Issuu on Google+

Kamis, 3 Mei 2012

Edisi 23 „ Tahun X

Tidak Ada Karcis, Jangan Bayar Parkir

„ Bambang

SIANTAR- Setoran parkir menguap jutaan rupiah setiap hari dari berbagai lokasi parkir di Kota Siantar. Fakta teranyar, setoran parkir Jalan Merdeka dan Sutomo. Menyikapi ini, Komisi III DPRD Siantar mengimbau masyarakat tidak membayar parkir jika petugas parkir tidak memberikan karcis parkir. “Kita sudah mengimbau kepada masyarakat Siantar sejak Desember 2011 lalu, agar jangan membayar parkir jika petugas parkir

„ Sopar Sitorus

„) Baca Tidak Ada ...Hal 2

Foto: Billy

„ Tersangka Bismar Sitorus, dipapah putrinya di Mapolsek Serbelawan.

Bisa Jalan di Atas Air TAPIAN DOLOK– Seorang mantan pejuang (veteran), Bismar Sitorus (83) warga Siliat Liatan, Kelurahan Panamparan, Kecamatan Habinsaran, Kabupaten Tobasa, tiba-tiba mengamuk, Rabu (2/5) kemarin. Kakek 8 cucu ini membacok Sopar Sitorus (30) anaknya dan Bambang Wibisono (40) menantunya, dengan samurai. „) Baca Mantan...Hal 2

Foto: Eko

„ Anak-anak korban, menunjukkan lokasi ayahnya dibacok sang kakek.

SAAT dikonfirmasi METRO, anak tersangka yang menjadi korban pembacokan, Sopar Sitorus, mengatakan, kejadaian itu bukan kemauan ayahnya. Melainkan karena pelaku memiliki ilmu hitam yang dipelajarinya pada masah penjajahan Belanda. Sewaktu Sopar masih SMA, dia sempat melihat ayahnya berjalan di atas air, kemudian berjalan di pagar. Atas kejadian itu, Sopar yakin ayahnya memliki ilmu hitam. Karena ayaknya sudah lanjut usia, Sopar membawanya ke tempat orang pintar beberapa tahun silam di daerah Medan. Rencananya, di sana mereka akan melepaskan ilmu hitam tersangka. Orang pintar tersebut berhasil mengeluarkan sebuah peluru dari bagian badan ayahnya. „) Baca Bisa Jalan ...Hal 2

Penikam Inang Pendeta Dihukum 4 Tahun Penjara SIMALUNGUN– EN (15) warga Jalan Huta Panambean II Nagori Silakkidir, Kecamatan Hutabayu Raja, terdakwa penikam Inang Pdt Melati Butarbutar dihukum empat tahun penjara. Vonis itu dijatuhkan setelah terdakwa dinyatakan terbukti bersalah melakukan tindak pidana melakukan

DEMO MAHASISWA NYARIS BENTROK DENGAN SATPOL-PP

PEMKO SIANTAR MANDUL

percobaan pembunuhan dan melanggar Pasal 338 KUHPidana jo Pasal 53 ayat 1 KUHPidana jo UU RI No 3 Tahun 1997 tentang Pengadilan. Sidang agenda putusan yang digelar di Pengadilan Negeri Simalungun dipimpin hakim majelism, Ga-

SIANTAR- Puluhan mahasiswa yang tergabung dalam Liga Mahasiswa Nasional untuk Demokrasi (LMND) Kota Siantar menggelar demonstrasi ke kantor Walikota Siantar, Rabu (2/5) sekira pukul 11.00 WIB. Mahasiswa nyaris bentrok dan terlibat aksi dorong dengan Satpol PP, karena memaksa masuk ke kantor walikota. Para pengunjuk rasa juga meneriaki Pemko Siantar mandul. Puluhan mahasiswa LMND berkumpul di depan kantor BRI Jalan Merdeka dan membagi selebaran kepada setiap pengendara yang melintas. Dengan berjalan kaki, mereka bergerak menuju kantor walikota. Tidak lama kemudian, mereka berorasi. Koordinator Lapangan, Frans Simbolon menyebutkan, selama ini pemerintah tidak

„) Baca Penikam ...Hal 2

SIDANG ASEN SI BANDAR SABU

Awalnya Mencari Tau Apa Ada Anggota Terlibat SIMALUNGUN– Pihak Korem Simalungun yang menangkap bandar sabu-sabu Siantar, Asen alias Faruk merupakan tindak lanjut apakah ada anggotanya yang terlibat. Terutama saat mendapat informasi, yakni akan ada transaksi narkoba di belakang warung di Jalan H Ulakma Sinaga dengan ciri memakai tas sandang ber-

warna hitam. Hal itu disampaikan saksi dari Korem, Fernando Saragih dan Deny Hardiansyah di Pengadilan Negeri Simalungun, Rabu (2/5). Di hadapan majelis hakim dipimpin, Ramses Pasaribu beranggotakan Irwansyah

„) Baca Pemko ...Hal 2 FOTO: LAZUARDY FAHMI

ORASI: Seorang mahasiswi LMND Siantar berorasi di depan kantor Walikota, Rabu (2/5).

„) Baca Awalnya ...Hal 7

Sidang

Mantan Istri Pangulu Pesta Sabu

Rasanya Enak dan S IMALUNGUN– itu, sabu Lebih juga senjataPede mereka Membuat menghilangkan suntuk.

FOTO:IMELDA PURBA

„ Mantan istri Pangulu Silau Dunia, Riati alias Bunda bersama rekannya memberikan keterangan di PN Simalungun, Rabu (2/5).

Mantan istri Pangulu Silau Dunia, Riati alias Bunda yang tertangkap pesta sabu bersama empat rekannya, yakni Saiful Bahri Lubis (32), Agustina (37), Reni (29) dan Hafni Rais Lubis (40), mengaku mengonsumsi sabu itu rasanya enak dan lebih percaya diri (pede). Selain

Hal itu disampaikan para terdakwa pada sidang yang digelar di Pengadilan Negeri Simalungun, Rabu (2/5) dengan agenda pemeriksaan terdakwa. Di hadapan majelis hakim yang dipimpin, Gabe Doris beranggotakan Monalisa dan Irwansyah Sitorus, terdakwa menyampaikan, awalnya rekannya datang hanya untuk bertamu saja. „) Baca Rasanya ...Hal 7

FOTO: LAZUARDY FAHMI

„ Kendaraan roda dua yang sedang parkir di atas tratoar Jalan Sutomo Siantar, Rabu (2/5).

Pemerkosa Cucu Masih Berkeliaran KERASAAN- Jaitan Nainggolan (55), Kepala Dusun Huta IV, Nagori Pematang Kerasaan Kecamatan Bandar Simalungun, yang dilaporkan cucunya, Melati (nama samaran) menyetubuhinya hingga melahirkan, masih bebas bekerliaran. Menurut Parlindungan Simarmata (43), warga Huta II, Nagori Pematang Kerasaan Kecamatan Bandar, ketika ditemui METRO di ladang miliknya tak jauh dari kediaman tersangka, Rabu (2/5) pukul 11.00 WIB me„) Baca Pemerkosa ...Hal 7

Selamat Jalan Bu Mentri JAKARTA- Setelah berjuang melawan kanker paru-paru selama tiga minggu dalam perawatan di Paviliun Kencana RSCM, mantan Menteri Kesehatan Endang Rahayu Sedyaningsih (57) akhirnya mengembuskan napas terakhirnya, Rabu (2/5) pukul 11.41 WIB. Menkes dideteksi menderita kanker sejak Oktober 2010, setahun setelah menjabat sebagai menteri untuk periode 2009-2014. „) Baca Selamat ...Hal 7

Anda punya keluhan terhadap pelayanan publik di Siantar-Simalungun? kirim SMS ke nomor:

082164546471 Jalan Kain Suji Ujung Belum Pernah Dibangun

Pak Walikota Siantar yang terhormat, kami masyarakat Jalan Kain Suji Ujung mengharapkan pembangunan jalan. Karena Jalan Kain Suji Ujung belum pernah tersentuh pembangunan. Kami saat ini seperti masyarakat yang terisolir di pusat Kota Siantar. Pengirim: 081375050xxx


KAMIS

3 Mei 2012

Bisa Jalan di Atas Air Sambungan Halaman 1 Melihat hal tersebut, Sopar sempat merasa puas. Namun ketika istri tersangka P br Tampubolon meninggal dunia, penyakit ayahnya kambuh lagi. Sebelum kejadian ini, pelaku sering memegang parang dan mengayunkannya seperti dalam medan perang. Namun setelah diketahui pelaku kambuh lagi, Sopar sengaja datang dari Jakarta untuk menjemput ayahnya dan berniat ingin membawa ayahnya ke Jakarta. Naas, kejadian yang mereka alami menggagalkan rencana Sopar. Selanjutnya Sopar dan Bambang dirawat di RS Mina Padi. Sementara Bismar diamankan di Mapolsek Serbelawan untuk diproses hukum. Baru Datang dari Tobasa Di rumah korban yang terbuat dari papan, tepatnya di belakang Akademi Kebidanan (Akbid) Henderson, Bakti Sinaga (10) anak korban saat ditemui METRO mengatakan, ayah dan ibunya sedang berada di RS Mina Padi. “Ayahku sudah di Rumah Sakit Mina Padi karena ditikam Oppung (kakek) tadi malam,” ucapnya polos. Di rumah yang juga tempat jualan jajanan anak-anak itu, Bakti anak ke-5 dari 7 bersaudara mengatakan, selama ini kakeknya tinggal di Toba, dan baru datang Senin malam. Sebelum kejadian, kata Bakti, ayahnya bernama Bambang Sinaga alias Ateng tidur di ruang depan tepatnya di depan TV. Sedangkan ibunya, Marusaha br Sitorus tidur di kamar. Namun, Bismar Sitorus tidur di ruang tengah. Saat tertidur pulas, sekitar pukul 02.00 WIB tersangka bangun. Selanjutnya mengampil parang yang terletak di dinding rumah. Tanpa bicara sepatah kata pun, tersangka langsung membacok leher korban hingga mengeluarkan darah. Begitu mendengar Bambang menjerit, Marusaha istrinya langsung bangkit dari kamar serta berteriak minta tolong dan dia juga melihat suaminya sudah berdarahdarah. Oleh keluarga, berusaha menahan amukan tersangka dan meraih pisaunya. Sopar Sitorus, anak korban yang ketepatan di rumah itu juga berusaha meraih pisau dari tangan pekaku. Akan tetapi pelaku yang sempat bertahan, sempat membuat Sopar kesulitan meraih pisau tersebut. Akibatnya tangan dan kepalanya terkena pisau. Beruntung, pisau tersebut berhasil diraih Sopar dan pelaku langsung diamankan. Untuk menghindari jatuh korban lainnya, oleh keluarga, tangan pelaku diikat pakai tali hingga pelaku dipastikan tidak dapat melakukan perlawanan. Sampai kemudian polisi datang, tangan pelaku masih dalam posisi terikat. Sementara Bambang dan Sopar, yang sudah terluka langsung dibawa ke RS Mina Padi. Pihak medis yang langsung sigap, berhasil menyelamatkan nyawa, Bambang. Sebab, darah yang sempat banyak keluar, bisa menyebabkan Bambang meninggal dunia. Namun akibat tikaman di lehernya tersebut, ia menjalani perawatan intensif. Kepada METRO, Bakti juga menunjukkan bekas-bekas darah yang masih lengket di dinding rumah mereka. “Kemarin, katanya kakek sudah sembuh setelah pulang berobat dari Jakarta. Makanya ia pulang ke kampung. Senin semalam, ia datang ke sini,” sebut Bakti. Bakti mengatakan, ayahnya yang jadi korban pembacokan selama ini bekerja sebagai pencari batu padas di daerah Mandoge, Asahan. Sementara ibunya, terkadang berkeliling ke sekolah-sekolah menjual jajanan anak-anak. Pada kesempatan yang sama, Boru Purba, tetangga korban mengatakan, kejadian itu sempat membuat warga ketakutan. Namun karena mengetahui pelaku diikat, warga jadi tenang ditambah ketika polisi datang membawa tersangka. Menurut dia, tersangka tidak begitu sering datang dari Toba. Namun soal tujuan kedatanganya, Boru Purba tidak mengetahuinya. “Tadi pagi itu kejadiannya. Kami pun terkejut mendengar teriakan minta tolong dan melihat warga sudah ramai,” ucapnya. Disingung soal hubungan keluarga korban dengan pelaku,Boru Purba mengatakan sepertinya tidak ada masalah atau konflik antara keluarganya. (mag-4/pra)

Mantan Pejuang Bacok Anak & Menantu Sambungan Halaman 1 Peristiwa itu terjadi pukul 03.00 dinihari di rumah menantunya di Gang Keluarga, Kelurahan Sinaksak Km 2 Kecamatan Tapian Dolok, Simalungun. Akibat pembacokan itu, Bambang Wibisono dan anak keempatnya Sopar Sitorus (30) yang datang dari Jakarta, mengalami luka berat di kepala dan punggung hingga dirawat di Rumah Sakit Mina Padi. Ditemui METRO Rabu (2/5) pukul 16.00 WIB di Polsek Serbelawan, Bismar mengaku kesal dengan sikap kedua korban yang kerap meremehkannya. Bahkan tersangka yang diduga mengalami kelainan jiwa ini berharap agar dia segera menyusul istrinya yang telah tiada. ”Mereka sepele kali sama aku. Aku sudah bosan, sudahlah mau kususul istriku,” katanya sembari memalingkan wajah. Sementara, setelah tertidur selama tiga puluh menit di Polsek Serbelawan, dengan kondisi mata lebam dan kepala berdarah, tersangka membaringkan tubuhnya di kursi kayu ruang tunggu sel tahanan Polsek Serbelawan. Terpisah, anak ketiga tersangka, L Br Sitorus (35) warga Jalan Aman, Gang Sejahtera, Kelurahan Siopat Suhu, Siantar Timur mengaku dirinya mengetahui aksi brutal

Sambungan Halaman 1 memperhatikan pendidikan bagi rakyat miskin. Seharusnya pemerintah menggratiskan pendidikan bagi warga miskin pada semua jenjang pendidikan. Pembiayaan pendidikan harus lebih besar lagi dianggarkan di APBN. “Pemerintah harus menjalankan pasal 33 UUD 1945 secara konsisten. Pemko Siantar juga kita minta menjalankan pendidikan gratis kepada masyarakat miskin,” tegasnya. Ketua LMND Kota Siantar, Vivin SriWahyuni menyebutkan, pemerintah pusat selama ini lebih cenderung menerapkan liberalisasi pendidikan, tidak berusaha mewujudkan pendidikan nasional yang gratis, ilmiah dan demokratis. Pemko Siantar, kata Vivin, tidak memperhatikan dengan baik pendidikan di Siantar. Menurutnya, pendidikan di Siantar berada di pusat kota. Lebih banyak dikuasai nonpribumi. Dia berharap agar hal ini menjadi perhatian

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Pandapotan MT Siallagan Alvin Nasution Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

sering melihat itu, kami jadi biasa saja,” katanya. Keluarga Minta Tersangka Dibebaskan Pada METRO, L Br Sitorus mengaku setelah musyawarah dengan keluarga, mereka memutuskan agar tersangka segera dibebaskan. Sebab korban tidak merasa dirugikan dalam tindakan tersangka. ”Setelah saya tanya sama abang dan adik, mereka sepakat ingin membebaskan Bapak. Soalnya, kami sangat sayang sekali dengan orangtua kami ini dan mereka juga sudah memaafkannya. Sebenarnya warga yang memaksa ayah kami ditangkap, padahal kami ingin damai keluarga saja,” katanya. Kapolsek Serbelawan AKP Kitaman Manurung dihubungi METRO, Rabu (2/5), mengaku motif penyerangan tersangka ini disebabkan tersangka stres dan membayangkan sesuatu membahayakan menghampirinya. ”Sejauh ini, kita temukan motif pembacokan ini disebabkan karena tersangka stres ditinggal mati istrinya. Sehingga dia membayangkan sesuatu yang bahaya. Makanya tindakannya pun spontan. Namun demikian, kita akan lakukan pengembangan lagi dan kasus ini masih dalam penyelidikan,” ujarnya. (mag–02)

bagi seluruh masyarakat di Siantar. Setelah berorasi sekitar 30 menit, tidak ada satupun pejabat pemko yang menemui pengunjuk rasa. Hal ini memicu pengunjuk rasa merapatkan barisan dan berniat masuk ke kantor walikota. Namun niat pengunjuk rasa ini langsung dihadang sekitar 10 personel Satpol PP. “Ayo kita masuk ke dalam, karena kita juga tidak dihargai para pejabat Pemko Siantar. Kita sudah mengetuk pintu permisi, ternyata tak digubris sama sekali. Kita sudah lama berorasi, namun tak seorangpun pejabat yang menemui kita. Ke mana mereka semua,” teriak salah satu orator. Aksi saling dorong antara mahasiswa dengan Satpol PP inipun terjadi hingga tiga kali. Ketika mahasiswa bergerak masuk, Satpol PP langsung menghadang hingga beberapa mahasiswa sempat terjatuh di tangga. Salah seorang mahasiwa juga sempat memukulkan tiang bendera yang terbuat dari

bambu kepada salah seorang personel Satpol PP. Aksi ini reda setelah kedua pihak ditenangkan kawannya masing-masing. “Di mana pejabat pemko, tidak ada satupun yang turun dan menghargai kami. Tidak ada satupun pejabat pemko yang menghargai kami sebagai rakyat yang menyampaikan aspirasi. Ini membuktikan Pemko Siantar tidak menghargai rakyatnya. Hanya ada satu kata, Pemko Siantar mandul,” teriak Frans Simbolon sebelum meninggalkan kantor walikota. Dengan berjalan kaki, massa LMND ini menyusuri Jalan Merdeka menuju Kantor Dinas Pendidikan Siantar. Namun niat mereka terhalang karena pintu gerbang yang ditutup, sehingga massa tertahan dan melakukan orasi di depan Kantor Dinas Pendidikan. Tidak jauh beda dari depan kantor walikota, orasi yang disampaikan di lokasi ini juga meminta pemerintah melaksanakan pendidikan gratis bagi rakyat miskin. Setelah berorasi sekitar 30 menit, pintu gerbang

dibuka dan perwakilan pengunjuk rasa membacakan pernyataan sikap dihadapan Sekretaris Dinas Pendidikan Mansur Sinaga, Kabag Humas Daniel Siregar dan beberapa pejabat Dinas Pendidikan lainnya. “Masyarakat miskin harus ditanggungjawabi pendidikannya oleh Pemko Siantar. Masih banyak warga miskin di Siantar ini yang belum memeroleh pendidikan,” jelas salah seorang pengunjuk rasa. Menyikapi ini, Mansur Sinaga menyebutkan, Dinas Pendidikan Siantar akan memberikan perhatian kepada warga miskin yang belum memiliki pendidikan. Dia meminta kepada LMND, jika memiliki data warga miskin ini, silahkan berikan datanya ke Dinas Pendidikan, mereka akan menindaklanjutinya. Setelah para pengunjukrasa merasa puas atas penjelasan yang diberikan Mansur, pengunjukrasa meninggalkan Dinas Pendidikan dan berjalan kaki lagi menuju Gedung DPRD Kota Siantar. (ral)

PENIKAM INANG PENDETA DIHUKUM 4 TAHUN PENJARA TIDAK ADA KARCIS, Kecamatan Huta Bayu Raja. Saat itu terdakditolak korban sambil meronta-ronta. Sambungan Halaman 1 JANGAN BAYAR PARKIR wa melihat korban di kediamannya,” sebut“Emosi, terdakwa secara membabi buta be Doris beranggotakan, Irwansyah Sitorus dan Monalisa, Rabu (2/5). Persidangan yang dibuka untuk umum tersebut berbeda dari sidang biasa, yakni baik hakim, jaksa dan kuasa hukum tidak diperbolehkan mengenakan jubah. Selanjutnya hakim pun mulai membacakan isi putusan, baik kronologi kejadian hingga hal memberatkan dan meringankan. Menurutnya, terdakwa terbukti secara sah dan meyakinkan melakukan percobaan pembunuhan hingga menyebabkan luka terhadap saksi korban, Inang Pdt Melati Butarbutar. “Perbuatan itu dilakukan terdakwa, Rabu (15/2) sekira pukul 15.00 WIB di rumah Dinas Pendeta komplek Gereja HKBP Panambean I Nagori Silakkidir,

lamanya itu, yakni dengan minum Milkuma, minuman serbuk susu kambing yang diproses secara alami, tanpa pemanis buatan dan bahan pengawet. Bahan dasarnya adalah susu kambing peranakan ettawa segar dan Gula Aren. Manfaat Milkuma telah dirasakan olehnya setelah minum selama 1 bulan. "Dulu saya terbiasa dengan obat warung, tapi sekarang tidak lagi! Sejak minum Milkuma sekarang sakit maag sudah berkurang." Ungkap warga Padang Bulan, Medan, Sumatera Utara tersebut. Karena merasakan manfaatnya secara langsung, sekarang ia menyarankan orang lain untuk mencoba Milkuma, "Mari kita sehat bersama Milkuma." Ajak pria berusia 21 tahun tersebut. Sebenarnya, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu kambing. Berbeda dengan susu sapi, sesungguhnya susu kambing memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Kini, hadir Milkuma yang bermanfaat untuk menjaga daya tahan tubuh dan meningkatkan vitalitas. Satu gelas susu kambing

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

sepertinya dia punya pengalaman buruk ketika masih mengikuti perang dulu. Dan ayah saya ini mantan pejuang kemerdekaan,” katannya. Ketidaknyamanan ini yang diduga kuat melatarbelakangi tersangka stres, hingga nekat membacok anak dan menantunya. Sementara tersangka yang sehari–hari bekerja sebagai petani kopi ini merupakan mantan pejuang atau veteran. Hal ini dibuktikan dengan kepemilikan baret pejuang yang diperoleh tersangka ketika terlibat perang. Dijelaskannya lagi, perubahan sikap ayahnya ini terjadi ketika istrinya P br Tampubolon meninggal dunia awal April 2009 silam akibat lemah jantung. Setelah kejadian itu, tersangka kerap terlihat murung dan gampang emosi, bahkan kerap membayangkan dirinya tengah berada di medan perang dengan mengacungkan sebilah parang sepanjang satu meter. Parang yang sering diacungkannya itu juga yang digunakannya untuk menebas anak dan menantunya. ”Sejak ibu meninggal dunia, ayah menjadi gampang emosi. Kadang kita tegur pelan saja, dia langsung marah. Namun yang saya herankan dia sering membayangkan dia ada di medan perang. Awalnya keluarga saya takut, tetapi setelah

PEMKO SIANTAR MANDUL

SERBA SALAH KARENA SAKIT MAAG? MINUM SUSU KAMBING SOLUSINYA... Maag atau r a d a n g lambung atau t u k a k lambung adalah gejala penyakit y a n g menyerang lambung dikarenakan terjadi luka atau peradangan pada lambung yang menyebabkan sakit, mulas, dan perih pada perut. Penyebabnya bisa karena penderita makannya tidak teratur, terdapat mikroorganisme yang merugikan, mengonsumsi obatobatan tertentu, atau sebab-sebab lainnya seperti mengonsumsi alkohol, pola tidur yang tidak teratur dan stress. Keluhan maag ini telah dirasakan oleh Muhammad Anhar yang sehariharinya bekerja sebagai karyawan di sebuah toko grosir dan eceran busana muslim. "Kalau maag saya kambuh, rasanya jadi serba salah, makan salah, tidak makan pun salah, beraktifitas jadi terhambat." Cerita pria yang akrab disapa-Anhar tersebut. Untunglah, kini ia sudah menemukan cara tepat untuk mengatasi keluhan yang telah dialaminya selama 6 bulan

bapaknya setelah salah seorang keponakannya mengabarkan langsung Rabu kemarin. Mendengar itu, dia langsung mengecek kondisi ayahnya. ”Saya diberitahu oleh kemanakan saya. Dia datang pukul 03.30 WIB, katanya Bapak saya membacok adik dan abang ipar saya, makanya saya langsung datang,” katanya. Bahkan, kericuhan yang terjadi ini sempat mengundang perhatian warga. Selanjutnya warga menangkap dan menganiaya tersangka. Sementara kedua korban yang mengalami luka berat, langsung dilarikan ke Rumah Sakit Mina Padi untuk mendapatkan pertolongan medis. ”Waktu datang, saya lihat ayah sudah dipukuli warga dan diseret keluar. Sementara kedua saudara saya sudah berdarah dan langsung dibawa warga sekitar ke Rumah Sakit Mina Padi,” katannya. Berselang beberapa saat, aparat Polsek Serbelawan datang ke lokasi dan mengamankan tersangka. Sementara keluarga tersangka yakin, penyebab pembacokan itu diawali ketika tersangka sulit tidur pada malam hari. Bahkan tersangka sering menghayal. ”Kalau malam dia sering sulit tidur, bahkan sejak mama kami meninggal dunia, ayah ini sering melamun. Kadang dia menghayal,

memasok 20,0% dari nilai harian Riboflavin. Selain itu, Fluorine yang terdapat dalam susu kambing bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan menetralisir asam lambung. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Ditambah dengan kandungan Gula Aren bermutu tinggi sebagai pemanisnya, menjadikan Milkuma sebagai pilihan bijak untuk kesehatan. Untuk memperoleh hasil yang maksimal, terapkan pola hidup sehat seperti disiplin dalam pola makan, rutin berolahraga dan mengkonsumsi air putih paling sedikit 8 gelas/ hari. Dapatkan informasi lengkap tentang Milkuma di www.milkuma.com. Saat ini, Milkuma sudah tersedia di apotek2 juga toko obat terdekat dikota anda, atau hubungi, Sumut : 085314072195 / 06191128785. Kota Pematang Siantar : 085360106966, Apt Sehat, Apt. Dear farma, Tebing tinggi : Apt. Tangan mas, Apt. Bulian, Apt. Saudara Baru. Depkes dengan no PIRT. 6.09.3328.01.395.

nya hakim. Lebih lanjut, kata majelis hakim, hingga sekitar pukul 23.30 WIB terdakwa masih terbayang-bayang wajah korban dan timbul niat untuk menjumpai korban di rumahnya. Tiba di komplek Gereja HKBP, terdakwa langsung mengintip pentilasi kamar tidur korban. Di sana terdakwa melihat korban sedang tertidur pulas. “Saat itu mulai timbul niat terdakwa untuk menjamah dan menyetubuhi korban. Selanjutnya terdakwa mencari jalan untuk masuk, tapi semua pintu dikunci rapat. Tidak mau kehabisan akal terdakwa pun mengambil kursi yang kebetulan sedang rusak. Kemudian terdakwa langsung memanjat dinding dan berhasil masuk,” paparnya. Sambungnya, setelah berhasil masuk, terlebih dahulu terdakwa membuka pintu belakang mempermudah untuk melarikan diri. Setelah berhasil dibuka, terdakwa menuju ruang depan untuk mengambil sehelai sarung untuk dijadikan topeng dan mengambil pisau yang terletak di rak televisi. Kemudian terdakwa menuju kamar korban dan mulai melangsungkan niat bejatnya, “Di kamar tersebut terdakwa langsung mendekati saksi korban dan menutup mulutnya dengan tangan kiri. Sedangkan tangan kanannya memegang pisau. Seketika itu juga korban melihat terdakwa dan langsung berteriak minta tolong. Sejurus kemudian terdakwa langsung mengancam korban dan mengacungkan pisau,” jelas Gabe Doris. Menurutnya, saat itu terdakwa mengatakan ‘jangan coba berteriak, kalau teriak kubunuh nanti kau’. Akan tetapi korban tetap melawan dan berupaya melepaskan tangan terdakwa dengan menendang terdakwa. Melihat itu, terdakwa merasa berang dan timbul niat untuk menghilangkan nyawa korban. “Terdakwa langsung menikam pisau ke badan korban, tapi korban menangkap pisau. Akibatnya, telapak tangan korban terluka saat menggenggam pisau tersebut sambil berteriak minta tolong. Korban pun berkata, apa yang kau mau Tulang. Kalau mau perhiasan ini ambil kalungku. Kalau mau uang ambil sana, asal jangan kau ganggu aku,” ungkap hakim menirukan pernyataan Inang Pendeta. Dia menerangkan, terdakwa pun mengakutidakmembutuhkanitudanmeminta agar korban mengikutinya menuju arah dapur. Setelah korban mengamini dan berjalan menuju dapur, terdakwa mengajak korban pergi ke sawah. Akan tetapi, permintaan itu

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta) Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Alvin Nasution, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: Syafruddin Yusuf, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus),Aristo Linghten Panjaitan (Tobasa), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina)

menikami bagian dada, perut, dan tangan korban. Karena terdakwa terus menjerit dan melakukan perlawanan, terdakwa semakin gugup dan memukul kening korban dengan batu bata yang terletak di dapur. Kemudian terdakwa juga sempat memukul korban dengan botol sirup, hingga korban terjatuh di lantai,” terangnya. Disebutkan hakim, saat korban terjatuh di lantai, terdakwa kembali hendak menikam tubuh korban dan saat bersamaan itu pula saksi, Simon dan warga langsung berdatangan. Terdakwa langsung ditangkap dan dihajar massa. Akibat perbuatan EN, korban harus dirawat di RS Vita Insani selama lima hari. Kata hakim, menimbang berdasarkan keterangan saksi-saksi hingga keterangan terdakwa, maka secara sah dan meyakinkan terdakwa terbukti melakukan tindak pidana. Untuk hal memberatkan perbuatan terdakwa meresahkan masyarakat terutama Inang Pendeta. Akibat perbuatan terdakwa, saksi korban menjadi trauma dan mengalami cacat terutama di bagian paruparu dan tulang tengkorak. Selanjutnya, antara pihak keluarga koban dan terdakwa tidak ada perdamaian. Sementara untuk hal meringankan terdakwa belum pernah dihukum, menyesal serta berjanji tidak akan mengulanginya kembali. Terdakwa masih tergolong anak-anak dan masih memiliki masa depan. “Dengan pertimbangan tersebut majelis hakim yang memeriksa dan mengadili perkara ini memutuskan menuntut menghukum terdakwa empat tahun penjara dikurangi masa tahanan. Kemudian, kepada terdakwa melalui kuasa hukumnya, Maria Purba diberikan kesempatan untuk pikir-pikir selama seminggu, menerima atau banding,” terang Gabe Doris. Terlalu Berat Untuk Anak-anak Sementara itu orangtua terdakwa, J Nadapdap mengaku, hukuman tersebut terlalu berat untuk anak-anak. “Gimanalah mau dibilang, sebenarnya itu terlalu berat untuk anak-anak. Tapi biar saya konsultasikan dulu sama pengacara. Saya tetap berharap yang terbaik untuk anak-anak,” sebutnya. Sedangkan Ketua Umum Komisi Nasional Perlindungan Anak, Arist Merdeka Sirait menyikapi tuntutan dari Jaksa serta putusan dari hakim menerangkan, berdasarkan UU Perlinduangan Anak No 23 Tahun 2002 dan UU No 3 Tahun 1997 tentang Perlindungan Anak, prinsip dasar hukum harus mengedepankan kebaikan. (mua)

METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Goldian Purba, Eva Wahyuni, Hermanto Sipayung, Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

Sambungan Halaman 1 tidak memberikan karcis. Kalau tak ada karcis, tak usah bayar,” tegas anggota Komisi III DPRD Siantar, Muhammad Rivai Siregar, Rabu (2/5). Dia menegaskan, pengendara harus meminta karcis parkir kepada petugas parkir. Hal itu merupakan salah satucaramenekantingkatkebocoransetoranparkiryang sangattinggi.Melaluikarcisparkirini,akanjelasdiketahui pemasukanrildariparkiryangadasetiaphari.“Itulahcara yang sudah kita anjurkan kepada masyarakat sejak Desember lalu. Cara lain belum ada kita pikirkan. Sebenarnya, kita ingin mencontoh Ramayana yang menggunakan mesin pencatat jumlah orang yang parkir di lokasinya, tapi itu sepertinya berat, karena parkir kita berada di pinggir jalan umum,” jelasnya. Disebutkan, parkir merupakan ujung tombak Pendapatan Asli Daerah (PAD) di Kota Siantar. Sektor ini merupakan sektor penghasil PAD terbesar bagi kota berhawa sejuk ini. Untuk tahun 2012, target PAD yang diharapkan bisa diperoleh dari sektor ini Rp2,5 miliar. “Kita pernah melakukan investigasi di beberapa titik lokasi parkir di Jalan Merdeka dan Sutomo. Kita akui, memang tingkat kebocoran setoran parkir kita masih sangattinggi.TidakwajartargetparkirkitahanyaRp2miliar setiap tahun kalau berdasarkan amatan kita saat ini,” jelasnya. “Sewaktu Kepala UPTD Parkir, AS Sitorus kita panggil ke DPRD Desember 2011, kita sudah pertanyakan itu samadia,apakendalakenapasampaikejadiannyaseperti itu. Kenapa target Rp2 miliar itu tidak tercapai,” ujarnya lagi. Dikatakan Ketua Fraksi PDI-Perjuangan ini, disebabkanminimnyarealisasiPADyangdiperolehtahun 2011 lalu, Komisi III telah mensahkan target PAD parkir tahun 2012 sebesar Rp2,5 miliar. Hal ini dimaksudkan sebagai langkah menekan tingkat kebocoran parkir. “SayabelumbisakatakankekuranganuangRp800juta dari target PAD tahun lalu dikorupsi pejabat Dishub. Kita belum memiliki data sejauh itu. Namun kita sudah pertanyakanitudulusamakepalaUPTD.Apakendalanya, kenapa Rp800 juta lagi tidak bisa dicapai,” jelasnya lagi. Lebih lanjut dikatakan Rivai, sebagai penyumbang terbesar PAD, mereka telah meminta pemko agar memperhatikan kesejahteraan para petugas parkir. Setidaknya sekali dua tahun, baju para petugas parkir ini diganti pemko. Selanjutnya, perlu dipertimbangkan memberikan honor kepada petugas parkir, disebabkan gaji yang mereka peroleh selama ini masih minim. Sebelumnya, sesuai penelusuran METRO, setoran parkir Jalan Sutomo menguap ratusan ribu rupiah. Delapan titik parkir di Jalan Sutomo menghasilkan Rp1.990.000 setiap hari. Pengakuan Kepala UPTD Parkir Siantar,ASSitorus,empattitikparkirditaksirmenghasilkan setoran Rp1.010.000 saja. Sementara empat titik lokasi parkir di Jalan Merdeka, kataASSitorus,menghasilkanuangsekitarRp280ribuper hari. Sementara fakta di lapangan, Jalan Merdeka bisa menghasilkan setoran Rp1.670.000 per hari. (ral)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : metrosiantar@yahoo.com. Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733

DALAM PELIPUTAN, WARTAWAN METRO SIANTAR SELALU DIBEKALI IDENTITAS DIRI DAN TIDAK DIBENARKAN MEMINTA SERTA MENERIMA APAPUN DARI NARASUMBER BILA ADA YANG MERASA DIRUGIKAN OLEH WARTAWAN METRO SIANTAR, DIMINTA UNTUK MELAPOR KE PIHAK BERWAJIB ATAU HUBUNGI 0622-7553998


KAMIS

3 Mei 2012

Pencuri Berkeliaran di Pasar Horas Pak Kapolres Siantar, kami pedagang di Pasar Horas merasa ketakutan atas kenyamanan barang dagangan yang kami simpan di dalam kios. Karena maling yang membongkar kios kemarin belum tertangkap juga. Kapan pelakunya ditangkap Pak, supaya kami pedagang merasa nyaman. 087868014xxx

Polisi Persulit Pengambilan Sepedamotor Kapolres Siantar terhormat, tolong ditindak anggota unit laka di Polres Siantar yang mempersulit masyarakat mengurus pengambilan sepedamotor. Padahal antara korban dan tersangka sudah berdamai, tetapi anggota Bapak mempersulit pengambilan sepedamotor tersebut. 087749681xxx

Jalan Kain Suji Belum Tersentuh Pembangunan

PAK Walikota Siantar terhormat, kami masyarakat Jalan Kain Suji ujung mengharapkan pembangunan jalan, karena Jalan Kain Suji belum pernah tersentuh pembangunan. Kami saat ini seperti masyarakat yang terisolir di pusat kota. 081375050xxx

Telepon Penting PMI (Palang Merah Indonesia) 118, 0622-433911 Alamat Jl Sutomo No. 248, Pematangsiantar Kantor Imigrasi Alamat: Jl. Raya Medan Km. 11,5 Pematang Siantar Telepon : (0622)465018, 465014 Samsat Dipendasu Jln Sangnawaluh No 37A 0622 7552345.

RS dr Djasamen Saragih Jln Sutomo No 230. 0622 (23824) Hotel Sapadia Jl.Diponegoro No.21 A P.Siantar Telp:0622-435922 Nice Trans Siantar-Medan Medan. (061) 4558844 Siantar (0622)7000200 085275144777

Halte Angdes & Angkot di Depan Ramayana Penyebab Macet SIANTAR-Jalan Sutomo dan Jalan Merdeka bagian dari wajah dari Kota Pematangsiantar. Namun penataan di kedua jalan ini sangat jarang diperhatikan. Terbukti, titik-titik macet berpusat di kedua jalan tersebut. Salah satunya seperti yang nampak di Jalan Sutomo depan Ramayana, yang setiap menit pada saat jam kerja selalu terjadi macet. Padahal, untuk mengatasi kemacetan itu tidak sulit, hanya dengan menertibkan Halte Angdes dan Angkot yang

berada di depan Ramayana, macet bisa teratasi. Pasalnya di Halte tersebut Angdes dan Angkot secara bergiliran antrian menaikkan dan menurunkan penumpang. Sehingga mobil yang yang berada dibelakang tidak bisa lewat, akibatnya terjadi macet yang

Bubarkan Halte di Pusat Kota PEMKO Siantar harus membubarkan segala Halte yang berada dipusat Kota. Tanpa itu, predikat kota semberaut sulit ditanggalkan dari Siantar. (Osi) DR Saragih, LSM

Potret Buram Siantar PUSAT Kota Siantar yang semberaut dibuat tidak ada penataan merupakan potret buram bagi Pemko Siantar. Banyaknya angkot yang sembarangan menaikkan dan menurunkan penumpang disembarangan tempat. (Osi) Robeston Silalahi Mahasiswa

Tidak Punya Visi Misi Dalam Mengelola Transportasi PEMKO Siantar tidak memiliki visi misi dalam melakukan pengelolahan terhadap transportasi. Maka tak heran, nyaris di setiap titik di inti kota terjadi kemacetan. Pemko Siantar perlu melakukan pembenahan terhadap penataan kota ini, khususnya dalam penanggulangan kemacetan. (Osi) Frengky Alex Silalahi masyarakat Siantar


KAMIS

3 Mei 2012

APA KATA MEREKA

Kirim Opini Anda ke email: metrosiantar @yahoo.com. Maksimal tulisan 5.000 karakter.

Saya tidak ambisi untuk mempunyai jabatan, tapi jika memang dibutuhkan oleh masyarakat saya siap untuk maju. Jika memang pada nantinya diberi amanah, saya siap.

Sikap Kami Masalah Sosial dan Kesadaran Sosialnya Semua kita tahu bahwa bulan Mei itu bulan penuh sejarah bagi bangsa kita. Pada awal Mei, 1 Mei, kita menghadapiHariInternasionalBuruh–bangsaIndonesia sejatinya terbentuk dari mental buruh atau bekerja sama-samasembaricanda-tawa-Selainitu,adaHarkitnas, Hardiknas,PeringatanMarsinah,danhari-haripenting reformasi1998.Begitulahsejarahyangtercecerpadabulan Mei ini. Ceceran sejarah itu, selain jadi reflektif sosial, merupakansimbolsosialdalambangsanya.Sejarahitu adalahpenandadarisuatupetanda. Simbol tersebut ibarat cermin. Ketika kita bercermin, kita akan melihat siapa diri kita yang sebenarnya. Apakah di wajah kita ada noda, apakah di wajah kita ada jerawat, apakah di wajah kita ada luka, ataumenarikatautidakmenarikkahwajahkita.Itulah sekelumit pencerminan tadi. Karena dengan cerminlah kita bisa menyesuaikan diri, baik itu menyesuaikan diri terhadap lingkungan maupun menyesuaikan diri terhadap pasangan. Sesungguhnya, ceceran sejarah tadi merupakan masalah-masalah sosial yang takkunjung usai, atau setidaknya menemui titik klimaks –ibarat ingin mencium kekasih, selalu saja ada gangguan-. Misalnya, sejarah Hardiknas, sebuah momentum perjuangan pendidikan bagi bangsa Indonesia –kala itu masih Nusantara- yang dilakukan oleh Bung Oetomo. Buktinya, IPM (Indeks Pembangunan Manusia) atau HDI (Human Development Index) kita masih jauh tertinggal dibandingkan negara-negara Asia lainnya, apalagi dibandingkan negara-negara di dunia. Pendidikan sebagai salah satu unsur penting terhadappembangunansosialbelumpernahmencapai titik puncaknya terbaiknya, kecuali dalam hal kontribusi guru ke Malaysia ketika Malaysia gencar membangun negaranya melalui pendidikan. Adabanyakmasalahsosialyangmasihkitahadapi sampaisaatini,setelah60tahunlebihmerdeka.Selain permasalahanyangadadidalamcerminyangdisebut di atas, masalah-masalah sosial lainnya yang sedang kita hadapi, misalnya korupsi, kemacetan, konflik antarwarga, konflik antar kelompok, hingga permasalahan fundamen itu semua, yakni kemiskinan. Dalam kehidupan bernegara, titik permasalahan sosial seperti ini memang ada pada titik tertinggi di struktur sosial, yakni pemerintah (negara). Hal ini sudah sering diungkap di dalam tulisan-tulisan pada umumnya. Di sini, dalam tulisan ini, saya akan menyoroti titik permasalahannya pada individu (unsur pembentuk sosial). Dalam konteks ekspansi kapitalisme di berbagai lini saat ini, termasuk di dalam pikiran pejabat dalam menjalankan fungsi jabatannya, dehumanisasi adalah satu dampak sosial yang patut dicermati. Dehumanisasi merupakan suatu sifat yang merusak atau menghancurkan sifat kemanusiawian. Rakyatdehumanisasi tadi akan hidup semakin liar ibarat hewan liar –semakin ia dibebaskan semakin ia membuas-. Salah satu wujudnya adalah membeludaknyakepemilikankenderaanpribadi.Dalamsatu rumah saja kita temui ada tiga atau empat mobil, apalagi motor. Padahal, anggota keluarganya hanya tiga orang. Mobil-mobil tersebut cuma sebatas konsumsi makna tanpa melihat fungsi, sebab tidak menyesuaikan orang yang ada terhadap ketersediaan fasilitas di mobilnya. Sehingga, hal itu, merusak nilai-nilai empati sesama individu-manusia karena saling berebut memiliki mobil –harta- sebanyakbanyaknya, tanpa memikirkan kesempatan orang lain untuk memilikinya. (***)

Mantan Wakil Presiden RI Jusuf Kalla, rabu (2/5)

MenggelorakanBudaya Menulis Anak Bangsa Setiap tanggal 2 Mei, pemerintah Indonesia memperingatinya sebagai Hardiknas (Hari Pendidikan Nasional). Berdasarkan Surat Keputusan Presiden RI No. 305 tahun 1959 yang dikeluarkan pada 28/11/1959, tanggal 2 Mei dijadikan Hari Pendidikan Nasional untuk mengapresiasi jasa-jasa Suwardi Suryaningrat -yang lebih dikenal dengan nama Ki Hajar Dewantara (KHD)- dalam merintis pendidikan umum. Dua Mei adalah tanggal lahir KHD.

Ahmad Arif Ginting Surat Keputusan itu juga menyatakan KHD sebagai Bapak Pendidikan Nasional Indonesia. Bagian dari semboyan ciptaannya, tut wuri handayani, menjadi slogan Kementerian Pendidikan Nasional Indonesia. Di samping itu, namanya diabadikansebagaisalahsatunamakapalperang Indonesia,KRIKiHajarDewantara.Potretdirinya pundiabadikanpadauangkertaspecahan20.000 rupiahtahunemisi1998. IroniPerguruanTinggi Salah satu ironi dunia pendidikan di Indonesia adalahrendahnyabudayaliterer(penulisan).Dan, perguruantinggiadalahtitikkulminasiironiitu.Dalam catatanPusatDokumentasidanInformasiIlmiah LembagaIlmuPengetahuanIndonesia(PDIILIPI), hinggasaatini,jumlahjurnalilmiah(cetak)diIndonesiahanyasekitar7.000buah.Darijumlahtersebut, hanya4.000jurnalyangmasihterbitsecararutin,dan sedikitnya hanya 300 jurnal ilmiah nasional yang telahmendapatkanakreditasiLIPI.Sedangkandata dariScimagojr,JournalandCountryRanktahun2011 menunjukkanselamakurun1996-2010Indonesia telahmemiliki13.047jurnalilmiah.Dari236negara yang di-ranking, Indonesia berada di posisi ke-64. Sementara Malaysia telah memiliki 55.211 jurnal ilmiah dan Thailand 58.931 jurnal ilmiah (Kompas.com,7/2/2012). Disisilain,daridatayangdikeluarkanKemendikbud, sepertiyangdilansirolehberbagaimediaonline(27/2/ 2012),terlihatgrafikpublikasijurnalilmiahIndonesia cenderungdatarsejaktahun2006,sedangkannegara berkembang justru melesat tajam sejak tahun 2003. PublikasijurnalilmiahIndonesiaperjutapenduduk pada tahun 1996 terletak pada angka 1, hingga 2010 angka itu hanya mengalami sedikit kenaikan yang mencapai angka 4. Sementara, untuk negara berkembang,angka26padatahun1996melonjaktajam hinggamencapaiangka35padatahun2010.

Jumlah publikasi jurnal ilmiah Indonesia pada tahun 2010 pada angka 4, sedangkan Malaysia beradapalingpuncakdiangka500padatahunyang sama.Malaysiapunmengunggulinegaralainpada tahun yang sama, seperti Turkey pada angka 400, China pada angka 240, Thailand pada angka 130, Mesirpadaangka100,Indiadiangka50,Vietnam10, danFilipinadiangka5. Datadanfaktaitulahyangkemudiandijadikan dasarkebijakandariKebijakanKemendiknasyang menjadikontroversisebagaimanatermaktubdalam suratDirjenDiktibertanggal27Januari2012tentang publikasikaryailmiahuntukmahasiswaS-1,S-2,dan S-3 sebagai syarat kelulusan yang berlaku mulai Agustus 2012; S1 harus ada makalah yang terbit di jurnalilmiah;S2harusadamakalahyangterbitdijurnal ilmiahterakreditasiDikti;S3harusadamakalahyang terbitdijurnalInternasional. BebanPsikologis Menulisadalahekspresipersonal,demikianjelas Eep Saifullah Fatah dalam “Menuntaskan Perubahan;CatatanPolitik1998-1999(Mizan,2000;xlviiilv)secarapanjanglebar.Melaluipenulisan,menurut Eep, seorang penulis itu sedang menggunakan haknya sebagai warga Negara untuk menyampaikan pikiran secara bebas. Menulis bukanlah kegiatanpublikyangpenuhpotensiancaman. Siapapunsebetulnyaberpotensimenjadipenulis. Buktinya,setiaporangbisamenulisdiary-nyadengan lancar,runtut,baik,ekspresif,artikulatif.Ketikaorang menulisdiary-nyasendiri,iadalamsituasipsikologis yangbebas,tidakmerasasedangdiancamolehsiapa pun.Iamemosisikankegiatanpenulisandiary-nya sebagai kegiatan ekspresi personal yang tak memerlukanpenilaidanpemberisanksi.Toh,sebuah diary tak akan dibaca orang. Karena itulah ia bisa menulisdenganbaik.Tetapiketikapenulisdiaryitu mulaimenulisartikelataulaporanyangakandibaca

orang,makajadilahiapenulisyangtersendat-sendat, ekspresinya macet, sulit meruntutkan gagasan, artikulasinya terhambat, dan kerap kali gagal. Sebabnya,ketikamenulis,merekamereposisisindiri menjadi individu yang terkerangkeng oleh hantu ancamanyangdibentuknyasendiri.Reposisiinilah yang keliru. Jadi, kuncinya adalah pada beban psikologissebagaipemilikgagasan. MenggelorakanBudayaMenulis Nah, untuk menggelorakan budaya literer anak bangsa,Eepmenguraikantigahalyangsangatpenting bagi seorang penulis. Pertama, kemampuan teknis. Mautidakmau,seorangpenulismestiterusmenerus melatih kemampuannya menulis. Ini bukan untuk mencapaisatugayaakhiryangfinaldanpermanen, melainkanuntukmakinmengefektifkanpenyampaian pesanyangdisampaikannyalewattulisan.Merekayang cepatputusasadangampangmenyerahkalah,berhenti berlatihmenulis,pastiakangagalmenjadipenyampai pesanyangbaik.Kemampuanteknisadalahfaktortertier yang mendampingi dua faktor lain yang bersifat sekunderdanprimer. Kedua, sistem sosial politik di sekitar kegiatan penulisan.Dalamsistemyangmembebaskan,semua jenistulisanakanbisaberkembang.Sementaradalam sistemyangmengekang,hanyatulisanyangberbau humordananekdotyangakanberkembang.Sistem inilah faktor sekunder itu. Ketiga, faktor primernya terletakpadakualitaskemanusianmasing-masing calonpenulis.WargaNegarayangmemilikitiranidi kepalanya–yangmembuatnyapunyabanyakhantu rekaannya sendiri, yang membuatnya takut, terkekang, dan tak bisa mengaktualisasikan kemanusiaannyasecarautuh-akansulitmenjadipenulis. Sebaliknya,wargaNegarayangbisamembebaskan diridaritiranisemacamitupastiakanmampumenuliskanapayangiapikirkandenganbaik. Jadi, sekali pun sistemnya mengekang dan ia punya kemampuan menulis terbatas, seseorang akan tetap bisa melakukan kegiatan penulisan dengan baik manakala ia sudah berhasil membangun kualitas dirinya sebagai warga Negara dengankemanusiaanyangutuh.Tentusaja,suasana penulisanyangterbaikakanbisadicapaimanakala kemampuan teknik yang tinggi bertemu dengan sistem yang membebaskan dan utuhnya kualitas kemanusiaanpenulis.Semoga. (***) PenulisadalahpemilikRUMAN (RumohBacaAneukNanggroe)BandaAceh

Saya tetap komitmen kalau tidak tercapai saya mundur.Target eKTP sebesar 172 juta sebenarnya dapat tercapai jika semua pihak bekerja keras sesuai dengan yang telah disepakati. Hingga April 2012, Kemendagri telah mencatat perekaman sebesar 72 juta e-KTP atau melebihi target awal sebesar 67 juta e K T P.

Mendagri Gemawan Fauzi, Rabu (2/5)

Kita harus membuat terobosan dengan membantu kepada orang-orang kecil, dengan aktif supaya rakyat kecil tahu ada yang menjadi hak-hak mereka. Jangan kita terpaku dan berharap bisa efektif dan bukan hanya sebagai pajangan.

Menkumham Amir Syamsuddin, Rabu (2/5)


KAMIS

3 Mei 2012

Internasional

Istri Nazaruddin

Obama Pulang, Kabul Dihantam Bom

MINTA JEMPUT KPK

KABUL- Sebuah bom meledak di Kabul, Rabu (2/5), beberapa jam setelah Presiden Amerika Serikat Barack Obama meninggalkan ibu kota Afganistan tersebut. Diberitakan sebelumnya, Obama secara mendadak melawat ke Afganistan, Selasa tengah malam. Dalam kunjungan singkat, sekitar enam jam, Obama bertemu dengan tentara AS di Pangkalan Udara Bagram dan Presiden Hamid Karzai serta menandatangani kepakatan kerja sama strategis kedua negara. Menurut kepala polisi Ayub Salangi, bom mobil itu meledak di Jalan Jalalabad. Di jalan utama kota Kabul itu terdapat sejumlah pangkalan militer AS dan kompleks perumahan untuk warga Barat. Salangi mengatakan, satu kompleks yang dikenal dengan nama Green Village merupakan sasaran bom itu. Seorang perwira polisi lain mengatakan, ledakan itu disusul dengan baku tembak. Belum ada kejelasan soal jumlah korban, tetapi beberapa media Afganistan memperkirakan jumlah korban cukup banyak. Seorang juru bicara dari markas NATO di negara itu menyatakan mengetahui adanya beberapa ledakan. Sejumlah orang di pusat kota juga mengaku mendengar suara ledakan. Sementara itu, Kedutaan Besar AS di Kabul mengatakan, gedung kedutaan besar itu tertutup serta memperingatkan stafnya untuk berlindung dan menjauhi jendela. Kedubes AS berlokasi di area utama diplomatik di pusat kota Kabul. Melalui akun Twitter-nya, Kedubes AS juga memperingatkan warganya di negara itu. “Tiarap dan berlindung di sini di kedubes. Bukan latihan, hindari area,” begitu bunyi pesan itu. (dtc/int)

„ Nunun memberikan keterangan terkait kasus yang menimpanya di Pengadilan Tipikor Jakarta.

KPK Yakin Nunun Bersalah JAKARTA- Sidang lanjutan kasus cek pelawat dengan terdakwa Nunun Nurbaeti mengagendakan pembacaan replik duplik. Jaksa menolak nota pembelaan kuasa hukum, dan tetap menilai Nunun bersalah. Hal itu disampaikan saat pembacaan replik oleh tim JPU KPK Andi Suharlis dan Siswanto di hadapan Majelis Hakim Pengadilan Tipikor Jakarta. Jaksa Andi tidak sependapat dengan pledoi yang disampaikan oleh tim Penasehat Hukum Nunun. ”Penasehat hukum menyatakan (dalam pledoi kemarin) tidak ada hubungan perbuatan terdakwa dengan pasal 5 ayat 1 huruf b dengan perbuatan anggota

DPR vonis pasal 11 UU Tipikor, terhadap itu, kami tidak sependapat,” tutur jaksa Andi di pengadilan Tipikor, Jl Rasuna Said, Jaksel, Jakarta, Rabu (2/5/2012). Menurut jaksa, alasan pihaknya menuntut Nunun dengan pasal 5 Huruf b tidak hanya pasal 11 sebagaimana yang didakwakan pada para anggota DPR sebelumnya itu karena tidak ada suatu delik yang pembuktiannya harus digantungkan dengan pasal yang lainnya dan juga saat anggota DPR itu divonis pasal 11 UU Tipikor mengenai gratifikasi, Nunun belum bisa dihadirkan dalam persidangan. JPU juga menilai soal penerimaan uang senilai Rp 1 miliar ke rekening

Nunun. Dalam pledoi kemarin, penasehat hukum menyatakan bahwa harta diperoleh secara mandiri dan bukan oleh cara koruptif. Atas hal tersebut, dalam replik yang diajukan, JPU tidak sependapat. ”Kami tidak sependapat, penuntut umum menerapkan pembuktian bahwa Rp 1 miliar berasal dari pencairan TC 480 lembar yang dibagikan kepada DPR” ujarnya lagi. Sebelumnya, Nunun dituntut empat tahun penjara dan denda Rp 200 juta, subsider 4 bulan penjara. Jaksa KPK juga meminta uang Rp 1 miliar yang berasal dari 20 lembar cek BII dirampas untuk negara. (dtc/int)

Anas Tak Mau Diadili Lewat Opini GARUT - Ketua Umum DPP Partai Demokrat, Anas Urbaningrum meminta kepada semua pihak untuk melihat secara jernih kasus suap Wisma Atlet yang menyeret namanya dan mantan Wasekjen Demokrat, Angelina Sondakh. Menurut Anas, lebih baik kasus suap Wisma Atlet dituntaskan lewat proses hukum. “Begini.... begini. Kita serahkan ke proses hukum yang adil. Jangan digiring dengan opini-opini,” kata Anas di selasela kunjungan kerja (Kunker) bersama dengan anggota Fraksi Demokrat di DPR di Garut, Jabar, Kamis (2/5). Anas menegaskan, jika proses hukum digiring dengan opini maka yang terjadi adalah pengadilan opini. Mantan anggota KPU itu khawatir pengadilan opini akan mengesampingkan proses

hukum yang adil. “Proses hukum digiring terus dengan opini, bukan proses hukum yang adil. Yang terjadi adalah pengadilan-pengadilan opini, kalau terjadi pengadilan opini, ya bukan keadilan,” ujarnya. Karenanya, kata dia, opini dalam proses hukum harus dihindari demi tegaknya keadilan. “Kemenangan opini itulah yang harus kita hindari. Tetapi kalau proses hukum, serahkan kepada aparat penegak hukum, biarkan bekerja,” tukasnya. Seperti diketahui, dalam beberapa kali kesempatan Nazaruddin menyebut keterlibatan Anas dalam dugaan korupsi, seperti proyek sport center Hambalang. Nazaruddin juga menyebut kemenangan Anas di Kongers Partai Demokrat juga tak lepas

dari money politic yang berasal dari dana proyek-proyek APBN. Namun kini Anas tak mau dipusingkan dengan opini negatif yang mengarah ke dirinya. Ia justru semakin rajin turun ke bawah menemui konstituen Demokrat. Selama di Jabar, Anas melakukan kunjungan kerja di tiga kabupaten selama 2 hari dari 1-2 Mei 2012. Yakni Kabupaten Bandung, Bandung Barat dan Garut. Ia didampingi oleh legislator dari daerah pemilihan Jabar seperti Herman Khaeron, Roestanto Wahidi dan Yahya Sacawirya. Selain membagi-bagikan sumbangan kepada masyarakat, rombongan Anas juga melaksanakan program bedah rumah layak huni bagi warga yang tidak mampu.(awa/jpnn)

JAKARTA- Istri Nazaruddin, Neneng Sri Mulyani, yang menjadi buron KPK ‘menyerah’. Dia pun mengaku siap bekerja sama dengan KPK. Tapi, tersangka kasus korupsi PLTS Kemenakertrans ini minta tidak ditangkap. Wah! ”Ya dijemput saja,” kata pengacara Nazaruddin, Elza Syarief, saat berbincang dengan wartawan, Rabu (2/5). Elza mengamini bahwa Neneng sudah berkirim surat dan melakukan kontak dengan KPK. Tapi dia mengaku tidak tahu di mana keberadaan Neneng. Elza pun tidak tahu kalau Neneng seperti kabar yang beredar, berada di Jurong, Malaysia. ”Ya belum tahu,” ujarnya. Elza juga menjelaskan bahwa Neneng akan memenuhi proses hukum bila tidak ditangkap dan ditahan. “Tentu akan kooperatif,” janjinya. Sebelumnya, Jubir KPK Johan Budi membenarkan adanya surat kepada pimpinan mengenai koordinasi pemulangan Neneng. Namun, dia tidak mngetahui apakah surat itu dari kuasa hukum Nazaruddin ataupun Neneng. ”Jadi Jumat pekan lalu pimpinan KPK menerima surat dari pengacara (kuasa hukum Nazaruddin). Surat itu isinya mereka ingin koordinasi berkaitan dengan pemulang Neneng,” kata Juru Bicara KPK Johan Budi di kantornya, Selasa (1/5). Menurut Johan, saat ini surat tersebut masih dibahas oleh pimpinan KPK. Belum ada keputusan dari pembahasan tersebut. Lobi Upaya Pemulangan dari Malaysia Pihak Neneng Sri Wahyuni menyurati pimpinan KPK. Buronan kasus korupsi PLTS Kemenakertrans ini ingin berkoor-

dinasi mengenai upaya pemulangan dari pelarian di luar negeri. Jubir KPK Johan Budi membenarkan adanya surat kepada pimpinan mengenai koordinasi pemulangan Neneng. Namun, dia tidak mengetahui apakah surat itu dari kuasa hukum Nazaruddin ataupun Neneng. ”JadiJumatpekanlalupimpinan KPK menerima surat dari pengacara (kuasa hukum Nazaruddin). Surat itu isinya mereka ingin koordinasi berkaitan dengan pemulang Neneng,” kata Juru Bicara KPK Johan Budi di kantornya, Selasa (1/5). Menurut Johan, saat ini surat tersebut masih dibahas oleh pimpinan KPK. Belum ada keputusan dari pembahasan tersebut. ”Belum ada keputusan,” ujar Johan. Dihubungi terpisah, kuasa hukum Nazaruddin, Junimart Girsang, yang juga menjadi pengacara Neneng, membenarkan ada surat itu. Namun dia tidak menjelaskan lebih rinci mengenai maksudkoordinasidalamsuratitu. ”Iya. Tapi nanti saja ya lengkapnya, saya sedang ada acara,” papar Junimart. Sebelumnya, Wakil Ketua KPK Busyro Muqoddas pernah menyatakan Neneng bersembunyi di Malaysia. “Sampai sekarang informasinya masih di Malaysia,” kata Busyro beberapa waktu silam. Hingga saat ini, sambung Busyro, KPK terus bekerjasama denganinterpoluntukmenangkap istribekasBendaharaUmumPartai Demokrat itu. (dtc/int)

Anis Matta: KPK Harus Usut Aliran Dana Wa Ode JAKARTA-WakilKetuaDPR Anis Matta siap memenuhi panggilan KPK sebagai saksi kasus Wa Ode Nurhayati. Anis sepakat Wa Ode diusut dengan UU Tindak Pidana Pencucian Uang (TPPU) dan mendorong KPK mengusut aliran dana Wa Ode. ”Saya mengucapkan terima kasihsebesar-besarnyakepada KPK yang memberi saya kesempatan membantu mengusut kasus suap Saudara Wa Ode Nurhayati, anggota Banggar dari fraksi PAN yang sudah dikembangkandenganpidana TPPU,”kataAniskepadawartawan di Gedung DPR, Senayan, Jakarta, Rabu (2/5). Anis akan mengungkapkan semuayangdiketahuinyakepada KPK. Anis siap menjelaskan mekanisme pembahasan

anggaran di DPR. ”Saya akan membantu KPK mengusut kasusinisepanjangsesuaidengan kewenangansayasebagaiwakil ketua Banggar bidang koordinator keuangan,” ujar Anis. Anis meyakini kasus ini terpisah. Anis mendorong KPK justru mengungkap aliran dana Wa Ode Nurhayati. ”Di sini ada dua kasus terpisah. Pertama kasus suap yang menimpa Wa Ode Nurhayati dari Fraksi PAN. Kedua, pembahasan anggaran yang sudah ditetapkan di DPR. Yang perluditelusurialirandanadari suap itu siapa yang lebih menikmati dari aliran ini. Itu yang lebih relevan untuk ditelusuri. Ini tidak ada hubungannya dengan mekanisme,” tandasnya. (kmc/int)

TERCECER Telah tercecer Ijazah SMA Negeri 1 Pematangsiantar An. Abdul Rahman SPd Tercecer antara Jl. Merdeka - Jl. Sutomo sekitarnya. Bagi yang menemukan hub: HP 0812 6305 5622 Tidak dituntut tapi diberikan imbalan yang sepantasnya


KAMIS

3 Mei 2012

HD Spywatch

Kamuflase Kamera dalam Rupa Jam Tangan Semakin majunya jaman, dan berkembangnya teknologi tak dapat dipungkiri membawa perubahan dalam perilaku hidup manusia. Munculnya beragam perangkat komputer, gadget, hingga perangkat multimedia seperti kamera, tak pelak membuat tingkat kebutuhan akan perangkat semacam ini seolah-olah melonjak bak meteor. Kamera salah satunya. Rupa-rupa bentuk dari kamera saat ini beredar di pasaran. Mulai dari kamera manual, kamera digital, hingga perangkat camcorder yang mampu merekam video. Bermacam bentuk dan pengembangan dari kamera pun bemunculan. Salah satu contohnya adalah kamera pengintai. Kamera pengintai adalah kamera yang diletakkan pada perangkat-perangkat tertentu dan fungsinya disamarkan atau dikamuflasekan menjadi perangkat tertentu, seperti pena, jam tangan, jam meja, kotak tisu, kunci mobil, kancing, korek api, asbak, kacamata, bahkan dasi. Salah satu yang akan kita bahas kali ini adalah kamera pengintai berbentuk jam tangan. Secara tampilan tidak berbeda dengan jam tangan pada umumnya. Namun yang membuatnya istimewa, jam tangan ini mampu merekam video dengan teknologi HD. Kualitas gambar yang dihasilkan tak kalah dengan camcorder yang beredar di pasaran. Selain mampu merekam video HD, perangkat yang bernama HD Spywatch ini juga dapat digunakan untuk mengabadikan foto dengan output jpeg, yang mampu menghasilkan resolusi 1600x1200. Cara Penggunaan Video Penggunaan HD Spywatch sangatlah mudah. Untuk menyalakan, anda tinggal tekan dan tahan tombol on/off, hingga lampu indikator menyala berwarna ungu, lalu berubah menjadi biru. Pada saat lampu indikator berwarna biru, tekan tombol on/off 1x (tidak di tahan), lampu indikator akan berkedip 3x lalu padam, menandakan bahwa spywatch sudah dalam keadaan merekam video. Foto Pada saat lampu indikator berwarna biru (video mode), tekan tombol mode 1x untuk memindahkan ke mode foto. Lampu indikator akan berubah menjadi merah, dan lanjutkan dengan menekan tombol on/off 1x untuk melakukan pengambilan gambar. Untuk mematikannya, Anda cukup menekan tombol on/off, hingga lampu indikator berwarna merah berkedip 3x lalu padam. Kualitas video maupun foto yang dihasilkan pada kondisi ruang dengan ketersediaan cahaya mencukupi, hasilnya tidak kalah dengan kamera saku digital lainnya. Namun memang harus diakui, HD Spywatch belum bisa diandalkan dalam ruang yang minim cahaya (malam hari), dikarenakan belum adanya perangkat flashlight di dalamnya.(int).

(FOTO : IRWANSYAH)

„ Ka UPTD Dikjar Hatonduhan Rosmidar br Lubis foto bersama guru -guru seusai perayaan Hardiknas di SMP Bens Grup Hatonduhan, Rabu (2/5) siang.

Jadikan Hardiknas Momentum Kebangkitan Pendidikan HATONDUHAN- Peringatan Hardiknas merupakan momentum kebangkitan pendidikan dan memperkuat komitmen bangsa terhadap pembangunan Negara, khususnya pembangunan pendidikan di Kecamatan Hatonduhan. Demikian dikatakan Ka UPTD Dinas Pendidikan Hatonduhan Rosmidar Lubis SPdI kepada METRO, Rabu (2/5) di selah-selah

utama untuk bangkit meraih kemajuan dan diyakini mampu melahirkan cikal bakal pemimpin bangsa,” katanya. Disebutkan, sudah cukup lama masyarajat Hatonduhan dikaruniai potensi sumber daya manusia berupa populasi usia produktip yang sangat besar jumlahnya. Tentu ini merupakan bonus besar

acara peringatan Hardiknas di SMP Bens Grup Hatonduhan. “Pembangunan pendidikan di Kecamatan Hatonduhan merupakan jalan

Kuartal Pertama 2012

Telkomsel Catat Laba Bersih Perusahaan Rp3,5 Triliun JAKARTA- PT Telekomunikasi Selular (Telkomsel) mencatat laba bersih yang sangat menggembirakan di kuartal pertama 2012 sebesar 3,5 triliun Rupiah. Telkomsel juga membagi deviden kepada para pemegang saham 10,2 trilyun Rupiah atas kinerja positif di tahun buku 2011. Hal ini disampaikan dalam Rapat Umum Pemegang Saham (RUPS) yang berlangsung di kantor pusat Telkomsel Rabu, (25/5) dan dihadiri para pemegang saham. Selama tahun buku 2011, Telkomsel berhasil mencatatkan pendapatan sebesar 48,7 trilyun Rupiah atau tumbuh 7 persen dibanding tahun sebelumnya. EBITDA Tahun 2011 juga meningkat menjadi 27,5 triliun Rupiah dengan laba bersih mencapai 12,8 triliun Rupiah dimana kontribusi terbesar berasal dari layanan data dan SMS. Pertumbuhan positif Telkomsel terus berlanjut sepanjang

kuartal pertama 2012. “Selama kuartal pertama 2012, Telkomsel berhasil menghadapi kompetisi di industri telekomunikasi yang semakin ketat dengan melakukan berbagai terobosan produk dan layanan. Hal ini terbukti dengan meningkatnya pendapatan sebesar 9 persen dibandingkan periode yang sama tahun lalu, tertinggi di industri telekomunikasi, sekaligus memimpin pasar dengan market share sebesar 43 persen dan 109,9 juta pelanggan,” papar Sarwoto Atmosutarno, Direktur Utama Telkomsel. Trafik data di Indonesia tahun ini diperkirakan tumbuh sebesar 40 persen karena semakin banyaknya perangkat ponsel canggih (smartphones) dengan harga yang terjangkau. Terkait dengan usaha untuk menambah dan memperluas pelanggan layanan data, Telkomsel telah menggelar lebih dari 10.000 BTS 3G dari sekitar 45.000 BTS di seluruh wilayah

Indonesia. Jumlah broadband city juga akan digenjot dari 46 kota menjadi 100 kota di akhir 2012. Telkomsel adalah operator pertama di Indonesia yang sukses melakukan uji coba layanan Long Term Evolution (LTE). Selama tiga tahun terakhir (2009-2011) jumlah pelanggan Telkomsel tumbuh sangat signifikan sebesar lebih dari 41 juta yang mendorong peningkatan pendapatan sebesar 7,1 trilyun Rupiah. Sementara itu jumlah pelanggan data melonjak dari 17 juta menjadi 40 juta. Tahun 2011, Telkomsel menyetor pajak sebesar 8,7 trilyun Rupiah ke kas negara sehingga menempatkan Telkomsel sebagai salah satu kontributor pajak yang signifikan di Indonesia Untuk melayani hampir 110 juta pelanggannya saat ini, Telkomsel melakukan beragam inovasi beyond telco dan layanan telekomunikasi selular berbasis data. (leo/rel)

kepada kita. Persolannya bagaimana kita menyikapinya untuk menggali potensi sebagai asset untuk memajukan pendidikan. Kita harus melakukan investasi dalam bidang pengembangan sumber daya manusia. Rosmidar Lubis menambahkan, salahsatu tokoh nasional Ki Hadjar Dewantara, selain memperkenalkan metode among (ing ngarsa sung tulada, ing madya mangun karsa, tut wuri handayani) dalam proses pembelajaran, sangat menekankan pendidikan sebagai jalan untuk memperbaiki nasib rakyat. Momentum Hardiknas kali ini sekaligus dimanfaatkan untuk pencanangan wajib belajar 12 tahun sebagai upaya melahirkan generasi emas 100 tahun Indonesia merdeka. Sementara itu, Camat Hatonduhan Daniel Silalahi menambahkan, suasana Hardiknas ini, diharapkan semangat guru dan murid semakin termotivasi. Ketertinggalan bisa dikejar jika memang guru dan siswa dan elemen pendukung lainnya saling bahu membahu. Namun demikian, dibutukan kerja keras kepala sekolah sebagai penyelenggara pendidikan untuk melengkapi sarana dan prasarana pendidikan. Paktor pendukung tersebut sangat diperlukan. Bila

penting melalui kerjasama dengan komite sekolah, merangkul anak rantau yang sukses untuk berkontribusi langsung. Atau kepala sekolah mengusulkan kepada managemen BUMN PTPN IV Hatonduhan atau PT BSE Sipitu Tikka agar dana CD dapat digulirkan ke dunia pendidikan. Kepala sekolah sebagai penaggung jawab pendidikan di sekolah masingmasing harus terlebih dahulu hadir dan belakangan meninggalkan sekolah. Camat Daniel Silalahi menambahkan, Pemerintah telah menyiapkan grand design pendidikan. Pendidikan anak usia dini digencarkan dengan gerakan PAUD-isasi, peningkatan kualitas PAUD, dan pendidikan dasar berkualitas dan merata. Selain itu, pembangunan dan rehabilitasi sekolah dan ruang kelas baru dilakukan secara besar-besaran. Ditempat terpisah, Rinto Manurung (35) dan Rikkot Damanik (40) pemerhati Pendidikan di Tangga Batu Hatonduhan, mengharapkan Sebagai salah satu generasi muda bangsa, kami berharap pemerintah beserta para pemangku kepentingan pendidikan dapat menggunakan momen Hari Pendidikan Nasional ini untuk refleksi diri dalam kinerja mereka.(iwa)

(FOTO : IRWANSYAH)

„ Camat Hatonduhan Daniel Silalahi MSi bertindak sebagai inspektur upacara .


KAMIS

3 Mei 2012

Mahasiswi Asal Siantar Tenggak.. Sambungan Halaman 8 Foto Well

„ Mobil Honda Stream yang menabrak pengguna jalan, diamankan di Mapolsek Sunggal, Rabu (2/5).

Supir Nyaris Dibakar Massa Sambungan Halaman 8 menyebabkan tiga korban mendapatkan perawatan di RS Bina Kasihini,bermulasaatSilemmelintas di Jalan TB Simatupang. Kala itu ia menyerempet seorang pengguna jalan. Karena takut diamuk massa,pengemudimelajukanmobil berwarna hitam itu dan masuk ke Gang Bakung yang buntu. Selanjutnya Silem yang sudah duhantui rasa takkut, membalikkan arah mobil dan keluar dari Gang bakung. Namun sebelum keluar, ia menabrak seorang lagi bernama Sajidah (22) yang mengendarai HondaRevoBK4185XF.Akibatnya, wanita muda ini mengalami luka seriusdikakikanan.Pengemudiyang semakin takut kembali melajukan kendaraannya dan akhirnya menabrak dua pejalan kaki lain. Masing-masing, Popy Widya Natha

(15) dan Herman (49). Keduanya mendapatlukadikepaladankaki. “Awalnya aku melihat mobil melintas kencang dari Jalan TB Simatupang menuju Sunggal. Aku saja tak menyangka ikut menjadi korban.Tapipengemudinyasudah diamankan warga setelah ban depan mobil pecah,” kata seorang korban bernama Herman. Warga yang emosi langsung merusakmobilyangiakemudikan. Karena takut, pria berdarah India inimemilihbertahandimobilyang nyaris dibakar warga. Beruntung polisi cepat ke lokasi dan mengamankannya. Kapolsek Sunggal Kompol Budi Hendrawan mengatakan, pihaknya telah mengamankan supir mobil. “Korban ada lima orang, namun tiga di antaranya dirawat di RS Bina Kasih,” terangnya. (wel/ pmg)

Tak Punya Uang.. Sambungan Halaman 8 bertabrakan dengan betor (beca bermotor) di Jalan MH Sitorus, tepat di depan kantor PLN Cabang Pematangsiantar. Setelah dibawa ke rumah sakit, ia tak mau masuk ruang perawatan. Alasannya, menunggu keluarga karena tak mengantongi uang. Peristiwa terjadi saat Saputra melaju dari Jalan Kartini menuju Jalan H Adam Malik. Tepat saat sepedamotornya melaju di depan Kantor PLN, dari arah berlawanan datang satu unit becak bermotor BK 2130 KJ, dikemudikan Apintus Pangaribuan (30-an) yang sedang membawa istri dan dua anaknya dengan kecepatan tinggi. Akibat kurang hati-hati, kedua kendaraan akhirnya bertabrakan. Begituterdengarsuarabenturan, Saputra dan sepedamotornya masukparit.Halyangsamajugaterjadi Apintus dan keluarganya. Beruntung luka-luka yang dialami sekeluarga ini tak begitu parah. Hanya mengalami lecet di tangan dan kaki saja. Warga sekitar lokasi yang menyaksikan kejadian, berusaha memberikanpertolongan.Saputra dan keluarga Apintus pun dibawa ke RS Tiara. Setibanya di rumah sakit, sekeluarga warga Jalan Enggang Kelurahan Sipinggol-pinggol ini langsung dirawat di UGD. Istri Apinten tampak berbaringdan mengalami

luka di beberapa bagian tubuhnya. Termasuk ketiga anaknya yang berusia 8 tahun dan 10 tahun. Namun lain halnya dengan Saputra. Pemuda yang mengalami luka di tangan dan dadanya ini malah terlihat berdiri di luar ruang perawatan. Saat wawancarai METRO,iadenganpolosnyamengaku sedang tidak mengantongi uang untuk berobat. “Gakadauangbang,jadiakugak berobat dululah. Ini masih menunggu keluarga datang,” katanya. Diceritakanya,sebelumkejadian ia baru saja pangkas rambut dan hendak pulang ke rumahnya di Jalan Gereja. “Memangsialsekalihariini.Tadi kulihat becak itu mau menyalip truk di depannya, makanya kami tabrakan. Aku tadi sempat masuk parit. Tapi kami sudah ngomong dan berencana akan berdamai,” tambah Saputra. Tak lama dari pembicaraan itu, keluarga Saputra tampak hadir di rumah sakit. Selanjutnya Saputra pun masuk untuk mendapat perawatan. Sementara seorang kerabat Apintus yang ditemui di rumah sakit mengatakan, Apintus adalah pedagang roti. “Dia ini jualan roti di dekat Suzuya, jadi tadi ia hendak mengantar rotinya dan terjadi kecelakaan,”ucapnyasaatbersama salah seorang putri Apintus yang mengalami luka di kaki. (pra/hez)

Informasi yang berhasil dihimpun, peristiwa yang menyebabkan Wiwin harus dirawat ke ruang IGD rumah sakit berplat merah ini terjadi setelah korban ditemukan rekan satu kos-nya, Lusiana (22), dalam keadaan pingsan. Setelah dilihat, ternyata mulut korban tampak berbuih dan terbaring di lantai kamar kos. “Saya menemukan dia (Wiwin) sudah tak sadarkan diri terbaring di lantai. Waktu itu saya yang mencoba memanggilnya karena dia tampak mengurung diri tanpa keluar kamar. Karena penasaran, saya mencoba memanggilnya, tapi tak ada sahutan. Saya pun menggedor pintu,” terang Lu-

siana. Karena tak mendengar sahutan dari kamar, Lusiana nekat mendobrak pintu. Mata Lusiana kemudian melihat temannya sudah terbaring tak sadarkan diri dengan mulut berbuih. Takut sesuatu hal buruk terjadi, Lusiana memanggil penghuni kos lain guna dimintai pertolongan. Selanjutnya Wiwin diberi minum susu guna menetralisir racun yang ditimbulkan obat pembersih lantai yang diminumnya. Karena tak ada hasil, Wiwin dibawa ke klinik terdekat. Namun karenakan kurangnya alat yang memadai, Wiwin dirujuk ke RS Pirngadi. Namun karena kondisi fisik Wiwin mengkhawatirkan, ia harus

Pedagang Lemang Dicakar.. Sambungan Halaman 8

diopname selama dua hari di ruang plus B lantai I rumah sakit tersebut. Belakangan diketahui, aksi nekat Wiwin terjadi setelah ia sakit hati dengan pacarnya. Pasalnya malam sebelum kejadian, Selasa (1/5), antara Wiwin dan pacarnya yang juga mahasiswa di Unimed, terlibat perang mulut via ponsel. Diduga pertengkaran dilatarbelakangi alasan yang sangat sensitif, sehingga pacar Wiwin yang diketahui berinisial A langsung datang ke kos-an gadis asal Kota Pematangsiantar ini. “Tidak diketahui pasti apa yang dibicarakan mereka, tapi suara bertengkar terdengar dari dalam kos Wiwin,” ujar rekan-rekannya. (zie/pmg)

12 Operator Genset PT Bridgestone Dipolisikan Sambungan Halaman 8 lianto alias Acong, Selasa (1/5) siang. Saat itu aliran listrik padam. Karena tak mau aktifitas perusahaan terganggu, Acong menyuruh pegawai perkebunan menyalakan mesin genset ke gudang. Beberapa menit kemudian, pegawai yang semula disuruh menyalakan genset malah datang kembali dan menyampaikan kabar buruk. Dalam laporannya, saat ia ke lokasi mesin genset, gudang sudah didapati dalam keadaan terbuka. Sedangkan gembok gudang sudah rusak. Khusus mesin genset, sudah acak-acakan dan tidak bisa dinyalakan.

Spontan, Acong yang tak percaya dengan laporan itu, mendatangi lokasi. Begitu melihat keadaan, ia menjad geram. Terlebih saat mesin tidak bisa dinyalakan. Akibatnya, banyak aktifitas di perkebunan yang terhambat. Selanjutnya Acong memanggil tiga operator genset yang dikenalnya untuk dimintai keterangan. Mereka adalah Samsul (50), Paino (55) dan Budi Nere (35), ketiganya warga Beringin, Kecamatan Tapian Dolok, Simalungun. Namun menurut para operator itu, kerusakan genset itu bukanlah disengaja. Meski begitu, Acong tidak dapat menerima alasan para operator-

nya. Tak lama dari kejadian Acong memilih membuat pengaduan ke Polres Simalungun. Dalam laporannya, selain tiga orang yang sudah dipanggil untuk dimintai keterangan, sembilan operator lain yang tidak ia kenali, juga diadukan. Kasubbag Humas AKP H Panggabean SH mengaku telah menerima laporan pengaduan Acong. “Laporannya bernomor LP/ 278/IV/SU/Simalungun. Sementara kedua belas tersangka terancam dijerat pasal 406 KUHPidana yo pasal 335 KUHPidana tentang pengerusakan dan perasaan tidak menyenangkan. (Osi/hez)

“Karena ada ledakan, warga lari menyelamatkan diri. Namun setelah diyakinkan oleh Danramil yang berada di TKP, warga kembali bergotong royong memadamkan api,” tambahnya. Satu jam kemudian, api berhasil dipadamkan. Sedangkan Darwis (35) menceritakan, saat itu ia baru saja menutup rumahnya. Ia berencana berkunjung ke rumah tetangganya. Saat melangkah 10 meter dari rumah, ia mendengar tetangganya berteriak mengatakan api. “Aku langsung balik dan melihat rumah sudah terbakar. Memang dinding rumahku terbuat dari gedek, di rumah juga banyak perabotan yang gampang terbakar,” tuturnya. Sedangkan Syahrial Sipayung (50), pemilik rumah lainnya mengatakan, tidak berada di rumah saat kebakaran terjadi. “Aku dapat kabar dari keluarga jika rumahku terbakar. Begitu sampai di rumah, api sudah mulai bisa dipadamkan. Seluruh isi rumah habis terbakar, padahal baru dua hari yang lalu aku belanja bahan bangunan. Habis semua kerja kerasku, beruntung mobil

yang kuparkir di depan rumah tidak ikut dilalap api,” ujar Mantan Pangulu Silou Paribuan ini. Sementara Danramil 19 ND Kapten S Sianturi mengatakan, saat kejadian dia langsung mengkoordinir warga untuk memberikan pertolongan. “Kebakaran berada di lokasi pemukiman yang padat penduduk. Kita khawatir api menyebar ke rumah lain, sementara pemadam kebakaran tidak ada yang dekat dengan TKP. Selanjutnya warga kita minta untuk menuang air ke parit, kemudian air yang sudah bercampur pasir dan tanah kita lemparkan ke rumah yang terbakar,” katanya. Terpisah, Kapolsek Silou Kahean AKP Lamin yang dikonfirmasi mengatakan, sumber api diduga karna korsleting listrik. “Dugaan sementara karena korsleting listrik. Pengakuan pemilik rumah, ada kabel listrik sudah usang dan digigit tikus sehingga mengeluarkan panas. Sementara di rumah banyak barang yang gampang terbakar. Walau demikian, kasus ini masih dalam lidik,” bebernya. (hp)

Usaha Perabotan Musnah Terbakar

Sambungan Halaman 8 korban jiwa dalam peristiwa ini, sedangkan kerugian materi diperkirakan mencapai Rp250 juta. Informasi dihimpun, sumber api diduga berasal dari rumah milik Darwis yang dijadikan sebagai tempat berjualan perabotan. Api kemudian menyebar ke dua rumah lain, masing-masing milik Syahrial Sipayung yang dijadikan usaha bahan bahan bangunan dan M Saragih. Menurut seorang saksi mata bernama Jaipan Saragih, kobaran api mulai terlihat dari atap rumah yang menjual perabotan rumah tangga. Api semakin cepat menyebar karena banyaknya barangbarang yang mudah terbakar. “Melihat api mulai marak, aku langsung berteriak meminta pertolongan warga, namun karna banyak barang-barang yang mudahterbakar,ketigarumahdan seluruh isinya rata dengan tanah” ujar Jaipan. Ditambahkannya, saat berusaha memadamkan api, warga sempat mendengar beberapa kali ledakan. Akibatnya warga takut memadamkan api.

kejadian ia sedang berjualan lemang di sebuah acara adat pesta orang batak yang meninggal dunia. Tak sendiri, adik iparnya Sarita br Lumbantobing juga berada di lokasi. Namun karena sebelumnya kakak beradik ini sudah sering bertengkar, tiba-tiba Herawati mengingatkan Sorita untuk tidak mencari masalah dan membuat keributan di lokasi. Nasehat itu ternyata tak ditanggapi dengan baik. Sebaliknya Sorita langsung mengeluarkan ucapan kotor. Karena tak senang dicaci maki adik ipar, Herawati membalas dengan kata-kata makian. Ung-

kapan itu ternyata semakin membuat Sorita semakin emosi dan mendatangi korban. Begitu jarak keduanya berdekatan, Sorita mencakar wajah kakak iparnya ini hingga mengalami luka di atas bibir. Keributan sempat mengundang perhatian warga. Namun Herawati memilih pergi dari lokasi dan mengajak temannya ke RSUD dr Djasamen Saragih untuk melakukan visum. Setelah visum, Herawati mendatangi Polsek Siantar Timur untuk membuat laporan pengaduan. Tetapi karena lokasi kejadian perkaranya di daerah Perumnas batu VI, Herawati disarankan untuk mengadu di Mapolsek Bangun. (pra/hez)

Korban Masih Kritis Sambungan Halaman 8 beberapa kali membuka mata. Namun ia belum dapat berbicara. “Kami saja belum bisa menjenguk berlama-lama,” ucap wanita paruh baya berkulit hitam ini. Dikatakannya, sejauh ini untuk biaya perobatan korban masih ditanggung pihak pengusaha pengerjaan pembangunan perumahan itu. Sedangkan hasil pemeriksaan medis terakhir, bagian tulang punggung korban remuk, termasuk di bagian dada. Istri korban bernama Susi, yang juga berada di RS Tiara terlihat lesu dan pucat. Namun wanita muda ini lebih memilih diam dan tidak mau berkomentar tentang kondisi suaminya. “Kami hanya berharap agar korban cepat sembuh agar bisa bekerja lagi. Sebab dua anaknya masih kecil-kecil dan

sangat membutuhkan biaya,” katanya. Susi sendiri adalah seorang ibu rumah tangga tanpa penghasilan. Sekedar mengingatkan, korban terjatuh dari lantai dua saat bekerja di Perumahan Griya Sitorus, di Jalan MH Sitorus Kelurahan Teladan, Siantar Barat, Selasa (1/5) sekira pukul 10.15 WIB. Diduga peranca yang menjadi pijakan korban tidak kuat menahan beban. Akibatnya Arifin terjun ke lantai dasar dan mengalami patah lengan kanan dan luka di bagian kepalanya. Beruntung korban masih bisa diselamatkan setelah rekan-rekannya melarikannya ke RS Tiara di Jalan Menambin, Kelurahan Timbang Galung. Sementara menurut pihak pengembang dan pengusaha perumahan mengaku akan membantu biaya perobatan korban warga Karang Sari ini. (pra/hez)

4 Pria Naik Avanza Rampok.. Sambungan Halaman 8 Informasi dihimpun METRO, perampokan terjadi ketika Surya mengendarai truk BK 8160 QL tanpa muatan dari arah Medan menuju Kisaran. Ketika melintas di Jalinsum, kawasan Pondok Seng, tibatiba mobil Avanza membuntutinya. Tak curiga, Surya terus melaju. Namun ketika dirinya mempercepat laju truk, spontan pengendara mobil Avanza menyalip dan menghentikan mobil di depan truk. Surya pun terkejut dan menghentikan laju truknya. Setelah truk berhenti, dari mobil Avanza keluar empat pria yang tidak dikenal. Para pria tersebut langsung menghampir dan mengancam dirinya serta memintanya turun dari truk. Karena ketakutan, Surya turun dari truk dan segera

digiring empat pria itu ke pinggir jalan. Lalu empat pria itu mengendarai truk ke arah Kisaran, dan meninggalkan Surya sendirian di Jalinsum kawasan perkebunan PT SMA. Setelah ditinggal para pelaku, Surya berjalan kaki mencari pertolongan. Ketika menemukan warung yang masih buka, Surya menceritakan peristiwa yang dialaminya. Selanjutnya warga menemani Surya membuat laporan ke Polsek Labuhan Ruku. Kapolsek Labuhan Ruku AKP H Matondang ketika dikonfirmasi mengatakan pihaknya menerima laporan seorang sopir truk yang mengaku dirampok. Sejauh ini, katanya, polisi masih melakukan penyelidikan. ”Benar kita menerima laporan itu. Tapi kita masih meminta keterangan dari sopir untuk bahan penyelidikan,” katanya singkat. (CK-1)

Sambungan Halaman Satu Selamat Jalan Bu Mentri

Rasanya Enak dan Membuat Lebih Pede Sambungan Halaman 1 mereka mengkonsumsi sabu yang sebelumnya sudah dibawa Saiful yang dibeli dari Andi dengan paket Rp100 ribu,” sebutnya. Lebih lanjut, dia menerangkan, tidak lama setelah menghisap sabu tersebut, terdakwa kakak beradik Agustina dan Reni datang ke rumah Bunda. Rencananya pertemuan itu untuk mencarikan Agustina seorang pekerja yang mau bekerja di café. “Sebelum pesta sabu pagi itu, saya terakhir memakai sekitar seminggu sebelumnya. Sementara untuk terdakwa, Agustina dan Reni kedatangannya untuk bertamu. Akan tetapi, mereka ikut mengkonsumsi sabu dan kami memutuskan untuk patungan beli sabu,” sebut janda

lima anak itu. Menurutnya, agar dapat melanjutkan pesta sabu tersebut, ia mengeluarkan uang Rp50 ribu, Saiful Rp100 ribu, Reni Rp50 ribu, Agustina Rp50 ribu, sedangkan Hafni hanya ikut memakai saja. Setelah memesan sabu kepada, Andi kurir warga Galang, pesanan dua bungkus paket sabu pun diantar. Selanjutnya mereka menghisap sabu tersebut bergantian. Saat ditanyakan hakim, bagaimana rasanya usai menghisap sabu tersebut, diterangkan Riati, setelah menghisap sabu rasanya enak dan lebih pede. Tidak hanya itu, rasa suntuk dalam diri juga ikut hilang. Apalagi seperti dirinya yang tidak memiliki pekerjaan dan telah ditinggal kawin suaminya. Sementara itu, Saiful mengaku, sudah menggunakan sabu-sabu sejak tahun

2010. Biasanya, dia membeli sabu dari Andi. “Sebelum ditangkap, awalnya saya sendiri yang membawa sabu paket Rp100 ribu ke rumah Bunda. Saya sendiri pun sudah ketergantungan sabu sejak tahun 2010 dan sering mengkonsumsinya,” sebut Saiful yang berprofesi sebagai supir. Selanjutnya, usai memberikan keterangan di persidangan, dengan kompak para terdakwa mengaku menyesal dengan perbuatan itu. Terdakwa warga Bah Sarimah, Nagori Dolok Kecamatan Silou Kahean Simalungun itu berjanji tidak akan mengulanginya. Selanjutnya, hakim majelis memutuskan menunda persidangan hingga Rabu (9/5) dengan agenda tuntutan dari Jaksa Penuntut Umum (JPU), Conny TM Sagala. (mua)

Pemerkosa Cucu Masih Berkeliaran Sambungan Halaman 1 nuturkan, sejak tersangka dilaporkan, Minggu (29/4) hingga kini aparat Polres Simalungun belum menangkap tersangka. Ia mengaku, kerap melihat tersangka berkeliaran di seputar nagorinya. “Saya sering melihat, Jaitan Nainggolan melintas di jalan kampung ini. Selama ini, kami kenal tersangka itu orangnya sombong dan kurang bergaul,” kata Parlindungan. Bahkan kata dia, tersangka masih melakukan kegiatan sehari–harinya sebagai Humas Pabrik minuman di Kerasaan dan sebagai Kepala Dusun Huta IV Nagori Pematang Bandar. Masih kata Parlindungan, sebenarnya kejadian yang menimpa korban sudah menjadi rahasia umum di kampung itu. Apalagi selama tinggal bersama pelaku, korban terlihat jarang

bergaul dengan teman lelakinya, tapi mendadak korban hamil hingga melahirkan seorang anak. ”Semua orang kampung ini sudah lama mencurigai ‘kenakalannya’. Sebab selama ini, kami ketahui cucunya ini jarang keluar rumah dan orangnya baik. Tapi mendadak dia hamil. Itu yang membuat warga heran dan menaruh curiga,” ujar Parlindungan. Begitupun, lanjut Parlindungan, tersangka sempat mengaku pada warga bahwa kejadian yang menimpa cucunya itu tidak benar adanya. ”Pada warga, dia (tersangka) juga mengaku bahwa kejadian itu sama sekali tidak benar. Padahal warga sekitar ini sudah sangat tahu sekali kelakuan bejat dia,” ujar Parlindungan geram. Sementara warga lainnya, Polman Sinambela (34) menambahkan, sangat mengenal pribadi tersangka. Selama ini, kata dia, tersangka kerap mengantar

dan menjemput korban kerja ke Pabrik minuman tersebut. ”Dulu sewaktu cucunya masih tinggal di kampung ini, dia sering mengantarkan cucunya ke tempat kerja. Bahkan saat pulang kerja, pasti dijemputnya,” katanya. Selain itu, kata Polman, Jaitan Nainggolan juga diketahui sering mengunjungi lokalisasi Bukit Maraja. Ia sendiri mengaku pernah diajak. Namun dia sangat mengesalkan sikap Jaitan yang kerap meremehkan teman-temannya. ”Kami seringnya mengunjungi lokasi Bukit Maraja, tetapi terkadang yang kami sesalkan dari sikapnya dia terkadang meremehkan kami. ungkin karena dia banyak uang, makanya dia begitu,” katanya. Warga sendiri ketika dikonfirmasi mengaku kesal dengan kinerja Polres Simalungun yang terkesan lambat menangani kasus itu. Warga mengaku resah, sebab hingga kini tersangka masih berkeliaran. (mag–02)

Sambungan Halaman 1 Selama 1,5 tahun terakhir, Endang Rahayu mulai menjalani perawatan untuk melawan penyakitnya itu, baik di dalam maupun di luar negeri, hingga akhirnya tiga minggu yang lalu dia dilarikan ke RSCM karena merasa nyeri di tubuhnya. Pengobatan yang selama ini telah dijalani mantan Menkes antara lain radiasi lokal dan bedah beku, tujuannya untuk mengobati kanker secara lokal serta meningkatkan daya tahan tubuh. Kondisi mantan Menkes mengalami penurunan sejak dua hari yang lalu dan berada dalam kondisi kritis sejak Selasa (1/5) pagi. Ia dimasukkan dalam perawatan ICU. Namun, sel kanker yang telah me-

nyebar ke bagian lain di tubuhnya membuat Endang Rahayu akhirnya wafat, meninggalkan seorang suami, Dr Reanny Mamahit, SpOG, MM, dua putra dan satu putri. Putra pertama bernama Arinanda Wailan Mamahit, putra kedua bernama Awandha Raspati Mamahit, dan anak putri paling kecil bernama Rayinda Raumanen Mamahit. Dikenal Tak Merokok Kanker paru-paru stadium empat yang menjadi penyebab Endang Rahayu Sedyaningsih meninggal dunia sempat menjadi keheranan tersendiri bagi beberapa pihak. Pasalnya, almarhum Endang selama ini diketahui tidak memiliki kebiasaan merokok. “Tidak. Sebabnya kanker itu

memang perokok, pasif dan aktif, kita juga tidak tahu penyebabnya apa, lingkungan keluarga tidak,” ujar Sekjen Kementerian Kesehatan Ratna Rosita di sela-sela pelayatannya di rumah duka, Jalan Pendidikan Raya III Blok J-55 Kompleks IKIP Duren Sawit, Jakarta Timur, Rabu (2/5). Sebagai rekan seangkatan kuliah di Fakultas Kedokteran Universitas Indonesia, Ratna menerangkan, Endang tidak memiliki riwayat penyakit di pernapasannya sejak dahulu. Sementara sejak menjadi pemimpin Kementerian Kesehatan, Endang pun secara rutin melakukan general check up. “Beliau enggak pernah TBC, dari general check up, menteri pejabat eselon satu atau dua tiap tahun general check up,” lanjutnya. (kdc)

Awalnya Mencari Tau Apa Ada Anggota Terlibat Sambungan Halaman 1 Sitorus dan Adria Dwi Afanti, saksi mengaku melakukan penangkapan sekira pukul 22.00 WIB. “Senin (23/1) sekira pukul 21.00 WIB, kami mendapatkan informasi dari masyarakat bahwa akan ada transaksi narkoba di sekitar warung di Jalan H Ulakma Sinaga. Pelaku transaksi sabu tersebut menggunakan tas sandang berwarna hitam,” sebut Fernando. Katanya, tanpa berpikiran panjang dan mendapat persetujuan dari pimpinan, mereka langsung bergerak menuju Jalan H Ulakma Sinaga, Rambung Merah. Sesampainya di sana, kami pun melihat gelagat seorang pria yang mencurigakan di belakang warung sedang duduk dan memakai tas sandang berwarna hitam,” jelasnya. Keduanya menambahkan, setelah diintai sebentar, mereka langsung

mendatangi terdakwa dan mulai menanyakan identitasnya. Saat isi tasnya dibuka, ditemukan empat bungkus besar narkotika diduga sabu-sabu. Kemudian 27 bungkus kecil sabusabu, 1 bungkus ganja, 15 lembar uang Rp50 ribu, bong, timbangan dan plastik bergaris merah dan lainnya. “Setelah kami tanyai, terdakwa mengaku saat itu sedang menunggu pembeli bernama Iwan. Mereka di sana sudah janjian dan rencananya akan melakukan transaksi di lokasi tersebut,” jelasnya. Dia menerangkan, mereka pun langsung membawa terdakwa ke Makorem di Jalan Asahan. Di sana, mereka kembali menanyakan identitas terdakwa dan menanyakan sabu-sabu itu milik siapa. Selanjutnya, Selasa (24/ 1) terdakwa pun diserahkan ke Polres Simalungun. Saat ditanyakan apa tujuan pihak Korem melakukan penangkapan,

sambung Fernando, mereka melakukan itu atas perintah pimpinan. “Kami ingin menindaklanjuti, apakah ada anggota yang terlibat dalam aksi transaksi sabu-sabu tersebut. Itu juga sesuai perintah Danrem. Sehingga mendengar informasi itu kami langsung terjun ke lokasi dan melakukan penangkapan,” terangnya. Usai mendengarkan keterangan saksi, hakim memutuskan menunda persidangan hingga Rabu (9/5). Kepada Jaksa Penuntut Umum (JPU) M Azril diminta untuk menghadirkan kembali saksi dari kepolisian. Sementara itu seperti biasanya, saat turun dari mobil tahanan hingga sebelum persidangan, kedua tangan Asen diborgol. Itu semua dilakukan untuk menghindari agar Asen tidak melarikan diri, seperti yang telah ia lakukan saat ditahan di Unit Narkoba Asrama Polisi (Aspol) Jalan Asahan. (mua)


METRO SIANTAR

KAMIS 3 MEI 2012

Mahasiswi Asal Siantar Tenggak Pembersih Lantai

4 Pria Naik Avanza Rampok Truk Kosong BATUBARA- Empat pria yang menumpang mobil Toyota Avanza, merampok mobil truk tanpa muatan yang dikemudikan Surya (42) warga Serdang Bedagai (Sergai). Perampokan ter-

jadi di Jalinsum MedanRantauprapat, tepatnya di kawasan Pondok Seng, Talawi, Batubara, Rabu (2/5) dini hari.

„) Baca 4 Pria ..Hal 7

MEDAN- Wiwin Zulhafni Perwira (20), mahasiswi Unimed asal Kota Siantar yang kos di Jalan Belat Nomor 82, Medan Tembung, dilarikan ke RSUD Pirngadi Medan. Itu setelah cewek manis ini nekat menenggak pembersih lantai (wipol), karena sakit hati dengan pacarnya pada Rabu (2/5) sekitar pukul 14.30 WIB. „) Baca Mahasiswi ..Hal 7 (Foto Hardono purba)

TERBAKAR- Warga mengemasi barang-barang dari tiga rumah di Silonduyung yang musnah terbakar, Rabu (2/5).

Soal Kuli Bangunan Jatuh darai Lantai II

Foto Rozie

„ Wiwin, mahasiswi asal Kota Siantar yang menenggak pembersih lantai, diboyong ke RSUD Pirngadi

Korban Masih Kritis

Pedagang Lemang Dicakar Adik Ipar SIANTAR- Herawati br Harahap (35) mengaku kesakitan saat adik ipar mencakar wajahnya. Peristiwa terjadi saat penjual lemang ini menjajakan dagangan di pesta adat yang berlangsung di kawasan Perumnas Batu VI, Simalungun, Rabu (2/5) sekira pukul 13.00 WIB. Kepada METRO wanita yang menetap di Jalan Asahan ini mengatakan, Sebelum „ Herawati br Harahap

„) Baca Pedagang ..Hal 7

12 Operator Genset PT Bridgestone Dipolisikan SIMALUNGUNSebanyak 12 operator mesin genset yang bekerja di Perkebunan Brigestone dipolisikan pihak perkebunan. Itu setelah mereka dituding lalai melaksanakan kerja, sehingga satu-satu-

nya genset di perusdahaan itu tidak bisa dipakai lagi. Informasi dihimpun, Rabu (2/5) menyebutkan, kerusakan genset pertama kali diketahui penanggung jawab mesin di PT Brigestone, Mu-

„) Baca 12 Operator ..Hal 7

Foto Pra

„ Satu unit Betor BK 2130 KJ yang bertabrakan dengan Yamaha Mio di depan kantor PLN Siantar, Rabu (2/5).

Kreta Laga Kambing dengan Betor

Tak Punya Uang, Korban Enggan Berobat SIANTAR- Apes dialami Saputra (21). Uang yang pas-pasan di saku digunakannya untuk pangkas rambut. Usai memotong rambut, Yamaha Mio yang dikendarainya malah

„) Baca Tak Punya ..Hal 7

SIANTAR- Hingga Rabu (2/5), Arifin (28), kuli bangunan yang jatuh dari lantai II Perumahan Griya Sitorus Kota Siantar, masih dirawat intensif di ruang ICU RS Tiara. Dari keterangan keluarganya, korban belum juga sadar total. Setelah menjalani operasi pada lengan yang patah, Arifin

„) Baca Korban ..Hal 7

Usaha Perabotan Musnah Terbakar

SILOU KAHEAN- Usaha perabotan milik Darwis di Huta Silonduyung Nagori Silou Panribuan, Silau Kahean, Simalungun, musnah dilalap sijago merah, Selasa (1/5) sekira pu-

kul 18.30 WIB. Tak hanya itu, dua rumah yang sekaligus usaha bahan bangunan di sekitar lokasi ikut terbakar. Tidak ada

„) Baca Usaha ..Hal 7

Tabrak Lima Pengguna Jalan

Supir Nyaris Dibakar Massa MEDAN- Satu unit mobil Honda Stream BK 1113 CP yan g dike mud ikan Sile m (26), warga Jalan Sei Belutu Selayang, dirusak dan nyaris dibakar massa. Itu setelah mobil menabrak lima peng-

guna jalan di Jalan Sunggal Kota Medan, Rabu (2/5) sekira pukul 21.30 WIB. Informasi dihimpun menyebutkan, kecelakaan yang

„) Baca Supir ..Hal 7


KAMIS

3 Mei 2012

Ka UPTD Pendidikan Tak Ikut Upacara Hardiknas (FOTO:FAHMI)

PETIK- Dua pemetik teh perkebunan Sidamanik sedang memanen pucuk daun teh.

Teh Sidamanik Batal Dikonversi

PERDAGANGAN- Camat Bandar mengaku kecewa dengan sikap Kepala UPTD Pendidikan Kecamatan Bandar, Pitaria Situmorang yang tidak hadir pada apel tahunan dalam rangka memperingati Hari Pendidikan Nasional dengan alasan sibuk menandatangani berkas di kantornya. Akibatnya, apel tersebut nyaris gagal.

Camat Bandar, Budiman Silalahi ketika bertemu METRO, Rabu ( 2/5) mengaku dirinya sangat menyesalkan sikap Kepala UPTD Pendidikan Kecamatan Bandar yang terkesan

mengacuhkan peringatan Hardiknas. ”Semua para guru sudah hadir, tetapi entah mengapa kepala UPTD sendiri yang tidak hadir. Padahal acara ini diperingati setahun sekali,”

Baca Teh ...Hal 10

(FOTO: EDI SARAGH)

Donor Darah Wujud Peduli Lingkungan SIANTAR- Donor darah merupakan wujud kepedulian kepada lingkungan pelaksanaannya cukup mudah, tetapi manfaatnya sangat besar bagi yang membutuhkan.

Baca Donor ...Hal 10

Baca Ka UPTD Hal 10

Elkananda Lantik PK KNPI Dolok Silau

SIMALUNGUN- Konversi kebun teh Sidamanik yang direncanakan menjadi perkebunan kelapa sawit batal. Hal itu terungkap setelah pergantian jajaran pimpinan PTPN IV Kebun Sidamanik, yang kini dipimpin Erwin Nasution,

DONOR DARAHKaryawan PT BAF melaksanakan donor darah sebagai wujud nyata peduli lingkungan, Rabu (2/5).

ujarnya, Masih kata Budiman, ketika di sela-sela berlangsungnya acara ini, kepala UPTD ini menu-

( FOTO : LAZUARDY FAHMI )

HORMAT BENDERA : Para pelajar sekolah dasar terlihat antusias saat menghormat Bendera Merah Putih dalam upacara Hari Pendidikan Nasional yang bertempat di Lapangan haji Adam Malik, Rabu (2/5).

Pendidikan Penting Untuk Membangun Peradaban SIMALUNGUN- Kemajuan ilmu pengetahuan dan teknologi menyebabkan mobilitas fisik dan nonfisik semakin tinggi. Kondisi ini pun memunculkan dominasi peradaban tertentu. Dalam kaitan inilah peran

dunia pendidikan penting dalam membangun peradaban bangsa yang didasarkan atas jati diri dan karakter bangsa. Demikian disampaikan Menteri Pendidikan dan Kabudayaan (Men-

dikbud) Republik Indonesia Muhammad Nuh dalam sambutan tertulisnya dengan tema “Bangkitnya Generasi Emas Indonesia”

Baca Pendidikan ...Hal 10

SIMALUNGUN- Ketua Dewan Pengurus Daerah Komite Nasional Pemuda Indonesia (DPD KNPI) Simalungun, Elkananda Shah SE, Sabtu (28/4) melantik Pengurus Kecamatan (PK) KNPI Dolok Silau di Balai Desa Nagori Saran Padang. Dalam arahannya, Elakanda mengharapkan PK KNPI di Kecamatan Dolok Silau menjadi wadah pemuda dan sebagai mitra bagi pemerinElkananda Shah tah, instansi lainnya serta bagi semua pihak, khususnya dalam menyelesaikan berbagai masalah di tengah pemuda. Diingatkan pria yang akrab disapa Nanda ini, KNPI harus berada di garda depan dalam pemberantasan penyakit remaja saat ini, seperti narkoba. Menurut Nanda, KNPI di Dolok Silau harus menjadi asosiasi pemuda yang berwibawa yang senantiasa memberikan kepedulian di tengah masyarakat. KNPI harus menunjukkan diri sebagai pemuda dengan moral yang layak ditiru. “Pemuda Dolok Silau harus peduli terhadap berbagai persoalan di tengahtengah masyarakat. Sikap arogansi pemuda

Baca Elkananda ...Hal 10

Ketersediaan Bahan Baku Ulos Harus Dikawal PARAPAT- Dirjen Industri Kecil dan Menengah (IKM) RI Euis Saedah menegaskan, agar ketersediaan bahan baku tenun ulos tetap dikawal. Bila bahan baku tersebut dikawal, akan bisa menentukan harga di tengah persaingan pasar. Dan diharapkan dari perguruan tinggi tetap mengawasinya. Hal itu disampaikan pada Forum Group Discussion (FGD) Kalster IKM Fashion dan temu usaha IKM tenun ulos yang dilaksanakan di Parapat, Rabu (2/5) yang dihadiri seratusan peserta yang terdiri dari berbagai intansi di Kabupaten Simalungun, Samosir, Tapanuli Utara, Toba Samosir dan Pematangsiantar, serta para nara-

sumber dari Jakarta dan para pengrajin dan penenun ulos. Dirjen IKM menjelaskan, pada tiga tahun mendatang, kebebasan berindustri sudah semakin terbuka. Sehingga keadaan tersebut akan membuka kran terhadap negara-negara luar yang

Baca Ketersediaan Hal 10

(FOTO: JETRO)

FOTO BERSAMA- Dirjen IKM RI Euis Saedah dan rombongan foto bersama dengan sejumlah pimpinan SKPD dari Kabupaten Simalungun, Samosir, Tapanuli, Toba Samosir dan Pematangsiantar, usai menerima cenderamata di Inna Hotel, Parapat, Rabu (2/5)


KAMIS

3 Mei 2012

Elkananda Lantik PK KNPI Dolok Silau

Ka UPTD Pendidikan Tak Ikut Upacara Hardiknas Sambungan Halaman 9

Sambungan Halaman 9 pada masa lalu sudah kita hilangkan. Kita segenap pemuda harus mampu menjadi malaikat penolong bagi masyarakat dan juga bisa menjadi malaikay ‘pencabut nyawa’ bagi oknum-oknum yang tega menyengsarakan rakyat,” sebutnya. Kepengurusan KNPI Simalungun yang dilantik antara lain, Ketua Elias Barus, Sekretaris Viktor Perangin-angin, dan Bendahara Esmy Wati Sipayung yang dilengkapi dengan beberapa wakil-wakil ketua, wakil-wakil sekretaris dan komisi-komisi. Dalam sambutannya, Ketua PK KNPI Dolok Silau Elias Barus menyatakan, KNPI Dolok Silau siap menggali potensi pemuda dan menjadi mitra pemerintah. Menurut Elias, pemuda di Dolok Silau sangat berpotensi untuk diberdayakan dan diikutsertakan dalam membangun Dolok Silau. Untuk ke depannya, para pemuda diharapkan diberi kesempatan untuk berperan serta membangun dan memajukan Dolok Silau. Sementara Camat Dolok Silau Drs Malem Ukur Barus menyatakan siap menjadi mitra bagi KNPI dalam rangka memberdayakan KNPI di Kecamatan Dolok Silau. Dia juga berharap KNPI merangkul organisasi pemuda dan tokoh masyarakat dan mampu memberikan pencerahan bagi pemuda yang belum menunjukkan peranannya sebagai pemuda yang aktif dan kreatif dalam bermasyarakat.(rel/nas)

Donor Darah Wujud Peduli Lingkungan Sambungan Halaman 9 Kepala Administrasi PT Busson Auto Finance (BAF) Cabang Pematangsiantar di Jalan Dr Wahidin Pematangsiantar, Roni Ignatius, Rabu (2/5) di sela-sela kegiatan donor darah yang diikuti karyawanya BAF mengatakan, perusahaan memiliki kewajiban untuk menyalurkan corporate social responsibility (CSR) kepada lingkungan wilayah kerja. Pelaksanaannya dilakukan dalam berbagai bentuk, seperti menanam pohon, pengecatan rumah ibadah serta aksi donor darah yang dilaksanakan secara rutin setiap tahun. “Walau sederhana yang kita lakukan, tetapi kami harap masyarakat dapat terbantu, terutama saudarasaudara yang membutuhkan darah. Diharapkan ke depan, aksi sosial seperti ini dapat ditingkatkan,” kata Roni. Roni menyampaikan, visi BAF adalah memberikan layanan keuangan terbaik untuk meningkatkan kesejahteraan masyarakat. Menjadi mitra jasa keuangan, untuk, bagi dan di dalam masyarakat diwujudkan dengan memberikan pelayanan terbaik kepada masyarakat. “Kesejahteraan masyarakat termasuk dalam visi perusaahaan. Kegiatan sosial ini menunjukkkan kepedulian kepada masyarakat,” katanya. Sementara Kepala UPT Tranfusi Darah Palang Merah Indonesia (PMI) Cabang Siantar-Simalungun Dr Abadi Sinaga mengatakan, karyawan PT BAF berhasil menyumbangkan 23 kantung darah. Sumbangan ini selanjutnya disalurkan kepada masyarakat yang membutuhkan melalui PMI. “Kita mengapresiasi perusahaan yang rutin melakukan aksi donor darah, termasuk PT BAF. Terbukti, kebutuhan darah untuk pasien di rumah sakit di SiantarSimalungun secara perlahan dapat dipenuhi walau belum keseluruhan,” katanya. Dia menjelaskan, ada peningkatan aksi sosial berupa donor darah yang dilakukan oleh masyarakat di SiantarSimalungun, baik secara perorangan maupun secara kelembagaan. Faktor kesadaran serta kepedulian kepada lingkungan serta sesama merupakan unsur yang menyebabkan terjadinya peningkatan jumlah pendonor. Pemahaman tentang pentingnya donor darah bagi kesehatan serta peran darah yang dapat menyelamatkan nyawa sesama, yang disosialisasikan oleh PMI juga ikut mendorong peningkatan aksi donor. “PMI siap memberikan pelayanan donor kepada masyarakat, baik di kantor PMI di Jalan Sutomo samping RSUD dr Djsamen Saragih maupun langsung dijemput ke lokasi pendonor, jika pendonor cukup banyak,” katanya. (esa/ara)

gaskan salah seorang pegawainya untuk memawakili. Namun Camat Bandar ini justru memintanya agar kembali memanggil kepala UPTD tersebut untuk hadir langsung mengikuti apel. “Saya kecewa sekali. Soalnya ketika acara akan berlangsung, dia malah mengirimkan anggotanya untuk menggantikan. Katanya, lagi sibuk meneken surat yang saya sendiri tidak tahu surat apa itu,” katanya.

Padahal, sebelumnya, surat edaran pemberitahuan akan diadakan rapat sudah disebar, termasuk kepada Kepala UPTD Pendidikan Kecamatan Bandar. Namun setelah acara ini diselenggarakan, ternyata kepala UPTD ini justru mengabaikannya. “Saya heran. Sebab sebelumnya pelaksanaan acara ini sudah melalui pemberitahuan. Tetapi kenapa dia tidak hadir. Ini berarti dia tidak mengahargai peringatan Haridinas,” katanya. Dalam acara tersebut turut hadir unsur

Muspika Bandar, termasuk pemuka agama, jajaran lurah dan para dewan guru, yang menggelar apel di pelataran kantor Camat Bandar ini. P Situmorang SPd, salah seorang guru SMA di Kecamatan Bandar juga mengaku kecewa atas sikap kepala UPTD tersebut yang terkesan mengabaikan acara ini. ”Kami sudah lama menunggu hari ini sebab inilah perjuangan hingga menjadi pendidikan yang maju dan modern. Tetapi kepala UPTD ini justru mengabaikannya

dan terkesan sombong,” ujarnya lagi. Dia juga berharap agar Pemkab Simalungun segera memanggil kepala UPTD ini dan memberikan teguran agar sikapnya terserbut. Terpisah, Kepala UPTD Pendidikan Kecamatan Bandar Pitaria Situmorang yang hendak dikonfirmasi tidak bersedia ditemui. Satpam yang bertugas di kediamannya mengatakan bahwa beliau sedang beristirahat dan tidak bisa diganggu. ”Ibu lagi istirahat dan tidak bisa diganggu,” katanya singkat. (mag-02/ara)

Pendidikan Penting Untuk Membangun Peradaban

TehSidamanikBatalDikonversi

Sambungan Halaman 9

Sambungan Halaman 9

yang dibacakan Plt Sekda Drs Gidion Purba saat bertindak sebagai pembina upacara pada Hari Pendidikan Nasional (Hardiknas) Kabupaten Simalungunyangdipusatkandihalamaneks kantor Bupati Simalungun, Pamatang Raya, Rabu (2/5). “Kita harus bersyukur bahwa pada tahun 2010 sampai 2035, bangsa kita dikaruniaolehTuhanYangMahaKuasa potensi Sumber Daya Manusia (SDM) berupa populasi usia produktif yang jumlahnya besar. Jika kesempatan emas yang baru pertama kalinya sejak Indonesia merdeka dapat kita kelola dan memanfaatkannya dengan baik, populasi yang jumlahnya besar tersebut akan menjadi bonus demografi (demographic dividend) yang sangat berharga”, kata Mendikbud dalam sambutan tertulisnya. Dia melanjutkan, periode 2010 sampai 2035 kita harus melakukan investasi besar-besaran dalam bidang pengembangan SDM sebagai upaya menyiapkan generasi 2045, yaitu saat 100 tahun Indonesia merdeka. Karenanya, kita harus menyiapkan generasi akses seluas-luasnya kepada anak bangsa untuk memasuki dunia pendidikan, mulai dari Pendidikan Anak Usia Dini (PAUD) sampai ke perguruan tinggi. Untuk mempersiapkan generasi emas tersebut, telah disiapkan kebijakan yang sistematis yang memungkinkan terjadinya mobilitas vertikal secara masif. Untuk itu, mulai tahun 2011 yang lalu telah dilakukan gerakan PAUD, penuntasan dan peningkatan kualitas pendidikan dasar, menyiapkan Pendidikan Menengah Universal (PMU) yang akan dimulai pada 2013. Di samping itu, perluasan akses ke perguruantinggijugadisiapkanmelalui pendirian Perguruan Tinggi Negeri (PTN) di daerah perbatasan dan memberikan akses secara khusus kepada masyarakatyangmemilikiketerbatasan ekonomi, tetapi berkemampuan baik.

(FOTO: LAZUARDY FAHMI)

MARCHING BAND- Aktraksi marching band SMAN 4 dalam acara Hardiknas, Rabu (2/5). Hardiknas tahun 2012 di Kabupaten Simalungun ditandai dengan upacara pengibaran Bendera Merah Putih yang diiringi lagu Indonesia Raya, hening cipta dan pembacaan teks Pancasila, Pembukaan UUD 1945. Bertindak sebagai pemimpin upacara Kadis Pendidikan Resman H Saragih SSos. Upacara tersebut diikuti siswa-siswi SLTA, SLTP, SD, Pramuka, mahasiswa, OKP, Satpol PP dan PNS di jajaran Pemkab Simalungun. Tampak hadir dalam upacaratersebutBupatiSimalungunJR Saragih Saragih, Ketua DPRD Binton Tindaon, Wakil Bupati Hj Nuriaty Damanik, mewakili Kapolres Simalungun Kompol Amri S, mewakil Kajari Bilin Sinaga, mewakil Ketua PN Ramses Pasaribu, rombongan DPRD Aceh Singkil yang melakukan kunjungan kerja di Kabupaten Simalungun, KNPI danparapejabatdilingkunganPemkab Simalungun. Di kesempatan tersebut, Bupati Simalungundidampingiunsurpimpinan daerah, Ketua DPRD dan wakil bupati sertaPltSekdamenandatanganiprasasti

penggunaan ruang kelas baru SDN 091317 Pamatang Raya, SMPN 1 Raya dan SMAN1 Raya. Dilanjutkan dengan penyerahan beasiswa kepada putraputri tenaga kerja peserta jamsostek Pematangsiantar yang berprestasi. UntuksiswaSD10orang,SLTP8orang,SLTA 7 orang dan mahasiswa 5 orang. Selanjutnya, pemberian piagam penghargaan kepada siswa-siswi SLTA yang meraih juara I-III lomba Olimpiade Sains Nasional (OSN) tahun 2012 dengan mata pelajaran matematika, fisika, kimia, biologi, komputer, astronomi, ekonomi dan kebumian. Pelaksanaan Hardiknas ini juga dimeriahkan penampilan tarian Simalungun yang dibawakan PAUD KasihIbuKecamatanTapianDolokdan PAUD TK Negeri Pembina Raya serta siswi SMPN 2 Raya. 20 Siswa Terima Beasiswa Sebanyak 20 siswa SD hingga SMA serta mahasiswa perguruan tinggi di Kota Siantar menerima beasiswa selama 12 bulan dari PT Jamsostek Pematangsiantar. Pemberian beasiswa dalam rangka peringatan Hardiknas yang dilaksanakan di Lapangan Adam Malik, Rabu (2/5). Pemberian beasiswa diberikan Walikota Siantar Hulman Sitorus didampingi unsur Muspida Kota Siantar. Penerimabeasiswaantaralain,10siswa SD, 2 siswa SMP, 8 siswa SMA dan 1 mahasiswa. Beasiswa diberikan dalam bentuktabunganBankSumut.Besaran bantuan setiap bulan Rp150 ribu untuk siswa SD hingga SMP serta Rp200 ribu untuk siswa SMA dan mahasiswa perguruan tinggi. PeringatanHariPendidikanNasional di Lapangan Adam Malik juga diisi penampilan marching band SDN 122349 Jalan Bola Kaki, marching band SMP Muhammadiyah, SMA Sultan Agung dan SMAN 4. Usai upacara di Lapangan Adam Malik, kegiatan peringatan Hardiknas dilanjutkan dengan ziarah ke Taman Makam Pahlawan (TMP) Nagur. (osi/ ara/ral)

Ahmad Aslan Saragih sebagai direktur produksi dan Andi Wibisono sebagai direktur umum. PutraSembiring,salahseorangwargaSidamanikmengatakan, sejak pergantian jajaran pimpinan baru, konversi teh Sidamanik dibatalkan. Pembatalan itu juga dikuatkan oleh pernyataan Menteri BUMN Dahlan Iskan di sejumlah media massa. “Informasi pembatalan konversi itu sudah menyebar di masyarakat Sidamanik. Buktinya, tidak ada lagi aktifitas penanaman sawit di lahan perkebunanitu,” ujar Putra, Rabu (2/5). Senada diungkapkan Ketua DPC Angkatan Muda Indonesia Bersatu (AMIB) Kabupaten Simalungun Oloan Piktor Sipayung SE. Katanya, sejak adanya berita pembatalan itu, dia langsung melakukan investigasi ke Perkebunan Sidamanik. Menurut Piktor, kebijakan tersebut merupakan akumulasi dari saran dan kritik yang telah dilakukan AMIB Simalungun kepada pihak pemerintah daerah dan pusat serta kepada PTPN IV sejak 2011. “Menolak konversi adalah kebijakan yang sangat arif bagi pembangunan di Simalungun,” ujar Piktor. Untuk itu, dia mengharapkan agar semua pihak dapat menerimakebijakandenganelegan.Katanya,AMIBSimalungun sebelumnya telah melakukan investigasi secara faktual terhadap dampak yang ditimbulkan oleh kebijakan konversi tanaman teh menjadi kelapa sawit di Kebun Sidamanik, Bah Butong dan Tobasari. AMIB Simalungun memberikan masukan secara elegandenganmenginformasikanmelaluimediadansuratresmi sehingga pihak mengambil keputusan dapat mengevaluasi dan memberikan solusi yang optimal untuk kesejahteraan masyarakat. Lebih lanjut Piktor mengatakan, ke depannya, pihak PTPN IV juga dsiharapkan dapat mengakomodir dan mengoptimalisasi pelaksanaan corporate social responsibility (CSR) di Kabupaten Simalungun secara profesional. Karena dari sisi wilayah, lokasi kebun PTPN IV lebih besar di Kabupaten Simalungun. Karenanya, dia mengharapkan agar pihak PTPN IV memperhatikan potensi local, baik pemberdayaan SDM dan alokasi pembangunan melalui CSR. “Jika kebijakan PTPN IV dapat berjalan dengan prinsip winwinsolution,AMIBsangatmengapresiasidanmendukungPTPN IV dalam melakukan usaha dengan konsep profit dan sosial untuk mensejahterahkan masyarakat. Untuk itu, mari bekerjasama membangun dengan memperhatikan dan kelengkapan secara global,” ajaknya. Sementara, DR Robert Tua Siregr Msi, yang merupakan ahli perencanaan wilayah mengatakan, kebijakan itu sangat memberikan pencerahan bagi kelanjutan pembangunan di Simalungun. Sebab konsep pembangunan yang berkelanjutan harus dapat melakukan Nature Balanced antara sumber daya alam dan manusia. (osi/ara)

Ketersediaan Bahan Baku Ulos Harus Dikawal Sambungan Halaman 9 lebih pintar, seperti Malaysia dan negara tetangga lainnya untuk mengembangkan industrinya di Indonesia. Jika kondisi ini tidak disikapi dengan jeli, para pengusaha maupun pengrajin dan penenun ulos di Indonesia akan tergilas sendiri dan menjadi penonton di rumahnya sendiri. SementaraIrRamonBangunMBAdariDirjen BasisIndustriManufaktursangatmenyesalkan kurangnya ketersediaan bahan baku di Indonesia. Sebab berdasarkan analisis datanya, bahanbakuyangasalnyadariIndonesiasendiri lebihbanyakdieksportkeluarNegara.Sehingga

kestabilan terhadap ketersediaan bahan baku akan berdampak kepada sejumlah pengrajin dan penenun ulos maupun pengusahanya. Pada sisi lain Ramon Bangun juga mengungkapkan keprihatinannya terhadap pengrajin dan penenun ulos di Indonesia, di mana hasil yang dirasakan tidak sesuai dengan jerih payah dari para pekerjanya, seperti penelitian yang pernah dilakukannya di Samosir. Seorang pekerja di sana hanya bisa menghasilkan keuntungansebesarRp80ribuyangdikerjakan selama 4 hari. Berarti, pendapatannya dalam satu hari hanya Rp20 ribu saja. Dia pun berharap kepada para pengrajin maupun penenun ulos yang tak terlepas dari

pengusahanya agar dapat memikirkan pembuatan satu kerajinan industri seperti di salah satu negara luar yang mampu menciptakan satu kerajinan dengan mutu yang bagus dan dijual seharga Rp6 juta. “Dengan begitu, hasil jerihpayahsipekerjadapatdinikmatibeberapa minggu dan bahkan menutupi kebutuhan untuk satu bulan,” ujarnya. Padasesiberikutnya,salahseorangpengembang pengrajin tenun ulos di Jakarta, Marta Sirait br Napitupulu menyampaikan akan pentingnya tenun ulos sebagai hasil industri untuk dikembangkan dan dapat didesain sejajar dengan tuntutan kebutuhan di pasar. “Untuk pengembangan industri sangat diper-

lukankerjasamadenganoranglain.Danpelaku pengrajin orang Batak dituntut agar dapat merendahkan diri. Bagaimanalah untuk merangkul demi kemajuan usaha,” ujarnya. Dalam kesempatan itu, Marta mengungkapkan bahwa pengrajin maupun penenun ulos di Sumatera sudah jauh ketinggalan dengan Pulau Jawa. Untuk itu perlu meningkatkandesainterhadapindustrimandarBalige, membuat busana kantor, busana pesta, baju pakaian sekolah, taplak meja, sarung bantal, dompet, keramik bercorak gorga, hiasan dinding dari hasil industri pengrajin maupun tenunan ulos. “Mau melayani luar, harus mau melayanididalamdulu,”imbuhnya.(rait/ara)


KAMIS

3 Mei 2012

Dikira Mayat Dalam Mobil

Diserbu Polisi

POZNAN-Seorang tukang bangunan Polandia yang sedang tidur terbangun dari tidurnya setelah diserbu polisi. Pria itu disangka mayat oleh pihak kepolisian.

KEJADIAN ini dialami Bartek Bablewski yang tengah istirahat di dalam mobil dari lokasi sebuah kontruksi di Poznan. tidur tanpa mengenakan baju, sepertinya, membuat warga yang melihatnya merasa ketakutan. “Saya biasa tidur saat waktu istirahat. Pekerja bangunan adalah sulit,” ujar Bablewski, Rabu (2/5/2012). “Saya tidur tanpa mengenakan baju karena cuaca memang panas dan saya selalu tidur dengan lengan menyilang di dada. Beberapa saat kemudian, polisi dan petugas medis mencoba membuka pintu mobil saya dengan paksa. Itu membuat saya takut,” imbuhnya. Polisi kemudian meminta maaf kepada pria berusia 36 tahun tersebut. Mereka mengaku mendapatkan laporan dari warga mengenai adanya mayat di sebuah mobil.”Saat kami (polisi) melihatnya bergerak, kami juga ketakutan,” keterangan pihak polisi. (oz)

(Foto: Int)

TIDUR: Bartek Bablewski tidur di mobilnya

„ VW Golf buatan tahun 1990

Mobil Kanselir Jerman

LAKU Rp121 Juta

BERLIN-Mobil Volkswagen Kanselir Jerman Angela Merkel laku terjual di situs lelang online senilai 10.165 euro atau sekitar Rp 121 juta. VW Golf buatan tahun 1990 itu berpindah tangan kepada penawar tertinggi, Dirk Fricke. Fricke membeli VW tersebut untuk perusahaannya, Frisch-Linch. Dia merasa senang mendapatkan VW itu walaupun dia bukan penggemar Merkel. ”Secara politis, kami ini netral,” ujarnya. ”Saya menawar hanya karena ingin mobil tersebut tetap berada di Jerman. Mobil seperti ini sebaiknya tidak keluar dari Jerman, seperti yang terjadi pada mobil Paus beberapa tahun yang lalu,” katanya. Pada lelang serupa tahun 2005, seorang penawar dari Amerika Serikat menawar 250.000 dollar AS atau Rp 2,2 miliar untuk mobil VW Golf yang tadinya dimiliki Kardinal Joseph Ratzinger, yang kemudian menjadi Paus Benediktus XVI. (kps)

Miliki Tato “Tuhan” Perempuan AS Ditangkap OHIO - Seorang perempuan yang memiliki tato bertuliskan “God” atau Tuhan dalam bahasa Indonesia ditangkap oleh pihak kepolisian. Perempuan itu diketahui menguntit petugas penjara perempuan. Jamie Calloway yang memiliki tato unik di dahinya itu dituduh menguntit petugas penjara perempuan yang disukainya. Rasa

suka yang dipendam Calloway sepertinya sudah tumbuh selama dirinya berada di Penjara Montgomery, Maryland, Amerika Serikat (AS). Perempuan berusia 33 tahun itu diketahui kerap mengirim sipir itu dengan berbagai macam hadiah. Tetapi, dia juga dituduh menusuk ban mobil dari sipir itu, Rabu (2/5). Polisi dengan mudah

mengidentifikasinya, karena tato yang ada di dahinya, termasuk juga beberapa gigi besi yang digunakannnya. Kini dirinya terpaksa mendekam di penjara atas ulah yang dilakukannya. Calloway merupakan satu pelaku kejahatan yang ditangkap polisi AS, karena tato yang dimilikinya. Lewat tato itu, polisi dengan mudah melakukan identifikasi.(oz)

CAPELLA PEMATANGSIANTAR YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 / bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari MAHAGA SEJAHTERA: membuYAYASAN

• All New Xenia Ready stok • Terios Ready stok • Luxio Dp 15% (hadiah menarik) • Sirion Dp 15 % • Pick up Dp 15 % • Mini Bus Dp 15 % hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Proses cepat data dijemput. Menyediakan TEST DRIVE!!

CASH & CREDIT: Rumah tipe 36/42/45. Atap Multi roof, atap rangka baja ringan, dinding batu bata, gibsun, relief keramik. RUKO LANTAI 1 : Pondasi untuk 2 lantai atap cor, dinding batubata, dilokasi sedang dibangun Martoba Water park. PERUMAHAN BERSATU MAJU : Lokasi jl. Pdt. Wismar Saragih P. Siantar.Telp. 081370261747-085296029651-081361161011081362303662.

tuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515SEGERA: 1742 DIBUTUHKAN Tenaga kerja wanita usia 17-40 Tahun dengan posisi sbb:Baby Sister,Perawat jompo/Pribadi,PRT,syarat fc.ijazah, KTP, KK, gaji bersih 700rb s.d 1.500rb/ bulan + bonus + THR, makan, asrama, dijemput loket,gratis.hub YYS Marel Mandiri.JL.Cengkeh Raya No 18.C Medan HP 0813 6199 9211: 0878 6968 7879.

BARU SUZUKI ERTIGA Suzuki Ertiga, 7 Penumpang (3 baris) 1400cc DP 10% atau bunga 3,220% mulai Rp. 150Jt-an Ready Stock : carry Pick Up Dp. Rp. 13Jt Angs Rp. 2Jt-an APV Pick up Dp. Rp. 18Jt Angs Rp. 2Jt-an APV Arena Dp. Rp. 17Jt Angs Rp. 3Jt-an Hub: PT. Trans Sumatera Agung, Ricky HP 0812 6570 683 Ikuti Test Drive Berhadiah Suzuki Ertiga NEW NISSAN: Grand Livina, Nissan Juke, Nissan X-Trail, Navara, Murano. Ready Stock. Cash/Credit Hub. Wandi 0813 61400 0058, 061-7770TOYOTA 9408 SIANTAR

PR OMO TOYOTA B AR U PROMO BAR ARU

· All New Avanza ..Ready Stock ! Bonus Lengkap ! · All New Avanza VELOZ ... Bonus Lengkap !! · YARIS...Ready Stok,Diskon besar, Buruan !! · New Rush ..... Ready Stok !! · Grand New Innova .... Ready Stock !! · Grand New Fortuner ... Ready Stock !! · Hilux S-Cab/D-Cab .... Bensin/Diesel !! HUB. HUB. RICKY. M - 0853 7199 9499- 0812 6505 3191 SALES EXECUTIVE TOYOTA SIANTAR. Data dijemput, Cash/Credit PROSES CEPAT..!! DIJAUL: 1 unit mobil Suzuki Escudo Nomade, warna hitam coklat, tahun 1997, harga 90 jt (nego) tanpa perantara, yang berminat hub. HP 0852 7563 8768 Y br Saragih

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 150 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan. Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 DIJUAL TOYOTA KIJANG PICK UP: tahun thn + 1.6 jt per bulan, selama 15 thn + 1.3 90. hub. HP 0853 7078 6233 jt per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 SUZUKI BARU Carry Pick Up Dp. 15Jt angs 2Jtan 76122445; 08126207631; (0622) Ertiga Dp. 30Jt angs 4Jtan 7070442. APV Arena Dp. 26Jt angs 4Jtan CASH & CREDIT: Menyediakan rumah Hub: Rio Sirait, 0812 6315 9559 dan tanah kavling sesuai tipe dengan TOYOTA BARU 2012: Dapatkan New Toyota dengan Bunga Kredit 3,85%. Proses cepat & yang anda inginkan dan stok yang bisa tukar tambah & dapatkan hadiah khusus di tersedia. Hub: Alboin Sidabalok di No.Telp. bulan ini. Hub: PREDY SIMATUPANG, 0813 0813 76122445; 08126207631; (0622) 6165 1801 - 0853 6207 2000 7070442 P. Siantar

• All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya

ABADI MOTOR PROMO AKHIR BULAN: •Mio sporty 2007 (putih) •Mio sporty 2010 (hijau) • Mio sporty 2011 (hitam, merah, hijau dan putih) •Vega R new 2008 •Vega ZR 2011 (putih, biru dan hitam) •Jupiter Z new 2011 new 2011 CW (merah, hitam) •Shogon RR 2008 •Spin 2008 •Spin 2010 •Revo Absolute 2009 •Revo 2008 •Vario CW 2008 •Jupiter MX 2009

DAIHATSU PAKET MURAH 100%

CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 tahun + Rp 16 jt per bulan selama 15 tahun + Rp 1,3 jt per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

DP Angsuran • Xenia 12.750.000 3.125.000 • Terios 15.000.000 4.090.000 • Luxio 19.100.000 3.961.000 • Pick up 9.000.000 2.432.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0878 9228 2993. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio

CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Rp 100 jt, DP 20 jt, angsuran selama 10 thn + Rp 1 jt per bulan, selama 15 thn + 800 rb per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 DIKONTRAKKAN: Rumah 1 pintu, permanen, uk 4,5 x 9 M, 1 kamar tidur, ruang tamu, dapur, kamar mandi WC di dalam air PAM listrik Jl. Dahlia 27 / Bel P. Siantar. hub. AFIF HP 0813 6235 6727 CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Rp 175 jt, DP 40 jt, angsuran selama 10 thn + Rp 2 jt per bulan, selama 15 thn + 1,6 jt per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Rp 150 jt, DP 30 Jt, angsuran selama 10 thn + 1,7 juta per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

„ Kanselir Jerman Angela Merkel.

CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Rp 200 jt, DP 50 jt, angsuran selama 10 thn + Rp 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan, Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah tipe 42 Luas tanah 9x12 m, atap baja ringan dinding batu-bata, gimsum, relief lantai keramik, PLN., PDAM SHM, IMB dan KPR. PERUMAHAN SETIA NEGARA BARU : lOKASI JL. Pengintai Komp. setia negara IV Telp. 081370261747- 08529602965, 081361161011- 081362303662. CASH & CREDIT: 10 x 21,8 m Rp 76 jt, 20 x 22 m Rp 154 jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Rp 95 jt, Dp 20 jt, angsuran selama 10 tahun + Rp 950 rb per bulan, selama 15 tahun + Rp 752 rb per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 47 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar. CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Rp 200 jt, Dp Rp 50 jt, angsuran selama 10 thn + 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan. Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: 1.908 M2 Rp 300 jt, cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT : Rumah tipe 36, tipe 42, Atap Multi roof, dinding batu bata , gimsum, relief lantai keramik. RUKO TIPE 40: Pondasi untuk 2 lantai, atap cor, dinding batu -bata, relief pintu besi , PLN, PDAM, SHM, IMB, dan KPR. PERUMAHAN BATU PERMATA RAYA : Lokasi Jl. Batu permata raya ujung-kelurahan bah kapu.Telp. 081370261747-085296029651081361161011-081362303662 CASH & CREDIT : Rumah tipe 36, 42. atap Multi roof, rangka atap baja ringan, dinding batubata, gimsum, relief lantai keramik. RUKO TIPE 40 : Pondasi untuk 2 lantai, atap cor, dinding batu-bata, relief pintu besi, PLN, PDAM, SHM, IMB, KPR. PERUMAHAN HERAWATI INDAH : Lokasi Jl. Viyata Yudha ujung,kelurahan Bah Kapul.(tojai baru) Telp. 081370261747085296029651-0813611611011-081362303662.

PIJAT DAN LULURAN “MBAK SARI”: Jika Anda Capek, Pegal, Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan Badan, Urut Bayi, Terkilir serta Luluran. Hub: kami di Jl. Usgara No. 1 (Masuk dari Jl. Bali samp. SMK Negeri) P. Siantar HP. 0812 635 5430 PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852.7600 0031; 0813.9688 9800. PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar Hp. 0813 7658 8917

CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

PIJAT DAN LULURAN “IBU SUM” Jika anda capek, pegal linu, lesuh, lelah kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran hub kami di Jl. flores No. 07 P. Siantar HP 0812 6526 0864; 0813 754 74647

CASH & CREDIT: 5 x 20 m Rp 17 jt, 10 x 20 m Rp 34 jt, 15 x 20 m Rp 51 jt, 20 x 20 m Rp 68 jt. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

MENYEDIAKAN ANEKA HEWAN PELIHARAAN: Burung hias/konsumsi, pheasant, bebek hias, reptile, kura-kura (import & lokal), hamster, landak mini, merpati, ayam, perkutut, anjing, kodok hias, kelinci, cicak, jangkrik, ulat Hongkong/Jerman, kroto, aksesories, pakan, kandang dll. hub. 0878 6849 0858 Medan

DIJUAL: Tanah, sertifikat, luas tanah 825 M2, lokasi Jl. SM Raja Kel. Bah Kapul Kec. Siantar Sitalasari Kota P. Siantar hub. HP 0812 9892 163 DIJUAL TANAH: Tanah ukuran 8x23,m (SHM) dan Rumah/bangunan 7 x 15 M. Kamar Tidur 3,Kamar Mandi 2, Keramik,Gipsun. Harga 275 Juta /NegoLokasi Jl. Lau Cimba Ujung. Pematangsiantar. HP 0813 7043 4885 / 0813 7031 6990 (TP) CASH & CREDIT TANAH: 5 x 25 m Rp 25 jt, 5 x 20 m Rp 20 jt, cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” BUTUH DANA CEPAT: • SERTIPIKAT • BPKB Hub: KAMI PT BPR EKA PRASETYA Jl. SM Raja no 202. P. Siantar (depan parluasan) Telp. 0622 - 430780; HP 0852 7657 8625 HARI INI INVESTASI: Mulai besok dapat profit 7% Rp. 6.300.000 setiap harinya non stop selama 200 hari (Tanpa Rekrut) Minat???? SMS "Petunjuk" ke HP 0877 8847 7900

DIJUAL: Tanah 2 kavling ukuran 22 x 23 M2, SHM, harga nego, lokasi Komp. Bah Kapul Indah Kel. Sitalasari Siantar. hub. HP 08116051 166 (TP) DIJUAL: Rumah ukuran 4,5 x 27 M di Jl. Sudirman No. 56, Harga nego. hub. 0622 25694; 0813 9630 0319

TERCECER: BPKB dan STNK asli, merk kereta Jetwin dengan nopol BK 2429 MV, tercecer di Blok 12 Batu III Desa Nagori Bosar Kec. Panei, pada tanggal 30 April 2012, jam 16.00 WIB. Bagi yang menemukan hub. HP 0821 6262 4364; 0812 6568 3083 An. Nurul

PIJAT DAN LULURAN “IBU Restu” jika anda capek, pegal linu, lesuh, lelah kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran. Jl. Simpang Viyata Yudha Komp. kelapa-2 dekat sekolah RK Katolik Asisi P. Siantar HP 0821 6681 7943; 0813 9635 4127

HOTLINE Telp. 0622 - 7553511


IKLAN INFO

KAMIS 3 Mei 2012

12

METRO SIANTAR

TERCECER Telah tercecer dompet warna hitam yang berisikan SIM A dan SIM C An. Rado Dearma Saragih, STNK nopol BK 1182 DU, STNK nopol BK 1537 TD, KTP An. Rado Dearma Saragih, ATM BCA, ATM Mandiri, ATM BRI. Tercecer di sekitar Jl. Kartini bawah dekat Telkom pada tanggal 23 April 2012, pada pukul 17.00 WIB. Bagi yang menemukan hubungi : HP. 0852 6220 7171; 0812 6202 860 Tidak dituntut tapi diberikan imbalan yang sepastasnya.

30

TERCECER

Sebuah BPKB Kijang 2003 An. Ali Zainal Abidin nomor polisi B 1004 TVC dan nomor BPKB C4953351G. Tercecer antara Tiga Balata - Pematangsiantar. Bagi yang menemukan hub: HP 0813 8397 0368 Tidak dituntut tapi diberikan imbalan yang sepantasnya


KAMIS

3 Mei 2012

Julia Perez mulai menekuni bisnis barunya di bidang batu bara. Baru tiga bulan, Jupe langsung mengeruk untung besar. Ia mendapat hadiah dari rekanan bisnisnya, H Tommy Cangkung. Jupe dihadiahi sebuah mobil mewah BMW Z3 dua pintu seharga satu miliar rupiah. “Baru tiga bulan aku bisnis sudah dikasih bonus BMW dua pintu pula. Rencananya hari ini sampai di Jakarta, soalnya semalam sudah di Lamongan. Masih enggak sangka. Gue beruntung banget. Mobil Alphard gue saja nyicil. Itu mobil sampai Rp1 miliar,” tutur Jupe di kawasan Kebon Jeruk, Jakarta Barat, Rabu (2/4) siang. Jika mobil mewah sudah sampai di kediamannya, Jupe mengaku langsung akan memakai jalan-jalan ke tempat syuting. Jupe akan memesan plat

Olla R amlan Ramlan

Tak Suka Banyak Bulu Olla Ramlan termasuk artis yang sangat peduli dengan penampilan dan kebersihan. Olla bahkan mengaku rajin ‘mengusir’ bulu-bulu halus di sekitar tubuhnya. ”Menurut saya sih yang berkumis harusnya cowok. Bulu-bulu tipis saya sih di wax,” ujar Olla di kawasan Kebon Jeruk, Jakarta Barat, Rabu (2/5) siang. Bila diperhatikan, Olla Ramlan juga memiliki bulu halus yang menyerupai kumis tipis di bawah hidungnya. Meski tak terlalu suka banyak bulu, Olla tak mau mempermasalahkan yang satu itu karena dianggap tak terlalu mengganggu. “Kalau saya sih walaupun enggak berkumis banget, tapi ada kumiskumis tipis. Masalah dihilangkan atau enggak, itu selera,” tukas kekasih pengusaha Muhammad Aufar itu. ”Saya memang enggak suka dengan yang terlalu banyak bulu, harusnya perempuan itu di waxing, tapi balik lagi soal selera,” katanya malu-malu. Apakah Olla rajin waxing lantaran ingin menikah? “Orang masih lama kok, enggak ada persiapan apa-apa, keluarga juga belum ketemu,” jawab Olla sambil masuk ke dalam mobilnya. (nov/int)

Artis cantik Krisdayanti membantah kalau rumah tangganya sedang bermasalah dengan sang suami, Raul Lemos. Bahkan, adik kandung artis Yuni Shara itu mengaku jika dirinya kerap tampil bersama dengan Raul. “Aku sudah membantah gosip itu dan ini salah satu bukti kebersamaan kami. Dia rutin mengantar saya ke dokter untuk konsultasi tentang bentuk tubuh. Dia juga yang selalu mendorong saya agar bisa mendapatkan kembali bentuk tubuh ideal dan montok,” ujar Krisdayanti saat jumpa pers Laser Lipolysis Nibelth Klinik, di Excelso Cafe, Cilandak, Jakarta Selatan. Sebagai diva, KD menjelaskan

bahwa kini dirinya sedang berkonsentrasi mengurusi keluarga barunya dengan bayi yang baru berusia enam bulan. Sedangkan kabar dua anak hasil perkawinannya dengan Anang Hermansyah, dia katakan baik, meski mereka lebih banyak bersama Anang dan calon ibu barunya. Bicara tentang Aurel putri sulungnya, KD ingat dulu saat remaja itu masih kecil, dia tidak sempat ikut mendaftarkan sekolah saking sibuknya. “Allah memberikan saya kesempatan kedua punya anak lagi. Jadi, saya tidak mau kehilangan moment itu. Saya nanti ingin mendaftarkan Amora sekolah dan mengantarnya belajar setiap hari,” pungkas KD. (kpl/int)

nomor khusus untuk mobil barunya. “Saya mau pakai jalan-jalan, mau dibuka sun roofnya. Kayak orang kampung gue. Saya lagi bahagia dikasih mobil baru BMW Z3. Plat nomornya juga pesan B 7 UPE. Soalnya kan masih plat nomor Kalimantan,” bebernya. Setelah memiliki rumah mewah, mobil Alphard dan sebuah BMW, Jupe merasa belum puas. Jika bisnisnya kian sukses, Jupe akan membeli sebuah helikopter agar ia tak lagi kena macet. “Kalau sukses di batubara saya mau beli helikopter biar enggak kena macet. Terserah deh orang mau ngomong apa, Jupe lagi senang. Kan kalau Jupe itu dapat motor pasti dibilang jelek, hasil guna-guna atau ngepet lah, terserah, pokoknya gue lagi senang,” katanya sambil tertawa. (nov/int)

Chelsea Olivia

Dilarang Kurus Oleh Pacar Berat badan tampaknya menjadi hal yang paling dijaga pesinetron Chelsea Olivia. Sebab, ia sangat dilarang kurus oleh sang kekasih, Glenn Alinskie. Menurut Chelsea, kekasihnya itu tak menyukai perempuan yang kurus. Glenn pun akan terlihat sebal saat berat badan Chelsea turun drastis. ”Glenn nggak suka cewek kurus. Dia paling sebal kalau aku bilang aku kurusan,” ungkapnya saat ditemui di Buaya Show, Indosiar, Jakarta Barat, Rabu (2/ 5). ”Dia selektif banget. Aku pernah naik 5 Kg, dari situ Glenn bilang aku gemukan,” lanjutnya. Tak hanya soal berat badan, Glenn juga punya larangan untuk Chelsea dalam hal berpakaian. Menurutnya, Glenn tak suka jalan bareng saat dirinya mengenakan gaun motif bunga-bunga. ”Bagi Glenn itu kuno, menurut dia polkadot dan bunga-bunga itu kolot,” tuturnya. Sudah cukup lama memang keduanya menjalin asmara. Namun, kata-kata pujian jarang mereka ungkapkan satu sama lain. Kok? ”Kita bukan pasangan yang suka memuji, apa yang dikeluarkan jujur dan nggak berlebihan,” tutur Chelsea. (dtc/int)


KAMIS 3 Mei 2012

KOMUNITAS FB XPRESI METRO SIANTAR Teman-teman Xpresi, negara manakah yang ingin kalian kunjungi? Dan, apa alasannya? Nb: kalau yang bikin status ingin ke Jepang... Lihat bunga sakura bermekaran plus pengarang manga Detektif Conan Duh, kok jadi curhat ya? Hmmm :) Andika Sang Penghibur Pengen ke Amerika Serikat, Ketemu ama bapak presiden nya BARACK OBAMA.

Ingin merasakan pengalaman summer course di salah satu perguruan tinggi di Belanda dan bertemu dengan temanteman dari mancanegara? Nuffic Neso Indonesia kembali membuka kesempatan tersebut melalui K ompetiblog Studi di Kompetiblog Belanda 2012.

Irwan Zebua Kalo gue sih pengen israel... melihat tmpat kelahiran Yesus n ngeliat kcanggihan teknologi mereka..

Yusak MrYuss Sigalingging Aku pengen ke belanda karena kagum dengan kincir anginnya dan bendungan kotanya.

Kompetiblog Studi di Belanda merupakan kompetisi menulis blog yang diadakan oleh Nuffic Neso Indonesia. Tahun ini, kegiatan rutin tersebut memasuki tahun keempat penyelenggaraannya. “Tahun ini diharapkan bisa menarik minat lebih banyak penulis untuk ikut serta. Tulisan bisa memuat pengetahuan, pendapat, serta pengalaman individu sesuai tema yang ditetapkan oleh panitia,” kata Mervin Bakker, Direktur Nuffic Neso I. Ia mengatakan, cara mengikuti kompetisi ini tidak sulit. Peserta cukup menulis maksimal 500 kata sesuai ketentuan syarat yang diberlakukan. Dua orang pemenang utama kompetisi ini akan berkesempatan mengikuti summer course di Utrecht Summer School, Utrecht, Belanda, selama dua minggu. Panitia juga memberikan hadiah hiburan berupa smartphone untuk pemenang kedua dan

Michael Tambunan Pagaraji Pengen ke Brazil , mw lihat ulaR coBra anD ikan piranha . Sekalian lihaT sungai amazon

Nurika Hayati Aqu mw k Pranciss.. dbwah menara eiffel qu tulis nama Qu n my honey...

Beasten Stack Ethiopia : Pengen melihat sebenarnya negara ini yang mayoritas penduduknya dilanda kelaparan terus menerus dan selalu dilanda konflik

Agustin Putri Mahardika Tampubolon Aku pengen ke inggris, soalnya aku mw ktmu pangeran william trus aq mau ktemu pemain sepak bola dunia Frank Lampard.

Tyna Kocikk Jerman :-D. Mimpi terbesarku ,mw ngunjungin Brandenburger Tor ,Sony Center ,Boden See ,kota Jena ,Muenchen ,Koeln ,Stuttgart ,smua.a la .amen :-)

Adi Susanto Lumban Tukkup Pengen ke London, Ontario, Canada, mau ketemu sama Justin Bieber, trus mau ludahin mulutnya yang uda lantam mencap Indonesia yang bukan-bukan...

Mosen Sianipar Pengen ke Thailand, supaya bisa liat budaya bela diri Muay Thai yg terkenal itu :)

Perry Baringbing Oh kalau aku pingin ke disneyland australia.................. pingin sekali. liat filim-filim disney atau pembuatanya

Dicky Boolyn Sazalach Aku sih pengen ke china.....mau blajar buat hand phone... biar bsa dbuat di negara korup nih....:)

Saddam Dasuha Ingin ke Jamaica,,melihat pantai caribia,,mendengarkan lantunan music bang BOB marley hadoohhh indah nya dunia

Midun’boyee Jefri’boyee Sule’ohtidakbisa Timor Leste, mw liad bisnis Raul Lemos

EyrikHa Iin Girsang Aku pingin ke Korea. Ingin lebih mengenal negara penghasil gingseng dan silsilahnya plus belajar banyak tetang kulitas penduduknya hingga karya entertainment nya yang penuh insfirasi....

kamera digital untuk pemenang ketiga. Ia mengatakan, tahun ini tema Kompetiblog 2012 adalah: “Dutch Creativity”. Peserta dapat menterjemahkan tema tersebut dan menggunakan berbagai pendekatan untuk menjadi bahan penulisan. “Kami ingin mengajak para peserta memberikan opini tentang Belanda atau ulasan mengenai kebiasaan bangsa Belanda dalam berdiskusi untuk mendapatkan ide-ide baru dan terus menerus melakukan inovasi. Contohnya metoda pengajaran yang menggunakan system problem based learning,” ujar Mervin. Ia menuturkan, peserta yang bisa mengikuti kompetisi ini adalah warga negara Indonesia dan berdomisili di Indonesia saat mengikuti kompetisi ini. Peserta juga harus berusia antara 17-40 tahun dan belum pernah menempuh studi di Belanda. Tertarik? Informasi selengkapnya bisa dilihat di www.nesoindonesia.or.id. (int)

The Raid Diserbu Mahasiswa Belanda

Sejak pertama kali diputar di Toronto Film Festival 2011, The Raid: Redemption menjadi buah bibir di kalangan pecinta film, baik di Indonesia maupun dunia. Film yang digarap oleh sutradara asal Wales, Gareth Evans, ini dianggap media internasional sebagai bentuk baru dan segar dalam lembaran sejarah film laga di dunia. Di Belanda, film yang dibintangi Iko Uwais dan Yayan Ruhian ini diputar untuk kali pertama di ajang Imagine Film Festival 2012, di Amsterdam. Festival yang sudah 28 kali diadakan ini khusus memutar film bergenre horor, fiksi sains, animasi, dan thriller. Lebih dari 60 judul film dari seluruh dunia diputar di festival ini. Tahun ini, Indonesia diwakili oleh film Madame X, garapan sutradara Lucky Kuswandi, dan The Raid: Redemption. Diserbu Mahasiswa Indonesia di Belanda Sepanjang festival ini, film The Raid: Redemption diputar tiga kali. Hampir 30 persen dari para penonton yang memenuhi bioskop merupakan mahasiswa Indonesia yang sedang menjalani studi di Belanda. Mereka rela datang jauh-jauh ke Amsterdam dari kota-kota lain. Sebut saja dari Arnhem, Den Haag, Tilburg, Rotterdam, dan juga Wageningen. Salah satu alasan mereka rela datang jauh-jauh adalah karena mereka banyak mendengar cerita dan membaca resensi positif, baik dari teman-teman di Indonesia maupun

dari media. Demikian diungkapkan oleh Nyoman, mahasiswa dari Den Haag. Bahkan, sebelum menonton, Witantra, mahasiswa dari Tilburg, melakukan riset mengenai film tersebut. “Akhirnya terbayar juga setelah menonton filmnya langsung,” imbuhnya. “Bikin bangga sih. Tapi filmnya intens banget, bikin capek. Pokoknya deg-degan, soalnya isinya darah darah semua,” kata Vina, mahasiswi dari zAmsterdam. Undang Decak K agum Kagum Sepanjang film berdurasi 100 menit ini, para penonton memang tidak henti-henti dibuat kagum, entah karena aksi laga atau penggambaran kesadisannya. Bahkan, sempat terdengar riuh suara tepuk tangan ketika adegan sang tokoh utama (Iko Uwais) berhasil mengalahkan sang musuh tangguh (Yayan Ruhian). Toh, ada juga satudua penonton keluar dari bioskop di

tengah film. Pada akun Twitter-nya, @tbarnyard, seorang warga Belanda, menulis, “The Raid: Redemption keren banget! Yang bilang film Indonesia nggak ada yang bagus, kiss my a**!” Akun @ardvark juga mengakui, “Kemarin The Raid sukses besar di Imagine FF Amsterdam. Para penonton bergumam “oooh” dan “aaah” di momen momen yang tepat!” Pemenang PPenghargaan enghargaan Publik Kesuksesan film The Raid: Redemption di Imagine Film Festival 2012 bukan sekadar basabasi. Film ini mend a p a t penghargaan publik alias menjadi film yang mendapat apresiasi paling tinggi dari para penonton. Penghargaan Sp!ts Silver

Scream Award ini diumumkan pada penghujung festival. The Raid: Redemption memenangkan penghargaan Sp!ts Silver Scream Award mengungguli film kolaborasi dari Finlandia, Jerman, dan Australia, Iron Sky, dan film Spanyol Mientras Duermes. Dengan penghargaan ini The Raid: Redemption menambah koleksi piala internasional, setelah merebut penghargaan dari Toronto International Film Festival 2011 dan Dublin (int) International Film Festival 2012.(int)


KAMIS

3 Mei 2012

Bulls Terjungkal Chicago Bulls benar-benar kehilangan Derrick Rose. Tanpa Rose, Bulls terjungkal di kandang sendiri dari Philadelphia 76ers 92-109. Skor pun kini imbang 11. Posisi Rose sebagai point guard digantikan oleh C.J. Watson. Penampilan Watson tidak istimewa karena dari 11 tembakan, dia hanya berhasil memasukkan empat di antaranya. Total, Watson mengemas 12 poin. Sebelum laga di United Center pada Selasa (1/5) malam waktu setempat atau Rabu (2/5) pagi WIB ini dimulai, penonton sempat memberikan standing ovation kepada Rose yang datang langsung menyaksikan pertandingan.

Point guard All Star tersebut dipastikan absen hingga akhir musim karena cedera lutut pada game pertama Jumat (28/4) lalu. Bulls sebenarnya selalu unggul di dua kuarter pertama. Tiga poin dari Watson menutup kuarter pertama dengan keunggulan Bulls 28-25. Keunggulan Bulls terus berlanjut di kuarter kedua. Jump shoot dari center Bulls Joakim Noah membuat Bulls memimpin 55-47 saat jeda. Namun, hanya sampai disitulah keunggulan Bulls. Di kuarter ketiga, 76ers tampil menggila. Di kuarter ini saja mereka berhasil mencetak 36 angka untuk berbalik unggul 83-69. Keunggulan 76ers berhasil di-

pertahankan di kuarter keempat. Three point shoot dari Lou Williams berhasil menutup pertandingan dengan keunggulan 109-92. Point guard 76ers, Jrue Holiday menjadi pencetak angka terbanyak dengan 26 angka. Lou Williams mencetak 20 poin, Evan Turner menambah 19 poin, dan Andre Iguodala mengemas 11 poin. Dari kubu Bulls, Joakim Noah menorehkan 21 poin, John Lucas mencatat 15 poin, dan Richard Hamilton membuat 10 poin. Game ketiga akan digelar di kandang 76ers di Well Fargo Center pada Jumat (4/5) malam waktu setempat atau Sabtu (5/5) pagi WIB. (oz/int)

PT Liga Indonesia Bermasalah PSSI akan Lakukan Audit

„ Chicago Bulls tak berkutik di kandang sendiri

ROY HODGSON LATIH INGGRIS Pelatih West Bromwich Albion Roy Hodgson akhirnya ditetapkan sebagai pelatih Tim Nasional (Timnas) Inggris oleh Football Association (FA) pada Selasa (2/5) waktu setempat untuk masa kontrak selama empat tahun.

H

odgson mengganti posisi pelatih asal Italia, Fabio Capello yang mengundurkan diri tiga bulan silam karena tidak menerima keputusan FA yang secara sepihak memecat John Terry dari jabatan kapten Timnas Inggris. Hodgson adalah salah satu pelatih terbaik Inggris yang malang melintang melatih di luar negeri, terutama di Eropa dan Timur Tengah selama 36 tahun dan memiliki keahlian teknis. Hodgson pernah melatih Timnas Swiss, Finlandia, dan Uni Emirat Arab. Hodgson juga pernah melatih klub di Inggris, Swedia, Denmark, Norwegia, Swiss, dan Italia. Di Italia, dua kali melatih Inter Milan. Di tangannya, Timnas Swiss yang tidak pernah masuk pada turnamen-turnamen besar sejak 1966, akhirnya bisa tembus ke Piala Dunia 1994 dan Piala Eropa 1996. Pada Piala Eropa 1996, Swiss tersingkir pada putaran pertama tetapi sempat menahan imbang Inggris 1-1. Di tingkat klub, Hodgson memenangi delapan gelar juara liga di dua negara berbeda bersama tiga klub. Hodgson diharapkan bisa membawa Inggris menjuarai Piala Eropa

„ Roy Hodgson setelah pelatih-pelatih sebelumnya baik dari Inggris maupun pelatih asing termasuk Sven-Goran Eriksson dari Swedia dan Fabio Capello dari Italia gagal mempersembahkan gelar. Sejak ditunjuk sebagai pelatih Timnas Inggris, pria bersuai 64 tahun ini tidak punya waktu untuk bersantai mengingat Piala Eropa tinggal hitungan hari. Dia harus segera berkantor di Wembley, memilih skuad untuk Piala Eropa, mempersiapkan tim pada dua pertandingan persahabatan, sebelum melakoni pertandingan pertama Piala Eropa melawan Prancis pada 11 Juni 2012. Sejak menerima tugas tersebut, Hodgson meninggalkan klubnya,

West Bromwinch Alibon akhir bulan ini. Hodgson mengaku, ada begitu banyak kritik atas keterpilihannya menjadi pelatih Timnas Inggris. Tetapi dia sudah siap dengan kritikkritik tersebut. “Ada begitu banyak kritik dan saya harus siap menghadapi itu. Sebab selalu menjadi pekerjaan besar untuk memenangkan banyak orang. Saya siap menerima semua kritik. Saya minta publik sedikit memahami situasi kami karena pascapengunduran diri Fabio Capello, situasinya berbeda. Saya tidak punya waktu banyak,” kata Hodgson. Sementara itu, Ketua FA David Bernstein mengungkapkan, bahwa sebenarnya

mereka sudah merekrut Hodgson bulan lalu dengan mempertimbangkan pengalaman, rekam jejak, dan kemampuannya membangun sebuah tim juara. Sedangkan Direktur Pengembangan Sepakbola FA Trevor Brooking yang membantu perekrutan Roy Hodgson menegaskan bahwa ekspektasi Timnas Inggris adalah menjadi seperti Jerman, Belanda, dan Spanyol. Hodgson juga diyakini bisa membawa perubahan yang tidak pernah dilakukan oleh pelatih-pelatih sebelumnya. Menyusul terpilihnya Roy Hodgson, Kapten Liverpool Steven Gerrard adalah pemain nasional Inggris pertama yang menyampaikan ucapan selamat kepada Hodgson. “Saya sudah bekerja sama dengan Roy. Dia orang yang baik dan pelatih yang baik. Penting sekali dia diberi kesempatan dan saya tunggu bekerja sama dengan dia lagi,” kata Gerrard. Sedangkan pemain-pemain bintang Inggris seperti bek Manchester United (MU) Rio Ferdinand, Wayne Rooney, Michael Owen, dan pemain Tottenham Hotspur Jermain Defoe lebih menjagokan Harry Redknap. “Sejauh ini Harry Redknapp menjadi pelatih pilihan saya,” kata Rio Ferdinand melalui akun twitternya. “Capello sudah pergi dan Inggris harus menggantinya. Harry Redknapp untuk saya,” tulis Rooney. “Apakah pernah ada pendapat publik begitu kencang terkait pelatih Inggris mendatang? Saya tidak tahu kalau ada orang yang tidak menginginkan Redknapp,” tulis Michael Owen. (int)

Stoner Optimis Sambung Kemenangan

„ Casey Stoner

Setelah beberapa seri pembuka gagal mendapuk puncak podium, Casey Stoner akhirnya membuka kemenangan pertamanya di GP Spanyol,pekanlalu.Kini,jelangGP Portugal di Estoril, sang juara bertahan berniat kembali meraih hasil serupa. Persaingan di klasemen MotoGP kini kian ketat. Stoner semakin merapatkan posisi dengan rider Yamaha – Jorge Lorenzo yang masih bercokol di puncak. Saat ini, bentangan poin Stoner hanya berjarak empat poin berkat tambahan 25 angka di Jerez lalu. “Kembali melalui perjalanan udara ke base camp (Repsol Honda), kami akan mempersiapkan

diri jelang GP Portugal, akhir pekan ini. Setelah menang di Jerez, saya sudah tak sabar menuju Estoril dan berharap bisa mempertahankan performa di duaseriterakhir,terutamadiJerez,” tutur Stoner. Meski di kelas MotoGP Stoner belum pernah sekalipun menjadi yang tercepat di sesi lomba, tapi kenangan di kelas 250cc bisa menjadi suntikan motivasi tersendiri bagi pembalap berjuluk The Kurri Kurri Boy itu. “Saya punya beberapa catatan yang lumayan di Estoril. Saya memenangkan podium pertama saya di kelas 250cc di Estoril. Jadi, saya akan menargetkan hasil

serupa, tapi saya juga mengharapkan cuaca yang baik, akhir pekan ini,” lanjutnya, seperti disadur Stay on the Black, Rabu (2/ 5). Dengan jangka waktu yang cukup singkat menyongsong GP Portugal,Stonerakanbekerjakeras dengan timnya, untuk memperbaiki problem di area armpump, yang sempat menjadi masalah di Jerez. “Akan tetapi, kami harus segera memperbaikimasalaharm-pump di motor saya. Memang saat di Jerez,kamibisasedikitmengurangi efek masalahnya, tapi kami belum sempat memperbaikinya secara keseluruhan,” tuntasnya. (oz/int)

Persatuan Sepak Bola Seluruh Indonesia (PSSI) kembali berniat melakukan audit investigasi terhadap stuktur keuangan PSSI era Nurdin Halid dan PT Liga Indonesia (PT LI) periode 20092011. Audit direncanakan setelah PSSI mensinyalir adanya dugaan pencucian uang hingga Rp 20 miliar dalam neraca keuangan PSSI periode tersebut. Saat melakukan jumpa pers di Kantor PSSI, Rabu (2/5), Ketua Komite Audit Internal PSSI, Asril Umri mengungkapkan PSSI akan dibantu lima auditor dari Badan Pengawasan Keuangan dan Pembangunan (BPKP). Audit investigasi itu, lanjutnya, akan mulai berjalan pada hari Senin (7/5). “Ini hanya salah satu faktor. Kita membaca laporan ada transfer uang dari seseorang masuk ke PSSI dan uang ini dibukukan di PSSI tapi uangnya tidak ada.

Uang itu kurang lebih jumlahnya Rp 20 miliar. Kemudian beberapa bulan kemudian uang ini dikembalikan dan totalnya sama. Ini uang dari mana,” ujarnya. Asril menuturkan, audit itu dilaksanakan berdasarkan laporan audit yang dilakukan oleh kantor auditor independen Deloitte yang sebelumnya sudah melakukan review audit. Laporan tersebut menunjukkan sejumlah penyelewengan terhadap keuangan PSSI saat masih diketuai Nurdin Halid. “Oleh karena itu, kami mencoba membuktikan dugaan-dugaan itu benar atau tidak. Jadi, kami dalam waktu dekat ini akan mencoba masuk ke dalam PSSI. Mudah-mudahan waktunya tidak terlalu lama,” ujarnya. Sebelumnya, pada tahun lalu, PT LI dan Badan Liga Indonesia (BLI) pernah menolak untuk diaudit oleh Deloitt yang ditunjuk

PSSI. Pasalnya, ketika itu, Ketua BLI, Andi Darussalam Tabussala mengatakan bahwa BLI sudah sedang berada dalam proses akhir audit, dan akan menyerahkan hasil audit itu kepada pengurus lama. Ketika ditanya apakah, PSSI tidak takut rencana tersebut akan kembali menemui kegagalan, Asril dengan tegas akan berusaha semaksimal mungkin. Apalagi, kata dia, PSSI saat ini adalah pemilik 99 persen saham PT LI. “Sampai dengan hari ini, masih tercatat bahwa PT LI, 90 persen sahamnya adalah milik PSSI, dan itu belum pernah diubah, sesuai dengan keputusan pemerintah. Jadi, kita akan berusaha untuk mengungkap kejanggalan-kejanggalan ini. Jika ditemukan bukti, baru kita akan proses ke ranah hukum,” tegasnya. (kps/int)

„ Alexander Dale Oen

Juara Dunia Renang Tewas Mendadak Alexander Dale Oen, juara dunia renang gaya dada 100 m di Shanghai, 2011 meninggal dunia setelah terkena serangan jantung. Perenang yang bakal mewakili Norwegia di Olimpiade London 2012, meninggal saat menjalani pemusatan latihan di Flagstaff, Arizona, AS. Dale Oen meninggal akibat mengalami gagal jantung. Dalam pernyataan yang dikeluarkan Federasi Renang Norwegia, juara dunia itu ditemukan kolaps di lantai kamar tidur, Senin (30/4). Ia sempat dibawa ke rumah sakit, sayangnya dalam

perjalanan pria berumur 26 itu menghembuskan nafas terakhirnya. “Kami semua merasa terkejut. Ini adalah pengalaman mengejutkan bagi semua anggota tim disini. Rasa duka kami ditujukan kepada keluarganya yang sudah kehilangan Alexander di usianya yang masih amat muda,” papar pelatih Norwegia, Petter Loevberg. Juru bicara RS Flagstaff Medical Centre Starla Collins mengkonfirmasikan kematian Dale Oen, kendati begitu ia tak memberikan detil lanjutan.

Dale Oen memenangkan gaya dada 100 m di Shanghai, Juli lalu. Sebelumnya Dale Oen memenangkan medali perak di Olimpiade Beijing 2008. Keberhasilan Dale memenangkanmedaliemasdiShanghai,terjadi tiga hari setelah pembantaian di Norwegia oleh ekstrimis sayap kananAndresBreivikyangmemakan 77 korban jiwa. Dale Oen mendedikasikan kemenangan itu kepada parakorbandaripembantaianitu.Ia langsung menunjuk bendera Norwegia di penutup kepala usai memenangkan medali emasnya. (int)

Alonso akan Kunjungi Indonesia

„ Xabi Alonso

Pemain Real Madrid, Xabi Alonso, dijadwalkan akan mengunjungi Indonesia pada tanggal 8 Juli 2012 mendatang untuk mengikuti acara “Indonesia Mengoper Bola 2012” di Jakarta. Selain Xabi Alonso, beberapa pemain nasional juga akan dilibatkan dalam acara tersebut. Hal itu diungkapkan oleh Deputi Direktur PT Dua Kelinci, Edwin Sutiono. Ia mengatakan pemain nasional tersebut telah dihubungi dan menyatakan kesiapannya. “Ada Hamka Hamzah, Firman Utina, Ponaryo Astaman dan Kim Jeffery Kurniawan,” katanya. Menurutnya, sebelum kegiatan puncak yang akan dihadiri

oleh pemain timnas Spanyol tersebut, pihaknya selaku sponsor juga akan melakukan kegiatan yang sama di tiga kota lainnya yaitu Surabaya (3 Juni), Semarang (10 Juni) dan Bandung (24 Juni). Namun, Edwin masih belum dapat memastikan kapan Xabi Alonso akan tiba di Tanah Air. Xabi direncanakan akan tiba pada tanggal 8 Juli, namun kedatangannya bisa saja lebih cepat. “Dia (Xabi Alonso) masih menunggu hasil pertandingan Euro. Yang jelas untuk menentukan siapa pemain yang datang ke Indonesis harus melalui persetujuan Jose Mourinho (pelatih Real Madrid),” katanya. (int)


SOCIETY

14

KAMIS

3 Mei 2012

„ Ketua DPD KNPI Simalungun, Elkananda Shah SE memberikan pataka kepada Ketua PK KNPI Dolok Silau yang baru, Elias Barus, saat acara pelantikan, Sabtu (28-4) di Balai Desa Nagori Saranpadang.

16

„ Pengurus DPD KNPI Simalungun dan PK KNPI Dolok Silau berfoto bersama muspika Kecamatan Dolok Silau usai acara pelantikan.

ELKANANDA SHAH SE, LANTIK PK KNPI DOLOK SILAU

KNPI Harus Terdepan Berantas Narkoba „ Pengurus dan Srikandi KNPI berjoget bersama usai pelantikan pengurus PK KNPI Dolok Silau.

„ Elkananda Shah SE

„ Sanju MJ Sidabutar

„ Ketua PK KNPI Dolok Silau yang baru dilantik, Elias Barus, Tomas, Pemuda, dan Organisasi foto bersama.

„ Ketua DPD KNPI Simalungun, Elkananda Shah dan pengurus beserta para undangan.

„ Elias Barus

„ Para PK KNPI Dolok Silau bersiap dilantik oleh Ketua DPD KNPI Simalungun, Elkananda Shah SE.

„ Elkananda Shah SE memberikan ucapan selamat kepada para pengurus PK KNPI Dolok Silau.

„ DPD KNPI Simalungun, PK KNPI Dolok Silau dan dr Laila, dokter puskesmas Dolok Silau berfoto bersama.

Teks dan Foto: Nasa Putra.

16 2

NAPOLI

PALERMO

0

BERANGKAT KEJURDA-Tim Kareta Siantar berangkat mengikuti Kejurda Forki Sumut Tingkat Kadet dan Junior berfoto bersama Drs Hendrik Sihombing (Dan V) dan pelatih Mangaraja Nababan (Dan II), Rabu (2/5).

KARATEKA SIANTAR BERLAGA

DI

KEJURDA JUNIOR FORKI SUMUT

Target Medali Emas Tiket ke Kejurnas SIANTAR- Tim Karate Junior Kota Pematangsiantar diberangkatkanDRDrsHendrikSihombing MSi selaku Ketua Bidang Organisasi Forki Pematangsiantar, Rabu (2/5), untuk mengikuti Kejuaraan Daerah Federasi Olahraga Karetedo Indonesia (Forki) Sumatera Utara Tingkat Kadet dan Junior, yang akan dilaksanakan di UniversitasMedan(Unimed)Jalan Wiliam Iskandar pada tangal 5-6 Mei 2012. Mereka antara lain, Choirul Efendi Lubis, Roland Lubis, Nazaret Nababan, Fahmi Pohan dan Gilang Ramadan di bagian putra serta Mutita, Faradiba dan Kartika Putri Ayu di bagian putrid. Hendrik Sihombing (Dan V Karatedo) mewakili Forki Pematangsiantar didampingi pelatih kepala Mangaraja Nababan SPd (Dan II Karetedo), usai memberangkatkan tim yang berjumlah 8 orang termasuk pelatih di halaman kantor Lurah Proklamasi, Kecamatan Siantar Barat mengatakan, pihaknya berharap doa dan dukungan masyarakat Kota Siantar untuk keberhasilan para atlet. Kejurda yang digelar di Medan merupakan bagian dari seleksi untuk mendapatkan atlet terbaik, untuk mewakili Sumatera Utara pada Kejurnas Forki Tingkat Kadet dan Junior di Manado, Sulawesi Utara,

untukmemperebutkanPialaMendagri XVI. “Kami berpesan kepada atlet untuk berjuang habis-habisan, tetap bersemangat walau pun harus menggunakan dana swadaya dari orangtua serta pengurus Forki. Jika disiplin serta berkerja keras, maka kami yakin medali emas akan diperoleh,” kata Hendrik Sihombing. Dia menjelaskan, motivasi yang ada dalam diri atlet sangat penting untuk mewujudkan raihan terbaik dan menjadi juara. Sifat sportifitas harus tetap dijunjung tinggi. “Setahun terakhir, sudah tiga kali atlet Forki Siantar mengikuti kejuaraan serta berhasil memeroleh medali emas. Walau belum pernah menerima bantuan dana dari Pemko Siantar melalui Dispora, termasuk dari KONI Siantar sebagai induk cabang olahraga. Gantinya, orangtua yang berkorban bersama pengurus,” jelas mantan atlet karate tahun 1980-an ini. Sementara pelatih kepala Kushin Ryu M Karate Do Indonesia (KKI) Mangaraja Nababan, menambahkan, dibutuhkan kepedulian semua pihak untuk mengembangkan olahraga terutama dalam hal pembinaan sejak dini. “Dibutuhkan fasilitas yang memadai berupa tempat serta pera-

latan. Untuk mengasah kemampuan, dibutuhkan kejuaraan-kejuaraan yang tentunya membutuhkan dana untuk pemberangkatan serta bekal selama pertandingan. Kendalanya kadang soal dana, kadang kita sampai hati memberatkan orangtua, sementara atlet berlaga atas nama Kota Siantar,” kata Mangaraja. Ditambahkannya, jika memang pemangku kepentingan olahraga tidak dapat membantu, minimal tidakmempersulitterutamaterkait soal urusan administrasi terkait pemberangkatan atlet karate. “Soal prestasi sudah cukup banyak, terutama Choirul Efendi Lubis peraih medali emas pada Tournament Karateka Tingkat Asia tahun 2012 di Kuala Lumpur, Malaysia. Dan Kartika Putri Ayu yang meraih medali perunggu pada tunamen yang sama serta meraih medali emas pada Kejurda Forki tahun 2011, serta beberapa atlet yang sering mengikuti Piala Walikota Medan” katanya. Sementara Choirul Efendi Lubis, mewakili atlet berjanji akan bekerja keras untuk mendapatkan hasil terbaik yakni medali emas. “Kami ingin terpilih mewakili Sumut ke Piala Mendagri di Manado. Maka medali emas menjadi keharusan, kami mohon dukungan,” katanya. (esa/ara)

Napoli makin nyaman di tangga ketiga Liga Italia usai menggebuk tamunya, Palermo 2-0 di San Paoli, Selasa Malam.

S

etelah sempat terseok-seok s e l a m a beberapa pekan, Partenopei meraih tiga kemenangan beruntun di Serie A dan kini makin berpeluang mengenggang tiket kualifikasi Liga Champions, dengan mengoleksi 58 poin atau unggul tiga angka dari para pesaingnya, Udinese, Inter Milan dan Lazio yang baru akan memainkan laga Rabu ini. Skuad besutan Walter Mazzarri mendominasi laga sejak awal dan Edinson Cavani mencetak gol pembuka melalui titik putih di menit ke-16, sementara Marek Hamsik menggandakan keunggulan sembilan menit kemudian. Napolisudahmemperolehkansmencetak gol saat laga baru berjalan lima menit, di mana Goran Pandev mengirim umpan kepada Gokhan Inler, tapi sepakannya masih terhalang mistar gawang. Tidak lama berserang, Palermo mendapat dua peluang emas di depan gawang. Morgan De Sanctis melakukan penyelamatan gemilang saat menepis usaha Josip Ilicic dengan kakinya dari jarak sembilan yard, kemudian jatuh bangun menggagalkan tandukan Abel Hernandez. Wasitmemberikanhadiahpenaltisaat Milanovic melakukan sliding untuk menghalau crossing Pandev dan bola mengenai tangannya. Pemain Palermo sempat melakukan protes, tapi tenda-

ngan keras Cavani dari titik 12 pas mengoyak jala Emiliano Viviano. Cavani mencoba memberikan assist kepada Pandev dengan melakukan chip dari luar kotak penalti, tapi Eros Pisano dengan cepat menyapu di kulit bundar. Partenopei akhirnya menggandakan keunggulantuanrumahmelaluiHamsik berkat kerja sama apik dengan Pandev di area penalti. Pemain asal Slovakia itu melepaskan tendangan mendatar yang gagal dihalau Viviano. Napoli nyaris memperbesar keunggulan sepuluh menit pasca jeda, namun sepakan Cavani yang menerima umpan Walter Gargano dari sisi kanan masih melebar. Palermo mencoba melakukan tekanan di menit 64 dimana tendangan Massimo Donati dari luar kotak penalti hampirmenjebolgawangDeSanctis.Namun, tendangannyasetelahmenerimaumpan Edgar Barreto masih melebar. Permainan mulai mengendur memasukisepuluhmenitakhir.JuanZuniga mendapatkan umpan Marek Hamsik, tapi tendangannya belum menemui sasaran. Menjelang peluit akhir, Palermo kembali memperoleh peluang menjebol gawang De Sanctis. Tendangan kaki kiri Abel Hernandez dari area penalti dengan mudah dihalau De Sanctis. Dengan kekalahan ini Rosanero turun ke posisi 15, mengoleksi 42 poin atau unggul enam poin dari Genoa yang menduduki zona degradasi. (int)


Edisi 270 „ Tahun VIII

KAMIS, 3 MEI 2012

(FOTO: DUNGO)

„ Pihak keluarga menemukan jasad keluarganya yang terbongkar akibat hujan deras dan menyebabkan longsor di pemakaman HKBP Sibolga Julu. Sebanyak 63 jasad dan kerangka telah ditemukan dan 38 sudah dikuburkan kembali.

Selamat Jalan Bu Mentri Setelah sempat mengalami masa kritis, Menkes non aktif Endang Rahayu Sedyaningsih akhirnya menghembuskan napasnya yang terakhir kemarin (2/5) di RSCM Kencana. Endang meninggal setelah hampir dua tahun berjuang melawan penyakit kanker paru-paru yang dideritanya. “Dia wafat pada pukul 11.41. “Kami menyampaikan berita duka pada hari ini (kemarin) jam 11.41, Ibu Endang telah meninggal dunia di tempat pe-

rawatan intensif. Kami sudah berupaya melakukan yang terbaik dan memberikan perawatan semaksimal mungkin, tapi Tuhan berkehendak lain,”jelas Direktur Utama RSCM Akmal Taher ditemui di RSCM Kencana, kemarin. “Akmal menuturkan, jenazah akan disemayamkan di kediaman almarhumah di Jalan Pendidikan Raya III Blok J-55 Komplek IKIP Duren Sawit, ‹ ‹ Baca

Selamat..Hal 2 (FOTO: RAKA DENNY/ JAWAPOS)

„ Jenazah Menteri Kesehatan Endang Rahayu Sedyaningsih tiba di rumah duka Jalan Pendidikan Raya III Blok J-55, Komplek IKIP Duren Sawit, Jakarta Timur, Rabu sore pukul 14.40 WIB dengan diantar mobil jenazah dari RS Cipto Mangunkusumo.

62 Rangka dan Jasad Masih Terus Digali 63 Ditemukan, 38 Kerangka dan Jasad Sudah Dikuburkan SIBOLGA- Pencarian kerangka manusia yang kuburannya terbongkar akibat longsor melanda perkuburan HKBP Sibolga Julu di Kel. Angin Nauli Aek Parira, Sibolga Utara, minggu lalu, masih terus dilakukan. Hingga kemarin masih 86 kerangka utuh yang belum ditemukan. ‹ ‹ Baca

62 Rangka..Hal 2

Sahat Simatupang Mengaku Khilaf

(FOTO: BORNEO)

„ Kapolres Psp AKBP S Taufik SIK MSi melalui pengeras suara massa dari atas mobil, meminta pengunjuk rasa tenang dan tidak berbuat anarkis.

Setelah Rekaman Pernyataannya Beredar

Kantor Bupati Tapsel Rusuh

TAPTENG- Rekaman video amatir berisi pernyataan Sahat Simatupang terkait tulisannya soal wacana perluasan Kota Sibolga ke wilayah Tapteng, beredar di publik. Dalam video berdurasi pendek itu, Sahat mengakui tulisannya itu mendapat restu pimpinannya. Sepertinya video itu terekam saat Sahat sedang menyampaikan sambutan dalam suatu pertemuan dengan sejumlah warga Sibolga. Dengan nada

PNS Dilempari, Pagar Roboh, Kantor Hancur

lantang Sahat menuturkan bahwa dirinya diminta oleh pimpinannya untuk tidak mundur. Sebab, jika Sahat kalah itu merupakan hal yang biasa. Tapi jika Bonaran kalah, maka Bonaran sudah dipermalukan sebagai Bupati Tapteng. Hanya saja, Sahat tidak mengungkapkan siapa pimpinan yang dimaksudnya tersebut. Informasi yang dihimpun, ‹ ‹ Baca

DISIMPAN DI GEREJA: Pendeta Resort HKBP Sibolga Julu, Pdt S Siahaan SmTh saat memperlihatkan tulang belulang yang disimpan di salah satu ruangan HKBP Sibolga Julu, Rabu (2/5) malam kemarin.

SIDIMPUAN- Unjuk rasa menuntut pemindahan Kantor Bupati Tapsel dari Jalan Kenanga, Padangsidimpuan (Psp) ke Sipirok, Tapsel, berlangsung ricuh, kemarin. Ribuan pengunjuk rasa melempari kantor bupati dengan batu dan kemasan air mineral. Sejumlah pegawai juga

terkena lemparan. Lampu taman dan kaca jendela pecah. Pengunjuk rasa juga menjebol pagar hingga roboh. Pantauan koran ini, pengunjuk rasa yang tergabung dalam Lembaga Pengkajian Pembangunan Tapanuli Selatan (LP2TS), Aliansi Masyarakat Sipirok Peduli Hukum (AMPSPH),

FORWASH, Naposo Nauli Bulung Napa-napa Ni Sibual-Buali (NNBS), dan Ikatan Keluarga Alumni Pelajar Sipirok Sekitarnya (IKAPSI), serta lainnya, berangkat dari Sipirok dengan menggunakan puluhan ken‹ ‹ Baca

PNS..Hal 7

Sahat..Hal 2

Dua Mantan Sekda Tahan Mobil Dinas SIBOLGA- Dua mantan Sekretaris Daerah (Sekda) Kota Sibolga Drs Dahwir Nasution dan Syaiful Bahri Hasibuan belum mengembalikan mobil dinas. Padahal sudah berulang kali kedua Sekda itu disurati. Hal itu terungkap pada rapat dengar pendapat antara Komisi I DPRD dengan pimpinan Satuan Kerja Perangkat Daerah (SKPD) Pemko Sibolga terkait pembahasan Laporan Pertanggungjawaban (LKPj) Walikota Sibolga, Rabu (2/5) di gedung

(FOTO: DUNGO)

dewan. Mobil dinas itu sendiri adalah Toyota Kijang Kapsul BB 300 N dan BB 19 N. “Dua mobil dinas itu adalah aset Pemko Sibolga, dan harus segera ditarik. Termasuk juga kendaraan dinas lainnya yang dipakai mantan pejabat Pemko Sibolga, siapapun itu,” tegas anggota Komisi I DPRD Sibolga, Albar Sikumbang SH dalam pandangannya terkait adanya sejumlah kendaraan ‹ ‹ Baca

Dua..Hal 2

Andrew Weintraub, Profesor Universitas Pittsburgh dan Vokalis Dangdut Cowboys (2-Habis)

Siapkan Reality Show, Pentas Dangdut hingga Washington DANGDUT Cowboys Andrew dibentuk pada 2007. Orkes musik beranggotakan enam orang ini secara khusus memainkan musik dangdut dengan gaya Cowboys. Tidak ada baju berumbai ala Rhoma Irama atau goyang asoy khas A. Rafiq. Sebagai gantinya, Andrew dan teman-temannya mengenakan kostum khas cowboy negeri Paman Sam. Topi cowboys, sepatu boot, dan jeans. Hendromasto, Jakarta

(FOTO: DOK)

„ Andrew Weintraub bersama Roma Irama.

Video penampilan Dangdut Cowboys yang diunggah ke situs Youtube sudah lebih dari 250 ribu kali ditonton orang dari berbagai negara. Dangdut Cowboys juga sudah naik panggung di berbagai kota dan kesempatan di negeri Paman Sam. Pittsburgh, New York, hingga Washington menjadi kota-kota yang pernah Dangdut Cowboys singgahi untuk tampil. Penampilan mereka di kota-kota itu ditonton warga setempat yang notabene masih asing dengan dangdut.”Saya yang mengenalkan dangdut ‹ ‹ Baca

Siapkan..Hal 7


KAMIS

3 Mei 2012

62 Rangka dan Jasad Masih Terus Digali Sambungan Halaman 1 Hujan deras yang melanda Kamis (25/4) malam lalu membuat warga Lingkungan Satu, Kelurahan Angin Nauli Aek Parira, tak keluar rumah. Namun sebagian warga kampung mengaku mendengar suara kuat seperti pohon tumbang. Esok paginya warga mendapati pemakaman HKBP Sibolga Julu yang berada di pundak bukit, longsor. “Areal pemakaman itu longsor sekitar 100 meter,” kata Albiner, warga setempat. Albiner mengatakan, pascalongsor, tulang-belulang manusia berserak di tanah yang bercampur lumpur. “Peti mati juga ikut terbongkar,” tambahnya. Nah, setelah sekitar enam hari melakukan pencarian, 44 kerangka

dan jasad sudah ditemukan pihak keluarga. Kerangka-kerangka itu dibawa ke Gereja HKBP Sibolga Julu, sebelum kemudian dikuburkan kembali. Menurut Camat Sibolga Utara, Marajahan Sitorus, hingga saat ini ada 63 tulang belulang yang sudah ditemukan dan 38 di antaranya sudah dikebumikan oleh masing-masing keluarganya. Sementara jumlah keseluruhan jasad yang dikuburkan sebanyak 125. Artinya sebanyak 62 jasad dan kerangka masih terus dicari. “Bahkan ada juga pihak keluarga yang bersangkutan membawa tulang belulang itu dikebumikan di luar Kota Sibolga seperti di Siborong-borong, Tapanuli Utara, Barus, Tapanuli Tengah dan juga di tempat lainnya di Kota Sibolga seperti di Aek Parira,”

beber Marajahan. Terkait dengan sisa tulang belulang yang belum dikuburkan, kata Marajahan, diambil kebijakan untuk menyimpan seluruhnya yakni sebanyak 25, 23 di antaranya dimasukkan dalam peti dan 2 dibungkus sarung dan karton. “Di antara ke 25 tulang belulang itu, sekitar 8 sudah teridentifikasi namun belum diambil pihak keluarganya. Dan kita memberikan kesempatan kepada pihak keluarga menyimpannya dalam gereja HKBP Sibolga Julu sampai ditemukan tempat pemakamannya,” terangnya. Masih menurut Marajahan, jika tulang belulang lainnya tidak teridentifikasi juga, maka pada hari Sabtu (5/5) mendatang pihaknya bersama pengurus gereja dan tokoh

masyarakat akan melakukan penguburan massal. “Kebijakan itu kita buat berdasarkan hasil rapat bersama pengurus gereja dan tokoh masyarakat setempat. Namun soal tempat penguburan massal, belum bisa dipastikan tempatnya dimana, apakah di pekuburan HKBP itu juga atau di tempat lainnya. Nantilah, sebab hal itu masih kita bicarakan lagi bersama pengurus gereja dan tokoh masyarakat,” tukasnya. Terkait soal pencarian tulang belulang lainnya, sambungnya, pihaknya masih akan melakukan pencarian hingga hari Jumat (4/5) mendatang. “Pencarian kita lakukan hingga hari Jumat besok. Namun demikian, jika pihak keluarga yang merasa ada kuburan keluarganya

berada di sana dan belum ditemukan, kita persilahkan untuk mencarinya,” tandas Marajahan. Sementara Lurah Angin Nauli Aek Parira, Pariama Siburian, menerangkan, lokasi penguburan ada di beberapa titik seperti di Desa Simaninggir, Kecamatan Sitahuis, Tapteng. Di KM 5 Kec. Sibolga Utara, dan Ada di Kelurahan Sibolga Julu. Dikatakan Pariama, sebagian besar kerangka dan jasad yang dikenali berdasarkan keterangan pihak keluarga. “Semua dikenali keluarganya masing-masing. Sedangkan 10 lagi kerangka dan jasad disimpan di Gereja HKBP Sibolga sebelum dikuburkan kembali,” terangnya. Ditanya bagaimana pihak keluarga

mengenali tulang-belulang dan jasad tersebut? “Pihak keluarga mengenali dari sepatu yang masih ada, baju, celana, peti mati dan lain-lain,” jawabnya. Pantauan koran ini kemarin, pascalongsor, setiap hari sedikitnya 30 orang melakukan pencarian tulang-belulang di lokasi pemakaman HKBP Sibolga Julu. Mereka berkelompok yang merupakan kumpulan dari beberapa kepala keluarga. Pencarian dilakukan dengan peralatan seadanya sejak pukul 09.00 pagi hingga berakhir pukul 17.00 sore. Sebagian di antara mereka ada yang sengaja membawa bontot makanan sebagai makan siang. (dungo/tob)

Sahat Simatupang Mengaku Khilaf Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Tapanuli, Metro Siantar, Metro Asahan, Metro Tabagsel) Chairman : Rida K Liamsi Komisaris Utama : Makmur Kasim Komisaris : Kadafi Direktur Utama : Marganas Nainggolan Direktur : Goldian Purba Pengasuh Pemimpin Umum/Penjab/GM : Marganas Nainggolan Wa PU/Pimpinan Perusahaan : Maranatha Tobing Pimred Metro Tapanuli : Alvin Nasution Pimred Metro Siantar : Pandhapotan MT Siallagan Pimred Metro Tabagsel : Muhiddin Hasibuan Pimred Metro Asahan : Eva Wahyuni Wapimred Metro Tapanuli : Daniel Simanjuntak Tim Ombudsman : Vincent Wijaya DIVISI PRODUKSI Departemen Redaksi Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Alvin Nasution, Eva Wahyuni, Muhidin Hasibuan, Daniel Simanjuntak, Leonardus Sihotang, Syafruddin Yusuf, Nurjannah, Hermanto Sipayung. Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Putra Hutagalung ( Sibolga), Masril Rambe (koresponden Barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput). Sekretaris Redaksi: Yanti Nurhapni METRO SIANTAR Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta) Lazuardy Fahmi (Fotografer), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). METRO TABAGSEL Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina). METRO ASAHAN Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Sahat Halomoan Hutapea, Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan), Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang). Departemen, Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS. Kordinator Teknisi, Maintenance IT: Irwan Nainggolan. Staf Operasional Website: Hotland Doloksaribu DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria. Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Ferry Agustika. Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman. Staf Pengembangan: Simson Winata, Roy Amarta, Ismail, Efendi Tambunan. Kordinator Ekspedisi: Jhon Tua Purba. Staf Ekspedisi: Nico, Ardi, Erik. Departemen Iklan Manager Iklan: Jamot S. Kord Iklan: Bambang Satria, Kord Piutang Iklan: Hariyani Kartini, Staf Piutang Iklan: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi. Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat. Perwakilan Metro Asahan Ka Perwakilan/Ka Biro Usaha: Darwin Purba. Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa. Kuasa Hukum: Binaris Situmorang SH Tarif Iklan: Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan: Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp: (0622) 7553511, Fax (0622) 7553501 Siantar. e-mail: metrosiantar@yahoo.com. Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak: PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733.

Sambungan Halaman 1 pernyataan itu dilontarkan Sahat dalam kapasitasnya sebagai Camat Sibolga Selatan. Pernyataan itu terjadi dalam sebuah pertemuan dengan sejumlah warga di Kantor Lurah Aek Parombunan, beberapa hari lalu. Tampak dalam video saat itu Sahat berbicara tanpa menggunakan mikrofon, duduk di sebuah kursi, danmengenakanbajubatikwarna coklat kebiru-biruan, serta memakai kacamata. Anehnya, saat METRO mencoba mengkonfirmasi Sahat terkait pernyataannya tersebut, pengamat pariwisata SibolgaTapteng itu awalnya membantah. Tapi, setelah diperdengarkan rekaman suara dari video tersebut, Sahat justru balik menyatakan supaya jangan dibesar-besarkan lagi. “Sudahlah jangan lagi dibesarbesarkan.Namanyamanusiapasti ada kesilapan,” tandas Sahat mengamini kebenaran video itu, saat ditemui di halaman gedung DPRD Sibolga, Senin (30/4) siang. Saat itu Sahat baru saja selesai mengikuti rapat dengar pendapat bersama kalangan mahasiswa, komisiIDPRDSibolgayangdipimpin Wakil Ketua DPRD Sibolga, Toni Lumbantobing. Kesimpulan pertemuan itu adalah bahwa mahasiswa dan DPRD Sibolga mendukung Sahat. Semakin dicecar dengan pertanyaan soal siapa yang dimaksudnya pimpinannya tersebut, Sahat mengaku pimpinannya adalah rektor perguruan tinggi, bukan Walikota Sibolga Syarfi

Hutauruk.“Itukananalisisseorang dosen, sehingga pimpinan saya adalah rektor,” tukasnya. Ketika wartawan kemudian mempertanyakan bahwa analisis dalam tulisannya itu tidak sesuai fakta, dan tidak ilmiah, Sahat menyebutkan itu adalah kesilapannya. “Akandipertimbangkan,”jawab Sahat saat ditanya apakah dirinya akanmembuatpermohonanmaaf secara resmi atas rekasi dari Pemkab Tapteng terhadap tulisannya tersebut. Terpisah,KabagHumasyPemko Sibolga, Srasamaluddin SE MM kepada wartawan, Senin (30/4) petang melalui selulernya, mengatakanbahwapernyataanSahat Simatupang SE dalam video itu tidak ada hubungannya dengan Walikota Sibolga. “Tulisan atau pernyataan Sahat itu merupakan pemikirannya sebagai dosen, tidak ada hubungannya dengan walikota,” tuturSrasamaluddin. Tulisan Sahat Simatupang SE sebagai Dosen STIE Alwasliyah Sibolga-Tapteng soal wacana perluasan wilayah Kota Sibolga ke wilayah Tapteng sendiri dimuat di salahsatu media lokal, beberapa waktu lalu. Tulisan itu kemudian menuai ketersinggungan Bupati Tapteng, Raja Bonaran Situmeang SHMHum.Sebab,menurutBonaran, tulisan itu tidak berdasarkan fakta, bermuatan fitnah dan hasutan. Karena itu, Bonaran memberi dua opsi menyikapinya. Pertama, Pemkab Tapteng akan mengundangresmiSahatSimatupangyang juga menjabat Camat Sibolga Selatan itu untuk melihat fakta di

lapangan. Jika undangan itu diabaikan, maka Pemkab Tapteng akan kembali melayangkan undangan melalui Walikota Sibolga. Dan jika undangan kedua itu juga diabaikan, maka Pemkab Tapteng akan melaporkan pemerhati pariwisata SibolgaTapteng tersebut ke kepolisian, sesuai Pasal 315 KUHP tentang tindakan memfitnah dan penghasutan dengan tulisan. Dijelaskan Bonaran, bahwa dalam tulisannya, Sahat Simatupang SE menyebutkan bahwa di Sibolga ada rumahsakit, pusat perbelanjaan, hotel, dan pertokoan.Sementarafasilitasyang demikian belum tersedia di Tapteng. Lalu, Sahat juga menulis meski satu periode pemerintahan PemkabTaptengsekarang,fasilitas tersebut tidak mungkin terwujud. Kemudian, dituliskan juga bahwa perluasan Kota Sibolga justruakanmerugikanpemerintah dan masyarakat Kota Sibolga sendiri. Alasannya, karena perluasan akan menambah beban APBD Kota Sibolga. “Itu langkah yang akan kami ambil. Minggu depan akan kami undangbeliauuntukjalan-jalanke Pandan atau ke Tapteng untuk melihatdimana-manasajaadahotel, RSU, pasar dan pertokoan. Biar beliau lihat langsung fakta di lapangan. Saya meminta agar Sahat Simatupang SE meralat sekaligus menyampaikan permohonan maaf atas kekeliruan tulisannya tersebut,” tukas Bonaran kepada sejumlah wartawan di Lobi Bandara Dr FL Tobing Pinangsori, Tapteng, Rabu (25/4) pagi lalu. (mora)

Dua Mantan Sekda Tahan Mobil Dinas Sambungan Halaman 1 dinas milik Pemko Sibolga yang belum dikembalikan. Menurut Albar, Pemko Sibolga dalam hal ini harus bertindak tegas dan tidak membiarkannya begitu saja, sebab ini menyangkut persoalan hukum yang harus diselesaikan sesegera mungkin. Bila tidak, Pemko Sibolga dikhawatirkan nanti dapat terjerat kasus hukum. “Agar permasalahan hukum tidaktimbulkedepan,seluruhaset pemerintah berupa kendaraan dinas yang belum dikembalikan diharapkan dapat ditarik. Kita dari DPRD akan membantu dengan menerbitkan surat rekomendasi untukitu.Namun,dalamprosedur

hukumnya,PemkoSibolgajangan lupa menyurati kembali siapa saja mantan pegawai atau pejabat Pemko Sibolga yang belum mengembalikan. Bila perlu nanti dalam penarikannya, minta dukungan dari Satpol PP Pemko Sibolga,” tegas Albar. Nantinya, kata Akbar, bila seluruh aset tersebut berhasil ditarik, dimasukkan ke dalam pool (gudang penyimpanan) menunggu proses berikutnya, apakah akan dilelang atau digunakan kembali oleh pemerintah. Pada kesempatan itu, Kabag Umum dan Perlengkapan Pemko Sibolga Amarullah Gultom mengaku, pihaknya menerima permintaan sekaligus harapan Komisi I DPRD Kota Sibolga ters-

ebut. “Hal itu akan segera kita laksanakan. Soalnya, pihak PKAD Kota Sibolga sebelumnya juga telah mengeluarkan peraturan tentang pengaturan kenderaan plat merah guna ditindaklanjuti,” ujarnya. Usai rapat dengan pendapat, Amarullah Gultom kepada wartawan membenarkan, bahwa kedua kendaraan dinas yang digunakan mantan Sekdakot Sibolga tersebut hingga kini belum dikembalikan kepada Pemko Sibolga. “Soal berapa banyak mobil dinas pemerintah lainnya yang belum dikembalikan, itu kurang saya tahu pasti, tapi kebanyakan roda dua,” tandasnya. (tob)

lamanya itu, yakni dengan minum Milkuma, minuman serbuk susu kambing yang diproses secara alami, tanpa pemanis buatan dan bahan pengawet. Bahan dasarnya adalah susu kambing peranakan ettawa segar dan Gula Aren. Manfaat Milkuma telah dirasakan olehnya setelah minum selama 1 bulan. "Dulu saya terbiasa dengan obat warung, tapi sekarang tidak lagi! Sejak minum Milkuma sekarang sakit maag sudah berkurang." Ungkap warga Padang Bulan, Medan, Sumatera Utara tersebut. Karena merasakan manfaatnya secara langsung, sekarang ia menyarankan orang lain untuk mencoba Milkuma, "Mari kita sehat bersama Milkuma." Ajak pria berusia 21 tahun tersebut. Sebenarnya, banyak masyarakat kita yang belum mengetahui tentang manfaat yang terkandung dalam susu kambing. Berbeda dengan susu sapi, sesungguhnya susu kambing memiliki kandungan gizi yang lebih unggul, baik dari segi protein, energi, maupun lemak yang mendekati air susu ibu (ASI). Kini, hadir Milkuma yang bermanfaat untuk menjaga daya tahan tubuh dan meningkatkan vitalitas. Satu gelas susu kambing

memasok 20,0% dari nilai harian Riboflavin. Selain itu, Fluorine yang terdapat dalam susu kambing bermanfaat sebagai antiseptik alami dan dapat membantu menekan pembiakan bakteri di dalam tubuh serta membantu pencernaan dan menetralisir asam lambung. Selain diproses secara alami, pakan ternak yang diberikan pun organik, sehingga menghasilkan susu yang lebih sehat dan bermanfaat bagi kesehatan. Ditambah dengan kandungan Gula Aren bermutu tinggi sebagai pemanisnya, menjadikan Milkuma sebagai pilihan bijak untuk kesehatan. Untuk memperoleh hasil yang maksimal, terapkan pola hidup sehat seperti disiplin dalam pola makan, rutin berolahraga dan mengkonsumsi air putih paling sedikit 8 gelas/ hari. Dapatkan informasi lengkap tentang Milkuma di www.milkuma.com. Milkuma sudah tersedia di apotek2 juga toko2 obat terdekat dikota anda, atau hubungi, Sumut : 085314072195 / 061-91128785. Depkes RI NO. PIRT.6.09.3328.01.395.

Demokrat Berharap Angie Buka Suara Termasuk Sebut Anas jika Memang Terlibat JAKARTA- Kesiapan Komisi Pemberantasan Korupsi (KPK) memberikan reward kepada Angelina Sondakh jika bersedia menjadi whistle-blower direspons Partai Demokrat (PD). Ketua Divisi Komunikasi Publik PD Andi Nurpati menyatakan, pilihan terbaik bagi tersangka kasus suap wisma atlet dan korupsi di Kemendikbud itu justru bersikap kooperatif kepada penyidik. “Lebih baik sampaikan apa adanya semua yang diketahui dan dialami,” tutur Nurpati setelah konferensi pers terkait Hari Buruh Internasional di Warung Daun, Jakarta, kemarin (1/5). Menurut Nurpati, jika benar ada nama lain yang ikut terlibat, sebaiknya Angie “sapaan Angelina Sondakh” membeberkannya secara terbuka. “Sehingga Mbak Angie tidak hanya sendirian kalau faktanya memang ada yang lain,” tandasjurubicaraDPPPDtersebut. Dugaan keterlibatan sejumlah pihak lain itu, lanjut dia, setidaknya mengacu pada sejumlah pernyataan yang kerap dilontarkan terdakwa kasus wisma atlet M. Nazaruddin. “Siapa pun, apakah itu dari Demokrat atau dari luar, kami berharap bisa diceritakan semuanya,” tegas mantan anggota KPU tersebut. Apakah tidak khawatir jika ternyata juga akhirnya menyeret petinggi PD, termasuk Ketua Umum Anas Urbaningrum” “Demokrat sama sekali tidak khawatir. Sekali lagi, silakan Mbak Angie terbuka. Pak SBY kan selalu mendorongbahwahukumitutidak boleh pandang bulu,” ucapnya. Meski demikian, Nurpati mengingatkan KPK sebagai lembaga yang menangani perkara

yang membelit Angie agar juga bisa tetap menjaga profesionalitasnya. Lembaga yang dipimpin Abraham Samad itu tidak boleh bertindak atas permintaan atau tekanan pihak-pihak tertentu. Nurpati merasa perlu menyampaikan imbauan tersebut karena pihaknya sempat mendengar informasi bahwa ada pihak yang berusaha menekan KPK. Pihak yang dipastikan dari luar PD itu, ungkap dia, sempat meminta KPK segera menetapkan status tersangka kepada pihak lain yang selamainijugakerapdisebut-sebut ikut terlibat. “Ada permintaan di antaranya agar Mas Anas juga segera ditetapkan (tersangka). Ini kan tidak tepat. Sebaiknya biarkan KPKberlakuprofesional,”tuturnya. Sebagaimanadiberitakan,Nazaruddin berkali-kali menyebut keterlibatannama-namalain.Selain Angie yang akhirnya menjadi tersangka, mantan bendahara umumPDitujugakerapmenyebut nama sang Ketua Umum Anas Urbaningrum,MenporaAndiMallarangeng, Wakil Ketua Banggar Mirwan Amir, Ketua Komisi X Mahyuddin, dan beberapa nama lain. Dari luar partai, muncul pula nama anggota Banggar DPR dari PDIP Wayan Koster. Senada dengan Nurpati, Ketua Departemen Perekonomian DPP PDsekaligusWakilKetuaFraksiPD Sutan Bhatoegana menyatakan bahwa partainya selalu siap menerima kemungkinan terburuk keterlibatan kadernya dalam perkara korupsi wisma atlet atau kasus lainnya. “Kita serahkan saja kepada KPK. Apa pun konsekuensi terhadap individu adalah tanggung jawab masing-masing,” ucap Sutan. (dyn/c9/agm)

Selamat Jalan Bu Mentri

SERBASALAH KARENASAKIT MAAG? MINUM SUSU KAMBING SOLUSINYA... Maag atau r a d a n g lambung atau t u k a k lambung adalah gejala penyakit y a n g menyerang lambung dikarenakan terjadi luka atau peradangan pada lambung yang menyebabkan sakit, mulas, dan perih pada perut. Penyebabnya bisa karena penderita makannya tidak teratur, terdapat mikroorganisme yang merugikan, mengonsumsi obat-obatan tertentu, atau sebabsebab lainnya seperti mengonsumsi alkohol, pola tidur yang tidak teratur dan stress. Keluhan maag ini telah dirasakan oleh Muhammad Anhar yang sehari-harinya bekerja sebagai karyawan di sebuah toko grosir dan eceran busana muslim. "Kalau maag saya kambuh, rasanya jadi serba salah, makan salah, tidak makan pun salah, beraktifitas jadi terhambat." Cerita pria yang akrab disapaAnhar tersebut. Untunglah, kini ia sudah menemukan cara tepat untuk mengatasi keluhan yang telah dialaminya selama 6 bulan

„ Angie

Sambungan Halaman 1 Jakarta Timur. Jenazah dibawa menuju rumah duka pada pukul 14.05 WIB. Jenazah sampai di rumah duka pada pukul 14.58 WIB. Jenazah Endang dibalut kain kafan berwarna putih diselimuti kain hijau dengan tulisan kaligrafi. Suasana rumah duka di kediaman Endang cukup padat. Para pelayat terus berdatangan. Mulai dari saudara, kerabat dekat, para tetangga, hingga para staf di lingkungan Kemenkes. Sejumlah jajaran menteri dari Kabinet Indonesia Bersatu (KIB) Jilid II juga ikut datang melayat. Diantaranya, Menlu Marty Natalegawa, Menteri Koperasi dan UKM Syarif Hasan, Mendagri Gamawan Fauzi, Menteri Pekerjaan Umum Djoko Kirmanto, Menteri Pertanian Suswono, Menkopolhukam Djoko Suyanto, Menhut Zulkifli Hasan,MensosSalimSegafAlJufri, Menkominfo Tifatul Sembiring hingga Mantan Menteri Pemberdayaan Perempuan dan Perlindungan Anak Meutia Hatta. Sebelumnya, saat jenazah masih berada di rumah sakit, tampak Menkokesra Agung Laksono, Menteri Negara

„ Endang Rahayu Sedyaningsih Perencanaan Pembangunan Nasional (PPN)/ Kepala Bappenas Armida Alisjahbana dan Menakertrans Muhaimin Iskandar. Para menteri tersebut merasa kehilangan dengan meninggalnya Endang. Tidak hanya jajaran menteri, Presiden RI Susilo Bambang Yudhoyono dan Wapres Boediono pun ikut menyampaikan rasa belasungkawanya ke rumah duka. Menkes meninggalkan suami, Dr. Reanny Mamahit, SpOG dan tiga orang anak, yakni Arinanda

Wailan Mamahit, Awandha Raspati Mamahit, Rayinda Raumanen Mamahit. Selama menerima tamu yang melayat, sang suami menampakkan kesedihan yang mendalam. Dia lebih banyak diam. Sementara itu, ketiga putranya juga tampak sedih. Bahkan putra keduanya, Awandha Raspati Mamahit yang baru saja tiba dari Jenewa, Swiss tak kuasa menahan tangis. Dia terus memeluk foto ibunya. Beberapa kerabat pun berusaha menenangkannya. Menurut rencana, jenazah Menkes akan diberangkatkan ke

kantor Kemenkes untuk mendapatkan penghormatan terakhir pada pukul 07.00 hingga pukul 09.00 WIB. “Besok akan diberangkatkan dari rumah duka untuk penghormatan terakhir di Ruang Leimena, Gedung Kemenkes. Lalu pada pukul 09.00 WIB akan diberangkatkan ke San Diego Hills, Karawang untuk dimakamkan. Bertindak sebagai inspektur upacara saat pemakaman adalah Presiden SBY,”jelas Sekjen Kemenkes Ratna Rosita, kemarin. Menkes Endang Sedyaningsih akhirnya menyerah pada penyakit kanker paru-paru yang dideritanya. Pejabat kelahiran 1 Februari itu terdeteksi memiliki kanker saat menjalani check up kesehatan rutin pada bulan Oktober 2010. Kanker yang diderita Endang sudah mencapai stadium lanjut yakni stadium IV. Dari pemeriksaan lebih lanjut itulah ditemukan adanya kanker di tubuhnya. Setelah menerima berita tersebut, Endang lantas mengaku telah melaporkan kondisinya ke Presiden Susilo Bambang Yudhoyono dan menerima dukungan untuk berobat. (ken)

DALAM PELIPUTAN, WARTAWAN METRO TAPANULI SELALU DIBEKALI IDENTITAS DIRI DAN TIDAK DIBENARKAN MEMINTA SERTA MENERIMA APAPUN DARI NARASUMBER BILA ADA YANG MERASA DIRUGIKAN OLEH WARTAWAN METRO TAPANULI, DIMINTA UNTUK MELAPOR KE PIHAK BERWAJIB ATAU HUBUNGI 0631-24676


KAMIS

3 Mei 2012

Pekan Hujan, Pedagang Gigit Jari BARUS-Hujan deras yang mengguyur Kota Barus dan sekitarnya pada hari pekan, Rabu (2/5), membuat pedagang di Pasar Onan Barus terpaksa gigit jari. Pasalnya, akibat hujan deras tersebut membuat pendapatan para pedagang merosot drastis. “Kalau sudah hujan seperti ini pasti pembeli sepi. Karena orang-orang jadi malas berbelanja, kalau sudah begini alamat dagangan tidak laku. Harga normal sayur mayur seperti kangkung, bayam dan daun ubi itu Rp1000 perikat, sudah hujan begini ditawarkan Rp500 pun tidak laku. Dan kalau tidak laku besok tidak akan bisa dijual lagi karena sudah busuk,” ujar Rani Simamora, salah seorang pedagang sayur mayur yang ditemui METRO di Pasar Onan Barus. Senada dengan itu, R Purba mengaku bahwa setiap turun hujan dihari pekan secara otomatis harga dagangan menjadi menurun drastis. “Sayur-sayur seperti kol dan sawi ini kalau sudah kena hujan akan menjadi sangat cepat busuk. Jika tidak laku pasti kami akan rugi besar. Maka terpaksalah menjual dengan harga miring setidak-

nya tidak rugi total,” tambahnya. Selain itu, R Purba menerangkan kondisi pajak yang menjadi becek karena hujan menjadi salah satu penyebab daya beli menurun karena para pembeli menjadi enggan berjalan di lumpur untuk berbelanja. “Terutama kami para pedagang sayur ini, hujan menjadi faktor utama penyebab dagangan kami tidak laku. Kalau para pedagang barang jadi seperti pakaian dan barang-barang toko hujan tidak akan berpengaruh pada dagangan mereka. Selain barang mereka awet dan tempat dagangan mereka pun aman dari hujan sementara kami pedagang sayur mayur begini hanya berjualan di pinggir jalan atau halaman rumah warga, jadi kalau hujan dagangan sering terendam. Kalau tak laku ya rugilah,” keluh Purba. (rin/nasa)

(photo.Rinawati Marbun)

„ Jalan kota Barus bagaikan kolam musiman saat musim hujan. Oleh karenanya warga minta Pemkab Tapteng segera memperbaikinya.

Jalan Berubah Jadi Kolam Musiman BARUS-Kondisi jalan-jalan di Kecamatan Barus sudah masuk dalam kategori memprihatinkan. Pasalnya, dalam 5 tahun terakhir kondisi jalan Kota Barus hampir 70 persen dalam keadaan rusak. Kerusakan yang terjadi sangat beragam, mulai hanya terkelupas sebahagian sampai yang telah membentuk lubang besar di tengah-tengah ruas jalan. Sayangnya, hingga saat ini kondisi tersebut tidak mendapat penanganan yang berarti dari pihak pemerintah. Lubang-lubang besar di tengah ruas jalan tentu saja menjadi faktor

yang sangat serius terhadap keselamatan para pengendara. Pasalnya para pengendara terutama pengendara sepedamotor sering mencuri jalan untuk menghindari lubang. Hal itu sering mengakibatkan terjadi kecelakaan. Selain itu, lubang besar di ruas jalan menjadi kolam musiman ketika diguyur hujan. Kondisi ini telah lama dikeluhkan oleh para warga Barus dan sekitarnya. Seperti yang dikeluhkan oleh M Simamora kepada METRO, Rabu (2/5). “Saya sangat kecewa dengan kondisi jalan-jalan di Kota Barus ini. Sampai saat ini dimana-mana masih

sangat banyak jalan-jalan yang rusak. Bahkan di jalan-jalan lintas sekalipun. Misalnya sepanjang jalan lintas SM Raja Barus, tepatnya di depan panti asuhan dan di depan SPBU Barus. Kedua ruas jalan tersebut selalu menjadi langganan kolam nmusiman saat hujan,” terang Simamora panjang lebar. Ditambahkan oleh Simamora, bahwa kolam musiman tidak hanya terjadi karena kerusakan jalan namun juga kondisi tanah jalan yang menurun. “Jalan yang di depan SPBU itu tidak ada rusaknya, namun tanah jalan sudah sangat turun sehingga

membentuk cekungan, maka jika hujan sedikit saja ruas jalan itu langsung tergenang, ditambah lagi tidak ada gorong-gorong atau parit untuk mengalirkan air. Sehingga air yang bertahan menjadi sangat lama mongering,” tambahnya. Para warga Barus berharap kepada pemeintah Kabupaten Tapanuli Tengah agar secepatnya menangani kerusakan-kerusakan jalan di Tapanuli Tengah dan Kecamatan Barus khususnya. Sehingga aktifitas perjalanan warga tidak terganggu dan mengurangi resiko terjadinya lakalantas. (rin/nasa)

Hardiknas, Murid SD Gelar Jalan Santai BARUS-Menyambut peringatan Hari Pendidikan Nasional (Hardiknas) yang jatuh pada tanggal 2 Mei, ribuan murid SD baik negeri maupun swasta se Kecamatan Barus, Senin (1/ 5) menggelar jalan santai. Gerak jalan santai yang mengambil finish di depan kantor Camat Barus tersebut dimulai dari pukul 06.00 WIB. Kepala sekolah Madrasah Ibtidaiyah Negeri Barus, Juslaini Munthe sebagai salah satu peserta gerak jalan santai, mengatakan bahwa jalan santai tersebut merupakan gagasan dari Dinas Pendidikan Kecamatan Barus dan Camat Barus dalam rangka memeriahkan peringatan Hardiknas. Selain diikuti oleh murid SD, jalan santai tersebut juga diiringi oleh ratusan guru dan kepala sekolah dari masingmasing SD. Suasana jalan santai semakin meriah dengan alunan lagu-lagu nasional yang dinyanyikan oleh para

peserta sepanjang perjalanan. “Jalan santai ini start di depan kantor camat mengambil rute keliling dari Jalan K S Tubun menuju Pasar Terandam dan keluar dari Simpang Kantor Pos Pasar Batu Gerigis terus melewati Pasar Onan Barus tembus ke Jalan A Yani Kampung Solok berlanjut ke Jalan Syekh Rukunuddin dan Jalan Hamzah Fansyuri. Kemudian diteruskan ke Jalan S M Raja simpang Kantor Polisi dan kembali ke depan kantor Camat Barus,” ujar Juslaini. Salah seorang murid SD Negeri Padang Masiang 2, Nur Lestari, mengaku sangat senang dengan acara tersebut karena bisa bergabung bersama seluruh siswa SD se Kecamatan Barus. “Walaupun berjalan keliling-keliling tapi tidak terasa capeknya karena jalannya sambil bernyanyi dan senang juga karena sangat ramai,” pungkasnya. (rin/nasa)


KAMIS

3 Mei 2012

APA KATA MEREKA Saya tidak ambisi untuk mempunyai jabatan, tapi jika memang dibutuhkan oleh masyarakat saya siap untuk maju. Jika memang pada nantinya diberi amanah, saya siap.

Saya tetap komitmen kalau tidak tercapai saya mundur.Target e-KTP sebesar 172 juta sebenarnya dapat tercapai jika semua pihak bekerja keras sesuai dengan yang telah disepakati. Hingga April 2012, Kemendagri telah mencatat perekaman sebesar 72 juta e-KTP atau melebihi target awal sebesar 67 juta e KTP.

Mantan Wakil Presiden RI Jusuf Kalla, rabu (2/5)

Mendagri Gemawan Fauzi, Rabu (2/5)

Kita harus membuat terobosan dengan membantu kepada orang-orang kecil, dengan aktif supaya rakyat kecil tahu ada yang menjadi hak-hak mereka. Jangan kita terpaku dan berharap bisa efektif dan bukan hanya sebagai pajangan. Menkumham Amir Syamsuddin, Rabu (2/5)

Kirim Opini Anda ke email: metrotapanuli @yahoo.com. Maksimal tulisan 5.000 karakter.

Sikap Kami Masalah Sosial dan Kesadaran Sosialnya Semua kita tahu bahwa bulan Mei itu bulan penuh sejarah bagi bangsa kita. Pada awal Mei, 1 Mei, kita menghadapi Hari Internasional Buruh –bangsa Indonesiasejatinyaterbentukdarimentalburuhataubekerja sama-sama sembari canda-tawa- Selain itu, ada Harkitnas, Hardiknas, Peringatan Marsinah, dan harihari penting reformasi 1998. Begitulah sejarah yang tercecer pada bulan Mei ini. Ceceran sejarah itu, selain jadi reflektif sosial, merupakan simbol sosial dalam bangsanya. Sejarah itu adalah penanda dari suatu petanda. Simbol tersebut ibarat cermin. Ketika kita becermin, kitaakanmelihatsiapadirikitayangsebenarnya.Apakah diwajahkitaadanoda,apakahdiwajahkitaadajerawat, apakah di wajah kita ada luka, atau menarik atau tidak menarikkah wajah kita. Itulah sekelumit pencerminan tadi. Karena dengan cerminlah kita bisa menyesuaikan diri, baik itu menyesuaikan diri terhadap lingkungan maupun menyesuaikan diri terhadap pasangan. Sesungguhnya, ceceran sejarah tadi merupakan masalah-masalah sosial yang takkunjung usai, atau setidaknya menemui titik klimaks –ibarat ingin mencium kekasih, selalu saja ada gangguan-. Misalnya, sejarah Hardiknas, sebuah momentum perjuangan pendidikan bagi bangsa Indonesia –kala itu masih Nusantara- yang dilakukan oleh Bung Oetomo. Buktinya, IPM (Indeks Pembangunan Manusia) atau HDI (Human Development Index) kita masih jauh tertinggal dibandingkan negara-negara Asia lainnya, apalagi dibandingkan negara-negara di dunia. Pendidikan sebagai salah satu unsur penting terhadap pembangunan sosial belum pernah mencapai titik puncaknya terbaiknya, kecuali dalam hal kontribusi guru ke Malaysia ketika Malaysia gencar membangun negaranya melalui pendidikan. Ada banyak masalah sosial yang masih kita hadapi sampai saat ini, setelah 60 tahun lebih merdeka. Selain permasalahan yang ada di dalam cermin yang disebut di atas, masalah-masalah sosial lainnya yang sedang kita hadapi, misalnya korupsi, kemacetan, konflik antarwarga, konflik antar kelompok, hingga permasalahan fundamen itu semua, yakni kemiskinan. Dalamkehidupanbernegara,titikpermasalahansosial sepertiinimemangadapadatitiktertinggidistruktursosial, yaknipemerintah(negara).Halinisudahseringdiungkap di dalam tulisan-tulisan pada umumnya. Di sini, dalam tulisan ini, saya akan menyoroti titik permasalahannya padaindividu(unsurpembentuksosial). Dalamkonteksekspansikapitalismediberbagailini saat ini, termasuk di dalam pikiran pejabat dalam menjalankan fungsi jabatannya, dehumanisasi adalah satu dampak sosial yang patut dicermati. Dehumanisasi merupakan suatu sifat yang merusak atau menghancurkan sifat kemanusiawian. Rakyat-dehumanisasi tadi akan hidup semakin liar ibarat hewan liar –semakin ia dibebaskan semakin ia membuas-. Salah satu wujudnya adalah membeludaknya kepemilikan kenderaan pribadi. Dalam satu rumah saja kita temui ada tiga atau empat mobil, apalagi motor. Padahal, anggota keluarganya hanya tiga orang. Mobil-mobil tersebut cuma sebatas konsumsi makna tanpa melihat fungsi, sebab tidak menyesuaikan orang yang ada terhadap ketersediaan fasilitas di mobilnya. Sehingga, hal itu, merusak nilai-nilai empati sesama individumanusia karena saling berebut memiliki mobil –hartasebanyak-banyaknya, tanpa memikirkan kesempatan orang lain untuk memilikinya. Ketidaksederhaan sikap mendasari hal di atas. Ibaratnya, seseorang yang sudah memegang nasi padang di tangan kanannya masih ingin nasi bakar menu special. Kesederhanaan merupakan cara hidup yang manusiawi. Artinya, kita hidup sesuai kebutuhan saja, baik kebutuhan sendiri maupun kebutuhan keluarganya. Mengapa kita pilih hidup sederhana sesuai kebutuhan masing-masing saja? Dari itulah, kesadaran tiap-tiap individu sangat penting dicanangkan di pikiran masing-masing. Kesadaranpunbukansemata-matatumbuhbegitu saja. Perlu adanya peran pemerintah. Pun proses kesadaran didorong oleh tiap-tiap individu itu sendiri, tentunya dengan kesadaran yang berbasis pengetahuan.Misalnya,menanamkankesadarantersebutke dalam materi pengajaran peserta didik. Dengan kesadaran berbasis pengetahuan itu, berarti kita telah memahamimanayangbenardantepatsertamanayang salah dan tidak tepat. Bila kita tahu pembedaan seperti itu, mental kita pun (sebagai rakyat) secara otomatis tidak akan menjadi mental infantil (mental yang menguntungkanpenguasa-kekuasaan)Haliniserupaadigum klasik, berani karena benar takut karena salah. Jadi, kembali ke awal ulasan, dengan kesadaran seperti itu sebagai modal becermin (red: melihat sejarah) kita akan mudah menyesuaikan diri untuk menyejahterakan rakyat tanpa masuk ke lubang sejarah. Selayaknya orang becermin, setelah membersihkan diri dan memahami diri, maka ke mana pun kita pergi akan merasa yakin (Pede) sehingga mampu menguasai lingkungan maupun menguasai tujuan. Dengan begitu pula konteks sosial dengan kesadaran sosialnya di dalam melihat sejarah, otomatis kita menguasai tujuan bersama tanpa terjerumus ke ‘lubang hitam’ sejarah. (***)

Menggelorakan Budaya Menulis Anak Bangsa Setiap tanggal 2 Mei, pemerintah Indonesia memperingatinya sebagai Hardiknas (Hari Pendidikan Nasional). Berdasarkan Surat Keputusan Presiden RI No. 305 tahun 1959 yang dikeluarkan pada 28/11/1959, tanggal 2 Mei dijadikan Hari Pendidikan Nasional untuk mengapresiasi jasa-jasa Suwardi Suryaningrat -yang lebih dikenal dengan nama Ki Hajar Dewantara (KHD)- dalam merintis pendidikan umum. Dua Mei adalah tanggal lahir KHD.

Ahmad Arif Ginting Surat Keputusan itu juga menyatakan KHD sebagai Bapak Pendidikan Nasional Indonesia. Bagian dari semboyan ciptaannya, tut wuri handayani, menjadi slogan Kementerian Pendidikan Nasional Indonesia. Di samping itu, namanya diabadikan sebagai salah satu nama kapal perang Indonesia, KRI Ki Hajar Dewantara. Potret dirinya pun diabadikan pada uang kertas pecahan 20.000 rupiah tahun emisi 1998. Ironi Perguruan Tinggi Salah satu ironi dunia pendidikan di Indonesia adalah rendahnya budaya literer (penulisan). Dan, perguruan tinggi adalah titik kulminasi ironi itu. Dalam catatan Pusat Dokumentasi dan Informasi Ilmiah Lembaga Ilmu Pengetahuan Indonesia (PDII LIPI), hingga saat ini, jumlah jurnal ilmiah (cetak) di Indonesia hanya sekitar 7.000 buah. Dari jumlah tersebut, hanya 4.000 jurnal yang masih terbit secara rutin, dan sedikitnya hanya 300 jurnal ilmiah nasional yang telah mendapatkan akreditasi LIPI. Sedangkan data dari Scimagojr, Journal and Country Rank tahun 2011 menunjukkan selama kurun 1996-2010 Indonesia telah memiliki 13.047 jurnal ilmiah. Dari 236 negara yang di-ranking, Indonesia berada di posisi ke-64. Sementara Malaysia telah memiliki 55.211 jurnal ilmiah dan Thailand 58.931 jurnal ilmiah (Kompas.com, 7/2/2012). Di sisi lain, dari data yang dikeluarkan Kemendikbud, seperti yang dilansir oleh berbagai media online (27/2/ 2012), terlihat grafik publikasi jurnal ilmiah Indonesia cenderung datar sejak tahun 2006, sedangkan negara berkembang justru melesat tajam sejak tahun 2003. Publikasi jurnal ilmiah Indonesia per juta penduduk pada tahun 1996 terletak pada angka 1, hingga 2010 angka itu hanya mengalami sedikit kenaikan yang mencapai angka 4. Sementara, untuk negara berkembang, angka 26 pada tahun 1996 melonjak tajam hingga mencapai angka 35 pada tahun 2010. Jumlah publikasi jurnal ilmiah Indonesia pada tahun 2010 pada angka 4, sedangkan Malaysia berada paling puncak di angka 500 pada tahun yang sama. Malaysia pun mengungguli negara lain pada tahun yang sama, seperti

Turkey pada angka 400, China pada angka 240, Thailand pada angka 130, Mesir pada angka 100, India di angka 50, Vietnam 10, dan Filipina di angka 5. Data dan fakta itulah yang kemudian dijadikan dasar kebijakan dari Kebijakan Kemendiknas yang menjadi kontroversi sebagaimana termaktub dalam surat Dirjen Dikti bertanggal 27 Januari 2012 tentang publikasi karya ilmiah untuk mahasiswa S-1, S-2, dan S-3 sebagai syarat kelulusan yang berlaku mulai Agustus 2012; S1 harus ada makalah yang terbit di jurnal ilmiah; S2 harus ada makalah yang terbit di jurnal ilmiah terakreditasi Dikti; S3 harus ada makalah yang terbit di jurnal Internasional. Beban Psikologis Menulis adalah ekspresi personal, demikian jelas Eep Saifullah Fatah dalam “Menuntaskan Perubahan; Catatan Politik 1998-1999 (Mizan, 2000; xlviii-lv) secara panjang lebar. Melalui penulisan, menurut Eep, seorang penulis itu sedang menggunakan haknya sebagai warga Negara untuk menyampaikan pikiran secara bebas. Menulis bukanlah kegiatan publik yang penuh potensi ancaman. Siapa pun sebetulnya berpotensi menjadi penulis. Buktinya, setiap orang bisa menulis diary-nya dengan lancar, runtut, baik, ekspresif, artikulatif. Ketika orang menulis diary-nya sendiri, ia dalam situasi psikologis yang bebas, tidak merasa sedang diancam oleh siapa pun. Ia memosisikan kegiatan penulisan diary-nya sebagai kegiatan ekspresi personal yang tak memerlukan penilai dan pemberi sanksi. Toh, sebuah diary tak akan dibaca orang. Karena itulah ia bisa menulis dengan baik. Tetapi ketika penulis diary itu mulai menulis artikel atau laporan yang akan dibaca orang, maka jadilah ia penulis yang tersendatsendat, ekspresinya macet, sulit meruntutkan gagasan, artikulasinya terhambat, dan kerap kali gagal. Sebabnya, ketika menulis, mereka mereposisi sindiri menjadi individu yang terkerangkeng oleh hantu ancaman yang dibentuknya sendiri. Reposisi inilah yang keliru. Jadi, kuncinya adalah pada beban psikologis sebagai pemilik gagasan. Dalam tradisi oral, orang akan merasa punya beban yang sedikit saja atau bahkan tidak punya sama sekali. Tapi ketika ia masuk ke tradisi literer, tradisi tulisan, beban itu bertambah bertumpuk-tumpuk. Ketika akan menuliskan gagasannya, setiap calon penulis seperti sedang menyusun sendiri bukti-bukti kuat yang bisa membuatnya diberi sanksi. Entah sanksi moral, sosial, hukum, atau politik. Maka ia pun gagap menulis karena beban itu. Celakanya, institusi pendidikan kita, baik formal maupun informal, justru mengajarkan sikap dasar menulis yang keliru. Sekolah, misalnya, justru menjadi tempat yang menyeragamkan materi pikiran dan cara berpikir setiap calon penulis. Di samping itu, guru kerap kali bertindak secara sewenang-wenang sebagai penilai dan pemberi sanksi yang seolah-olah memiliki hierarki dan autoritas lebih tinggi ketimbang si penulis, murid mereka. Maka sejak awal, pelajaran mengarang di sekolah justru mematikan potensi-potensi kemunculan calon penulis besar di

temapat kita. Wajarlah bila dari penduduk Indonesia yang berjumlah 240 juta jiwa lebih, sangat sedikit kemudian yang bisa menjadi penulis andal. Dan tentu saja, sangat sedikit buku yang dihasilkannya. Hubungan guru-murid tadi sebetulnya merupkan replika dari sistem relasi sosial-politik yang ada di luar sekolah dalam kerangka yang lebih makro. Sentralisasi, penyeragaman, rezimentasi, represi dan praktik-praktik sejenisnya telah lama menjadi ciri pokok sistem sosial politik kita. Dalam konteks inilah kemudian orang dipaksa kehilangan indivualitasnya, jati dirinya, bahkan kemanusiaannya. Ini kemudian ikut memberikan sumbangan besar bagi kemacetan dan kemandekan luar biasa dalam dunia literer kita, dalam dunia penulisan kita. Kematian pontensi para penulis kita pun bisa diletakkan dalam carut-marut sistem yang sesat keliru semacam itu. Menggelorakan Budaya Menulis Nah, untuk menggelorakan budaya literer anak bangsa, Eep menguraikan tiga hal yang sangat penting bagi seorang penulis. Pertama, kemampuan teknis. Mau tidak mau, seorang penulis mesti terus menerus melatih kemampuannya menulis. Ini bukan untuk mencapai satu gaya akhir yang final dan permanen, melainkan untuk makin mengefektifkan penyampaian pesan yang disampaikannya lewat tulisan. Mereka yang cepat putus asa dan gampang menyerah kalah, berhenti berlatih menulis, pasti akan gagal menjadi penyampai pesan yang baik. Kemampuan teknis adalah faktor tertier yang mendampingi dua faktor lain yang bersifat sekunder dan primer. Kedua, sistem sosial politik di sekitar kegiatan penulisan. Dalam sistem yang membebaskan, semua jenis tulisan akan bisa berkembang. Sementara dalam sistem yang mengekang, hanya tulisan yang berbau humor dan anekdot yang akan berkembang. Sistem inilah faktor sekunder itu. Ketiga, faktor primernya terletak pada kualitas kemanusian masing-masing calon penulis. Warga Negara yang memiliki tirani di kepalanya –yang membuatnya punya banyak hantu rekaannya sendiri, yang membuatnya takut, terkekang, dan tak bisa mengaktualisasikan kemanusiaannya secara utuh- akan sulit menjadi penulis. Sebaliknya, warga Negara yang bisa membebaskan diri dari tirani semacam itu pasti akan mampu menuliskan apa yang ia pikirkan dengan baik. Jadi, sekali pun sistemnya mengekang dan ia punya kemampuan menulis terbatas, seseorang akan tetap bisa melakukan kegiatan penulisan dengan baik manakala ia sudah berhasil membangun kualitas dirinya sebagai warga Negara dengan kemanusiaan yang utuh. Tentu saja, suasana penulisan yang terbaik akan bisa dicapai manakala kemampuan teknik yang tinggi bertemu dengan sistem yang membebaskan dan utuhnya kualitas kemanusiaan penulis. Semoga. (***) Penulis adalah pemilik RUMAN (Rumoh Baca Aneuk Nanggroe) Banda Aceh


KAMIS

3 Mei 2012

Dikira Mayat Dalam Mobil

Diserbu Polisi

POZNAN-Seorang tukang bangunan Polandia yang sedang tidur terbangun dari tidurnya setelah diserbu polisi. Pria itu disangka mayat oleh pihak kepolisian.

KEJADIAN ini dialami Bartek Bablewski yang tengah istirahat di dalam mobil dari lokasi sebuah kontruksi di Poznan. tidur tanpa mengenakan baju, sepertinya, membuat warga yang melihatnya merasa ketakutan. “Saya biasa tidur saat waktu istirahat. Pekerja bangunan adalah sulit,” ujar Bablewski, Rabu (2/5/2012). “Saya tidur tanpa mengenakan baju karena cuaca memang panas dan saya selalu tidur dengan lengan menyilang di dada. Beberapa saat kemudian, polisi dan petugas medis mencoba membuka pintu mobil saya dengan paksa. Itu membuat saya takut,” imbuhnya. Polisi kemudian meminta maaf kepada pria berusia 36 tahun tersebut. Mereka mengaku mendapatkan laporan dari warga mengenai adanya mayat di sebuah mobil.”Saat kami (polisi) melihatnya bergerak, kami juga ketakutan,” keterangan pihak polisi. (oz)

(Foto: Int)

TIDUR: Bartek Bablewski tidur di mobilnya

Miliki Tato

“Tuhan”

Perempuan AS Ditangkap OHIO - Seorang perempuan yang memiliki tato bertuliskan “God” atau Tuhan dalam bahasa Indonesia ditangkap oleh pihak kepolisian. Perempuan itu diketahui menguntit petugas penjara perempuan. Jamie Calloway yang memiliki tato unik di dahinya itu dituduh menguntit petugas penjara perempuan yang disukainya. Rasa suka yang dipendam Calloway sepertinya sudah tumbuh selama dirinya berada di Penjara Montgomery, Maryland, Amerika Serikat (AS). Perempuan berusia 33 tahun itu diketahui kerap mengirim

Ingin Barter

Justru Ditangkap WASHINGTON - Ada-ada saja ulah seorang perampok di Washington, Amerika Serikat (AS). Bukannya berusaha untuk menghilangkan jejak agar tidak tertangkap, perampok ini justru mengajukan sebuah penawaran yang membuatnya dengan mudah tertangkap. “Beberapa jam setelah menjalankan aksinya, perampok itu menghubungi korbannya. Ia (sang perampok) tiba-tiba saja mengajukan penawaran untuk menukarkan barang-barang berharga yang dirampoknya, dengan barangbarang miliknya yang tertinggal di rumah korbannya tersebut,” demikian tulis Yahoo! 7 Selasa, (1/5). Perampok itu mengaku, ia ingin menukarkan barang-barang berharga yang diambil dengan beberapa barang miliknya.Perampok tersebut khawatirkan dapat meninggalkan jejak dan mempermudah polisi melacak keberadaannya. Entah apa yang ada dibenak sang perampok, ia tiba-tiba saja mengikuti permintaan korbannya yang menyuruhnya untuk mengambil barang-barang miliknya yang tertinggal itu dirumah sang korban. Sontak saja, ketika ia tiba dirumah itu untuk mengambil barang-barang miliknya, sejumlah anggota kepolisian telah siap siaga melakukan penahanan terhadap dirinya.(oz)

Ditemukan 60 Kepala Manusia di Bandara

sipir itu dengan berbagai macam hadiah. Tetapi, dia juga dituduh menusuk ban mobil dari sipir itu, Rabu (2/5). Polisi dengan mudah mengidentifikasinya, karena tato yang ada di dahinya, termasuk juga beberapa gigi besi yang digunakannnya. Kini dirinya terpaksa mendekam di penjara atas ulah yang dilakukannya. Calloway merupakan satu pelaku kejahatan yang ditangkap polisi AS, karena tato yang dimilikinya. Lewat tato itu, polisi dengan mudah melakukan identifikasi.(oz)

ARKANSAS – Petugas Bandara Arkansas dikagetkan dengan penemuan pengiriman barang yang berisikan 60 kepala manusia. Para petugas melihat bahwa paket berisi kepala tersebut berlabel secara tidak lengkap, sehingga mereka mengecek apa isi paket tersebut. Petugas menemukan paket tersebut dibungkus dengan acak-acakan dan ditemukan pada minggu lalu. Setelah mereka melaporkan kejadian tersebut ke pihak kepolisian, kepala-kepala itu pun dikembalikan ke bagian koroner. Petugas Koroner Pulaski Garland Camper mengatakan, pengiriman tersebut menggunakan bahan plastik dan tidak menggunakan segel penerbangan. Penyelidikan lebih lanjut didapatkan kepala-kepala tersebut sedianya dikirimkan ke Medtronic Inc di Forth Worth, Texas. Kepala itu nantinya akan digunakan oleh para bedah syaraf untuk mempelajari telinga, hidung dan prosedur tenggorokan. Hal yang tidak biasa adalah cara pengiriman kepala-kepala tersebut dengan menggunakan fasilitas penerbangan komersial. Medtronic merupakan perusahaan alat kesehatan terbesar di dunia, mereka menggunakan perusahaan jasa pengiriman yang berada di Arkansas untuk mengirimkan kepala-kepala itu. (int)

(Foto: Int)

DITANGKAP POLISI: Jamie Calloway ditangkap polisi yang memiliki tato GOD (Tuhan) di kening.

Mobil Kanselir Jerman

LAKU Rp121 JUTA tertinggi, Dirk Fricke. Fricke membeli VW tersebut untuk perusahaannya, Frisch-Linch. Dia merasa senang mendapatkan VW itu walaupun dia bukan penggemar Merkel. ”Secara politis, kami ini netral,” ujarnya. ”Saya menawar hanya karena ingin

BERLIN-Mobil Volkswagen Kanselir Jerman Angela Merkel laku terjual di situs lelang online senilai 10.165 euro atau sekitar Rp 121 juta.

VW Golf buatan tahun 1990 itu berpindah tangan kepada penawar

„ VW Golf buatan tahun 1990

mobil tersebut tetap berada di Jerman. Mobil seperti ini sebaiknya tidak keluar dari Jerman, seperti yang terjadi pada mobil Paus beberapa tahun yang lalu,” katanya. Pada lelang serupa tahun 2005, seorang penawar dari Amerika Serikat menawar 250.000 dollar AS atau Rp 2,2 miliar untuk mobil VW Golf yang tadinya dimiliki Kardinal Joseph Ratzinger, yang kemudian menjadi Paus Benediktus XVI. (kps)

„ Kanselir Jerman Angela Merkel.

(Foto: int)

PENGUMPUL: Seorang pemulung mengumpulkan popok untuk dijadikan bahan bakar.

Jepang Ubah Limbah Popok Menjadi Bahan Bakar JEPANG-Populasi Jepang didominasi masyarakat berusia tua. Angka kelahiran di bawah rata-rata sehingga terjadi penurunan produksi popok bayi. Namun sebaliknya, produksi popok dewasa naik 7% dalam dua tahun ini dan mencapai lima miliar unit tahun lalu. Jepang miliki teknologi pengubah limbah popok dewasa menjadi bahan bakar yang baik. Perusahaan Enter Japanese telah menciptakan mesin SFD Recycle System yang merobek secara otomatis, mengeringkan dan mensterilisasi popok dewasa kotor dari rumah sakit dan rumah perawatan serta mengubahnya menjadi bahan bakar. Bahan bakar bebas bakteri ini dapat digunakan sebagai sumber panas biomassa dan kompor rumah atau pemanas air. Berbeda dengan alat daur ulang popok yang ada di Eropa, mesin-mesin ini dapat dipasang langsung pada sumbernya. Sebuah rumah sakit di Tokyo memiliki dua mesin yang mengolah 1,400 pon (635 kg) popok bekas setiap harinya. Alat ini membutuhkan waktu sehari untuk mengubah popok dewasa menjadi bahaan baker.Mesin Suoer Faith memiliki tiga model ukuran yang dapat mengolah 330-1.102 pon (150500 kg) popok per hari.(int)


KAMIS

3 Mei 2012

Kepala Sekolah Geranyangi Murid di Toilet SURABAYA- Achmad Fadil (42), seorang guru bahasa arab yang juga menjabat Kepala Madrasah Tsanawiyah, dibekuk polisi karena tertangkap basah tengah berbuat amoral dengan seorang siswinya di toilet Masjid tak jauh dari sekolahnya. “Pelaku adalah kepala madrasah. Dia digerebek warga dan diamankan saat berbuat mesum di toilet Masjid,” ungkap Kepala Satuan Reserse Kriminal Polres Malang AKP Bayu Indra Wiguno, Selasa (1/5). Dikatakan Bayu, korban perbuatan asusila berinisial SM. Umurnya masih 15 tahun. SM adalah siswi sebuah Madrasah Tsanawiyah di lokasi, Desa Sumberagung. Saat kejadian, SM digerayangi oleh pelaku di kamar mandi. Warga memergoki pelaku masuk ke dalam kamar mandi selepas zuhur. Warga yang curiga ada orang berlainan jenis masuk kamar mandi, menungguinya di luar. Tanpa diduga, di dalam kamar mandi itu didapati kedua-

nya sedang berasyik masyuk. “Pelaku sempat diamankan warga dan diserahkan ke Polsek Sumbermanjing Wetan. Saat ini, pelaku sudah kami amankan untuk menjalani pemeriksaan,” paparnya. Diketahui kemudian, pelaku merupakan Kepala Sekolah tempat SM menimba ilmu. Saat diperiksa penyidik Polres Malang, Fadil mengaku jika dia hanya meraba dan menciumi SM di kamar mandi. “Saya hanya meraba dan menciuminya saja,” terang Fadil. Saat didesak Fadil mengaku sudah berbuat mesum dengan SM sebanyak dua kali. “Hanya dua kali saja pak. Saat itu, saya melakukannya sewaktu SM saya ajak ke Surabaya dan Probolinggo,” pungkasnya. Fadil masih menjalani pemeriksaan intensif. Atas kasus yang dilakukannya, guru sekaligus kepala sekolah itu dijerat dengan pasal 81 UU Perlindungan Anak dengan ancaman hukuman 15 tahun penjara. (pk/int)

„ Jembatan Sei Rakyat Kecamatan Panai Tengah yang kondisinya berlubang. Dari jembatan ini, seorang siswi SMP nyemplung ke sungai. Hingga kini jasadnya belum ditemukan, Rabu (2/5).

JEMBATAN LAPUK, SISWI SMP NYEMPLUNG Jasad Belum Ditemukan RANTAU- Akibat kondisi lantai Jembatan Sei Rakyat, Kecamatan Panai Tengah yang sudah lapuk, siswi kelas II SMP Negeri 2 Panai Hulu, Sri Astuti (14) yang sedang melintas di atasnya, jatuh ke sungai, Rabu (2/5) sekira pukul 06.30 WIB. Hingga berita ini diturunkan, korban belum ditemukan.

„ Dua kakak-beradik korban pencabulan juragan kontrakan, membuat pengaduan di Polsek Sunggal, Rabu (2/5).

Juragan Kontrakan Garap Duo Kakak Adik

MEDAN- Dua wanita cantik, Yusti Diana (25) dan adiknya In (17), warga Jalan Pinang Baris Kelurahan Lalang, Medan Sunggal, mendatangi Mapolsek Sunggal, Rabu (2/5). Maksudnya mengadukan juragan rumah kontrakan Pak Haji Anwar (65) yang diketahui menetap di kawasan Jalan Binjai kilometer 10,5 setelah mencabuli keduanya. Keterangan dihimpun menyebutkan, peristiwa bermula ketika Yusti dan In mengontrak rumah milik Anwar di Jalan Pinang Baris, pada Februari silam. Selama menetap di kontrakan itu, Yusti kerap mendapatkan perlakuan yang tak senonoh setiap pelaku mendatangi kontrakannya. Singkat cerita, setelah menetap beberapa minggu di sana, pelaku mulai sering melakukan tindakan tak senonoh. Bahkan Anwar tak segan-segan meminta kakak adik ini melayani nafsu birahinya. Pernah korban diminta untuk memegang dan meremasremas kemaluan pelaku yang telah uzur ini. Namun semakin hari kelakuan Anwar semakin

menjadi-jadi. Bahkan sesuai pengakuan korban, ia kerap melayani nafsu Anwar dengan melakukan oral seks. Lama kelamaan itu tak bisa memuaskan Anwar dan meminta korban untuk melakukan yang lebih lagi. Awalnya terasa berat, namun dengan segala bujuk rayu dan intimidasi, korban akhirnya merelakan tubuh seksi dan mulusnya. Sebagai imbalannya, kakak beradik ini tidak perlu membayar kontrakan. Namun belakangan istri Anwar bernama Hj Samsiar (59) mengusir mereka. Tak pasrah begitu saja, mereka pun memilih melaporkan peristiwa itu ke Polsek Sunggal. Sementara Kanit Reskrim Polsek Sunggal AKP Victor Zilliwu saat dikonformasi mengatakan, pelapor bukanlah korban pencabulan karena ada unsur suka sama suka. “Kita masih mintai keterangan pelapor, Sebab sepertinya yang ia beratkan bukan pencabulannya. Tetapi karena pelapor di usir dari kontrakannya, sementara barang-barang miliknya masih di kontrakan,” tandasnya. (wel/mri)

Informasi diperoleh dari beberapa warga sekitar yang ikut melakukan pencarian, masingmasing Samsul (42), Jefri (34) dan Henny (36), dan Iyus (34), saat itu korban hendak pergi mengikuti upacara peringatan Hardiknas di Kecamatan Panai Hulu. Sesaat sebelum kejadian, Sri tampak berboncengan naik sepedamotor Honda Supra dengan temannya Fitri. Karena kondisi lantai jembatan yangterbuatdarikayubanyakyang berlubang, membuat para pengemudi bus, mobil dan sepedamotor yang hendak melintasi jembatan terpaksa antri. Melihat itu, Sri lalu berniat turun dari boncengan temannya dan berniat menyeberangi jembatan dengan berjalan kaki.

Namun naas, ketika Sribaru saja turun dari sepedamotor dan kakinya baru menginjak lantai jembatan, ternyata papan yang dipijaknya tak mampu menahan bobot badan korban. Lalu papan lapuk dan tubuh Sri terjatuh ke sungai. Sejumlah warga setempat yang melihat korban jatuh, berusaha menyelamatkan korban. Namun begitu mendarat di air sungai, tubuhnya langsung terbawa arus sekitar 70 meter dari lokasipertamaterjatuh.BahkanSri sempat melambaikan tangan dan berteriakmintatolongkepadawarga yang berada di jembatan. Beberapa warga lantas melemparkan jerigen ke sungai dengan harapan bisa dipakai Sri sebagai pegangan agar tidak tenggelam.

Beberapa warga lainnya lalu terjun ke sungai dan berusaha mengejar Sri yang dibawa arus sungai. Sayangnya ketika warga hampir meraihtubuhSri,iatenggelamdan tak terlihat lagi. Melihat itu warga lalu memanggil orangtuanya dan polisi.Dibantupetugaskeamanan, warga menyisir sungai. Namun tetap saja Sri belum ditemukan. Kedua orangtua korban, Parno (43) dan Jumiati (39), terlihat syok dan jatuh pingsan di pinggir sungai. Sementara Kanit Reskrim Polsek Panai Tengah Aiptu Kadiso mengatakan, pihaknya dibantu warga terus melakukan pencarian. “Kami masih melakukan pencarian terhadap korban,” terangnya. Sedangkan Sekretaris Disdik Labuhanbatu Hobol Z Rangkuti mengaku, sudah mendapat laporan via telepon seluler atas kejadian tersebut. ”Iya tadi saya dapat laporan secara lisan, dan masih menunggu kabar selanjutnya,” ujar Hobol. (riz)

Sakit Hati Dengan Pacar

Mahasiswi Tenggak Pembersih Lantai MEDAN- Wiwin Zulhafni Perwira (20) mahasiswi Unimed asal Kota Siantar yang kos di Jalan Belat Nomor 82, Medan Tembung, dilarikan ke RSUD Pirngadi Medan. Hal itu setelah cewek nekat menenggak obat pembersih lantai (wipol) karena sakit hati dengan pacarnya pada Rabu (2/ 5) sekitar pukul 14.30 WIB. Informasi yang berhasil dihimpun, peristiwa yang menyebabkan Wiwin harus dirawat ke ruang IGD rumah sakit berplat merah ini terjadi setelah korban ditemukan rekan satu kos-nya, Lusiana (22), dalam keadaan pingsan. Setelah dilihat, ternyata mulut korban tampak berbuih dan terbaring di lantai kamar kos. “Saya menemukan dia (Wiwin) sudah tak sadarkan diri

terbaring di lantai. Waktu itu saya yang mencoba memanggilnya karena dia tampak mengurung diri tanpa keluar kamar. Karena penasaran, saya mencoba memanggilnya, tapi tak ada sahutan. Saya pun menggedor pintu,” terang Lusiana. Karena tak mendengar sahutan dari kamar, Lusiana nekat mendobrak pintu. Mata Lusiana kemudian melihat temannya sudah terbaring tak sadarkan diri dengan mulut berbuih. Takut sesuatu hal buruk terjadi, Lusiana memanggil penghuni kos lain guna dimintai pertolongan. Selanjutnya Wiwin diberi minum susu guna menetralisir racun yang ditimbulkan obat pembersih lantai yang diminumnya. Karena tak ada hasil,

Wiwin dibawa ke klinik terdekat. Namun karenakan kurangnya alat yang memadai, Wiwin dirujuk ke RS Pirngadi. Namun karena kondisi fisik Wiwin mengkhawatirkan, ia harus diopname selama dua hari di ruang plus B lantai I rumah sakit tersebut. Belakangan diketahui, aksi nekat Wiwin terjadi setelah ia sakit hati dengan pacarnya. Pasalnya malam sebelum kejadian, Selasa (1/5), antara Wiwin dan pacarnya yang juga mahasiswa di Unimed, terlibat perang mulut via ponsel. Diduga pertengkaran dilatarbelakangi alasan yang sangat sensitif, sehingga pacar Wiwin yang diketahui berinisial A langsung datang ke kos-an gadis asal Kota Pematangsiantar ini. (zie/pmg)

Jambu Pemancing Gadis ABG Dalam cerita Si Unyil, Pak Raden marah jika jambunya diambili anak-anak. Kakek Mustam (75) justru sebaliknya, senang sekali. Tapi ternyata itu merupakan motif. Buah jambu itu sekedar pancingan, untuk menggiring ABG doyan jambu itu ke kamarnya dan kemudian digauli. Sekedar “uang lelah” diberinya gadis malang itu uang Rp1.000,Ingat Pak Raden yang galak pada anak-anak gara-gara buah jambu? Dia selalu curiga pada Unyil dan Usro, karena dikhawatirkan bocah itu akan mencuri buah jambu miliknya. Uniknya, meski kumis tebal dan suara menggelegar, punya penyakit klasik: encok. Penyakit itu akan mendadak kambuh, jika diminta kerja bakti bersama warga. Kakek Mustam dari Pidie (Aceh) ini berkebalikan dengan Pak Raden. Dia sangat sayang anak, sehingga ketika

buah jambunya yang ranum diambili anak-anak termasuk para ABG, malah senang. Kadang malah ikut membantu mengambilkan buah itu, sehingga nama kakek Mustam sangat populer di kalangan anak-anak di bilangan Baro Kunyet, Kecamatan Padang Tijie, Pidie. Namun ternyata, kedermawanan kakek Mustam punya motif tersembunyi. Dalam usia yang bau tanah, dia masih punya “gairah” manakala ketemu gadis ABG para pemburu jambu tersebut. Dan kepada gadis Mirna (16) dia sangat “memanjakan” dalam soal jambu itu tadi. Dia boleh ambil kapan saja, yang penting pamitan. “Kalau butuh jambu, tinggal ngomong saja ya. Pasti kakek kasih….,” ujarnya dengan suara serak, mirip Pak Raden memang. Seperti yang terjadi bebe-

rapa hari lalu, sejumlah anak gadis ABG mendatangi pohon jambu kakek Mustam. Kali ini justru lebih royal. Bukan saja boleh ambil jambu, tapi juga diberi uang masing-masing Rp1.000,- Tapi khusus untuk Mirna, dia malah diajak masuk ke dalam rumah, sementara ABG lainnya disuruh jaga di luar rumah. Katanya, jika nenek Mustam pulang, harap segera memberi tahu. Setengah jam kemudian, barulah Mirna keluar dari kamar kakek Mustam. Dia tak mau cerita apa yang terjadi di dalam. Cuma katanya, sekarang selangkangannya terasa sakit. Jalannya pun semakin nyata, jadi ngegang macam roda rontok lakhernya. “Hore, Mirna sudah jadi istri kakek Mustam,” ledek temanteman sekedar meraba-raba. Sejak itu, anak-anak kampung Baru Kunyet selalu menjuluki Mirna sebagai istri

kakek Mustam. Tentu saja orangtua Mirna jadi curiga. Apa maksud kata-kata itu? Dalam sebuah kesempatan, diinterogasilah putri kesayangan itu. Betapa terkejutnya orangtua, demi Mirna mengaku bahwa beberapa hari lalu dipaksa bersetubuh oleh kakek Mustam. Hampir saja orangtua malang itu mengerahkan warga untuk menghajar si kakek. Untung hal itu tak sampai dilakukan, karena saran sejumlah warga. Dengan hati panas, tapi kepala tetap dingin, kakek Mustam kemudian dilaporkan ke Polsek Padang Tijie. Polisi pun kaget juga, masa ada

kakek setua Mustam masih mikir begituan? Dalam pemeriksaan terungkap, bukan kali ini saja kakek Mustam berbuat cabul. Beberapa tahun lalu, gadis idiot sempat “ditelateni” juga hingga melahirkan. Tapi bayinya kemudian mati. Eh, di kala usia makin menanjak, Mustam bukannya tobat, malah masih juga menyetubuhi Mirna ABG anak tetangga. Mestinya getol cari pahala, malah mikirin paha! (pk/int)

12 Operator Genset PT Bridgestone Dipolisikan SIMALUNGUN- Sebanyak 12 operator mesin genset yang bekerja di Perkebunan Brigestone dipolisikan pihak perkebunan. Itu setelah mereka dituding lalai melaksanakan kerja, sehingga satu-satunya genset di perusahaan itu tidak bisa dipakai lagi. Informasi dihimpun, Rabu (2/ 5) menyebutkan, kerusakan genset pertama kali diketahui penanggung jawab mesin di PT Brigestone, Mulianto alias Acong, Selasa (1/5) siang. Saat itu aliran listrik padam. Karena tak mau aktifitas perusahaan terganggu, Acong menyuruh pegawai perkebunan menyalakan mesin genset ke gudang. Beberapa menit kemudian, pegawai yang semula disuruh menyalakan genset malah datang kembali dan menyampaikan kabar buruk. Dalam laporannya, saat ia ke lokasi mesin genset, gudang sudah didapati dalam keadaan terbuka. Sedangkan gembok gudang sudah rusak. Khusus mesin genset, sudah acak-acakan dan tidak bisa dinyalakan. Spontan, Acong yang tak percaya dengan laporan itu, mendatangi lokasi. Begitu melihat keadaan, ia menjad geram. Terlebih saat mesin tidak bisa di-

nyalakan. Akibatnya, banyak aktifitas di perkebunan yang terhambat. Selanjutnya Acong memanggil tiga operator genset yang dikenalnya untuk dimintai keterangan. Mereka adalah Samsul (50), Paino (55) dan Budi Nere (35), ketiganya warga Beringin, Kecamatan Tapian Dolok, Simalungun. Namun menurut para operator itu, kerusakan genset itu bukanlah disengaja. Meski begitu, Acong tidak dapat menerima alasan para operatornya. Tak lama dari kejadian Acong memilih membuat pengaduan ke Polres Simalungun. Dalam laporannya, selain tiga orang yang sudah dipanggil untuk dimintai keterangan, sembilan operator lain yang tidak ia kenali, juga diadukan. Kasubbag Humas AKP H Panggabean SH mengaku telah menerima laporan pengaduan Acong. “Laporannya bernomor LP/ 278/IV/SU/Simalungun. Sementara kedua belas tersangka terancam dijerat pasal 406 KUHPidana yo pasal 335 KUHPidana tentang pengerusakan dan perasaan tidak menyenangkan. (Osi/hez)

Foto Pra

„ Satu unit Betor BK 2130 KJ yang bertabrakan dengan Yamaha Mio di depan kantor PLN Siantar, Rabu (2/5).

Tak Kantongi Uang, Korban Sungkan Berobat SIANTAR-NaasdialamiSaputra (21). Uang yang pas-pasan di saku digunakannya untuk pangkas rambut. Usai memotong rambut, Yamaha Mio yang dikendarainya malah bertabrakan dengan betor (beca bermotor) di Jalan MH Sitorus, tepat di depan kantor PLN Cabang Pematangsiantar. Setelah dibawa ke rumah sakit, ia tak mau masuk ruang perawatan. Alasannya, menunggu keluarga karena tak mengantongi uang. Peristiwa terjadi saat Saputra melaju dari Jalan Kartini menuju Jalan H Adam Malik. Tepat saat sepedamotornya melaju di depan Kantor PLN, dari arah berlawanan datang satu unit becak bermotor BK 2130 KJ, dikemudikan Apintus Pangaribuan (30-an) yang sedang membawa istri dan dua anaknya dengan kecepatan tinggi. Akibat kurang hati-hati, kedua kendaraan akhirnya bertabrakan. Begituterdengarsuarabenturan, Saputra dan sepedamotornya masuk parit. Hal yang sama juga terjadi Apintus dan keluarganya. Beruntung luka-luka yang dialami

sekeluarga ini tak begitu parah. Hanya mengalami lecet di tangan dan kaki saja. Warga sekitar lokasi yang menyaksikan kejadian, berusaha memberikanpertolongan.Saputra dan keluarga Apintus pun dibawa ke RS Tiara. Setibanya di rumah sakit, sekeluarga warga Jalan Enggang Kelurahan Sipinggol-pinggol ini langsung dirawat di UGD. Istri Apinten tampak berbaring dan mengalami luka di beberapa bagian tubuhnya. Termasuk ketiga anaknya yang berusia 8 tahun dan 10 tahun. Namun lain halnya dengan Saputra. Pemuda yang mengalami luka di tangan dan dadanya ini malah terlihat berdiri di luar ruang perawatan. Saat wawancarai METRO, ia dengan polosnya mengaku sedang tidak mengantongi uang untuk berobat. “Gak ada uang bang, jadi aku gak berobat dululah. Ini masih menunggu keluarga datang,” katanya.(pra/hez)


KAMIS

3 Mei 2012

Keluarga Meninggal, Disantuni Rp500 Ribu Sambungan Halaman 8

(FOTO:RIDWAN)

SERAHKAN HADIAH, Wali Kota Sibolga, Drs HM Syarfi Hutauruk saat menyerahkan hadiah kepada para pemenang olimpiade sains usai peringatan Hari Pendidikan, Rabu (2/5) kemarin.

Peringatan Hardiknas 2012

Bangkitnya Generasi Emas SIBOLGA- Wali Kota Sibolga, Drs HM Syarfi Hutauruk memimpin upacara Peringatan Hari Pendidikan Nasional (Hardiknas), Rabu (2/5) kemarin. Dalam upacara yang digelar di Lapangan SimareMare tersebut dihadiri para pejabat unsur Muspida Sibolga, pengurus Persatuan Guru Republik Indonesia (PGRI), dan dihadiri juga para tenaga pendidik dan para pelajar Kota Sibolga. Wali Kota yang membacakan sambutan Mendiknas dalam Hardiknas yang mengangkat tema “Bangkitnya Generasi Emas Indonesia” tersebut menyampaikan bahwa manusia dalam dunia pendidikan merupakan subjek sekaligus objek dan keilmuan sebagai medianya, memanusiakan manusia sebagai salah satu tujuannya. “Inilah yang membuat pendidikan itu kompleks, menantang namun sangat mulia dan kita patut bersyukur atas kembalinya bidang kebudayaan ke Kementerian Pendidikan. Sebab, sejatinya kebudayaan dan pendidikan memang tidak bisa dipisahkan, di dalam pendidikan selalu ada unsur budaya, begitu pula sebaliknya,” sebut Syarfi. Dikatakannya, pada periode tahun 2010 sampai tahun 2035 Indonesia harus melakukan investasi besar-besaran dalam bidang pengembangan sumber daya manusia (SDM) sebagai upaya menyiapkan generasi 2045, yaitu 100 tahun Indonesia Merdeka. “Oleh karena itu, kita harus menyiapkan akses seluasluasnya kepada seluruh anak bangsa untuk memasuki dunia pendidikan, mulai dari pendidikan anak usia dini (Paud) sampai ke perguruan tinggi, tentu perluasan akses tersebut harus diikuti dengan peningkatan kualitas pen-

didikan, sekalipun kita semua memahami bahwa pendidikan itu adalah system rekayasa sosial terbaik untuk meningkatkan kesejahteraan keharkatan dan kemartabatan,” ujarnya. Untuk mempersiapkan generasi emas tersebut, sambungnya, telah disiapkan kebijakan yang sistematis, yang memungkinkan terjadinya mobilitas vertical secara massif. Unti itu, mulai tahun 2011 telah dilakukan gerakan pendidikan anak usia dini, penuntasan dan peningkatan kualitas pendidikan dasar, penyiapan pendidikan menengah universal (PMU) yang Insya Allah akan dimulai tahun 2013. “Disamping itu, perluasan akses ke perguruan tinggi juga disiapkan melalui pendirian perguruan tinggi negeri di daerah perbatasan dan memberikan akses secara khusus kepada masyarakat yang memiliki keterbatasan kemampuan ekonomi, tetapi berkemampuan akademik,” tandasnya. Sedangkan Kepala Dinas Pendidikan Sibolga, Drs Alpian hutauruk MPd menyebutkan, peringatan Hardiknas tahun ini hanya dilangsungkan dengan sederhana, namun tidak mengurangi makna dari peringatan itu sendiri. “Namun demikian, sebelumnya juga kita mengadakan berbagai perlombaan diantaranya tarik tambang, bola volley, bulu tangkis, tennis meja, catur dan kegiatan jalan santai hari Minggu (6/5) mendatang,” tandasnya. Upacara peringatan Hari pendidikan Nasional tahun 2012 itu juga dirangkai dengan pemberianhadiahkepadapara pemenang Olympiade Sains Tingkat SLTA se-Kota Sibolga yang diserahkan langsung oleh WaliKotaSibolgaDrsHMSyarfi Hutauruk. (tob/nasa)

Camat Sibolga Sambas, Faisal Fahmi Lubis didampingi Lurah Pancuran Dewa, Lurah Pancuran Bambu, Lurah Pancuran Kerambil, dan Lurah Pancuran Pinang, mengatakan santunan kematian ini berasal dari APBD Sibolga melalui Dinas Sosial dan telah dilakukan sejak tahun 2011 lalu. Bantuan ini diberikan sebagai bentuk keprihatinan Pemko Sibolga terhadap warganya. “Bantuan ini kita terima dari Pemko Sibolga melalui Dinas Sosial yang kita salurkan

kepada keluarga pewaris apabila ada salah seorang keluarganya meninggal. Hal ini diberikan sebagai bantuan keprihatinan atau tali kasih sebagai bentuk kepedulian kepada keluarga yang kemalangan. Artinya, apa yang dirasakan keluarga yang dalam kemalangan, kita sebagai pemerintah setempat juga turut merasakannya,” tutur Faisal. Ditambahkannya, sebanyak 40 orang pewaris dari 4 kelurahan datang untuk menerima santunan ini. Santunan kematian ini diberikan kepada warga yang anggota keluarganya

meninggal dunia terhitung sejak bulan Desember 2012 hinggan bulan April 2012. “Keempat puluh warga pewaris ini, terhitung sejak bulan Desember 2012 lalu, untuk bulan sebelumnya sudah kita serahkan langsung setelah mereka melengkapi permohonan bantuan, surat keterangan meninggal dunia dari lurah setempat, surat pernyataan pewaris dari pihak keluarga, kartu keluarga beserta fotokopi KTP pewarias,” terang Faisal lagi. Dengan santunan ini, camat berharap agar dapat membantu warga yang kemalangan

sebagai pengganti uang penguburan. Santunan ini juga disambut baik para pewaris. ”Kami dari pihak keluarga berterima kasih atas bantuan yang diberikan kepada kami, sebab ini adalah suatu kepedulian pemerintah kepada warganya yang membutuhkan bantuan,” ujar N Pasaribu, salah seorang warga penerima santunan kematian. Dalam kesempatan itu juga, Faisal bersama pihak kelurahan melakukan sosialisasi tentang pentingnya elektronik KTP atau e-KTP. Dijelaskannya, e-KTP dilatarbelakangi oleh sistim

Bendahara Bidan PTT Peras Bidan Rp2,5 Juta Sambungan Halaman 8 rima Kapolsek Pandan, AKP H E Sidauruk. “Benar ada laporan itu. Pengaduannya sudah kita terima, dan akan kita sampaikan laporan ini ke Polres Tapteng. Nantinya Polres Tapteng akan menentukan siapa yang menangani kasus ini,” ujar kapolsek. Dari laporan yang disampaikan ASWAL, diketahui kalau dugaan tindak pidana tersebut terungkap dari keluhan masyarakat. Di mana, mereka menyebutkan terjadi pungutan kepada para Bidan PTT sebesar Rp2,5 juta yang dilakukan oleh pegawai Dinas Kesehatan Tapteng. Setelah dicek, ternyata keluhan masyarakat tersebut benar. Para Bidan PTT harus menyerahkan uang Rp2,5 juta kepada Bendahara Bidan PTT Dinas Kesehatan Tapteng jika ingin memperpanjang SK tugasnya di Kabupaten Tapteng. “Salah seorang Bidan PTT mencoba menghubungi bendahara Bidan PTT Dinas Kesehatan Tapteng melalui telepon selulernya. Dari pembicaraan yang direkam tersebut, bendahara mengatakan uang Rp2,5 juta tersebut untuk biaya administrasi,” ujar Ketua ASWAL, Zulkarnain Parinduri melalui

sekretarisnya, S Simon Situmorang. Lanjut S Simon Situmorang, pada hari Rabu (2/5) sekira pukul 11.10 WIB, pihaknya mendapat rekaman video penyerahan uang sebanyak Rp2,5 juta oleh salah seorang Bidan PTT dan diterima langsung bendahara Bidan PTT di Kantor Dinas Kesehatan Tapteng. Berdasarkan bukti-bukti tersebut, ASWAL pun melaporkannya ke Polsek Pandan. Menurut Simon, apa yang dilakukan Bendahara Bidan PTT tersebut adalah tindakan penggelapan, pemerasan, korupsi secara terstruktur/ sistimatik yang dilakukan oleh Dinas Kesehatan Tapteng. Oleh karenanya, ASWAL berharap agar Polres Tapteng melalui Polsek Pandan segera menuntaskan kasus tersebut

hingga tuntas. “Saya harap kasus ini segera diproses. Sebab sebelumnya, juga berdasarkan informasi dari beberapa Bidan PTT bahwa sejak bulan April hingga Desember 2011 dana insentif Bidan PTT se-Tapteng tidak disalurkan. Oleh karena itu kami dari ASWAL akan mengambil sikap tegas untuk mengawal proses penuntasan kasus ini sampai selesai,” tegas Simon sembari berharap Pemkab Tapteng turut bertanggung jawab dalam penyelesaian kasus tersebut. Terpisah, salah seorang Bidan PTT yang tidak ingin namanya dikorankan membenarkan adanya pungutan tersebut. “Saya menyetorkan uang sebanyak Rp2,5 juta itu sekira pukul 11.10 WIB, dan langsung saya berikan kepada ibu bendahara Bidan PTT, dan uang tersebut dikatakannya sebagai administrasi perpanjangan SK penempatan,” tutur bidan tersebut. Saat ditanya mengapa mau memberikan uang tersebut, bidan ini mengaku takut kalau perpanjangan SK perpanjangan tidak akan dikeluarkan dan insentifnya tidak dicairkan. “Saya ikut prosedur yang diberikan saja, katanya setelah membayar akan menerima SK perpanjangan, dan setelah itu baru bisa menerima insentif,” pungkasnya.(fred/nasa)

pembuatan KTP konvensional di Indonesia yang memungkinkan seseorang dapat memiliki lebih dari satu KTP. Hal ini disebabkan belum adanya basis data terpadu yang menghimpun data penduduk dari seluruh Indonesia. Fakta tersebut memberi peluang penduduk yang ingin berbuat curang terhadap negara dengan menduplikasi KTP-nya. Untuk mengatasi duplikasi tersebut sekaligus menciptakan kartu identitas multifungsi, digagaslah e-KTP yang menggunakan pengamanan berbasis biometrik.(fred/nasa)

Viky Sianipar Tantang Musisi Nias Berkolaborasi Sambungan Halaman 8 perkotaan. Dan ternyata musik yang saya bawakan bisa diterima anak muda Indonesia. Seni budaya bangsa kita akan selalu lestari,” tutur Viky yang gaya bermusiknya dikenal beraliran etnik kontemporer. . Pada kesempatan itu, Viky juga menantang musisi etnis Nias untuk berkolaborasi. “Impian saya bisa berkolaborasi dengan musisi Nias. Saya tunggu di Jakarta,” tantang Viky. Gunungsitoli adalah kota ketiga setelah pada tanggal 27 dan 29 April lalu Viky tampil di Kisaran dan Balige. Sedangkan untuk konser selanjutnya di Tebing Tinggi dan Dumai, pada tanggal 5 dan 19 Mei 2012 nanti. (mor/nasa)

Manusia, Ilmu, dan Kualitas Sambungan Halaman 8 ini memang perlu dikaji secara luas dan mendalam karena meliputi berbagai hal, berbagai sudut pandang, serta terkait erat dengan sistem pendidikan yang diterapkan. Sistem pendidikan nasional adalah satu keseluruhan yang terpadu dari semua satuan dan kegiatan pendidikan yang berkaitan satu dengan lainnya untuk mengusahakan tercapainya

tujuan pendidikan nasional. Pemikiran-pemikiran kritis yang muncul bukanlah hendak menyalahkan sistem pendidikan nasional kita, tetapi pada pelaksaan sistem tersebut. Sudahkah sistem pendidikan nasional kita dijalankan dengan baik dan benar? Refleksi Momen hari pendidikan nasional ini, kiranya dapat kita jadikan saat untuk bercermin. Sebagai tenaga pendidik, mau

tak mau kita dituntut untuk terus berbenah diri dan meningkatkan kualitas profesionalisme. Sebagai insaninsan yang setiap hari terjun langsung ke lapangan dunia pendidikan ini, berhadapan dengan tunas bangsa yang membutuhkan uluran tangan kita dengan tulus dan tanpa kenal lelah, guna mempersiapkan mereka ke masa depan untuk menghadapi tantangan kehidupan nyata.

Para tenaga pendidik, yaitu para guru, adalah sebuah model, seorang contoh teladan bagi murid-muridnya, bagi masyarakatnya. Setiap saat kita harus siap untuk dinilai, dipuji atau dicibir. Segala tindaktanduk, sikap dan perilaku kita sebagai para pendidik akan ditiru oleh anak didik, akan diamati oleh masyarakat. Tentu ini adalah beban berat kita, sebab sebagai guru kita tak bisa bertingkah sesuka hati. Tetapi,

menjadi guru adalah sebuah pilihan, bukan pelarian atau coba-coba. Karena tugas mulia ini telah kita pilih, maka segala konsekuensi dan komitmen pengabdian ini marilah kita genggam bersama dalam keteguhan. Gurulah pelita. Penerang dalam gulita. Jasamu tiada tara. Kepala Sekolah SMAN 1 Andam Dewi dan Dosen Sastra Indonesia STKIP Barus

Siapkan Reality Show, Pentas Dangdut hingga Washington Sambungan Halaman 1 kepada beberapa teman dan kemudian kami sepakat membentuk Dangdut Cowboys,” kata Andrew. Sebagai musisi dangdut, Andrew mengaku masih belum sampai pada taraf menciptakan lagu. Dia masih membawakan lagu-lagu dangdut asal Indonesia yang sebagian di antaranya dia nyanyikan dalam

bahasa Inggris. Pria murah senyum ini menyebut publik negeri Paman Sam ternyata apresiatif dengan musik yang diusung bersama Dangdut Cowboys. Menurutnya, pada dasarnya dangdut tidak jauh berbeda dengan genre musik lain yang sudah tenar di Amerika. Dengan Blues misalnya. “Ada kesamaan antara dangdut dan blues,” terang Andrew. Keduanya adalah musik yang

pada awalnya lekat dengan stigma marginal. Dangdut identik dengan kalangan bawah Indonesia, blues lekat dengan para budak kulit hitam. Rasa dangdut dan blues juga Andrew sebut punya kesamaan. Keduanya sering mengangkat tematema yang menyayat hati baik oleh karena cinta ataupun kerasnya hidup. “Dilihat dari cord, feel, dan lirik lagunya, dangdut dan blues punya

kesamaan. Keduanya sering mengusung tema melankolis dengan tetap ada harapan di dalamnya,” kata Andrew. Selain itu, menurut Andrew, blues dan dangdut juga sama-sama sebuah genre musik yang terbentuk dari banyak unsur di dalamnya. Ada rasa Afrika di dalam blues yang mengalami singgungan-singgungan dengan rock khas barat. Begitu pula dangdut yang merupakan hasil dari

PNS Dilempari, Pagar Roboh, Kantor Hancur Sambungan Halaman 1 daraan jenis truk, bus, dan mobil pribadi. Mereka start sekitar pukul 09.30 WIB dengan mendapat pengawalan aparat keamanan. Sesampai di depan kantor bupati, pengunjuk rasa langsung berorasi menuntut haknya sebagai warga. Yakni, meminta Bupati Tapsel Syahrul M Pasaribu melaksanakan Undang-Undang (UU) Nomor 37 dan 38 tahun 2007, dengan segera berkantor dan melaksanakan Sipirok sebagai pusat pemerintahan. Dan, tak berselang lama, Syahrul M Pasaribu bersama wakil bupati Ir Aldinz Rapolo Siregar dan pejabat teras lainnnya menemui pengunjuk rasa. Namun, kehadiran bupati di tengah para pengunjuk rasa di bawah kawaalan puluhan aparat Polresta Padangsidimpuan dan Polres Tapsel tidak menemui titik

temu. Sebab, bupati tidak bersedia menandatangani surat yang disodorkan pengunjuk rasa. Isi surat tersebut meminta kesediaan bupati berkantor di Sipirok. Saat menanggapi pengunjuk rasa, Syahrul berpidato seputar rencana pembangunan kantor Bupati Tapsel di sekitar Kilang Papan Dano Situmba, Kecamatan Sipirok. Kontan saja warga bersorak dan berteriak kalau mereka bukan ingin mendengar pidato akan tetapi kesediaan bupati menuruti UU untuk berkantor di Sipirok. “Kami datang bukan untuk mendengar pidato tentang rencana anda melaksanakan pembangunan kantor bupati. Kami datang ingin meminta hati nurani anda untuk melaksanakan UU dan berkator di Sipirok dengan menandatangani surat masyarakat Sipirok ini,” teriak

orator massa, Bangun Siregar. Lalu tanpa kesepakatan, rombongan bupati tadi kembali memasuki ruangan. Berselang beberapa menit, perwakilan massa, Raja Parlindungan Pane, Bangun Siregar Faisal Reza Pardede, Zulfan Hutasuhut, Julkarmedi Siregar, Muklis Simatupang, Alpian Sontang Siregar, dan lainnnya menggelar pertemuan dengan bupati dan pejabat lainnya, di aula kantor bupati. Namun, bupati tetap menjelaskan rencana pembangunan kantor dan pembangunan lainnya di Sipirok dan tidak mau menandatangani maklumat yang disodorkan masyarakat, sehingga membuat para perwakilan massa merasa topik pembicaraan tidak pada komposisi yang diharapkan. Akhirnya, massa keluar. “Bupati yang terhormat, sepertinya anda tidak mengerti atau

sengaja tidak mengerti komposisi yang dibicarakan. Kami hanya ingin anda menanda tangani setuju atau tidak menanda tangani tuntutan kami agar anda berkantor di Sipirok itu saja, bukan cerita pembangunan yang kami maksudkan,” ujar Raja sembari meninggalkan pertemuan. Sore hari, giliran ibu-ibu yang melanjutkan tuntutan. Kaum ibuibu diterima di Aula Beringin kantor bupati. Dan tuntutan tetap tidak menghasilkan apa-apa. Unjuk rasa ini sempat ricuh. Itu sebelum bupati menemui massa di pelataran kantor. Saat itu, pagar kantor bupati roboh dijebol massa ketika saling dorong dengan aparat. Tiba-tiba, pengunjuk rasa melempari kantor bupati dengan batu dan kemasan (baca; gelas plastik) air mineral. Dan, sejumlah PNS, aparat keamanan, bahkan wartawan yang tidak menduga akan ada lemparan, spontan menghindar agar tidak terkena lemparan. Namun, sejumlah PNS ada yang kena lemparan. Bukan hanya itu, dua kaca jendela sebelah

sintesis antara unsur-unsur musik dari Timur Tengah, India, dan kemudian bertemu dengan musik Melayu. Begitu pula jika dangdut dibandingkan dengan musik country. Akan didapatkan kemiripankemiripan di antara ke duanya. Walau punya kemiripan dengan musik-musik yang akrab dengan telinga di negeri Paman Sam, bukan berarti dangdut kemudian dibawakan secara khas Indonesia. Andrew tetap bergaya bak cowboys dengan kostum dan gayanya. Padahal, Andrew membenarkan bahwa salah satu kekuatan dan ciri khas dangdut Indonesia adalah pentas-pentasnya yang selalu heboh. “Dangdut adalah sebuah tontonan yang eksesif,” kata Andrew. Sebagai sebuah tontonan eksesif, dengan sendirinya sebuah pentas dangdut muncul dengan segala kehebohannya sendiri. Mulai kostum hingga gaya sang penyanyi selalu punya kemeriahan tersendiri selain riuh rendah para penontonnya. Andrew tidak membawa ciri pentas panggung dangdut Indonesia pada penampilan Dangdut Cowboys. “Itu adalah bagian dari kompromi antara rasa IndonesiaAmerika. Gaya cowboy, musiknya dangdut,” kata Andrew member alasan mengapa goyangnya di atas panggung seperti penyanyi country yang tenang dan mengapa kostum cowboy jadi pilihannya. Dengan gayanya sendiri yang tidak sama dengan para artis dangdut Indonesia, Andrew bersama Dangdut Cowboys tetap percaya diri menggoyang Amerika.

“Kita sedang berencana membuat reality show tentang dangdut di Amerika,” terang Andrew. Seperti apakah reality show itu, Andrew tidak menjelaskannya. Namun, dia menegaskan rencana pembuatan reality show itu adalah bagian dari cita-citanya memopulerkan dangdut di Amerika. Cita-cita serupa juga menjadi alasan Andrew membentuk Dangdut Cowboys. Selama penampilannya di kotakota Amerika, Andrew menangkap dangdut bisa diterima warga negara Paman Sam itu. Irama yang beda dengan musik kebanyakan di Amerika Serikat, keampuhan energi dangdut mengajak goyang penontonnya, hingga alasan-asalan merujuk kebaruan adalah latar belakang mengapa dangdut bisa dinikmati di negeri Obama itu. “Mereka (penonton) senang walau tak tahu bahasanya. Mereka merasakan energinya dan kebanyakan orang suka joget. Bagi mereka, dangdut adalah sesuatu yang baru karena sebelumnya tak pernah mendengarkan,” beber Andrew. Keseriusan Andrew menggeluti dangdut dia akui pada awalnya mendapat kesan beragam. Pada saat mulai melakukan penelitian tentang dangdut misalnya. Dia menyebut ada dua kelompok pendapat yang muncul dari para koleganya.


KAMIS

3 Mei 2012

Keluarga Meninggal, Disantuni Rp500 Ribu (FOTO:METROMARIHOT SIMAMORA)

KOLABORASI- Viky Sianipar dan Candil kolaborasi pada single “Dijou Au Mulak” di Surya 16 Live In Concert di Lapangan Merdeka Gunungsitoli, Sumut, Rabu (25) malam.

Surya 16 Viky Sianipar Konser di Gunungsitoli

Viky Sianipar Tantang Musisi Nias Berkolaborasi GUNUNGSITOLI- Musisi Viky Sianipar hadir di Lapangan Merdeka Gunungsitoli, Sumut, Rabu (2/5) malam. Di rangkain konser Surya 16 tour di 5 kota itu, Viky berkolaborasi dengan rocker Indonesia, Candil Serious Band, rocker berdarah Batak Dewi Marpaung dan Alex Hutajulu asal Balige, Tobasa. Ada 17 single yang dilantunkan malam itu, diantaranya Dijou Au Mulak, Sipata, Tilo-tilo, Jamila oleh Alex Hutajulu. Single Sipata adalah salahstu lagu dari album terbaru garapan Viky, yakni album Tobatak yang dirilis di Jerman. Kemudian disusul dengan single Ansideng dari album Tobadream oleh Korem Sihombing, pesuling Batak ternama. Lalu, Porompompom, Serma/Posni, Tortorhon, Piso Surit,

Didia Rokkapi oleh Dewi Marpaung. Serta Tobadream Instrumental. Serunya lagi, Candil membius ribuan dengan single Sing Sing So, Apa-apanya Dong, Musik Jazz, Rocker Juga Manusia dan Alusi Au. Konser ditutup dengan single Sinanggar Tullo kolaborasi Viky, Korem Sihombing, Candil dan Alex Hutajulu. “Malam ini kita minta Candil untuk menyanyikan lagu Batak, meskipun dia bukan orang Batak,” cetus Viky dari atas panggung, disambut riuh penonton yang menjamuri lapangan. Dengan suara khasnya Candil mampu membius penonton saat melantunkan “Sinanggar Tullo” yang dikemas dalam irama musik rock dipadu dengan nada-nada yang dihasilkan dari alat musik tradisional

SIBOLGA- Sebanyak 40 warga di Kecamatan Sibolga Sambas menerima santunan masing-masing sebesar Rp500 ribu dari pemerintah daerah, Rabu (2/5). Santunan yang diserahkan oleh Camat Sibolga Sambas, Faisal Fahmi Lubis, ini ditujukan kepada warga yang anggota keluarganya meninggal dunia. ‹ Baca Keluarga ...Hal ‹

Batak seperti tagading dan sulim. Di kesempatan itu Candil mengaku sangat sangat senang didaulat menyanyikan lagu-lagu Batak. “Musik tradisional bangsa memang harus dipertahankan,” ujar Candil. Sebelumnya, Viky sendiri sempat menyatakan kekagumannya akan musik dan lagu Batak. Sayangnya, anak muda Batak, khususnya yang lahir dan besar di kota cenderung mengganggap musik Batak itu kampungan. Viky mengakui, keprihatinan akan tenggelamnya kelestarian musik dan lagu serta budya bangsa itulah Hal itulah yang memotivasinya bermusik. “Saya ingin menggugah semangat anak muda Batak agar lebih mencintai budayanya, terutama yang tinggal di

‹ Baca Viky Sianipar ...Hal ‹

7

(FOTO: FREDDY)

„ Camat Sibolga Sambas Faisal Fahmi Lubis SSos memberikan santunan kepada salah seorang pewaris.

Bendahara Bidan PTT Peras Bidan Rp2,5 Juta Tak Beri Uang, SK Tugas Tak Diperpanjang PANDAN- Asosiasi Wartawan dan LSM (ASWAL), Rabu (2/5) mendatangi Mapolsek Pandan. Kedatangan mereka untuk melaporkan dugaan penggelapan dan pemerasan yang terjadi di Dinas Kesehatan Tapteng terhadap Bidan PTT (Pegawai Tidak Tetap) yang ingin memperpanjang SK (surat keputusan) tugasnya di wilayah Kabupaten Tapteng. Laporan ini langsung dite(FOTO : FREDDY)

7

ASWAL saat memberikan laporan kepada Kapolsek Pandan AKP H E Sidauruk SH.

‹ Baca Bendahara ‹ ...Hal 7

Hari Pendidikan Nasional (2/Habis)

Manusia, Ilmu, dan Kualitas Pendidikan merupakan jalan untuk menimba ilmu. Dengan pendidikan, manusia dituntut untuk berilmu, berkualitas, dan bermanfaat bagi diri sendiri dan bangsa. Siti Aisyah, Dosen Sastra Indonesia STKIP Barus Yang kita harapkan dari proses pendidikan dan pengajaran adalah anak-anak berkembang utuh sebagai manusia, yang beriman dan berilmu. Kita inginkan anak-anak tumbuh sebagai manusia muda, dan manusia

„ Siti Aisyah SPd MHum

muda itu berkarakter, mempunyai kompetensi akademik, memiliki hati nurani, dan memiliki kepedulian. Dalam proses pendidikannya, anakanak dipersiapkan hingga mampu membedakan mana yang baik dan buruk, mana yang salah dan benar, dan mampu mengambil keputusan pada perkara-perkara yang serius dan berat dalam hidup mereka. Sudahkah atau mampukah dunia pendidikan kita mempersiapkan semua itu? Sebagai tanda bahwa kita adalah bangsa yang besar, tentu harus memikirkan dengan serius pendidikan generasi mudanya. Bangsa Indonesia menghadapi tantangan yang tidak mudah untuk

dapat mencapai tujuan pendidikan nasional yang telah dicanangkan. Pendidikan nasional bertujuan mencerdaskan kehidupan bangsa dan mengembangkan manusia Indonesia seutuhnya, yaitu manusia yang beriman dan bertaqwa terhadap Tuhan yag Maha Esa dan berbudi pekerti luhur, memiliki pengetahuan dan keterampilan, kesehatan jasmani dan rohani, kepribadian yang mantap dan mandiri serta rasa tanggung jawab kemasyarakatan dan kebangsaan. Masalah yang dihadapi dalam upaya pencapaian tujuan pendidikan

‹ Baca Manusia...Hal ‹

7


KAMIS

3 Mei 2012

Terbayang Sedang Perang

Ayah Bacok Anak & Menantu TOBASA- Bismar Sitorus (83) warga Siliat Liatan Kelurahan Panamparan, Kecamatan Habinsaran, Kabupaten Tobasa mengamuk. Kakek delapan cucu ini membacok Sopar Sitorus (30) anaknya dan Bambang Wibisono (40) menantunya, Selasa dini hari (1/5) sekira pukul 02.00 di Gang Keluarga Kelurahan Sinaksak KM 2 Kecamatan Tapian Dolok Simalungun.

„ Massa yang tergabung dalam Aliansi Peduli Jurnalis (AJP) Tapanuli Utara menuju kantor Bupati Taput, Rabu (2/5).

Massa AJP Datangi Kantor Bupati

Tuding Kadiscatpil Buta UU Pers

BERDIALOG: Massa yang tergabung dalam AJP berdiaolog dengan petugas Polisi di Halaman Kantor Bupati Taput, Rabu (2/5).

TARUTUNG- Sedikitnya 40 orang wartawan yang tergabung dalam aliansi peduli jurnalis (AJP) Tapanuli Utara mendatangi kantor Bupati Taput, Jalan Letjen Suprapto, Tarutung, Rabu (2/5). Kedatangan mereka untuk menyampaikan aspirasi terkait pernyataan Kepala Dinas Pendudukan dan Catatan Sipil (Kadisdukcatpil) Marconis Siregar yang menyebut “Wartawan Perusak Bangsa”. Massa AJP yang berasal dari Taput, Humbang Hasundutan, Samosir dan Tobasa itu berunjuk rasa damai dengan membawa berbagai poster yang bertuliskan antara lain, wartawan bukan perusak bangsa, Marconis Buta UU Pokok Pers

Nomor 40 Tahun 1999, Marconis Musuh dalam selimut Bupati dan lain lain. Massa sebelum mendatangi kantor tersebut mengambil titik kumpul di halaman Gedung Serbaguna Tarutung. Dengan berjalan kaki, mereka menuju kantor Bupati. Setibanya di sana, massa melakukan orasi serta mengangkat poster poster yang telah dipersiapkan dengan pengawalan sejumlah personel Polisi dan Satpol PP. Setelah melakukan pendekatan kepada aparat dan jaminan tidak akan terjadi tindakan anarkis, massa baru diperbolehkan melakukan orasi. Sekda Taput, Drs

SAAT dikonfirmasi METRO, anak tersangka yang juga menjadi korban pembacokan, Sopar Sitorus, kejadaian itu bukan kemauan ayahnya. Melainkan karena pelaku memiliki ilmu hitam yang dipelajarinya pada masah penjajahan Belanda.

„) Baca Punya ..Hal 10

( FOTO : LAZUARDY FAHMI )

PELAKU TERTIDUR : Pelaku penganiayaan Bismar Sitorus warga gang keluarga Kelurahan Sinaksak Kecamatan Tapian Dolok yang tertidur saat berada di Mapolsek Serbelawan, Rabu (2/5).

Terkait Gadis Bugil Hanyut di Pantai Namartua

Warga Duga Korban Diperkosa Lalu Dibunuh

„) Baca Tuding ...Hal 10

METRO TAPANULI

Foto : JETRO SIRAIT

DIMAKAMKAN: Gadis yang ditemukan bugil di Pantai Namartua Sioma dimakamkan di TPU Desa Pintu Sonan Pangururan, Samosir.

Pencurian Kerbau Marak di Sipoholon Lima Ekor Hilang dari Adaran

Foto M Roy Siregar

„ Siswa-siswi MIN menaikan bendera merah putih pada upacara peringatan Hari Pendidikan Nasional, Rabu (2/5).

Hardiknas di MIN Sirihit-rihit

Dirangkai Tarik Tambang PAHAEJAE- Peringatan Hari Pendidikan Nasional di Madrasah Ibtidaiyah Negeri (MIN) Sirihit-rihit di Desa Setia Kecamatan Pahaejae, Kabupaten Taput dirangkai dengan tarik tambang, lomba baca Alquran, Rabu (2/5). Kepala MIN Ustad Rusman Nasution SAg mengatakan dalam pelaksanaan Hari Pendidikan Nasional mari mengentaskan buta aksara

Alquran, dan menciptakan insani yang berahlakulkarimah setiap anak didik. Serta diharapkan anak didik sudah lulus bisa bersaing di sekolah lanjutan serta terus meningkatkan kualitas pendidikan hususnya di Madarasah Ibtidaiyah Negeri Sirihit-rihit. Hardiknas dilakukan upacara yang dipimpin Kepsek Rusman Nasution. (Roy Siregar)

„ Siswa-siswi dan Guru serta Kepala Sekolah usai menghormati bendera merah putih.

TARUTUNG- Aksi pencurian ternak kerbau marak terjadi di Kecamatan Sipoholon, Tapanuli Utara (Taput). Sedikitnya empat ekor kerbau milik warga hilang dari andaran (tempat kerbau merumput). Kerugian diperkirakan mencapai ratusan juta rupiah. Aksi ini sangat meresahkan warga. Apalagi, Februari lalu, warga juga kehilangan tujuh ekor kerbau. M Simamora (50) dan J Manalu (50) warga Desa Hutaraja

„) Baca Pencurian Hal 10

„ Kepala Sekolah MIN Ustad Rusman Nasution sebagai Irup pada peringatan Hardiknas.

„ Para Guru makan bersama usai upacara peringatan Hardiknas.

„) Baca Ayah ...Hal 10

Punya Ilmu Hitam

SOCIETY

16

Akibat pembacokan dengan sebilah parang panjang itu, Bambang Wibisono warga Kelurahan Sinaksak Kecamatan Tapian Dolok dan anak keempatnya, Sopar Sitorus (30)

„ Ipda W Barimbing

Bupati: Kualitas Pendidikan Harus Ditingkatkan DOLOKSANGGUL- Bupati Humbahas Drs Maddin Sihombing mengimbau kepada seluruh guru agar mengutamakan dan meningkatkan kualitas pendidikan di daerah itu. Hal itu diungkapkan bupati pada upacara peringatan Hari Otonomi Daerah (Otda) dan Hardiknas di Halaman Kantor Bupati Humbahas, Bukit Inspirasi Kecamatan Doloksanggul, Rabu

(2/5). Ia mengatakan, mulai tahun 2010 hingga 2035 mendatang, harus dilakukan investasi besar-besaran dalam bidang pengembangan Sumber Daya Manusia (SDM) sebagai upaya menyiapkan generasi 2045, yaitu 100 tahun Indonesia merdeka. “Sehingga untuk menggapai

„) Baca Bupati ..Hal 10

PANGURURAN- Pasca penemuan seorang gadis berusia sekitar 16 tahun (bukan 20 tahun) tewas terapung di Pantai Namartua Sioma, Desa Hutahotang, Onanrunggu, Samosir, empat hari lalu, masih menjadi perbincangan hangat di daerah itu. Beberapa warga menduga korban diperkosa lalu dibunuh. Kemudian dibuang ke danau guna menghilangkan jejak. “Melihat usia korban masih muda, kita menduga dia korban pembunuhan. Bisa saja kan. Apalagi kondisi saat ini hari libur. Bahkan, sebagian pelajar baru selesau Ujian Nasional. Bisa saja mereka libur-

„) Baca Warga ..Hal 10

Makden Sihombing Plt Camat Onan Ganjang HUMBAHAS- Makden Sihombing, yang saat ini masih menjabat Kepala Bagian Tata Pemerintahan Setdakab Humbang Hasundutan, dilantik menjadi Pelaksana Tugas (Plt) Camat Onan Ganjang. Makden mengantikan Hotman Manullang yang memasuki masa pensiun. Pelantikan sekaligus Serah Terima Jabatan (sertijab) dilaksanakan, Rabu (2/5) di Kantor Camat Onang Ganjang oleh Asisten I, Tony Sihombing. Saat serah terima jabatan tersebut, Tony mengatakan, Pemkab mengucapkan terima kasih kepada Hotman atas pengabdiannya selama satu tahun lebih menjadi Camat Onan Ganjang. ”Atas nama Pemkab mengucapkan banyak terima kasih terhadap Hotman atas pengabdiannya selama bertugas di Humbahas dan selama satu tahun lebih menjadi Camat Onan Ganjang,” ujar Tony Sihombing, Rabu (2/5). Ia menyebut, bahwa Hotman selama bertugas di daerah itu telah memberi pengabdian yang baik dari sisi tugas sebagai PNS. ”Pengabdian yang baik selama ini sangat kami hargai. Tentunya, masyarakat khususnya di Kecamatan Onan Ganjang juga turut merasakannya,” imbuh Tony.

„) Baca Makden ..Hal 10


KAMIS

3 Mei 2012

Makden Sihombing.. Sambungan Halaman 9 Iamenjelaskan,dihunjuknyaMakden menjabat Plt Camat Onan Ganjanghanyauntukmengisisementara kekosongan pejabat Camat di kecamatan tersebut. ”Makden menjabat Plt Camat Onan Ganjang hanya sementara saja, menunggu ada camat yangdefenitif,”ungkapnya. Namun demikian, Tony meminta kepada Makden agar segera melakukan konsolidasi internal kepada seluruh staf di Kantor Camat Onan Ganjang. ”Saudara Makdentelahkitainstruksikanagar segera konsolidasi internal. Agar

nantinya pendelegasian tugas dan kewenangan di Kantor Camat Onan Ganjang tidak terganggu,” paparnya. Disisi lain, Tony juga mengimbau Makden, agar turut serta melakukan konsolidasi eksternal. ”Kita juga meminta Makden agar konsolidasieksternal,yaknikepada jajaranunsurpimpinankecamatan serta tokoh masyarakat, tokoh agama dan pemuda yang ada di kecamatan itu,” tandasnya. (hsl)

Bupati: Kualitas Pendidikan .. Sambungan Halaman 9 target itu, harus disiapkan akses seluas-luasnya kepada seluruh anak bangsa untuk memasuki dunia pendidikan. Mulai dari PAUD sampai perguruan tinggi. Dimana hal itu sebagai sistem rekayasa sosial terbaik untuk meningkatkan kesejahteraan, keharkatan dan kemartabatan bangsa,” ujar Maddin. Terkait peringatan Hari Otda keXVI, bupati mengatakan, penyerahan sebagian besar urusan pemerintahan kepada Pemerintah Daerah (pemda), telah menempatkan Pemda sebagai ujung tombak Pembangunan Nasional guna menghasilkan dampak positif dalam bentuk pertumbuhan ekonomi yang semakin merata serta tingkat kemiskinan dan pengangguran semakin menurun. Untukitu,paparMaddin,pemerintah pusat diharapkan dapat memberi peran, kewenangan dan tanggung jawab yang lebih besar kepadaPemdadalamusahamela-

yanirakyatlebihbaik,mudah,cepat dan lebih murah. ”Jikadalamduniausahaberlaku prinsip pembeli adalah raja, maka dalam dunia pemerintahan pada prinsipnya ialah segalanya untuk rakyat,” imbaunya. Oleh sebab itu, lanjut Bupati, diperlukan peningkatan kapasitas dankompetensiaparaturpemerintah daerah dalam mengoptimalkanpelayanankepada masyarakat serta menghadirkan tata kelola pemerintahan yang baik ( transparansi dan akuntabilitas), sesuai dengan prinsip-prinsip Good Governance and Clean Government. “Selaras dengan itu, upaya pembenahan birokrasi merupakan hal yang perlu dikedepankan dan dilakukan secara berkesinambungan. Mengingat hal itu sangat strategis, karena menyangkut perubahan pola pikir dan pola sikap seluruh jajaran aparat pemerintah dari tingkat paling tinggi sampai pelaksana tingkat bawah,” ungkapnya. (hsl)

Tuding Kadiscatpil Buta .. Sambungan Halaman 9 Sanggam Hutagalung MM menyambut kedatangan massa dan menyampaikan surat pernyataan sikap. Setelah itu, massa beranjak menuju Gedung DPRD Taput. Pantuan mETRO, sebelum aksi digelar, massa yang mendapat pengawalan dari puluhan polisi, s mengendarai sepedamotor dari Gedung Serbaguna Tarutung menujukantor BupatiTaput.Selanjutnya massa beranjak dengan berjalan kaki ke gedung Dewan. Dalam orasinya , massa meminta agar oknum Kepala Dinas SKPDPemkabTaput yangmengeluarkan statetmen ‘wartawan adalah perusak bangsa’ segera mengklarifikasi pernyataan itu. ”Wartawan adalah penyambunglidahmasyarakatdankontrol sosial, bukan perusak bangsa. Untuk itu, kami minta kepada oknum Kadis segera mengklarifikasi pernyataannya itu. Sebab, hal ini akan menimbulkan preseden buruk dan sangat melecehkan tugas-tugas jurnalistik,” tandas Koordinator aksi, Dompak Sihombing. Menurut Dompak, pernyataan yang disampaikan oknum Kadis tersebut sangat tidak wajar dan bisa menimbulkan asumsi bermacammacamsehinggaberdampaknegatifbagiwartawanyangmeliputberita. “Kitabaik-baikkonfirmasiberita, kenapa langsung marah-marah danmengatakanwartawanadalah perusakbangsa.ApadasarKadisitu mengatakan hal seperti itu. Untuk itu,kamimenuntutagarKadisyang bersangkutan mengklarifikasi pernyataannya karena sudah sangat tendensius,” tegas Dompak. Iamenceritakanpadatanggal20 Apri salah seorang wartawan media cetak melakukan konfirmasi ke Kantor Dinas Kependudukan dan Catatan Sipil (Disdukcapil) Taput. Kedatangan wartawan tersebut hanyamemintakonfirmasiadanya dugaan pungutan liar pengurusan akta nikah sebesar Rp500 ribu di Disdukcapil. ”TetapiKepalaDisdukcapillang-

sung marah-marah dan mengatakan wartawan adalah perusak bangsa. Ada apa ini? Ini menandakan adanya upaya penutupan informasi dan mencurigakan,” tandasnya. Sebelumnya,SekdaTaputSanggam Hutagalung langsung meminta maaf atas kesilapan bawahannyadalammemberikanjawaban konfirmasi kepada wartawan. ”Ini mungkin salah satu kegagalan saya. Untuk itu, saya minta maaf atas kesilapan ini dan kami juga akanintropkesidiri.Kedepankami akanberusahauntuktidakmengeluarkan kata-kata yang membuat wartawan tersinggung. Biarlah ini menjadipembelajaranbagikami,” ucap Sanggam. Diamenyambutbaikaksidamai dariPersTapanuli.Sekdakabdalam penerimaanyamengakuiadakelemahan eksekutif dalam pemberianinformasikepadapers.Namun hal itu bukan karena faktor kesengajaan dan kehadiran Pers sangat dihargai sebagai kontrol sosial pembangunan. “Kedepankemitraan Pers dengan pihak eksekutif lebih kita tingkatkan. Dengan demikian informasi yang seimbang akan berdampak positip kepada masyarakat,” ujarnya. Setelah dari kantor bupati, massa melanjutkan ke kantor DPRD. Mereka diterima dua orang anggota Dewan yakni Alamsa Sihombing dan Carles Simanungkalit. “Kami sebagai anggota DPRD refrentasi dari masyarakat, merasakan apa yang dirasakan teman teman wartawan. Kita sangat menyangkan kalau ada SKPD yang menyebut Wartawan Perusak Bangsa. Itu pendapat yang keliru. Justru wartawan merupakan elemen keempat setelah eksekutif, legeslatif dan yudikatif. Kami juga tidak terima pernyataan itu. Dalam waktu dekat, DPRD akan memanggil Kadis yang bersangkutan untuk mengklarifikasi pernyataan tersebut,” tandas Carles Simanungkalit. (cr-01/cr-02)

Ayah Bacok Anak & Menantu Sambungan Halaman 9 yang datang dari Jakarta mengalami luka berat di kepala dan punggung hingga dirawat di Rumah Sakit Mina Padi. Menurut, Bismar Sitorus, ketika ditemui METRO, Rabu (2/5) pukul 16.00 WIB di Polsek Serbelawan, mengaku kesal dengan sikap kedua korban yang kerap meremehkannya. Bahkan tersangka yang diduga mengalami kelainan jiwa iniberharapagardiasegeramenyusulistrinyayang telah tiada. ”Mereka sepele kali sama aku. Aku sudah bosan, sudahlah mau kususul istriku,” katanya sembari memalingkan wajahnya dari hadapan METRO. Sementara, setelah tertidur selama tiga puluh menit di Polsek Serbelawan, dengan kondisi mata lebam dan kepala berdarah, tersangka membaringkantubuhnyadikursikayuruangtunggusel tahanan Polsek Serbelawan. Terpisah,anakketigatersangka,LBrSitorus(35) warga Jalan Aman Gang Sejahtera Kelurahan Siopat Suhu Siantar ketika ditemui METRO, Rabu (2/4), mengaku dirinya mengetahui aksi brutal bapaknya setelah salah seorang keponakannya mengabarkan langsung Rabu kemarin. Mendengar itu, dia langsung mengecek kondisi ayahnya. ”Saya diberitahu oleh keponakan saya. Dia datang pukul 03.00 WIB, katanya Bapak saya membacokadikdanabangiparsaya,makanyasaya langsung datang,” katanya. Bahkan, kericuhan yang terjadi ini sempat mengundang perhatian warga. Selanjutnya warga langsung menangkap dan menganiaya tersangka. Sementara kedua korban yang mengalami luka berat,langsungdilarikankeRumahSakitMinaPadi untuk mendapatkan pertolongan medis. ”Waktu datang, saya lihat ayah sudah dipukuli wargadandiseretkeluar.Sementarakeduasaudara saya sudah berdarah dan langsung dibawa warga sekitar ke Rumah Sakit Mina Padi,” ujarnya. Berselang beberapa saat, aparat Polsek Serbelawan datang ke lokasi dan mengamankan tersangka. Sementara keluarga tersangka yakin, penyebabpembacokanitudiawaliketika tersangka sulit tidur pada malam hari. Bahkan tersangka sering menghayal. ”Kalaumalamdiaseringsulittidur,bahkansejak Mama kami meninggal dunia, Ayah ini sering melamun. Kadang dia menghayal, sepertinya dia

Punya Ilmu Hitam Sambungan Halaman 9 Sewaktu Sopar masih SMA, dia sempat melihat ayahnya berjalan di atas air, kemudian berjalan di pagar. Atas kejadian itu, Sopar yakin kalau ayahnya memliki ilmu hitam. Karena ayaknya sudah lanjut usia, Sopar membawanya ke tempat orang pintar beberapatahunsilamdidaerahMedan.Rencanaya, di sana mereka akan melepaskan ilmu hitam tersangka.Orangpintartersebutberhasilmengeluarkan sebuah peluru dari bagian badan ayahnya. Melihathaltersebut,Soparsempatmerasapuas. Namun ketika istri tersangka P br Tampubolon meninggal dunia, penyakit ayahnya kambuh lagi. Diketahui sebelum kejadian ini, pelaku sering memegang parang dan mengayunkannya seperti dalam medan perang. Namun setelah diketahui pelaku kambuh lagi, SoparsengajadatangdariJakartauntukmenjemput ayahnya dan berniat ingin membawa ayahnya ke Jakarta. Naas, kejadian yang mereka alami menggagalkan rencana Sopar. Selanjutnya Sopar dan Bambang dirawat di RS Mina Padi. Sementara BismardiamankandiMapolsekSerbelawanuntuk diproses hukum. Baru Datang dari Tobasa Di rumah korban yang terbuat dari papan, tepatnya di belakang Akademi Kebidanan (Akbid) Henderson, Bakti Sinaga (10) anak korban saat ditemui METRO mengatakan, ayah dan ibunya sedang berada di RS Mina Padi. “AyahkusudahdiRumahSakitMinaPadikarena ditikam Oppung (kakek) tadi malam,” ucapnya polos. Di rumah yang juga tempat jualan jajanan anak-anak itu, Bakti anak ke-5 dari 7 bersaudara mengatakan,selamainikakeknyatinggaldiTobasa, dan baru datang Senin malam. Sebelum kejadian, kata Bakti, ayahnya bernama Bambang Sinaga alias Ateng tidur di ruang depan tepatnyadidepanTV.Sedangkanibunya,Marusaha br Sitorus tidur di kamar. Namun,BismarSitorustidurdiruangtengah.Saat tertidur pulas, sekitar pukul 02.00 WIB tersangka bangun. Selanjutnya mengampil parang yang terletakdidindingrumah.Tanpabicarasepatahkata pun, tersangka langsung membacok leher korban hinggamengeluarkandarah. Begitumendengar,Bambangmenjerit,Marusaha

TOYOTA BARU ASTRA: Ready Avanza, innova, fortuner Hub. Purba 0813 9789 4633; 0813 9736 0333 PROMO MITSUBISHI: Pick Up L300 & T120ss. Colt Diesel Chassis & Dumptruck. Fuso, Triton, Pajero Sport. BB/BK >oke..! Kuning/Hitam>oke!! Diskon spesial Hubungi: VINA NAULI SIREGAR 0812 6036 0000

MENYEDIAKAN ANEKA HEWAN PELIHARAAN: Kenari Import, Kenari Norwich, Timbradd, Scoth Folncy, Gloster, Grested, Border, Black Throolet, Mozambik, Sanger, Brim Stone, dll Hub: 0878 6849 0858 Medan

punya pengalaman buruk ketika masih mengikuti perang dulu. Dan ayah saya ini mantan pejuang kemerdekaan,” bebernya. Ketidaknyamananiniyangdidugakuatmelatar belakangi tersangka stress, hingga nekat membacok anak dan menantunya. Sementara tersangka yang sehari-hari bekerja sebagai petani kopi ini merupakan mantan pejuang atau veteran. Hal ini dibuktikan dengan kepemilikan baret pejuang yang diperoleh tersangka ketika terlibat perang. Dijelaskannyalagi,perubahansikapayahnyaini terjadiketikaistrinya,PbrTampubolonmeninggal dunia awal April 2009 silam akibat lemah jantung. Setelah kejadian itu, tersangka kerap terlihat murung dan gampang emosi. Bahkan tersangka kerap membayangkan dirinya tengah berada di medan perang dengan mengacungkan sebilah parang sepanjang satu meter. Parangyangseringdiacungkannyaitujuga yang digunakannya untuk menebas anak dan menantunya. ”Sejak ibu meninggal dunia, ayah menjadi gampang emosi. Kadang kita tegur pelan saja, dia langsung marah. Namun yang saya herankan dia sering membayangkan dia ada di medan perang. Awalnya keluarga saya takut, tetapi setelah sering melihat itu, kami jadi biasa saja,” katanya. Keluarga Minta Tersangka Dibebaskan Pada METRO, L Br Sitorus mengaku setelah musyawarah dengan keluarga, mereka memutuskan agar tersangka segera dibebaskan. Sebab korban tidak merasa dirugikan dalam tindakan tersangka. ”Setelah saya tanya sama abang dan adik, mereka sepakat ingin membebaskan Bapak. Soalnya, kami sangat sayang sekali dengan orangtuakamiinidanmerekajugasudahmemaafkannya. Sebenarnya warga yang memaksa ayah kami ditangkap, padahal kami ingin damai keluarga saja,” katanya. KapolsekSerbelawan,AKPKitamanManurung dihubungi METRO, Rabu (2/5), mengaku motif penyerangan tersangka ini disebabkan tersangka stres dan membayangkan sesuatu membahayakan menghampirinya. ”Sejauh ini, kita temukan motif pembacokan ini disebabkan karena tersangka stres ditinggal mati istrinya. Sehingga dia membayangkan sesuatu yang bahaya. Makanya tindakannya pun spontan. Namun demikian, kita akan lakukan pengembangan lagi dan kasus ini masih dalam penyelidikan,” ujarnya. (mag–02)

HARI INI INVESTASI: Mulai besok dapat profit 7% Rp. 6.300.000 setiap harinya non stop selama 200 hari (Tanpa Rekrut) Minat???? SMS "Petunjuk" ke HP 0877 8847 7900

DIJUAL: Mobil Minibus Suzuki carry Futura 1.3 thun 1991, body mulus, harga nego tanpa perantara hub. D. Simanjuntak HP 0813 7554 0521

Carry Pick Up Dp. 20Jt angs 2Jtan APV Pick Up Dp. 25Jt angs 2Jtan APV Arena GL Dp. 26Jt angs 4Jtan Hub: Chandra Pasaribu SE 0852 1514 0852

DIJUAL: Mobil kijang LGX silver metallic 2001, 1800 CC, EFI, AC, Mulus, harga negos, serius hub. HP 0821 6159 0417 / 0813 6179 9055

TOYOTA BARU 2012: Dapatkan New Toyota dengan Bunga Kredit 3,85%. Proses cepat & bisa tukar tambah & dapatkan hadiah khusus di bulan ini. Hub: PREDY SIMATUPANG, 0813 6165 1801 - 0853 6207 2000

SUZUKI 100% BARU

istrinya langsungbangkit dari kamar serta berteriak minta tolong dan dia juga melihat suaminya sudah berdarah-darah.Olehkeluarga,berusahamenahan amukan tersangka dan meraih pisaunya. Sopar Sitorus, anak korban yang ketepatan di rumahitujugaberusahameraihpisaudaritanganpelaku.Akantetapipelakuyangsempatbertahan,sempatmembuatSoparkesulitanmeraihpisautersebut. Akibatnya tangan dan kepalanya terkena pisau. Beruntung,pisautersebutberhasildiraihSopardan pelaku langsung diamankan. Untuk menghindari jatuh korban lainnya, oleh keluarga, tangan pelaku diikat pakai tali hingga pelaku dipastikan tidak dapat melakukan perlawanan. Sampai kemudian polisi datang,tanganpelakumasihdalamposisiterikat. Sementara Bambang dan Sopar, yang sudah terluka langsung dibawa ke RS Mina Padi. Pihak medis yang langsung sigap, berhasil menyelamatkannyawa,Bambang.Sebab,darahyangsempat banyak keluar, bisa menyebabkan Bambang meninggal dunia. Namun akibat tikaman di lehernya tersebut, ia menjalani perawatan intensif. KepadaMETRO,Baktijugamenunjukkanbekasbekas darah yang masih lengket di dinding rumah mereka. “Kemarin, katanya kakek sudah sembuh setelah pulang berobat dari Jakarta. Makanya ia pulang ke kampung. Senin semalam, ia datang ke sini,” sebut Bakti. Bakti mengatakan, ayahnya yang jadi korban pembacokanselamainibekerjasebagaipencaribatu padas di daerah Mandoge, Asahan. Sementara ibunya, terkadang juga berkeliling ke sekolahsekolahmenjualjajanananak-anak. Pada kesempatan yang sama, Boru Purba, tetangga korban mengatakan, kejadian itu sempat membuatwargaketakutan.Namunkarenamengetahui pelaku diikat, warga jadi tenang ditambah ketika polisi datang membawa tersangka. Menurutdia,tersangkatidakbegituseringdatang dari Toba. Namun soal tujuan kedatanganya, Boru Purbatidakmengetahuinya. “Tadi pagi itu kejadiannya. Kami pun terkejut mendengarteriakanmintatolongdanmelihatwarga sudahramai,”ucapnya. Disingung soal hubungan keluarga korban denganpelaku,BoruPurbamengatakansepertinya tidak ada masalah atau konflik antara keluarganya. (mag-4/pra)

Warga Duga Korban Diperkosa Lalu Dibunuh Sambungan Halaman 9 an atau rekreasi di Samosir bersama pacar atau teman. Namun karena cekcok, atau salah paham, kalut dan terjadilah peristiwa itu,” kata Oppung Naga sembari menghunjuk pemakaman korban yang dimakamkan Selasa malam karena sudah bau dan berulat. Berbeda dikatakan Kepala Tata Usaha Rumah Sakit Umum (RSU) Pangururan, O Galingging. Ia mengatakan, jasad perempuan itu telah dimakamkan di Tempat Pemakaman Umum (TPU) Desa Pintu Sonan Pangururan, Selasa (1/5) pukul 19.00 Wib. Pihaknya terpaksa menguburkan jasad korban malam itu juga karena tidak mengizinkan lagi untuk disimpan di ruang mayat, mengingat kondisi mayat sudah bau dan berulat. “Tadi malam kami minta bantuan dua orang petugas Lapas Pangururan untuk menguburkannya,” ujar Galingging. Dia juga membenarkan ada dua keluarga yang mengaku kehilangan anak perempuan dari Nainggolan dan Sidikkalang. Namun setelah diperiksa, ternyata mayat tersebut bukan aggota keluarga mereka. “Dari Desa Nainggolan ada mengaku kehilangan anak perempuan dua bulan yang lalu. Sedangkan dari Sidikkalang mengaku kehilangan anggota keluarganya pada bulan Desember 2011 lalu,” sebutnya. Ditanya hasil otopsi, Galingging mengelak menurutnya. Karena belum mendapat izin dari pihak kepolisian. “Kami hanya bisa menginformasikan kalau wanita itu berusia 16 tahun, tidak ada tanda-tanda kekerasan, luka atau goresan. Hanya sebagian rambut sudah mulai lepas dari kulit kepala,” paparnya.

Kapolsek Onanrunggu, AKP P Simatupang yang dihubungi METRO via selulernya mengaku belum mengetahui hasil otopsi dari Laboratorium Forensik RSU Pangururan. Pihaknya masih menunggu perkembangan dari hasil olah TKP yang dilakukan oleh Satreskrim Polres Samosir. “Untuk perkembangan selanjutnya menunggu keterangan dari Kanit Reskrim yang berada di lapangan,” tandas Kapolsek. Sementara itu, Pakar Psikologis dan Dosen Paska Sarjana Universitas Negeri Medan dan STT Paulus Medan, Prof Dr L Sihombing MPd dihubungi melalui selulernya berpendapat, penemuan mayat perempuan tanpa identitas di Samosir itu perlu diselidiki lebih serius oleh pihak berwajib. “Perempuan yang masih berusia 10-17 tahun masih punya tingkat kesadaran yang tinggi, sehingga jika dikatakan kurang waras belum tentu. Karena diusia remaja anak gadis seperti itu, masih jarang mengalami depresi kecuali karena mengalami trauma pemerkosaan dan percobaan pembunuhan,” ucapnya. Menurutnya, jika dikaitkan dengan kasus-kasus kriminal yang selama ini terjadi diberbagai tempat, anak tersebut adalah korban pemerkosaan yang akhirnya dibunuh dan untuk menghilangkan jejak, pelaku menghilangkan identitas korban dengan menelanjangi dan membuangnya ke tempat yang dimitoskan warga daerah angker. Agar fokus pikiran penyelidik sedikit terganggu dan mengira itu adalah korban tenggelam, kecelakaan, tumbal atau bunuh diri. “Tapi saya rasa itu modus lama. Untuk itu harus ditangani dengan serius, agar tidak ada lagi korban baru,” pungkasnya.(jetro/des)

Pencurian Kerbau Marak di Sipoholon Sambungan Halaman 9 Hasundutan, Sipoholon, adalah pemilik tujuh kerbau tersebut. Peristiwa serupa dialami Dongan Sipahutar (61) warga Dusun Pancinaran Kelurahan Situmeang Kecamatan Sipoholon. Dia kehilangan lima ekor kerbau dari adaran (tempat kerbau merumput), Selasa (1/5). Ceritanya, pagi itu sekira pukul 06.00 Wib, seperti biasa, korban hendak memindah kelima kerbau miliknya. Namun, alangkah terkejutnya korban begitu melihat kerbaunya tidak berada lagi di tempat. Padahal, sore sebelum hilang, ia memastikan kelima kerbau itu diikat di pengandangan. Kerbau diduga hilang sekitar pukul 23.00 WIB. Marah dan kesal. Setelah beberapa jam dilakukan pencarian, tidak ketemu juga, Dongan langsung membuat pengaduan ke Polres Taput. Dia berharap kelima kerbau miliknya bisa kembali. “Kita ingin, Polisi segera menangkap pelaku pencurian ternak itu. Tindakan seperti itu harus dihentikan. Tangkap pelaku. Sebab mereka hanya meresahkan warga,” ujar Dompu Situmeang (65) salah seorang peternak kerbau di Sipoholon. Humas Polres Taput, Ipda W Barimbing membenarkan pe-

ngaduan Dongan. “Benar, ada warga yang mengadu karena kehilangan kerbau. Kita masih menyelidiki kasus ini. mudahmudahan pelaku bisa terungkap,” kata Barimbing. Ia mengakui sudah dua kali masyarakat Sipoholon kehilangan kerbau. Bahkan, guna menyelidiki kasus itu, pihaknya telah membentuk tim khusus. Hanya saja pihaknya belum memiliki bukti-bukti kuat mengungkap kasus tersebut. Namun, pihaknya telah mengimbau kepada para peternak kerbau di daerah ini supaya mengandangkan kerbaunya tidak terlalu jauh dari pemukiman warga. Sehingga bisa lebih mudah dipantau. “Kita sudah menyarankan agar peternak tidak mengandangkan kerbau jangan terlalu jauh dari pemukiman warga,” ucapnya. Kasus pencurian ini, sambung Barimbing, merupakan PR prioritas bagi Polres Taput. Namun, selain dilakukan pengembangan oleh pihak kepolisian, warga juga diharapkan lebih waspada. “Ini akan menjadi PR prioritas kita, sebab menyangkut masalah kehidupan warga. Tetapi warga juga harus waspada. Kejahatankan terjadi bukan karena hanya ada niat pelakunya, namun juga karena adanya kesempatan,” ucapnya menirukan ucapan Bang Napi. (cr-01)


KAMIS

3 Mei 2012

Istri Nazaruddin

Internasional

Obama Pulang, Kabul Dihantam Bom KABUL- Sebuah bom meledak di Kabul, Rabu (2/5), beberapa jam setelah Presiden Amerika Serikat Barack Obama meninggalkan ibu kota Afganistan tersebut. Diberitakan sebelumnya, Obama secara mendadak melawat ke Afganistan, Selasa tengah malam. Dalam kunjungan singkat, sekitar enam jam, Obama bertemu dengan tentara AS di Pangkalan Udara Bagram dan Presiden Hamid Karzai serta menandatangani kepakatan kerja sama strategis kedua negara. Menurut kepala polisi Ayub Salangi, bom mobil itu meledak di Jalan Jalalabad. Di jalan utama kota Kabul itu terdapat sejumlah pangkalan militer AS dan kompleks perumahan untuk warga Barat. Salangi mengatakan, satu kompleks yang dikenal dengan nama Green Village merupakan sasaran bom itu. Seorang perwira polisi lain mengatakan, ledakan itu disusul dengan baku tembak. Belum ada kejelasan soal jumlah korban, tetapi beberapa media Afganistan memperkirakan jumlah korban cukup banyak. Seorang juru bicara dari markas NATO di negara itu menyatakan mengetahui adanya beberapa ledakan. Sejumlah orang di pusat kota juga mengaku mendengar suara ledakan. Sementara itu, Kedutaan Besar AS di Kabul mengatakan, gedung kedutaan besar itu tertutup serta memperingatkan stafnya untuk berlindung dan menjauhi jendela. Kedubes AS berlokasi di area utama diplomatik di pusat kota Kabul. Melalui akun Twitter-nya, Kedubes AS juga memperingatkan warganya di negara itu. “Tiarap dan berlindung di sini di kedubes. Bukan latihan, hindari area,” begitu bunyi pesan itu. (dtc/int)

MINTA JEMPUT KPK JAKARTA- Istri Nazaruddin, Neneng Sri Mulyani, yang menjadi buron KPK ‘menyerah’. Dia pun mengaku siap bekerja sama dengan KPK. Tapi, tersangka kasus korupsi PLTS Kemenakertrans ini minta tidak ditangkap. Wah!

„ Nunun memberikan keterangan terkait kasus yang menimpanya di Pengadilan Tipikor Jakarta.

KPK Yakin Nunun Bersalah JAKARTA- Sidang lanjutan kasus cek pelawat dengan terdakwa Nunun Nurbaeti mengagendakan pembacaan replik duplik. Jaksa menolak nota pembelaan kuasa hukum, dan tetap menilai Nunun bersalah. Hal itu disampaikan saat pembacaan replik oleh tim JPU KPK Andi Suharlis dan Siswanto di hadapan Majelis Hakim Pengadilan Tipikor Jakarta. Jaksa Andi tidak sependapat dengan pledoi yang disampaikan oleh tim Penasehat Hukum Nunun. ”Penasehat hukum menyatakan (dalam pledoi kemarin) tidak ada hubungan perbuatan terdakwa dengan pasal 5 ayat 1 huruf b dengan perbuatan anggota

DPR vonis pasal 11 UU Tipikor, terhadap itu, kami tidak sependapat,” tutur jaksa Andi di pengadilan Tipikor, Jl Rasuna Said, Jaksel, Jakarta, Rabu (2/5/2012). Menurut jaksa, alasan pihaknya menuntut Nunun dengan pasal 5 Huruf b tidak hanya pasal 11 sebagaimana yang didakwakan pada para anggota DPR sebelumnya itu karena tidak ada suatu delik yang pembuktiannya harus digantungkan dengan pasal yang lainnya dan juga saat anggota DPR itu divonis pasal 11 UU Tipikor mengenai gratifikasi, Nunun belum bisa dihadirkan dalam persidangan. JPU juga menilai soal penerimaan uang senilai Rp 1 miliar ke rekening

Nunun. Dalam pledoi kemarin, penasehat hukum menyatakan bahwa harta diperoleh secara mandiri dan bukan oleh cara koruptif. Atas hal tersebut, dalam replik yang diajukan, JPU tidak sependapat. ”Kami tidak sependapat, penuntut umum menerapkan pembuktian bahwa Rp 1 miliar berasal dari pencairan TC 480 lembar yang dibagikan kepada DPR” ujarnya lagi. Sebelumnya, Nunun dituntut empat tahun penjara dan denda Rp 200 juta, subsider 4 bulan penjara. Jaksa KPK juga meminta uang Rp 1 miliar yang berasal dari 20 lembar cek BII dirampas untuk negara. (dtc/int)

Anas Tak Mau Diadili Lewat Opini

„ Obama

China Langgar Wilayah Terbang India NEW DELHI - Sepanjang Maret tahun ini, pesawat-pesawat China dilaporkan telah dua kali melanggar wilayah udara India, di kawasan perbatasan yang disengketakan kedua negara. Demikian ungkap Menteri Pertahanan India, AK Antony, kepada parlemen di New Delhi, Rabu (2/5). Menurut Antony, insiden pelanggaran wilayah udara itu terjadi pada 16 dan 19 Maret. Insiden pertama bahkan melibatkan dua helikopter China, yang melintasi perbatasan kedua negara secara ilegal. Pelanggaran tersebut terjadi di negara bagian Himachal Pradesh di bagian utara India, yang berbatasan langsung dengan wilayah Tibet, bagian dari China. Antony mengatakan, dua insiden ini dilaporkan ke Beijing melalui mekanisme diplomatik resmi demi menjaga perdamaian. “Berbagai insiden transgresi dan intrusi, dibahas dengan pihak China melalui berbagai mekanisme yang sudah ditetapkan, seperti sambungan telepon khusus, pertemuan pejabat militer, pertemuan personel penjaga perbatasan, dan saluransaluran diplomatik normal. Semua mekanisme ini memfasilitasi pemeliharaan perdamaian,” papar Menhan India. China dan India pernah berperang pada tahun 1962, memperebutkan kawasan perbatasan yang disengketakan. China mengklaim seluruh wilayah negara bagian Arunachal Pradesh di timur laut India sebagai wilayahnya, dan juga sebagian kawasan di provinis Kashmir. Sejak 1962, kedua negara sudah menggelar 14 perundingan sengketa perbatasan tanpa hasil. Hingga saat ini, China masih terus menggelar infrastruktur militer yang kuat di perbatasan dengan India. India sendiri melihat Beijing sebagai ancaman jangka panjang negara itu. Beberapa pekan lalu, India menguji coba rudal balistik Agni V yang mampu mengusung hulu ledak nuklir, dan bisa menjangkau seluruh kota besar China. (kmc/int)

GARUT - Ketua Umum DPP Partai Demokrat, Anas Urbaningrum meminta kepada semua pihak untuk melihat secara jernih kasus suap Wisma Atlet yang menyeret namanya dan mantan Wasekjen Demokrat, Angelina Sondakh. Menurut Anas, lebih baik kasus suap Wisma Atlet dituntaskan lewat proses hukum. “Begini.... begini. Kita serahkan ke proses hukum yang adil. Jangan digiring dengan opini-opini,” kata Anas di selasela kunjungan kerja (Kunker) bersama dengan anggota Fraksi Demokrat di DPR di Garut, Jabar, Kamis (2/5). Anas menegaskan, jika proses hukum digiring dengan opini maka yang terjadi adalah pengadilan opini. Mantan anggota KPU itu khawatir pengadilan opini akan mengesampingkan proses hukum yang adil. “Proses hukum digiring terus dengan opini, bukan proses hukum yang adil. Yang terjadi adalah pengadilan-pengadilan opini, kalau terjadi pengadilan opini, ya bukan keadilan,” ujarnya. Karenanya, kata dia, opini dalam proses hukum harus dihindari demi tegaknya keadilan. “Kemenangan opini itulah yang harus kita hindari. Tetapi

„ Anas Urbaningrum

kalau proses hukum, serahkan kepada aparat penegak hukum, biarkan bekerja,” tukasnya. Seperti diketahui, dalam beberapa kali kesempatan Nazaruddin menyebut keterlibatan Anas dalam dugaan korupsi, seperti proyek sport center Hambalang. Nazaruddin juga menyebut kemenangan Anas di Kongers Partai Demokrat juga tak lepas dari money politic yang berasal dari dana proyek-proyek APBN. Namun kini Anas tak mau dipusingkan dengan opini negatif yang mengarah ke dirinya. Ia justru semakin

rajin turun ke bawah menemui konstituen Demokrat. Selama di Jabar, Anas melakukan kunjungan kerja di tiga kabupaten selama 2 hari dari 1-2 Mei 2012. Yakni Kabupaten Bandung, Bandung Barat dan Garut. Ia didampingi oleh legislator dari daerah pemilihan Jabar seperti Herman Khaeron, Roestanto Wahidi dan Yahya Sacawirya. Selain membagi-bagikan sumbangan kepada masyarakat, rombongan Anas juga melaksanakan program bedah rumah layak huni bagi warga yang tidak mampu.(awa/jpnn)

Anis Matta: KPK Harus Usut Aliran Dana Wa Ode JAKARTA- Wakil Ketua DPR Anis Matta siap memenuhi panggilan KPK sebagai saksi kasus Wa Ode Nurhayati. Anis sepakat Wa Ode diusut dengan UU Tindak Pidana Pencucian Uang (TPPU) dan mendorong KPK mengusut aliran dana Wa Ode. ”Saya mengucapkan terima kasih

sebesar-besarnya kepada KPK yang memberi saya kesempatan membantu mengusut kasus suap Saudara Wa Ode Nurhayati, anggota Banggar dari fraksi PAN yang sudah dikembangkan dengan pidana TPPU,” kata Anis kepada wartawan di Gedung DPR, Senayan, Jakarta, Rabu (2/5).

„ Anis Matta

Anis akan mengungkapkan semua yang diketahuinya kepada KPK. Anis siap menjelaskan mekanisme pembahasan anggaran di DPR. ”Saya akan membantu KPK mengusut kasus ini sepanjang sesuai dengan kewenangan saya sebagai wakil ketua Banggar bidang koordinator keuangan,” ujar Anis. Anis meyakini kasus ini terpisah. Anis mendorong KPK justru mengungkap aliran dana Wa Ode Nurhayati. ”Di sini ada dua kasus terpisah. Pertama kasus suap yang menimpa Wa Ode Nurhayati dari Fraksi PAN. Kedua, pembahasan anggaran yang sudah ditetapkan di DPR. Yang perlu ditelusuri aliran dana dari suap itu siapa yang lebih menikmati dari aliran ini. Itu yang lebih relevan untuk ditelusuri. Ini tidak ada hubungannya dengan mekanisme,” tandasnya. (kmc/int)

”Ya dijemput sapemulangan ja,” kata pengacara Neneng. Namun, Nazaruddin, Elza dia tidak mengeSyarief, saat tahui apakah surat berbincang dengan itu dari kuasa huwartawan, Rabu (2/ kum Nazaruddin 5). ataupun Neneng. Elza mengamini ”Jadi Jumat pebahwa Neneng kan lalu pimpinan sudah berkirim surat KPK menerima dan melakukan surat dari pengkontak dengan KPK. acara (kuasa hukum Tapi dia mengaku Nazaruddin). Surat tidak tahu di mana „Neneng Sri Mulyani itu isinya mereka keberadaan Neneng. Elza pun ingin koordinasi berkaitan tidak tahu kalau Neneng seperti dengan pemulang Neneng,” kabar yang beredar, berada di kata Juru Bicara KPK Johan Budi Jurong, Malaysia. di kantornya, Selasa (1/5). ”Ya belum tahu,” ujarnya. Menurut Johan, saat ini surat Elza juga menjelaskan bahwa tersebut masih dibahas oleh Neneng akan memenuhi proses pimpinan KPK. Belum ada kepuhukum bila tidak ditangkap dan tusan dari pembahasan tersebut. ditahan. “Tentu akan koo”Belum ada keputusan,” ujar peratif,” janjinya. Johan. Dihubungi terpisah, Sebelumnya, Jubir KPK Johan kuasa hukum Nazaruddin, Budi membenarkan adanya suJunimart Girsang, yang juga rat kepada pimpinan mengenai menjadi pengacara Neneng, koordinasi pemulangan membenarkan ada surat itu. Neneng. Namun, dia tidak mNamun dia tidak menjelaskan ngetahui apakah surat itu dari lebih rinci mengenai maksud kuasa hukum Nazaruddin koordinasi dalam surat itu. ataupun Neneng. ”Iya. Tapi nanti saja ya leng”Jadi Jumat pekan lalu pimkapnya, saya sedang ada acara,” pinan KPK menerima surat dari papar Junimart. pengacara (kuasa hukum NazarSebelumnya, Wakil Ketua uddin). Surat itu isinya mereka KPK Busyro Muqoddas pernah ingin koordinasi berkaitan menyatakan Neneng bersemdengan pemulang Neneng,” bunyi di Malaysia. kata Juru Bicara KPK Johan Budi “Sampai sekarang infordi kantornya, Selasa (1/5). masinya masih di Malaysia,” kata Menurut Johan, saat ini surat Busyro beberapa waktu silam. tersebut masih dibahas oleh Hingga saat ini, sambung Buspimpinan KPK. Belum ada yro, KPK terus bekerjasama keputusan dari pembahasan dengan interpol untuk metersebut. nangkap istri bekas Bendahara Lobi Upaya Pemulangan Umum Partai Demokrat itu. dari Malaysia “Kalau yang namanya DPO Pihak Neneng Sri Wahyuni (Daftar Pencarian Orang) kan menyurati pimpinan KPK. Buharus dikejar,” tegas Busyro. ronan kasus korupsi PLTS KeIa enggan menjelaskan lebih menakertrans ini ingin berkoorjauh mengapa hingga saat ini dinasi mengenai upaya pemuNeneng belum dipulangkan ke langan dari pelarian di luar negeri. Indonesia, meski keberadaannya Jubir KPK Johan Budi membesudah terdeteksi. “Kalau masalah narkan adanya surat kepada itu, interpol juga harus pimpinan mengenai koordinasi menjelaskan,” katanya. (dtc/int)

Anis Matta: KPK Harus Usut Aliran Dana Wa Ode JAKARTA-WakilKetuaDPR Anis Matta siap memenuhi panggilan KPK sebagai saksi kasus Wa Ode Nurhayati. Anis sepakat Wa Ode diusut dengan UU Tindak Pidana Pencucian Uang (TPPU) dan mendorong KPK mengusut aliran dana Wa Ode. ”Saya mengucapkan terima kasihsebesar-besarnyakepada KPK yang memberi saya kesempatan membantu mengusut kasus suap Saudara Wa Ode Nurhayati, anggota Banggar dari fraksi PAN yang sudah dikembangkandenganpidana TPPU,”kataAniskepadawartawan di Gedung DPR, Senayan, Jakarta, Rabu (2/5). Anis akan mengungkapkan semuayangdiketahuinyakepada KPK. Anis siap menjelaskan mekanisme pembahasan

anggaran di DPR. ”Saya akan membantu KPK mengusut kasusinisepanjangsesuaidengan kewenangansayasebagaiwakil ketua Banggar bidang koordinator keuangan,” ujar Anis. Anis meyakini kasus ini terpisah. Anis mendorong KPK justru mengungkap aliran dana Wa Ode Nurhayati. ”Di sini ada dua kasus terpisah. Pertama kasus suap yang menimpa Wa Ode Nurhayati dari Fraksi PAN. Kedua, pembahasan anggaran yang sudah ditetapkan di DPR. Yang perluditelusurialirandanadari suap itu siapa yang lebih menikmati dari aliran ini. Itu yang lebih relevan untuk ditelusuri. Ini tidak ada hubungannya dengan mekanisme,” tandasnya. (kmc/int)

DPR Tagih Janji Menlu Ungkap Kasus Penembakan 3 TKI di Malaysia JAKARTA- Anggota Komisi I DPR Poempida Hidayatullah mengirimkan nota kepada Menteri Luar Negeri (Menlu) Marty Natalegawa. Ia meminta Menlu proaktif mengungkap kasus penembakan 3 TKI asal Lombok Timur, NTB oleh polisi Malaysia. ”Kami berharap agar pihak Kementerian Luar Negeri dapat segera mengambil langkah-langkah yang dianggap perlu untuk membongkar secara transparan segala sesuatu hal yang berhubungan dengan peristiwa penembakan tersebut,” kata Poempida kepada wartawan, Rabu (2/5).

Bagi Poempida, kasus penembakan 3 TKI janggal karena diduga polisi Malaysia bertindak sewenang-wenang. ”Perlu kami ingatkan, jika memang terindikasi hal tersebut terjadi, maka hal ini merupakan suatu pelanggran hak asasi manusia,” tegasnya. Karena itu dalam nota yang dikirimkan Poempida hari ini, Kemenlu diminta menginformasikan laporan kronologis formal dari kepolisian Malaysia. ”Agar kami dapat jadikan bahan kajian dan pertimbangan dalam me-

nentukan sikap kami kemudian,” ujar dia. Seperti diketahui Badan Nasional Penempatan dan Perlindungan Tenaga Kerja Indonesia (BNP2TKI), menemukan fakta tiga TKI asal Lombok Timur, NTB diberondong tembakan oleh polisi Malaysia.Tiga TKI yang tewas adalah Herman (34) dan Abdul Kadir (25), asal Dusun Pancor Kopong, Desa Pringgasela Selatan, Kecamatan Pringgasela, Lombok Timur, NTB serta Mad Noor (28) beralamat Dusun Gubuk Timur, Desa Pengadangan, Kecamatan Pringgasela, Lombok Timur. Penembakan pada tiga TKI terjadi

„ Poempida Hidayatullah

di area Port Dickson (pelabuhan), Negeri Sembilan, Malaysia pada 24 Maret 2012 sekitar pukul 05.00 waktu setempat. Penembakan dilakukan atas dugaan para TKI melakukan upaya perampokan di kawasan Kampung Tampin Kanan Tinggi, Port Dickson, Negeri Sembilan. Keterangan yang diperoleh juga menyebutkan, para TKI berusaha melawan hingga polisi melepaskan tembakan berkali-kali ke bagian wajah dan tubuh atau dada, yang kemudian membuat ketiganya meninggal dengan cara mengenaskan. (dtc/int)


KAMIS

3 Mei 2012

Kami telah merancang Apache RTR sebagai sepeda motor dengan level yang lebih tinggi. Varian ini adalah pengembangan dari brand TVS. Setiap sistem, detail dan komponen telah disempurnakan guna mendapat performa yang memaksimalkan,” President Director TVS Motor HS

PABRIKAN sepeda motor asal India TVS resmi meluncurkan varian sport Apache RTR 2012. TVS memberikan perubahan pada desain Apache ini dengan tema desain perubahan tidak terbatas. TVS memberikan sentuhan manis pada dua model Apache RTR 160 dan Apache RTR 180. Fitur yang disematkan pada Apache terbaru ini tidak mainmain. TVS memasang rem ABS dan lampu pilot LED yang langsung menyala saat tombol start dihidupkan.

„ Seorang model menaiki TVS Apache RTR

Desain tangki bahan bakar dibuat tajam dengan bantuan fairing di setiap sisinya, panel instrumen dengan indikator digital. Otot sepeda motor semakin dipertegas dengan penutup mesin, dengan warna menyatu antara head lamp, fairing tangki dan penutup mesin bawah. “Kami telah merancang Apache RTR sebagai sepeda motor dengan level yang lebih tinggi. Varian ini adalah pengembangan dari brand TVS. Setiap sistem, detail dan komponen telah disempurnakan guna mendapat performa yang memaksimalkan,” kata President Director TVS Motor HS Goindi, seperti dilansir, Selasa (1/5). Soal dapur pacu mesin, TVS tidak memberikan perubahan. TVS Apache RTR 160 mampu memproduksi daya output 15,2 PS dengan kecepatan tertinggi 118 km/ jam. Sementara TVS Apache 180 menghasilkan daya 17,03 PS dengan kecepatan tertinggi 124 km/jam. Apache RTR 160 tersedia dalam empat warna ganda, merah, hijau, kuning dan abu-abu. Sementara warna hitam menjadi dasar. Sedangkan Apache 180 hadir juga dengan empat warna yakni putih, hitam, kuning dan abu-abu. TVS Apache RTR versi ABS hanya tersedia dalam warna putih dan hitam. Mengenai harga,

„ GeForce GTX 690

NVIDIA Luncurkan GeForce GTX 690 NVIDIA mengumumkan keluarga kartu grafis GTX terbaru yang mengusung teknologi dual Graphics Processing Unit (GPU). Kartu grafis ini adalah NVIDIA seri GeForce GTX 690 yang diklaim dapat menawarkan performa terbaik dikelasnya. Jajaran baru perangkat kartu grafis perkasa ini hadir menawarkan performa terbaik. Sebulan setelah situs Hexus memberitakan NVIDIA Kepler GPU GTX 680, kini muncul seri GTX 690 yang dikabarkan mampu mengalahkan Radeon HD 7970 besutan AMD. Menurut informasi yang beredar, seri GTX 690 akan dirilis mulai 3 Mei 2012. Kartu grafis ini dibanderol USD999 atau sekira Rp8,9 juta. GTX 690 mengusung fitur GK104 GPU dengan RAM 4GB, menjadikan kartu grafis ini memiliki performa mutakhir untuk generasi kartu grafis saat ini. GTX 690 diklaim memiliki tampilan fisik kartu grafis terbaik. Pasalnya, NVIDIA hadir dengan balutan alumunium serta lapisan chromium. Tidak hanya itu, kartu grafis canggih ini juga dilengkapi dengan magnesium fan housing untuk fungsi thermal (pendingin) serta pencahayaan laser LED. Selain itu, GTX 690 juga mempunyai dua fitur pendingin di masing-masing GPU-nya, yakni mengkolaborasikan heatspreader yang berjalan di bawah kipas utama. Tak diragukan lagi, kemampuan perangkat pacu grafis ini layak dirilik oleh para penggemar game 3D terkini. Spesifikasi yang terungkap, menyebutkan GTX 690 memiliki Core Clock 915 Mhz, Boost Clock 1019Mhz, Memory Clock 6.008 Ghz GDDR5, Memory Bus 2 x 256-bit serta VRAM 2 x 2GB. Kartu grafis yang diproduksi menggunakan proses fabrikasi 28 nanometer ini juga membutuhkan Thermal Design Power (TDP) sebesar 300 Watt. (int/)

MESKI tablet mulai menyerang dan terlihat menyingkirkan netbook di negara maju, seperti Amerika Serikat tapi hal itu tidak berlaku di Indonesia . Terbukti dengan bersemangatnya Asus menghadirkan netbook Flare Series terbarunya, yang salah satu diantaranya adalah Eee PC 1225B. Kali ini okezone akan mereview kemampuan netbook besutan perusahaan asal Taiwan tersebut. Dari desain, netbook ini memiliki tampilan body yang mulus. Asus memperkaya desain Eee PC Flare Series ini dengan tambahan finishing metalik pada bagian body casing. Netbook ini hadir dengan pilihan empat warna yaitu Rock Black, Angel White, Modern Silver dan Rouge Red. Sama seperti casing netbook yang terasa mulus, begitu juga dengan touchpad . Selain berfungsi sebagai mouse, touchpad yang berukuran cukup besar ini juga bisa menjadi alat zoom in dan zoom out

hanya dengan meletakkan dua jari di atasnya. Artinya, Eee PC 1225B menggunakan touchpad Multi Gesture yang tidak hanya befungsi sebagai mouse karena pengguna juga bisa menscroll halaman atau foto di netbook menggunakan dua jarinya. Misalnya, untuk memperbesar gambar di layar, cukup dengan melebarkan kedua jari tadi, sedangkan untuk memperkecilnya dengan merapatkan kedua jari yang ada di atas touchpad. Permukaan touchpad memang terasa halus, tapi tombol klik yang terintegrasi dengan touchpad terasa

kaku dan harus menekan sedikit sedikit lebih keras untuk menggunakannya. Untuk mengetik, keyboard di Eee PC 1225B terasa sedikit rapuh ketika ditekan sehingga mungkin pengguna harus membiasakan diri menggunakannya. Meski begitu, keyboard tetap responsif ketika digunakan. Netbook yang dibekali dengan prosesor AMD Fusion APU 1,65GHz dan Grafis AMD Radeon HD6320 ini juga cukup ringan untuk dibawa bepergian mengingat beratnya yang hanya 1,38Kg. Untuk ukuran netbook, layar Eee PC

ini cukup lebar sehingga memberikan tampilan yang lebih luas dan tajam. Ini semua berkat Asus yang memberikan layar seluas 11,6 inci dengan resolusi High Definition (1366x768) sehingga tampilan menjadi lebih jernih dan cerah. Tapi mengingat layar yang hadir dengan tampilan glossy (mengkilap), sebaiknya hindari penggunaannya jika berada di tempat dengan cahaya yang kuat karena akan memantulkan cahaya dan bayangan. Eee PC 1225B menggunakan sistem operasi Windows 7 Home Premium, sedangkan untuk paket penjualannya Asus melengkapinya dengan sistem operasi DOS. Meski memiliki body yang tidak terlalu besar, tapi untuk multitasking Eee PC 1225B berjalan cukup baik. Ketika dijajal menjalankan browser dengan membuka banyak tab, LibreOffice 3.5, foto dan pemutar musik, Eee PC 1225B masih berjalan baik.(int/mer)

Smartphone Berkamera Disukai Masyarakat HTC berpendapat setiap pengguna ponsel cerdas cenderung menginginkan fitur kamera yang lebih baik. Menurut mereka, kamera yang lebih baik tersebut mestinya memenuhi beberapa kriteria. “Dalam setiap survei yang menanyakan fitur apakah yang diinginkan pengguna smartphone, jawaban mengenai fitur-fitur kamera yang lebih baik muncul di berbagai negara. Apakah fitur kamera yang lebih baik ini?,” ujar Head of Product Marketing HTC Indonesia Samudro Seto, di Jakarta, kemarin. “Pertama adalah kualitasnya. Kamera tidak sekeedar megapixel, tapi ada sensor gambar sampai prosesor smartphone itu sendiri yg saling mempengaruhi,” tambahnya. Selanjutnya Samudro menambahkan, hal kedua yang diperhatikan adalah Speed. Maksudnya adalah

pertimbangan bahwa orang-orang biasanya menggunakan kamera smartphone untuk momen-momen penting yg tidak terencana. Momenmomen yang cepat dan tidak akan kembali lagi. “Fast kamera diperlukan supaya tidak kehilangan momen ini,” imbuhnya. Selain itu, pengguna smartphone juga menilai penting fitur video. Menurutnya, fitur ini selalu dipakai di setiap negara dan memiliki nilai sama penting dengan still image (kamera). “Dari ketiga hal tersebutlah kami memulainya. HTC kemudian membuat perangkat yang bisa memberikan the best kamera experience,” paparnya menjelaskan alasan HTC memilih ponsel yang menjagokan kamera. Meskipun ketiga hal di atas adalah pokok yang memperngaruhi pengalaman pengguna smartphone dengan kameranya, masih ada hal yang perlu dilihat lebih dalam lagi. “Untuk

dapat jadi the best camera, ada tiga area yg mesti didalami,” jelasnya. Hal pertama yang diungkapkan adalah master of light. Maksudnya, kamera sebuah ponsel cerdas mesti bisa digunakan di berbagai suasana pencahayaan. Baik itu kurang cahaya, tidak ada cahaya dan ketika cahaya terang. “Kualitas cahaya mesti bisa kita pegang,” ujar Samudro. Selain itu masih ada high speed shooting yang maksudnya kecepatan kamera dalam memotret gambar. Misalnya ketika melakukan continuous shooting bisa terus menerus mengambil gambar sampai 99 kali dengan jeda per gambar hanya 0,2 detik. Terakhir, menurutnya adalah pengalaman pengguna ketika menggunakan kamera ponsel cerdasnya untuk merekam video. “Ini adalah area baru yang akan kami fokuskan,” ungkap Samudro mengenai hal tersebut. (int/mer)


6

KAMIS

3 Mei 2012

Julia Perez mulai menekuni bisnis barunya di bidang batu bara. Baru tiga bulan, Jupe langsung mengeruk untung besar. Ia mendapat hadiah dari rekanan bisnisnya, H Tommy Cangkung. Jupe dihadiahi sebuah mobil mewah BMW Z3 dua pintu seharga satu miliar rupiah. “Baru tiga bulan aku bisnis sudah dikasih bonus BMW dua pintu pula. Rencananya hari ini sampai di Jakarta, soalnya semalam sudah di Lamongan. Masih enggak sangka. Gue beruntung banget. Mobil Alphard gue saja nyicil. Itu mobil sampai Rp1 miliar,” tutur Jupe di kawasan Kebon Jeruk, Jakarta Barat,

Olla R amlan Ramlan

Tak Suka Banyak Bulu Olla Ramlan termasuk artis yang sangat peduli dengan penampilan dan kebersihan. Olla bahkan mengaku rajin ‘mengusir’ bulubulu halus di sekitar tubuhnya. ”Menurut saya sih yang berkumis harusnya cowok. Bulu-bulu tipis saya sih di wax,” ujar Olla di kawasan Kebon Jeruk, Jakarta Barat, Rabu (2/5) siang. Bila diperhatikan, Olla Ramlan juga memiliki bulu halus yang menyerupai kumis tipis di bawah hidungnya. Meski tak terlalu suka banyak bulu, Olla tak mau mempermasalahkan yang satu itu karena dianggap tak terlalu mengganggu. “Kalau saya sih walaupun enggak berkumis banget, tapi ada kumis-kumis tipis. Masalah dihilangkan atau enggak, itu selera,” tukas kekasih pengusaha Muhammad Aufar itu. ”Saya memang enggak suka dengan yang terlalu banyak bulu, harusnya perempuan itu di waxing, tapi balik lagi soal selera,” katanya malu-malu. Apakah Olla rajin waxing lantaran ingin menikah? “Orang masih lama kok, enggak ada persiapan apa-apa, keluarga juga belum ketemu,” jawab Olla sambil masuk ke dalam mobilnya. (nov/int)

HOROSKOP HARI INI TAURUS (21 April - 20 Mei) Karier: Pertahankan prestasi kerja Anda, buat bos bangga. Asmara: Bertemu orang baru yang menggetarkan hati.

Aquarius

(20 Januari - 18 Februari)

Artis cantik Krisdayanti membantah kalau rumah tangganya sedang bermasalah dengan sang suami, Raul Lemos. Bahkan, adik kandung artis Yuni Shara itu mengaku jika dirinya kerap tampil bersama dengan Raul. “Aku sudah membantah gosip itu dan ini salah satu bukti kebersamaan kami. Dia rutin mengantar saya ke dokter untuk konsultasi tentang bentuk tubuh. Dia juga yang selalu mendorong saya agar bisa mendapatkan kembali bentuk tubuh ideal dan montok,” ujar Krisdayanti saat jumpa pers Laser Lipolysis Nibelth Klinik, di Excelso Cafe, Cilandak, Jakarta Selatan. Sebagai diva, KD menjelaskan bahwa kini dirinya sedang berkonsentrasi mengurusi keluarga barunya dengan bayi yang baru berusia enam bulan. Sedangkan kabar dua anak hasil perkawinannya dengan Anang Hermansyah, dia katakan baik, meski mereka lebih banyak bersama Anang dan calon ibu barunya. Bicara

Rabu (2/4) siang. Jika mobil mewah sudah sampai di kediamannya, Jupe mengaku langsung akan memakai jalan-jalan ke tempat syuting. Jupe akan memesan plat nomor khusus untuk mobil barunya. “Saya mau pakai jalan-jalan, mau dibuka sun roofnya. Kayak orang kampung gue. Saya lagi bahagia dikasih mobil baru BMW Z3. Plat nomornya juga pesan B 7 UPE. Soalnya kan masih plat nomor Kalimantan,” bebernya. Setelah memiliki rumah mewah, mobil Alphard dan sebuah BMW, Jupe merasa belum puas. Jika bisnisnya kian sukses,

tentang Aurel putri sulungnya, KD ingat dulu saat remaja itu masih kecil, dia tidak sempat ikut mendaftarkan sekolah saking sibuknya. “Allah memberikan saya kesempatan kedua punya anak lagi. Jadi, saya tidak mau kehilangan moment itu. Saya nanti ingin mendaftarkan Amora sekolah dan mengantarnya belajar setiap hari,” pungkas KD. (kpl/int)

Demian

Pingsan Dijepit Balok Es Peti Mati Seorang ilusionist macam Demian memang harus siap menerima resiko buruk dengan aksiaksinya. Malam tadi, ia pingsan gara-gara dijepit balok es berbentuk peti mati. ”Demian pingsan saat latihan di jepit oleh balok es berbentuk peti mati untuk pertunjukan ‘Show Spektakuler 6 jam dijepit balok es’,” kisah Nanda, sangmanajersaatdihubungimelaluitelepon,Rabu (2/5). Padahal aksi tersebut baru dijalaninya satu jam saja. Selama berada di dalam es balok tersebut, Demian memang terus melakukan komunikasi dengan awak kru. Namun, tiba-tiba Demian terdiam. Ia pun langsung dievakuasi. Dokter mendiagnosa, Demian mengalami frozen bite. Acara pertunjukan itu pun terancam batal digelar. ”Dokter nggak rekomen Demian untuk terusin acara itu,” tuturnya. (dtc/int)

Karier: Banyak peluang mencapai sukses dalam dunia bisnis. Teruskan sifat hemat, bijaksana, dan berhati-hati dalam mengelola bisnis. Asmara: Hidup ini hambar tanpa cinta. Anda patut dipuji karena setia dan suka berkorban demi kebahagiaan kekasih.

Virgo

Jupe akan membeli sebuah helikopter agar ia tak lagi kena macet. “Kalau sukses di batubara saya mau beli helikopter biar enggak kena macet. Terserah deh orang mau ngomong apa, Jupe lagi senang. Kan kalau Jupe itu dapat motor pasti dibilang jelek, hasil guna-guna atau ngepet lah, terserah, pokoknya gue lagi senang,” katanya sambil tertawa. (nov/int)

(23 September - 22 Oktober)

Karier: Ada beberapa kesempatan kerja. Kendati tidak seperti yang Anda harapkan, namun bisa berarti baik untuk jenjang karier Anda ke depan. Asmara: Penuh sukacita. Tampaknya Anda sudah menemukan pasangan yang meyakinkan untuk masa depan.

Scorpio

(23 Oktober - 22 November)

Karier: Melalui masa-masa sulit. Jangan khawatir, badai pasti berlalu. Asmara: Semua terasa di dalam mimpi, karena Anda sedang dimanjakan oleh pasangan Anda. Nikmati saja.

Libra

(23 Agustus-22 September)

Chelsea Olivia

Karier: Mulai jenuh. Hati-hati, ini akan mudah sekali terkena stres. Lebih baik Anda berencana ambil cuti tahunan dan berlibur. Asmara: Semakin berbunga-bunga. Meski sudah lama kenal, sikapnya tidak pernah membuat Anda bosan.

Capricorn

Dilarang Kurus Oleh Pacar

(21 Desember -19 Januari)

Berat badan tampaknya menjadi hal yang paling dijaga pesinetron Chelsea Olivia. Sebab, ia sangat dilarang kurus oleh sang kekasih, Glenn Alinskie. Menurut Chelsea, kekasihnya itu tak menyukai perempuan yang kurus. Glenn pun akan terlihat sebalsaatberatbadanChelseaturundrastis.”Glenn nggak suka cewek kurus. Dia paling sebal kalau aku bilang aku kurusan,” ungkapnya saat ditemui di Buaya Show, Indosiar, Jakarta Barat, Rabu (2/5). ”Dia selektif banget. Aku pernah naik 5 Kg, dari situ Glenn bilang aku gemukan,” lanjutnya. Tak hanya soal berat badan, Glenn juga punya larangan untuk Chelsea dalam hal berpakaian. Menurutnya, Glenn tak suka jalan bareng saat dirinya mengenakan gaun motif bunga-bunga. ”Bagi Glenn itu kuno, menurut dia polkadot dan bunga-bunga itu kolot,” tuturnya. Sudah cukup lama memang keduanya menjalin asmara. Namun, kata-kata pujian jarang mereka ungkapkan satu sama lain. Kok? ”Kita bukan pasangan yang suka memuji, apa yang dikeluarkan jujur dan nggak berlebihan,” tutur Chelsea. (dtc/int)

Karier: Anda adalah tipe setia pada atasan. Tapi Anda lebih suka bekerja sendiri tanpa nasihat dan kritik.Asmara: Anda sedang merindukan cinta sejati, tetapi Anda sama sekali belum berhasil mendapatkannya.

Sagitarius

( 23 November - 20 Desember)

Karier: Selamat! Anda tampaknya akan dipromosikan dalam waktu dekat ini, pertahankan stamina kerja Anda. Asmara: Walaupun sering selisih paham, namun hubungan Anda dengan si dia baikbaik saja.

Pisces

19 Februari - 20 Maret

Karier: Berargumentasi dengan atasan Anda masih dianggap wajar apabila masih dalam jalur urusan pekerjaan. Lebih dari itu, pertanda hati-hati dengan posisi Anda sekarang. Asmara: Sikap sabar dalam menghadapi pasangan patut diacungi jempol.

Gemini

(21 Mei - 20 Juni)

Karier: Berkat semangat Anda dalam mewujudkan cita-cita, maka saat ini adalah saatnya menuju sukses besar. Asmara: Banyak godaan. Jadi, tetaplah bertahan karena ini hanya sesaat.

Cancer

(21 Juni- 20 Juli)

Karier: Jangan terpengaruh teman. Lakukan saja yang Anda mampu agar tugas kantor tidak menumpuk. Asmara: Anda sangat tergantung pada kekasih Anda, sampai-sampai Anda tidak memiliki pendirian.

Leo

(21 Juli-21 Agustus)

Karier: Jangan terpengaruh teman. Lakukan saja yang Anda mampu agar tugas kantor tidak menumpuk. Asmara: Anda sangat tergantung pada kekasih Anda, sampai-sampai Anda tidak memiliki pendirian.

Aries

19 Februari - 20 Maret

Karier: Jangan terpengaruh teman. Lakukan saja yang Anda mampu agar tugas kantor tidak menumpuk. Asmara: Anda sangat tergantung pada kekasih Anda, sampai-sampai Anda tidak memiliki pendirian.

Julie Estelle

Sedih Ditinggal Nikah Sang Kakak

Pernikahan kakak kandungnya, Cathy Sharon pada 14 April 2012 membuat Julie Estelle merasa kesepian. Meski begitu, Julie mencoba memakluminya. “Kalau dibilang kehilangan awalnya kaget. Di Jakarta kan tinggal berdua sama Cathy, pasti ada rasa sedih. Tapi aku enggak lihat itu sebagai sebuah kehilangan,” ujar Julie saat ditemui di acara peluncuran film Broken Hearts, Planet Holywood, Jakarta. Menurut Julie, rasa kehilangan yang dialaminya merupakan hal yang wajar. Namun, lambat laun ia sudah terbiasa. “Aku malah merasa dapat kakak lakilaki. Sebentar lagi aku sama Cathy dan suaminya mau traveling 3 minggu ke Yerusalem, Amsterdam, dan Prancis,”

ujarnya senang. Sebagai adik, Julie pun mendoakan yang terbaik untuk kakaknya. “Sekarang senang aja, mudah-mudahan semuanya bahagia,” harapnya. Tepis Kesepian dengan Syuting Untuk menepis kesepian sejak ditinggal nikah kakak kandung, Cathy, Julie

menghibur diri di tempat syuting. Dia dipertemukan dengan Reza Rahardian. Adegan ciuman bibir dengan lawan mainnya, Reza, tak membuat Julie Estelle takut diprotes pihak lain. Menurutnya, semua yang dilakukannya tak lain sebatas profesionalisme kerja. “Semua itu profesional. Ini juga bukan

film pertama aku berciuman. Dan itu enggak pernah dipermasalahkan,” ujar Julie saat ditemui di acara peluncuran film Broken Hearts. Adik kandung Cathy Sharon ini justru lebih fokus pada pendalaman karakter. Julie berperan sebagai editor novel bernama Olivia. “Kesulitan pasti ada, setiap film punya tantangan masing-masing. Di sini bedanya ada pada penggarapan. Itu tantangan aku. Memerlukan karakter tanpa menangis tapi terlihat sedih,” paparnya. Dalam film tersebut, Olivia ditinggal kekasihnya Jamie yang diperankan Reza Rahardian, yang rencananya akan menikah. Namun, lantaran menderita penyakit mematikan, Reza pun menghilang tanpa kabar. (nov/int)


KAMIS, 3 Mei 2012

Hai Bunda, sudah semakin dekat dengan hari H kelahiran si buah hati nih. Jangan tegang gitu dong, yuk dibaca dulu 10 hal penting sebelum lahiran berikut ini: 1. Manjakan diri Anda Sebentar lagi Bunda akan dibuat sangat sibuk dengan kehadiran si kecil, jam tidur bisa sangat kurang, penampilan jadi tak begitu diperhatikan, dan rasa lelah di badan tentu tak bisa dihindari. Nah, sebelum hari itu datang, boleh juga kok bunda menyediakan waktu terlebih dahulu untuk memanjakan diri. Misalnya saja haircut di salon agar penampilan lebih segar dan tidak ribet. 2. Banyak membaca Semakin dekat dengan hari H, semakin banyak pula info yang bunda butuhkan, terutama jika ini adalah anak pertama. Beli beberapa buku yang dibutuhkan, dan konsultasikan juga dengan dokter pribadi atau sharing dengan ibu-ibu hamil lain yang lebih berpengalaman, karena tak semua informasi yang ada di buku itu harus selalu diikuti. 3. It’s a babymoon! Apabila setelah menikah Anda menikmati momen manis honeymoon dengan suami, kini saatnya menyusun momen sebelum hari lahiran, it’s a babymoon time! Bermesraan dengan suami sambil membelai si kecil sebelum ia keluar dari rahim adalah quality time yang wajib dimiliki. Anggap saja ini adalah sebuah momen sambutan agar si kecil juga merasa lebih dekat dengan ayah dan bundanya. 4. Mommy time! Dan apabila quality time dengan suami sudah dimiliki, jangan lupakan juga quality time dengan sahabat dan bumil lainnya. Setidaknya di waktu ini Anda bisa mendapatkan dukungan support lebih dari orang terdekat dan yang memiliki pengalaman sama dengan Anda. Intinya adalah rileks ya, Bun... 5. Don’t snooze your alarm Sekalipun ingin bermanja, tetapi jangan di- snooze terus dong alarmnya. Berusahalah untuk selalu bangun lebih pagi dari hari biasanya, dan nikmati olahraga kecil di seputar rumah atau lingkungan tempat tinggal Anda sembari menikmati udara segar. 6. Persiapkan keuangan Anda Nah, ini yang sangat penting dan wajib menjadi prioritas. Sekalipun

sudah ada perkiraan hari lahiran, namun terlebih dahulu Anda harus mempersiapkan budget untuk lahiran. Setidaknya pastikan Anda punya dana cadangan apabila tibatiba Anda harus melakukan operasi caesar. 7. Album Bayi Ingin mengabadikan perkembangan si buah hati, mulai persiapkan sejak sebelum lahiran ya, Bun. Bisa dengan mulai mengabadikan barang-barang yang sudah dibeli, kamar atau keranjang bayi. 8. Baju bayi Tentunya sebelum lahiran, bunda juga harus sudah menyiapkan beberapa baju bayi. Tak harus selalu membeli baju bayi bermerk yang mahal, karena sebenarnya yang terpenting adalah kualitasnya. Beberapa merk baju bayi yang tidak terkenal juga memiliki kualitas yang baik kok. 9. Tetap berolahraga Sekalipun mungkin pinggang rasanya sudah pegal-pegal dan tubuh enggan diajak bergerak, namun Anda tak boleh hanya berdiam di atas ranjang saja. Lakukan gerakangerakan olahraga ringan semisal sekedar berjalan-jalan menghirup udara segar atau berputar-putar di dalam rumah. Setidaknya otot-otot tubuh tidak kaku dan lebih lemas. 10. Rileks saja bun, jangan tegang Dan hal terakhir yang sangat penting sekali untuk selalu diingat adalah rileks dan jangan tegang. Berlatihlah pernafasan seperti yang sudah bunda pelajari pada saat senam, sehingga dengan pernafasan yang teratur proses melahirkan nanti akan lebih lancar dan mudah. Tak perlu menyimpan pikiran buruk dan negatif tentang cerita-cerita miring saat melahirkan, karena proses melahirkan setiap orang selalu berbeda-beda. Miliki tidur cukup sebelum lahiran ya Bun, dan semangat sampai hari H lahiran. (kl/int)

Waffle Original Bahan: 280 gram tepung terigu protein sedang 1/2 sdt baking powder 1/2 sdt garam 2 sdm gula pasir 425 susu cair 50 gram margarin cair 2 butir telur Cara Membuat: 1. Ayak tepung terigu dan baking powder bersamaan 2. Kocok margarin, garam dan gula hingga mengembang. Tambahkan telur kemudian kocok kembali pada kecepatan sedang. 3. Sambil tetap mengocok di kecepatan rendah, tambahkan susu cair sedikit demi sedikit. 4. Tuangkan adonan pada cetakan yang sudah dipanaskan (boleh menggunakan cetakan listrik, atau kompor) 5. Sajikan waffle dengan topping sesuai selera Anda. (kl/int)

Makanan Sehat untuk Pencernaan Sehat Anda tentu sudah akrab dengan istilah “You Are What You Eat”. Ini menunjukkan bahwa apa yang kita makan mencerminkan seperti apa diri kita. Buktinya, banyak yang mengalami gangguan kesehatan akibat buruknya pola diet yang dijalani setiap harinya. Sebaliknya, jika diet sehari-hari kita berisi makanan sehat, tentu kita akan menjalani hidup sehat. Diet dan Kesehatan Pencernaan Saluran pencernaan adalah salah satu organ tubuh yang paling sering mendapat keluhan secara langsung akibat makanan yang kita konsumsi. Kanker usus besar merupakan salah satu jenis kanker yang saat ini sering menjangkiti banyak orang di seluruh belahan dunia. Nah, pada artikel ini kita akan berbicara tentang makanan yang baik untuk pencernaan yang sehat. Serat dan Fungsinya Serat merupakan makanan sehat yang paling utama untuk menunjang kesehatan, tak hanya untuk saluran pencernaan tetapi juga kesehatan kita secara

keseluruhan. Dan berikut ini adalah beberapa manfaat serat bagi tubuh kita: Mencegah dan mengatasi sembelit atau konstipasi Membantu penurunan berat badan dengan menurunkan nafsu makan dan membuat kenyang lebih lama Mencegah kanker kolon Menurunkan kolesterol Membantu dalam terapi diet untuk berbagai penyakit, terutama yang berhubungan dengan saluran cerna Melawan Kanker Kolon Banyak ora n g ,

termasuk di Indonesia, mengklaim bahwa mereka telah menjalani pola diet sehat, namun tetap gagal mencapai tingkat minimum konsumsi serat yang dianjurkan yaitu sebesar 25-35 gram per hari. Inilah sebabnya mengapa orang menjadi rentan terhadap berbagai gangguan pencernaan bahkan kanker usus besar, di mana makanan pokok untuk melawan kanker usus besar adalah serat. Itu adalah salah satu makanan yang terbaik baik untuk pencernaan yang sehat. Serat Larut dan Tak Larut Serat memiliki 2 tipe ditinjau dari segi kelarutannya, yakni serat larut dan serat tak larut. Namun, keduanya memiliki fungsi yang saling berkaitan u n t u k meningkatkan kesehatan s a l u r a n pencernaan. Serat larut akan membantu

memperlambat waktu pengosongan lambung sehingga difermentasi oleh bakteri baik yang terdapat di dalam usus lebih baik. Sedangkan serat tak larut akan membantu menahan air serta menambah berat dan volume feses sehingga lebih mudah dikeluarkan, membuat kenyang lebih lama dan juga memperlambat penyerapan gula. Untuk itu, Anda dapat mengonsumsi makanan seperti sayuran dan buah-buahan segar, karena ini adalah cara yang baik untuk menambahkan serat ke dalam diet Anda. Sayuran dan buahbuahan sangat baik bagi saluran cerna Anda dan dapat diproses atau bahkan dicerna oleh tubuh dengan mudah. Tak hanya kaya serat, sayuran dan buah-buahan juga kaya akan vitamin dan mineral yang akan membantu tubuh Anda berfungsi lebih optimal. Nah, mulai sekarang, pastikan konsumsi serat Anda senantiasa tercukupi setiap harinya. Demi pencernaan yang sehat. Dan demi tubuh yang sehat pula! (kl/int)

Hadapi Pengganggu di Kantor Sering dibuat kesal oleh rekan kerja? Sering diperlakukan tidak adil oleh atasan? Sering mengalami.. rekan kerja mencuri ide proyek? Sering bingung bagaimana menghadapi situasi tersebut? Anda tidak sendirian, ada banyak orang yang juga mengalami kondisi yang sama. Didiamkan saja justru keadaan semakin menjadi-jadi (dan Anda tetap menjadi korbannya), tetapi jika ingin diselesaikan.. takut terjadi konflik yang justru akan menimbulkan hal-hal tak menyenangkan lainnya. Tenang, Ladies! Kami punya tujuh cara menghadapi situasi ini tanpa

membahayakan posisi Anda di kantor. 1. Putuskan apakah Anda ingin menyelesaikan masalah ini atau terus menjadi korban si pengganggu. Dari berbagai pengalaman sahabatsahabat kami, menutup mata dan telinga tidak akan menyelesaikan masalah di kantor. Lebih baik Anda menyampaikan apa yang mengganjal di hati daripada terus menyimpannya. Jika Anda setuju untuk berhadapan dengan si pengganggu, lanjutkan membacapoint selanjutnya! 2. Berbicara dengan orang yang tepat, dengan orang yang memang

bermasalah dengan Anda secara empat mata. Berbicaralah dengan nada suara yang tenang, sopan dan rasional. Fokuskan pembicaraan pada situasi dan fakta yang memang terjadi, hindari gosip atau apapun yang berbentuk serangan pribadi. 3. Hati-hati dengan postur dan bahasa tubuh Anda. Ekspresi wajah dan nada suara bisa menggambarkan apa yang ada di dalam hati Anda. Tetap tenang, berkata-kata tegas tidak sama dengan meninggikan nada suara. Hindari posisi arogan, seperti melipat kedua lengan di depan dada. Ingat, Anda ingin menyelesaikan masalah, bukan ingin menunjukkan bahwa Anda bisa bersikap bossy! 4. Bisa jadi dia membela diri dan mengatakan hal-hal yang bersifat pembelaan diri. Dengarkan semua yang dia katakan tanpa menyela. Coba pahami mengapa si pengganggu itu sampai bersikap demikian menyebalkan pada Anda. Tempatkan diri Anda pada posisinya! 5. Setelah dia selesai memberi pembelaan diri atau mungkin minta maaf, sekarang waktunya bagi Anda

untuk menanggapi kata-katanya. Anda bisa mengatakan, “Saya memahami posisi Anda seperti itu, dan saya merasa.....” ungkapkan semua hal yang mengganjal di hati dan pikiran Anda. Biarkan dia tahu bahwa beberapa perbuatannya berakibat buruk pada Anda dan Anda tak suka diperlakukan seperti itu. 6. Setelah mengungkapkan hal mengganjal padanya, berkomunikasilah dengan jelas dan kemukakan win win solution untuk Anda dan dia. Lakukan hal ini dengan fleksibel tanpa menyudutkan posisi dia ataupun Anda. 7. Jika Anda sudah melakukan usaha di atas tetapi hal yang sama kembali terjadi atau si pengganggu tidak peduli dengan argumen Anda, maka sudah saatnya Anda membicarakan hal ini pada atasan Anda. Jika yang berbuat hal-hal tak menyenangkan adalah atasan Anda sendiri, minta bantuan seseorang yang posisinya lebih tinggi dibanding atasan Anda. Anda juga bisa meminta bantuan pihak HRD. Ingat, kemukakan fakta dengan jelas dan tegas, tanpa rengekan. (kl/int)


RABU

2 Mei 2012

Bulls Terjungkal Chicago Bulls benar-benar kehilangan Derrick Rose. Tanpa Rose, Bulls terjungkal di kandang sendiri dari Philadelphia 76ers 92-109. Skor pun kini imbang 11. Posisi Rose sebagai point guard digantikan oleh C.J. Watson. Penampilan Watson tidak istimewa karena dari 11 tembakan, dia hanya berhasil memasukkan empat di antaranya. Total, Watson mengemas 12 poin. Sebelum laga di United Center pada Selasa (1/5) malam waktu setempat atau Rabu (2/5) pagi WIB ini dimulai, penonton sempat memberikan standing ovation kepada Rose yang datang langsung menyaksikan pertandingan.

Point guard All Star tersebut dipastikan absen hingga akhir musim karena cedera lutut pada game pertama Jumat (28/4) lalu. Bulls sebenarnya selalu unggul di dua kuarter pertama. Tiga poin dari Watson menutup kuarter pertama dengan keunggulan Bulls 28-25. Keunggulan Bulls terus berlanjut di kuarter kedua. Jump shoot dari center Bulls Joakim Noah membuat Bulls memimpin 55-47 saat jeda. Namun, hanya sampai disitulah keunggulan Bulls. Di kuarter ketiga, 76ers tampil menggila. Di kuarter ini saja mereka berhasil mencetak 36 angka untuk berbalik unggul 83-69. Keunggulan 76ers berhasil di-

pertahankan di kuarter keempat. Three point shoot dari Lou Williams berhasil menutup pertandingan dengan keunggulan 109-92. Point guard 76ers, Jrue Holiday menjadi pencetak angka terbanyak dengan 26 angka. Lou Williams mencetak 20 poin, Evan Turner menambah 19 poin, dan Andre Iguodala mengemas 11 poin. Dari kubu Bulls, Joakim Noah menorehkan 21 poin, John Lucas mencatat 15 poin, dan Richard Hamilton membuat 10 poin. Game ketiga akan digelar di kandang 76ers di Well Fargo Center pada Jumat (4/5) malam waktu setempat atau Sabtu (5/5) pagi WIB. (oz/int)

PT Liga Indonesia Bermasalah PSSI akan Lakukan Audit

„ Chicago Bulls tak berkutik di kandang sendiri

ROY HODGSON LATIH INGGRIS Pelatih West Bromwich Albion Roy Hodgson akhirnya ditetapkan sebagai pelatih Tim Nasional (Timnas) Inggris oleh Football Association (FA) pada Selasa (2/5) waktu setempat untuk masa kontrak selama empat tahun.

H

odgson mengganti posisi pelatih asal Italia, Fabio Capello yang mengundurkan diri tiga bulan silam karena tidak menerima keputusan FA yang secara sepihak memecat John Terry dari jabatan kapten Timnas Inggris. Hodgson adalah salah satu pelatih terbaik Inggris yang malang melintang melatih di luar negeri, terutama di Eropa dan Timur Tengah selama 36 tahun dan memiliki keahlian teknis. Hodgson pernah melatih Timnas Swiss, Finlandia, dan Uni Emirat Arab. Hodgson juga pernah melatih klub di Inggris, Swedia, Denmark, Norwegia, Swiss, dan Italia. Di Italia, dua kali melatih Inter Milan. Di tangannya, Timnas Swiss yang tidak pernah masuk pada turnamen-turnamen besar sejak 1966, akhirnya bisa tembus ke Piala Dunia 1994 dan Piala Eropa 1996. Pada Piala Eropa 1996, Swiss tersingkir pada putaran pertama tetapi sempat menahan imbang Inggris 1-1. Di tingkat klub, Hodgson memenangi delapan gelar juara liga di dua negara berbeda bersama tiga klub. Hodgson diharapkan bisa membawa Inggris menjuarai Piala Eropa

„ Roy Hodgson setelah pelatih-pelatih sebelumnya baik dari Inggris maupun pelatih asing termasuk Sven-Goran Eriksson dari Swedia dan Fabio Capello dari Italia gagal mempersembahkan gelar. Sejak ditunjuk sebagai pelatih Timnas Inggris, pria bersuai 64 tahun ini tidak punya waktu untuk bersantai mengingat Piala Eropa tinggal hitungan hari. Dia harus segera berkantor di Wembley, memilih skuad untuk Piala Eropa, mempersiapkan tim pada dua pertandingan persahabatan, sebelum melakoni pertandingan pertama Piala Eropa melawan Prancis pada 11 Juni 2012. Sejak menerima tugas tersebut, Hodgson meninggalkan klubnya,

West Bromwinch Alibon akhir bulan ini. Hodgson mengaku, ada begitu banyak kritik atas keterpilihannya menjadi pelatih Timnas Inggris. Tetapi dia sudah siap dengan kritikkritik tersebut. “Ada begitu banyak kritik dan saya harus siap menghadapi itu. Sebab selalu menjadi pekerjaan besar untuk memenangkan banyak orang. Saya siap menerima semua kritik. Saya minta publik sedikit memahami situasi kami karena pascapengunduran diri Fabio Capello, situasinya berbeda. Saya tidak punya waktu banyak,” kata Hodgson. Sementara itu, Ketua FA David Bernstein mengungkapkan, bahwa sebenarnya

mereka sudah merekrut Hodgson bulan lalu dengan mempertimbangkan pengalaman, rekam jejak, dan kemampuannya membangun sebuah tim juara. Sedangkan Direktur Pengembangan Sepakbola FA Trevor Brooking yang membantu perekrutan Roy Hodgson menegaskan bahwa ekspektasi Timnas Inggris adalah menjadi seperti Jerman, Belanda, dan Spanyol. Hodgson juga diyakini bisa membawa perubahan yang tidak pernah dilakukan oleh pelatih-pelatih sebelumnya. Menyusul terpilihnya Roy Hodgson, Kapten Liverpool Steven Gerrard adalah pemain nasional Inggris pertama yang menyampaikan ucapan selamat kepada Hodgson. “Saya sudah bekerja sama dengan Roy. Dia orang yang baik dan pelatih yang baik. Penting sekali dia diberi kesempatan dan saya tunggu bekerja sama dengan dia lagi,” kata Gerrard. Sedangkan pemain-pemain bintang Inggris seperti bek Manchester United (MU) Rio Ferdinand, Wayne Rooney, Michael Owen, dan pemain Tottenham Hotspur Jermain Defoe lebih menjagokan Harry Redknap. “Sejauh ini Harry Redknapp menjadi pelatih pilihan saya,” kata Rio Ferdinand melalui akun twitternya. “Capello sudah pergi dan Inggris harus menggantinya. Harry Redknapp untuk saya,” tulis Rooney. “Apakah pernah ada pendapat publik begitu kencang terkait pelatih Inggris mendatang? Saya tidak tahu kalau ada orang yang tidak menginginkan Redknapp,” tulis Michael Owen. (int)

Stoner Optimis Sambung Kemenangan

„ Casey Stoner

Setelah beberapa seri pembuka gagal mendapuk puncak podium, Casey Stoner akhirnya membuka kemenangan pertamanya di GP Spanyol,pekanlalu.Kini,jelangGP Portugal di Estoril, sang juara bertahan berniat kembali meraih hasil serupa. Persaingan di klasemen MotoGP kini kian ketat. Stoner semakin merapatkan posisi dengan rider Yamaha – Jorge Lorenzo yang masih bercokol di puncak. Saat ini, bentangan poin Stoner hanya berjarak empat poin berkat tambahan 25 angka di Jerez lalu. “Kembali melalui perjalanan udara ke base camp (Repsol Honda), kami akan mempersiapkan

diri jelang GP Portugal, akhir pekan ini. Setelah menang di Jerez, saya sudah tak sabar menuju Estoril dan berharap bisa mempertahankan performa di duaseriterakhir,terutamadiJerez,” tutur Stoner. Meski di kelas MotoGP Stoner belum pernah sekalipun menjadi yang tercepat di sesi lomba, tapi kenangan di kelas 250cc bisa menjadi suntikan motivasi tersendiri bagi pembalap berjuluk The Kurri Kurri Boy itu. “Saya punya beberapa catatan yang lumayan di Estoril. Saya memenangkan podium pertama saya di kelas 250cc di Estoril. Jadi, saya akan menargetkan hasil

serupa, tapi saya juga mengharapkan cuaca yang baik, akhir pekan ini,” lanjutnya, seperti disadur Stay on the Black, Rabu (2/ 5). Dengan jangka waktu yang cukup singkat menyongsong GP Portugal,Stonerakanbekerjakeras dengan timnya, untuk memperbaiki problem di area armpump, yang sempat menjadi masalah di Jerez. “Akan tetapi, kami harus segera memperbaikimasalaharm-pump di motor saya. Memang saat di Jerez,kamibisasedikitmengurangi efek masalahnya, tapi kami belum sempat memperbaikinya secara keseluruhan,” tuntasnya. (oz/int)

Persatuan Sepak Bola Seluruh Indonesia (PSSI) kembali berniat melakukan audit investigasi terhadap stuktur keuangan PSSI era Nurdin Halid dan PT Liga Indonesia (PT LI) periode 20092011. Audit direncanakan setelah PSSI mensinyalir adanya dugaan pencucian uang hingga Rp 20 miliar dalam neraca keuangan PSSI periode tersebut. Saat melakukan jumpa pers di Kantor PSSI, Rabu (2/5), Ketua Komite Audit Internal PSSI, Asril Umri mengungkapkan PSSI akan dibantu lima auditor dari Badan Pengawasan Keuangan dan Pembangunan (BPKP). Audit investigasi itu, lanjutnya, akan mulai berjalan pada hari Senin (7/5). “Ini hanya salah satu faktor. Kita membaca laporan ada transfer uang dari seseorang masuk ke PSSI dan uang ini dibukukan di PSSI tapi uangnya tidak ada.

Uang itu kurang lebih jumlahnya Rp 20 miliar. Kemudian beberapa bulan kemudian uang ini dikembalikan dan totalnya sama. Ini uang dari mana,” ujarnya. Asril menuturkan, audit itu dilaksanakan berdasarkan laporan audit yang dilakukan oleh kantor auditor independen Deloitte yang sebelumnya sudah melakukan review audit. Laporan tersebut menunjukkan sejumlah penyelewengan terhadap keuangan PSSI saat masih diketuai Nurdin Halid. “Oleh karena itu, kami mencoba membuktikan dugaan-dugaan itu benar atau tidak. Jadi, kami dalam waktu dekat ini akan mencoba masuk ke dalam PSSI. Mudah-mudahan waktunya tidak terlalu lama,” ujarnya. Sebelumnya, pada tahun lalu, PT LI dan Badan Liga Indonesia (BLI) pernah menolak untuk diaudit oleh Deloitt yang ditunjuk

PSSI. Pasalnya, ketika itu, Ketua BLI, Andi Darussalam Tabussala mengatakan bahwa BLI sudah sedang berada dalam proses akhir audit, dan akan menyerahkan hasil audit itu kepada pengurus lama. Ketika ditanya apakah, PSSI tidak takut rencana tersebut akan kembali menemui kegagalan, Asril dengan tegas akan berusaha semaksimal mungkin. Apalagi, kata dia, PSSI saat ini adalah pemilik 99 persen saham PT LI. “Sampai dengan hari ini, masih tercatat bahwa PT LI, 90 persen sahamnya adalah milik PSSI, dan itu belum pernah diubah, sesuai dengan keputusan pemerintah. Jadi, kita akan berusaha untuk mengungkap kejanggalan-kejanggalan ini. Jika ditemukan bukti, baru kita akan proses ke ranah hukum,” tegasnya. (kps/int)

„ Alexander Dale Oen

Juara Dunia Renang Tewas Mendadak Alexander Dale Oen, juara dunia renang gaya dada 100 m di Shanghai, 2011 meninggal dunia setelah terkena serangan jantung. Perenang yang bakal mewakili Norwegia di Olimpiade London 2012, meninggal saat menjalani pemusatan latihan di Flagstaff, Arizona, AS. Dale Oen meninggal akibat mengalami gagal jantung. Dalam pernyataan yang dikeluarkan Federasi Renang Norwegia, juara dunia itu ditemukan kolaps di lantai kamar tidur, Senin (30/4). Ia sempat dibawa ke rumah sakit, sayangnya dalam

perjalanan pria berumur 26 itu menghembuskan nafas terakhirnya. “Kami semua merasa terkejut. Ini adalah pengalaman mengejutkan bagi semua anggota tim disini. Rasa duka kami ditujukan kepada keluarganya yang sudah kehilangan Alexander di usianya yang masih amat muda,” papar pelatih Norwegia, Petter Loevberg. Juru bicara RS Flagstaff Medical Centre Starla Collins mengkonfirmasikan kematian Dale Oen, kendati begitu ia tak memberikan detil lanjutan.

Dale Oen memenangkan gaya dada 100 m di Shanghai, Juli lalu. Sebelumnya Dale Oen memenangkan medali perak di Olimpiade Beijing 2008. Keberhasilan Dale memenangkanmedaliemasdiShanghai,terjadi tiga hari setelah pembantaian di Norwegia oleh ekstrimis sayap kananAndresBreivikyangmemakan 77 korban jiwa. Dale Oen mendedikasikan kemenangan itu kepada parakorbandaripembantaianitu.Ia langsung menunjuk bendera Norwegia di penutup kepala usai memenangkan medali emasnya. (int)

Alonso akan Kunjungi Indonesia

„ Xabi Alonso

Pemain Real Madrid, Xabi Alonso, dijadwalkan akan mengunjungi Indonesia pada tanggal 8 Juli 2012 mendatang untuk mengikuti acara “Indonesia Mengoper Bola 2012” di Jakarta. Selain Xabi Alonso, beberapa pemain nasional juga akan dilibatkan dalam acara tersebut. Hal itu diungkapkan oleh Deputi Direktur PT Dua Kelinci, Edwin Sutiono. Ia mengatakan pemain nasional tersebut telah dihubungi dan menyatakan kesiapannya. “Ada Hamka Hamzah, Firman Utina, Ponaryo Astaman dan Kim Jeffery Kurniawan,” katanya. Menurutnya, sebelum kegiatan puncak yang akan dihadiri

oleh pemain timnas Spanyol tersebut, pihaknya selaku sponsor juga akan melakukan kegiatan yang sama di tiga kota lainnya yaitu Surabaya (3 Juni), Semarang (10 Juni) dan Bandung (24 Juni). Namun, Edwin masih belum dapat memastikan kapan Xabi Alonso akan tiba di Tanah Air. Xabi direncanakan akan tiba pada tanggal 8 Juli, namun kedatangannya bisa saja lebih cepat. “Dia (Xabi Alonso) masih menunggu hasil pertandingan Euro. Yang jelas untuk menentukan siapa pemain yang datang ke Indonesis harus melalui persetujuan Jose Mourinho (pelatih Real Madrid),” katanya. (int)


15

KAMIS

3 Mei 2012

PREMIERE LEAGUE KLASEMEN SEMENTARA 1 Man City

36 26

5

5

88-27

83

2 Man United

36 26

5

5

86-33

83

3 Arsenal

36 20

6

10

68-44

66

4 Tottenham H

35 18

8

9

59-39

62

5 Newcastle U

35 18

8

9

53-46

62

6 Chelsea

35 17

10

8

62-39

61

7 Everton

36 14

10

12

47-39

52

8 Liverpool

36 13

10

13

43-38

49

9 Fulham

36 13

10

13

46-48

49

10 WBA

36 13

7

16

41-47

46

11 Sunderland

36

11

12

13

44-43

45

12 Swansea City

36

11

11

14

43-49

44

13 Stoke City

36

11

11

14

34-50

44

14 Norwich City

36

11

10

15

47-63

43

15 Aston Villa

36

7

16

13

36-50

37

16 Wigan Ath

36

9

10

17

38-60

37

17 QPR

36

9

7

20

40-63

34 34

18 Bolton W

35 10

4

21

41-69

19 Blackburn R

36

8

7

21

47-75

31

20 Wolves

36

5

9

22

38-79

24

PENCETAK GOL

Piala Eropa 2000

Berjaya di Dua Negara

EURO- Timnas Perancis saat memenangkan Piala Eropa

Untuk pertama kalinya Piala Eropa digelar di dua negara, Belgia dan Belanda. Piala Eropa 2000 diikuti oleh 16 negara, termasuk dua negara penyelenggara turnamen pada 10 Juni-2 Juli 2000. Belanda yang diunggulkan karena bertindak sebagai tuan rumah tampil sempurna di babak penyisihan grup. Tim Oranje berhasil mengalahkan Perancis 3-2. Di babak perempat final, Belanda yang dimotori Patrick Kluivert sukses menggulung Yugoslavia 6-1. Sayangnya, di semifinal Belanda

2

28 26 22

Van Persie Wayne Rooney Sergio Aguero

dikalahkan Italia lewat adu penalti. Babak final mempertemukan dua kekuatan lama Eropa., Italia dan Perancis. Unggul di babak pertama membuat Italia berada di atas angin. Sampai akhirnya Sylvain Wiltord menyamakan kedudukan sesaat sebelum peluit akhir babak kedua dibunyikan. Kesialan Italia tidak hanya sampai di situ. Di babak tambahan, tepatnya menit 103, David Trezeguet mencetak Golden Goal untuk Perancis.

Sukses Perancis membuat mereka menjadi negara pertama yang menggabungkan trofi Piala Dunia dengan trofi Piala Eropa. Sebelumnya Perancis menjuarai Piala Dunia 1998 yang diselenggarakan di Perancis. Pertandingan ini juga menuai kontroversi. Marcell Desailly dan Patrick Vieira seharusnya tidak bisa tampil di babak final untuk melawan Italia. Tapi, karena sistem peraturan baru yang dibuat oleh UEFA, hukuman keduanya pun dibatalkan. (int)

PALERMO

NAPOLI

0

Arsenal Man United Man City

LIGA SPANYOL KLASEMEN SEMENTARA 1 Real Madrid

35 29

4

2

112-30

91

2 Barcelona

35 26

6

3

104-26

84

3 Valencia

35 15

10

10

54-43

55

4 Malaga

35 16

7

12

51-47

55

5 Levante

35 15

7

13

51-48

52

6 Atl Madrid

35 13

10

12

49-44

49

7 Ath Bilbao

35 12

12

11

49-46

48

8 Atl Osasuna

35

15

9

39-55

48

11

9 Sevilla

35 12

10

13

41-42

46

10 Mallorca

35 12

10

13

39-42

46

11 Getafe

36 12

10

14

40-49

46

12 Espanyol

36 12

9

15

45-51

45

13 Real Sociedad

35

11

10

14

44-50

43

14 Real Betis

35 12

7

16

42-51

43

15 Granada

36 12

6

18

34-53

42

16 Villarreal

36

9

14

13

39-51

41

17 R Vallecano

35 12

4

19

50-67

40

18 Sporting Gijon

36

9

7

20

40-67

34

19 Real Zaragoza

35

9

7

19

31-60

34

20 R Santander

36

4

15

17

25-57

27

Napoli makin nyaman di tangga ketiga Liga Italia usai menggebuk tamunya, Palermo 2-0 di San Paoli, Selasa Malam.

S

etelah sempat terseok-seok selama beberapa pekan, Partenopei meraih tiga kemenangan beruntun di Serie A dan kini makin berpeluang mengenggang tiket kualifikasi Liga Champions, dengan mengoleksi 58 poin atau unggul tiga angka dari para pesaingnya, Udinese, Inter Milan dan Lazio yang baru akan memainkan laga Rabu ini. Skuad besutan Walter Mazzarri mendominasi laga sejak awal dan Edinson Cavani mencetak gol pembuka melalui titik putih di menit ke16, sementara Marek Hamsik menggandakan keunggulan sembilan menit kemudian. Napoli sudah memperoleh kans mencetak gol saat laga baru berjalan lima menit, di mana Goran Pandev mengirim umpan kepada Gokhan Inler, tapi sepakannya masih terhalang mistar gawang. Tidak lama berserang, Palermo mendapat dua peluang emas di depan gawang. Morgan De Sanctis melakukan penyelamatan gemilang saat menepis usaha Josip Ilicic dengan kakinya dari jarak sembilan yard, kemudian jatuh bangun menggagalkan tandukan Abel Hernandez.

PENCETAK GOL

„ Cavani 43 43 21

Lionel Messi Ronaldo Higuaín

Barcelona Real Madrid Real Madrid

SERIA A ITALIA KLASEMEN SEMENTARA 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Juventus Milan Napoli Udinese Lazio Inter Roma Catania Parma Atalanta Bologna Chievo Siena Cagliari Palermo Fiorentina Genoa Lecce Novara Cesena

35 35 36 35 35 35 36 35 35 35 35 36 35 35 36 35 35 35 35 35

21 22 15 15 16 16 15 11 12 13 11 11 11 10 11 10 9 8 6 4

14 8 13 10 7 7 7 14 11 13 12 12 10 12 9 11 9 11 10 10

0 5 8 10 12 12 14 10 12 9 12 13 14 13 16 14 17 16 19 21

62-18 68-28 64-43 47-35 50-45 52-47 55-50 45-47 48-52 40-36 38-42 30-41 43-40 36-42 48-56 34-41 46-66 39-53 29-61 22-53

PENCETAK GOL

26 23 21

Ibrahimovic Cavani Di Natale

Milan Napoli Udinese

77 74 58 55 55 55 52 47 47 46 45 45 43 42 42 41 36 35 28 22

KARATEKA SIANTAR BERLAGA

DI

„ Duel Napoli vs Palermo yang dimenangkan Napoli dengan skor 2-0 Wasit memberikan hadiah penalti saat Milanovic melakukan sliding untuk menghalau crossing Pandev dan bola mengenai tangannya. Pemain Palermo sempat melakukan protes, tapi tendangan keras Cavani dari titik 12 pas mengoyak jala Emiliano Viviano. Cavani mencoba memberikan assist kepada Pandev dengan melakukan chip dari luar kotak penalti, tapi Eros Pisano dengan cepat menyapu di kulit bundar. Partenopei akhirnya menggandakan keunggulan tuan rumah melalui Hamsik berkat kerja sama apik dengan Pandev di area penalti. Pemain asal Slovakia itu melepaskan tendangan mendatar yang gagal dihalau Viviano. Napoli nyaris memperbesar keunggulan sepuluh menit pasca jeda, namun sepakan Cavani yang menerima umpan Walter Gargano

dari sisi kanan masih melebar. Palermo mencoba melakukan tekanan di menit 64 dimana tendangan Massimo Donati dari luar kotak penalti hampir menjebol gawang De Sanctis. Namun, tendangannya setelah menerima umpan Edgar Barreto masih melebar. Permainan mulai mengendur memasuki sepuluh menit akhir. Juan Zuniga mendapatkan umpan Marek Hamsik, tapi tendangannya belum menemui sasaran. Menjelang peluit akhir, Palermo kembali memperoleh peluang menjebol gawang De Sanctis. Tendangan kaki kiri Abel Hernandez dari area penalti dengan mudah dihalau De Sanctis. Dengan kekalahan ini Rosanero turun ke posisi 15, mengoleksi 42 poin atau unggul enam poin dari Genoa yang menduduki zona degradasi. (int)

KEJURDA JUNIOR FORKI SUMUT

Target Medali Emas Tiket ke Kejurnas SIANTAR- Tim Karate Junior Kota Pematangsiantar diberangkatkan DR Drs Hendrik Sihombing MSi selaku Ketua Bidang Organisasi Forki Pematangsiantar, Rabu (2/5), untuk mengikutiKejuaraanDaerahFederasi Olahraga Karetedo Indonesia (Forki) Sumatera Utara Tingkat Kadet dan Junior, yang akan dilaksanakan di Universitas Medan (Unimed) Jalan Wiliam Iskandar pada tangal 5-6 Mei 2012. Mereka antara lain, Choirul Efendi Lubis, Roland Lubis, Nazaret Nababan, Fahmi Pohan dan Gilang Ramadan di bagian putra serta Mutita, Faradiba dan Kartika Putri Ayu di bagian putrid. Hendrik Sihombing (Dan V Karatedo)mewakiliForkiPematangsiantar didampingi pelatih kepala Mangaraja Nababan SPd (Dan II Karetedo), usai memberangkatkan tim yang berjumlah 8 orang termasuk pelatih di halaman kantor Lurah Proklamasi, Kecamatan Siantar Barat mengatakan, pihaknya berharap doa dan dukungan masyarakat Kota Siantar untuk

BERANGKAT KEJURDA-Tim Kareta Siantar berangkat mengikuti Kejurda Forki Sumut Tingkat Kadet dan Junior berfoto bersama Drs Hendrik Sihombing (Dan V) dan pelatih Mangaraja Nababan (Dan II), Rabu (2/5). keberhasilan para atlet. Kejurda yang digelar di Medan merupakan bagian dari seleksi untuk mendapatkan atlet terbaik, untuk mewakili SumateraUtarapadaKejurnasForki Tingkat Kadet dan Junior di Manado, Sulawesi Utara, untuk memperebutkan Piala Mendagri XVI. “Kami berpesan kepada atlet untukberjuanghabis-habisan,tetap

bersemangat walau pun harus menggunakan dana swadaya dari orangtua serta pengurus Forki. Jika disiplin serta berkerjakeras,makakamiyakinmedali emas akan diperoleh,” kata Hendrik Sihombing. Diamenjelaskan,motivasiyangada dalam diri atlet sangat penting untuk mewujudkanraihanterbaikdanmenjadi juara. Sifat sportifitas harus tetap

dijunjung tinggi. “Setahun terakhir, sudah tiga kali atlet Forki Siantar mengikuti kejuaraan serta berhasil memeroleh medali emas. Walau belum pernah menerima bantuan dana dari Pemko Siantar melalui Dispora, termasuk dari KONI Siantar sebagai induk cabang olahraga. Gantinya, orangtua yang berkorban bersama pengurus,” jelas mantan atlet karate tahun 1980-an ini. Sementara pelatih kepala Kushin Ryu M Karate Do Indonesia (KKI) Mangaraja Nababan, menambahkan, dibutuhkan kepedulian semua pihak untuk mengembangkan olahraga terutama dalam hal pembinaan sejak dini. “Dibutuhkan fasilitas yang memadai berupa tempat serta peralatan. Untuk mengasah kemampuan, dibutuhkan kejuaraan-kejuaraan yang tentunya membutuhkan dana untuk pemberangkatan serta bekal selama pertandingan. Kendalanya kadang soal dana, kadang kita sampai hati memberatkan orangtua, sementara

atlet berlaga atas nama Kota Siantar,” kata Mangaraja. Ditambahkannya, jika memang pemangku kepentingan olahraga tidak dapat membantu, minimal tidak mempersulit terutama terkait soal urusan administrasi terkait pemberangkatan atlet karate. “Soal prestasi sudah cukup banyak, terutama Choirul Efendi Lubis peraih medali emas pada Tournament Karateka Tingkat Asia tahun 2012 di Kuala Lumpur, Malaysia. Dan Kartika Putri Ayu yang meraih medali perunggu pada tunamen yang sama serta meraih medali emas pada Kejurda Forki tahun 2011, serta beberapa atlet yang sering mengikuti Piala Walikota Medan” katanya. Sementara Choirul Efendi Lubis, mewakili atlet berjanji akan bekerja keras untuk mendapatkan hasil terbaik yakni medali emas. “KamiinginterpilihmewakiliSumut ke Piala Mendagri di Manado. Maka medaliemasmenjadikeharusan,kami mohon dukungan,” katanya. (esa/ ara)


METRO SIANTAR