuhan pokok merupakan kebutuhan yang tak dapat dipisahkan dalam kehidupan siapapun di dunia ini. Jangankan manusia, hewan pun tidak akan bisa bertahan hidup, jika tidak ditopang kebutuhan pokok. kebutuhan pokok sering kali berada di tengah ancaman. Iklim menjadi ancaman terbesar atas ketersediaan kebutuhan pokok. Ancaman kelangkaan pangan yang kini melanda dunia, termasuk Indonesia menjadi pekerjaan tersendiri bagi pemerintah untuk melindungi kebutuhan dalam negeri. Meski secara geografis memiliki kekayaan alam yang melimpah, namun ancaman krisis pangan ini tetap dialami Indonesia sebagai dampak dari mata rantai kehidupan dunia.

Apalagi kebutuhan akan konsumsi beras masyarakat Indonesia cukup tinggi dan merupakan yang terbesar di dunia dengan volume sebanyak 130 Kilogram (Kg) sampai 140 Kg per orang per tahun. Konsumsi itu mencapai dua kali dari masyarakat di kawasan Asia Tenggara yang hanya 65 kg sampai 70 kg. Untuk memenuhi kebutuhan tersebut, pemerintah melakukaan berbagai langkah strategis, diantaranya mengantisipasi kekurangan pangan melalui produksi optimal pengadaan beras. Tujuannya hanya satu, yaitu kebutuhan nasional tetap terjaga.Terkesan Bulog selama ini tidak diberi peran untuk menstabilitaskan harga komoditas selain beras. Padahal infrastruktur gudang, jaringan, maupun fasilitas lain dapat dimanfaatkan Bulog untuk mengatasi permasalahan pangan didalam negeri. Untuk itu bulog perlu di revitalisasikan. Penulis sependapat dengan apa yang disampaikan Hatta rajasa, dengan adanya revitalisasi ini. Bulog harus tetap mengacu kepada regulasi dan mengacu kepada stabilisasi supaya tidak menimbulkan distorsi terhadap mekanisme pasar. Kemampuan untuk tetap menjaga komoditas dan menstabilisasikan harga pada akhirnya menjadi tantangan tersendiri bagi bulog. Sebelumnya, Presiden Susilo Bambang Yudhoyono menginstruksikan agar Bulog direvitalisasi kembali fungsinya sebagai stabilisasi harga komoditas pangan yang

dibutuhkan masyarakat, tidak hanya untuk beras. Menurutnya revitalisasi Bulog dibutuhkan mengingat tantangan stabilitas berbagai harga pangan yang terus meningkat, sementara kebutuhan pangan masyarakat yang juga terus naik. Untuk itu, Yudhoyono meminta segera dibentuk tim guna mengembalikan peran Bulog tersebut dan mengkaji komoditas-komoditas pangan yang akan menjadi tanggung jawab Bulog. Penulis berkeyakinan dengan adanya revitalisasi ini Bulog mampu memainkan perannya dalam memenuhi kebutuhan pokok masyarakat. Setidaknya revitalisasi ini, masyarakat tidak terbebani dengan adanya kenaikan harga, akibat kelangkaan bahan pokok. Selain memainkan perannya, fungsi Bulog diperkuat untuk melindungi konsumen dan produsen sekaligus. Setidaknya keuntungan yang didapat dari revitalisasi ini, konsumen dilindungi dari lonjakan harga kebutuhan pokok. Sedangkan produsen dilindungi dari penurunan harga panen. Pada saat panen pun harga bahan kebutuhan pokok melonjak dan keuntungan dari lonjakan harga itu tidak dinikmati petani, melainkan segelintir pedagang atau lebih banyak di nikmati tenkulak. (**) Penulis Merupakan Ketua Karang Taruna Rw 09 Kebon Jeruk Jakarta Barat dan Leader Samudera Down Hill Mountaine Bike Community


6 September 2012


Raffi Ahmad

Tak Kapok Naik Moge

Artis serba bisa Raffi Ahmad ikut prihatin atas musibah yang menimpah beberapa temannya dalam menggendarai Motor gede, Raffi mengatakan bahwa kecelakaan bisa menimpa siapa aja, bahkan kepada pejalan kaki sekalipun, yang penting harus berhatihati saja. ”Saya turut prihatin dengan kejadian yang menimpa beberapa teman saya, salah satunya Rezky, buat saya yang paling penting sih dalam mengendarai Motor khususnya Motor Gede kita harus hati-hati dan harus saling menghormati sesama pengendara motor,” ungkap Raffi saat ditemui di Studio RCTI, Kebon Jeruk, Jakarta Barat, Rabu (5/8). Bagi Raffi hobby dirinya naik motor akan terus ditekuni, dirinya tidak terpengaruh dengan kejadian-kejadian yang menimpa beberapa teman-temannya. Bahkan dalam jangka waktu dekat ini dirinya bersama teman-temannya akan melakukan Touring Makassar-Toraja. ”Enggak lah enggak kapok, dan dalam waktu dekat ini saya juga mau Touring ke Makassar neh dan saya sih naik motor gede selalu mematuhi peraturan dan menggenakan safety raiders. (abu/jpnn)

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober) Di hari ini hampir tidak ada gangguan yang berarti yang akan membikin kacau. Karena suasana dan situasi cukup mendukung bisnis Anda, maka jangan ragu untuk melakukan manuver-manuver yang berbahaya sekalipun.


(21 Desember -19 Januari)

Tak perlu ragu untuk mencoba memulai hal baru, walaupun semua itu memang berat untuk di awalnya, akan tetapi yang terpenting jalani dulu semua itu. Resiko dan hambatan di kemudian hari sebaiknya dipikir sambil jalan.


(20 Januari - 18 Februari)

cha Septriasa adalah salah satu aktris yang selalu tampil total di film. Hal ini kembali Acha buktikan saat beradu akting dengan Reza Rahardian di film “Test Pack” produksi Starvision. Mungkin penikmat film Indonesia masih ingat dengan fill “Love Is Cinta” yang dibintangi Acha bersama Irwansyah. Saat itu keduanya tampil cukup romantis. Di masa itu Acha dan Irwansyah adalah sepasang kekasih, sementara di film ini Acha dan Reza bukanlah pasangan kekasih di dunia nyata. ”Sebagai pemain itulah tantangannya. Kalau pasangannya beda itu tantangan, karena harus bikin chemistry yang beda lagi,” kata Acha di Planet Hollywood Jakarta Selatan. Film “Test Pack” menceritakan perjalanan pasangan suami istri Rahmat (Reza Rahardian) dan Tata (Acha Setriasa). Konflik kemudian muncul karena

pasangan ini tak dikaruaniahi anak meski telah tujuh tahun menikah. Test Pack juga menyajikan adegan kemesraan antara Reza dan Acha yang berjuang untuk memperoleh anak. Acha mengungkapkan dirinya tak merasa

AKTRIS yang juga model cantik Renata Kusmanto terus dikait-kaitkan punya hubungan khusus dengan Fachri Albar. Tapi pemeran Shinta dalam film “Test Pack” juga terus membantah hubungannya dengan Fachri Albar. ”Enggak tahu deh, temenan sih. Tergantung orangnya aja melihatnya mau seperti bagaimana,” kata Renata di Planet Hollywood Jakarta Selatan. Renata juga terkesan berhati-hati jika ditanya tentang Fachri Albar. “Enggak tahu deh saya, seperti dia apa adanya. Saya melihat dia sebagai seorang pria,” ujar Renata. Renata saat ini tidak menargetkan diri kapan akan menikah. Namun

canggung beradegan mesra dengan Reza. ”Saya langsung dapat gimana nyender sama dia, gimana pegang tangan dia, dia cium saya. Karena ceritanya hubungan suami istri,” ungkap Acha. Saat pertama kali menerima tawaran film ini, Acha tidak tahu akan bermain dengan Reza Rahardian. Selain Reza aktor lain seperti Winky Wiryawan dan Christian Sugiono sempat ditawarkan ”Akhirnya terpilih Reza Rahadian. Umur saya enggak jauh beda dan belum pernah punya istri, jadi saya lebih bebas berekspresi saya,” terangnya. (abu/ jpnn)

Renata juga tidak mau menutup diri, jika saja dirinya menemukan pria yang cocok untuknya.”Saya mau fokus dikerjaan aja. Waktunya sih enggak ada, kalau memang ketemunya pas banget ya sudah enggak dibatasi, yang penting pas aja dan cocok,” kata Renata. Aktris yang akan merayakan ulang tahun ke30 pada 7 November mendatang ini mengaku orang tuanya tidak terlalu mendesak untuk menikah. “Dia cuma nyanya aja bagaimana, tapi terserah sama aku, yang penting cocok,” jelasnya. (abu/jpnn)

PENYANYI Alexa Key termasuk artis yang peduli pada pendidikan. Ia pun mengaku lebih mengutamakan sekolah ketimbang kariernya. Alexa Key memang tak memungkiri banyak tawaran manggung datang. Namun, kembali lagi ke jadwal, ia akan mempertimbangkan tawaran itu ketika tak sibuk sekolah. ”Pendidikan nomor satu, Papa juga bilang sekolah nggak boleh ditinggalkan,” ungkapnya saat ditemui di acara HUT TVRI ke-50 di Jalan Gerbang Pemuda, Senayan, Jakarta Selatan, Rabu (5/9). Sebelumnya, Alexa menimba ilmu di Bali. Tapi, tampaknya sekolah di sana tak efisien dalam segi waktu. Ia pun memilih tinggal di Jakarta. ”Waktu di Bali diprotect orangtua, sekarang dikasih kepercayaan, tapi kontek setiap hari. Jaga diri, jangan lupa sekolah, mereka orangtua yang ketat dan protektif, tapi aku sudah dewasa dan dikasih kebebasan. Aku di Jakarta sama asisten,” tuturnya. (dtc/int)

Teruslah berupaya meraih hasil yang terbaik. Tidak perlu menyerah dengan keadaan karena ibarat orang berjalan pasti tidak akan selalu mulus jalannya, maka dari itu tetaplah optimis dan yakin.


19 Februari - 20 Maret

Waspadalah, omongan yang berhembus itu anggaplah angin lalu. Tak perlu ditanggapi toh nantinya akan hilang dengan sendirinya ditiup angin. Cobalah lebih konsentrasi pada apa yang sedang Anda hadapi. Tak perlu memikirkan yang bukan-bukan.


(21 Maret - 20 April)

Entah karena apa, belakangan ini Nikita Mirzani jadi sering membicarakan dan menyebut-nyebut nama Aming. Setelah mengklaim pacaran dengan komedian itu, kini ia membuat pengakuan baru lagi. Kali ini, artis yang kerap tampil seksi itu seolah menyangkal pernyataannya sendiri sebelumnya. Kini ia mengaku hanya berteman, dan menginginkan pendamping seperti Aming. ”Sebenernya gini, Nikita itu temen deketnya dia (Aming). Kalau orang kan salah menginterpretasikannya,” tuturnya saat berbincang melalui ponselnya, Rabu (5/9). ”Kalau aku suka dia itu, pengen yang jadi pendampingku nanti seperti dia, kepribadiannya, sifatnya dan semuanya,” tambahnya. Nikita mengaku bingung kenapa gosip hubungannya dengan Aming menjadi ramai diberitakan. Menurutnya, pacar Aming yang sebenarnya sempat terganggu dengan kabar tersebut.

Peluang yang tinggi sebaiknya bisa diimbangi juga dengan kerja keras jangan sampai loyo ataupun tidak ada peningkatan dalam prestasi kerjanya. Di hari ini peruntungan cukup mujur sehingga selalu ada saja jalan setiap menemui suatu permasalahan.


(21 April - 20 Mei)

Tak ada gunanya mengobral janji kalau akhirnya hanya akan membuat beban Anda saja di kemudian hari. Bicaralah terus terang dan tak perlu menutup-tutupi kesulitan yang lagi Anda hadapi saat ini.


(21 Mei - 20 Juni)

Peruntungan cukup mujur sehingga sangat baik untuk digunakan menyelesaikan masalah yang terkatungkatung itu. Hanya saja jangan mudah percaya dengan orang lain sebelum Anda melihat sendiri buktinya.


(21 Juni- 20 Juli)

Optimis memang perlu tetapi untuk saat ini sebaiknya jangan terlalu berambisi karena situasi di sekitar Anda sulit untuk Anda prediksi. Lebih baik Anda melangkah dengan sabar tetapi sangat terencana agar kesuksesan tetap dapat Anda raih.


(21 Juli-21 Agustus)

Apapun resiko yang akan muncul sebaiknya keyakinan tetap tidak boleh bergeser, untuk itu hindari membicarakan persoalan pada orang lain agar pikiran dan visi Anda tidak sampai terganggu.

Gisel Libra

(23 Agustus-22 September)

.Tetaplah melangkah maju karena sudah kepalang tanggung untuk melangkah mundur. Lebih baik yang ada dijalani dengan kesungguhan dan kemantapan hati.


(23 Oktober - 22 November)

Jangan biarkan kecerobohan mengganggu kinerja dan kelangsungan bisnis Anda, apalagi kompetitor tampak selalu memperhatikan setiap gerak-gerik Anda.


( 23 November - 20 Desember)

Jangan hanya diam saja melihat sikap orang lain meremehkan kemampuan diri Anda. Segera lakukan gebrakan karena bagaimanapun juga mereka ternyata tidak bisa dihadapi dengan halus.

Sejak berita kecelakaan pesinetron, Rezky Aditya tersebar luas di media, Gissel ‘Idol mengaku jadi takut. Sinden Opera Van Java ini pun merasa ngeri boncengan motor bersama kekasihnya, Gading Marten. Gissel takut karena membayangkan ia bersama Gading akan mengalami kecelakaan seperti yang dialami oleh Rezky Aditya. “Baru mau mulai seru-seruan, baru beli jaket, kok malah kayak gini. Keder sih, makanya aku selalu ngomong ke Gading, aku kan selalu bilang, pokoknya pake helm

pake jaketnya yang lengkap. Meski pun ngebut, ngebutnya hati-hati,” kata Gissel di RCTI, Kawasan Kebon Jeruk, Jakarta Barat, Rabu (5/9). Menurut Gissel sebenernya ia agak khawatir juga dengan kekasihnya, meskipun Gading sudah bisa naik motor. Namun mengendarai motor gede (moge) itu baru bagi Gading. “Makanya aku khawatir banget, cerewet banget. Bukannya nggak suka dia naik motor, tapi khawatir,” ujarnya. Gissel sadar jika naik motor gede pasti

larinya kenceng, nggak mungkin pelan. Makanya ia bilang ke Gading agar selalu pakai pelindung motor yang banyak. “Mobilkan banyak pengamannya. Kalau motor langsung badan, langsung kepala,” ujarnya. Karena ketakutannya ini pula Gissel harus memupus angannya bisa naik moge seperti motor polisi. “ “Tapi kok kayak gininya. Jadi biarlah itu jd angan-angan belaka. Sekarang jadi parno, ntar-ntar ajalah,” tandasnya. (tr/int)

Pengen yang jadi pendampingku nanti seperti dia, kepribadiannya ”Aming nggak marah sih, ketawa aja. Dia orangnya asik, tapi pacarnya ngambek,” paparnya. (dc/int)


6 September 2012


Ribuan Bangkai Tikus Penuhi Mississippi

TUPELO - Puluhan ribu tikus mati akibat terjangan badai isaac melanda Amerika Serikat (AS). Saat ini, bangkaibangkai tikus itu tersapu oleh badai dan memenuhi pantai Mississippi. Badai Isaac menciptakan wabah banjir di Louisiana, pada saat yang sama, tikustikus pun terbawa arus air yang mengalir hingga Mississippi. Bangkai dari puluhan ribu tikus dapat disaksikan di garis pantai Mississippi. Pada Selasa kemarin, para petugas kontraktor menemukan 16 ribu bangkai tikus di Hancock County. Mereka pun terpaksa mengangkut bangkai-bangkai itu dengan menggunakan sekop dan garpu tanah. ”Kami akan menggelar acara yang bernama “Pesiar Pantai” pada Oktober

Kami harus segera membersikan pantai ini,” ujar salah seorang pejabat di

mendatang, dipastikan 30 ribu hingga 40 ribu orang akan datang ke pantai ini.

Hancock County, Rabu (5/9). Bau busuk pun tercium di sekitar pantai Mississippi, meski bangkai-bangkai itu tidak akan menyebabkan gangguan kesehatan, bangkai itu terlihat menjijikkan. Pantai di Mississippi terlihat amat kotor untuk saat ini. Mississippi juga sempat bergelut dengan masalah bangkai tikus di saat Badai Katrina dan Gustav menyerang wilayah tersebut. Pantai itupun ditutup untuk publik karena pengunjungpengunjung tidak akan kuat dengan bau bangkai itu. Selain bangkai tikus, para pekerja kontraktor juga menemukan bangkai hewan-hewan lain. Hewan itu adalah babi, rusa, rubah, ular dan kelinci. (oz/ nik)

COLOMBO - Seorang pria di Sri Lanka ditangkap polisi saat menelan berlian yang bernilai lebih dari USD13 ribu atau sekira Rp124,2 juta (Rp9.560 per USD). Aksinya dilakukan saat menghadiri sebuah pameran perhiasan di Colombo. ”Chou Wan menelan batu berharga saat memeriksa berlian di sebuah gerai, tepat di pembukaan pameran perhiasan di Colombo,” ujar juru bicara Polisi Ajith Rohana, Rabu (5/9).

Rohana mengatakan, pemilik berlian itu langsung melaporkan kejadian tersebut ke pihak polisi. Mereka khawatir Chou akan kabur dengan membawa berlian berharga di perutnya.

”Chou adalah warga negara China, dirinya saat ini masih ditahan untuk menjalani penyelidikan,” jelasnya. Sri Lanka selama ini dikenal sebagai penghasil batu berharga di dunia. Pameran perhiasan dan batu berharga kerap kali diadakan di negara tersebut dan mengundang banyak pengrajin dari batu berharga tersebut. (oz/ nik).


Toko Pakaian di India Diprotes

Desa dengan Seluruh Wanitanya

BERAMBUT PANJANG Setiap daerah pasti memiliki tradisi tersendiri, salahsatunya di Desa Huanglo yang mewajibkanya seluruh wanitanya memiliki rambut panjang di dunia mencapai 2 meter. Alasanya rambut merupakan mahkota namun bagi suku Yao di Desa Huanglo Pengamat budaya mengatakan rambut adalah simbol paling berharga dan menggambarkan kehormatan dan kesejahteraan. “Makanya tidak heran jika Anda menemukan seluruh wanita di suku ini memiliki rambut yang super panjang,” katanya. Desa Huangluo terletak di wilayah Longji Guilin. Setidaknya ada 82 kepala keluarga yang tinggal di desa tersebut. Kebanyakan dari mereka masih memegang nilai tradisi leluhur dan hidup penuh dengan kesederhanaan. Hampir sama dengan pemandangan alam, lingkungan yang asri serta kebudayaan yang terbilang kuno menjadi atraksi tersendiri bagi para wisatawan yang datang baik dari luar daerah ataupun mancanegara. Paling mengundang minat mereka adalah tradisi kaum wanitanya yang terobsesi memanjangkan rambut hingga menyentuh tanah. Reputasi itu membuat desa ini dijuluki ‘desa rambut panjang’. Bahkan mereka mendapat pengakuan resmi dari museum rekor dunia Guiness World Record sebagai ‘Desa Dengan Rambut Terpanjang’. Sebagai catatan, rata-rata panjang rambut para wanita yang ada di sana adalah 1,7 meter. Sementara yang terpanjang bisa mencapai 2.1 meter. Dahulu, atau lebih tepatnya sebelum tahun 1987, tradisi di Huangluo tidak memperbolehkan orang lain melihat rambut mereka tergerai selain suami dan anak-anak. Dengan kata lain, setiap warga perempuan diwajibkan menggulung rambut dan memakai penutup kepala. Dan jika ada orang lain yang secara tidak sengaja melihat rambut mereka, maka orang itu harus diangkat menjadi menantu dan tinggal selama tiga tahun. Namun peraturan ini dihapus dan akhirnya mereka pun bebas memperlihatkan rambut mereka kapan saja. Bagai mana menurut kalian unik bukan Desa Huanglo ini yang seluruh wanitanya berambut panjang. (int/nik)

NEW DELHI— Untuk apalah arti sebuah nama. Istilah ini yang dialamatkan Toko Pakaian Hitler di Ahmadabat Negara Bagian Gujarat, India setelah mendapat protes dari warga. Pasalnya, nama itu dianggap diktator Jerman Adolf Hitler dan penuh masalah. Nama Hitler dipampang besar-besar di depan Toko milik Rajesh Shah itu dan tak lupa titik di atas huruf “I” dilengkapi lambang swastika Nazi yang terkenal itu. Pemilik Tokoh Manish Chandani mengatakan, nama Hitler dipilihnya untuk mengenang sang kakek yang membesarkan anak-anaknya dengan disiplin tegas sehingga kerap dijuluki Hitler. Memang nama toko itu menarik perhatian, tetapi sekaligus cercaan yang datang dari komunitas Yahudi yang tinggal di Ahmadabad. Tak hanya masyarakat Yahudi biasa yang mengajukan protes, Konsulat Jenderal Israel di Mumbai bahkan meminta pemerintah negara bagian untuk turun tangan. Manish Chandani, salah seorang pemilik toko ini, mengaku mendapatkan

„ Toko pakaian Hitler di Ahmadabad, Gujarat, India akhirnya berganti nama setelah mendapat banyak protes dan kecaman. banyak telepon dan permintaan untuk segera mengganti nama tokonya itu. ”Saya berencana untuk mengganti nama toko secepat mungkin,” ujar Chandani. ”Kami menerima banyak desakan dari komunitas Yahudi dan pemerintah untuk mengganti nama toko ini,” tambah dia. ”Kami tak menyadari Hitler bertanggung jawab atas kematian enam

juta orang Yahudi di masa Perang Dunia II,” aku Chandani. Kasus terkait Hitler dan lambanglambang Nazi sudah beberapa kali terjadi. Pada 2006 lalu, sebuah restoran di Mumbai bernama Hitler Cross memicu kemarahan warga. Restoran itu kemudian mengganti namanya setelah mendapatkan protes dari Kedutaan Israel, Jerman, dan Liga Antifitnah Amerika Serikat. (kps/nik)

Ternyata, Penguin Suka Gay AFRIKA -Kisah cinta terlarang rupanya bukan hanya milik manusia saja. ‘Panah Cupid’ bisa menyerang siapa dan apa saja termasuk hewan lucu: penguin. Ya, seperti dialami oleh dua penguin Afrika jantan yang berada di kebun binatang Toronto, Canada. Kedua penguin gay ini akhirnya harus dipisahkan agar keduanya bertemu dengan penguin betina sehingga bisa berkembang biak. Kedua penguin itu bernama Buddy dan Pedro. Mereka berasal dari Ohio, Amerika Serikat yang kemudian dibesarkan di kebun binatang Toronto. Seksualitas kedua hewan mungil ini terlihat ketika

mereka sering saling bersentuhan, tidur bersama dan bahkan menunjukkan tanda perilaku binatang yang sedang kawin. Termasuk membuat suara meringkik dan mempertahankan wilayah mereka. ”Mereka melakukan perilaku pacaran dan kawin seperti yang dilakukan hewan betina dan jantan dan mereka berpasangan setiap malam,” kata salah satu penjaga kebun binatang. Para ilmuwan yang berasal dari Universitas of California pun menemukan bahwa burung rupanya bisa mengalami hubungan sesama jenis. Setengah dari kelompok hewan yang dibesarkan bersama-sama bisa

mengalami hubungan ‘unik’ itu. Penelitian berlanjut ketika hewan betina didatangkan ke dalam kelompok tersebut. Lima dari delapan pasangan hewan jantan mengabaikan betina tersebut dan kembali ke pasangan sesama jenis mereka. ”Hubungan pada hewan bisa lebih rumit dari sekedar laki-laki dan perempuan yang bertemu dan bereproduksi. Pengamatan saya membawa saya ke hasil yang mengejutkan bagi hewan, sesama jenis kelamin juga akan berinteraksi seperti pasangan jantan dan betina,” kata seorang penulis Dr Julie Elie. (int/nik)


Untuk Atasi Disfungsi Ereksi Air Susu Ibu (ASI) diakui banyak manfaatnya untuk kesehatan bayi, baik mengatasi masalahnya. Karena bernafaat besar, suami Michelle yakni Jeff di AS meminumnya untuk mengatasi masalah disfungsi ereksi yang di alaminya. Jeff meminta hal itu dirahasiakan karena aktivitas menyusui itu ke dalam rutinitas hubungan seksual keduanya sejak beberapa bulan setelah kelahiran anak pertama mereka.Kini anak pertama mereka yang berkelamin perempuan itu berusia 2 tahun dan telah berhenti menyusu kepada ibunya, namun kini istrinya Michelle (27) juga tengah memproduksi ASI untuk anak laki-laki mereka yang berusia 8 bulan. Jeff pun mengaku meminum susu Michelle ‘langsung dari sumbernya’. Keduanya tak hanya menganggap hal itu sangat erotis namun Jeff juga mengaku kebiasaan ini mampu mengurangi gejala-gejala disfungsi ereksi yang dialaminya secara signifikan. Meski begitu, kedua anak mereka selalu mendapatkan prioritas untuk urusan ASI Michelle, catat Jeff. Keduanya pun diperbolehkan tampil dalam sebuah acara TV di AS yang memaparkan berbagai macam seks unik dan aneh berjudul Strange Sex. Meski begitu awalnya pasangan ini berharap dimasukkan ke dalam salah satu jenis seks aneh yaitu vampirisme. “Vampirisme itu persis seperti apa yang selama ini kita dengar, namun saya tak membutuhkan darah,” kata Jeff seperti dilansir dari huffingtonpost. Bagi Michelle dan Jeff sendiri, vampirisme bukan berarti pengalaman seks yang berdarah-darah. Gigitan yang diberikan Jeff akan membuat Michelle merasa seperti lututnya tergores dengan jumlah darah yang keluar sangat sedikit. Lagipula kata Jeff, vampirisme ini mengurangi gejala-gejala disfungsi ereksi yang dialaminya. Namun pasangan ini memutuskan untuk tidak melakukannya terlalu sering, sebagian karena khawatir dengan risiko luka yang bisa ditimbulkan. Ketika Michelle mulai menyusui anak mereka maka aktivitas vampirisme itu harus berhenti karena payudara Michelle telah menjadi target gigitan Jeff. Kemudian keduanya menemukan gagasan untuk membuat eksperimen dengan menyusui Jeff. Keduanya pun menganggap hal ini sebagai transisi alami. Stasiun TV yang akan menyiarkan acara ini awalnya juga menolak aplikasi Michelle dan Jeff yang menunjukkan vampirisme. Namun ketika pasangan ini mengirimkan aplikasi kembali, kali ini dengan menyebutkan kata menyusui, akhirnya stasiun TV itu pun bersedia menampilkan pengalaman keduanya di acara mereka. Jeff mengaku ingin tampil di acara tersebut agar bisa mendorong para pria yang mungkin menderita disfungsi ereksi untuk mencoba berbagai hal baru dengan pasangannya. Jeff merasa bahwa para pria bisa saja menemukan sesuatu yang bisa membantunya, sama halnya dengan yang terjadi padanya. Jeff menekankan bahwa gejala disfungsi ereksinya belum benarbenar sembuh. Namun menyusu pada Michelle membuat gejala disfungsi ereksinya jauh lebih ringan dan telah terbukti mampu meningkatkan kehidupan seksualnya. Lagipula, bagi Jeff tak masalah jika istrinya berhenti menghasilkan susu. “Kita tinggal kembali ke vampirisme,” pungkasnya. (int/nik)


Empat Jurus Cegah Osteoporosis Dini

Manfaat Baca Buku untuk Kesehatan Pekerjaan padat dan juga semakin canggihnya alatalat gadget, membuat orang-orang mulai jarang melirik membaca buku. Sekarang ini, banyak orang yang lebih senang mengutak-atik gadget mereka, daripada membaca buku. Padahal, membaca buku tak hanya bisa memperluas wawasan

dan pengetahun kita. Membaca buku juga bermanfaat untuk kesehatan. Hal itu diungkapkan para ilmuwan dari Oxford University. Mereka berpendapat membaca buku tidak hanya untuk kecerdasan, namun juga baik secara fisik dan psikologi. Menurut Profesor John Stein, membaca tak hanya mengikuti plot pasif, tapi juga menghadirkan imajinasi. "Kita merasa empati dengan karakter sehingga kita melalui semua pasang surut

dengan mereka," kata Stein seperti dikutip dari GeniusBeauty. Selain itu, jika seseorang membaca buku tentang penciuman, rasa, atau gambar pemandangan, akan membuat bagian otak yang bertanggungjawab untuk persepsi akan mulai bekerja, seolah-olah itu terjadi dalam realitas. Disamping itu, manfaat lainnya adalah, enam menit membaca juga bisa mengurangi tingkat stres sekitar dua pertiga. Tak cuma itu,

membaca mampu membantu mengatasi stres lebih baik dibanding berjalan di alam atau mendengarkan musik. Dan dengan membaca buku juga akan bermanfaat dalam hal disiplin mental, seperti kemudahan perencanaan jangka panjang dan pengelolaan percakapan panjang tentang topik yang sama. Dengan begitu, alangkah pentingnya untuk menanamkan kecintaan membaca buku sejak kecil.(int)

OSTEOPOROSIS merupakan gangguan tulang yang mengarah ke risiko fraktur atau patah. Ditandai dengan berkurangnya kepadatan mineral tulang yang dapat memicu keretakan akibat trauma sepele. Pengeroposan tulang ini biasanya muncul tanpa tanda-tanda mencolok sebelumnya. Osteoporosis bisa terjadi akibat berbagai faktor. Terlepas penuaan, pengeroposan tulang ini juga dapat menyerang akibat faktorfaktor genetik, menopause dini, dan kurangnya asupan kalsium dalam tubuh. Berikut beberapa hal sederhana yang dapat Anda lakukan untuk mencegah osteoporosis dini, seperti dikutip Fit Sugar: • Paparan sinar matahari Di bawah kulit kita ada vitamin D. Saat terpapar cahaya matahari, vitamin itu akan aktif dan berubah menjadi vitamin D3. Bentuk aktif vitamin tersebutlah yang berguna mempertahankan kepadatan dan kekuatan tulang. Tak butuh waktu lama untuk mengaktifkan vitamin D3 dalam tubuh. Cukup 10 menit sebelum

pukul 09.00 pagi dan sesudah pukul 15.00 sore. Kecukupan kalsium dan vitamin D sejak muda menjadi hal penting yang harus diperhatikan jika ingin terhindar dari osteoporosis. • Minum susu Susu adalah salah satu sumber kalsium terbaik yang berperan mencegah tulang keropos. Biasakan rutin mengonsumsi susu atau makanan mengandung kalsium lainnya seperti kacang almond, sarden, salmon, sereal, jus jeruk, dan sayuran hijau. • Olahraga Aktivitas kebugaran ini merupakan salah satu kunci menjaga tulang tetap kuat. Pastikan melakukannya setidaknya 30 menit sehari. Pilih jenis olahraga yang memiliki efek membuat tulang tarikmenarik untuk meningkatkan kepadatan tulang. Yang bisa menjadi pilihan di antaranya yoga, lari, atau latihan kekuatan otot. • Hindari alkohol dan soda Konsumsi alkohol atau soda secara berlebihan juga meningkatkan risiko terkena osteoporosis. Karenanya, batasi segera konsumsinya.(int)

Hamil di Usia Remaja

ApaBahayanya? IDEALNYA, hamil dan memiliki anak dialami oleh wanita yang sudah 'cukup umur' dan telah bersuami. Tapi nyatanya, dunia ini memang tak selalu ideal. Lantaran sesuatu hal yang biasa disebut 'kecelakaan' kadangkala seorang remaja terpaksa menikah dan punya anak. ''Yah bagaimana lagi, daripada menanggung malu,'' begitu biasanya ucapan pasrah para orangtua yang terpaksa menikahkan anaknya di usia dini. Namun persoalan tak selesai hanya sampai di sini. Mengapa begitu? Tak lain karena pernikahan dan kehamilan di usia remaja membawa risiko yang tidak kecil, baik dari sisi medis maupun psikologis. ''Masalah kehamilan remaja apakah sudah nikah atau belum, secara biologis maupun sosial mempunyai dampak yang tidak baik pada si ibu maupun si anak,'' kata Deputi Kesehatan Reproduksi dan Remaja BKKBN Dr Siswanto Agus Wilopo. Mengapa kehamilan remaja cenderung meningkat? Menjawab pertanyaan ini Siswanto menjelaskan bahwa dari aspek sosial budaya, di desa-desa umumnya orangtua yang mempunyai anak perempuan ingin segera menikahkan anaknya. Di samping itu, dengan perkembangan biologis yang semakin baik terutama karena perbaikan gizi dan adanya rangsangan terhadap organ reproduksi yang lebih terbuka, ada kecenderungan anak remaja

haid lebih awal. ''Dalam waktu 20 tahun terakhir ini rata-rata usia menarche (menstruasi yang pertama kali) sudah lebih awal dua tahun, misalnya dulu menarche baru mulai usia 15 tahun, sekarang anak usia 12 tahun sudah mengalami menarche.'' Selain itu, anak remaja sekarang cenderung memiliki masa subur yang relatif lebih panjang. Hal ini, kata Siswanto, terkait dengan masalah birahi, baik pada laki-laki maupun perempuan. ''Akibatnya bagi mereka yang tidak bisa membendung keinginan reproduksinya, terpaksa punya anak walau belum siap.'' Lebih jauh Siswanto menerangkan, kehamilan pada remaja mengundang risiko terhadap si ibu juga anaknya. Ibu yang hamil saat remaja cenderung mengalami anemia (kurang darah) berat. Ini karena sebelum hamil pun, remaja (sekitar 40-50 persen) sudah anemia. Dan asal tahu saja, ibu hamil yang anemia, kesehatannya akan terganggu. ''Misalnya saja napsu makannya atau ngidamnya menjadi lebih berat, kondisi fisiknya juga akan lemah, dan lain-lain.'' Selain

itu, kalau dia melahirkan, kemungkinan terjadi perdarahan lebih besar. Begitu pun anak yang dilahirkan, ada kemungkinan lahir prematur atau memiliki berat lahir rendah. ''Di bidang kedokteran sudah diketahui apabila janin lahir prematur atau berat lahir rendah itu kemungkinan terjadi perdarahan besar,'' kata Siswanto. Dari fenomena secara umum saja, perdarahan post partum (segera setelah bayi lahir) menjadi penyebab kematian ibu secara menyeluruh. Resiko ini (perdarahan) juga ditanggung oleh para remaja. Untuk diketahui, risiko meninggal pada ibu yang hamil muda/ remaja lebih tinggi yaitu 4-6 kali dibandingkan ibu yang berusia 2030 tahun. Belum lagi jika kehamilan itu terjadi di luar nikah di mana seorang remaja cenderung untuk menggugurkannya (aborsi). Padahal aborsi sama sekali bukan solusi yang aman. Data menunjukkan, kontribusi aborsi terhadap kematian ibu mencapai lebih dari 13 persen. Dijelaskan Siswanto, aborsi memiliki banyak efek samping. Jika dilakukan dengan cara kuret dan tidak hati-hati, bisa merusak leher rahim. Dan ini bisa membuat si remaja tadi tidak bisa mempunyai anak karena serviks (leher rahim) membuka terus sehingga ia akan mudah sekali mengalami keguguran. Masalah yang tak kalah berat juga akan muncul jika si remaja putri hamil dalam kondisi rumah tangga yang belum siap. Bukan tak mungkin, dia akan kekurangan gizi. Dan jelas sekali hal ini akan berisiko terhadap janin yang ia kandung. Jika si ibu kurang gizi, hampir bisa dipastikan janin pun tidak akan tumbuh dengan baik.(int)

RahasiaCantikdari BerbagaiBenua SETIAP perempuan di bagian belahan dunia lain pasti memiliki rahasia tersendiri dalam merawat kecantikannya. Nah, seperti perempuan Indonesia dengan lulur, jamu dan rempahrempahnya, perempuan dari belahan dunia lain juga meiliki rahasia kecantikan yang berasal dari alamnya. Kunyit Bumbu yang memberikan warna khas kari, ternyata merupakan antiseptik dengan sifat antiinflamasi yang sangat kuat. Di India, tradisi umum bagi calon pengantin perempuan dan laki-laki untuk luluran dengan pasta kunyit dan chickpea flour sebelum hari pernikahan mereka. Kunyit terkenal kekuatannya dalam membunuh kuman sedangkan chickpea flour membantu mengelupaskan kulit mati sekaligus melembapkan. Pepaya Salep pepaya yang terbuat dari pepaya, umumnya digunakan sebagai obat di Australia. “Mengatasi kulit terbakar, gigitan serangga, gatal-gatal dan kulit pecah-pecah dan bibir kering. Saya selalu memilikinya di rumah. selain itu saya sering mengoleskan pada kutikula agar lembap,” ujar ahli kecantikan dari HuffPost, Carmindy. Argan oil Argan oil telah lama dikenal perempuan Afrika sebagai keajaiban alam, dan sekarang menjadi terkenal di negara Barat juga. Diproduksi secara eksklusif oleh perempuan Berbere di Maroko, minyak ini diekstrak dari pohon Argan. Mempunyai kandungan tinggi vitamin E dan asam lemak lainnya. Ia memiliki sifat anti-aging yang sangat baik. Argan oil merupakan pelembap yang sangat baik dan diyakini mampu mengatasi problem kulit seperti jerawat hingga keriput. “Perempuan Maroko memiliki

rambut yang indah karena mereka rutin menuangkan argan oil di kepalanya,” kata Carmindy Monoi oil Bunga tahitian gardenia dan minyak kelapa yang dikenal dengan Monoi oil digunakan oleh perempuan Tahiti untuk menenangkan dan melindungi rambut serta kulit mereka. “Saya belum pernah melihat perempuan yang memiliki rambut dan kulit yang indah serta harum,” kata Carmindy. Camellia Nut Oil Menurut ahli kecantikan Shalini Vadhera, camellia nut oil atau biji teh digunakan oleh perempuan Jepang sebagai antioksidan, untuk memelihara dan melembapkan kulit, mengobati luka bakar, stretch mark dan memperkuat kuku. Camellia nut oil mengandung vitamin E yang tinggi, antioksidan dan asam oleat. “Dua tetes minyak camellia dicampur dengan satu sendok makan sake dapat membuat kulit lebih halus,” tulis Vadhera dalam buku Passport To Beauty. Alpukat Terkenal akan kandungan lemak dan vitamin E nya yang tinggi, alpukat bukan hanya terasa lezat juga baik bagi kecantikan Anda Anda. Perempuan Amerika Selatan menggunakan buah untuk menyehatkan kulit dan rambut mereka. “Hampir semua bagian dari alpukat dapat digunakan dalam perawatan kecantikan,” kata Jessica Harris dalam buku World Beauty Book. Ambil kulit dan gosok pada wajah Anda. Tekstur sedikit kasar dari bagian dalam kulit alpukat akan membantu pengelupasan kulit mati. Selain itu kulit tersebut kaya dengan minyak alpukat.” Carmindy merekomendasikan masker wajah yang terbuat dari alpukat dan madu. “Madu memiliki sifat antiinflamasi dan alpukat bekerja melembapkan kulit.” (int)


6 September 2012

Pedrosa Cetak Rekor di Aragon


ASURANSI ATLET: Presdir PT BCA Jahja Setiaatmadja di dampingi ketua KOI Rita Subowo dan Ketua Kontingen Olimpiade Indonesia Erick Tohir usai pemberian penghargaan.

Dua atlet angkat besi Eko Yuli Irawan dan Triyanto kembali mendapatkan penghargaan. Peraih medali di Olimpiade 2012 itu diberi jaminan asuransi kesehatan untuk jangka waktu yang sangat lama. Angkat besi adalah satu-satunya cabang yang menyumbangkan medali bagi kontingen Indonesia di Olimpiade lalu. Eko Yuli Irawan meraih medali perunggu,

sementara Triyatno menyabet medali perak. Sebagai wujud kepedulian atas prestasi yang diraih dua atlet angkat besi tersebut, Bank Cen-

tral Asia (BCA) memberikan penghargaan berupa perlindungan asuransi kesehatan. “Pemberian penghargaan ini merupakan bukti nyata kepedulian BCA terhadap peningkatan jaminan kepada atlet di masa depan. Karena kami turut bersyukur dan bangga atas prestasi dan pencapaian mereka,” ujar Presiden Direktur BCA,

Jahja Setiaatmadja, di Planet Hollywood, Jakarta, Rabu (5/9). Perlindungan asuransi tersebut tertanggung hingga usia 75 tahun. Rinciannya adalah perawatan rumah sakit kelas VIP, perlindungan 34 macam penyakit kritis dan perlindungan kecelakaan. Selain itu, pemberian jaminan perlindungan kematian sampai usia 99

Ahsan Mulai dari Awal Lagi

Pemain ganda putra Indonesia Mohammad Ahsan harus memulai perjuangan dari titik awal untuk kembali ke elite dunia setelah memutuskan berpisah dengan pasangannya Bona Septano. Keduanya sepakat berpisah setelah sama-sama mengevaluasi diri dari pencapaian prestasi. Keduanya memang masuk dalam elite dunia dalam peringkat 10 besar dunia. Namun, keduanya kerap kesulitan meraih gelar ketika berhadapan dengan empat ganda kuat dunia dari China, duo Korea Selatan, dan Denmark. Hasil mengecewakan pada Olimpiade London 2012 juga menjadi pertimbangan terakhir mereka untuk berpisah. “Kami pikir kita sudah waktunya berpisah. Permainan kita berdua sudah mentok dan kami butuh suasana baru,” kata Ahsan dalam jumpa pers

„ M Ahsan di pelatnas Cipayung Jakarta, Rabu (5/9). Selanjutnya Ahsan akan berpasangan

dengan Hendra Setiawan yang merupakan juara Olimpiade Beijing. Hendra sendiri sebelumnya juga menyatakan berpisah dengan Markis Kido setelah dipanggil kembali ke pelatnas Cipayung. Seusai menyalami Bona yang disaksikan pelatihnya Herry IP yang didampingi kepala pelatih ganda Christian Hadinata, Ahsan mengungkapkan dirinya akan berupaya keras untuk kembali ke jajaran elite dunia. “Kami akan memulai lagi setahap demi setahap. Mudah-mudahan prestasi kami lebih bagus,” kata Ahsan. (int)

tahun. Jahja menambahkan, dengan diberikan asuransi kesehatan itu diharapkan dapat memberikan rasa aman bagi Eko dan Triyanto saat berlaga maupun saat pensiun. “Dengan adanya penghargaan ini, diharapkan menjadi acuan dan motivasi para atlet agar terus bekarya,” tukasnya. (int)

„ Kate Middleton

buat balapan selanjutnya dan mari kita lihat apa yang bisa kita dapattkan dari motor ini,” tandas The Little Spaniard (julukan Pedrosa). Lorenzo sendiri harus puas menempati peringkat kedua, sedangkan Ben Spies menempati peringkat ketiga dengan selisih waktu +0.664 detik dari Pedrosa. Kemudian disusul Stefan Bradl (+1.587 detik) dan Jonathan Rea (+2.696 detik), yang akan sementara mengggantikan posisi Stoner Tes MotoGP Aragon selanjutnya akan berlangsung pada Rabu waktu setempat. Sementara itu, Ducati mengadakan tes pribadi di Sirkuit Mugello, pekan ini. (int)

mampu menang set pertama 6-1. Di set kedua, Trosur mampu membalas dengan memetik kemenangan 6-4. Duel sengit kembali terjadi di set ketiga. Kedua petenis tampil ngotot dan pertandingan berjalan alot. Tapi Stosur tampaknya harus mengakui keunggulan lawannya itu. Azarenka berhasil menutup set ketiga dengan 7-6(5). Kemenangan ini membuat petenis Belarusia itu berhak melaju ke babak semifinal. Di babak ini, Azarenka akan menghadapi antara Maria Sharapova atau marion Bartolli. Sharapova diketahui menjadi unggulan ketiga di turnamen ini. Sedangkan Bartolli merupakan unggulan kesebelas. (int)

Alonso: Grosjean Minta Maaf lewat Telepon

Pembalap Ferrari, Fernando Alonso, tak menaruh dendam terhadap pebalap Lotus, Romain Grosjean, yang menggagalkan usahanya untuk merebut poin di GP Belgia, akhir pekan lalu. Pebalap asalSpanyolinimengatakandirinya sudah memaafkan pebalap Perancis tersebut, yang telah mengakui kesalahannya meskipun melalui telepon. “Ya,kamisudahmengadakan kontak, karena kami memiliki hubungan yang baik,sertakamimerupakan teman kelas pada 2009. Saya mengirimkan SMS untuk menjelaskan bahwa dia tidak memperhitungkan jarak, dan dia sudah meminta maaf atas insiden itu. Saya mengatakan kepadanya bahwa tak ada masalah lagi,” jelas Alonso, seperti dikutip T o p sportracing, Rabu (5/ 9).

Tolak Bersalaman dengan Kate Middleton berjabat tangan dengan perempuan yang tidak memiliki hubungan keluarga atau muhrimnya,” ujar perwakilan Kerajaan Inggris, seperti dilansir Daily Mail. Delegasi Iran mengatakan, tindakan Kahram sama sekali tak punya sentimen politik, dan semata-mata hanya untuk menjalankan ajaran agama Islam. “Jika atlet putri yang mendapat medali, pasti akan berjabatan tangan dengan sang putri.” Tahun lalu, tim voli putra Iran dikecam di negaranya setelah berjabatan tangan dengan wasit perempuan usai pertandingan melawan Afghanistan. Sejumlah media m e n y e b u t tindakan tersebut s a n g a t memalukan, dan tak pantas dilakukan. (int)

„ Dani Pedrosa

Azarenka Tekuk Juara Bertahan

PETENIS unggulan pertama, Victoria Azarenka sukses menghentikan langkah juara bertahan, Samantha Stosur di babak perempat final Grand Slam AS Terbuka, Selasa, 4 September 2012 (Rabu dinihari WIB). Azarenka memenangi laga lewat duel tiga set 6-1, 4-6, 7-6 (5). Kemenangan ini tidak diperoleh dengan mudah oleh petenis 23 tahun itu. Stosur yang berstatus juara bertahan memberikan perlawanan sengit. Dalam laga yang digelar di Arthur Ashe Stadium ini, Azarenka

Mehrdad Karam Zadeh

ATLET paralimpiade asal Iran, Mehrdad Karam Zadeh, menjadi perbincangan di Eropa setelah menolak menjabat tangan istri Pangeran William, Kate Middleton, yang merupakan keluarga kerajaan, di ajang Paralimpiade 2012 di London. Atlet tolak peluru ini menolak bersalaman tangan dengan Duchess of Cambridge setelah penyerahan medali perak. Middleton sebelumnya mendapat sambutan hangat dari peraih medali emas, Alec Davies dari Inggris Raya dan peraih perunggu, Lezheng Wang dari Cina.Namun saat Middleton mengalungkan medali perak kepada Karam, atlet berusia 40 tahun itu tidak menjulurkan tangan seperti dua atlet sebelumnya. Ia hanya meletakkan kedua tangannya di depan dada seperti salam yang biasa dilakukan orang Thailand. Bagi orang-orang Eropa kejadian tersebut dianggap sangat menghebohkan, bahkan dikait-kaitkan dengan sentimen politik. Padahal pastinya, Karam tak berjabatan tangan dengan sang putri lantaran hal itu bertentangan dengan ajaran Islam. Dengan kata lain sang putri bukan muhrimnya. Juru bicara Istana St James, yang merupakan tempat sang putri bermarkas, sebelumnya mengatakan pihaknya telah memberi tahu Kate agar tak menjabat tangan atlet Iran tersebut. “Atlet pria dari negara Islam tidak

Dani Pedrosa terus melanjutkan performa gemilangnya. Pedrosa menjadi pembalap tercepat mengalahkan rivalnya Jorge Lorenzo dalam sesi tes di Aragon, Selasa (4/9) kemarin waktu setempat. Lorenzo yang mencatat kemenangan dalam balapan terakhir di Brno, tidak mampu membendung keperkasaan Pedrosa. Pembalap Repsol Honda itu unggul 0.488 detik dari rivalnya tersebut. Pedrosa yang fokus di suspensi dan elektronik, mampu melahap sekitar 35 lap dengan mencatatkan waktu terbaik 1m 47.983 detik. Catatan yang diraih pembalap asal Spanyol itu, melampaui rekor yang pernah dibuat oleh Casey Stoner di Aragon. “Kami fokus untuk mengerjakan suspensi untuk meningkatkan performa grip bagian depan khususnya. Kami hanya berusaha untuk membuat motor lebih lembut lagi,” ungkap Pedrosa, dikutip dari Crash, Rabu (5/9). Saat itu, ia berhasil mencatat rekor 1m 49.046 detik saat perlombaan dan 1m 48.451 detik, ketika meraih pole position pada sesi kualifikasi. Keduanya diraih saat masih menggeber mesin 800cc. “Ini tes resmi terakhir, jadi sangat penting untuk memanfaatkan keuntungan

„ Victoria Azarenka

Memang, Alonso harus menerima kenyataan pahit pada balapan tersebut.Saatlampumerahpadam tanda balapan dimulai, dia ikut menjadi korban tabrakan beruntun yang disebabkan oleh Grosjean, yang lebih dulu menyenggol mobil Lewis Hamilton, sebelum menghantam Sergio Perez, dan akhirnyaikutmenyeretmobilAlonso yang mengalami rusak berat. Akibat kegagalan dalam lomba ini, Alonso tak mampu mendapatkan poin, meskipun dia tetap memimpin klasemen sementara. Akan tetapi, posisinya sudah mulai mendapatkan ancaman dari pebalapRedBullRacing,Sebastian Vettel, yang menjadi runner-up setelah finis di belakang pebalap McLaren, Jenson Button. Kini, Alonso hanya unggul 24 poin atas juaradunia2010dan2011tersebut. Namun Alonso tak mau larut dalam kekecewaan akibat insiden, yang tidak ingin dijadikan persoalan. Mantan pebalap Renault dan McLaren ini mengaku siap menghadapi seri selanjutnya di Monza, Italia, pada akhir pekan ini. Apalagi, balapan tersebut akan berlangsung di kandang Ferrari. “Saya baik-baik saja, dan dalam kondisi 100 persen, serta siap melanjutkan pertarungan. Memang, kejadian hari Minggu itu menyakitkan, tetapi tidak menghancurkan. Setelah bangun, saya sudah dalam kondisi 100 persen. Saya sudah bisa berolahraga, bekerja di simulator, dan semuanya sempurna,” ujar juara dunia 2005 dan 2006 ini. Alonso bekerja secara intensif di Maranello,untukmempersiapkan diri menghadapi balapan akhir pekan ini di Monza. Dia bertelad menebus kegagalan di Belgia dengan kemenangan di harapan publik Ferrari. “Mobilbisamemimpin kami untuk berarung memperebutkan gelar juara dunia. Meskipun dengan banyak kesulitan, kami tetap memiliki keuntungan. Monza merupakan trek spesial bagi kami dan harapannya pasti tinggi. Kami tidak boleh mengecewakan para tifosi sehingga harus memberikan 110 persen,” jelasnya. (int)


KAMIS 6 September 2012

ENGLISH PREMIER LEAGUE No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

„ Ronaldo

Team Chelsea Swansea City West Brom Man City Man United Everton West Ham Arsenal Wigan Newcastle Fulham Stoke City Sunderland Tottenham Norwich City Reading Aston Villa Liverpool QPR Southampton

M 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 2 3 3 3 3

M 3 2 2 2 2 2 2 1 1 1 1 0 0 0 0 0 0 0 0 0

S 0 1 1 1 0 0 0 2 1 1 0 3 2 2 2 1 1 1 1 0

K 0 0 0 0 1 1 1 0 1 1 2 0 0 1 1 1 2 2 2 3

SG 8-2 10-2 6-1 8-5 6-5 4-3 4-3 2-0 4-4 3-4 7-6 3-3 2-2 3-4 2-7 3-5 2-5 2-7 2-9 4-8

Nilai 9 7 7 7 6 6 6 5 4 4 3 3 2 2 2 1 1 1 1 0

TOP SCORER Kamu memiliki cinta dari kami, dan kami juga akan membantu apapun yang kamu butuhkan. Kita akan berbicara lebih banyak lagi setelah laga uji coba internasional. Tapi satu yang harus kamu ingat, kami selalu ada untuk mendengarkan dan menolongmu.”

Gol 4 4 3

Nama Klub Michu Swansea City R. van Persie Manchester United C. Tévez Manchester City

Jose Mourinho

MADRID - Kesedihan yang dirasakan Cristiano Ronaldo membuat gusar beberapa penggawa Real Madrid. Tak terkecuali Jose Mourinho, yang menyebut kalau semua orang di El Real mencintainya.


onaldo mengejutkan banyak pecinta sepakbola dengan mengatakan sedang bersedih pasca duel melawan Granada di La Liga, akhir pekan kemarin. Salah satu rumor menyebutkan, eks winger Manchester United itu sudah tak betah lagi di Santiago Bernabeu. Real Madrid tentu tak ingin pemain termahalnya itu hengkang lantaran ada sesuatu yang membuatnya sedih. Takut hal yang tak diinginkan terjadi, Mourinho meyakinkan Ronaldo kalau orang-orang di Madrid masih mencintainya. Pria Portugal itu juga meminta pemain termahal dunia itu berbagi ‘misteri’ kesediahannya. “Kau adalah pemain spesial di sini (Real Madrid). Saya sama sekali tak ragu akan hal tersebut. Kita harus bicara, kau sangatdihargaidanbutuhdicintai,”ujarMoudalamsebuah percakapan yang dilansir Marca. “Kamu memiliki cinta dari kami, dan kami juga akan membantu apapun yang kamu butuhkan. Kita akan berbicara lebih banyak lagi setelah laga uji coba internasional. Tapi satu yang harus kamu ingat,kami selalu ada untuk mendengarkan dan menolongmu,” tuntas Mourinho. Banyak rumor berkembang terkait kesedihan yang dirasakan pesepakbola 27 tahun tersebut. Selain masalah uang dan kontrak baru, kabar lain menyebut ada ketidakcocokan dengan rekan setim. Meski mantan pemain terbaik dunia itu sudah menyangkal kalau kesedihannya berlatar belakang uang, masalah apa yang sebenarnya terjadi dengan CR7 masih tetap misteri. (int)

No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Team M Barcelona 3 Mallorca 3 Málaga 3 Rayo Vallecano 3 Real Valladolid 3 Deportivo 3 Sevilla 3 Getafe 3 Atlético Madrid 2 Levante 3 Real Madrid 3 Real Betis 2 Real Sociedad 3 Real Zaragoza 3 Celta de Vigo 3 Athletic Club 3 Valencia 3 Granada 3 Espanyol 3 Osasuna 3

M 3 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0

S 0 1 1 1 0 2 2 1 1 1 1 0 0 0 0 0 2 1 0 0

K 0 0 0 0 1 0 0 1 0 1 1 1 2 2 2 2 1 2 3 3

SG 8-2 4-2 3-1 3-1 3-2 6-4 3-2 4-4 5-1 4-5 5-3 6-5 3-7 2-3 3-3 5-9 4-5 1-5 4-7 1-6

Nilai 9 7 7 7 6 5 5 4 4 4 4 3 3 3 3 3 2 1 0 0

TOP SCORER Gol 4 3 3

Nama L. Messi R. Falcao T. Hemed

Klub Barcelona Atlético Madrid Mallorca

Pippo Inspirasi Falcao

Ini Alasan Inter Mata-matai Vieri MILAN- Akibat memata-matai kehidupan pribadi Christian Vieri, Inter Milan diperintahkan pengadilan untuk membayar denda besar.ApaalasanLaBeneamatamemata-matai mantan bombernya itu? Seperti diberitakan sebelumnya, Vieri berang ketika tahu Inter Milan menyadap teleponnya. Ia pun mengajukan gugatan dan gugatan tersebut dimenangkan pengadilan. Bukan hanya Inter yang digugat oleh Vieri, tetapi juga perusahaan komunikasi Telecom Italia. Keduanya dituding Vieri telah melakukan penyadapan pada teleponnya lantaran Inter ingin memantau kehidupan pria yang kerap disapa Bobo itu. Seperti diberitakan kantor berita ANSA, Vieri akhirnya mendapatkan ganti rugi sebesar 1 juta euro (Rp 12 miliar). Meski angka yang dia minta sebagai ganti rugi lebih besar dari itu. Vieri mengajukan gugatan tersebut lantaran masalah tersebut telah mengganggu kehidupan pribadinya dan imbasnya berpengaruh pada permainannya di lapangan. Tapi, hal itu dibantah oleh Inter. “Kami jelas terkejut dengan tudingannya dan kami akan melakukan banding. Kami yakin bahwa kami tidak bersalah,” ujar pengacara Inter, Marco Fassone, di Football Italia. “Dalam pengadilan olahraga, kasus yang diperbincangkan ini sudah dikubur. Masa kasusnya sudah kadaluarsa.”(int)


„ Radamel Falcao

JAKARTA- Radamel Falcao kini bisa jadi dianggap sebagai salah satu striker terbaik di dunia. Siapakah pemain yang menjadi inspirasinya? Striker Atletico Madrid tersebut menjawab, Filippo Inzaghi. Naluri gol Falcao memang tengah menggila. Terakhir ia mencetak trigol ke gawang juara Liga Champions musim lalu, Chelsea, pada laga Piala Super Eropa. Los Colchoneros pun dibawanya menang 4-1. Layaknya pesepakbola lain, ia

juga punya idola. Ia menyebut Pippo telah menginspirasinya hingga dapat bermain seperti sekarang. Kepada rekan senegaranya di Kolombia, Mario Yepes, yang juga sempat merasakan menjadi rekan satu tim Inzaghi di AC Milan, Falcao bahkan meminta tolong agar Pippo bersedia menandatangani kostum Rossoneri untuknya. “Apakah kabar itu benar, bahwa saya menyuruh Mario Yepes agar Inzaghi menandatangani kostum Milan saya? Tentu saja itu benar,” tukas striker 26 tahun tersebut di Soccerway.

“Inzaghi adalah striker yang sangatsayakagumikarenainstingnya dalam mencetak gol. Dia menginspirasisayadengancaranya bermain.” Pasca memutuskan pensiun akhir musim lalu, Pippo kini tengah merintiskariersebagaipelatihditim junior di Milan. Selama lebih dari 10 tahun membela Il Diavolo, Pippo sukses meraih dua Scudetto, satu Coppa Italia, dua trofi Liga Champions, dua trofi Piala Super Eropa, dan satu trofi Piala Dunia Antarklub. (int)

Rooney: Sir Alex Punya Standar Tinggi MANCHESTER- Wayne Rooney menyebut bahwa Sir Alex Ferguson punyastandartinggi.Sakingtingginya standaritu,Rooneysampaimengaku takut untuk membuat kesalahan. Sir Alex memang dikenal begitu. Cerita bahwa dia suka menyemprot pemainnya —dikenal dengan hair dryer-treatment—ketikaManchester United bermain buruk, adalah cerita yang banyak diketahui orang. Sudah bukan rahasia. MenurutRooney,tekananituakan lebih besar kepada para penyerang. Kalau tidak tampil bagus, ada

kemungkinan si pemain bakal dicadangkan (atau tidak dimainkan sama sekali) pada pertandingan berikutnya.“Sebagaipenyerang,saya harusbekerjakerassetiapwaktu.Saya harus tetap tajam, yang artinya kebugaran saya harus terjaga supaya saya bisa terus bermain bagus. Jika saya tidak bugar, maka itu akan terlihat jelas,” ujarnya seperti dilansir Sportinglife.”Mungkinakanberbeda jika seandainya saya adalah seorang full-back. Saya bisa sedikit bersembunyi, membuat beberapa lari pendek ke depan dan sudah

dimaklumi.” “Sebagai penyerang Manchester United, tak ada pemakluman sama sekali. Saya harus bekerja sekeras mungkin, jika tidak manajer akan menariksayadarilapanganatausaya ditinggalkan pada pertandingan berikutnya.” “Tak ada ruang untuk membuat kesalahan atau menjadi yang terbaik kedua di klub ini,” papar Rooney. Penyerangberusia26tahunitupun memberikan contoh, yakni ketika dirinyapergimakanmalambersama beberaparekansetimdanpasangan-

pasangan mereka pada Boxing Day 2011. Ketika itu MU baru saja menang5-0.Rooneymengirahalitu boleh-boleh saja. Tapi, ternyata tidak. Bagi Sir Alex, keluar malammalamenamharimenjelangpertandingan penting tidak bisa ditolerir. Keesokan harinya, manajer asal Skotlandia itu memanggil Rooney dan mengatakan bahwa dirinya tidak senang. “Saya didenda dan ada yang lebih buruk lagi; saya ditinggalkan untuk pertandingan melawan Blackburn pada malam tahun baru.”(int)

ITALIAN SERIE A 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Juventus Napoli Lazio Sampdoria Roma Catania Torino Genoa Internazionale Milan Fiorentina Chievo Parma Cagliari Udinese Bologna Palermo Pescara Atalanta Siena

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

2 2 2 2 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0

0 0 0 0 1 1 1 0 0 0 0 0 0 1 0 0 0 0 1 1

TOP SCORER Gol 3 3 2

Nama S. Jovetiæ G. Pazzini G. Bergessio

Klub Fiorentina Milan Catania

0 0 0 0 0 0 0 1 1 1 1 1 1 1 2 2 2 2 1 1

6-1 5-1 4-0 3-1 5-3 5-4 3-0 4-3 4-3 3-2 3-3 2-2 2-2 1-3 2-6 1-5 0-6 0-6 1-2 1-2

6 6 6 5 4 4 3 3 3 3 3 3 3 1 0 0 0 0 -1 -5





Kamis, 6 September 2012


9 ○

Edisi 207 „ Tahun V

Miliki Sabu & Ganja PNS DITANGKAP SIANTAR-Supriayadi (42), PNS yang bertugas di kantor Badan Pelayanan Izin Terpadu (PIT) ditangkap karena memiliki satu paket kecil sabusabu dan ganja 5 gram, Selasa (4/9) sekitar pukul 13.00 WIB

di Jalan Farel Pasaribu Siantar. Informasi dihimpun METRO, penangkapan Supriyadi bermula dari informasi

‹‹ Baca Miliki ...Hal 7

7 PNS Palsu Terkuak di Pemkab Batubara BATUBARA-Sebanyak 7 orang staf berstatus Pegawai Negeri Sipil (PNS) di Pemkab Batubara diduga siluman dan palsu. Padahal, para pegawai itu sudah bekerja sejak tahun 2008.

Surat Keputusan (SK) pengangkatan asli sebagai CPNS, para pegawai itu tidak bisa menunjukkan. Kepala Badan Kepegawaian Daerah (BKD) Batubara Saut Siahaan kepada METRO, Rabu (5/9) menerangkan, selama ini para pegawai yang diduga palsu itu menerima gaji sesuai kepangkatan yang dicantumkan dalam surar perpindahan dari asal mereka. Namun ketika para pegawai

Data dihimpun METRO, terkuaknya kasus itu berawal ketika diberlakukannya Nomor Induk Pegawai (NIP) yang memakai 18 digit angka, dan setelah diminta menunjukkan

‹‹ Baca 7 PNS ...Hal 6

Rakyat & Pemerintah Harus Kompak Tolak TPL SIMALUNGUN- Hingga saat ini, lahan pertanian masyarakat yang diserobot paksa PT Toba Pulb Lestari (TPL) belum dikembalikan. Sehingga banyak warga yang menghabiskan hariharinya di rumah. Sebab tak ada lagi lahan pertanian yang bisa dikelola.Ketua Komisi III DPRD Simalungun Drs Johalim Purba mengatakan, kalau hanya sepi-

hak rakyat yang menginginkan TPL ditutup, sangat jauh peluangnya perusahaan yang bergerak dalam penanaman kayu eucalyptus ditutup. Masyarakat dan pemerintah harus kompak menolak keberadaan TPL di Kabupaten Simalungun. “Alasan masyarakat dan Pemkab Simalungun menolak

‹‹ Baca Rakyat ...Hal 7 FOTO: JPMC

Aura Kasih

„ Menteri Negara BUMN Dahlan Iskan (kanan) dan Direktur Utama PT Pos Indonesia, I Ketut Mardjana saat peluncuran perangko mobil listrik sebagai salah satu agenda peringatan

Pilih Cara Prangko Bergambar Tradisional Mobil Listrik Diluncurkan


„ Supriyadi (42) ditangkap karena memiliki satu paket kecil sabu-sabu dan ganja 5 gram di perempatan Jalan Melanthon Siregar dan Jalan Farel Pasaribu, Rabu (5/9)

Dalam banyak hal, caracara tradisional tak pernah ditinggalkan. Salah satunya untukurusan perawatan kecantikan. Hal itu juga dilakukan oleh artis Aura Kasih.

‹‹ Baca


Mendaftar ke KPU Kader Gerindra Konvoi BATUBARA-Ratusan kader Partai Gerakan Indosia Raya (Gerindra) lengkap dengan atribut partai, konvoi mendatangi kantor Komisi Pemilihan Umum (KPU) Batubara untuk mendaftar sebagai peserta pemili 2014, Rabu (5/9). Pantauan METRO, kedatangan pengurus Partai Gerindra diterima Ketua KPU Batubara Khairil Anwar SH, Sekretaris Lukman SH dan

JAKARTA – Koleksi prangko PT Pos Indonesia bertambah satu lagi. Sebuah prangko bergambar “Mobil Listrik” resmi diluncurkan Rabu (5/9) oleh Direktur Utama PT Pos Indonesia I Ketut Mardjana dan Menteri Negara Badan Usaha Milik Negara (BUMN) Dahlan Iskan. Peluncuran prangko “Mobil Listrik” ini terbilang unik, karena tidak dilakukan melalui aca-

ra resmi maupun waktu lazim. Meneg BUMN Dahlan Iskan memilih menandatangani sampul peringatan Hari Kebangkitan Teknologi Nasional yang berisi prangko bergambar mobil listrik itu kemarin pukul 06.00 di lapangan Monumen Nasional (Monas). Terang saja acara menarik perhatian

‹‹ Baca Prangko ...Hal 6

...Hal 6

jajaran KPU Batubara. Terlihat, pengurus menyerahkan dua bundelan berupa 1008 Kartu Tanda Anggota (KTA) Gerindra, administrasi pengurus DPC, Pengurus Kecamatan (PK) dan Pengurus Ranting (PR). Dalam kesempatan itu, Ketua KPU

‹‹ Baca Mendaftar ...Hal 6 FOTO: SOFYAN BUTAR BUTAR

„ Jenazah Irwansyah usai dibersihkan paramedi di salahsatu klinik di Kecamatan Pulau Rakyat.

Pemuda Tewas Disenggol Truk (FOTO:AMRAN POHAN)

„ Suasana ketegangan antara massa denga warga di Desa Telo yang sempat terjadi aksi lemparan.


MASSA LEMPAR BATU, POLISI LETUSKAN TEMBAKAN BATANGTORU- Unjuk rasa ribuan warga berbagai desa di Kecamatan Muara Batangtoru, Kabupaten Tapanuli Selatan, yang menolak pemasangan pipa limbah perusahaan tam-

bang emas milik PT G Resource Martabe, Rabu (5/9), berlangsung ricuh. Massa dan petugas keamanan yang siaga di areal tersebut saling dorong. Tak hanya itu, massa yang emosi juga

melempari petugas dengan batu. Untuk meredakan situasi, polisi meletuskan tembakan peringatan. Dorr…. Pantauan METRO, aksi lempar sempat terjadi dua kali antara ribuan warga

dengan petugas keamanan yang telah disiagakan. Untuk diketahui, ribuan warga berdemo di tiga tempat. Lokasi

‹‹ Baca Massa ...Hal 7

PULAURAKYAT-Irwansyah (25), warga Desa Persatuan Kecamatan Pulau Rakyat Asahan, tewas seketika setelah sepedamotor yang dikemudikannya disenggol truk di Jalinsum Asahan KM 208-209, Rabu (5/9) sekitar pukul 20.30 WIB. Data dihimpun METRO di lokasi kejadian, sebelum peristiwa kecelakaan itu, terlihat Irwansyah mengendarai Honda Revo BK2087 VAM berboncengan dengan adiknya Herdiansyah melintas dari arah Aek Kanopan menuju Kisaran.

Tepat di Rumah Makan Maninjau, Irwansyah mendahuli kendaraan yang ada di depannya. Ternyata, dari arah berlawanan melintas truk BK 8746 TV sehingga terjadi senggolan antara stang sepedamotor korban dengan badan truk dari Siantar itu. seketika, korban dan adiknya terpental, ke badan jalan. Warga yang melihat kejadian itu, langsung berhamburan ke lokasi dan berusaha

‹‹ Baca Pemuda ...Hal 6



6 September 2012


Beresiko Tinggi Meninggal Dunia Presiden Mesir Mohamed Morsi

Presiden Mesir

Serukan Assad MUNDUR KAIRO- Presiden baru Mesir Mohamed Morsi kembali menyerukan rezim Presiden Suriah Bashar al-Assad untuk mengundurkan diri. Ditegaskan Morsi, resolusi untuk krisis Suriah merupakan tanggung jawab Arab. ”Saya katakan pada rezim Suriah bahwa masih ada peluang untuk menghentikan pertumpahan darah,” kata Morsi dalam pertemuan para menteri luar negeri (menlu) Liga Arab di Kairo, Mesir. ”Jangan mengambil langkah yang benar di waktu yang salah... karena itu akan menjadi langkah yang keliru,” tutur Morsi seperti dilansir kantor berita AFP, Rabu (5/9). ”Sekaranglah waktunya untuk perubahan,” tegas Morsi seraya mengingatkan rezim Assad untuk “memetik pelajaran dari sejarah baru-baru ini.” Dalam pertemuan tersebut, Morsi mendesak para diplomat Arab untuk bergerak cepat guna menyelesaikan konflik Suriah. “Darah rakyat Suriah sedang ditumpahkan siang dan malam, kita bertanggung jawab atas ini,” cetus Morsi. “Kita tak bisa tidur sementara darah rakyat Suriah ditumpahkan,” imbuhnya. ”Saya mendesak Anda para menlu Arab, untuk bekerja keras menemukan solusi cepat atas tragedi di Suriah,” tutur Morsi. “Jika kita tidak bergerak, dunia tak akan bergerak dengan serius,” tandasnya. (dtc/int)

JAKARTA- Tingkat kematian jemaah haji Indonesia pada 2011 mencapai 2,34 persen. Dari 223.395 jemaah pada tahun lalu, sebanyak 522 di antaranya meninggal dunia. Tingginya kematian jemaah disebabkan mayoritas jemaah telah memiliki risiko kematian tinggi sebelumnya, seperti mengidap penyakit kronis berat dan berusia lanjut. ”Jemaah haji Indonesia memang tergolong memiliki risiko kesakitan yang cukup tinggi,” ujar Dirjen Pengendalian Penyakit dan Penyehatan Lingkungan (Dirjen P2PL) Kemenkes Tjandra Yoga Aditama di Jakarta, Rabu (5/9). Lebih dari separuh dari total jemaah, menurut Tjandra, telah memiliki risiko tinggi terhadap kematian sebelum berangkat. Menurut inventaris Kemenkes, sekitar 50.58% atau

111.697 dari 223.395 jemaah yang bemenjalani ibadah, menurut dia, ada rangkat pada tahun lalu masuk dalam beberapa hal yang perlu dipersiapkelompok risiko tinggi. kan. Pertama, jemaah Tercatat jenis penyawajib memeriksakan kit yang paling banyak kesehatan ke dokter. diidap oleh jemaah haji Kedua, jika memang yang meninggal pada memiliki penyakit krotahun lalu adalah pennis, sebaiknya memastiyakit jantung dan pemkan persediaan logistik buluh darah. Selanjutobat terpenuhi. Selannya adalah penyakit jutnya jika memang megangguan pernapasan, miliki resiko kesehatan otak, masalah pada tinggi, yang bersangkusistem sirkulasi, entan bisa meminta surat dokrin metabolik, infekpengantar dari dokter. si, ginjal, masalah ”Surat tersebut bisa pencernaan, tumor, menjadi masukan bagi dan penyakit darah. dokter kloter yang bertuMengingat kelomgas dalam persiapan tinpok terbang (kloter) dakan yang perlu diamTjandra Yoga Aditama bil nantinya,” imbuh pertama jemaah haji 2012 akan berangkat Tjandra. pada akhir September, Tjandra menSelanjutnya jika berangkat bersama yarankan jemaah haji melakukan berorang lanjut usia, sambungnya, perbagai persiapan agar kesehatan dan siapan lebih rinci seperti pengeibadah mereka tidak terkendala. tahuan tentang menyewa kursi roda. Agar tubuh sehat dan bugar saat (mdc/int)

Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini mendatangi kantor KPK untuk menjalani pemeriksaan.

Purnomo memberikan keterangan pers terkait rencana kerja sama dengan Australia.


Perkuat Kerja Sama Pertahanan JAKARTA- Pertemuan bilateral antara Menteri Pertahanan RI Purnomo Yusgiantoro dan Menteri Pertahanan Australia Stephen Smith menghasilkan kesepakatan strategis dalam rangka memperkuat kerja sama kedua negara dalam bidang pertahanan, terutama sektor industri. ”Setidaknya kami sepakat dalam satu semangat yang sama yaitu memperkuat kerja sama pertahanan di antara kedua negara. Khusus untuk sektor industri pertahanan, tentu saja akan bergerak dalam wilayah untuk memperkuat pertahanan negara masing-masing,” ujar Purnomo saat memberi keterangan pers di Kantor Kementerian Pertahanan di Jakarta, Rabu (5/9). Pertemuan yang merupakan lanjutan dari kunjungan Menhan Purnomo ke Darwin pada Mei 2012 lalu ini dilandasi semangat saling menghormati

bagi kemajuan industri pertahanan kedua negara. “Soal detail seperti apa, tentu saja akan dibahas kemudian sambil berjalannya waktu,” jelasnya. Selain kerja sama memperkuat industri pertahanan, Purnomo menjelaskan lingkup kegiatan kerja sama pertahanan antara RI dan Australia juga meliputi kebijakan pertahanan, hubungan antarinstansi, kontraterorisme, keamanan maritim, bantuan kemanusiaan dan pemulihan bencana, dukungan logistik militer dan pelayanan medis, pemeliharaan perdamaian, intelijen, industri pertahanan, material, ilmu pengetahuan dan teknologi. ”Juga pendidikan dan pelatihan di bidang pertahanan atau militer, tata kelola dan manajemen pertahanan, dan bidang lainnya yang menjadi kepentingan bersama kedua negara,” lanjut Purnomo. (dtc/int)

Kapal Tanker Singapura


Dibajak Perompak


ABUJA- Sebuah kapal tanker minyak milik Singapura dibajak oleh perompak di Pelabuhan Lagos, Nigeria. Pembajakan ini merupakan yang ketiga kalinya terjadi dalam 2 minggu terakhir di wilayah Teluk Guinea, Afrika. Menurut Biro Maritim Internasional (IMB), kapal yang membawa 23 awak tersebut dibajak perompak pada Selasa (4/9) sore waktu setempat. Kapal bermuatan bahan bakar tersebut digiring oleh para perompak ke wilayah laut lepas. Namun pusat informasi pembajakan yang bermarkas di Kuala Lumpur, Malaysia tersebut tidak menjelaskan secara detail bagaimana kapal tersebut bisa dibajak. ”Kami telah memberitahu otoritas Nigeria yang telah mengambil tindakan,” ujar Kepala IMB, Noel Choong, kepada AFP, Rabu (5/ 9). Menurut Noel, para awak kapal mengunci diri mereka dalam ruangan aman. “Kami mengkhawatirkan keselamatan mereka dan aksi-aksi kekerasan yang bisa saja terjadi,” imbuhnya. Para bajak laut membajak dan menjarah dua tanker minyak di dekat Togo pada bulan Agustus lalu. Kedua kapal dan seluruh awak kapal kemudian dibebaskan. Noel menuturkan, kemungkinan besar ada sindikat pelaku kriminal yang berada di balik pembajakan ini. Hal ini bisa dilihat dari modus operasi pembajakan yang nyaris sama. ”Mereka akan menguasai kapal tersebut selama 5 hari — kemudian merangsek masuk ke dalam kabin awak kapal dan menyedot minyak ke kapal perompak lainnya,” terang Noel. Noel menyatakan, pihaknya telah berulang kali memperingatkan kapal-kapal yang berlayar di dekat Teluk Guinea, dekat pantai barat Afrika, untuk lebih berhati-hati dan waspada. IMB juga meminta otoritas setempat untuk meningkatkan patroli keamanan di wilayah perairan yang tahun lalu disebut sebagai ‘hot spot’ pembajakan. Diketahui bahwa di wilayah tersebut sudah terjadi 37 kali serangan pembajakan, termasuk penculikan dan pembunuhan sepanjang tahun 2012 ini. Para perompak tersebut biasanya mengincar kapal-kapal kargo yang berlayar di kawasan tersebut. Mereka akan memindahkan barang-barang muatan kapal tersebut dan kemudian menjualnya di pasar gelap. (dtc/int)

2 Perwira Polisi Diperiksa KPK Kasus Simulator SIM JAKARTA- Para perwira Polri harus wira wiri memenuhi panggilan penyidik KPK sebagai saksi kasus simulator SIM. Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini kali ini dimintai keterangan lagi. ”Keduanya dipanggil sebagai saksi dalam perkara pengadaan driving simulator di Korlantas Mabes Polri,” ujar Kabag Pemberitaan KPK, Priharsa Nugraha, ketika dikonfirmasi, Rabu (5/9). Setidaknya sampai pukul 09.30 WIB, dua perwira tersebut belum sampai di kantor KPK. Ini merupakan panggilan kedua bagi Kompol Endah Purwaningsih dan Kompol Ni Nyoman Suwartini.

KPK sebelumnya memeriksa AKBP Indra Darmawan Irianto dan AKBP Susilo Wardono. Sedangkan pada pekan lalu, KPK juga telah memeriksa empat perwira sebagai saksi untuk Irjen Djoko yakni AKBP Wandi Rustiwan, Kompol Ni Nyoman Sumartini, Kompol Endah Purwaningsih, dan AKBP Wisnu Buddhaya. Sebelumnya mereka sempat tak hadir dalam panggilan pertama karena ada masalah administrasi. Dalam kasus Simulator SIM ini, KPK menetapkan mantan Kakorlantas Irjen Djoko Susilo sebagai tersangka. KPK juga menetapkan bawahan Djoko, Brigjen Pol Didik Purnomo, Direktur Utama PT Inovasi Teknologi Indonesia, Sukotjo S. Bambang dan Direk-

tur PT Citra Mandiri Metalindo Abadi, Budi Santoso sebagai tersangka. Polri juga menetapkan status sama terhadap tiga nama terakhir tersebut. Tiga nama yang menjadi ‘tersangka bersama’ itu memicu persoalan. Sampai saat ini KPK dan Polri samasama ngotot untuk menangani kasus ini. Sampai saat ini belum ada titik temu antara dua lembaga penegah hukum tersebut. Polri telah melakukan gerak cepat dengan melakukan penahanan terhadap para tersangkanya, yang juga tiga di antaranya merupakan tersangka di KPK. Irjen Djoko juga telah dua kali diperiksa sebagai saksi. Sedangkan KPK masih hanya fokus memeriksa saksi dan berkas untuk Irjen Djoko. (dtc/int)

JAKARTA- Mantan Menteri Kelautan dan Perikanan Fadel Muhammad menegaskan Kementerian Kelautan dan Perikanan bertanggung jawab terhadap semua pulau-pulau di Tanah Air. Saat ada informasi penjualan 2 pulau di Indonesia, Fadel mengungkapkan kritik kepada Menteri Kelautan dan Perikanan saat ini, Sharif Cicip Sutardjo. ”Kementerian Kepulauan dan Perikanan menangani semua pulau-pulau di Indonesia. Pulau terluar waktu itu kita inventarisir ada 60 buah pulau dan kita tidak mau menyewakan apalagi menjual. Kita anggap lokasi strategis untuk menjaga keamanan negara di perbatasan,” kata Fadel, Rabu (5/9). Fadel mengingatkan agar Kementerian KP lebih jeli mengamankan pulau-pulau Indonesia. Jangan sampai pulau dijual tapi juga harus peka terhadap investasi. ”Nggak boleh kita menjual pulau kepada siapapun juga. Kita bikin kerja sama untuk investasi, kita undang investornya masuk dengan beberapa pertimbangan. Yang pertama kita bisa membangun holiday resort, kita bisa bikin apakah 15 tahun ataukah 20 tahun perjanjian,” saran Fadel. Fadel lantas mengkritisi kinerja Kementerian KP setelah ditinggalkannya. Di bawah menteri yang baru tak lain adalah Wakil Ketua Umum Golkar Sharif C Sutardjo, dia mendengar ada hal yang menjadi tidak teratur. ”Saya dengar sekarang sudah nggak teratur. Ya saya banyak prihatinnya. Misalnya program kita menaikkan produksi ikan rakyat sudah ditiadakan,

sekarang orientasinya industri. Dulu saya canangkan program itu agar kita nggak perlu impor ikan. Itu prinsip membangun ekonomi kerakyatan,” ingat Fadel yang juga menjabat Wakil Ketua Umum Golkar ini. Situs www. memasang iklan penjualan pulau Gambar di Laut Jawa dan pulau Gili Nanggu di Lombok, Nusa Tenggara Barat. Kementerian Kelautan dan Perikanan pun melakukan pengecekan kepemilikan pulau tersebut. Pulau Gambar menjadi salah satu pulau yang dijual dalam situs penjualan pulau pribadi dunia tersebut. Harga yang ditawarkan tergolong murah yakni USD 725 ribu atau setara dengan Rp 6,8 miliar (kurs Rp 9.500). Dalam informasi penjualannya, pulau itu disebutkan berada di kawasan Laut Jawa dengan luas 2,2 hektar. Pulau Gambar dideskripsikan sebagai pulau unik yang masih ‘perawan’. Dengan pantai indah yang mengelilinginya, pulau ini layak dijadikan sebuah hunian pribadi. Air laut di sekitar pulau relatif tenang dan dangkal. Para pengunjung bisa menyelam, snorkelling dan memancing. Sejumlah ikan dan lobster bisa ditemukan di tepi pantai. Sementara pulau Gili Nanggu di Lombok yang memiliki luas 4,99 hektar itu ditawarkan dengan harga Rp 9,9 miliar. Lokasinya yang berada di laut Bali jadi daya jual tersendiri. Menurut situs tersebut, pemilik pulau menawarkan Gili Nanggu dengan sejumlah fasilitas. Di antaranya 10 unit cottage, 7 unit bungalow, 1 unit restoran, mini bar, kamar, dan area pengembangbiakan kura-kura. (dtc/int)

Sidang Angelina Dipimpin Hakim Sudjatmiko JAKARTA- Angelina Sondakh bakal duduk di kursi pesakitan pada Kamis (6/9). Sidang perdana politisi Partai Demokrat itu dipimpin ketua majelis hakim Sudjatmiko. Sidang Angie dijadwalkan digelar sekitar 09.00 WIB. ”Anggota majelis hakimnya ada Marsudin Nainggolan, Avi Antara, Hendra Yospin dan Aleks Marwata dan panitera T Umar,” ujar Sudjatmiko ketika dikonfirmasi, Rabu (5/9). Sedangkan tim jaksa penuntut umum dari KPK akan dipimpin oleh jaksa Agus Salim. Sudjatmiko selama ini sudah beberapa kali memimpin persidangan di pengadilan Tindak Pidana Korupsi Jakarta di antaranyamengadili Nyoman Sui-

Angelina Sondakh memasuki ruang persidangan sebagai saksi kasus Nazaruddin. snaya, terdakwa kasus suap PPID di Kemenakertrans, dan menjatuhi hukuman tiga tahun penjara.

Hakim yang juga menjadi jubir Pengadilan Negeri Jakarta Pusat ini juga menjadi ketua majelis hakim yang menjatuh-

kan hukuman 2,5 tahun untuk Nunun Nurbaetie. Angie menjadi tersangka kasus suap pembahasan angga-

ran pengadaan alat laboratorium di 17 perguruan tinggi negeri di Kementerian Pendidikan serta pembangunan Wisma Atlet SEA Games Palembang di Kementerian Pemuda dan Olahraga. KPK menduga Angie telah menerima suap Rp 6 miliar. Suap terhadap Angie ini terungkap dari pengembangan kasus suap Wisma Atlet. Terpidana Wisma Atlet, Mindo Rosalina Manulang, mengatakan pernah berhubungan melalui pesan BlackBerry dengan Angie. Isi percakapan tersebut membahas berbagai proyek di perguruan tinggi. Namun Angie membantahnya. Dia bahkan mengaku tidak memiliki BlackBerry saat itu. (kmc/int)


6 September 2012 “Dikhawatirkan bagi partai yang memiliki dana besar akan membuat ketentuan administrasi secara borongan lewat konsultan. Jelas, tertib administrasi tidak bisa jadikan jaminan akan menghasilkan DPR yang berkwalitas,” Ketua Umum Partai Nasional Indonesia Marhaenisme (DPP PNI Marhaenisme) DM Sukmawati Sukarno.

Kirim Opini Anda ke email: metroasahan Maksimal tulisan 5.000 karakter

Sikap Kami

“Merepotkan (verifikasi). Tapi tetap dilaksanakan, walaupun ini sebagai sebuah kesalahan sejarah,”

Ketua Umum Partai Persatuan Pembangunan (PPP) Suryadharma Ali.

Ketua Komisi III, Gede Pasek Suardika.

Revitalisasi Bulog dan Kebutuhan Masyarakat

Mengelola Musim HIDUP di dua musim seperti di Indonesia, yakni musim hujan dan panas, mestinya mendatangkan berkah. Kondisi demikian tidak membutuhkan antisipasi dan perlakuan sesulit negeri dengan empat musim atau lebih seperti di Eropa. Sayangnya, berkah dua musim itu kini tak pernah lagi dinikmati. Yang terjadi justru musibah akibat buruknya perencanaan. Ketika musim hujan tiba, banjir muncul di mana-mana. Ketika kemarau datang, kekeringan tidak bisa lagi dihindari. Ribuan hektare lahan pertanian kering, bahkan ratusan hektare di antaranya gagal panen. Waduk-waduk yang menjadi urat nadi bagi sawah, listrik, dan air bersih pun kering kerontang.Peristiwa terakhir menunjukkan susutnya air waduk membuat tiga pembangkit listrik tenaga air (PLTA) tidak beroperasi. Ketiga pembangkit listrik itu ialah PLTA Wadaslintang, PLTA Sempor, dan PLTA Pajengkolan yang semuanya berada di Kebumen, Jawa Tengah. VolumeWadukWadaslintang,misalnya,kinitinggal261,46 juta meter kubik. Padahal, isi maksimalnya mencapai 413,46 jutameterkubik.Kekeringanjugaterusmeluas.DiKabupaten Magelang dan Temanggung di Jawa Tengah, Pasuruan, Jawa Timur, Karangasem, Bali, dan Kabupaten Kupang, Nusa Tenggara Timur, krisis air bersih sudah terjadi. Di Pasuruan, sedikitnya 20 desa di delapan kecamatan bahkan mengalami krisis air bersih. Ketersediaan air bersih di desa-desa tersebut tidak mampu memenuhi kebutuhan minimal 10 liter per hari per orang.Kenyataan tersebut menunjukkan masih buruknya antisipasi dan perencanaan pemerintah. Antisipasi bencana masih dilakukan dengan kebijakan reaktif, yakni membagi-bagi bantuan uang setelah musibah datang. Begitu bencana kekeringan pergi, semuanya kembali seperti sedia kala seolah tidak pernah terjadi apa-apa. Kebijakan yang bersifat preventif dan proaktif nyaris tidak banyak dilakukan.Akibat kebijakan dadakan itu, menurut hitung-hitungan Institut Hijau Indonesia, terjadi potensi kerugian lebih dari Rp100 triliun. Padahal, jika yang dikedepankan ialah kebijakan antisipatif, dana yang dibutuhkan kurang dari Rp50 triliun. Bila penghentian penebangan hutan dan penyetopan konversi lahan pertanian menjadi permukiman dilakukan secara konsisten, bencana bisa dihindari. Kerugian finansial lebih besar pun bisa diminimalkan. Kenyataannya, potensi kerugian malah kian bertambah karena dana yang digelontorkan untuk mengatasi kekeringan diserahkan kepada pemerintah daerah dengan pengawasan minimal. Tidak banyak yang tahu apakah bantuan itu sampai ke masyarakat atau tidak. Jika manajemen musim masih bertumpu pada pola-pola darurat seperti saat ini, dampak yang lebih buruk akan menjadi kenyataan. Kalau sekarang kita baru menghadapi krisis listrik dan air bersih akibat kekeringan, bukan tidakmungkinkrisispanganbenar-benarmenjadikenyataan. Padatitikitubangsayangpernahgemilangdibidangagraris ini tinggal meratapi tragedi berkesinambungan. (**)

“Badan Nasional Penanggulan Teroris (BNPT) harus melakukan pencegahan dan deradikalisasi, jangan hanya penindakan terus, itu yang harus dilakukan. Apalagi notabenenya pelaku teroris itu masih muda, ada yang belasan tahun lagi? Ini harus diselamatkan dan dibina,”

Kekayaan alam di negeri ini yang tak terhingga menjadikan negeri ini berbeda dari negara lainnya. Namun, dibalik kekayaan alam yang berlimpah ini, alangkah disayangkan jika pihak-pihak yang seharusnya mampu mengatasi permasalahan kebutuhan penduduknya, justru melahirkan sebuah permasalahan baru.

Oleh : Budi Prasetyo TAK sepatutnya luas wilayah daratan sekitar 1.922.570 km², masih kesulitan masalah pangan. Beberapa waktu lalu, kita dihibur dengan melambung tingginya harga kedelai dipasaran. Kenyataan ini, benar-benar di luar kewajaran dan telah mencapai angka klimaks. Bahkan, melebihi harga tertinggi tahun 1998. Tahun 1998, harga kedelai mencapai Rp7.050 per kg dan sekarang hampir menembus angka Rp8.000 per kg. Bukan itu saja, sejarah mencatat bahwa Indonesia yang dulu terkenal dengan negara agraris, sekarang ternyata sangat bergantung kepada pangan impor. Untuk memenuhi kebutuhan dalam negeri, sebanyak 60% pasokan pangan di Indonesia diimpor dari luar negeri. Tercatat beras selama 2 tahun terakhir yang diimpor hampir 2 juta ton, jagung 1,2 juta ton, kedelai hampir 30% dari kebutuhan, gula 30%, 50% garam konsumsi impor, susu 70%, dan gandum 100%. Akibatnya, angka inflasi mengalami naik selama April 2012 akibat harga pangan yang tinggi, ternyata di sisi lain adanya gejolak pangan di tingkat internasional saat ini. Badan Pusat Statistik (BPS) mengumumkan bahwa inflasi April 2012 naik dibandingkan bulan sebelumnya sebesar 0,21 %, sedangkan inflasi secara year on year tercatat sebesar 4,5%. Padahal, target inflasi dalam APBN-P 2012 adalah 6,8%. Tingkat inflasi tersebut didorong oleh kenaikan harga beberapa komoditas pangan sejak awal bulan. Di antaranya harga komoditas yang mengalami kenaikan tersebut adalah bawang putih, cabai rawit, gula pasir, bawang merah, dan minyak sawit. Untuk itu revitalisasi Bulog perlu dilakukan, tujuannya untuk memenuhi ketercukupan pangan. Menkope-

rekonomian Hatta Rajasa mengeluarkan statment berkaitan revitalisasi Bulog. Dirinya setuju adanya revitalisasi dalam tubuh Bulog alasannya sangat penting untuk stabilisasi harga agar masyarakat tidak terbebani dengan kenaikan harga akibat kelangkaan bahan kebutuhan pangan pokok. Sejak wewenangnya dipangkas pemerintah atas tekanan IMF (Dana Moneter Internasional), 1998, Bulog hanya menangani beras. Komoditas pangan lainnya diserahkan sepenuhnya kepada mekanisme pasar. Alhasil, kebijakan ini merugikan masyarakat konsumen dan para petani sebagai produsen. Harga bahan kebutuhan pokok berfluktuasi tajam. Sudah sepatutnya, Badan Urusan logistik (Bulog) ditingkatkan perannya yang bertujuan untuk menjaga ketahanan pangan agar berjalan efektif. Jika Perum Bulog diberi peran tidak hanya menjalankan stabilisasi harga beras, namun juga menjaga stabilisasi harga sejumlah bahan pokok. Harga kebutuhan pokok sudah selayaknya dikontrol pemerintah, karena kebutuhan pokok ini merupakan kebutuhan strategis yang harus dilindungi sesuai amanat Undang-Undang Dasar 1945. Tujuan turut campurnya pemerintah dalam penentuan harga untuk mencegah terjadinya kelangkaan dan kelonjakan harga bahan pokok serta terjadinya monopoli pasar. Apalagi, kebutuhan pokok merupakan kebutuhan yang tak dapat dipisahkan dalam kehidupan siapapun di dunia ini. Jangankan manusia, hewan pun tidak akan bisa bertahan hidup, jika tidak ditopang kebutuhan pokok. kebutuhan pokok sering kali berada di tengah ancaman.

Iklim menjadi ancaman terbesar atas ketersediaan kebutuhan pokok. Ancaman kelangkaan pangan yang kini melanda dunia, termasuk Indonesia menjadi pekerjaan tersendiri bagi pemerintah untuk melindungi kebutuhan dalam negeri. Meski secara geografis memiliki kekayaan alam yang melimpah, namun ancaman krisis pangan ini tetap dialami Indonesia sebagai dampak dari mata rantai kehidupan dunia. Apalagi kebutuhan akan konsumsi beras masyarakat Indonesia cukup tinggi dan merupakan yang terbesar di dunia dengan volume sebanyak 130 Kilogram (Kg) sampai 140 Kg per orang per tahun. Konsumsi itu mencapai dua kali dari masyarakat di kawasan Asia Tenggara yang hanya 65 kg sampai 70 kg. Untuk memenuhi kebutuhan tersebut, pemerintah melakukaan berbagai langkah strategis, diantaranya mengantisipasi kekurangan pangan melalui produksi optimal pengadaan beras. Tujuannya hanya satu, yaitu kebutuhan nasional tetap terjaga.Terkesan Bulog selama ini tidak diberi peran untuk menstabilitaskan harga komoditas selain beras. Padahal infrastruktur gudang, jaringan, maupun fasilitas lain dapat dimanfaatkan Bulog untuk mengatasi permasalahan pangan didalam negeri. Untuk itu bulog perlu di revitalisasikan. Penulis sependapat dengan apa yang disampaikan Hatta rajasa, dengan adanya revitalisasi ini. Bulog harus tetap mengacu kepada regulasi dan mengacu kepada stabilisasi supaya tidak menimbulkan distorsi terhadap mekanisme pasar. Kemampuan untuk tetap menjaga komoditas dan menstabilisasikan harga pada akhirnya menjadi tantangan tersendiri bagi bulog. Sebelumnya, Presiden Susilo Bambang Yudhoyono menginstruksikan agar Bulog direvitalisasi kembali fungsinya sebagai stabilisasi harga komoditas pangan yang dibutuhkan masyarakat, tidak hanya untuk beras. Menurutnya revitalisasi Bulog dibutuhkan mengingat tantangan stabilitas berbagai harga pangan yang terus meningkat, sementara kebutuhan pangan masyarakat yang juga terus naik. Untuk itu, Yudhoyono meminta segera dibentuk tim guna mengembalikan peran Bulog tersebut dan mengkaji komoditas-komoditas pangan yang akan menjadi tanggung jawab Bulog. Penulis berkeyakinan dengan adanya revitalisasi ini Bulog mampu memainkan perannya dalam memenuhi kebutuhan pokok masyarakat. Setidaknya revitalisasi ini, masyarakat tidak terbebani dengan adanya kenaikan harga, akibat kelangkaan bahan pokok. Selain memainkan perannya, fungsi Bulog diperkuat untuk melindungi konsumen dan produsen sekaligus. Setidaknya keuntungan yang didapat dari revitalisasi ini, konsumen dilindungi dari lonjakan harga kebutuhan pokok. Sedangkan produsen dilindungi dari penurunan harga panen. Pada saat panen pun harga bahan kebutuhan pokok melonjak dan keuntungan dari lonjakan harga itu tidak dinikmati petani, melainkan segelintir pedagang atau lebih banyak di nikmati tenkulak. (**) Penulis Merupakan Ketua Karang Taruna Rw 09 Kebon Jeruk Jakarta Barat dan Leader Samudera Down Hill Mountaine Bike Community



6 September 2012




NYAWA SUHARDI MELAYANG SIMALUNGUN– Niat Suhardi alias Adik untuk melerai Supriatin dengan terdakwa Christian Siregar alias Cipet (30) yang cek-cok di warung tuak milik Litawati di Kampung Bandar Syahkuda, Kelurahan Kerasaan I, Kecamatan Pematang Bandar berujung maut. Suhardi „ Christian Siregar akhirnya tewas dibacok oleh terdakwa di bagian perutnya lantaran terdakwa tidak senang karena dilerai. Hal itu terungkap di persidangan yang digelar di PN Simalungun yang dipimpin majelis hakim Ramses Pasaribu beranggotakan Gabe Doris dan AdriaDwiAfanti,Rabu(5/9).JaksaPenuntutUmum (JPU) Julius Butar-butar dalam dakwaannya menyebutkan peristiwa itu berlangsung pada Jumat (23/3) sekira pukul 20.30 WIB. “Sekira pukul 15.30 saksi Supriatin datang ke rumah korban Suhardi dan mengajaknya untuk minum tuak. Kemudian Supriatin dan korban sepakat minuk tuak di warung tuak Litawati. Mereka berangkat dengan mengendarai sepedamotor dan setibanya di sana mereka langsung memesan satu galon tuak,” sebutnya. Dia menerangkan, sambil minum tuak keduanya pun bercerita sambil menikmati gorengan yang disediakan. Karena tuak yang sudah dipesan habis, Supriatin pun kembali memesan tuak satu galon. Setelah itu, mereka kembali minum hingga Supriatin melihat terdakwa datang dan langsung memesan tuak kepada pemilik warung. Selanjutnya terdakwa duduk di kursi lain dengan jarak empat meter dari korban dan Supriatin. “Setelah beberapa jam, tiba-tiba terdakwa Christian mendatangi mereka sambil membawa gelas yang berisi tuak dan berdiri tepat di samping korban. Saat itu terdakwa tampak berbincangbincang dengan korban, namun Supriatin tidak mendengar apa perbincangan mereka. Setelah beberapa menit kemudian terdakwa mengambil tuak dari teko dan menuangkannya ke gelas Supriatin dan korban,” ungkap jaksa. Sambungnya, setelah itu terdakwa mengajak Supriatin dan Suhardi untuk tos (laga gelas). Selanjutnya Supriatin mengangkat dan melagakan gelasnya ke gelas terdakwa dan terdakwa meminum tuaknya. Sementara Supriatin membuang tuaknya ke bawah meja sambil berkata ‘sudah puas kau’. “Mendengar itu terdakwa meletakkan gelasnya di meja dan berkata kepada Supriatin ‘apanya kau’ sambil menolak dada saksi Supriatin. Saat itu, Supriatin mendekati terdakwa dan korban langsung berdiri dan melerai saksi Supriatin dan terdakwa. Saat itu korban melerai dengan menghalangi badan terdakwa. Akan tetapi terdakwa saat itu tidak mau dihalang-halangi oleh korban dan dengan spontan korban pun menolak dada terdakwa,” terang Butar-butar. Katanya, Supriatin pun melihat antara terdakwa dan korban saling menolak dan akhirnya Supriatin mengajak korban untuk pulang. Kemudian Supriatin berjalan menuju tempat sepedamotornya diparkirkan di samping warung tuak dekat pohon coklat. Sementara korban tampak berjalan menuju arah coklat, sedangkan terdakwa berjalan cepat menuju sepedamotor dan mengambil pisau belati dari bagasi keretanya. “Saat Supriatin pun berniat menghampiri korban sambil mendorong keretanya. Akan tetapi lagi-lagi terdakwa dan korban saling dorong-dorongan. Tidak beberapa lama terdakwa pun langsung membacokkan perut korban hingga usus korban terburai. Usai melakukan aksinya terdakwa pun melarikan diri dan meninggalkan korban dalam keadaan bersimbah darah,” ungkapnya. Sementara itu, usai mendengarkan dakwaan jaksa, kuasa hukum terdakwa, Omri Gultom memutuskan tidak mengajukan eksepsi dan meminta agar hakim langsung melanjutkan ke dalam pokok perkara. Selanjutnya hakim pun memutuskan menunda persidangan karena saksi belum hadir.(mua)


Divonis Penjara Seumur Hidup MEDAN- Majelis hakim akhirnya menjatuhkan vonis penjara seumur hidup kepada terdakwa Adi Aryanto (35), yang membunuh dan memerkosa kakak iparnya sendiri bertempat di kamar 17, Hotel Bukit Hijau Jalan Jamin Ginting Km 11 Medan pada 27 Desember 2011 lalu.

Foto Reza

„ Musa tewas tergantung di pohon rambutan, Rabu (5/9).

Musa Tewas Tergantung di Pohon Rambutan MEDAN- Musa Daulay ditemukan penjual es cream dengan kondisi tergantung, leher terjerat akar-akaran di pohon rambutan. Saat ditemukan, pria berusia 26 tahun itu ditemukan telah tewas di pohon setinggi sekitar 5 meter di Jalan Sei Deli, Kelurahan Sei Agul, Kecamatan Medan Barat. Motif tewasnya warganya Jalan Sekata Gang Mawar ini diduga karena stress ibunya meninggal dunia 2 tahun silam. Sehingga membuat pria lajang ini kerap meminta-minta makanan kepada warga sekitar, bahkan tak segan-segan mencuri, Rabu (5/9) sekitar pukul 11.30 WIB. Penemuan mayat Musa sontak membuat warga sekitar berhamburan ke lokasi kejadian. Menurut keterangan warga sekitar, seluruhnya mengenal pria yang tergantung tersebut. Dia adalah Musa Daulay, yang mengalami gangguan jiwa sejak ibunya meninggal dunia. “Si Musa itu, si Musa gantung diri,” celoteh para ibu-ibu saat di lokasi kejadian. Menurut salahseorang wanita berumur 40-an tahun ini, Musa mengalami gangguan kejiwaan semenjak ibunya meninggal dunia. “Memang ada stres, stresnya anak itu,” ujarnya. Dikatakannya, sifat Musa kerap meminta-minta makanan kepada warga sekitar. “Sering minta-minta makanan disini, minta uang pun sering dia,” sambungnya. Puncak, stresnya Musa ditambah dirinya dipecat dari pekerjaan sebagai angkat-angkat barang di Jalan Putri Hijau. “Habis itu, dipecat pula lagi dia dari kerjaannya. Makin menjadi lah,” jelas wanita yang memakai jilbab ini pada Posmetro Medan. Hal senada juga dikatakan, Mahmud. Musa dikenalnya suka masuk ke rumah orang mengambil makanan, bahkan sampai mengambil uang.

“Memang dia suka masuk ke rumah orang, kalau dia lapar. Dia masuk aja ke rumah orang minta makan,” katanya membuka pembicaraan pada Posmetro Medan. Menurut pria berumur sekitar 50 an tahun ini, Musa juga kerap mengambil uang warga. “Mencuri suka juga,” sambungnya. Dikatakannya pria yang berjualan bunga di bundaran Jalan Adam Malik, ini jenazah korban ditemukan kali pertama penjual es cream. “Penjual es cream yang nemukan dia pertama kali, habis itu ntah kemana dia,” katanya. Warga sekitar pun yang penasaran lalu melihatnya, ternyata mayat yang tergantung itu adalah Musa Daulay. “Pernah juga kerja dengan saya, masukin tanah ke pot bunga. Cuma kalau dia lapar, dia masuk aja kerumah orang,” ucap pria yang sudah beruban ini. Namun, kondisi Musa tergantung di pohon rambutan lidahnya tidak menjulur. Dengan menggunakan baju kaos hitam, celana Lea warna biru kotoran Musa berceceran di kakinya bahkan tubuh korban sudah banyak dikerumuni semut. Selang beberapa menit, tim olah tempat kejadian perkara (tkp) pun tiba dilokasi. Usai melakukan olah tempat kejadian perkara, jenazah korban dibawa dengan menggunakan mobil patroli Polsekta Medan Barat. Hingga jenazah dibawa, abang kandung korban bernama Ahmad tak kunjung datang kelokasi kejadian. Menurut cerita warga, rumah orangtuanya telah disewakan Ahmad kepada orang lain, hingga Musa tak tahu tinggal dimana. “Rumahnya disewakan abangnya, tinggalnya nggak tentu-tentu gitu,” celoteh warga. Saat ditemui, tim olah tempat kejadian perkara mengatakan kalau

korban murni bunuh diri. “Tidak semua yang tergantung lidahnya keluar. Bisa juga ditahan oleh gigi, tapi tadi sperma keluar,” ucapnya seraya berjalan keluar dari tkp. Menurutnya, korban murni tewas bunuh diri. “Murni ini bunuh diri, karena ditubuhnya tidak ada tandatanda kekerasan,” sambungnya lagi. Kapolsekta Medan Barat Kompol Nasrun Pasaribu Sik saat dikonfirmasi di lokasi kejadian, mengatakan kalau motif dari gantung diri korban karena mengalami stres ibunya telah meninggal 2 tahun lalu. “Motifnya kita duga stres, karena ibunya meninggal dunia 2 tahun lalu,” katanya membuka pembicaraan. Menurutnya, korban tewas tergantung di pohon rambutan sekitar 8 jam lamanya. “Diperkirakan kejadian ini 8 jam lalu,” sambungnya. Menurutnya, Musa murni bunuh diri di pohon setinggi 5 meter tersebut. “Murni bunuh diri, karena tidak ditemukan tanda-tanda penganiayaan dari tubuh korban,” ucapnya. Dikatakannya, korban diketahui kerap meminta-minta makanan kepada warga sekitar. “Korban ini mengalami stres, jadi sering memintaminta makanan kepada warga sekitar sini. Dan dia kerap bermain-main dilokasi sini,” tandas perwira satu melati emas dipundaknya ini. Guna proses penyelidikan, jenazah korban pun dibawa ke RS. Pirngadi Medan. Sedangkan barang bukti berupa, akar pohon yang digunakan korban untuk menggantung dirinya serta sandal jepit korban kini diamankan ke Polsekta Medan Barat. “Mayatnya kita bawa ke rumah sakit Pirngadi dahulu, menunggu keluarganya datang,” pungkas orang nomor satu di Polsekta Medan Barat ini mengakhiri perbincangan pada Posmetro Medan. (eza/pmg)

Hakim berpendapat, perbuatan terdakwa termasuk sadis yang membunuh kakak iparnya hanya untuk melampiaskan dendamnya dengan alasan, kakar iparnya menjadi orang yang mengakibatkan dirinya bercerai dengan sang istri. “Mengadili terdakwa atas nama Adi Aryanto dengan hukuman penjara seumur hidup. Hal yang memberatkan prilaku terdakwa tidak berprikemanusiaan, dan tergolong sadis. Selain itu, terdakwa juga diketahui sudah kerap keluar masuk penjara,” ucap majelis hakim yang diketuai Nelson Marbun, kemarin (5/9). Dijelaskannya, terdakwa dikenakan pasal 340 KUHPidana, tentang pembunuhan berencana. Selain hal yang memberatkan karena perbuatannya tergolong sadis, majelis hakim pun memberi pertimbangan hal-hal yang meringankan terdakwa karena telah mengakui dan merasa bersalah atas perbuatannya serta selama proses persidangan berprilaku sopan. Menanggapi vonis hakim, terdakwa pun mengajukan banding. Langkah sama dilakukan JPU Nilma, yang mengaku mengambil langkah banding. Pantauan POSMETRO (grup Koran ini), sikap Adi Aryanto berbeda jauh pada saat sidang tuntutan sebelumnya. Hari itu ia tampak tenang, hal berbeda ia tunjukkan pada sidang tuntutan beberapa waktu lalu, di mana ia mengamuk dan menantang semua pengawas sel tahanan sementara Pengadilan Negeri (PN) Medan, ditengarai sebuah sendok makan. Duduk manis di bangku pesakitan ruang utama PN Medan, Adi yang mengenakan baju putih dibalut baju tahanan bernomor punggung 06 berwarna orange, Adi pun terlihat dengan seksama mendengarkan dakwaan dan tuntutan yang dirangkum dan dibacakan majelis sebelum memvonisnya. Pada persidangan yang dimulai sekitar pukul 16.00 WIB hari itu, suasana persidangan pun tampak berbeda. Hal itu terlihat adanya lima orang anggota kepolisian yang berada di ruang persidangan, sementara satu orang pengawal tahanan tampak ber-

diri sigap di sebelah meja Jaksa Penuntut Umum (JPU) Nilma. Diketahui pula, tuntutan JPU Nilma terhadap Adi, yang tinggal di Desa Karang Sari Gang UBS Kecamatan Medan Polonia ini, disahkan oleh majelis hakim yang mengenakan terdakwa pasal 340 KUHPidana, tentang pembunuhan berencana. Kasus Adi sendiri diketahui bermula pada Selasa 27 Desember 2011 silam sekitar pukul 15.30 WIB, bertempat di kamar 17 Hotel Bukit Hijau Jalan Jamin Ginting Km 11 Medan dengan sengaja membunuh Elida Hasibuan yang notabene kakak kandung mantan istrinya. Saat itu terdakwa mengundang Elida ke hotel beralasan untuk memberikan sesuatu benda atau kenang-kenangan kepada korban. Namun nahas, niatnya ternyata berubah dan berusaha memperkosa korbannya di mana sebelumnya mengatakan “kakak sudah janda sementara aku sudah duda, ya udah kita melakukan persetubuhan saja,” ujarnya sesuai BAP. Sebelum membunuh korbannya, Adi juga terbukti meminta atau memaksa korban untuk melakukan persetubuhan dengan membuka paksa celana korban. Akan tetapi korban Elida saat itu melakukan perlawanan dan berteriak minta tolong sehingga terdakwa menutup mulut korban dengan menggunakan celana panjang milik korban. Selain itu karena kalap, terdakwa menggunakan kain sprai mengikat tangan korban dan menjambak korban dan langsung menggorok leher Elida secara berulang-ulang sampai kurang lebih lima kali tebas. Setelah itu, terdakwa berusaha membakar korban dengan menyiramkan minyak bensin yang berasal dari sepeda motornya. Mau Pukul Wartawan Ketika terdakwa keluar dari ruang sidang utama, dia sempat mengancam wartawan yang ingin mengabadikan fotonya. “Dia sempat mau mukul wartawan yang ngambil fotonya, dia sempat melirik tajam ke arah wartawan dan mengepal tangannya ke arah salahsatu wartawan,” jelas salahsatu pengawal tahanan. (gib/pmg)

Paman Cabul Dihukum Delapan Tahun Penjara


DIHUKUM 8 TAHUN- Adi Sofian Sinaga, paman cabul asal Huta Labuhan, Nagori Tigaras, Kecamatan Dolok Pardamean dihukum delapan tahun penjara di PN Simalungun, Rabu (5/9).

SIMALUNGUN– Paman cabul Adi Sofian Sinaga (33), warga Huta Labuhan Nagori Tigaras, Kecamatan Dolok Pardamean, dihukum delapan tahun penjara di PN Simalungun, Rabu (5/9). Itu setelah terdakwa terbukti bersalah dan meyakinkan mencabuli keponakannya yang masih berusia lima tahun sebut saja Mawar. Putusan terhadap terdakwa dibacakan majelis hakim dipimpin Ramses Pasaribu beranggotakan Gabe Doris dan Siti Hajar. “Berdasarkan keterangan saksi dan keterangan terdakwa di persidangan terungkap perbuatan terdakwa melanggar pasal 81 ayat 1 UU RI Nomor 23 Tahun 2002 tentang Perlindungan Anak. Terdakwa berhasil mencabuli Mawar sebanyak lima kali dengan imingiming memberikan uang Rp2 ribu,” sebutnya. Dia menerangkan, peristiwa itu berlangsung pada (16/4) sekira pukul 16.30 WIB. Saat itu, korban bertemu dengan terdakwa di depan rumah korban. Selanjutnya, terdakwa mengajak Mawar masuk ke

rumahnya. Setelah berada di rumah korban, terdakwa langsung menidurkan korban di atas tikar di depan ruang TV. “Setelah korban tergeletak di atas tikar, tanpa basa basi terdakwa langsung membuka celana korban. Kemudian terdakwa pun membuka celananya sendiri dan langsung menyetubuhi korban layaknya hubungan suami istri hingga puas,” ungkapnya. Sambung hakim Ramses, kejadian berikutnya berlangsung pada Agustus, sekira pukul 15.00 WIB. Terdakwa kembali datang ke rumah korban dan mendekati korban yang saat itu sedang tidur-tiduran di ruang TV. Kemudian terdakwa membuka celananya dan langsung memasukkan kemaluannya. Saat itu, korban langsung menjerit dan berkata ‘jangan tulang’. Akan tetapi terdakwa saat itu hanya diam saja sambil tetap melakukan aksinya. “Setelah puas, terdakwa pun langsung memberikan uang Rp2 ribu terhadap korban. Peristiwa itu berlangsung hingga lima kali dan akhirnya orangtua korban mengetahui perbuatan tersebut. Korban sering menangis karena

kemaluannya terasa sakit,” terang hakim. Untuk hal memberatkan, perbuatan terdakwa merusak masa depan korban. Seharusnya terdakwa melindungi korban karena masih saudara. Sementara hal meringankan terdakwa merasa bersalah dan selaput darah korban masih normal. Sehingga berdasarkan pertimbangan itu maka majelis hakim yang mengadili perkara tersebut menyatakan terdakwa terbukti secara sah dan meyakinkan melakukan persetubuhan terhadap anak dibawah umur. “Selanjutnya menjatuhkan hukuman terhadap terdakwa delapan tahun penjara dengan denda Rp100 juta subsider enam bulan penjara. Hukuman itu jauh lebih ringan dibandingkan tuntutan Jaksa, Nurdiningsih yakni sembilan tahun penjara,” ujar Ramses. Sementara usai mendengarkan hukuman itu terdakwa hanya tampak terdiam sambil tertunduk. Terdakwa mengaku menerima putusan yang dijatuhkan oleh majelis hakim. (mua)

Foto Gibson

„ Adi Aryanto, terdakwa kasus pembunuhan saat mendengarkan putusan hakim di PN Medan.

Telat Pulang, Istri Dipukuli MEDAN- Hanya karena terlambat pulang ke rumah, Abdul Rohim (32) nekat memukuli istrinya Melisa (29). Akibatnya, warga Jalan Marwar, Medan Polonia ini memilih membuat pengaduan ke Polresta Medan. Atas kejadian tersebut paha, tangan dan betisnya korban mengalami memar karena dipukuli sang suami, Rabu (5/9) siang. Laporan Kekerasan Dalam Rumah Tangga (KDRT) di Unit Perlindungan Perempuan dan Anak (UPPA) Polresta Medan itu tertuang dalam No Laporan:R/499/XI/2012/SPKT RESTA MDN. Kepada petugas, korban mengaku, kejadian pemukulan itu terakhir kali Senin (3/9), saat itu korban yang baru pulang dari tempatnya bekerja di Jalan Brigjen Katamso/Kampung Baru pulang ke rumah, Selasa (4/9), sekitar pukul 22.30 WIB. Sesampainya di rumah, ia lang-

sung dimaki-maki suaminya dan menudingnya telah mangkal sebelum tiba di rumah. Mendengar itu, korban pun tidak terima dan menjawab semua perkataan suaminya, hingga tersangka pun kalap menunjangi istrinya sampai tersungkur. Beruntung, aksi main hakim sendiri itu tak berlangsung lama. Pasalnya, anak bungsunya terbangun dari tidurnya hingga pertengkaran mereka terhenti. Diketahui, sejak setahun terakhir, suaminya memang kerap memukulinya, tepat semenjak dirinya bekerja di Jalan Brigjen Katamso. Karena takut aksi main hakim sendiri itu berulang-ulang, korban akhirnya memilih membuat pengaduan ke Mapolresta Medan atas kejadian tersebut yang kini kasus KDRT tersebut masih dalam penyelidikan oleh unit PPA, Polresta Medan. (eza/ pmg)


6 September 2012

Krisis Surat Kabar hanya Terjadi di Amerika Utara KIEV - Jawa Pos (grup METRO ASAHAN) lagi-lagi mendapat perhatian khusus di ajang tingkat internasional. Pada hari kedua World Newspaper Congress Ke-64 yang dihelat WAN-IFRA di Ukrainian House, Kiev, Selasa (4/9), ruang redaksi Jawa Pos dipilih sebagai The Coolest Newsroom.Ruang redaksi tersebut, yang terletak di lantai 4 gedung Graha Pena Jawa Pos Surabaya, merupakan salah satu di antara lima newsroom yang dibahas khusus. Tepatnya dalam sesi World Editors Forum yang dipimpin Juan Senor, pakar koran kelas dunia dari Innovation Media Consulting Group

Inggris. Sesi itu merupakan bagian dari rangkaian kongres yang terus memikirkan bagaimana koran bisa terus mengembangkan diri di masa mendatang. Juga, bagi Juan Senor, lulusan Oxford University, bentuk dan suasana ruang redaksi punya peran tak kalah penting. “Semua orang mengkhawatirkan masa depan surat kabar. Tapi, bagi saya, yang lebih menakutkan adalah sebuah newsroom yang berantakan. Para jurnalis tertidur di sembarang tempat. Kertas-kertas menumpuk tak beraturan di meja. Itu mengerikan,” ujar Senor, mantan

Jangan Persulit Penganut Parmalim Urus e-KTP JAKARTA- Pemerintah Daerah di Sumatera Utara kembali diingatkan agar jangan mempersulit warga penganut aliran kepercayaaan Parmalim, untuk mengurus Kartu Tanda Penduduk Elektronik (eKTP). Sebab merupakan hak setiap warga negara yang telah berusia diatas 17 tahun maupun yang telah menikah, untuk memperoleh eKTP. Penegasan tersebut kembali dikemukakan Kepala Pusat Penerangan Kementerian Dalam Negeri (Kapuspen Kemendagri) Reydonnyzar Moenek di Sumedang, Rabu (5/9). Ia menilai hal ini perlu disampaikan, agar tindakan Pemerintah Kabupaten Kuningan yang menghentikan pembuatan eKTP pengikut Ahmadiyah di Desa Manislor, Kecamatan Jalaksana, Kabupaten Kuningan, Jawa Barat, tidak meluas hingga ke daerahdaerah lain. Meskipun alasan penghentian, untuk menjaga kondusifitas, setelah adanya protes sebuah organisasi keagamaan. “Stateman Sekda (Sekretaris Daerah) Kuningan menghentikan sementara e-KTP, itu sama sekali tidak benar,”ungkap kapuspen yang setiap saat memberi keterangan kepada para wartawan ini. Menurutnya sesuai dengan Peraturan Pemerintah Nomor 37 tahun 2012 tentang administrasi kependudukan, sangat jelas dikemukakan. Bahwa e-KTP merupakan hak semua warga negara yang berdomisili Indonesia. Dan

sama sekali tidak mempersoalkan agama. “Formulir untuk kolom agama, itu kan hanya boleh diisi dengan salah satu dari enam agama yang diakui negara. Tapi misalnya aliran kepercayaan seperti Parmalim ingin mencantumkan dari salah satunya bisa. Tapi tidak boleh dengan nama aliran kepercayaan tersebut. Karena pilihannya hanya ada hanya enam. Tapi kalau nggak mau, itu bisa dikosongkan kolom tersebut,”ungkapnya. Oleh sebab dalam kesempatan kali ini, Donny tidak saja hanya mengingatkan Pemkab Kuningan. Namun juga Pemda Sumut, dan sejumlah pemerintah daerah lainnya. “Karena untuk soal keyakinan, negara tidak bisa ikut campur. Dan kalau pun untuk kolom agama itu dikosongkan, itu hak warga negara tersebut. Itu boleh dan dibenarkan. Tapi kalau diisi diluar enam, tidak boleh. Saya sudah kontak dengan Pemkab, kita sudah ingatkan bahwa itu tidak benar.” Sementara terhadap masyarakat sendiri, Donny secara khusus juga mengharapkan agar setiap warga masyarakat yang telah cukup usia untuk segera mengurus e-KTP. Alasannya sangat sederhana. “Karena setiap warga negara (yang usianya telah cukup), itu wajib. Apalagi per 1 Januari 2013 mendatang, e-KTP telah berlaku sebagaimana diatur dalam Peraturan Presiden nomor 67 tahun 2011. Jadi rugi kalau tidak urus eKTP. Karena basis data semua menggunakan e-KTP.”(gir)

Pilih Cara TTradisional radisional Sambungan Halaman 1 Mulai dari pijat, lulur sampai totok muka menjadi ‘obat’ pilihan Aura agar tetap terlihat cantik. Alhasil, biaya yang dikeluarkan pelantun ‘Mari Bercinta’ itu pun lebih murah dibanding perawatan modern. “Alhamdulillah nggak yang harus mahal-mahal, suntik sana-sini, tradisional aja, pijit, lulur, totok

presenter Wall Street Journal TV dan CNBC Europe. Sebuah produk jurnalistik yang bagus, papar Senor, tidak bisa dihasilkan bila rumah tempat pembuatnya sudah tidak keruan. “Logikanya, jika ingin membuat koran yang bagus, harus diciptakan integritas yang seimbang antara hardware, dalam hal ini ruangnya, dan software, dalam hal ini orangorangnya,” tuturnya. “Dan menimbang itu semua, saya menobatkan ruang redaksi Jawa Pos sebagai yang terkeren, the coolest, jika dibandingkan dengan newsroom media lain di seluruh dunia,” tegas dia. Dalam sesi itu, di layar lebar ditampilkan video tentang suasana ruang redaksi Jawa Pos. Bagaimana sebuah ruang besar itu terasa sangat terbuka, dilengkapi peralatan gym dan olahraga, studio musik, serta meja meeting melingkar yang memudahkan interaksi dan komunikasi. “Newsroom Jawa Pos tak ubahnya seperti arena playground (bermain, Red) besar. Itu contoh ideal suasana menyenangkan untuk membuat surat kabar,” tambah Senor. Ruang redaksi lain yang mendapat pujian milik Le Journal de Montreal (Kanada), sebagai newsroom dengan pembagian space terbaik. Gelar newsroom paling modern di benua Amerika diberikan kepada koran Venezuela, Cadena Capriles, serta harian Peru, El Comercio. Di Asia, ruang redaksi paling modern adalah milik India Today Multiplex yang baru saja selesai dibangun. Panelis Masa Depan Koran Pada sesi sore hari, dalam diskusi panel Print Plus tentang masa depan surat kabar, Jawa Pos juga mendapat kesempatan untuk tampil. Direktur Utama PT Jawa Pos Koran Azrul Ananda dipilih sebagai salah satu panelis bersama beberapa pakar se-


„ Ariyanti Kurnia, Anabel Hernandez, Leak Kustiya, dan Agung Kurniawan saat wawancara dengan penerima Golden Pen of Freedom kemarin. nior kelas dunia. Di panggung utama konferensi itu, duduk pula Mario Garcia (CEO dan pendiri Garcia Media, Amerika Serikat), Raul Dharival (CEO The Times of India), Rainer Esser (CEO Die Zeit, Jerman), dan Claire Boonstra (co-founder dan business development director Layar, Belanda). Diskusi itu dimoderatori Eamonn Byrne, salah seorang konsultan koran paling terkenal dari Inggris (The Byrne Partnership). Dalam sesi tersebut, pada dasarnya disepakati krisis koran hanya terjadi di Amerika Utara. Di Eropa dan Amerika Latin, koran masih menunjukkan pertumbuhan positif. Baik dalam sirkulasi maupun pemasukan iklan. Asia lebih hebat lagi, tumbuh paling baik. Byrne juga menunjukkan hasil riset yang memperlihatkan kalau masa depan online justru lebih berat. Pemasukan (revenue) online tidak tumbuh dalam beberapa tahun terakhir dan diprediksi tidak akan tumbuh dalam beberapa tahun

ke depan. Bahwa ada koran yang tidak tumbuh dalam beberapa tahun terakhir, maka itu adalah akibat dari perbuatan koran itu sendiri. Khususnya di Amerika Serikat. “Dalam beberapa tahun terakhir, koran telah mengalokasikan begitu banyak biaya untuk memikirkan online. Tapi, bukan itu yang mematikan koran. Yang mematikan adalah: Dalam beberapa tahun terakhir, koran telah mengalokasikan begitu banyak brainpower (orang dan pikiran) untuk online. Padahal, online terbukti kurang menghasilkan. Seandainya brainpower itu fokus ke koran, hasilnya mungkin berbeda,” jelas Byrne. Mario Garcia menambahkan, “Kalau orang masuk kerja di koran tidak happy dan merasa korannya akan punah, apa yang dia takutkan itu justru akan terwujud. Beda kalau kita masuk kerja dengan penuh semangat.” Garcia menegaskan, koran bukan hanya akan bertahan 10

7 PNS Palsu Terkuak di Pemkab Batubara Sambungan Halaman 1 tersebut tidak dapat menunjukkan SK asli, maka pihaknya menghentikan gaji menunggu keputusan dari BKN pusat. Saut menyatakan, belum dapat berbuat banyak menyikapi kasus CPNS palsu itu,

karena belum ada jawaban dari intansi berwenang menyatakan keberadaan mereka. “ Untuk saat ini BKD telah menghentikan sementara gaji mereka, tinggal lagi untuk sikap selanjutnya apakah pemberhentian atau menindak lanjuti ke tingkat hukum kita lihat nanti,” ujar Saut.

Ditambahkan Saut, modus para PNS palsu ini dilakukan dengan cara menunjukkan surat mutasi dari daerah Rokan Hulu dan Aceh ke Batubara, dilengkapi dengan surat keterangan dari Sekda asal yang bersangkutan, juga ada surat BKN Regional IV.(CK-1)

muka, aku tradisional banget,” tuturnya usai mengisi acara musik ‘DahSyat’ di Studio RCTI, Kebon Jeruk, Jakarta Barat, Rabu (5/9). Selain dengan perawatan tradisional, Aura mengaku rajin minum jus agar wajahnya tetap fresh. Selain jus, ia juga tak pernah lupa untuk selalu minum air putih. “Jus aku bikin sendiri, yang mengandung vitamin C, sisanya minum air putih,” jelasnya. (int)

Pemuda Tewas Disenggol Truk

Prangko Bergambar Mobil Listrik Diluncurkan Sambungan Halaman 1 masyarakat yang sedang berolah raga pagi di kawasan Monas. “Waktunya sengaja dipilih pagi hari pada saat matahari sedang muncul di ufuk timur dan dilakukan di tengah masyarakat, sebagai simbol era baru transportasi yang ramah lingkungan dengan mobil listrik,” kata Awie Setiawan selaku koordinator acara di sela-sela acara peluncuran prangko terbaru PT Pos Indonesia. Sedangkan Dahlan menilai prangko bergambar mobil listrik yang dibanggakannya itu sangat menarik dan inovatif. “Karena ini merupakan wujud nyata gerakan menuju era transportasi listrik,” kata Dahlan sebelum membubuhkan tanda tangan pada sampul berukuran besar bertuliskan kalimat “Selamat Atas Terbitnya Prangko Baru Ini”. Menurutnya, saat ini pemerintah mengembangkan beberapa purwarupa mobil listrik. Karenanya,

Dahlan berharap PT Pos membuat beberapa prangko berseri dengan gambar mobil listrik. “Saya usul, semua mobil listrik yang dikembangkan dibuat berseri sehingga masyarakat semakin mengenal berbagai model transportasi listrik,” cetusnya. Menanggapi permintaan Dahlan, Dirut PT Pos Indonesia I Ketut Mardjana langsung menyatakan kesanggupanya. Menurutnya, PT Pos Indonesia memang sudah siap memproduksi prangko seri transportasi listrik tersebut. “Produksinya akan dilakukan secara bertahap sesuai dengan kesiapan alat transportasinya dan momentum yang tepat,” ucapnya. Tanda tangan Dahlan Iskan tadi pagi menjadi puncak acara peluncuran perangko “Mobil Listrik” yang sebelumnya diawali di Kantor Pusat PT Pos Indonesia di Bandung pada 29 Agustus 2012 lalu. Acara dibandung itu juga dihadiri Ir Dasep Ahmadi yang dikenal sebagai pencipta mobil listrik. (aj/jpnn)

Anggota SPS No.: 438/2003/02/A/2007

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

sampai 20 tahun lagi. “Koran akan abadi asalkan bisa terus beradaptasi,” ucapnya. Setelah diskusi panel, Azrul punya kesimpulan lanjutan. “Intinya adalah fokus. Kalau korannya fokus mengembangkan koran, maka ia akan terus berkembang. Die Zeit yang terbesar di Jerman membuktikan itu. Ada koran Swedia yang juga membuktikan itu. Mereka di Eropa, tapi bisa tumbuh dengan strategi fokus ke print. Sama persis dengan yang dilakukan Jawa Pos selama bertahun-tahun,” paparnya. Secara pribadi, Azrul mengaku bangga sekaligus canggung berada di panggung tersebut. “Saya ini anak kemarin sore. Kalah kelas jauh sama pembicara yang lain. Tapi, bangga juga karena ada koran Indonesia yang diminta duduk di sana. Dan itu Jawa Pos,” ucap pria 35 tahun tersebut. Pendapat bahwa industri koran sebenarnya hanya krisis di Amerika Utara sebenarnya juga sudah disinggung dalam berbagai sesi sehari sebelumnya (Senin, 3/9). Dan Asia ditegaskan sebagai pendorong baru pertumbuhan koran. “Sirkulasi koran kini kembali naik. Pertumbuhan positif itu diprediksi berlanjut hingga akhir tahun ini,” kata Larry Kilman, deputy CEO dan executive director of communication and public affairs WAN-IFRA (asosiasi koran dunia). Dari data yang ada, disebutkan beberapa negara Asia mengalami pertumbuhan signifikan, baik secara bisnis maupun oplah. Khususnya di Tiongkok, India, dan Indonesia. “Koran-koran di Asia Pasifik harus diakui lebih bergairah. Tidak hanya didukung oleh pertumbuhan ekonomi, tapi koran di negaranegara tersebut telah berevolusi dengan kreativitas masing-masing,” pungkas Kilman. (ayi/iro/c11)

Sambungan Halaman 1

„ Ketua DPC Gerindra Batubara M Rafig menyerahkan berkas kepada Ketua KPU Khairul Anwan.

Mendaftar ke KPU Kader Gerindra Konvoi Sambungan Halaman 1 Batubara Khairil Anwar SH, mengucapkan apresiasi pada Partai Gerindra Batubara dan seluruh jajaran yang tengah memenuhi pendaftaran verifikasi parpol. Disampaikan Khairil,

Departemen Redaksi METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin PurbaEva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput)

penyerahan berkas merupakan syarat yang harus dilaksanakan, guna dilakukan verifikasi secara faktual. “Hingga saat ini, masih dua parpol mendaftar yakni Partai Nasional Demokrat (Nasdem) dan hari ini Partai Gerindra,” kata Khairil.

Sementara Ketua Partai Gerindra Batubara M Rafi menurtkan, pihaknya optimis Partai Gerindra akan lolos menjasi peserta pemilu. Hal itu dibuktikan, dengan antusiasnya kader mengikuti proses penyerahan berkas partai untuk diverifikasi. (CK-1)

METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ardi, Roy Amarta, Ferdinan. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

memberikan pertolonngan. Namun naas, Irwansyah meghembuskan nafas sebelum dibawa ke rumah sakit, sementara adiknya Herdiansyah mengaoami luka ringan. Kepada METRO, Hardiansyah (21) mengatakan, dia dan abangnya hendak pulang ke rumah, namun di perjalan mengalami kecelakaan karena hendak mendahululi kendaraan yang berada di depan mereka. “Waktu mau mendahului kendaraan, tiba – tiba ada truk di depan kami. Abang saya sudah berusaha menghindar, tapi tetap terjadi benturan dan kepala abang saya terbentur di badan truk hingga dia tewas di lokasi,” katanya. Kapos Lantas Pulau Raja Aiptu Mariadun ketika dikonfirmasi, membenarkan peristiwa itu dan ketika petugas tiba di lokasi, mereka tidak menemukan supir dan hanya mengamankan truk dan sepedamotor korban. “Supir truk melarikan diri, kendaraannya sudah kita amankan di mapolsek,” katanya. (sof)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


KAMIS 6 September 2012

Paket Internet Terbaik 2 GB Dengan Koneksi Tercepat Sambungan Halaman 8

diikuti oleh para talenta berbakat Indonesia. Launching produk ini juga dilaksanakan di Kota Siantar, Rabu (5/9) kemarin di Rumah Makan Garuda yang dipimpin manejer graPARI Siantar Eko Admaja didampingi Manejer Sales Yogi dan karuawan lainnya. Acara tersebut dihadiri Mitra dan para Outlet. Pelanggan juga bisa menikmati paket internetan sebesar 500 MB hanya dengan Rp 20.000 untuk 30 hari. Dengan kedua pilihan paket tersebut, kini pelanggan simPATI dapat melakukan asyiknya chatting, browsing, social networking, email, upload, dan download di ponsel cukup dengan mengakses *999#. Kartu perdana simPATI terbaru hadir dengan harga yang lebih terjangkau hanya Rp 3.000 sudah termasuk kuota akses 3G sebesar 100 MB selama 30 hari sejak diaktifkan. Sebagai bagian yang tidak terpisahkan dalam kehidupan sehari-hari, simPATI berkomitmen untuk selalu menghadirkan keceriaan guna mendukung kebutuhan komunikasi dan akses internet para penggunanya. Bentuk keceriaan tersebut diwujudkan simPATI melalui penggelaran kompetisi Dance Like Agnes yang merupakan kompetisi dance untuk mencari 20 pemenang di tingkat nasional. Mereka yang terpilih akan ikut menjadi dancer pada konser Agnes Monica di bulan Desember 2012 mendatang. Untuk mengikuti kompetisi ini, peserta cukup mengakses Pada proses berikutnya, mereka diminta untuk mengunggah (upload) hasil karya video dance mereka sendiri. Video dance yang mereka kirim merupakan video yang dikreasikan dengan beberapa gerakan Agnes Monica yang muncul pada iklan simPATI di televisi. Peserta dapat mulai mengirim video dance pada 5 September 2012. Dari seluruh video yang masuk, Agnes Monica akan memilih 200 video terbaik yang akan dipilih

oleh publik melalui microsite Head of Marketing Communications Group Telkomsel Irlamsyah Syam mengatakan, “Telkomsel menyadari bahwa jumlah pengguna mobile internet di Indonesia terus bertambah seiring dengan semakin tingginya kebutuhan masyarakat terhadap akses informasi maupun hiburan terkini. Kompetisi Dance Like Agnes merupakan salah satu tools bagi kami untuk memberikan gambaran wujud keceriaan dan gaya hidup penuh mobilitas, yang diidentikkan dengan karakteristik pengguna simPATI.” Nantinya sebanyak 20 pemenang dengan vote/like terbanyak akan mengikuti proses pelatihan bersama Agnes Monica dan NEZindaHOOD di Jakarta. Selain itu, masing-masing pemenang juga akan mendapatkan berbagai hadiah berupa Samsung Galaxy S3, uang tunai Rp 10 juta, saldo T-Cash sebesar Rp 5 juta, pulsa simPATI senilai Rp 5 juta, dan paket internet 1 GB/ bulan selama 1 tahun. “Beragam aktivitas yang saya jalani sehari-hari tentu harus diimbangi dengan akses komunikasi yang mampu memberi solusi maksimal. Kebutuhan akses internet untuk mengirim video, browsing, chatting, kirim email, dan download lagu melalui handset mutlak terpenuhi guna mendukung rutinitas pribadi. Oleh karenanya, kehadiran simPATI sangat memudahkan saya dalam berkomunikasi data karena produk ini memiliki kecepatan akses tinggi yang mencapai 7.2 Mbps,” ujar Agnes Monica selaku brand ambassadorproduksimPATI. Aktivitas mobile lifestyle pelanggan simPATI semakin optimal berkat dukungan jaringan terluas berkualitas Telkomsel. Lebih dari 50.000 Base Transceiver Station (BTS) termasuk di antaranya 13.000 Node B (BTS 3G) telah tersebar di seluruh wilayah Indonesia. Telkomsel juga telah menyiapkan akses bandwidth internet berkapasitas 20 Gbps demi menjamin kelancaran akses komunikasi data. (leo)

Belum Diresmikan

Sambungan Halaman 8

anggota DPRD untuk melaksanakan tugas. Bagian atap telah banyak yang bocor dan ruang gedung terlalu sempit. “Penggunaan gedung ini telah melalui pengusulan ke Pemko Tanjungbalai melalui Sekretariat DPRD (Sekwan),” katanya.

Ditambahkannya, gedung DPRD yang baru dibangun, mulai dikerjakan tahun 2007 dan selesai pada tahun 2012. Sementara Sekretaris Dewan Ramadhan Syahdan SH mengatakan, penempatan gedung DPRD Tanjungbalai yang baru telah melalui pengusulan. Walau belum diresmikan, tetapi telah layak digunakan. (ilu)

Warga Protes Proyek PNPM

Jalan Masih Bagus Dibongkar SIANTAR- Warga di Jalan Sriwijaya Gang Hasanah Kelurahan Melayu, Siantar Utara, protes terhadap pengerjaan PNPM. Menurut mereka, proyek itu tak tepat sasaran. Sebab pengerjaan ditujukan untuk membongkar jalan yang notebenenya masih bagus. Kejadian bermula saat dua tukang datang ke Gang Hasanah dan membongkar jalan di gang tersebut. Masih sedikit yang berhasil dibongkar, warga langsung datang dan meminta supaya tukang memberhentikan aktifitasnya. Menurut warga, jalan mereka masih bagus dan belum ada yang rusak. Jika dibongkar dengan alasan untuk dibangun kembali, itu sangatlah tidak te-


„ Warga yang protes soal jalan yang dihancurkan. Rabu (5/9) pat. Bahkan mereka menganggap pengerjaan PNPM tersebut tidak tepat sasaran. Sebab masih banyak infrasturktur yang harus diperbaiki. Akibat warga protes, kedua

pekerja tersebut pergi dan meninggalkan pekerjaan mereka. Menurut Lisna br Pasaribu yang ditemui di lokasi menyebutkan, pembongkaran jalan di gang itu ditolak dan tidak disetujui oleh

sejumlah warga. “Ini masih bagus, lalu kenapa dibongkar. Sementara parit yang sudah tersumbat tidak diperbaiki. Makanya kami protes,” sebut Lina.

Sementara Riduan selaku pelaksana pembangunan pengerjaan tersebut mengatakan, dana pembangunan itu bersumber dari PNPM sebanyak Rp10 Juta. Dana itu diperuntukkan membongkar jalan sepanjang 82 meter dengan lebar 1,2 meter. Ia mengatakan, bahan yang akan dibuat jalan jenis paving blok atau tidak dicor lagi. Sebab juklak-nya diperuntukkan untuk pembangunan jalan dan konsepnya adalah pengerjaan jalan di Gang Hasanah. Sementara Lurah Melayu Makdin Sagala mengatakan, pihaknya tidak bisa mengintervensi soal letak pengerjaan PNPM. Menurutnya pihaknya hanya sebatas mengetahui saja. (pra/hez)

Empat Pengurus Pramuka Ngadu ke Kwarda Sambungan Halaman 8

dan 3 rekannya yang selama ini bekerja di kantor Kwarcab Asahan di Kelurahan Mekar Baru Kecamatan Kisaran Barat, Asahan, seharusnya tetap masih sebagai pengurus, setelah ada pengesahan, pengukuhan dan pelantikan pengurus yang baru. Ketua terpilih Amir Hakim, lanjut Basuki, merupakan peraih suara terbanyak padaa Muscab Gerakan Pramuka Kwarcab Asahan yang diselenggarakan 4 Juli 2012 lalu mengalahkan dua kandidat la-

in, Drs Supomo dan Hj Sri Mariani. Setelah terpilih, Amir Hakim didampingi beberapa formateur akan menyusun kepengurusan periode 2012-2017. “Setelah komposisi kepengurusan terbentuk, terjadilah tindakan pemecatan itu,” kata Basuki, kesal. Tidak tercatat sebagai pengurus, terang Basuki, bukan menjadi masalah, tetapi pemecatan dirinya dan 3 rekannya harus memiliki alasan yang jelas. Sesuai aturan, pemecatan karyawan/pekerja atau staf pada Sekretariat Gerakan Pramuka Kwarcab Asahan melanggar

UU Nomor 12 Tahun 2010 pasal 29 ayat 5 yang berbunyi, “kepemimpinan kwartir cabang bersifat kolektif” dan bunyi anggaran dasar Gerakan Pramuka pasal 30 Kwartir adalah satuan organisasi pengelola Gerakan Pramuka yang dipimpin secara kolektif pada setiap tingkatan wilayah, pada pasal 91 ayat 9 disebut juga selama pengurus kwartir cabang yang baru, hasil musyawarah belum dilantik, maka pengurus kwartir lama tetap melaksanakan tugasnya, dengan ketentuan tidak dibenarkan mengambil keputusan mengenai hal-hal yang prinsip,

Distribusi e-KTP di Kisaran Timur Lambat Sambungan Halaman 8

yang membutuhkan KTP,” katanya. Dijelaskannya, dirinya sangat kesal karena ada tetangganya yang baru melakukan perekaman tetapi KTPnya sudah selesai.

Terpisah, Camat Kisaran Timur Rahmat Hidayat SSos MSI yang dikonfirmasi dikantornya di Jalan Asahan-Rantau Prapat mengatakan, penyaluran eKTP belum tuntas. “Memang dari pusat e-KTP sebanyak 570 ribu lembar telah datang, tetapi belum seluruh-

nya sempat dibagikan. Petugas hanya mampu membagi 500 lembar per hari,” katanya. Menyangkut soal yang duluan siap, lanjut Rahmat, pengerjaannya dilakukan oleh pusat, sehingga soal siapa yang duluan merupakan wewenang pusat. (mar)

MUI, hadir H Nukmat Adam SHMH, H Mahmudin Lubis, Ahmad Qosim Marpaung SAg dan Sutrisno SSos dan beberapa pengurus. Mewakili Ketua MUI Asahan Salman Abdullah MA yang tidak dapat hadir karena ada kegiatan lai, pengurus MUI menyatakan sangat senang menyambut kehadiran pengurus LSM dan Wartawan Asahan. S Hamonangan Siahaan dalam sambutannya mengatakan, dirinya dan M I Nasution merasa terpanggil untuk menjaga hubungan antara wartawan dan LSM serta MUI yang sempat mengalami kesalah-

pahaman beberapa waktu lalu. Kesalahpahaman yang sempat berujung dengan unjuk rasa di Masjid Agung, Kisaran barubaru ini. “Ini masih dalam rangka Lebaran, maka jika ada kesilapan oknum LSM dan Wartawan yang tidak berkenan, mohon dimaafkan.Semuainimasihbutuh bimbingan yang banyak dari ulama,” kata Hamonangan. Hal senada disampaikan MI Nasution dan Ketua PWI Asahan Awaluddin SAg. “Wartawan dan ulama, samasama membina umat. Ke depan ini kita harapkan tidak terjadi lagi,” kata Nasution. (van)

seperti: mengadakan kerjasama dengan pihak ketiga; menandatangani pengeluaran uang di luar program kerja; mengubah struktur organisasi kwartir dan/atau mengadakan alih tugas staf. Diterangkannya lebih lanjut, pengesahan ketua kwartir dipilih oleh musyawarah, diangkat oleh presidium dan disahkan dengan surat keputusan presidium. Pengukuhan pengurus kwartir cabang yang terdiri atas ketua, wakil ketua, sekretaris, bendahara, dan andalan ditetapkan dengan surat keputusan ketua majelis pembimbing cabang dan dikukuhkan dengan surat keputusan ketua kwartir daerah dan pelantikan kepengurusan dilakukan sesudah pengukuhan dilaksanakan ketua Majelis Pembina. “Semua surat keputusan tentang pemberhentian staf dan surat-surat yang ditandata-

ngani Amir Hakim SP tidak sah dan batal menurut hukum mengingat Amir Hakim SP baru memasuki tahab pengesahan sebagai ketua yang dilakukan Presidium Muscab 2012,” katanya. Sementara Amir Hakim, Ketua Gerakan Pramuka Kwarcab Asahan terpilih menyebutkan bahwa pemberhentian Basuki dan 3 staf Kwarcab Pramuka Asahan sudah berdasarkan prosedur. Diakuinya, pengurus Gerakan Pramuka Kwarcab Asahan belum dilantik, termasuk dirinya. Rasyid, salah seorang staf di secretariat Gerakan Pramuka Kwarda Sumatera Utara mengaku belum mengetahui soal pemecatan pengurus dan staf secretariat di Kwarcab Asahan. Dikatakannya, pihaknya siap menerima pengaduan dan laporan pelanggaran aturan, serta mencari solusi atas permasalahan yang timbul. (van)

Anak Perempuan dan Bersama Menjaga Kekondusifan Cucu Tinggalkan Rumah

Sambungan Halaman 8

yah Asahan dan sekitarnya sepakat untuk bersama-sama menjaga suasana kekondusifan di Asahan, sekaligus saling memberikan masukan untuk kemajuan pembangunan Asahan Kesepakatan ini terungkap dalam kunjungan silaturahmi wartawan yang digagas MI Nasution dan Anggota DPRD Asahan HS Hamonangan Siahaan ke kantor MUI Asahan di Jalan Turi, Kisaran. Hadir juga beberapa wartawan senior Yasir Ul Haq, Indra Sikumbang serta beberapa wartawan. Mewakili

Sambungan Halaman 8

karena masih kecil. Kalau soal nasehat dan pertengkaran soal biasa, tapi tujuan kami demi kebaikan,” katanya. Dijelaskan Adlan, sebagai orangtua, dirinya memiliki tanggungjawab untuk memberikan nasehat serta arahan dengan tujuan masa depan yang lebih baik. Ternyata, nasehat kepada anak sulungnya (Erna) tidak diterima dan menyebabkan ketersinggungan yang berakhir dengan meninggalkan rumah. “Memang saat ini hanya saya

dan adik-adiknya di rumah, sementara ibunya sedang di Malaysia, bekerja. Kami sempat telepon, katanya tinggal di Aceh Tamiang, tetapi ternyata tidak ada,” katanya. Ditambahkannya, dirinya pernahmendatangiPolsekAirJoman, oleh pihak Polsek disarankan untuk mencari terlebih dahulu ke rumah keluarga dan kenalan. “Bagi yang menemukan dan melihat, kami mohon bantuannya,” katanya, sambil menyebut cirri-ciri anaknya yang memiliki tinggi sekitar 162 centimeter, kulit sawo matang dan berat sekitar 50 kilogram. (ilu)

Sambungan Metro Asahan Massa Lempar Batu, Miliki Sabu & Ganja PNS Ditangkap Polisi Letuskan Tembakan Sambungan Halaman 1 demo pertama berada di Simpang Tiga areal PTPN 3 Batangtoru sekitar 1 kilometer dari Pasar Batangtoru menuju Hutaraja. Di sini, massa hanya berorasi dan tidak ada blokade petugas. Demo berlangsung dari pukul 10.00 WIB hingga 13.00 WIB. Dalam waktu bersamaan demo juga terjadi di Desa Telo atau sekitar enam kilometer dari Pasar Batangtoru. Di lokasi ini lah tempat terjadinya aksi saling dorong dan lempar batu. Dari pukul 10.00 WIB hingga pukul 12.00 situasi memanas. Massa dan petugas keamanan terlibat saling dorong dan lempar batu. Ketegangan antara warga dengan petugas keamanan baru reda ketika Wakapolres Tapsel Kompol Zainuddin dan perwakilan warga berbicara dari mobil dengan pengeras suara. “Saudara-saudara harus tenang, aso hita buat kesepakatan (agar kita bisa membuat kesepakatan),” kata Wakapolres. “Madung hami pareso langsung inda dong dope anggo pemasangan pipa i (kami sudah tinjau langsung bahwa pemasangan pipa belum ada),” kata salah seorang perwakilan warga dari atas mobil polisi. Namun, setengah jam kemudian, massa yang terdiri dari ibu-ibu, remaja putri, dan bapak-bapak yang memenuhi simpang tiga menyusul ke Desa Telo. Mereka terus menyuarakan keberatan atas rencana pemasangan pipa pembuangan tambang emas itu yang akan dialirkan ke sungai Batang Toru.

Dan beberapa saat tanpa dikomandoi, massa bergerak cepat menuju areal tambang yang berjarak sekitar 1,5 km dengan berjalan kaki dan naik sepeda motor serta becak. Dan lagi-lagi ribuan warga yang bermaksud memasuki areal tambang dihadang ratusan personil keamanan, dan ketegangan kembali terjadi antara massa dan petugas. Bahkan, massa berteriak bakar tambang emas tersebut. Mendengar teriakan ini, polisi melepaskan tembakan peringatan sebanyak satu kali. Akhirya sekitar 20 perwakilan warga yang ada di lingkar tambang diperbolehkan masuk untuk berdialog bersama pihak perusahaan. Namun hasil perbincangan masih belum mencapai kesepakatan hingga menjelang sore kemarin. Beberapa warga yang dimintai keterangan terhadap tujuan utama mengelar aksi tersebut mengaku keberatan jika limbah tambang dibuang ke sungai Batang Toru yang merupakan sumber kehidupan dan penghidupan ribuan warga di pinggirannya. “Sesuai dengan sosialisasi 2008 lalu limbah tambang direncanakan akan dibuang ke laut. Kenapa justru dibuang ke sungai Batang Toru. Padahal ribuan warga memanfaatkan aliran sungai tersebut termasuk untuk minum,” tegas beberapa warga dengan setengah berteriak menjawab pertanyaan METRO. (ran)

Sambungan Halaman 1 yang diterima polisi dari warga yang menyebutkan, Supriyadi diduga memiliki dan sering mengonsumsi sabu-sabu dan ganja. Mendengar ini, polisi lalu bergerak ke perempatan Jalan Melanthon dan Jalan Farel Pasaribu. Saat itu, Supriyadi baru saja keluar dari kantornya di Jalan Melanthon Siregar dan hendak pergi ke salah satu lokasi di Jalan Melanthon Siregar Ujung. Setelah menghentikan sepedamotor Supriyadi, polisi lalu mengintrogasi tersangka. Namun Supriyadi sempat berkilah dan mengaku tidak memiliki sabu dan ganja. Polisi tidak kehabisan akal, polisi lalu menggeledah kreta Yamaha

Xeon 5996 TAJ milik Supriyadi. Dari jok sepeda motornya polisi menemukan ganja sebanyak 5 gram. Polisi terus melakukan pengembangan, polisi lalu bergerak ke rumah Supriyadi dan menemukan satu paket kecil sabu-sabu di rumahnya Jalan Melati, Kelurahan Simarito, Siantar Barat. Sabu ini ditemukan di lantai II rumahnya. Dengan penemuan itu, polisi lalu menggiring Supriyadi ke Mapolres Siantar. Amatan METRO, dari pagi hingga sore, Supriyadi menjalani pemeriksaan di Unit Narkoba Polres Siantar. Saat diperiksa, Supriyadi sempat dijenguk istri dan keluarganya yang lain. Saat diwawancari METRO,

Supriyadi mengaku sebagai PNS di Badan PIT Kota Siantar dan bertempat tinggal di Jalan Melati Kelurahan Simarito, Siantar Barat. Namun dia membantah memiliki sabu dan ganja tersebut. Menurutnya, ganja dan sabu itu ditempelkan di jok sepedamotor bukan miliknya. Namun dia mengakui, sebelumnya pernah memakai ganja dan sabu-sabu. “Memang saya pernah memakai sabu dan ganja, tapi itu dulu, sekarang tidak lagi, “ jelasnya. Ketika METRO mendatangi kantor Badan PIT Kota Siantar, Ester br Pakpahan dan salah satu staf di bagian penerimaan tamu di badan itu menyebutkan, Supriyadi merupakan staf di Kantor PIT Kota Siantar.

Namun mereka tidak mengetahui penangkapan Supriyadi. Sementara Kepala PIT Rudi Dipo Silalahi dan Sekretaris PIT Fatimah Yanti Siregar sesuai penjelasan Ester, tidak bisa diganggu karena banyak tamu. Ditunggu hingga setengah jam di depan kantor itu, keduanya tidak kunjung bisa ditemui. Kasat Narkoba Polres Siantar AKP Sofyan membenarkan penangkapan tersebut. Dia mengatakan, Supriyadi masih diproses untuk kepentingan penyelidikan. Namun berdasarkan tes urine tersangka positif menggunakan sabu-sabu. Dari tangan Supriyadi disita ganja 5 gram dan satu paket kecil sabu-sabu. (ral)

Rakyat & Pemerintah Harus Kompak Tolak TPL Sambungan Halaman 1 TPL sudah jelas, karena tidak menguntungkan masyarakat dan pemerintah daerah. Masyarakat semakin miskin karena lahan pertaniannya diserobot paksa, dan pemkab merugi dalam hal kekayaan alamnya dirusak TPL,” tegas Johalim, Rabu (5/9). Menurutnya, dalam hal penolakan tersebut DPRD Simalungun sebagai lembaga perwakilan rakyat, pada prinsipnya pro rakyat. Sepanjang yang diperjuangkan masyarakat masih berjalan sesuai koridor peraturan perundang-undangan, DPRD Simalungun tetap menjadi garda terdepan. “Kita DPRD Simalungun harus pro rakyat. Negara ini terbentuk atas nama rakyat, dan pemerintahnya dibentuk

untukkepentinganrakyat.Rakyatmelarat adalah kegagalan pemerintah yang tidak mampu mensejahterahkan rakyatnya,” katanya. Lebih jauh, kata Johalim, pihaknya bukan tidak setuju investor datang ke Simalungun menanamkan modalnya. Tetapi ketika investor tersebut sudah membuat masyarakat melarat, tidak tertutup kemungkinan investornya harusdipaksaangkatkakidariKabupaten Simalungun. “Buat apa banyak investor datang ke Simalungun kalau masyarakatnya melarat. Harusnya semakin banyak investor datang datang ke Simalungun, masyarakatnya pun semakin sejahtera. Masyarakat sekitar sudah bisa ditampung untuk kerja di perusahaan tersebut. Tetapi kenyataannya, kedatangan investor pemilik TPL ke

Simalungun, malah membuat masyarakat petani melarat. Kalau begitu, sebaiknya TPL angkat kaki dari Kabupaten Simalungun,” tegasnya. Lebih jauh, Johalim mengutarakan rasa prihatinnya melihat nasip warga Nagori Pondok Bulu, Kecamatan Dolok Pangribuan yang rata-rata lahan pertaniannya diserobot paksa TPL. Mereka terpaksa hanya di rumah tanpa aktifitas. Sementara untuk ingin melamar kerja ke perusahaan, mereka sudah tidak diterima lagi karena usia sudah tergolong tua. Rata-rata warga yang menganggur itu berusia antara 35-60 tahun. J Nainggolan (60), salah seorang warga di sana mengatakan, sejak lahan pertaniannya diserobot paksa TPL pada tahun 2005, dirinya terpaksa di rumah saja. Untuk kebutuhan sehari-harinya,

dirinya ditanggung anaknya yang masih punya ladang di Pondok Bulu. “Lahan pertanian anak saya itu pun kemarin sempat mau diserobot TPL. Tetapikarenaadadilakukanperlawanan, hanya sebagian saja yang sempat ditanami eukaliptus,” ucapnya. Sementara itu, Direktur PT TPL Leo Hutabarat mengatakan, banyak masalah yang timbul oleh masyarakat itu sendiri. Di mana, lahan TPL banyak yang digarap masyarakat. Sementara lahan tersebut sudah diserahkan pemerintah untuk dikelola TPL. “Pada akhirnya, kita mengelola lahan kita, salah di mata masyarakat. Kita mau tau juga lahan mana yang katanya diserobot di Dolok Panribuan. Dalam waktudekatkitaakanturunkelapangan,” katanya. (osi)

KAMIS Edisi 207 th V

6 September 2012



„ Gedung DPRD Tanjungbalai yang baru, sudah ditempati walau belum diresmikan.


Belum Diresmikan TANJUNGBALAI-Walau gedung baru DPRD Tanjungbalai belum diresmikan, aktivitas 25 angota DPRD telah dipindahkan ke gedung yang dibangun dengan dana sekitar Rp4 miliar ini. Anggota DPRD Tanjungbalai dari PDI Perjuangan Surya Darma Ar, kepada METRO, Selasa (5/9) mengatakan, gedung DPRD yang lama tidak layak lagi untuk ditempati (FOTO: ISHAK LUBIS)

„ Surya Darma

Empat Pengurus Pramuka Ngadu ke Kwarda KISARAN-Pemecatan Basuki SPd MPd sebagai Kepala Sekretariat Gerakan Pramuka Kwartir Cabang Asahan bersama tiga staf sekretariat oleh Ketua Kwarcab Pramuka Asahan terpilih Amir Hakim melanggar Undang-undang Nomor 12 Tahun 1980 tentang Gerakan Pramuka.

Kepada METRO, Rabu (5/9), Basuki menjelaskan, putusan pemecatan yang dilakukan oleh Ketua Gerakan Pramuka Kwarcab Asahan terpilih Amir Hakim terhadap dirinya, dan tiga rekannya Suwarno, Rudi

Santoso Marpaung dan Zulfawati akan disampaikan ke pengurus Kwartir Daerah Sumatera Utara. “Ini melanggar AD/ART Gerakan Pramuka dan bentuk kesemenamenaan. Sebagai ketua ter-

„) Baca Empat ....Hal 7

Distribusi e-KTPdiKisaran Timur Lambat KISARAN-Penyaluran elektronik kartu tanda penduduk (e-KTP) untuk Kelurahan Kisaran Timur dinilai lambat. Warga mengaku mengeluhkan lambatnya eKTP disalurkan, sehingga menyebabkan urusan warga terhambat. Pharizal (35), warga Gang Serumpun Kelurahan Kisaran Timur, kepada METRO, Rabu (5/ 9) mengatakan, dirinya telah melakukan perekaman di kantor camat sekitar 5 bulan lalu tetapi sampai saat ini belum ada KTPnya. “Kita sangat butuh KTP, tetapi sampai saat ini belum datang. Sementara banyak urusan

„) Baca Belum ....Hal 7

Anak Perempuan dan Cucu Tinggalkan Rumah TANJUNGBALAI-Ernawati (28) dan anaknya berumur 5 tahun, meninggalkan rumah orangtuanya Adlan alias Ucok (45) di Sei Apung Kecamatan Tanjungbalai, Senin (27/8) lalu. Menurut Adlan, kepada METRO, Rabu (5/9), anak perempuannya yang berstatus janda meninggalkan rumah setelah dinasehati, dan sampai saat ini belum diketahui keberadaannya. “Kami berharap Erna segera pulang, kasihan cucu kami

„) Baca Anak ....Hal 7

pilih, Amir Hakim belum melalui tiga tahapan untuk dinyatakan sah sebagai ketua,” kata Basuki. Dijelaskan Basuki, dirinya

„) Baca Distribusi ...Hal 7

B a k ombur (FOTO: ISHAK LUBIS)

„ Ernawati (28).


LARIS-Buah durian asal Pinang Sori, Sibolga sangat digemari masyarakat Tanjungbalai. Harganya bervariasi, dimulai dari harga Rp6 ribu per buah.

Wak Alang: Wakil kito, sudah menempati gedung baru, katonyo gedung lama sudah tak memadai. Wak Ongah: Harusnya dengan gedung baru, wakil kito makin gita bekerja memperjuangkan rakyat. (**)


„ LSM dan Wartawan bersilaturahmi di kantor MUI Asahan.

Kontainer Tumbang Ganggu Jalinsum

Silaturahmi Wartawan dan Pengurus MUI

Bersama Menjaga Kekondusifan KISARAN-Pengurus Majelis Ulama Indonesia (MUI) Asahan dan pengurus lembaga swadaya masyarakat

BATUBARA-Kontainer dengan nomor 2011211 tergeletak miring di jalan lintas sumatera (jalinsum) Perdagangan, Rabu (5/9). Kontainer tanpa truk ini, diduga terjatuh setelah mengelakkan luban. Setelah terjatuh, truk yang mengangkut kontainer meninggalkan begitu

(LSM) serta kelompok wartawan yang bertugas di wila-

„) Baca Bersama...Hal 7

saja di pinggir jalan sehingga sedikit mengganggu pengendara yang melintas. M Manurung, personil pos lantas Limapuluh yang berada di lokasi belum mengetahui pemilik container, karena kemungkinan kejadian jatuhnya container pada malam sebelumnya. (ck-01)

„ Manejer graPARI Telkomsel Siantar, Eko Admaja foto bersama dengan para mitra telkomsel saat launching paket data simPATI dengan kuota 2 GB yang memiliki koneksi tercepat hingga 7.2 Mbps.

simPATI “The Best Prepaid Brand”

Paket Internet Terbaik 2 GB Dengan Koneksi Tercepat SIANTAR- Guna memenuhi kebutuhan pelanggan terhadap akses internet berkualitas, Telkomsel menghadirkan paket data simPATI dengan kuota 2

GB yang memiliki koneksi tercepat hingga 7.2 Mbps. Paket terbaru simPATI ini dapat diperoleh seharga Rp60.000 dengan masa berlaku 45 hari. Untuk

mendukung promo tersebut, Telkomsel menggelar kompetisi Dance Like Agnes yang bisa

„) Baca Paket ....Hal 7


„ Kontainer yang tergeletak di pinggir jalinsum, Rabu (5/9).

Kamis, 6 September 2012


Tak Pernah Digaji, Tapi Tetap Rajin Mengajar


„ Puskesmas Batu Tunggal tampak tutup saat jam kerja. Di depan puskesmas dipasang plang praktek umum dr Fachrul.

Puskesmas Batu Tunggal jadi Lokasi Praktek Umum DINKES DIMINTA TEGUR KEPALA PUSKESMAS

BATU TUNGGAL– Puskesmas pembantu di Desa Batu Tunggal Kecamatan NA IX-X menjadi lokasi praktek umum kepala puskesmas. Hal ini menjadi perbincangan yang hangat di tengah-tengah warga. Pemkab Labuhanbatu melalui instansi terkait yakni Dinas Kesehatan diminta melakukan teguran kepada dr Fachrul Ahyar selaku kepala puskesmas. Misno (36) warga Batu Tunggal, Rabu (5/9) menyebutkan, tindakan kepala puskesmas tak layak ditiru.

Sungguh teragis nasib para guru honorer di Sekolah Dasar (SD) Negeri Sei Kaluang Kecamatan Panai Hilir Labuhanbatu. Bertahun-tahun mengabdikan diri untuk peningkatan pendidikan di Sei Kaluang, namun mereka tak pernah mendapat perhatian dari Pemkab Labuhanbatu melalui Dinas Pendidikan. Bahkan selama bertahun-tahun mengajar di sekolah itu, mereka tidak sekali pun pernah menerima gaji. AHMAD EFENDI-PANAI HILIR


„ Para siswa di SD Negeri Sei Kaluang Kecamatan Panai Hilir sedang mengikuti peroses belajarmengajar, Selasa (4/9).

„) Baca Tak Pernah ...Hal 10

Keluarga Korban Pembunuhan Ngamuk Polisi Lepas Tembakan RANTAU- Puluhan keluarga dan rekan korban pembunuhan Yanuar Ansar Ritonga alias Dedek mengamuk di Pengadilan Negeri (PN) Rantauprapat, Rabu (5/9) sekitar pukul 15.30 WIB. Para keluarga korban itu mengejar terdakwa Surya Darma Dalimunthe alias Uyak yang berada di dalam mobil tahanan Kejaksaan Negeri Rantauprapat. Untuk meredam kericuhan, polisi terpaksa melepaskan tembakan ke udara. „) Baca Keluarga Korban ...Hal 10

„) Baca Puskesmas ...Hal 10


„ Pengurus DPC Partai Demokrat menyerahkan berkas kepada KPUD Labuhanbatu untuk persyaratan verifikasi, Rabu (5/9).

Anggota DPRD Labuhanbatu Malas Ngantor

DPC Partai Demokrat Labuhanbatu Mendaftar ke KPUD RANTAU- Sebanyak 20 orang kader Partai Demokrat Kabupaten Labuhanbatu, Rabu (5/9) sekira pukul 14.00 WIB mendatangi kantor Komisi Pemilihan Umum Daerah (KPUD) Labuhanbatu. Kedatangan mereka guna melengkapi persyaratan sebagai permohonan verifikasi usulan partai jelang Pemilu 2014 mendatang. Kedatangan Sawal Effendi Hasibuan SE mewakili Dewan Pimpinan Cabang (DPC) Partai Demokrat

„ Keluarga korban pembunuhan saling dorong dengan petugas kejaksaan yang mencoba melindungi terdakwa.

DPRDSU Curiga Ada Perambahan Hutan di Labura

„) Baca DPC Partai ...Hal 10


„ Seorang petani menunjukan luas areal persawahan di Kecamatan Rantau Utara, Selasa (4/9).

Areal Persawahan di Labuhanbatu Berkurang RANTAU– Jumlah areal persawahan ada di Labuhanbatu berkurang. Sesuai data yang dimiliki Dinas Pertanian dan Tanaman Pangan Pemkab Labuhanbatu Kasubdis Program Dinas Pertanian dan Tanaman Pangan Pemkab Labuhanbatu Ishak Jaya Negara, Senin (3/9) mengatakan, total areal persawahan yang ada saat ini berkisar 24.318 hektar. Itu sesuai pendataan „) Baca Areal Persawahan ...Hal 10



„ Petugas dari Dinas Kehutanan Labura meninjau hutan di Desa Kuala Beringin Kecamatan Kualuh hulu yang dirambah orang.

MEDAN- Komisi-A Dewan Perwakilan Rakyat Daerah Sumatra Utara menduga adanya perambah kawasan hutan di Kecamatan Kualuh Hulu, Kabupaten Labuhan Batu Utara (Labura). Dugaan itu disampaikan sejumlah anggota Komisi-A DPRD Sumut dalam rapat dengar pendapat dengan Polda Sumut, Polres Labuhan Batu, dan Badan Pertanahan Nasional (BPN) Labuhan Batu di Medan, Selasa, terkait operasional PT SLJ di hutan Desa Sukaramai, Kecamatan Kualuh Hulu. Tudingan awal disampaikan anggota Komisi-A DPRD Sumut Hasbullah Hadi ketika mengetahui perusahaan itu belum memiliki izin pengusahaan hutan dari Kementerian „) Baca DPRDSU Curiga ...Hal 10

Silpa APBD Labuhanbatu Membengkak LABUHANBATU-Sisa Lebih Perhitungan Anggaran (Silpa) pelaksanaan APBD Kabupaten Labuhanbatu terus membengkak. Pada tahun 2010, dengan APBD sekitar Rp551 miliar lebih terdapat Silpa Rp2.772.992.260.33. Sedangkan tahun 2011 dengan APBD Rp560 miliar lebih Silpa Rp37.315.710.056.40. Demikian kutipan pandangan umum fraksi PDI Perjuangan DPRD terhadap Ranperda tentang Pertanggung jawaban Pelak-

sanaan APBD Kabupaten Labuhanbatu tahun 2011 lalu, Selasa (4/9) di ruang rapat paripurna gedung DPRD. Sekretaris fraksi PDI Perjuangan Dahlan Bukhari yang membacakan pandangannya mengatakan, kenaikan Silpa pada tahun 2011 lalu sangat fantastis. Besaran itu menunjukkan bahwa perencanaan pendapatan dan belanja daerah tidak terencana secara baik. “Serta menunjukkan bahwa kurangnya

koordinasi lintas Satuan Kerja Perangkat Daerah. Untuk hal ini, kami meminta penjelasan saudara bupati,” tegas Dahlan dalam paripurna yang dihadiri oleh Wakil Bupati Pemkab Labuhanbatu Suhari Pane. Selain itu tambahnya, sesuai dengan laporan hasil pemeriksaan oleh BPK RI perwakilan Provinsi Sumut ditemukan beberapa permasalahan dalam penggunaan „) Baca Silpa APBD ...Hal 10

RANTAU- Masyarakat Labuhanbatu kecewa dengan kinerja anggota DPRD yang sesuka hatinya masuk ke kantor. Akibat ulah para anggota Dewan ini, warga jadi kelusitan untuk menyampaikan aspirasinya. Pasalnya saat warga datang ke kantor DPRD, banyak ruangan di kantor DPRD yang kosong. Kekesal itu disampaikan pengurus Forum Masyarakat Peduli Labuhanbatu (FMPL), Rabu (5/9) kepada wartawan. Menurut Yudha selaku pengurus FMPL, Senin (3/9) saat me„) Baca Anggota ...Hal 10


„ Ruangan anggota DPRD tampak kosong.

Kelola Perda Pengelolaan Keuangan Daerah! PERMINTAAN LSM KEPADA PEMKAB DAN DPRD

KOTAPINANG- Pemkab Labuhanbatu Selatan (Labusel) dan DPRD belum menetapkan Peraturan Daerah (Perda) pokok terkait pengelolaan keuangan daerah dan sistem serta prosedur pengelolaan keuangan daerah. Selama ini pengendalian atas penerimaan dan pengeluaran kas di kas daerah pada bendahara SKPD sulit dilakukan. Sehingga penerimaan negara dari pajak sebesar Rp10.547.„) Baca Kelola Perda ...Hal 10

Atasan di Atas Bawahan INI lagi, pegawai honor disosor! Bila yang kemarin di Mojokerto, kini di Tanjungpinang (Bangka-Belitung). Ny. Reni, 36, pegawai magang di Pemko Tanjungpinang, dikencani Hari, 40, atasannya di sebuah hotel di Pancur. Yang menarik penggerebegan itu terselenggara berkat laporan istri Hari kepada polisi.

Yang namanya bawahan, harus tunduk pada atasan. Apa lagi yang masih status pegawai honorer, nasibnya ke depan kan yang menentukan atasan. Bisa saja usulannya jadi PNS dihambat atasan, jika dinilai kinerjanya tak memenuhi syahwat,…. eh syarat. Dan itulah yang terjadi di Tanjungpinang. Seorang bawahan harus siap “diatasi” atasannya agar kariernya menjadi PNS ke depan lancar-lancar saja. Hari dan Reni memang bekerja satu kantor di Pemko Tanjungpinang. Hari sudah jadi PNS yang punya kedudukan, sedangkan Reni masih magang. Sebagaimana „) Baca Atasan ...Hal 10


6 September 2012

PUSKESMAS BATU... Sambungan Halaman 9 Misnomenilailepalapuskesmastakberhakmenjadikanfasilitasumumuntukkantorpraktekpribadi. “Sudah bertahun-tahun ruangan itu dijadikan tempat praktek sama kepala puskesmas, kalau rusak bangunan tersebut kan uang negara juga digunakan untuk memperbaikinya. Kalau kepala puskesmas mau buka ruangan praktek, jangan lah memakai fasilitas umum,” kata Misno. Senada disampaikan warga Batu Tunggal lainnya, Candra (24), Leo (28) dan Muliadi (30). Menurutketigawargaini,puskesmastersebutjuga jarang dibuka, apa lagi pada hari jumat. “Saya sering lihat puskes itu setiap hari jumat jarang buka, bahkan pelayanan bagi masyarakat pun juga terkesan dibeda-bedakan dibanding jika berobat langgsung dengan dokter Fachrul Ahyar selakukepalapuskesmas.Sehinggamasyarakatjarang berobat ke puskesmas dan memilih berobat ke ruang praktek dr Fachrul,” terang ketiganya. Sementara, Kabag Humas Lembaga Pengawasan Supermasi Hukum Republik Indonesia (LPSHRI) Ali sahbana Siregar mengatakan, tindakan yang dilakukan oleh Kepala Puskesmas Batu Tunggal merupakan tindakan yang salah. “Inikan namannya pembodohan kepada masyarakat,”kataAli.Saathalinicobadikonfirmasi kepadaKepalaPuskesmasBatuTunggaldrFachrul Ahyar, menurut beberapa pegawai dr Fachrul sedang tidak berada di puskesmas. Para pegawai puskesmas mengaku tidak mengetahui kemana dr Fachrul pergi. (cr2)

ANGGOTA DPRD... Sambungan Halaman 9 reka datang ke kantor DPRD untuk menyampaikanaspirasiterkaittentanglimbahpabrikdidesa mereka, ternyata anggota DPRD tak ada yang masukkantor.Saatitumerekahanyamenemukan ruangankosongdantakbisabertemudengananggota Dewan. Akibatnya mereka tak bisa mengadu soal limbah pabrik yang dibuang sembarangan di desa mereka. Yudha mengatakan, dengan kejadian ini menunjukkan bahwa DPRD Labuhanbatutakpedulidengannasibmasyarakat. TerbuktidengantidakadanyaanggotaDPRDyang ditemukan di kantor pada jam kerja. “Kami datang mau membuat pengaduan mengenai masalah limbah yang dibuang sembarangan di desa kami. Tetapi saat kami datang ke kantor DPRD, tak ada satu pun anggota DPRD yang kami temui di kantor tersebut. Bagaimana mereka bisa menyelesaikan masalah masyarakat jika mereka sendiri sesuka hati ngantor. Tapi jika ada sidang membahas anggaran, semua anggota DPRD pasti hadir. Mereka lah salah satu lembaga yang membuat negara kita hancur,” ucap Yudha. Pantauan METRO, ruang kerja anggota DPRD memang sering terlihat kosong. Saat ditanya seorang pegawai yang meminta agar namanya jangan dikorankan, pegawai itu mengaku bahwa anggota DPRD belum ada yang datang. (cr2)

KELOLA PERDA... Sambungan Halaman 9 722.955,00 tidak dapat dimanfaatkan. Aktivis Jaringan Intelektual Muda Indonesia (JIMI) Labusel, Saiman Siregar, Rabu (5/9) mengatakan, Bupati Labusel H Wildan Aswan Tanjung bersama DPRD harus segera menetapkan Perda untuk pengelolaan keuangan daerah dan sistem serta prosedur pengelolaan keuangan daerah. Karena ini bisa mengakibatkan persoalan yang cukup serius terhadap pembangunan di Labusel dalam pemanfaatan pajak. Bupati Labusel juga diminta untuk memerintahkan kepada Kepala Dinas Pendapatan Pengelolaan Keuangan Aset Daerah (DPPKAD) agar melakukan pengelolaan kas sesuai dengan ketentuan yang berlaku. Terpisah Kabag Humas Pemkab Labusel Abdul Karim mengaku dirinya belum bisa memberikan komentar terkait maslah itu. Alasanya untuk memberikan keterangan mengenai itu membutuhkan waktu yang cukup panjang. (mhr)

SILPA APBD... Sambungan Halaman 9 anggaranolehSKPD,diantaranyaDinasPendidikan, RSUDRantauprapat,DinasBinaMarga,Pertamben sertaDinasCiptaKaryadanTarukim. Sementara Bupati Labuhanbatu H Tigor Panusunan Siregar mengatakan, terkait tingginya Silpa APBD tahun 2011 jika dibanding dengan APBD tahun 2010 lalu merupakan suatu keberuntungan. Sedang untuk dana APBN yang dititip melalui APBD, tidak dikembalikan ke pusat karena keterlambatan penggunaannya ketepatan di Desember 2011. “Masih syukur kita Sipa tahun 2011 dana APBN itu tidak ditarik mereka ke pusat. Jadi masih bisa dipergunakan untuk pembangunan. Kita tidak bisa mengharapkap melaksanakan pembangunan hanya memanfaatkan dana alokasi umum, karena beban belanja PNS yang tinggi,” terang Tigor. Alokasi Belanja Meningkat Pertumbuhan alokasi dana APBD Labuhanbatu untuk kalangan DPRD setempat setiap tahun anggaran 2012 mengalami kenaikan secara signifikan. Namun, hal itu dituding tidak sebanding dengan kenaikan kinerja kalangan wakil rakyat itu sendiri. Buktinya, belum ada produk hukum yang dihasilkan langsung kalangan DPRD di daerah itu. Ditambah lagi, hasil reses setiap tahunnya yang tak disampaikan dalam rapat paripurna. Alokasi dana untuk DPRD dalam hal belanja di bidang urusan wajib otonomi daerah, pemerintahan umum, administrasi keuangan daerah, perangkat daerah dan kepegawaian mencapai Rp5.459.534.131. Rendahnya kinerja DPRD itu menjadi sorotan khusus bagi kalangan Lembaga Studi dan Advokasi (Elsaka). Efendi Panjaitan, kordinator Elsaka mengatakan, kalangan DPRD Labuhanbatu seharusnya mampu mengimbangkan dana yang dipakai dengan kemampuan keuangan daerah itu. “DPRD harus melihat kinerja dan kondisi keuangan kabupaten,” kata Efendi. Menurut Efendi, seharusnya dengan terjadinya peningkatan besaran belanja harus diimbangi dengan hasil kenerja. (cr2)

Tak Pernah Digaji, Tapi Tetap Rajin Mengajar Sambungan Halaman 9 Selama ini mereka menerima penghasilan Rp500 ribu per triwulan dari kutipan yang dilakukan pihak sekolah kepada orangtua murid. Selain itu, mereka terpaksa membuka les tambahan di rumah masing-masing. Kehidupan pahit yang dijalani para guru honorer di SD Negeri Kaluang itu sudah berlangsung cukup lama, tepatnya sejak sekolah tersebut didirikan tahun 2002. Sekolah itu dijadikan negeri pada tahun 2010. Namun para guru yang mengajar disana tak pernah menerima gaji dari Pemkab Labuhanbatu dengan alasan mereka belum terdaftar sebagai honorer daerah. Mereka hanya digaji Rp500 ribu per tiga bulan. Gaji itu mereka terima dari sekolah melalui uang iuran yang dikutip dari siswa sebesar Rp17 ribu per bulan per siswa. Namunmeskiberpenghasilansangatkecil,para guru ini tetap mencurahkan segala perhatian mereka untuk memberikan ilmu pengetahuan kepadaanakdidikmerekaagarmenjadianakyangpintar

dan kelak bisa membanggakan Labuhanbatu. Beberapa guru di sekolah itu yang ditemui METRO mengaku mereka tetap bertahan untuk mengajar di sekolah itu meski tak digaji. Tujuan mereka semata-mata agar anak didik mereka bisa menimba ilmu dengan sebaik mungkin. Selain itu mereka juga berharap agar suatu saat mereka diangkat sebagai CPNS. Hanyasaja,tindakankomitesekolahdankepala sekolah yang mewajibkan setiap siswa membayar Rp17 ribu per bulan per siswa tidak diterima oleh orangtuasiswa.Banyakorangtuasiswayangmerasa kecewadengantindakantersebut. Mirswan(34)wargaSeiKaluangPanaiHiliryang anaknya sekolah di SD Negeri Sei Kaluang mengatakan, pengutipan tersebut terkesan dipaksa. Jika tidak dibayar pada tanggal yang ditentukan, maka siswa disuruh pulang. “Saya sangat kecewa dengan pengutipan yang dilakukanolehkepalasekolah,jikapadawaktuyang ditentukan para siswa belum membayar, maka siswa disuruh pulang,” kata Mirswan. Senada dikatakan Wulan (35) dan Bana Sir (39)

warga Sei Kaluang Panai Hilir. Menurut keduanya, mereka sudah pernah mempertanyakan pengutipan tersebut kepada Kacabdis Panai Hilir, namun tak dihiraukan. “Kami sudah pernah mengadukan masalah pengutipan Rp17 ribu per bulan untuk gaji guru honorer itu, namun tak ditanggapi Kacabdis. Padahal setahu saya bupati selalu kampanye tentang pendidikan gratis, tapi kok nggak gratasi biaya sekolah di tempat anak saya menimba ilmu. Berarti kampanye bupati itu pembohongan publik,” kata keduanya. Sementara,Wakil Bendahara Pengawas Pemerhati Pendidikan National ( P3N) Ali Syahbana Siregar menyebutkan, saat ini Pemkab Labuhanbatu memiliki program pendidikan gratis. Namun jika ada pengutipan yang dilakukan oleh pihak sekolah, ini namanya sudah melanggar program dari Pemkab Labuhanbatu. Untuk itu Ali meminta kepada bupati agar menindak tegas pelaku pengutipan tersebut. Sementara kepala sekolah dan para komite sekolah mengaku sudah pernah mengusulkan ke

Dinas Pendidikan untuk memberikan gaji kepada para guru yang mengajar di SD Negeri Kaluang. Pengusulan tersebut dilakukan pada tahun 2010 sejak sekolah diangkat menjadi negeri. Namun hingga kini belum ada balasan dari Dinas Pendidikan tentang pengusulan gaji guru honorer itu. Pihak sekolah melalui komite sekolah juga sudahpernahmemberitahukanusulangajitenaga honorer kepada Kacabdis Panai Hilir dengan tembusan surat kepada Lepala Dinas Pendidikan Labuhanbatu, namun tetap saja usulan tersebut tak digubris. Karenamerasakasihandengannasibparaguru, akhirnya komite dan kepala sekolah memutuskan untuk mengambil kutipan dari orangtua siswa. Kutipan tersebut diberikan kepada para guru honorer yang berjumlah 7 orang sebagai gaji mereka. Lalu pihak sekolah dan komite sekolah mengundang rapat para orangtua siswa. Dalam rapat tersebut tidak ada satu pun orangtua siswa yang protes dengan usulan tersebut. Karena orangtua siswa memaklumi pengutipan tersebut untuk membayar gaji para guru honorer. (***)

Keluarga Korban Pembunuhan Sambungan Halaman 9 Pantauan METRO, kejadian tersebut bermula ketikapuluhankeluargaDedekberdatangankePN Rantauprapat untuk mengikuti sidang perdana terdakwa Surya Darma Dalimunthe dengan agenda pembacaan dakwaan. Namun karena kuasa hukum terdakwa tidak hadir, persidangan ditunda hingga, Rabu (12/9). “Sidang pembacaan dakwaan dengan terdakwapembunuhanSuryaDarmaDalimunthe alias Uyak ditunda minggu depan karena kuasa hukumnya tidak hadir,” ujar Jaksa Penuntut Umum (JPU) Erning Kosasi kepada wartawan, Rabu (5/9) sore, di PN Rantauprapat. Karena sidangnya ditunda, petugas Kejaksaan Negeri Rantauprapat kemudian mengeluarkan terdakwa Uya dari sel tahanan PN Rantauprapat menuju mobil tahanan Kejaksaan Negeri Rantauprapat, untuk kembali dibawa ke tahanan Lapas Lobusona Rantauprapat. Namun saat itu, terdakwa disoraki para keluarga korban hingga masuk ke mobil tahanan. “Dasar pembunuh, pantasnya kau dihukum mati,” teriak para keluarga korban. Awalnya,parakeluargadanrekankorbanhanya meneriaki terdakwa yang digelandang petugas ke dalam mobil tahanan. Namun situasi semakin memanas saat salah seorang keluarga korban pembunuhan itu mengaku telah diludahi oleh seseorang dari dalam mobil tahanan terserbut. “Kau ludahi aku dari dalam mobil itu ya, kukejar kau,” teriak salah seorang pria berkacamata yang mengaku sebagai keluarga korban. Mengetahui salah satu anggota keluarga mereka telah diludahi dari dalam mobil tahanan itu, para keluarga dan rekan korban lainnya langsung mengamuk berlarian mengejar dan menghadang mobil tahanan tersebut. Saat itu,

bentrokan pun tak terhindarkan. Para keluarga korbanyangmenghadangmobiltahanantersebut terlibat saling dorong dengan petugas kejaksaan yang mencoba mengamankan. Bentrokan itupun terus berlanjut meski para keluargakorbandanpetugastersebutdiguyurhujan deras. Kekisruhan itu baru berakhir ketika salah seorang oknum polisi berpakaian preman, yang belum diketahui identitasnya meletuskan satu kali tembakan ke udara. Setelah tembakan itu, barulah mobil tahanan yang membawa terdakwa pembunuhanitubergerakmeninggalkankantorPNRantauprapatmenujuLapasLobusonaRantauprapat. Sementarasepertidiberitakansebelumnya,kesal dancemburu,karenamantankekasihnyamenjalin hubungan dengan pria lain, Surya Darma DalimunthealiasUya(21),wargaJalanSiringo-ringo, Gang Rambe, Rantau Utara, menghabisi nyawa YanuarAnsarNasutionaliasDedek(21),wargaJalan Teratai,PerumnasKampungBaruRantauUtara. Dedek diketahui selama ini dekat dengan Sri Rahma Yanti br Hasibuan alias Gadis (18), siswi kelas 3 SMA Negeri 1 Rantau Utara. Tersangka membunuh Dedek karena dendam dengan korban yang telah merebut Gadis. PembunuhandilakukanUyadipelataranparkir Pasar Glugur Rantauprapat, Sabtu (10/3) sekitar pukul18.00WIB.Soreitu,Uyatiba-tibamenghampiri korban dan menghujamkan pisau panjang yang diduga sengaja dibawanya. Hujamannya tepat mengenai dada kiri korban. Korban pun roboh. Melihat korban terkapar bersimbah darah, tersangka langsung berlalu. Informasidihimpun,sebelummenghabisinyawa korban, Uya sempat memukul Gadis yang masih beradadilingkungansekolahnya.PengakuanGadis, tanpa alasan jelas, dirinya dipukul tersangka yang sengaja mendatanginya ke sekolah. Bahkan, tersangka sempat menyuruh Gadis melaporkan

tindakannyaitukepadaDedek. “Saya dipukulnya waktu di sekolah. Saat itu dia (Uya, red) berkata: kau panggil cowokmu itu,” Gadis, Minggu (11/3). Tak terima dengan perlakuan Uya, Gadis melaporkantindakanmantanpacarnyaitukepada Dedek. Mendengar laporan dari kekasih hatinya, DedekmencariUya.TernyataUyabersamatemantemannya telah menunggu kedatangan Dedek di depan stasiun kereta api (KA) Rantauprapat. Sesampainya di sana, Dedek langsung dipukuli Uya dan rekannya. Namun pengeroyokan itu tak berlangsunglama.Sebabsejumlahwargayangmenyaksikan langsung melerai perkelahian itu. Usai pengeroyokan,Dedekmenceritakankejadianyang baru dialaminya kepada kawan-kawannya. “Kawan kami itu mengaku baru saja dikeroyok si Uya dan kawan-kawannya di depan stasiun kereta api,” ujar Balon (19), teman korban. Sementara Uya yang merasa yakin dirinya tidak aman usai memukul Dedek, segera pulang dan mengambil pisau belati dari rumahnaya. Setelah itu, tersangka dan sejumlah rekannya kembali menungguDedekdipelataranparkirPasarGlugur Rantauprapat. Selang beberapa menit, atau sekitar pukul 18.00 WIB, Dedek dan rekannya datang menghampiri Uya. Saat itulah, tanpa basa-basi, Uya langsung menusukkan pisau ke dada kiri Dedek hingga pria itu roboh bersimbah darah. Melihat Dedek terkapar, Uya dan temantemannya langsung kabur. Sementara temanteman Dedek langsung melarikannya ke Rumah Sakit Citra Medika Rantauprapat. Setelah sempat mendapat perawatan beberapa menitdirumahsakit,Dedekmeninggaldunia. Menggunakan mobil ambulans, jenazah korban dibawa keluarga ke rumah duka. Isak tangis ratusan keluarga dan kerabat di rumah itu bersahut-sahutan. Kapolres Labuhanbatu AKBP

DPRDSU Curiga Ada Perambahan Hutan di Labura Sambungan Halaman 9 Kehutanan. Pihaknya mempertanyakan alasan operasional perusahaan itu dengan hanya mengandalkan izin prinsip yang dikeluarkan beberapa intansi terkait. Namun, Kasubdit Tindak Pidana Tertentu Direktorat Reskrim Khusus Polda Sumut AKBP Abdul Rizal menyatakan bahwa pihaknya menyimpulkan perusahaan itu telah memiliki izin dengan adanya izin prinsip tersebut. Menanggapi pernyataan tersebut, Hasbullah Hadi menyatakan kesimpulan Polda Sumut itu salah, disebabkan izin prinsip belum dapat menjadi payung hukum dalam pemanfaatan hutan. “Kesimpulan itu tidak benar, yang ada izin prinsip, bukan mengusahai. Harus ada izin lanjutan. Kesimpulan dari Polda (Sumut) itu salah,” kata politisi Partai Demokrat tersebut. Anggota Komisi-A DPRD Sumut dari Fraksi Partai Persatuan Pembangunan Bustami HS justru menuding PT SLJ sebagai perampok kawasan hutan karena tidak memiliki izin pengelolaan kawasan hutan.

Apalagi pihaknya mendapatkan informasi dari Wakil Bupati Labura Minan Pasaribu bahwa kawasan yang dikelola PT SLJ tersebut tidak diusulkan untuk diusahakan. “Dalam kunjungan kerja kami belum lama ini, Wakil Bupati Bupati Labura, Minan Pasaribu, mengungkapkan bahwa kawasan itu tidak diusulkan menjadi hutan produksi,” katanya. Kasubsi Sengketa dan Konflik Pertanahan BPN Labuhan Batu Untung Jauhari mengatakan, PT SLJ belum pernah mengajukan permohonan HGU atas hutan di Desa Sukaramai, Kecamatan Kualuh Hulu tersebut. Meski perusahaan tersebut telah memiliki sejumlah izin prinsip, namun pihaknya tidak pernah menindaklanjutinya guna mengeluarkan HGU. “Apalagi sesuai petunjuk Kemenhut, lahan itu masuk dalam kawasan hutan,” katanya. Sementara itu, Kabag Pertanahan Biro Pemerintahan Umum Pemprov Sumut Darwin Hutauruk mengatakan, perusahaan yang mengelola kawasan hutan di Labuhan Batu Utara itu telah melakukan kesalahan sejak awal. “Kalau dikaji lagi, ‘illegal logging’ pun mungkin sudah terjadi di sana,” katanya.

Menyahuti berbagai informasi yang disampaikan dalam rapat dengar pendapat itu, AKBP Abdul Rizal meminta seluruh instansi terkait untuk menyampaikan tentang dugaan perambahan dan penyalahgunaan izin kawasan hutan dari Bupati Labura. “Nanti akan kami selidiki. Akan kami giring hingga pengadilan,” katanya. Usai rapat dengar pendapat itu, Sekretaris Komisi-A DPRD Sumut Mustofawiyah membacakan rekomendasi yakni pihaknya meminta semua instansi terkait agar membatalkan seluruh izin yang berkaitan dengan operasional PT SLJ di Labura. Dengan demikian, perusahaan tersebut diminta untuk menghentikan seluruh aktivitas yang berkaitan dengan pemanfataan kawasan hutan. Kemudian, Komisi-A DPRD Sumut meminta Pemkab Labura untuk mengambil inisiatif dalam menyelesaikan masalah itu dan mengembalikan status hutan produksi tersebut. Setelah itu, Polda Sumut diminta untuk bertindak adil dalam menghadapai masalah yang terjadi, baik dalam memproses pengaduan masyarakat mau pun perusahaan jika memintan bantuan hukum. (ant/int)

Hirbak Wahyu Setiawan melalui Kanit Jatanras Aiptu TR Sitompul membenarkan peristiwa penikaman dilakukan Surya Darma Dalimunthe. Katanya, pihaknya juga telah menahan tersangka yang ditangkap sejumlah anggota polisi usai menikam korban. “Jadi saat kejadian, ada sejumlah polisi sedang patroli di Pasar Gelugur. Makanya tersangka dapat langsung ditangkap,” ujar Sitompul kepada METRO, Sabtu (10/3) malam, di Mapolres Labuhanbatu. (cr1/riz) Dedek Sering Diancam Bunuh Hubungan asmara antara Yanuar Ansyah Nasution alias Dedek dan Sri Rahma Yanti Hasibuansudahberlangsunghampirenambulan. Selama mereka berpacaran, Surya Darma Dalimunthe alias Uya yang merupakan mantan pacar Sri, sering mengancam membunuh Dedek. “Dedek sering cerita kepada kita kalau dia itu sering diancam-ancam dibunuh oleh Uya. Ancaman itu juga pernah disampaikan tersangka melalui pesan singkat yang dikirim ke Hp korban,” ujar Fendi (24), teman korban. Bahkan, informasi dari sejumlah rekan korban, ancaman bunuh juga sempat dilontarkan tersangka kepada salah seorang adik korban yang kebetulan dikenalnya. “Kepada adik korban, si Uya itu juga sempat berkata dirinya suatu saat menikam abangnya. Untuk itu dia berpesan agar korban hati-hati,” ujar Balon (20), rekan sekaligus tetangga korban. Hal serupa disampaikan Sri. Ia mengaku sangat kecewa dengan tindakan mantan kekasihnya. “Memangdariduludia(Uya,red)itunggaksuka lihat almarhum dan sering mengancam membunuh Dedek,” tukasnya. Meski begitu, Sri sama sekali tidak menyangka Uya benar-benar nekat. “Pokoknya kita tidak sangka lah dia nekat berbuat itu,” tukas Sri. (cr1)

DPC PARTAI DEMOKRAT... Sambungan Halaman 9 Labuhanbatu tampak didampingi sejumlah kader lainnya, yakni Akhyar P Simbolon SE, H Ramlan Rambe, H Lahmuddin Hasibuan, Syaibral Syah, KhairulSuherlinDaulay,SudinSetiaRajaHarahap, AzwanRitongasertaEdiMukhtar.Kedatanganmereka langsungditerimaKetuaKPUDLabuhanbatuHjIra Wirtati didampingi anggota Syam Hasri. Ira mengatakan,kedatanganpengurusPartaiDemokrat itubukanmerupakanpendaftaranpartai,melainkan sebagailangkahawalmemenuhipersyaratanguna verifikasipesertapemilu2014mendatang. Menurut Ira, berdasarkan undang- undang yang telah ditetapkan, setiap partai diwajibkan memiliki minimal anggota sebanyak 504 orang. Di mana hal itu merupakan faktor kelulusan verifikasi dimaksud. “Setiap partai diwajibkan memiliki jumlah anggota minimal 504 orang. Di mana hal itu berdasarkan peraturan untuk lolos pada verifikasi pemilu 2014 mendatang,” ujar Ira. Terpisah, Ketua Dewan Pimpinan Cabang Partai Demokrat Labuhanbatu H Mukhlis Hasibuan mengatakan, peraturan yang telah ditetapkan pemerintah melalui KPUD itu harus dilaksanakn. Sebab itu merupakan kepatuhan yang wajib dilaksanakan oleh Partai Demokrat. (cr1)

Areal Persawahan di Labuhanbatu Berkurang Sambungan Halaman 9 terakhir yang dilakukan pihaknya. Areal persawahan di Labuhanbatu itu tersebar di Kecamatan Rantau Utara 160 hektare, Rantau Selatan 440 hektare, Bilah Barat 717 hektare, Bilah Hulu 10 hektare, Bilah Hilir 2.853 hektare, Panai Hulu 4.153 hektare, Panai Hilir 5.846 hektare, Pangkatan 160 hektare serta Kecamatan Panai Tengah sekitar 5.980 hektare. Saat disinggung berapa persen angka peralihan tanaman padi kepada pohon kelapa sawit, Ishak mengaku belum menghitungnya. “Inilah masih mau didata ulang. Data ini kan setelah dimekarkan dan belum kita kroscek kembali. Kalau dahulu sebelum dimekarkan

sebanyak 53 ribuan hektare,” kata Ishak. Sementara, sejumlah kelompok tani tanaman keras maupun padi yang ditemui di sekitaran areal persawahan di Kelurahan Aek Paing, Kecamatan Rantau Utara mengaku kini areal persawahan di Aek Paing hanya 63 hektare. Untuk itu, pihaknya berharap agar Pemkab Labuhanbatu segera melakukan revisi jumlah areal persawahan yang ada. Terpisah, para petani mengaku heran dengan data yang dimiliki DinasPertanian Labuhanbatu. “Kalau memang Rantau Utara sebanyak 160 hektar, kita mau turun kelapangan dengan pemerintah sama-sama mengukur, karena itu sangat digelembungkan. Hampir seratus hektar perbedaannya,” kata sejumlah petani

yang minta namanya dirahasiakan. Begitu juga anggota kelompok tani yang ada di KecamatanBilahBarat.Parapetanidisanamerasa heran jika di sana areal persawahan disebutkan mencapai 717 hektare. “Dimanaarealsawahnyaitu.Palingbanyakpun sawahdisinisekitar200hektar,itusudahditambahtambahi. Tidak benar data pemerintah itu,” ujar para petani. Menanggapi hal itu, Basir seorang pengamat petani mengatakan hingga kini nasib petani tidak ada yang patut dibanggakan. Sebabnya pemerintah tidak benar-benar mendukung petani, baik dalam pemberian bantuan hingga penyuluhan yang didukung dengan kebutuhan mutlak petani.

Menurutnya, yang mengambil keuntungan disaat panen tiba adalah para pembeli/tengkulak. “Kondisi petani hingga saat ini selalu menjerit, karena selalu serba kekurangan dan tidak ada yang istimewa. Hanya sederhana, salurkan hak petani, karena kondisinya memperihatinkan,” katanya Disinggung tentang data yang jauh berbeda, Basir mensinyalir pihak pemerintahan sengaja memanipulasi jumlah areal persawahan dengan maksud dan tujuan yang diragukan. “Bayangi, data saja pun tidak ada yang sesuai, apalagi bantuan yang diberikan, ya sangat-sangat tidak memuaskanlah. Mari kita benahi dan kita siap mendampingi pemerintah kelapangan jika memang diperlukan,” terang Basir. (cr1)

Atasan di Atas Bawahan Sambungan Halaman 9 bawahan, Reni harus menurut apa pun yang diperintahkan Hari sebagai atasan. Dari ngetik surat ini itu, sampai urusan lain yang masih ada hubungannya dengan kedinasan. Pendek kata, disuruh apa saja, Reni harus menjawab: siap, Pak! Kasihan memang si Reni, usia sudah menjelang kepala empat, belum juga diangkat jadi PNS. Jadi selama ini penghasilannya hanya berupa honor. Celakanya, “urusan lain” yang jadi tugas Reni lama-lama melebar bukan kedinasan lagi. Soalnya, Hari sebagai atasan sudah berani mengajak jalan-jalan ke luar kota. Atau memang Hari mau meniru anggota DPR, yang

studi banding ke luar negeri meski tidak nyambung kompetensinya. Sebenarnya Reni juga sudah tahu penyimpangan ini. Tapi karena anggarannya dikeluarkan Hari tanpa membebani APBD, ya sebodo amatlah. Yang penting bawahan diajak atasan menurut saja. Ternyata, “studi banding” ala Hari memang ada dikandung maksud lain. Ketika istirahat di sebuah hotel, bawahan itu diminta juga “di bawah”-nya dalam rangka hubungan layaknya suami istri. Sebetulnya Reni keberatan, tapi takut hal ini jadi hambatan kariernya menuju PNS, terpaksa dilayani juga. Hal ini terjadi bukan sekali dua. Hari ini termasuk lelaki pemberani luar biasa. Bagaimana tidak? Istrinya sendiri juga

bekerja di Pemko yang sama, hanya beda dinas atau instansi. Ini kan sama saja mau bunuh diri. Soalnya, cepat atau lambat, lamalama pasti ada yang mencium gelagat buruk ini, dan kemudian mengadu pada pihak yang berkompeten alias istrinya. Nah, bila informan itu sudah mengadu bla bla bla…, apa nggak kiamat gara-gara memburu nikmat? Prediksi ini ternyata terjadi juga. Ny. Yuyun, 32, mendengar info bila suaminya boncengan sepeda motor ke Daik bersama anak buahnya, Ny. Reni, yang belakangan jadi teman istimewa. Istri malang ini segera memburunya ke lokasi yang ditunjukkan orang. Ternyata di sana kehilangan jejak. Malah informasi baru menyebutkan, suami sedang menyeberang ke

Pancur bersama WIL-nya. Ternyata benar, sebab nampak sepeda motor suami berada di penitipan sepeda di dermaga Daik. Diapun segera menyeberang ke Pancur, dan langsung menghubungi polisi setempat. Berdasarkan informasi yang diterima, sebuah hotel di kota itu didatangi dan penggerebekan ke sebuah kamar dilakukan. Ternyata benar, suaminya ada di situ sedang kelonan bersama Reni anak buahnya. Keduanya segera digiring ke Polsek setempat untuk mempertanggungjawabkan perbuatannya. Dalam pemeriksaan, Reni – Hari memang mengakui segala perbuatannya selama ini. Jadi mereka sudah sering berbuat? Nangis Yun, nangis… (pkc/int)


6 September 2012


Ribuan Bangkai Tikus Penuhi Mississippi

TUPELO - Puluhan ribu tikus mati akibat terjangan badai isaac melanda Amerika Serikat (AS). Saat ini, bangkaibangkai tikus itu tersapu oleh badai dan memenuhi pantai Mississippi. Badai Isaac menciptakan wabah banjir di Louisiana, pada saat yang sama, tikustikus pun terbawa arus air yang mengalir hingga Mississippi. Bangkai dari puluhan ribu tikus dapat disaksikan di garis pantai Mississippi. Pada Selasa kemarin, para petugas kontraktor menemukan 16 ribu bangkai tikus di Hancock County. Mereka pun terpaksa mengangkut bangkai-bangkai itu dengan menggunakan sekop dan garpu tanah. ”Kami akan menggelar acara yang bernama “Pesiar Pantai” pada Oktober

mendatang, dipastikan 30 ribu hingga 40 ribu orang akan datang ke pantai ini.

Kami harus segera membersikan pantai ini,” ujar salah seorang pejabat di

Hancock County, Rabu (5/9). Bau busuk pun tercium di sekitar pantai Mississippi, meski bangkai-bangkai itu tidak akan menyebabkan gangguan kesehatan, bangkai itu terlihat menjijikkan. Pantai di Mississippi terlihat amat kotor untuk saat ini. Mississippi juga sempat bergelut dengan masalah bangkai tikus di saat Badai Katrina dan Gustav menyerang wilayah tersebut. Pantai itupun ditutup untuk publik karena pengunjungpengunjung tidak akan kuat dengan bau bangkai itu. Selain bangkai tikus, para pekerja kontraktor juga menemukan bangkai hewan-hewan lain. Hewan itu adalah babi, rusa, rubah, ular dan kelinci. (oz/ nik)

COLOMBO - Seorang pria di Sri Lanka ditangkap polisi saat menelan berlian yang bernilai lebih dari USD13 ribu atau sekira Rp124,2 juta (Rp9.560 per USD). Aksinya dilakukan saat menghadiri sebuah pameran perhiasan di Colombo. ”Chou Wan menelan batu berharga saat memeriksa berlian di sebuah gerai, tepat di pembukaan pameran perhiasan di Colombo,” ujar juru bicara Polisi Ajith Rohana, Rabu (5/9).

Rohana mengatakan, pemilik berlian itu langsung melaporkan kejadian tersebut ke pihak polisi. Mereka khawatir Chou akan kabur dengan membawa berlian berharga di perutnya.

”Chou adalah warga negara China, dirinya saat ini masih ditahan untuk menjalani penyelidikan,” jelasnya. Sri Lanka selama ini dikenal sebagai penghasil batu berharga di dunia. Pameran perhiasan dan batu berharga kerap kali diadakan di negara tersebut dan mengundang banyak pengrajin dari batu berharga tersebut. (oz/ nik).


Toko Pakaian di India Diprotes

Desa dengan Seluruh Wanitanya

BERAMBUT PANJANG Setiap daerah pasti memiliki tradisi tersendiri, salahsatunya di Desa Huanglo yang mewajibkanya seluruh wanitanya memiliki rambut panjang di dunia mencapai 2 meter. Alasanya rambut merupakan mahkota namun bagi suku Yao di Desa Huanglo Pengamat budaya mengatakan rambut adalah simbol paling berharga dan menggambarkan kehormatan dan kesejahteraan. “Makanya tidak heran jika Anda menemukan seluruh wanita di suku ini memiliki rambut yang super panjang,” katanya. Desa Huangluo terletak di wilayah Longji Guilin. Setidaknya ada 82 kepala keluarga yang tinggal di desa tersebut. Kebanyakan dari mereka masih memegang nilai tradisi leluhur dan hidup penuh dengan kesederhanaan. Hampir sama dengan pemandangan alam, lingkungan yang asri serta kebudayaan yang terbilang kuno menjadi atraksi tersendiri bagi para wisatawan yang datang baik dari luar daerah ataupun mancanegara. Paling mengundang minat mereka adalah tradisi kaum wani-


25 25 25 20 25

%, %, %, %, %,

angsuran angsuran angsuran angsuran angsuran

2 3 3 2 3

Jt-an Jt-an Jt-an Jt-an Jt-an

Proses cepat data dijemput

Hub: L. Rivai Sembiring 0812 6457 0000


• Carry Pick Up Dp. 15,7Jt Angs 2Jt • APV Mega Carry Pick Up Dp. 23Jt angs 2Jt • APV Dp. 29Jt angs 3Jt • Ertiga Dp. 35Jt angs 3Jt • Swift Dp. 35Jt angs 4Jt • SX4 Dp. 40Jt angs 4Jt • Grand Vitara Dp. 70Jt angs 5Jt Proses Cepat, Angsuran Ringan dan data bisa dijemput. Hub: Ardi Oslan Lubis 0812 6582 0292

tanya yang terobsesi memanjangkan rambut hingga menyentuh tanah. Reputasi itu membuat desa ini dijuluki ‘desa rambut panjang’. Bahkan mereka mendapat pengakuan resmi dari museum rekor dunia Guiness World Record sebagai ‘Desa Dengan Rambut Terpanjang’. Sebagai catatan, rata-rata panjang rambut para wanita yang ada di sana adalah 1,7 meter. Sementara yang terpanjang bisa mencapai 2.1 meter. Dahulu, atau lebih tepatnya sebelum tahun 1987, tradisi di Huangluo tidak memperbolehkan orang lain melihat rambut mereka tergerai selain suami dan anakanak. Dengan kata lain, setiap warga perempuan diwajibkan menggulung rambut dan memakai penutup kepala. Dan jika ada orang lain yang secara tidak sengaja melihat rambut mereka, maka orang itu harus diangkat menjadi menantu dan tinggal selama tiga tahun. Namun peraturan ini dihapus dan akhirnya mereka pun bebas memperlihatkan rambut mereka kapan saja. (int/nik)

Mitsubishi Ready Stock: Pajero Sport,

Outlander Sport, Mirage, Strada Triton, Lancer, (Chasis, Box, Tangki, Bus, Dump Truck Colt Diesel & Fuso, Pick Up & Minibus L300 & T120ss), Pesan Segera Hubungi DONI: 0813 6224 2904 ; 0852 6130 5040

MITSUBISHI RANTO “PROMO” LEBARAN: Pajero Sport, Triton, Colt Diesel Dump Truck, Chasis, L300, & Colt T120SS PickUp. DP 11% atau bunga mulai 0%. Hubungi: UNAS 0813 6333 3000

DIJUAL CEPAT: Yamaha VIXION warna Hitam tahun 2008. Body/ Mesin mulus.Hub 0813 7015 5910; 0813 6163 1463

NEW NISSAN: Grand Livina, Juke, X-Trail. Navara, Murano. Ready Stock, cash/credit. Hub: Mili 0852 7033 7739 DIJU AL: Tanah kapling uk 6x12M, harga mulai DIJUAL: 35jt-an, bisa nego. Lokasi strategus sebelah kolam renang Wahyu. Hub alamat: Kolam Renang Wahyu, Jl. St. Alisyah Bana, dengan Bpk IRWAN EDWIN (Buyung) Hp: 0813 7596 2988. *Juga menerima pelatihan renang yg diasuh oleh Pelatih bersertifikat &

NEW DELHI— Untuk apalah arti sebuah nama. Istilah ini yang dialamatkan Toko Pakaian Hitler di Ahmadabat Negara Bagian Gujarat, India setelah mendapat protes dari warga. Pasalnya, nama itu dianggap diktator Jerman Adolf Hitler dan penuh masalah. Nama Hitler dipampang besar-besar di depan Toko milik Rajesh Shah itu dan tak lupa titik di atas huruf “I” dilengkapi lambang swastika Nazi yang terkenal itu. Pemilik Tokoh Manish Chandani mengatakan, nama Hitler dipilihnya untuk mengenang sang kakek yang membesarkan anak-anaknya dengan disiplin tegas sehingga kerap dijuluki Hitler. Memang nama toko itu menarik perhatian, tetapi sekaligus cercaan yang datang dari komunitas Yahudi yang tinggal di Ahmadabad. Tak hanya masyarakat Yahudi biasa yang mengajukan protes, Konsulat Jenderal Israel di Mumbai bahkan meminta pemerintah negara

bagian untuk turun tangan. Manish Chandani, salah seorang pemilik toko ini, mengaku mendapatkan banyak telepon dan permintaan untuk segera mengganti nama tokonya itu. ”Saya berencana untuk mengganti nama toko secepat mungkin,” ujar Chandani. ”Kami menerima banyak desakan dari komunitas Yahudi dan pemerintah untuk mengganti nama toko ini,” tambah dia. ”Kami tak menyadari Hitler bertanggung jawab atas kematian enam juta orang Yahudi di masa Perang Dunia II,” aku Chandani. Kasus terkait Hitler dan lambang-lambang Nazi sudah beberapa kali terjadi. Pada 2006 lalu, sebuah restoran di Mumbai bernama Hitler Cross memicu kemarahan warga. Restoran itu kemudian mengganti namanya setelah mendapatkan protes dari Kedutaan Israel, Jerman, dan Liga Antifitnah Amerika Serikat. (kps/nik)

„ Toko pakaian Hitler di Ahmadabad, Gujarat, India akhirnya berganti nama setelah mendapat banyak protes dan kecaman.


Menjual : Laptop, Komputer, Accessories & Service Komputer,ATK, Kamera digital, Ipad / Tablet –PC, Belangko Undangan, Lion, Kertas HVS secara ecer dan grosir, juga melayani Cash & Credit. Alamat : Jl.Imam Bonjol No.149 Kisaran, Dpn Hotel Wisata.Tlp : 0623 41353

Telah Hadir di Kisaran, “RUMAH JAMUR” menyediakan menu masakan ala jamur, Lontong sate jamur, Bakso jamur, Sop jamur Ayam kampung, Mie jamur ayam kampong, Krispy jamur, es jamur, Dll. Buka setiap hari Kecuali “Jumat” mulai jam 12.00 siang sampai malam. Kunjungi alamat kami : Jl. Budi Utomo No. 116 Siumbutumbut Kisaran. HP : 0877 4878 2775 E XC E LC I S E


Lembaga kursus pelatihan Komputer. Kami melayani dan menerima murid baru serta menerima ketikan surat , kantor, pengetikan skripsi, majalah, proposal & surat lainnya. Kunjungi alamat kami : Jl. Malik Ibrahim No. 27 Kisaran. HP: 0813 6112 9333 ; 0812 6053 8000

SYUSUF PONSEL 4 Pusat Servis Handphone bergaransi dan Cuci photo dengan kualitas terbaik. Jl. M.Yamin Simp. Kedai Ledang Kisaran.

COLUMBIA CASH & CREDIT: Dibutuhkan segera : Tenaga Marketing & Kolektor TF. Fasilitas Mobil kerja, uang makan 8000 s/d 15000. Gaji pokok 350.000 s/d 1 Juta, komisi 4 % s/d 8 % + intensif. Alamat : Jl. Cokroaminoto Kisaran & JL. Koptu Mahmun Lubis Aek Kanopan Tlp . 0623 44260 BUTUH DANA TUNAI?: Lamhot Jaya Motor jaminan hanya BPKB Sepeda motor anda persyarat ringan. 1 jam cair juga melayani jual beli sepeda motor. Hubungi alamat Cabang kami : Jl. Lintas Siantar, Simp Tangsi. HP : 085373430808. Alamat Unit kami: Jl. Lintas Sei Mati, Ds Mekar Sari. HP : 085361450914 BUTUH DANA TUNAI: Lamhot Jaya Motor jaminan hanya BPKB Sepeda motor anda, persyaratan ringan, 1 jam cair, juga melayani jual beli sepeda motor. Hubungi alamat Pusat kami : Jl Diponogoro No.149, Kisaran. Telp 0623 43921 Hp : 081361505214


Untuk Atasi Disfungsi Ereksi Air Susu Ibu (ASI) diakui banyak manfaatnya untuk kesehatan bayi, baik mengatasi masalahnya. Karena bernafaat besar, suami Michelle yakni Jeff di AS meminumnya untuk mengatasi masalah disfungsi ereksi yang di alaminya. Jeff meminta hal itu dirahasiakan karena aktivitas menyusui itu ke dalam rutinitas hubungan seksual keduanya sejak beberapa bulan setelah kelahiran anak pertama mereka.Kini anak pertama mereka yang berkelamin perempuan itu berusia 2 tahun dan telah berhenti menyusu kepada ibunya, namun kini istrinya Michelle (27) juga tengah memproduksi ASI untuk anak lakilaki mereka yang berusia 8 bulan. Jeff pun mengaku meminum susu Michelle ‘langsung dari sumbernya’. Keduanya tak hanya menganggap hal itu sangat erotis namun Jeff juga mengaku kebiasaan ini mampu mengurangi gejala-gejala disfungsi ereksi yang dialaminya secara signifikan. Meski begitu, kedua anak mereka selalu mendapatkan prioritas untuk urusan ASI Michelle, catat Jeff. Keduanya pun diperbolehkan tampil dalam sebuah acara TV di AS yang memaparkan berbagai macam seks unik dan aneh berjudul Strange Sex. Meski begitu awalnya pasangan ini berharap dimasukkan ke dalam salah satu jenis seks aneh yaitu vampirisme. “Vampirisme itu persis seperti apa yang selama ini kita dengar, namun saya tak membutuhkan darah,” kata Jeff seperti dilansir dari huffingtonpost. Bagi Michelle dan Jeff sendiri, vampirisme bukan berarti pengalaman seks yang berdarah-darah. Gigitan yang diberikan Jeff akan membuat Michelle merasa seperti lututnya tergores dengan jumlah darah yang keluar sangat sedikit. Lagipula kata Jeff, vampirisme ini mengurangi gejala-gejala disfungsi ereksi yang dialaminya. Namun pasangan ini memutuskan untuk tidak melakukannya terlalu sering, sebagian karena khawatir dengan risiko luka yang bisa ditimbulkan. Ketika Michelle mulai menyusui anak mereka maka aktivitas vampirisme itu harus berhenti karena payudara Michelle telah menjadi target gigitan Jeff. Kemudian keduanya menemukan gagasan untuk membuat eksperimen dengan menyusui Jeff. Keduanya pun menganggap hal ini sebagai transisi alami. Stasiun TV yang akan menyiarkan acara ini awalnya juga menolak aplikasi Michelle dan Jeff yang menunjukkan vampirisme. Namun ketika pasangan ini mengirimkan aplikasi kembali, kali ini dengan menyebutkan kata menyusui, akhirnya stasiun TV itu pun bersedia menampilkan pengalaman keduanya di acara mereka. Jeff mengaku ingin tampil di acara tersebut agar bisa mendorong para pria yang mungkin menderita disfungsi ereksi untuk mencoba berbagai hal baru dengan pasangannya. Jeff merasa bahwa para pria bisa saja menemukan sesuatu yang bisa membantunya, sama halnya dengan yang terjadi padanya. (int/nik)

BUTUH DANA TUNAI? Satu jam cair bawa BPKB sepeda motor anda ke: UD.JAYA MOTOR AEK LOBA Jl. Cokroaminoto Samp.SPBU kisaran,juga melayani Cash & Kredit Sepeda Motor Bekas.Hub: Hermanto: 0813

7633 2981; 0812 6295 222

BAKSO MONAS Menyediakan menu bakso Gong, Bakso kaget & Mie Ayam herbal. NB: Bukan makan tepung tetapi bakso daging, Dilayani karyawan dari kraton Solo, Halal, Bersih, Nikmat dan Ramah. Alamat : Jl. Merpati Simp. Gambir Baru Kisaran. TO KO R A H M A D JAYA

Melayani : • PULSA LISTRIK BEBAS administrasi. • KARTU PERDANA terbaru & termurah • MENERIMA UANG RUSAK Hubungi alamat kami: Jl. Cokroaminoto No. 201, KISARAN. HP: 0812 6239 966; Email:


Menjual aneka pakaian batik, Tas batik, Kaos, Sabun Herbal, mainan kunci dan accessories lainnya. Dapat kan produknya di: Jl.SM.Raja No. 35 B, Kisaran. Dekat Rel KA.

SEHAT SERVICE Melayani: Doorsmeer, Ganti Oli, Pispot, Balancing Ban, Tubless, Angin, Hidrogen, Ban luar, Radial. Jl. A Yani No. 6/8 Kisaran WARUNG LESEHAN MBAK NUR Menyediakan : Menu Ikan Lele, Ikan Mas, Mujair, Gurami, Nasi Uduk, Ayam Kampung & Bebek goreng, serta aneka Juice. Kunjungi Alamat kami :Jl. A. Yani Simp.Tg. Alam Kisaran PURI COLLECTION Menjual : Berbagai macam pakaian, Pria dewasa, celana & baju perempuan, pakaian remaja anakanak, dan Accessories lainnya seperti Dompet, tas Dll. Kunjungi alamat kami : Jl. Ir Sutami No.17 Dekat KFC Simp Bunut Kisaran. PELUANG USAHA AIR MINUM Pemasangan Depot Air Minum Air Pegunungan (Mineral) Sistem RO Oxsygen dan Grosir Peralatan Depot Air Minum GRACE WATER: Jl. Cengkeh Raya P. Simalingkar. HP. 0813 7010 7352. *) Melayani pemasangan dalam dan luar kota


Empat Jurus Cegah Osteoporosis Dini

Manfaat Baca Buku untuk Kesehatan Pekerjaan padat dan juga semakin canggihnya alatalat gadget, membuat orang-orang mulai jarang melirik membaca buku. Sekarang ini, banyak orang yang lebih senang mengutak-atik gadget mereka, daripada membaca buku. Padahal, membaca buku tak hanya bisa memperluas wawasan

dan pengetahun kita. Membaca buku juga bermanfaat untuk kesehatan. Hal itu diungkapkan para ilmuwan dari Oxford University. Mereka berpendapat membaca buku tidak hanya untuk kecerdasan, namun juga baik secara fisik dan psikologi. Menurut Profesor John Stein, membaca tak hanya mengikuti plot pasif, tapi juga menghadirkan imajinasi. "Kita merasa empati dengan karakter sehingga kita melalui semua pasang surut

dengan mereka," kata Stein seperti dikutip dari GeniusBeauty. Selain itu, jika seseorang membaca buku tentang penciuman, rasa, atau gambar pemandangan, akan membuat bagian otak yang bertanggungjawab untuk persepsi akan mulai bekerja, seolah-olah itu terjadi dalam realitas. Disamping itu, manfaat lainnya adalah, enam menit membaca juga bisa mengurangi tingkat stres sekitar dua pertiga. Tak cuma itu,

membaca mampu membantu mengatasi stres lebih baik dibanding berjalan di alam atau mendengarkan musik. Dan dengan membaca buku juga akan bermanfaat dalam hal disiplin mental, seperti kemudahan perencanaan jangka panjang dan pengelolaan percakapan panjang tentang topik yang sama. Dengan begitu, alangkah pentingnya untuk menanamkan kecintaan membaca buku sejak kecil.(int)

OSTEOPOROSIS merupakan gangguan tulang yang mengarah ke risiko fraktur atau patah. Ditandai dengan berkurangnya kepadatan mineral tulang yang dapat memicu keretakan akibat trauma sepele. Pengeroposan tulang ini biasanya muncul tanpa tanda-tanda mencolok sebelumnya. Osteoporosis bisa terjadi akibat berbagai faktor. Terlepas penuaan, pengeroposan tulang ini juga dapat menyerang akibat faktorfaktor genetik, menopause dini, dan kurangnya asupan kalsium dalam tubuh. Berikut beberapa hal sederhana yang dapat Anda lakukan untuk mencegah osteoporosis dini, seperti dikutip Fit Sugar: • Paparan sinar matahari Di bawah kulit kita ada vitamin D. Saat terpapar cahaya matahari, vitamin itu akan aktif dan berubah menjadi vitamin D3. Bentuk aktif vitamin tersebutlah yang berguna mempertahankan kepadatan dan kekuatan tulang. Tak butuh waktu lama untuk mengaktifkan vitamin D3 dalam tubuh. Cukup 10 menit sebelum

pukul 09.00 pagi dan sesudah pukul 15.00 sore. Kecukupan kalsium dan vitamin D sejak muda menjadi hal penting yang harus diperhatikan jika ingin terhindar dari osteoporosis. • Minum susu Susu adalah salah satu sumber kalsium terbaik yang berperan mencegah tulang keropos. Biasakan rutin mengonsumsi susu atau makanan mengandung kalsium lainnya seperti kacang almond, sarden, salmon, sereal, jus jeruk, dan sayuran hijau. • Olahraga Aktivitas kebugaran ini merupakan salah satu kunci menjaga tulang tetap kuat. Pastikan melakukannya setidaknya 30 menit sehari. Pilih jenis olahraga yang memiliki efek membuat tulang tarikmenarik untuk meningkatkan kepadatan tulang. Yang bisa menjadi pilihan di antaranya yoga, lari, atau latihan kekuatan otot. • Hindari alkohol dan soda Konsumsi alkohol atau soda secara berlebihan juga meningkatkan risiko terkena osteoporosis. Karenanya, batasi segera konsumsinya.(int)

Hamil di Usia Remaja

ApaBahayanya? IDEALNYA, hamil dan memiliki anak dialami oleh wanita yang sudah 'cukup umur' dan telah bersuami. Tapi nyatanya, dunia ini memang tak selalu ideal. Lantaran sesuatu hal yang biasa disebut 'kecelakaan' kadangkala seorang remaja terpaksa menikah dan punya anak. ''Yah bagaimana lagi, daripada menanggung malu,'' begitu biasanya ucapan pasrah para orangtua yang terpaksa menikahkan anaknya di usia dini. Namun persoalan tak selesai hanya sampai di sini. Mengapa begitu? Tak lain karena pernikahan dan kehamilan di usia remaja membawa risiko yang tidak kecil, baik dari sisi medis maupun psikologis. ''Masalah kehamilan remaja apakah sudah nikah atau belum, secara biologis maupun sosial mempunyai dampak yang tidak baik pada si ibu maupun si anak,'' kata Deputi Kesehatan Reproduksi dan Remaja BKKBN Dr Siswanto Agus Wilopo. Mengapa kehamilan remaja cenderung meningkat? Menjawab pertanyaan ini Siswanto menjelaskan bahwa dari aspek sosial budaya, di desa-desa umumnya orangtua yang mempunyai anak perempuan ingin segera menikahkan anaknya. Di samping itu, dengan perkembangan biologis yang semakin baik terutama karena perbaikan gizi dan adanya rangsangan terhadap organ reproduksi yang lebih terbuka, ada kecenderungan anak remaja

haid lebih awal. ''Dalam waktu 20 tahun terakhir ini rata-rata usia menarche (menstruasi yang pertama kali) sudah lebih awal dua tahun, misalnya dulu menarche baru mulai usia 15 tahun, sekarang anak usia 12 tahun sudah mengalami menarche.'' Selain itu, anak remaja sekarang cenderung memiliki masa subur yang relatif lebih panjang. Hal ini, kata Siswanto, terkait dengan masalah birahi, baik pada laki-laki maupun perempuan. ''Akibatnya bagi mereka yang tidak bisa membendung keinginan reproduksinya, terpaksa punya anak walau belum siap.'' Lebih jauh Siswanto menerangkan, kehamilan pada remaja mengundang risiko terhadap si ibu juga anaknya. Ibu yang hamil saat remaja cenderung mengalami anemia (kurang darah) berat. Ini karena sebelum hamil pun, remaja (sekitar 40-50 persen) sudah anemia. Dan asal tahu saja, ibu hamil yang anemia, kesehatannya akan terganggu. ''Misalnya saja napsu makannya atau ngidamnya menjadi lebih berat, kondisi fisiknya juga akan lemah, dan lain-lain.'' Selain

itu, kalau dia melahirkan, kemungkinan terjadi perdarahan lebih besar. Begitu pun anak yang dilahirkan, ada kemungkinan lahir prematur atau memiliki berat lahir rendah. ''Di bidang kedokteran sudah diketahui apabila janin lahir prematur atau berat lahir rendah itu kemungkinan terjadi perdarahan besar,'' kata Siswanto. Dari fenomena secara umum saja, perdarahan post partum (segera setelah bayi lahir) menjadi penyebab kematian ibu secara menyeluruh. Resiko ini (perdarahan) juga ditanggung oleh para remaja. Untuk diketahui, risiko meninggal pada ibu yang hamil muda/ remaja lebih tinggi yaitu 4-6 kali dibandingkan ibu yang berusia 2030 tahun. Belum lagi jika kehamilan itu terjadi di luar nikah di mana seorang remaja cenderung untuk menggugurkannya (aborsi). Padahal aborsi sama sekali bukan solusi yang aman. Data menunjukkan, kontribusi aborsi terhadap kematian ibu mencapai lebih dari 13 persen. Dijelaskan Siswanto, aborsi memiliki banyak efek samping. Jika dilakukan dengan cara kuret dan tidak hati-hati, bisa merusak leher rahim. Dan ini bisa membuat si remaja tadi tidak bisa mempunyai anak karena serviks (leher rahim) membuka terus sehingga ia akan mudah sekali mengalami keguguran. Masalah yang tak kalah berat juga akan muncul jika si remaja putri hamil dalam kondisi rumah tangga yang belum siap. Bukan tak mungkin, dia akan kekurangan gizi. Dan jelas sekali hal ini akan berisiko terhadap janin yang ia kandung. Jika si ibu kurang gizi, hampir bisa dipastikan janin pun tidak akan tumbuh dengan baik.(int)

RahasiaCantikdari BerbagaiBenua SETIAP perempuan di bagian belahan dunia lain pasti memiliki rahasia tersendiri dalam merawat kecantikannya. Nah, seperti perempuan Indonesia dengan lulur, jamu dan rempahrempahnya, perempuan dari belahan dunia lain juga meiliki rahasia kecantikan yang berasal dari alamnya. Kunyit Bumbu yang memberikan warna khas kari, ternyata merupakan antiseptik dengan sifat antiinflamasi yang sangat kuat. Di India, tradisi umum bagi calon pengantin perempuan dan laki-laki untuk luluran dengan pasta kunyit dan chickpea flour sebelum hari pernikahan mereka. Kunyit terkenal kekuatannya dalam membunuh kuman sedangkan chickpea flour membantu mengelupaskan kulit mati sekaligus melembapkan. Pepaya Salep pepaya yang terbuat dari pepaya, umumnya digunakan sebagai obat di Australia. “Mengatasi kulit terbakar, gigitan serangga, gatal-gatal dan kulit pecah-pecah dan bibir kering. Saya selalu memilikinya di rumah. selain itu saya sering mengoleskan pada kutikula agar lembap,” ujar ahli kecantikan dari HuffPost, Carmindy. Argan oil Argan oil telah lama dikenal perempuan Afrika sebagai keajaiban alam, dan sekarang menjadi terkenal di negara Barat juga. Diproduksi secara eksklusif oleh perempuan Berbere di Maroko, minyak ini diekstrak dari pohon Argan. Mempunyai kandungan tinggi vitamin E dan asam lemak lainnya. Ia memiliki sifat anti-aging yang sangat baik. Argan oil merupakan pelembap yang sangat baik dan diyakini mampu mengatasi problem kulit seperti jerawat hingga keriput. “Perempuan Maroko memiliki

rambut yang indah karena mereka rutin menuangkan argan oil di kepalanya,” kata Carmindy Monoi oil Bunga tahitian gardenia dan minyak kelapa yang dikenal dengan Monoi oil digunakan oleh perempuan Tahiti untuk menenangkan dan melindungi rambut serta kulit mereka. “Saya belum pernah melihat perempuan yang memiliki rambut dan kulit yang indah serta harum,” kata Carmindy. Camellia Nut Oil Menurut ahli kecantikan Shalini Vadhera, camellia nut oil atau biji teh digunakan oleh perempuan Jepang sebagai antioksidan, untuk memelihara dan melembapkan kulit, mengobati luka bakar, stretch mark dan memperkuat kuku. Camellia nut oil mengandung vitamin E yang tinggi, antioksidan dan asam oleat. “Dua tetes minyak camellia dicampur dengan satu sendok makan sake dapat membuat kulit lebih halus,” tulis Vadhera dalam buku Passport To Beauty. Alpukat Terkenal akan kandungan lemak dan vitamin E nya yang tinggi, alpukat bukan hanya terasa lezat juga baik bagi kecantikan Anda Anda. Perempuan Amerika Selatan menggunakan buah untuk menyehatkan kulit dan rambut mereka. “Hampir semua bagian dari alpukat dapat digunakan dalam perawatan kecantikan,” kata Jessica Harris dalam buku World Beauty Book. Ambil kulit dan gosok pada wajah Anda. Tekstur sedikit kasar dari bagian dalam kulit alpukat akan membantu pengelupasan kulit mati. Selain itu kulit tersebut kaya dengan minyak alpukat.” Carmindy merekomendasikan masker wajah yang terbuat dari alpukat dan madu. “Madu memiliki sifat antiinflamasi dan alpukat bekerja melembapkan kulit.” (int)


6 September 2012


Raffi Ahmad

Tak Kapok Naik Moge

Artis serba bisa Raffi Ahmad ikut prihatin atas musibah yang menimpah beberapa temannya dalam menggendarai Motor gede, Raffi mengatakan bahwa kecelakaan bisa menimpa siapa aja, bahkan kepada pejalan kaki sekalipun, yang penting harus berhatihati saja. ”Saya turut prihatin dengan kejadian yang menimpa beberapa teman saya, salah satunya Rezky, buat saya yang paling penting sih dalam mengendarai Motor khususnya Motor Gede kita harus hati-hati dan harus saling menghormati sesama pengendara motor,” ungkap Raffi saat ditemui di Studio RCTI, Kebon Jeruk, Jakarta Barat, Rabu (5/8). Bagi Raffi hobby dirinya naik motor akan terus ditekuni, dirinya tidak terpengaruh dengan kejadian-kejadian yang menimpa beberapa teman-temannya. Bahkan dalam jangka waktu dekat ini dirinya bersama teman-temannya akan melakukan Touring Makassar-Toraja. ”Enggak lah enggak kapok, dan dalam waktu dekat ini saya juga mau Touring ke Makassar neh dan saya sih naik motor gede selalu mematuhi peraturan dan menggenakan safety raiders. (abu/jpnn)

HOROSKOP HARI INI VIRGO (23 September - 22 Oktober) Di hari ini hampir tidak ada gangguan yang berarti yang akan membikin kacau. Karena suasana dan situasi cukup mendukung bisnis Anda, maka jangan ragu untuk melakukan manuver-manuver yang berbahaya sekalipun.


(21 Desember -19 Januari)

Tak perlu ragu untuk mencoba memulai hal baru, walaupun semua itu memang berat untuk di awalnya, akan tetapi yang terpenting jalani dulu semua itu. Resiko dan hambatan di kemudian hari sebaiknya dipikir sambil jalan.


(20 Januari - 18 Februari)

cha Septriasa adalah salah satu aktris yang selalu tampil total di film. Hal ini kembali Acha buktikan saat beradu akting dengan Reza Rahardian di film “Test Pack” produksi Starvision. Mungkin penikmat film Indonesia masih ingat dengan fill “Love Is Cinta” yang dibintangi Acha bersama Irwansyah. Saat itu keduanya tampil cukup romantis. Di masa itu Acha dan Irwansyah adalah sepasang kekasih, sementara di film ini Acha dan Reza bukanlah pasangan kekasih di dunia nyata. ”Sebagai pemain itulah tantangannya. Kalau pasangannya beda itu tantangan, karena harus bikin chemistry yang beda lagi,” kata Acha di Planet Hollywood Jakarta Selatan. Film “Test Pack” menceritakan perjalanan pasangan suami istri Rahmat (Reza Rahardian) dan Tata (Acha Setriasa). Konflik kemudian muncul karena

pasangan ini tak dikaruaniahi anak meski telah tujuh tahun menikah. Test Pack juga menyajikan adegan kemesraan antara Reza dan Acha yang berjuang untuk memperoleh anak. Acha mengungkapkan dirinya tak merasa

AKTRIS yang juga model cantik Renata Kusmanto terus dikait-kaitkan punya hubungan khusus dengan Fachri Albar. Tapi pemeran Shinta dalam film “Test Pack” juga terus membantah hubungannya dengan Fachri Albar. ”Enggak tahu deh, temenan sih. Tergantung orangnya aja melihatnya mau seperti bagaimana,” kata Renata di Planet Hollywood Jakarta Selatan. Renata juga terkesan berhati-hati jika ditanya tentang Fachri Albar. “Enggak tahu deh saya, seperti dia apa adanya. Saya melihat dia sebagai seorang pria,” ujar Renata. Renata saat ini tidak menargetkan diri kapan akan menikah. Namun

canggung beradegan mesra dengan Reza. ”Saya langsung dapat gimana nyender sama dia, gimana pegang tangan dia, dia cium saya. Karena ceritanya hubungan suami istri,” ungkap Acha. Saat pertama kali menerima tawaran film ini, Acha tidak tahu akan bermain dengan Reza Rahardian. Selain Reza aktor lain seperti Winky Wiryawan dan Christian Sugiono sempat ditawarkan ”Akhirnya terpilih Reza Rahadian. Umur saya enggak jauh beda dan belum pernah punya istri, jadi saya lebih bebas berekspresi saya,” terangnya. (abu/ jpnn)

Renata juga tidak mau menutup diri, jika saja dirinya menemukan pria yang cocok untuknya.”Saya mau fokus dikerjaan aja. Waktunya sih enggak ada, kalau memang ketemunya pas banget ya sudah enggak dibatasi, yang penting pas aja dan cocok,” kata Renata. Aktris yang akan merayakan ulang tahun ke30 pada 7 November mendatang ini mengaku orang tuanya tidak terlalu mendesak untuk menikah. “Dia cuma nyanya aja bagaimana, tapi terserah sama aku, yang penting cocok,” jelasnya. (abu/jpnn)

PENYANYI Alexa Key termasuk artis yang peduli pada pendidikan. Ia pun mengaku lebih mengutamakan sekolah ketimbang kariernya. Alexa Key memang tak memungkiri banyak tawaran manggung datang. Namun, kembali lagi ke jadwal, ia akan mempertimbangkan tawaran itu ketika tak sibuk sekolah. ”Pendidikan nomor satu, Papa juga bilang sekolah nggak boleh ditinggalkan,” ungkapnya saat ditemui di acara HUT TVRI ke-50 di Jalan Gerbang Pemuda, Senayan, Jakarta Selatan, Rabu (5/9). Sebelumnya, Alexa menimba ilmu di Bali. Tapi, tampaknya sekolah di sana tak efisien dalam segi waktu. Ia pun memilih tinggal di Jakarta. ”Waktu di Bali diprotect orangtua, sekarang dikasih kepercayaan, tapi kontek setiap hari. Jaga diri, jangan lupa sekolah, mereka orangtua yang ketat dan protektif, tapi aku sudah dewasa dan dikasih kebebasan. Aku di Jakarta sama asisten,” tuturnya. (dtc/int)

Teruslah berupaya meraih hasil yang terbaik. Tidak perlu menyerah dengan keadaan karena ibarat orang berjalan pasti tidak akan selalu mulus jalannya, maka dari itu tetaplah optimis dan yakin.


19 Februari - 20 Maret

Waspadalah, omongan yang berhembus itu anggaplah angin lalu. Tak perlu ditanggapi toh nantinya akan hilang dengan sendirinya ditiup angin. Cobalah lebih konsentrasi pada apa yang sedang Anda hadapi. Tak perlu memikirkan yang bukan-bukan.


(21 Maret - 20 April)

Entah karena apa, belakangan ini Nikita Mirzani jadi sering membicarakan dan menyebut-nyebut nama Aming. Setelah mengklaim pacaran dengan komedian itu, kini ia membuat pengakuan baru lagi. Kali ini, artis yang kerap tampil seksi itu seolah menyangkal pernyataannya sendiri sebelumnya. Kini ia mengaku hanya berteman, dan menginginkan pendamping seperti Aming. ”Sebenernya gini, Nikita itu temen deketnya dia (Aming). Kalau orang kan salah menginterpretasikannya,” tuturnya saat berbincang melalui ponselnya, Rabu (5/9). ”Kalau aku suka dia itu, pengen yang jadi pendampingku nanti seperti dia, kepribadiannya, sifatnya dan semuanya,” tambahnya. Nikita mengaku bingung kenapa gosip hubungannya dengan Aming menjadi ramai diberitakan. Menurutnya, pacar Aming yang sebenarnya sempat terganggu dengan kabar tersebut.

Peluang yang tinggi sebaiknya bisa diimbangi juga dengan kerja keras jangan sampai loyo ataupun tidak ada peningkatan dalam prestasi kerjanya. Di hari ini peruntungan cukup mujur sehingga selalu ada saja jalan setiap menemui suatu permasalahan.


(21 April - 20 Mei)

Tak ada gunanya mengobral janji kalau akhirnya hanya akan membuat beban Anda saja di kemudian hari. Bicaralah terus terang dan tak perlu menutup-tutupi kesulitan yang lagi Anda hadapi saat ini.


(21 Mei - 20 Juni)

Peruntungan cukup mujur sehingga sangat baik untuk digunakan menyelesaikan masalah yang terkatungkatung itu. Hanya saja jangan mudah percaya dengan orang lain sebelum Anda melihat sendiri buktinya.


(21 Juni- 20 Juli)

Optimis memang perlu tetapi untuk saat ini sebaiknya jangan terlalu berambisi karena situasi di sekitar Anda sulit untuk Anda prediksi. Lebih baik Anda melangkah dengan sabar tetapi sangat terencana agar kesuksesan tetap dapat Anda raih.


(21 Juli-21 Agustus)

Apapun resiko yang akan muncul sebaiknya keyakinan tetap tidak boleh bergeser, untuk itu hindari membicarakan persoalan pada orang lain agar pikiran dan visi Anda tidak sampai terganggu.

Gisel Libra

(23 Agustus-22 September)

.Tetaplah melangkah maju karena sudah kepalang tanggung untuk melangkah mundur. Lebih baik yang ada dijalani dengan kesungguhan dan kemantapan hati.


(23 Oktober - 22 November)

Jangan biarkan kecerobohan mengganggu kinerja dan kelangsungan bisnis Anda, apalagi kompetitor tampak selalu memperhatikan setiap gerak-gerik Anda.


( 23 November - 20 Desember)

Jangan hanya diam saja melihat sikap orang lain meremehkan kemampuan diri Anda. Segera lakukan gebrakan karena bagaimanapun juga mereka ternyata tidak bisa dihadapi dengan halus.

Sejak berita kecelakaan pesinetron, Rezky Aditya tersebar luas di media, Gissel ‘Idol mengaku jadi takut. Sinden Opera Van Java ini pun merasa ngeri boncengan motor bersama kekasihnya, Gading Marten. Gissel takut karena membayangkan ia bersama Gading akan mengalami kecelakaan seperti yang dialami oleh Rezky Aditya. “Baru mau mulai seru-seruan, baru beli jaket, kok malah kayak gini. Keder sih, makanya aku selalu ngomong ke Gading, aku kan selalu bilang, pokoknya pake helm

pake jaketnya yang lengkap. Meski pun ngebut, ngebutnya hati-hati,” kata Gissel di RCTI, Kawasan Kebon Jeruk, Jakarta Barat, Rabu (5/9). Menurut Gissel sebenernya ia agak khawatir juga dengan kekasihnya, meskipun Gading sudah bisa naik motor. Namun mengendarai motor gede (moge) itu baru bagi Gading. “Makanya aku khawatir banget, cerewet banget. Bukannya nggak suka dia naik motor, tapi khawatir,” ujarnya. Gissel sadar jika naik motor gede pasti

larinya kenceng, nggak mungkin pelan. Makanya ia bilang ke Gading agar selalu pakai pelindung motor yang banyak. “Mobilkan banyak pengamannya. Kalau motor langsung badan, langsung kepala,” ujarnya. Karena ketakutannya ini pula Gissel harus memupus angannya bisa naik moge seperti motor polisi. “ “Tapi kok kayak gininya. Jadi biarlah itu jd angan-angan belaka. Sekarang jadi parno, ntar-ntar ajalah,” tandasnya. (tr/int)

Pengen yang jadi pendampingku nanti seperti dia, kepribadiannya ”Aming nggak marah sih, ketawa aja. Dia orangnya asik, tapi pacarnya ngambek,” paparnya. (dc/int)



6 September 2012

Pedrosa Cetak Rekor di Aragon


ASURANSI ATLET: Presdir PT BCA Jahja Setiaatmadja di dampingi ketua KOI Rita Subowo dan Ketua Kontingen Olimpiade Indonesia Erick Tohir usai pemberian penghargaan.

Dua atlet angkat besi Eko Yuli Irawan dan Triyanto kembali mendapatkan penghargaan. Peraih medali di Olimpiade 2012 itu diberi jaminan asuransi kesehatan untuk jangka waktu yang sangat lama. Angkat besi adalah satu-satunya cabang yang menyumbangkan medali bagi kontingen Indonesia di Olimpiade lalu. Eko Yuli Irawan meraih medali perunggu,

sementara Triyatno menyabet medali perak. Sebagai wujud kepedulian atas prestasi yang diraih dua atlet angkat besi tersebut, Bank Cen-

tral Asia (BCA) memberikan penghargaan berupa perlindungan asuransi kesehatan. “Pemberian penghargaan ini merupakan bukti nyata kepedulian BCA terhadap peningkatan jaminan kepada atlet di masa depan. Karena kami turut bersyukur dan bangga atas prestasi dan pencapaian mereka,” ujar Presiden Direktur BCA,

Jahja Setiaatmadja, di Planet Hollywood, Jakarta, Rabu (5/9). Perlindungan asuransi tersebut tertanggung hingga usia 75 tahun. Rinciannya adalah perawatan rumah sakit kelas VIP, perlindungan 34 macam penyakit kritis dan perlindungan kecelakaan. Selain itu, pemberian jaminan perlindungan kematian sampai usia 99

Ahsan Mulai dari Awal Lagi

Pemain ganda putra Indonesia Mohammad Ahsan harus memulai perjuangan dari titik awal untuk kembali ke elite dunia setelah memutuskan berpisah dengan pasangannya Bona Septano. Keduanya sepakat berpisah setelah sama-sama mengevaluasi diri dari pencapaian prestasi. Keduanya memang masuk dalam elite dunia dalam peringkat 10 besar dunia. Namun, keduanya kerap kesulitan meraih gelar ketika berhadapan dengan empat ganda kuat dunia dari China, duo Korea Selatan, dan Denmark. Hasil mengecewakan pada Olimpiade London 2012 juga menjadi pertimbangan terakhir mereka untuk berpisah. “Kami pikir kita sudah waktunya berpisah. Permainan kita berdua sudah mentok dan kami butuh suasana baru,” kata Ahsan dalam jumpa pers

„ M Ahsan di pelatnas Cipayung Jakarta, Rabu (5/9). Selanjutnya Ahsan akan berpasangan

dengan Hendra Setiawan yang merupakan juara Olimpiade Beijing. Hendra sendiri sebelumnya juga menyatakan berpisah dengan Markis Kido setelah dipanggil kembali ke pelatnas Cipayung. Seusai menyalami Bona yang disaksikan pelatihnya Herry IP yang didampingi kepala pelatih ganda Christian Hadinata, Ahsan mengungkapkan dirinya akan berupaya keras untuk kembali ke jajaran elite dunia. “Kami akan memulai lagi setahap demi setahap. Mudah-mudahan prestasi kami lebih bagus,” kata Ahsan. (int)

tahun. Jahja menambahkan, dengan diberikan asuransi kesehatan itu diharapkan dapat memberikan rasa aman bagi Eko dan Triyanto saat berlaga maupun saat pensiun. “Dengan adanya penghargaan ini, diharapkan menjadi acuan dan motivasi para atlet agar terus bekarya,” tukasnya. (int)

„ Kate Middleton

buat balapan selanjutnya dan mari kita lihat apa yang bisa kita dapattkan dari motor ini,” tandas The Little Spaniard (julukan Pedrosa). Lorenzo sendiri harus puas menempati peringkat kedua, sedangkan Ben Spies menempati peringkat ketiga dengan selisih waktu +0.664 detik dari Pedrosa. Kemudian disusul Stefan Bradl (+1.587 detik) dan Jonathan Rea (+2.696 detik), yang akan sementara mengggantikan posisi Stoner Tes MotoGP Aragon selanjutnya akan berlangsung pada Rabu waktu setempat. Sementara itu, Ducati mengadakan tes pribadi di Sirkuit Mugello, pekan ini. (int)

mampu menang set pertama 6-1. Di set kedua, Trosur mampu membalas dengan memetik kemenangan 6-4. Duel sengit kembali terjadi di set ketiga. Kedua petenis tampil ngotot dan pertandingan berjalan alot. Tapi Stosur tampaknya harus mengakui keunggulan lawannya itu. Azarenka berhasil menutup set ketiga dengan 7-6(5). Kemenangan ini membuat petenis Belarusia itu berhak melaju ke babak semifinal. Di babak ini, Azarenka akan menghadapi antara Maria Sharapova atau marion Bartolli. Sharapova diketahui menjadi unggulan ketiga di turnamen ini. Sedangkan Bartolli merupakan unggulan kesebelas. (int)

Alonso: Grosjean Minta Maaf lewat Telepon

Pembalap Ferrari, Fernando Alonso, tak menaruh dendam terhadap pebalap Lotus, Romain Grosjean, yang menggagalkan usahanya untuk merebut poin di GP Belgia, akhir pekan lalu. Pebalap asalSpanyolinimengatakandirinya sudah memaafkan pebalap Perancis tersebut, yang telah mengakui kesalahannya meskipun melalui telepon. “Ya,kamisudahmengadakan kontak, karena kami memiliki hubungan yang baik,sertakamimerupakan teman kelas pada 2009. Saya mengirimkan SMS untuk menjelaskan bahwa dia tidak memperhitungkan jarak, dan dia sudah meminta maaf atas insiden itu. Saya mengatakan kepadanya bahwa tak ada masalah lagi,” jelas Alonso, seperti dikutip T o p sportracing, Rabu (5/ 9).

Tolak Bersalaman dengan Kate Middleton berjabat tangan dengan perempuan yang tidak memiliki hubungan keluarga atau muhrimnya,” ujar perwakilan Kerajaan Inggris, seperti dilansir Daily Mail. Delegasi Iran mengatakan, tindakan Kahram sama sekali tak punya sentimen politik, dan semata-mata hanya untuk menjalankan ajaran agama Islam. “Jika atlet putri yang mendapat medali, pasti akan berjabatan tangan dengan sang putri.” Tahun lalu, tim voli putra Iran dikecam di negaranya setelah berjabatan tangan dengan wasit perempuan usai pertandingan melawan Afghanistan. Sejumlah media m e n y e b u t tindakan tersebut s a n g a t memalukan, dan tak pantas dilakukan. (int)

„ Dani Pedrosa

Azarenka Tekuk Juara Bertahan

PETENIS unggulan pertama, Victoria Azarenka sukses menghentikan langkah juara bertahan, Samantha Stosur di babak perempat final Grand Slam AS Terbuka, Selasa, 4 September 2012 (Rabu dinihari WIB). Azarenka memenangi laga lewat duel tiga set 6-1, 4-6, 7-6 (5). Kemenangan ini tidak diperoleh dengan mudah oleh petenis 23 tahun itu. Stosur yang berstatus juara bertahan memberikan perlawanan sengit. Dalam laga yang digelar di Arthur Ashe Stadium ini, Azarenka

Mehrdad Karam Zadeh

ATLET paralimpiade asal Iran, Mehrdad Karam Zadeh, menjadi perbincangan di Eropa setelah menolak menjabat tangan istri Pangeran William, Kate Middleton, yang merupakan keluarga kerajaan, di ajang Paralimpiade 2012 di London. Atlet tolak peluru ini menolak bersalaman tangan dengan Duchess of Cambridge setelah penyerahan medali perak. Middleton sebelumnya mendapat sambutan hangat dari peraih medali emas, Alec Davies dari Inggris Raya dan peraih perunggu, Lezheng Wang dari Cina.Namun saat Middleton mengalungkan medali perak kepada Karam, atlet berusia 40 tahun itu tidak menjulurkan tangan seperti dua atlet sebelumnya. Ia hanya meletakkan kedua tangannya di depan dada seperti salam yang biasa dilakukan orang Thailand. Bagi orang-orang Eropa kejadian tersebut dianggap sangat menghebohkan, bahkan dikait-kaitkan dengan sentimen politik. Padahal pastinya, Karam tak berjabatan tangan dengan sang putri lantaran hal itu bertentangan dengan ajaran Islam. Dengan kata lain sang putri bukan muhrimnya. Juru bicara Istana St James, yang merupakan tempat sang putri bermarkas, sebelumnya mengatakan pihaknya telah memberi tahu Kate agar tak menjabat tangan atlet Iran tersebut. “Atlet pria dari negara Islam tidak

Dani Pedrosa terus melanjutkan performa gemilangnya. Pedrosa menjadi pembalap tercepat mengalahkan rivalnya Jorge Lorenzo dalam sesi tes di Aragon, Selasa (4/9) kemarin waktu setempat. Lorenzo yang mencatat kemenangan dalam balapan terakhir di Brno, tidak mampu membendung keperkasaan Pedrosa. Pembalap Repsol Honda itu unggul 0.488 detik dari rivalnya tersebut. Pedrosa yang fokus di suspensi dan elektronik, mampu melahap sekitar 35 lap dengan mencatatkan waktu terbaik 1m 47.983 detik. Catatan yang diraih pembalap asal Spanyol itu, melampaui rekor yang pernah dibuat oleh Casey Stoner di Aragon. “Kami fokus untuk mengerjakan suspensi untuk meningkatkan performa grip bagian depan khususnya. Kami hanya berusaha untuk membuat motor lebih lembut lagi,” ungkap Pedrosa, dikutip dari Crash, Rabu (5/9). Saat itu, ia berhasil mencatat rekor 1m 49.046 detik saat perlombaan dan 1m 48.451 detik, ketika meraih pole position pada sesi kualifikasi. Keduanya diraih saat masih menggeber mesin 800cc. “Ini tes resmi terakhir, jadi sangat penting untuk memanfaatkan keuntungan

„ Victoria Azarenka

Memang, Alonso harus menerima kenyataan pahit pada balapan tersebut.Saatlampumerahpadam tanda balapan dimulai, dia ikut menjadi korban tabrakan beruntun yang disebabkan oleh Grosjean, yang lebih dulu menyenggol mobil Lewis Hamilton, sebelum menghantam Sergio Perez, dan akhirnyaikutmenyeretmobilAlonso yang mengalami rusak berat. Akibat kegagalan dalam lomba ini, Alonso tak mampu mendapatkan poin, meskipun dia tetap memimpin klasemen sementara. Akan tetapi, posisinya sudah mulai mendapatkan ancaman dari pebalapRedBullRacing,Sebastian Vettel, yang menjadi runner-up setelah finis di belakang pebalap McLaren, Jenson Button. Kini, Alonso hanya unggul 24 poin atas juaradunia2010dan2011tersebut. Namun Alonso tak mau larut dalam kekecewaan akibat insiden, yang tidak ingin dijadikan persoalan. Mantan pebalap Renault dan McLaren ini mengaku siap menghadapi seri selanjutnya di Monza, Italia, pada akhir pekan ini. Apalagi, balapan tersebut akan berlangsung di kandang Ferrari. “Saya baik-baik saja, dan dalam kondisi 100 persen, serta siap melanjutkan pertarungan. Memang, kejadian hari Minggu itu menyakitkan, tetapi tidak menghancurkan. Setelah bangun, saya sudah dalam kondisi 100 persen. Saya sudah bisa berolahraga, bekerja di simulator, dan semuanya sempurna,” ujar juara dunia 2005 dan 2006 ini. Alonso bekerja secara intensif di Maranello,untukmempersiapkan diri menghadapi balapan akhir pekan ini di Monza. Dia bertelad menebus kegagalan di Belgia dengan kemenangan di harapan publik Ferrari. “Mobilbisamemimpin kami untuk berarung memperebutkan gelar juara dunia. Meskipun dengan banyak kesulitan, kami tetap memiliki keuntungan. Monza merupakan trek spesial bagi kami dan harapannya pasti tinggi. Kami tidak boleh mengecewakan para tifosi sehingga harus memberikan 110 persen,” jelasnya. (int)

KAMIS 6 September 2012

Di-Bully Fans Lawan Wenger Sudah Kebal LONDON- Tak sekali dua kali Arsene Wenger mendapat teriakan olok-olok dari suporter lawan sepanjang 16 tahun melatih Arsenal. Apakah ia gentar dengan itu semua? The Professor menjawab tegas, tidak.

M „ Wenger

arkas Tottenham Hotspur, White Hart Lane, dan kandang Stoke City, Britannia Stadium, disebut Wenger sebagai tempattempat di mana ia pernah mendapat olok-olok. Presiden Arsenal, Peter Hill-Wood, bahkan

menyebut para suporter yang terus menyerang Wenger dengan sebutan ‘menjijikkan’. Tetapi Wenger tak peduli dengan hal tersebut. Meski tak menyukainya, pelatih 62 tahun tersebut merasa lebih baik fokus pada pertandingan daripada

meladeni ulah para suporter seperti itu. “Saya pribadi tak menyukai olok-olok suporter lawan, tetapi saya tak pernah takut. Ketika anda menjadi manajer. anda harus fokus pada pertandingan, bukan omongan suporter kepada anda,” tukasnya di Soccernet. Perjalanan waktu disebut Wenger telah mengajarkannya untuk tidak mempedulikan apa yang terjadi di tribun penonton dan fokus dengan apa yang ada di

atas lapangan. “Percayalah, jika saya menanggapi komentarkomentarsuporterlawandalam15 tahunlebihmasakepelatihansaya, sejak dulu saya sudah keluar dari sepakbola Inggris.” “Seiring berjalannya waktu, anda akan kebal dengan sendirinya dengan komentarkomentar tersebut. Setiap orang bisa saja berperilaku tidak sopan terhadap orang lain, tetapi anda tak boleh terpengaruh,” tuntasnya. (int)

Pulih Cedera, Aguero Bakal Kembali di Timnas Argentina BUENOS AIRES- Setelah absen sekitar dua pekan, Sergio Aguero akan segera comeback. Tapi laga pertamanya nanti bukan bersama Manchester City, melainkan dengan timnas Argentina di Kualifikasi Piala Dunia. Manchester City dan pelatih RobertoMancinimemprediksikan Aguero baru akan bisa kembali dimainkan pasca laga internasional sepanjang akhir pekan ini dan tengah pekan depan. Setelah mengalami cedera di pekan pembuka Premier League, Mancio tak mau anak didiknya buru-buru comeback yang justru bisa meng-

hadirkan risiko lebih besar. Tapi keinginan Mancini agar pemainnya itu beristirahat lebih lama hampir dipastikan tidak akan terwujud. Aguero yang sudah mulai pulih terlanjur bertekad tampil bersama timnas Argentina saat menghadapi Peru di Kualifikasi Piala Dunia 2014. “Saya di sini untuk laga kontra Peru,” seru Aguero seperti diberitakan Skysports. “Lutut saya masih sakit saat ini dan itu terasa mengganggu, tapi mungkin dalam dua atau tiga hari kondisinya akan berubah. Saya tidak akan bertemu dengan doktor

Spalletti: Milan Bukan Favorit di Grup C „ Spalletti

STPETERSBURG-PelatihZenit Saint Petersburg Luciano Spalletti, tak gentar meski timnya harus bertemu dengan AC Milan di fase grup Liga Champions. Spalletti juga tidak menganggap Rossoneri sebagai tim favorit. Hasil undian pada pekan lalu menempatkan Zenit dan Milan di Grup C. Mereka akan ditemani oleh Anderlecht dan Malaga. Spalletti menilai, grup ini seimbang dan tak ada tim yang benar-benar lebih diunggulkan untuk melaju ke babak berikutnya, termasuk Milan. “Apakah Milan favorit? Saya memprediksi grup yang seimbang, dimana itu akan membuat segalanya jadi lebih rumit,” ungkap Spalletti kepada Sky Sport Italia. “Saat saya bekerja di Rusia, kami telah menunjukkan kamampuan kami dan mampu memenangi beberapa trofi,” sambungnya. “DiLigaChampions,kamiharus bekerja lebih keras. Itulah kenapa

kami merekrut Hulk dan Alex Witsel karena mereka merupakan tambahan pemain yang penting untuk skuat yang telah ada,” kata ekspelatihUdinese dan AS Roma ini. (int)

timnas Argentina,” lanjut dia. Pelatih Argentina, Alejandro Sabella, sudah memasukkan nama Aguero dalam daftar pemain untuk laga tersebut. Namunjikakondisipemaindepan berusia 24 tahun itu tidak membaik, Sabella diyakini tidak akan memaksakan Aguero untuk tampil. “Selalu menyenangkan untuk berada di sini bersama teman-teman. Kami sudah saling kenal sejak usia di bawah 20 tahun dankarenaitulahkamimerupakan grup yang bagus, dan kami harus terus melanujutkannya,” lugas Aguero. (int)

„ Aguero

Balzaretti Absen Satu Bulan COVERCIANO- AS Roma tak akan bisa menggunakan tenaga Federico Balzaretti selama satu bulan ke depan. Akibat cedera paha, Balzaretti harus absen selama satu bulan. Balzaretti mulai mengalami masalahsaatRomabertandangke markas Inter Milan akhir pekan lalu dalam lanjutan Liga Italia. Di laga yang dimainkan di Giuseppe Meazzaitu,Balzarettiharusditarik keluar di menit ke-56 dan digantikan oleh Rodrigo Taddei. DilansirdariFootballItalia,hasil pemeriksaan menunjukkan bahwa Balzaretti mengalami cedera paha yang tingkat keparahannyaberkisarpada level pertama dan kedua. Karena itu, eks pemain Palermo itu harus menepi hingga satu bulan. Dengan cederanya Balzaretti, posisi bek kiri Roma

„ Federico Balzaretti

tinggal menyisakan nama Rodrigo Taddei. Dodo yang direkrut di jendela transfer musim panas ini masih belum bisa dimainkan karena masih dalam masa pemulihan cedera. Akibat cedera ini, Balzaretti juga harus meniggalkan pemusatan latihan timnas Italia. Dia tak bisa memperkuat Gli Azzurri di laga

kualifikasi Piala Dunia melawan Bulgaria (7/9) dan Malta (11/9/). (int)

Hari Ini, Sepakbola PON XVIII Riau Versus Sumbar KAMPAR- Meski resminya PON XVIII dimulai 9 September, tapi cabang olahraga sepakbola akan mulai dipertandingan hari Kamis(6/9)besokdiBangkinang, Kabupaten Kampar, Riau. Di Kampar akan dikonsentrasikanGrupCyangterdiridariRiau, Sumatera Barat (Sumbar), Jawa Tengah (Jateng), Kalimantan Selatan(Kalsel)/Kalimantan Timur (Kaltim). Tuan rumah Riau akan membuka perhelatan melawan Sumbar. “Khusus untuk Kaltim dan Kalsel masih menunggu keputusanPBPON,siapayangakan bertanding. Karena keduanya lagi ada masalah,” kata Ketua Harian Sub Pengurus Besar (PB) PON KE XVIII Kabupaten Kampar, Azwan, kepada wartawan dalam konferensi pers, di Kantor Sekretariat Sub PB PON Kabupaten Kampar, di Jalan Pramuka, di Bangkinang, Rabu (5/9). “Untuk partai berikutnya yang mempertemukan Kalimantan Timur/Kalimantan Selatan de-

ngan Jawa Tengah yang dijadwalkan akan berlangsung pada malam harinya, dengan kick-off pada pukul 19.00 WIB. Tapi untuk Kalsel dan Kaltim masih menunggukeputusanPBPONtadi,” ujarnya. Ada tiga grup di PON kali ini. Grup A ditempati Papua, Nusa Tenggara Barat, Sulawesi Tengah,danJami.Grupinibermain di Rengat, Kabupaten Indragiri Hulu. Grup C dihuni Jawa Timur, Jawa Barat, Sumatera Utara, dan Gorontola, dipusatkan di stadion Taluk Kuantan, Kabupaten Kuantan sengingi. (int)

MU Dikabarkan Tawar Neymar, Santos Membantah

„ Neymar SAO PAULO- Manchester United diisukan telah mengajukan penawaran besar untuk Neymarmenjelangbursatransfer ditutup. Sang klub, Santos membantahnya karena sejauh ini tak pernah ada kontak dari MU. Menurutlaporanyangberedar kubu “Setan Merah” menawarkan 38 juta poundsterling (sekitar Rp 576 miliar) di hari terakhir bursa transfer. Neymar sendirisudahlama dikaitkaitkan dengan

kepindahan ke Eropa dan klubklub top seperti Barcelona dan Real Madrid siap bertarung untuk memperebutkan tanda tangannya. Tapi pesepakbola 20 tahun itu berniat tetap di Brasil hingga gelaran Piala Dunia 2014. MU mengalihkan bidikannya ke Neymar usai gagal menggaet kompatriotnya Lucas Moura yang akhirnya hijrah ke Paris St. Germain dengan nilai transfer besar: 38 juta pounds. Bagaimanapun, isu tersebut ternyata hanyalah isapan jempol belaka.Santosmenegaskantidak pernah menerima kontak dari klub Inggris tersebut. “Saya tidak tahu kabar itu berasal dari mana, tapi itu tidak benar,” tegas Felipe Faro, direktur sepakbola Santos kepada Globo Esporte yang dilansir Sky Sports. Bantahan juga diungkapkan ayah sekaligus agen si pemain, Neymar Santos. “Neymar juga sudah terjual pada dua tahun lalu tapi kami masih disini,” cetusnya sembari menyindir soal kencangnya kabar kepindahan putranya ke Eropa beberapa waktu lalu. (int)

Javi: City Klub Terbaik Inggris & Aku Siap Berjuang MANCHESTERRekrutan anyar Manchester City, Javi Garcia, memuji klub barunya tersebut. Selain itu, ia mengaku siap untuk bertarung memperebutkan posisi. Javi didatangkan dari Benfica dengan nilai transfer mencapai 15 juta poundsterling. Pemain berusia 25 tahun itu pun mengaku senang bisa bermain dengan sederet pemain top lainnya. “Tak diragukan lagi, aku berada di klub terbesar di Inggris dan salah satu klub terbesar di Eropa saat ini,” ujarnya seperti dilansir Soccernet. “Jadi, aku sangat bangga dan aku sadar bakal bermain bersama tim yang dipenuhi pemain top.” Dengan banyaknya pemain-pemain kelas satu di skuat The Citizens, Javi sadar bahwa tidak mudah untuk masuk ke dalam starting XI. Javi biasa beroperasi sebagai

gelandang tengah, tetapi ia mengaku lebih nyaman bermain sebagai gelandang bertahan yang berdiri di depan duet bek tengah. Di City, posisi tersebut biasa dilakoni oleh Yaya Toure, Gareth Barry ataupun Nigel De Jong—yang kini sudah hengkang ke AC Milan. Namun, Toure punya peran lain. Ia kerap maju ke depan untuk membantu serangan. “Posisi naturalku adalah gelandang tengah, berada tepat di depan bek tengah. Terkadang, aku juga dimainkan sebagai bek tengah darurat ketika dibutuhkan di Benfica.” “Tapi, aku merasa nyaman bermain sebagai holding midfielder yang berdiri tepat di depan garis pertahanan. Aku harus berjuang keras untuk mendapatkan tempat di starting XI karena untuk mencapainya adalah sesuatu yang lebih berat dibandingkan di klub-klub lain.” (int)

Ada Fletcher di Skuad Liga Champions MU MANCHESTER-Duabulanlalu DarrenFletcherterancampensiun dini dari sepakbola akibat sakit yang dia alami. Seiring kondisinya yang terus pulih, dia dimasukkan Sir Alex Ferguson dalam skuad Manchester United di Liga Champions. Gara-gara penyakit pada ususnya, Fletcher absen memperkuat MU dari November 2011 lalu. Bukan itu saja, gelandang asal Skotlandia itu malah sempat dikhawatirkan akan menepi selamanya karena diprediksi tidak akan bisa

benar-benar pulih. Namun kondisi Fletcher kini sudahjauhmembaik.Setelahtampil dalam dua pertandingan eksebisi pada pertengahan Agustus lalu, namanya kini dimasukkan Fergie dalam skuat The Red Devils yang akan berlaga di Liga Champions.DemikiandikutipdariGuardian. “Darren bisa dengan mudah masuk dalam skuat 25 pemain dengan mudah, tanpa harus mengorbankan pemain lain yang tidak harus kami daftarkan karena mereka adalah pemain akademi

sepakbola kami. Itu sebuah keuntungan. Dia berlatih sangat baik dan bermain dengan sangat baik beberapa waktu lalu bersama tim U21,”sahutFergusonmengomentari kondisi pemainnya pekan lalu. Selain Fletcher, nama lain yang dimasukkan Fergie adalah para pemain baru ‘Setan Merah’ seperti Shinji Kagawa, Robin van Persie dan Nick Powell serta Alexander Buttner. Dua nama yang disebut terakhir sama sekali belum pernah dimainkan Fergie di awal msuim ini. (int)

KAMIS 6 September 2012

ENGLISH PREMIER LEAGUE No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

„ Ronaldo

Team Chelsea Swansea City West Brom Man City Man United Everton West Ham Arsenal Wigan Newcastle Fulham Stoke City Sunderland Tottenham Norwich City Reading Aston Villa Liverpool QPR Southampton

M 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 2 3 3 3 3

M 3 2 2 2 2 2 2 1 1 1 1 0 0 0 0 0 0 0 0 0

S 0 1 1 1 0 0 0 2 1 1 0 3 2 2 2 1 1 1 1 0

K 0 0 0 0 1 1 1 0 1 1 2 0 0 1 1 1 2 2 2 3

SG 8-2 10-2 6-1 8-5 6-5 4-3 4-3 2-0 4-4 3-4 7-6 3-3 2-2 3-4 2-7 3-5 2-5 2-7 2-9 4-8

Nilai 9 7 7 7 6 6 6 5 4 4 3 3 2 2 2 1 1 1 1 0

TOP SCORER Kamu memiliki cinta dari kami, dan kami juga akan membantu apapun yang kamu butuhkan. Kita akan berbicara lebih banyak lagi setelah laga uji coba internasional. Tapi satu yang harus kamu ingat, kami selalu ada untuk mendengarkan dan menolongmu.”

Gol 4 4 3

Nama Klub Michu Swansea City R. van Persie Manchester United C. Tévez Manchester City

Jose Mourinho

MADRID - Kesedihan yang dirasakan Cristiano Ronaldo membuat gusar beberapa penggawa Real Madrid. Tak terkecuali Jose Mourinho, yang menyebut kalau semua orang di El Real mencintainya.


onaldo mengejutkan banyak pecinta sepakbola dengan mengatakan sedang bersedih pasca duel melawan Granada di La Liga, akhir pekan kemarin. Salah satu rumor menyebutkan, eks winger Manchester United itu sudah tak betah lagi di Santiago Bernabeu. Real Madrid tentu tak ingin pemain termahalnya itu hengkang lantaran ada sesuatu yang membuatnya sedih. Takut hal yang tak diinginkan terjadi, Mourinho meyakinkan Ronaldo kalau orang-orang di Madrid masih mencintainya. Pria Portugal itu juga meminta pemain termahal dunia itu berbagi ‘misteri’ kesediahannya. “Kau adalah pemain spesial di sini (Real Madrid). Saya sama sekali tak ragu akan hal tersebut. Kita harus bicara, kau sangatdihargaidanbutuhdicintai,”ujarMoudalamsebuah percakapan yang dilansir Marca. “Kamu memiliki cinta dari kami, dan kami juga akan membantu apapun yang kamu butuhkan. Kita akan berbicara lebih banyak lagi setelah laga uji coba internasional. Tapi satu yang harus kamu ingat,kami selalu ada untuk mendengarkan dan menolongmu,” tuntas Mourinho. Banyak rumor berkembang terkait kesedihan yang dirasakan pesepakbola 27 tahun tersebut. Selain masalah uang dan kontrak baru, kabar lain menyebut ada ketidakcocokan dengan rekan setim. Meski mantan pemain terbaik dunia itu sudah menyangkal kalau kesedihannya berlatar belakang uang, masalah apa yang sebenarnya terjadi dengan CR7 masih tetap misteri. (int)

„ Vieri

No 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Team M Barcelona 3 Mallorca 3 Málaga 3 Rayo Vallecano 3 Real Valladolid 3 Deportivo 3 Sevilla 3 Getafe 3 Atlético Madrid 2 Levante 3 Real Madrid 3 Real Betis 2 Real Sociedad 3 Real Zaragoza 3 Celta de Vigo 3 Athletic Club 3 Valencia 3 Granada 3 Espanyol 3 Osasuna 3

M 3 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 0 0 0 0

S 0 1 1 1 0 2 2 1 1 1 1 0 0 0 0 0 2 1 0 0

K 0 0 0 0 1 0 0 1 0 1 1 1 2 2 2 2 1 2 3 3

SG 8-2 4-2 3-1 3-1 3-2 6-4 3-2 4-4 5-1 4-5 5-3 6-5 3-7 2-3 3-3 5-9 4-5 1-5 4-7 1-6

Nilai 9 7 7 7 6 5 5 4 4 4 4 3 3 3 3 3 2 1 0 0

TOP SCORER Gol 4 3 3

Nama L. Messi R. Falcao T. Hemed

Klub Barcelona Atlético Madrid Mallorca

Pippo Inspirasi Falcao

Ini Alasan Inter Mata-matai Vieri MILAN- Akibat memata-matai kehidupan pribadi Christian Vieri, Inter Milan diperintahkan pengadilan untuk membayar denda besar.ApaalasanLaBeneamatamemata-matai mantan bombernya itu? Seperti diberitakan sebelumnya, Vieri berang ketika tahu Inter Milan menyadap teleponnya. Ia pun mengajukan gugatan dan gugatan tersebut dimenangkan pengadilan. Bukan hanya Inter yang digugat oleh Vieri, tetapi juga perusahaan komunikasi Telecom Italia. Keduanya dituding Vieri telah melakukan penyadapan pada teleponnya lantaran Inter ingin memantau kehidupan pria yang kerap disapa Bobo itu. Seperti diberitakan kantor berita ANSA, Vieri akhirnya mendapatkan ganti rugi sebesar 1 juta euro (Rp 12 miliar). Meski angka yang dia minta sebagai ganti rugi lebih besar dari itu. Vieri mengajukan gugatan tersebut lantaran masalah tersebut telah mengganggu kehidupan pribadinya dan imbasnya berpengaruh pada permainannya di lapangan. Tapi, hal itu dibantah oleh Inter. “Kami jelas terkejut dengan tudingannya dan kami akan melakukan banding. Kami yakin bahwa kami tidak bersalah,” ujar pengacara Inter, Marco Fassone, di Football Italia. “Dalam pengadilan olahraga, kasus yang diperbincangkan ini sudah dikubur. Masa kasusnya sudah kadaluarsa.” “Jika penjelasan itu tidak cukup, tudingan yang diajukan juga tidak mungkin memengaruhi karier si pemain. Jadi, tak mungkin juga kasus itu merusak citranya. Kami tetap tenang dan akan mengajukan banding.” Lalu, mengapa juga Inter memilih untuk menyadap dan memata-matai Vieri? “Sebuah biro penyelidikan disewa untuk memantau apakah Vieri berlaku sesuai dengan peraturan internal Inter atau tidak,” lugas Fassone. (int)


juga punya idola. Ia menyebut Pippo telah menginspirasinya hingga dapat bermain seperti sekarang. Kepada rekan senegaranya di Kolombia, Mario Yepes, yang juga sempat merasakan menjadi rekan satu tim Inzaghi di AC Milan, Falcao bahkan meminta tolong agar Pippo bersedia menandatangani kostum Rossoneri untuknya. “Apakah kabar itu benar, bahwa saya menyuruh Mario Yepes agar Inzaghi menandatangani kostum Milan saya? Tentu saja itu benar,” tukas striker 26 tahun tersebut di Soccerway.

“Inzaghi adalah striker yang sangatsayakagumikarenainstingnya dalam mencetak gol. Dia menginspirasisayadengancaranya bermain.” Pasca memutuskan pensiun akhir musim lalu, Pippo kini tengah merintiskariersebagaipelatihditim junior di Milan. Selama lebih dari 10 tahun membela Il Diavolo, Pippo sukses meraih dua Scudetto, satu Coppa Italia, dua trofi Liga Champions, dua trofi Piala Super Eropa, dan satu trofi Piala Dunia Antarklub. (int)

Rooney: Sir Alex Punya Standar Tinggi

‘Jangan Tandemkan Cassano dengan Milito’

MANCHESTER- Wayne Rooney menyebut bahwa Sir Alex Ferguson punya standar tinggi. Saking tingginya standar itu, Rooney sampai mengaku takut untuk membuat kesalahan. Sir Alex memang dikenal begitu. Cerita bahwa dia suka menyemprot pemainnya —dikenal dengan hair dryer-treatment— ketika Manchester United bermain buruk, adalah cerita yang banyak diketahui orang. Sudah bukan rahasia. Menurut Rooney, tekanan itu akan lebih besar kepada para penyerang. Kalau tidak tampil bagus, ada kemungkinan si pemain bakal dicadangkan (atau tidak dimainkan sama sekali) pada pertandingan berikutnya. “Sebagai penyerang, saya harus bekerja keras setiap waktu. Saya harus tetap tajam, yang artinya kebugaran saya harus terjaga supaya saya bisa terus bermain bagus. Jika saya tidak bugar, maka itu akan terlihat jelas,” ujarnya seperti dilansir Sportinglife.”Mungkin akan berbeda jika seandainya saya adalah seorang full-back. Saya bisa sedikit bersembunyi, membuat beberapa lari pendek ke depan dan sudah dimaklumi.” “Sebagai penyerang Manchester United, tak ada pemakluman sama

MILAN - Legenda Inter Milan Sandro Mazzola, punya catatan untuk mantan klubnya itu. Ia menyebut, pertandingan melawan AS Roma adalah bukti bahwa Antonio Cassano dan Diego Milito tak bisa ditandemkan. Pada pertandingan yang dihelat di Stadion Giuseppe Meazza tersebut, Inter kalah 1-3. Satu gol La Beneamata disumbangkan oleh Cassano.MantanpemainACMilan itudimainkanberbarenganbersama Milito sejak awal. Namun ia kemudiandigantikanolehRodrigoPalacio di menit ke-50. “Itu adalah bukti bahwa Cassano tidak bisa ditandemkan dengan Milito. Tapi, mencadangkandiaakanmenjadihinaan kepadasepakbola,”ucapMazzoladi Football Italia. “Kita lihat saja nanti seperti apa jadinyadiakhirmusim.” Di sisi lain, Mazzola mengatakan bahwaRomadibawaharahanZdenekZemanmenunjukkanstartyang bagus pada pertandingan itu. Sedangkan Inter, menurutnya, masih butuh waktu lagi. “InterterdesakdengancaraRoma bermain. Giallorossi memulai dengan baik, seperti yang kerap dilakukan tim-tim arahan Zdenek Zeman.”(int)

„ Radamel Falcao

JAKARTA- Radamel Falcao kini bisa jadi dianggap sebagai salah satu striker terbaik di dunia. Siapakah pemain yang menjadi inspirasinya? Striker Atletico Madrid tersebut menjawab, Filippo Inzaghi. Naluri gol Falcao memang tengah menggila. Terakhir ia mencetak trigol ke gawang juara Liga Champions musim lalu, Chelsea, pada laga Piala Super Eropa. Los Colchoneros pun dibawanya menang 4-1. Layaknya pesepakbola lain, ia

„ Wayne Rooney sekali. Saya harus bekerja sekeras mungkin, jika tidak manajer akan menariksayadarilapanganatausaya ditinggalkan pada pertandingan berikutnya.” “Tak ada ruang untuk membuat kesalahan atau menjadi yang terbaik kedua di klub ini,” papar Rooney. Penyerang berusia 26 tahun itu pun memberikan contoh, yakni ketika dirinya pergi makan malam bersama beberapa rekan setim dan pasangan-pasangan mereka pada Boxing Day 2011. Ketika itu MU baru sajamenang5-0.Rooneymengirahal itu boleh-boleh saja. Tapi, ternyata tidak. Bagi Sir Alex, keluar malam-

malamenamharimenjelangpertandingan penting tidak bisa ditolerir. Keesokan harinya, manajer asal Skotlandia itu memanggil Rooney dan mengatakan bahwa dirinya tidak senang. “Saya didenda dan ada yang lebih buruk lagi; saya ditinggalkan untuk pertandingan melawan Blackburn pada malam tahun baru.” “Banyak klub tidak akan peduli pemain-pemainnya pergi malammalam enam hari sebelum pertandingan. Tapi, itulah bedanya di Manchester United dan itu adalah tandatingginyastandardantuntutan dari manajer,” tukasnya. (int)

ITALIAN SERIE A 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Juventus Napoli Lazio Sampdoria Roma Catania Torino Genoa Internazionale Milan Fiorentina Chievo Parma Cagliari Udinese Bologna Palermo Pescara Atalanta Siena

2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2

2 2 2 2 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0 0

0 0 0 0 1 1 1 0 0 0 0 0 0 1 0 0 0 0 1 1

TOP SCORER Gol 3 3 2

Nama S. Jovetiæ G. Pazzini G. Bergessio

Klub Fiorentina Milan Catania

0 0 0 0 0 0 0 1 1 1 1 1 1 1 2 2 2 2 1 1

6-1 5-1 4-0 3-1 5-3 5-4 3-0 4-3 4-3 3-2 3-3 2-2 2-2 1-3 2-6 1-5 0-6 0-6 1-2 1-2

6 6 6 5 4 4 3 3 3 3 3 3 3 1 0 0 0 0 -1 -5

epaper | Metro Siantar