Page 1




Jumat, 28 September 2012


Dipukul, Diseret & Didorong

PENTOLAN KOREKER DITANGKAP SIMALUNGUN- Pimpinan kuasa pendamping masyarakat Bandar Betsy yang tergabung dalam Kesatuan Organisasi Reformasi Keadilan Rakyat (Koreker), Larham Simaremare, ditangkap polisi karena membawa sajam. Larham ditangkap bersama tiga orang buruh pendamping, Henry Marbun (30), Arman Wuruwu, dan Mahadi Saragih (17) saat hendak bercocok tanam di lahan eks HGU PTPN III Bandar Betsy, Kecamatan

SIMALUNGUN- Dipukuli, diseret, dan didorong ke sungai aparat polisi. Inilah yang dialami Jamenson Silalahi (43) warga Jalan Tusam Bawah, Kelurahan Kahean, Kecamatan Siantar Utara, Kota Siantar, selaku kuasa pendamping masyarakat Bandar Betsy yang tergabung dalam Kesatuan organisasi reformasi keadilan rakyat (Koreker).


„ Anggota KOREKER bersama senjata tajam yang mereka gunakan dibawa ke Polres Simalungun, Kamis (27/9).


„) Baca Dipukul, Diseret .....Hal 6

Suami Setubuhi ABG 16 Tahun SIMALUNGUN- Edan memang kelakukan Supriadi (22) warga Huta V Pulo Lawan, Nagori Bah Gunung, Kecamatan Bandar Huluan, Simalungun ini. Saat istri sedang hamil 7 bulan, dia malah menyetubuhi ABG yang masih berusia 16 tahun. Atas perbuatannya itu, dia telah diamankan petugas Polsek Bangun, Kamis (27/9) sekira pukul 10.00 WIB dari rumahnya. Ditemui di Mapolsek Bangun, suami Aulia Saputri (19) ini menceritakan, Sabtu (22/9) lalu, dia berjanji bertemu dengan Mawar (nama samaran), yang merupakan kekasihnya, di Ramayana Kota Pematangsiantar, sekira pukul 15.00 WIB. Kemudian mereka menuju Taman Bunga dan menghabiskan sore di sana.


DEMO POLRES: Ratusan warga dari Desa Pandumaan dan Sipitu Huta, demo ke Mapolres Humbahas, Kamis (27/9).


„ Pelaku cabul saat diperiksa petugas Polsek Bangun, Kamis (27/9) siang.

„) Baca Suami Setubuhi .....Hal 6


Edisi 159 „ Tahun X


„) Baca Pentolan .....Hal 6




MENANGIS MINTA KEPALA KEMBALI SIDAMANIK– Arwah wanita yang ditemukan tewas mengenaskan di areal perkebunan teh PTPN IV Sidamanik, Nagori Mekar Sidamanik, Kecamatan Sidamanik, Simalungun, meminta agar potongan

kepalanya dikembalikan, kemudian disatukan ke potongan tubuhnya yang lain. Demikian dikemukakan, paranormal asal Sidamanik, O Sijabat (60) kepada METRO, Kamis (27/9). Dia juga

Warga Pandumaan-Sipitu Huta Demo Polres Humbahas

TolakPemanggilan 8 Warga DOLOK SANGGUL- Lima ratusan warga Desa Pandumaan dan Sipitu Huta, Kecamatan Pollung, Kabupaten Humbang Hasundutan, melakukan aksi demo ke Mapolres Humbang Hasundutan, Kamis (27/9). Mereka menolak pemanggilan 8 warga dari Desa Pandumaan sebagai saksi bentrok fisik di




„ Mantan Bupati Simalungun Zulkarnain Damanik saat duduk di persidangan PN Medan.


Ahli BPKP Cabut Keterangan MEDAN- Sidang lanjutan kasus dugaan korupsi dana APBD Kabupaten Simalungun tahun 2005-2006 senilai Rp529.654.638 dengan terdakwa mantan Bupati Simalungun Zulkarnain Damanik, kembali digelar diruang Kartika Pengadilan Tipikor pada

Pengadilan Negeri Medan, Kamis (27/9). Agenda sidang dengan Majelis Hakim yang diketuai Jonner Manik, kali ini untuk mendengarkan keterangan saksi sebagai „) Baca Ahli BPKP .....Hal 6

JAKARTA- Perjuangan Forum Guru Siantar (FGS) menyambangi sejumlah instansi di Jakarta, tidak sia-sia. Inspektorat Jenderal Kementerian Pendidikan dan Kebudayaan (Itjen Kemendikbud) akan segera membentuk tim investigasi dugaan penilepan dana insentif guru se-Sumut sebesar Rp66 miliar. Tidak main-main. Para oknum pejabat yang memainkan dana insentif guru ini terancam bakal berurusan dengan Komisi Pemberantasan Korupsi (KPK). Inspektur Jenderal (Irjen) Kemendikbud, Haryono Umar, menyatakan, jika dari hasil kerja tim investigasi ditemukan adanya penilepan dana yang merupakan haknya guru itu, maka pihaknya langsung merekomendasikan ke KPK untuk dilakukan langkah hukum. „) Baca Irjen Kemendikbud ..Hal 6

Anak Sakit Minta Jumpa Ayah

Dijumpai Istri, Rupanya Suami Sama Wanita Lain SIMALUNGUN– Niat Suci Nurleli (25) mempertemukan anak mereka dengan suaminya Ramadona Sinaga alias Dona (24) berujung kepedihan. Penyebabnya karena suaminya yang saat ini menjalani kursi pesakitan sedang menyimpan wanita idaman lain (WIL) dalam kamar tidurnya di Perumahan PT Torganda.

Hal itu terungkap pada persidangan yang digelar di Pengadilan Negeri Simalungun, Kamis (27/9) yang dipimpin Hakim Samuel Ginting dan Heriyanti. Usai membacakan dakwaannya, Jaksa Viktor Situmorang menghadirkan saksi korban yakni istri terdakwa Suci „) Baca Dijumpai .....Hal 7 FOTO:IMELDA PURBA

„ Terdakwa Ramadona Sinaga saat menjalani persidangan di PN Simalungun, Kamis (27/9).

Tombak Sitangi, Desa Sipitu Huta. Di mana dalam bentrok itu, warga berhadapan dengan salah seorang anggota Brimob Briptu Hotbastian Simamora dan seorang security perusahaan bubur kertas PT Toba Pulp Lestari Tbk Frengky „) Baca Tolak Pemanggilan .....Hal 6



SIANTAR- Kanit PPA Polres Siantar Aiptu Malon Siagian mengancam wartawan METRO SIANTAR saat berada di ruangan Ka BO Reskrim Iptu Asmon Bufitra, Kamis (27/9) pukul 15.00 WIB. Aiptu Malon mengancam akan menjadikan wartawan METRO seperti reporter Trans TV Andi Siahaan. „) Baca Kanit PPA .....Hal 7

IptuABTakPernah keLokasi Penggerebekan KA BO Reskrim Iptu AB menyebutkan berita yang sebelumnya tidak benar. Informasi dari masyarakat itu tidak benar. Selama ini Asmon tidak pernah ke lokasi untuk meminta „) Baca Iptu AB .....Hal 7

KUALITAS sebagai presenter sudah tak diragukan lagi. Namun Fenita Arie enggan menjajal ke bidang akting. Apalagi sampai kejar tayang, seperti kebanyakan sinetron saat ini. Dia lebih memilih berkumpul ber„) Baca Tolak Job .....Hal 6



28 September 2012

Pencurian dan Jambret Marak di Siantar SIANTAR-Aksi pencurian dan jambret kembali marak di Kota Siantar dalam sebulan belakangan ini. Tidak saja mencuri di rumah-rumah penduduk, para pencuri ini semakin nekat saja dengan melakukan pencurian di salah satu warung di Jalan Wandelfat yang bersebelahan dengan Mapolres Siantar, Selasa (25/9) pukul 15.30 WIB. Ketiga pencuri ini masih berusia muda. D Pardede (19) dan HP Nasution (23), dua diantara tiga pelaku sudah

diringkus polisi. Tentu saja maraknya aksi pencurian dan jambret ini membuat resah warga Kota Siantar.(ral/osi)


njukkan letak kreta „ Dedi Ginting menu ya yang diembat likn Honda Astrea 1997 mi maling.

Data Dua Minggu terakhir 1. Diana Juliana br Napitupulu (33) Jalan Melanthon Siregar, Kelurahan Pamatang Marihat, Siantar Marihat, Selasa (25/9). 2. A br Simatupang (24), perawat di RS Vita Insani Kota Siantar dijambret di Jalan Pantoan dekat Ramayana, Minggu (23/9). 3. Parhanger (guru huria) HKBP Siantar Simarimbun, R br Hutajulu (37) di Simarimbun Tangki, Siantar Simarimbun, Rabu (19/9).


„ Rumah Juliana br Napitupulu di Jalan Melanthon Siregar yang dibobol maling.

Sumber: Bank Data Metro Siantar

Minim Lapangan Pekerjaan


„ Seorang anak perempuan W br Purba menunjukkan pintu belakang rumahnya yang dijebol pelaku pencurian.

MINIMNYA lapangan pekerjaan di Kota Pematangsiantar membuat sebagian besar orang terpaksa melakukan tindakan kejahatan seperti mencuri, menjambret, dan merampok. Hal itu dilakukan demi memenuhi kebutuhan sehari-hari keluarganya. (osi) Arafta Nahampun, Mahasiswi, Warga Jalan Sangnaualuh

Telepon Penting PMI (Palang Merah Indonesia) 118, 0622-433911 Alamat Jl Sutomo No. 248, Pematangsiantar Kantor Imigrasi Alamat: Jl. Raya Medan Km. 11,5 Pematang Siantar Telepon : (0622)465018, 465014 Samsat Dipendasu Jln Sangnawaluh No 37A 0622 7552345.

RS dr Djasamen Saragih Jln Sutomo No 230. 0622 (23824) Hotel Sapadia Jl.Diponegoro No.21 A P.Siantar Telp:0622-435922 Nice Trans Siantar-Medan Medan. (061) 4558844 Siantar (0622)7000200 085275144777

Aksi Copet Juga Banyak KALAU jambret sama pencurian, sering memang kita dengar dan kita baca di berita. Selain jambret sama pencurian, aksi copet juga sering saya lihat di Pasar Horas. Pedagang disana sering memberitahu kita kalau yang ini dan itu copet, kita juga pernah lihat mereka mencopet. (ral) Arista Saragih dan Nurbaiti Warga Jalan Adam Malik, Siantar Barat

Aktifkan Kembali Pos Kamling

Pemerintah di tingkat kelurahan hingga lingkungan diharapkan agar mendirikan Pos Keamanan Lingkungan (Pos Kamling) guna meminimalisir terjadinya tindak kejahatan di tengahtengah masyarakat. Dan bila perlu menyatukan Pos Kamling dengan Forum Kemitraan Polisi dan Masyarakat (FKPM) yang sudah dibentuk di setiap kelurahan. (osi) Sawal, Pedagang Warga Jalan Vihara


Sophi martin

Aparat Bekingi Judi di Panei Tongah KAPOLRES Simalungun terhormat, tolong diberantas judi di Panei Tongah. Di sana judi terkesan bebas beroperasi karena dibekingi aparat kepolisian. 085262570xxx

Tutup Galian C Jembatan Bah Bolon

BUPATI Simalungun terhormat, sejak adanya galian C (pengerukan pasir) di bawah Jembatan Bah Bolon, sepanjang jalan jadi berdebu karena pasirnya berjatuhan ke badan jalan. Masyarakat berharap agar Bupati Simalungun mengintruksikan agar galian C tersebut ditutup. 082365955xxx

Jalan Menuju Wisata Karang Anyer Rusak KADIS PU Simalungun terhormat, tolong diperhatikan jalan menuju tempat wisata Karang Anyer, kondisinya sudah sangat rusak. Akibat jalan tersebut, wisatawan jadi malas datang ke tempat Wisata Karang Anyer. 085373991xxx


28 September 2012 “Kami tidak tergesa-gesa soal ini. Kami inginkan yang terbaik. KPK sangat dibutuhkan saat ini. Kalau sampai keberadaanya tidak memiliki kekuatan, itu tidak baik juga,” Ketua Baleg Ignatius Mulyono.

“Kami mendukung hukum mati bila memang yang dikorpsi jumlahnya besar dan mengakibatkan kerusakan yang masif terhadap perekonomian dan kehidupan bernegara. Jumlahnya mungkin di atas 100 miliar,”

Ketua Fraksi PKS Hidayat Nur Wahid.

Anggota Badan Legislatif Dimyati Natakusumah.

Wujudkan Pendidikan Berkeadilan

Kirim Opini Anda ke email: metrosiantar Maksimal tulisan 5.000 karakter

Sikap Kami Ancaman terhadap Supremasi Sipil PEMERINTAH dan DPR memang rajin membuat undangundang meski sering muatan undang-undang itu kandas di Mahkamah Konstitusi. Lebih memprihatinkan lagi, undangundang itu bukanlah aturan yang mempunyai tingkat urgensi tinggi. Salah satu rancangan undang-undang (RUU) yang disodorkan pemerintah ke DPR untuk dibahas saat ini ialah RUU tentangKeamananNasional.RUUitupernahdikembalikanDPR, tetapi diajukan lagi tanpa revisi. Sejumlah pasal dalam RUU itu beraroma militeristis. Artinya ingin membawa kembali TNI ke dalam urusan keamanan. Pasal 17 RUU Keamanan Nasional, misalnya, menyebutkan ancaman keamanan nasional di segala aspek kehidupan dikelompokkan ke dalam ancaman militer, ancaman bersenjata dan ancaman tidak bersenjata. Definisi itu abu-abu sehingga membuka ruang bagi TNI untuk berkiprah seperti di era Presiden Soeharto. Kita tegaskan bahwa semangat membawa TNI ke fungsi keamanan bertentangan dengan reformasi. Reformasi menempatkan TNI pada fungsi pertahanan, sedangkan fungsi keamanan dijalankan polisi. Membawa TNI ke ranah keamanan dikhawatirkan mengancamkebebasansipil,mencederaidemokrasi,danmenciptakan iklim represif. Kelak, dengan dalih mengganggu keamanan nasional,siapasajayangbersuarakritisbisadibungkam.Persyang mengkritik pemerintah bisa dengan mudah dipanggil menghadapi aparat keamanan. Definisi yang longgar dan ruang penafsiran yang elastis sangat memudahkan aparat keamanan melakukan tindakan menghabisi supremasi sipil dan kebebasan. Apalagi jika aparat keamanan diberi kewenangan khusus untuk menyadap, menyita, dan menggeledah. Kita mempunyai pengalaman panjang di rezim Orde Baru. Keterlibatan militer dalam banyak aspek kehidupan telah mengunci rapat-rapat hak sipil. Kita tidak ingin itu terulang. Bangsa ini sudah memiliki UU tentang Kepolisian, UU tentang Intelijen, UU tentang Keormasan, dan banyak undang-undang lainnya. Semua itu mengatur keamanan nasional dan membangun supremasi sipil. Jangan sampai hak-hak sipil dan kebebasan diberangus UU Keamanan Nasional. Meski partai politik mandul mengelola supremasi sipil, kewenangan itu tidak boleh diserahkan kepada TNI. Kita tidak ingin UU Keamanan Nasional memuat pasal-pasal virus yang menggerogoti supremasi sipil. Karena itu, sebaiknya DPR mengembalikan saja RUU itu ke pemerintah. (**)

Pendidikan merupakan modal penting dalam pembangunan. Tanpa pendidikan yang baik, sebanyak dan sebesar apapun sumber daya alam yang kita miliki akan berujung dengan kegagalan dan kesia-siaan. Tanpa pendidikan yang mumpuni hanya menghasilkan generasi lemah dan miskin kreasi. Terbukti, tata kelola sumber daya alam di negeri ini banyak dikuasai bangsa mancanegara. Sebab sumber daya manusia Indonesia masih gagap menghadapi perkembangan zaman.


Kami sebuah perusahaan Developer membuka peluang kerja bagi anda yang ingin berpenghasilan tak terbatas. Dengan kriteria sbb: • Pria / wanita min. 18 tahun • Pendidikan tidak diutamakan • Berpenampilan menarik • Supel dan pergaulan luas • Diutamakan berpengalaman dibidang perumahan • Diutamakan memiliki kendaraan sendiri dan SIM C • Disiplin dan sanggup bekerja di bawah tekanan Fasilitas yang akan anda dapat: • Gaji bulanan • Uang transport • Komisi • Insentif Bagi yang berminat silahkan antar surat lamaran anda ke:

CV RIZKY Bagian HRD (Andi HP 0812 6480 2849)

Jl. Sumber Jaya Simp. Kerang Pematangsiantar Jam 10.00 WIB s.d 17.00 WIB




Menerima Mahasiswa/i Baru T.A. 2012/2013

aw y Dr Luck


Pendaftaran: 1 Mei 2012 s/d 30 September 2012

edia ultim er M mput it Ko u) Un t a 1 (s

Bagi Mahasiswa/i Baru TA. 2012/2013 Dapat Beasiswa dari Ketua Yayasan 25% uang Kuliah Setiap Tahun

Kami Ada Untuk Anda Senin-Jumat (08.00 s.d 17/00) Sabtu (08.00 s.d 14.00)


Jl. Asahan Komp. Megaland Blok A No.58-60 Telp. 0622 7070215 - 7553367 Pematangsiantar

Mutu dan Pelayanan Yang Utama & Unggul Kwalitas, Unggul Teknologi Ketua Yayasan dto



CELAKANYA,pendidikandiIndonesiamasihdiskrimantif. Alhasil, diskriminatif yang makin masif mengorbankan pelbagai potensi. Apakah kita lupa atau memang tidak menyadari bahwa, pendidikan yang diskriminatif sungguh kontraproduktif? Pendidikan yang dijalankan adalah pendidikanpenuhkepalsuan.Pendidikanyangdiskriminatif, disadari atau tidak, sudah mengingkari kodratnya sebagai salah satu cara memuliakan manusia. Tesmasuk Tentusajakorbanpertamadanutamadarilakudiskriminatif adalahparamuriddanguru.Salahlangkahdalammengelola pendidikan sejak mula dilakukan ketika pendaftaran siswa baru. Pada pendidikan dasar dan menengah, baik di sekolah negeri maupun swasta akhir-akhir ini kerap mengadakan tes saringanmasuksekolah.Sejumlahsekolahdasaryangkadung disebut elitedanbonafideengganmenerimasiswabaru yang belum bisa membaca, menulis, dan menghitung (calistung). Maka terkumpullah siswa-siswa yang dikatakan pandai di satu sekolah. Terkum pul pula siswa yang digolongkan bodohdisekolahlain.Jelasinimenyalahiaturan.Sebabsyarat utama siswa untuk mengenyam pendidikan dasar adalah cukupumurdanlokasisekolahdekatdenganrumah.Dengan kata lain siapa yang mendaftar di awal, jika masih ada kuota, maka siswa tersebut mesti segera diterima.


Program Study:

“Saya nilai KPK ini masih rendah dalam penegakan hukum. Istilahnya kesalahan di depan mata tidak kelihatan tapi yang diufuk timur keliatan. kasus besar gak keliatan, tapi kasus kecil keliatan,”

Direktur dto


Sekolah bisa dikatakan bagus dan sukses bila menerima semua siswa tanpa labelisasi hingga semua siswa lulus sesuai dengan kemampuan yang dimiliki. Oleh karena itu, hentikan tes masuk untuk pendidikan dasar dan menengah! Sekolah harus mau dan mampu menghadapi semua siswa, tanpa mempermasalahkan tingkat kecerdasannya. Fasilitas Sementara itu, untuk mengenyam pendidikan masih banyak penduduk negeri ini mesti berjalan kaki puluhan kilo meter dengan menuruni lembah, menyeberang sungai dan lautan. Ketika di ruang belajar-mengajar guru dan murid itu selalu dihinggapi kekhawatiran karena atap sekolah terancam runtuh. Manakala membutuhkan kepustakaan atau alat peraga mereka hanya bisa berharap karena fasilitas yang dijanjikan tak kunjung datang. Saat hendak mendapat dana bantuan, mereka kerap kecewa karena dana itu selalu telat dan nominal yang diterima sudah menyusut di tengah jalan. Beban pelajaran Takpercaya?Saatmendampingianak-anakSekolahDasar IslamAl-Azhar27Cibinongdalamekskulsastradanjurnalistik saya kerap menghadapi anak yang mengeluh dengan sejumlah pelajaran yang terus bertambah. Keluh-kesah yang salah satunya dilontarkan oleh Sinta Oktaviani Wahyu Widodo, saya sarankan ditulis dalam bangunan cerpen.

Beruntung dimuat koran Pikiran Rakyat, Minggu, 29-5-2011. Dalam cerpen berjudul “Canat-cenut di Kelas Empat,” seperti yang diapresiasi Etti RS, cerpen itu menyajikan topik tentang pelajaran di sekolah. Melalui tokoh bernama Caca, tergambarlah beban pelajaran di kelas empat sekolah dasar yang begitu banyak. Caca seolah mewakili kenyataan zaman sekarang tentang muatan mata pelajaran di sekolah dasar yang begitu banyak dan membuat stres para siswa. Meski fiksi (anak), cerpen tetap berangkat dari kenyataan. Dan kenyatandalampendidikandasarhariiniadalahpendidikan yang membuat beban pikiran para peserta didik menjadi “cenat-cenut.” Pendidikan yang mestinya menggembirakan dan mencerahkan malah menjadi beban pemikiran. Anak-anaklah korban nyata dari perkembangan generasi tua yang memorak-porandakan Indonesia. Ketika gunung digunduli,sungaidanlautandikotori,sertakualitasalamyang terus mengalami kemerosotan anak-anaklah yang pertama mendapat“hukuman.”Atassaranparaaktivislingkungan,atas pertimbangan para pemikir, dan atas kebijakan para pejabat negara, dikeluarkanlah agar anak-anak sekolah dasar mendapat mata pelajaran pendidikan lingkungan hidup (PLH). Sementara itu, menyambut internasionalisasi yang kian masif,anak-anaksekolahdasarpundiwajibkanmendapatkan muatan internasional, umumnya memilih pelajaran bahasa Inggris. Tak cukup pelajaran bahasa Inggris, sekolah yang dikatakan “bonafide,” “elite,” atau “unggul” mereka pun membagi-bagimatapelajaran:IPAdalambahasaIndonesiadan SciencepelajaranIPAdalambahasaInggris;Matematikadalam bahasa Indonesia danMath pelajaran Matematika dalam bahasaInggris.Tentusajabuku,guru,dancarapembelajarannya punberbeda.TakmaukalahdenganpelajaranbahasaInggris, untukmenyaringpembaratan(westerenisasi)parapejabatdi daerahmewajibkanmatapelajaranmuatanlokal.Misal,biladi JabarmunculmatapelajaranmuatanlokalbahasaSunda,maka diJatimadamuatanlokalke-NU-an. Kita tahu, salah satu penyakit akut Indonesia saat ini adalah ihwal korupsi. Koruptorlah yang menggerogoti kekayaan nusantara. Anak-anak juga yang mesti menanggung beban. Yaps, atas desakan pelbagai pihak maka sejak dini mesti ada pendidikan antikorupsi. Maka bertambahlah mata pelajaran yang mesti dihadapi peserta didik. Tak cukup itu, terkenang dengan masa silam, para peserta didik juga disarankan mendapatkan mata pelajaran budi pekerti. Bejibunnyamatapelajaranyangmestidihadapianak-anak adalah salah satu bentuk lain dari diskriminasi atau ketidakadilanpendidikan.Masakanak-kanakyangbaiknyadiisidengan keceriaanmalahdirecoki saran-saranbuahdariparapemangku kepentingandanparaaktiviskemasyarakatan.Hakhidupnya untuk bermain terpaksa hilang karena mesti menghadappi banyaknyamatapelajaran.Okeh,ihwalbuku,guru,ataubiaya meskisudahdanmahalbisadicari,akantetapipsikologianak yangbisastresberatkarenabebanyangterpaksadiembansiapa beranimenjaminuntukmengatasi?Silakanrenungkan.(***) Penulis adalahEsais; praktisi pendidikan di Kota Bogor, Jawa Barat.

DIBUTUHKAN Dibutuhkan tenaga kerja untuk Doorsmeer

a. Supir b. Penjaga Toko Syarat: • Pria (a) • Bisa maju mundurkan mobil manual / matic (a) • Tukang cuci mobil / berpengalaman dalam pemakaian Hidrolik • Bisa masak (b) Honor gaji bisa bulanan / harian Lamaran diantar langsung ke: CARINA CAR WASH (CCW) Jl. Gereja No. 88 P. Siantar Telp. 0622 - 420742; HP 0812 6039 9860 Pada jam kerja


28 September 2012

Divonis 3 Tahun Penjara MIRANDA BANDING

„ Miranda usai menjalani persidangan di Pengadilan Tipikor Jakarta.

JAKARTA- Mantan Deputi Gubernur Senior Bank Indonesia, akan mengajukan banding atas Pengadilan Tindak Pidana Korupsi Jakarta yang menjatuhkan terhadapnya. Miranda menilai dirinya tidak terbukti bersalah menyuap anggota DPR 1999-2004 saat mengikuti pemilihan DGS BI 2004. Hal tersebut disampaikan Miranda dalam persidangan yang berlangsung di Pengadilan Tipikor, Kamis (27/9), seusai mendengar putusan majelis hakim.

”Saya ingin mengatakan, saya kaget, tidak menyangka. Tuhan tahu saya tidak bersalah, saya akan naik banding,” kata Miranda tegas. Sementara menyatakan masih akan pikir-pikir atas putusan majelis hakim tersebut. Dalam amar putusannya, majelis hakim yang diketuai Gusrizal menyatakan Miranda bersalah melakukan tindak pidana korupsi sesuai

dengan Pasal 5 Ayat 1 huruf b Undang-Undang Pemberantasan Tindak Pidana Korupsi (UU Tipikor) juncto Pasal 55 Ayat 1 ke-1 KUHP dalam dakwaan pertama. Putusan ini yang meminta hakim menghukum empat tahun penjara. Menurut hakim, Miranda terbukti menyuap bersama-sama aktor lainnya. Adalah Nunun Nurbaeti yang divonis dua tahun enam bulan penjara karena dianggap sebagai pemberi suap dalam kasus ini. Selama ini, Miranda berdalih kalau dirinya tidak mengetahui ihwal pemberian cek perjalanan kepada anggota DPR 1999-2004, sementara majelis hakim tidak sependapat dengan pembelaan Miranda tersebut. Menurut hakim, meskipun pemberian suap tidak dilakukan Miranda secara langsung, dia dapat dianggap ikut menyuap karena perbuatannya berhubungan dan berkaitan erat dengan perbuatan aktor lain, di antaranya Nunun Nurbaeti, Hamka Yandhu, Dudhie Makmun Murod, Udju Djuhaeri, dan Endin Soefihara. ”Kita tidak melihat masing-mas-

ing peserta dan berdiri sendiri-sendiri, melainkan perbuatan yang berhubungan dan sebagai kesatuan perbuatan peserta lainnya,” kata hakim Anwar. Pada Mei 2004, Miranda mengadakan pertemuan dengan anggota DPR 1999-2004 asal Fraksi PDI Perjuangan dan Fraksi TNI/Polri. Dalam dua pertemuan itu, Miranda menyampaikan visi dan misinya sebagai calon DGS BI 2004. Pertemuan Miranda itu dianggap berkaitan dengan pemberian cek perjalanan kepada anggota DPR 1999-2004 oleh Nunun Nurbaeti yang dekat dengan Miranda itu melalui Arie Malangjudo. Pemberian cek berlangsung di tengah-tengah uji kelayakan dan kepatutan calon DGS BI 2004. Setelah pemberian tersebut, Miranda terpilih sebagai DGS BI 2004. Dalam kasus ini, Nunun divonis dua tahun enam bulan penjara karena dianggap terbukti sebagai pemberi suap. Sementara lebih dari 25 anggota DPR 1999-2004 yang dianggap terbukti menerima cek perjalanan telah menjalani hukuman. (dtc/int)

„ Mendagri Gamawan

Mendagri Minta Kepala Daerah

Hati-hati Kelola Keuangan

JEDDAH - Jamaah haji dan keluarga di tanah air tidak perlu panik dengan munculnya virus flu bernama corona yang sudah menewaskan warga Saudi dan warga Qatar yang pernah ke Saudi. Kasi Pelayanan Kesehatan Daerah Kerja Jeddah dr Ananto Prasetya di Bandara Haji King Abdul Azis Jeddah, Kamis (27/9), mengatakan kasus virus corona belum pernah ditemukan pada jamaah haji. “Kasusnya ditemukan pada tiga orang, dua diantaranya tewas, satu warga Saudi (60) tahun dan warga Qatar (49) yang pernah berkunjung ke Saudi,” kata Ananto. Berkaitan dengan itu dia mengimbau agar jamaah haji Indonesia tidak panik

karena belum ditemukan kasus pada anggota jamaah haji dari negara lain juga. Meski demikian, dia menilai tidak ada salahnya bersikap hati-hati karena dari tiga kasus, dua meningal. Dijelaskannya, bahwa virus corona adalah virus baru yang ditemukan pada manusia dan berbeda dengan virus penyebab penyakit SARS. Virus corona diduga menyerang ginjal dan pada manusia yang bertubuh lemah. “Jadi jika kita menjaga vitalitas dubuh maka virus ini tidak bisa menyerang,” katanya. Karena itu dia mengimbau jamaah haji untuk menjaga kondisi tubuh. Dia meminta jamaah untuk makan dan minum yang cukup, banyak makanan yang

berserat, sayur dan buah-buahan. Dia menganjurkan sering minum karena saat ini udara di Saudi cukup panas di siang hari, yakni 37—38 derajat celsius pada pukul 12:00 waktu setempat Saat ini sebagian besar jamaah berusia lanjut, 50 tahun ke atas, karena itu dia mengimbau agar jangan beraktivitas banyak di luar ruangan di siang hari. Beribadahlah sesuai dengan kemampuan fisik, pilih yang wajib-wajib saja agar tidak kelelahan. Saat ini sebagian besar jamaah haji Indonesia di Madinah menunaikan shalat lima waktu selama delapan hari untuk mendapatkan arbain (40 kali shalat fardhu). (kmc/int)

JAKARTA- Angelina Sondakh, terdakwa kasus suap penganggaran proyek Kementerian Pemuda dan Olahraga serta Kementerian Pendidikan Nasional, meminta agar dijadikan tahanan rumah. Jika dikabulkan, Angelina tidak lagi mendekam di Rumah Tahanan Pondok Bambu, Jakarta Timur. Permintaan ini disampaikan Angelina atau Angie melalui pengacaranya, Tengku Nasrullah, dalam persidangan yang berlangsung di Pengadilan Tindak Pidana Korupsi (Tipikor) Jakarta, Kamis (27/9). “Kami memohon kepada yang mulia majelis hakim, terhadap urgensi penahanan terdakwa, mengingat anak terdakwa masih berumur dua tahun dan terdakwa adalah single parent. Besar harapan kami mengalihkan jadi tahanan rumah sehingga terdakwa bisa mengasuh anaknya,” kata Nasrullah. Menurut Nasrullah, sesuai Pasal 21 Kitab Undang-Undang Hukum Acara Pidana (KUHAP), sudah tidak ada lagi kepentingan untuk menahan Angelina. Pasal tersebut mengatur bahwa seseorang dapat ditahan jika berpotensi melarikan diri, menghilangkan alat bukti, atau mengulangi perbuatannya. Alasan Angelina akan melarikan diri dianggapnya tidak dapat lagi menjadi dasar penahanan karena Angie tidak akan melakukan hal tersebut. “Tidak akan mungkin karena terdakwa sudah dicegah dan sedang menjalani proses persidangan,” kata Nasrullah. Selain itu, menurut Nasrullah, kliennya tidak perlu lagi di tahanan karena tidak mungkin menghilangkan alat bukti mengingat perkaranya sudah disidangkan. Lalu, mengenai kemungkinan Angelina mengulangi perbuatannya, Nasrullah mengatakan, hal itu tidak mungkin terjadi karena Angelina sudah dinonaktifkan dari keanggotaan DPR. “Sehingga dalam saat yang bersamaan terdakwa bisa menjalankan fungsinya sebagai ibu,” ujar Nasrullah. Menanggapi permohonan terdakwa, Ketua Majelis Hakim Sudjatmiko mengatakan akan mempertimbangkannya. “Kami mendengar, kami pertimbangkan, dan apakah dikabulkan nanti akan jadi bagian pertimbangan kami,” kata Sudjatmiko. Dalam kasus ini Angelina didakwa menerima pemberian atau janji berupa uang yang nilai seluruhnya Rp 12,5 miliar dan 2, 35 juta dollar Amerika Serikat (Rp 21 miliar dengan kurs dollar Rp 9.000). Uang tersebut diberikan Grup Permai, perusahaan milik Muhammad Nazaruddin, terkait penganggaran proyek di Kementerian Pemuda dan Olahraga serta proyek Kementerian Pendiidkan Nasional. (kmc/int)

JAKARTA- Pemerintah menghormati putusan Mahkamah Konstitusi (MK) yang meminta penghapusan aturan izin presiden bagi penegak hukum untuk memeriksa kepala daerah bermasalah. Konsekuensinya, pemerintah akan meminta seluruh kepala daerah untuk berhatihati dalam membuat kebijakan yang berkaitan dengan keuangan daerah. ”Kita hargai putusan MK. Kita intensifkan pembinaan pengelola keuangan daerah dan pengambilan keputusan,” kata Mendagri Gamawan Fauzi ketika dihubungi, Kamis (27/9). Ia menyebutkan, adanya putusan MK ini juga berpengaruh terhadap rencana revisi UU No32/ 2004 tentang Pemerintah Daerah. Awalnya pemerintah tetap memasukkan klausul izin presiden untuk memeriksa kepala daerah. “Kita akan perhatikan putusan ini saat revisi UU Pemda,” ujarnya. Selama ini, adanya izin presiden tersebut dimasukkan dalam RUU Pemda yang merupakan revisi UU No32/ 2004. Pasalnya, kepala daerah merupakan perwakilan pemerintah pusat dalam melayani publik di daerah. Jika selama 60 hari izin presiden tidak keluar, penegak hukum bisa memproses lebih lanjut kepala daerah yang diduga bermasalah itu. ”Jadi wajar jika ingin meLokasi: Sumber Jaya Simp. Kerang P. Siantar lakukan proses hukum, atasannya harus diinformasiSegera Hubungi..... Persediaan terbatas kan,” ujar Dirjen Otonomi Daerah Kemendagri Djohermansyah Djohan. (mdc/int)



1 Kavling 20 jt-an Rumah yang segera dibangun

Jamah Haji Tak Perlu Cemas Virus Flu Corona

Minta jadi Tahanan Rumah


„ Seorang jamaah haji sujud syukur begitu sampai di Madinah.

Angelina Sondakh

Fasilitas: 1. PDAM dan PLN 2. Jalan utama L 7 M, jalan lingkungan L 5 M 3. Lokasi strategis dekat Komp. Siantar (Mas/Waterpark + 1 KM) Kantor Pemasaran:

Jl. Diponegoro No. 25 D P. Siantar (Depan Hotel Sapadia Simp. 4) Contact Person

HP 0823 6712 6137 Zulham Nasution SH Rudi A Nainggolan AMD HP 0821 6615 1867


28 September 2012

Pentolan Koreker Ditangkap Sambungan Halaman 1 Bandar Huluan. Informasi dihimpun METRO, Pengadilan Negeri Simalungun telah mengeluarkan putusan atas sengketa lahan eks Bandar Betsy yang dimenangkan oleh Koreker seluas 146 hektare. Setelah putusan itu, pengadilan juga telah melakukan eksekusi lahan. Namun saat itu pihak PTPN III Bandar Betsy yang tidak terima atas putusan pengadilan, melakukan perlawanan, dengan melarang warga menguasai lahan. Pasca batalnya eksekusi lahan, Koreker mendatangi berunjuk rasa ke Mapolres Simalungun meminta perlindungan hukum dan penegakkan hukum agar dijalankan seadil-adilnya. Supaya masyarakat yang memenangkan perkara itu dibiarkan menduduki lahan. Namun, Koreker menilai aksi ke Mapolres Simalungun tidak pro rakyat. Sehingga masyarakat pun berniat menduduki lahan tersebut secara paksa. Saat itu 200 orang buruh harian lepas (BHL) yang didatangkan dari Kota Siantar dan 300an masyarakat Koreker hendak memaksakan diri menanami lahan tersebut. Masyarakat dan BLH dilengkapi peralatan pertanian, seperti babat, sabit, parang, dan cangkul. Ketika masyarakat Koreker, BLH, dan kuasa pendamping menuju lahan tersebut, 200 meter sebelum sampai lokasi, polisi sudah menghadang. Masyarakat diminta agar tidak berkeras melanjutkan niatnya mengelola lahan tersebut, pasalnya di lahan juga ramai pihak PTPN III Bandar Betsy. Polisi berniat menghadang warga, agar tidak terjadi bentrok di lahan dengan pihak PTPN III Bandar Betsy. Namun, masyarakat tetap menerobos pertahanan polisi. Saat itu-lah pentolan Koreker Larham Simaremare (48) warga Jalan Tusam, Kelurahan Kahean, Kecamatan Siantar Utara ditangkap beserta 3 orang anggotanya. Ketika Larham diamankan, kubu masyarakat sedikit tenang. Saat ini Larham bersama 3 orang lainnya sedang menjalani pemeriksaan di Sat Reskrim Polres Simalungun. Mereka tiba di Polres Simalungun sekitar pukul 15.30 WIB dengan menumpangi mobil Kijang Kapsul dan pengawal ketat aparat kepolisian. Larham Simaremare mengatakan, pihaknya hanya ingin menanami lahan yang dimenangkan Korekar sesuai putusan Pengadilan Negeri Simalungun. Tetapi, di tengah perjalanan, polisi menghadang dan menangkapi masyarakat. “Memang benar kami ditangkap membawa senjata tajam. Tetapi sajam yang kami bawa adalah jenis peralatan pertanian yang mau dipergunakan untuk berocok tanam. Kami tidak ada niat untuk berbuat kekerasan. Kami yang dihadang karena mau mengelola lahan masyarakat,” ujarnya singkat sebelum diperiksa. Senada diungkapkan, Henry Marbun. Ia mengaku sajam yang diamankan darinya merupakan babat rumput. “Kami hanya mau menanami lahan itu,” katanya singkat. Kuasa hukum Koreker Juhong Siahaan SH, membenarkan bahwa 4 anggota koreker diamankan atas dugaan membawa senjata tajam. Dia mengatakan, senjata tajam yang diamankan jenis babat, dan parang merupakan peralatan pertanian warga. “Hasil pemeriksaan belum ada, karena keempatnya masih diperiksa,” ujarnya singkat. Kapolres Simalungun dikonfirmasi melalui Kasubag Humas AKP H Panggabean membenarkan keempat tersangka diamankan di Polres Simalungun. Sementara 1 x 24 jam, keempatnya masih menjalani pemeriksaan. (osi)

Tolak Job SINETRON Sambungan Halaman 1 sama keluarga daripada harus syuting stripping. Demikian diungkapkan di Senayan City, Jakarta. “Belakangan masih syuting program teve. Sekarang banyakan off air. Aku gak milih sinetron. Kalau kerja paling lama satu jam, memang kesepakatan bersama. Jadwal di rumah lebih banyak,” katanya. Untuk itu, Fenita pun mengaku lebih senang mengambil program atau acara yang mudah dan ringan lantaran bisa mengajak anakanaknya ke lokasi. “Jiwa ibu rumah tangga saya juga kental. Saya memang menyadari kerjaan saya ngabisin waktu. Menyiasati kumpul keluarga gimana. Di weekend ini kumpul, memang ada planning ke Bali, dua sampai tiga bulan sekali harus kumpul keluarga,” tandas istri Arie Untung lalu tersenyum. (int)

Dipukul, Diseret & Didorong Sambungan Halaman 1 Hal itu terjadi saat mereka mendampingi masyarakat bercocok tanam di lahan eks HGU PTPN III Bandar Betsy, Kecamatan Bandar Huluan, Kamis (27/9). Saat itu ratusan masyarakat Koreker dan pendamping membawa peralatan pertanian masing-masing untuk mengelola lahan eks HGU PTPN III Bandar Betsy yang telah dimenangkan Koreker dibuktikan putusan Pengadilan Negeri Simalungun. Akan tetapi, 200

Sambungan Halaman 1 Tepat pukul 18.00 WIB, mereka berangkat ke Ujung Tanjung, Simpang Benar, Duri, naik bus Intra dengan ongkos Rp180 ribu. Supriadi pergi meninggalkan rumah karena saat itu dia sedang ada masalah dengan istrinya. Minggu (23/9) pagi sekira pukul 06.30 WIB, Supriadi dan Mawar tiba di Duri dan langsung menuju rumah adik tirinya bernama Wulan. Kedatangan mereka disambut baik oleh Wulan dan suaminya Roni, yang bekerja sabagai security di Duri. “Wulan juga tahu soal kedekatan saya dengan Mawar. Dia tahu kami pacaran,” ujar buruh harian lepas (BHL).PKS Bah Gunung ini. Selama tiga hari mereka tinggal di rumah Wulan yang hanya memiliki satu kamar. Supriadi dan Mawar tidur di ruang depan, Wulan dan suaminya tidur di dalam kamar. Tiba larut malam, Supriadi dan Mawar

Sambungan Halaman 1 mengaku, masih terus mengikuti keinginan arwah wanita yang penasaran itu. O Sijabat mengatakan, dirinya sempat bermediasi dengan arwah korban. Arwah yang penasaran ini meminta agar potongan kepalanya segera ditemukan. ”Dia (arwah) meminta supaya saya temukan potongan kepalanya. Bahkan saat saya terawang, dia terlihat menangis. Mungkin itulah suara-suara rintihan yang sering didengar warga sekitar, ketika melintas di lokasi ini (penemuan mayat),” katanya. Dijelaskannya, selama ini arwah korban sempat dikunci oleh si pembunuh. Namun kali ini O Sijabat, mengaku berhasil menanyakan alamat korban. Saat itu, kata Sijabat, arwah wanita cantik ini menunjuk ke arah Jalan Sarimatondang, Sidamanik. Sambil menangis arwah ini terus menunjuk ke arah yang sama. ”Dari bahasa isyarat korban saya menyimpulkan korban ini berasal dari sekitar kawasan

Mendapat pengakuan tersebut, esok harinya, Kamis (27/9) Pakhruddin mendatangi Mapolsek Bangun guna membuat laporan. Petugas selanjutnya langsung mengamankan pelaku guna diproses lebih lanjut. Bersamaan itu pula Mawar dibawa kakeknya ke rumah sakit untuk divisum. Kepada METRO, Supriadi mengaku telah melakukan hubungan intim dengan Mawar sebanyak tiga kali selama di Duri. Ditanya soal rayuan berupa pelet, dia mengatakan tidak ada memakai pelet atau sejenisnya untuk bisa menyetubuhi Mawar. “Aku tidak ada pakai pelet untuk merayu perempuan Bang. Lagian dia itu pacarku,” kata Supriadi usai diperiksa. Kapolsek Bangun AKP Hitler Sihombing yang dikonfirmasi membenarkan adanya kasus tersebut. Saat ini pihaknya sedang melakukan peroses penyelidikan lebih lanjut. “Kita sudah tangani kasus itu dan masih dalam proses penyelidikan,” ujarnya.(mag-4)

Siantar. Sebab dari hasil penelusuran polisi, di kawasan Sidamanik ini tidak ada warga yang kehilangan anggota keluarganya. Firasat saya pun, wanita ini berasal dari Siantar,” katanya. Wanita ini juga terlihat terus memandangi sekitar lokasi kebun teh yang berada di sekitar semak belukar, tak jauh dari temuan mayat itu. Ketika paranormal ini berkomunikasi dengannya, sesekali arwah wanita panasaran ini tampak meringis kesakitan. ”Saat mulai berkomunikasi, sesekali arwah ini menjerit kesakitan, sebab dari lokasi lain ada paranormal yang memukulnya agar arwah ini tidak berbicara,” katanya. Dijelaskannya, sebelumnya pelaku pembunuh wanita ini sudah lebih dulu merencanakan ingin mengunci arwah wanita itu. Dengan menggunakan jasa paranormal, kemudian mediasi mereka dilakukan dengan mempersembahkan kepala korban pada jin. ”Sejak awal pembunuh korban ini sudah merencanakan aksinya. Kemudian untuk menutupi aksinya, pelaku juga mengambil

potongan kepalanya untuk dipersembahkan pada jin, sehingga mereka bisa mengendalikan arwah korban dari jarak jauh. Supaya ketika arwah korban mulai menungkap kasus ini, pelakunya langsung memukul arwah korban dengan mantra, sehingga dia ketakutan,” katanya. Namun dari hasil penerawangannya, korban diyakini berasal dari Siantar dan potongan kepala korban juga diduga kuat masih ada di sekitar kebun teh itu. Paranormal ini juga optimis akan mengungkap korban dengan meminta bantuan pada Mahagurunya yang juga paranormal asal Sipolha. Kapolsek Sidamanik AKP Delami SH yang dihubungi METRO, Kamis (27/9) menyebutkan, kasus ini masih dalam penyelidikan dan potongan kepala korban juga belum ditemukan hingga saat ini. ”Belum ada petunjuk soal temuan mayat ini. Bahkan potongan kepala korban juga belum ditemukan beserta identitas korban. Dan kasus ini masih dalam penyelidikan,” katanya. (mag-02)

Tolak Pemanggilan 8 Warga Sambungan Halaman 1 Hutagaol, Rabu (19/9) pukul 10.00 WIB. “Warga, hanya mempertahankan tanah ulayat milik bersama masyarakat Desa Pandumaan dan Sipitu Huta dari pembabatan hutan yang dilakukan TPL. Jika itu tetap berlanjut, kami tidak akan dapat makan dan tidak mampu menyekolahkan anak-anak kami lagi,” ujar Haposan Sinambela saat aksi berlangsung. Dia menjelaskan, warga kedua desa tersebut sama sekali tidak ingin bentrok dengan aparat kepolisian, apalagi Brimob yang bertugas. “Tapi sudah 4 tahun kami memperjuangkan tanah warisan ini melalui demo dan kesepakatan bersama mengusulkan revisi lahan warga dari cengkeraman TPL. Tapi TPL tetap membuka areal dengan memperluas lahan yang sudah ditanami pohon kemenyaan oleh warga. Jadi, kami sebenarnya menganggap TPL sebagai musuh kami,” tandas Sinambela. Dikatakannya, melalui rapat antara Uspida Humbahas, PT TPL dan warga Desa Pandumaan dan Sipitu Huta, telah menghasilkan kesepakatan untuk tidak ada lagi aktivitas penebangan pohon di hutan kemenyan warga oleh pihak TPL. ”Artinya, kesepakatan di lokasi sengketa itu adalah stanvas. Tapi justru TPL ingkar atas kesepakatan itu,” imbuhnya. Massa yang sempat bersitegang dengan aparat kepolisian, mengancam akan terus melakukan demo ke Mapolres Humbahas jika

pemanggilan terhadap 8 warga tetap dilakukan. “Kami tidak mengerti hukum, kami hanya tau tanah warisan nenek moyang kami hendak dirampas oleh TPL, sehingga kami berusaha mempertahankan tanah leluhur kami dari penggerogotan pihak PT TPL. Kami akan selalu mempertahankan tanah warisan nenek moyang kami, sampai revisi SK 44/Menhut-II/ 2005 dan tata batas konsesi PT TPL di sektor Tele dikeluarkan Menteri Kehutanan RI,” ujar Karsi Sihite, warga Desa Pandumaan. Tuntutan Warga Disetujui Aksi demo yang berlangsung lebih dari satu jam di Mapolres Humbahas, disambut langsung oleh Kapolres Humbahas AKBP Heri Sulismono. Kehadiran massa, sempat memacetkan jalur lalu lintas Dolok SanggulSiborongborong. Setelah menyampaikan tuntutan, pihak Polres Humbahas dan perwakilan massa akhirnya menyepakati ke-8 warga dimaksud tidak jadi dipanggil dan akan melakukan musyawarah bersama melalui pertemuan dengan Uspida Plus serta pihak PT TPL guna mencari solusi penyelesaian konflik. Setelah adanya kesepakatan tersebut, massa pun akhirnya membubarkan diri dengan tertib. Amatan METRO, peserta aksi di dominasi kaum ibu, pelajar bahkan Balita. Tanpa raguragu, sejumlah anak yang masih berstatus pelajar turut serta membawa poster penolakan pemanggilan 8 warga dari Desa Pandumaan sekaitan penyerangan ratusan

warga ke area pembukaan jalan baru area konflik konsesi PT TPL tanggal 19 September lalu, hingga berujung pada penganiayaan warga terhadap Briptu Hotbastian Simamora dan Frengky Hutagaol, serta membakar satu unit alat berat jenis excavator yang ada di lokasi bentrokan. Ke mana Lagi Petani Mengadu? Menanggapi konflik agraria tersebut, Direktur Wahana Lingkungan Hidup (Walhi) Sumatera Utara, Kusnadi, kepada METRO, Kamis (27/9) mengatakan, bahwa konflik agraria di Sumatera Utara khususnya antara warga di Kecamatan Pollung dengan pihak PT TPL merupakan sebuah kepentingan pragmatis dan cenderung menguntungkan pemegang modal. “Mental serakah untuk merebut tanah rakyat dan perampas hasil bumi rakyat saat ini telah bermetamorfosa. Berbagai payung hukum tentang agraria hanyalah aturan yang digunakan untuk menindas dan mendinginkan riak perlawanan rakyat,”ujar Kusnadi. Para korporasi dan spekulan tanah menjadikan tanah komoditi dagang dan bisnis sepihak. Sehingga, petani dan orang miskin secara perlahan tapi pasti akan digusur. Hak masyarakat adat juga digusur dan mengikis pengakuan hokum adat.”Jika sudah hokum adat, tanah ulayat dan hak rayta miskin atau petani juga sudah tidak diakui, kemana lagi petani akan mengadu..?maka perlawanan akan terjadi dan menimbulkan masalah baru,”imbuh Kusnadi. (jona/hsl)

telah disakiti dan dilecehkan oleh aparat Polres Simalungun. “Kita sekarang sedang di Mapoldasu membuat laporan pengaduan. Saya sedang menunggu di luar pemeriksaan. Sedangkan korban sedang menjalani pemeriksaan di ruang Propam. Orang yang kita laporkan adalah ketiga polisi yang diduga memukuli korban,” tegasnya. Sementara korban belum bisa dimintai diwawancarai. Sampai sore tadi, korban masih menjalani pemeriksaan di Propam Poldasu. (osi)

Irjen Kemendikbud Gandeng KPK Sambungan Halaman 1 “Kita akan rekomendasikan ke KPK. Ini loh, ada temuan seperti ini. Jika nantinya ada temuan penilepan, pasti kita minta KPK mengambil langkah hukum,” ujar Haryono Umar, yang juga mantan pimpinan KPK itu, kepada koran ini di Jakarta, Kamis (27/9). Haryono menjelaskan, begitu tim dari Itjen Kemendikbud sudah terbentuk, maka akan langsung mengumpulkan data sebagai bahan untuk audit investigasi. Data yang dibutuhkan pertama kali adalah data dari Kementerian Keuangan (Kemenkeu). Tim akan mencari tahu, berapa sebenarnya dana insentif guru yang sudah dikucurkan Kemenkeu ke Pemprov Sumut. Dari dana yang sudah digelontorkan Kemenkeu itu, berapa yang sudah disalurkan Pemprov Sumut ke seluruh kabupaten/kota. “Dari situ nanti akan kelihatan berapa dana yang mengendap. Jika memang ada, kita kejar dimana uang itu sekarang,” terang Haryono. Dia menjelaskan, dana insentif guru yang disalurkan Kemenkeu sudah pasti berdasarkan data jumlah guru yang diajukan Dinas Pendidikan Provinsi. “Jadi kita akan cari tahu dulu, apakah dana itu sudah disalurkan sesuai dengan data jumlah guru yang dulu diajukan. Kita dalami, kalau ada yang belum tersalurkan, mengapa belum tersalurkan dan dimana uangnya sekarang,” beber Haryono. Dikatakan, begitu nantinya tim dari Irjen Kemendikbud turun ke daerah, maka akan menggandeng Inspektorat Daerah, karena dana guru yang disalurkan Kemenkeu itu masuknya ke APBD. Haryono meminta Inspektorat Daerah agar memperketat pengawasan danadana yang merupakan hak guru. “Karena sekitar 70 hingga 80 persen dana pendidikan itu langsung ke daerah (tidak lewat Kemendikbud). Maka perlu pengawasan ketat,” ulasnya. Seperti diberitakan, delegasi Forum Guru Siantar (FGS) yang dipimpin Hendri Edwin Tampubolon, Selasa dan Rabu (26/9) menyambangi sejumlah instansi, antara lain Kejaksaan Agung, Kemendikbud, dan DPR. Hendri menyebutkan, seluruh guru di Sumut mendapat insentif atau bantuan kesejahteraan guru sebesar Rp60 ribu per bulan atau Rp720 ribu per tahun. Biasanya, insentif ini dibayarkan setiap tiga bulan sekali dari anggaran pemerintah provinsi setempat. Menurutnya, bantuan kesejahteraan guru itu telah diberikan sejak 2008. Di Pematang Siantar, kata dia, awalnya guru yang harus menerima sebanyak 4658 orang. Namun, pada 2011 keluar petunjuk teknis bantuan insentif guru 2011 yang mensyaratkan guru penerima 24 jam mengajar dan belum sertifikasi. Atas dasar itu, terseleksi hanya 3511 guru yang layak mendapatkan insentif tersebut. FGS pun mensinyalir ada dugaan upaya menyelewengkan dana tersebut. Ia juga mengatakan, tunjangan profesi para guru selama satu bulan di Bulan Desember 2011 lalu, hingga saat ini juga belum diterima para guru di Kota Pematangsiantar. Sementara, Ketua Dewan Pendidikan Pematangsiantar, Natsir Armaya Siregar mengatakan, ada dugaan penggelapan dana bantuan kesejahteraan guru itu dilakukan oleh oknum-oknum di Dinas Pendidikan bersama oknum Pemprov Sumut. Menurutnya, penggelapan dana tersebut tidak hanya terjadi di Kota Pematangsiantar saja, tetapi diduga juga merata di 33 kabupaten/kota yang ada di Provinsi Sumut. “Untuk Pematangsiantar total dana kesejahteraan guru yang diduga digelapkan itu mencapai Rp1,49 miliar dan jika ditambahkan lagi dengan kabupaten/kota yang ada di seluruh Sumut jumlahnya mencapai Rp66 miliar,” kata Natsir. (sam)

AHLI BPKP CABUT KETERANGAN Sambungan Halaman 1 Ahli Akuntansi dari BPKP Darwin Napitupulu yang dihadirkan Jaksa Penuntut Umum Amardi Barus dan Billin Sinaga. Dalam persidangan, tampak Ahli akuntansi dari BPKP perwakilan Sumatra Utara ini, sempat galau dalam memberikan keterangan dalam keahliannya. Bahkan Ahli yang dulu keterangan diminta selama proses penyidikan di Polres Simalungun mencabut keterangannya.

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel)

Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

melakukan hubungan layaknya suami istri. Perbuatan itu mereka lakukan selama tiga malam, selama mereka tinggal di sana. “Kami melakukannya satu kali satu malam,” ujarnya. Kemudian, Rabu (26/9) meraka kembali ke rumahnya di Huta V Pulo Lawan, Nagori Bah Gunung. Kepada istrinya, Supriadi mengatakan bahwa Mawar adalah sepupunya dari kampung dan istrinya percaya begitu saja dan memperbolehkan Mawar masuk ke rumah. Tanpa sepengetahuan mereka, kakek Mawar, Pakhruddin Dalimunthe (66) yang sudah lama mencari Mawar mendatangi rumah Supriadi, saat mereka baru tiba. Pakhruddin pun membawa Mawar kembali pulang ke rumahnya di Kecamatan Siantar, Kabupaten Simalungun. Sampainya di rumah, Pakhruddin menanyai cucunya hingga akhirnya Mawar mengaku telah disetubuhi Supriadi.


Anggota SPS No: 438/2003/02/A/2007 Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba

anggota Polsek Perdagangan. Di hadapan masyarakat Koreker, Jamerson dipukuli, diseret, dan tersorong hingga jatuh ke sungai. Spontan, kejadian itu mengundang amarah Koreker. Sebagian melakukan perlawanan terhadap aparat kepolisian, dan sebagian lagi menyelamatkan Jamerson. Penasehat Hukum Koreker, Suyetno SH MH mengatakan, pihaknya langsung berangkat bersama korban ke Propam Poldasu melaporkan kejadian tersebut. Masyarakat merasa

Suami Setubuhi ABG 16 Tahun

Terdepan, Terbesar, dan Terbaik di Siantar- Simalungun

Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pemimpin Perusahaan Metro Asahan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

meter sebelum tiba di lahan, masyarakat di hadang puluhan aparat kepolisian. Masyarakat yang tidak berterima dihadang aparat, lantas melakukan perlawanan dengan menerobos pertahanan kepolisian. Saat itu Jamenson dibarisan depan, sehingga dirinya yang pertama ditarik oknum polisi. Menurut masyarakat Koreker, yang menarik Jamerson adalah Aiptu Edi Sisuanto, Kapolpos Sei Lange, Kompol Samsul Siregar Kabag Ops Polres Simalungun, dan Marasak Nainggolan

Adapun keterangan yang dicabut saksi dalam keterangan, di antaranya bahwa terdakwa Zulkarnain Damanik telah melakukan perbuatan melawan hukum, dicabut dalam persidangan dengan dalih itu adalah bahasa polisi. Dalam sidang juga terungkap, sebagai tim audit BPKP telah pergunakan laporan Bawasda Simalungun yang tidak akurat. Contohnya dalam saldo rekening koran 001 buku bank 17 Peb 2006 Rp11,5 miliar tapi dalam saldo bank

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Chandro Purba, Nasa Putramaylanda, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Pala MD Silaban, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf,

penutup kas Rp11,2 miliar lebih. Terungkap juga dalam persidangan, hasil audit BPKP yg dilakukan saksi ahli Rp555 juta lebih kerugian negara, angka ini beda dengan isi dakwaan. Di mana kerugian negara tercatat Rp529 juta lebih. Saksi ahli BPKP itu juga tidak mampu menjelaskan berapa kerugian negara yang dilakukan oleh terdakwa. Pertama saksi bilang penggunaan panjar tidak boleh, tapi setelah didesak Junimart Girsang kuasa hukum terdakwa, saksi ahirnya

Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Niko, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli

mengatakan, penggunaan dana panjar boleh. Saksi ahli sebelumnya katakan terdakwa melanggar hukum, tapi kemudian karena tersudut dibuat pengacara terdakwa, dia mengatakan hanya menghitng kerugian negara dan tidak pernah mengatakan mantan bupati melanggar hukum. Usai mendengarkan keterangan saksi, maka proses persidangan ditunda hingga pekan depan dengan agenda masih mendengarkan keterangan sejumlah saksi. (pms)

Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



28 September 2012

DICULIK DI RAMBUNG MERAH.. Sambungan Halaman 8 korban dan menawarkan jasa untuk diantar pulang ke rumah. Namun korban menolak, sebab jarak rumah korban di Jalan Kampung Baru Rambung Merah sudah tidak jauh lagi. Namun, meski ditolak, tersangka yang siang itu mengendarai sepedamotor Yamaha Vega R tanpa nomor polisi tetap memaksa. Tersangka nekat menarik paksa tangan korban dan menaikkannya ke sepedamotor. Warga yang melihat kejadian itu langsung menghubungi abang korban yang bekerja di Water Park Siantar. Sebagian lagi mengejar, namun warga kehilangan jejak. Merasa aman dari kejaran warga, tersangka membawa korban melewati kawasan Siantar Square dan berputar-putar di kawasan pusat jajan tersebut. Kemudian memutar ke jalan Lapangan Bola Bawah. Setelah berputar-putar 30 menit, tersangka memacu sepedamotornya ke arah Tanah Jawa dengan tujuan Kisaran. Namun di depan Mapolsekta Tanah Jawa sedang ada razia rutin. Menyadari sepedamotor tidak memakai plat, tersangka gugup dan masuk Gang Kedai Kopi Dayat Silalahi di

Sambungan Halaman 8 Namunsaatberusahamembukapintu ini, tersangka dipergoki warga sekitar rumah korban dan warga inipun langsung membekuktersangkasaatitujuga.Sementara sebagian warga menghubungi polisi. Tak lama kemudian, aparat polisi Polsek Siantar Selatan tiba di lokasi dan mengamankan tersangka. Di Polsek Siantar Selatan, JT mengakui telahmelakukanpencuriansebanyak3kali di rumah Alfin Irwansyah. Pertama kali

Rintis IX Balimbingan arah kuburan Jawa. Priston Butarbutar (35), warga setempat yang sedang bekerja di kebun sawit milik marga Silalahi heran melihat tersangka masuk Gang Buntu. Diam-diam Priston membuntuti tersangka. Tampak dari kejauhan tersangka membuka paksa celana dalam korban. Selanjutnya, tersangka menidurkan korban. Karena mendapat perlawanan, tersangka mencekik leher korban dan mengancam akan menghanyutkan korban ke saluran irigasi. Menyaksikan adegan percobaan perkosaan tersebut, Priston berteriak keras sambil berlari ke kampung memanggil warga Rintis IX. Tak berapa lama, Haposan Silalahi (56) muncul dan berusaha menghadang sepedamotor tersangka yang hendak kabur. Melihat warga, tersangka sempat nekat dan hendak menabrak Haposan. Berhasil mengelak, Haposan langsung menarik baju tersangka. Namun tersangka tak menyerah, laju sepedamotornya terus dipacu hingga Haposan terseret sejauh 30 meter. Disaat yang genting itu muncul bantuan dan Prinner Butarbutar dan menghadang tersangka menggunakan kayu. Tapi

tersangka tetap nekat dan menabrak Prinner. Tapi Prinner tak gentar, ia menarik baju tersangka hingga laju sepedamotor tersangka oleng dan berhenti setelah menabrak tembok balerong. Setelah diinterogasi warga, tersangka mengaku bahwa bocah tersebut adalah keponakannya. Namun korban yang saat itu muncul mengaku sama sekali tidak mengenal tersangka. Mendengar jawaban korban, warga langsung mengamankan tersangka dan menghubungi polisi. Setelah diperiksa polisi, dari kantung celana tersangka ditemukan celana dalam korban. Kepada METRO, Saputra mengaku baru seminggu tinggal dan kos di Jalan Jati Pematangsiantar. Setiap paginya, tersangka menemani rekannya jualan sayur-mayur di Pasar Dwikora Parluasan. Sedangkan sepeadamotor yang digunakannya itu adalah milik temannya warga Marihat Lambou Siantar. Tersangka juga mengaku memiliki seorang istri bernama Siti br Lubis. Dari hasil perkawinannya dengan Siti, lahirlah tiga anak. Anak pertama berumur 6 tahun dan paling kecil usia 1 tahun. Namun, pria yang tidak punya pekerjaan tetap ini mengaku telah

pisang ranjang selama 2 bulan dengan istrinya. Ibu kandung korban Melur br Manullang, Kamis (27/9) malam, di Mapolsekta Tanah Jawa mengatakan, mengutuk perbuatan tersangka terhadap putrinya yang paling kecil dari lima bersaudara itu. “Biarlah proses hukum berjalan untuk mengganjar perbuatan keji tersangka,” ujar Melur sambil menangis dan mememeluk putrinya. Sementara korban tidak mau berkomentar. Ia masih trauma. Kapolsekta Tanah Jawa Kompol B Siallagan membenarkan kejadian itu. Ia menyebutkan, tersangka telah dijebloskan ke Rutan Mapolsekta Tanah Jawa. Dalam kasus ini, tersangka melanggar pasal 81 UU RI No 23 Tahun 2002 tentang Perlindungan anak dan diancam hukuman 15 tahun penjara. Pantauan METRO di Mapolsekta Tanah Jawa, sejak siang puluhan warga berbondong-bondong memenuhi ruangan penjagaan Mapolsekta Tanah Jawa untuk melihat wajah tersangka dan wajah korban. Kabar percobaan perkosaan langsung menyebar ke seluruh pelosok hingga menyebabkan warga Tanah Jawa gempar. (iwa/dro)

padaSenin(2/7)lalu,JTmengambillaptop merk Zyrex dan satu dompet berisi uang Rp500 ribu. Kemudian kedua kali pada Rabu (1/8), JT kembali mencuri dan mengambilsatuinfocus,satuHPsertadua kaosmilikAlfin.“Akumencuriuntukmain game point blank di warnet Putri, barang yang aku curi kemudian aku jual ke tukang stiker yang ada di dekat Rumah Potong. Laptop itu kujual seharga Rp310 ribu, uangnya sudah habis bang. Kalau infocus dan HP gak ingat aku ke mana kujual dan sama siapa kujual bang dulu,”

ujar remaja yang mengaku putus sekolah dari SMPN 3 ini. Korban Alfin Irwansyah mengaku, sudah dua kali kehilangan barang dari rumahnya.Namuntidakmelaporkanhal tersebut ke polisi. Hal ini dimaksudkannya agar tersangka tidak melarikan diri. Sebab selama ini, dia juga sudah curiga dengan gerak-gerik tersangka yang tinggal satu kelurahan dengannya ini. “Sudah dua kali saya kehilangan, pertama laptop sama dompet, kedua HP sama baju kaos. Tidak

saya lapor ke polisi Bang. Biar si pencuri itu tidak curiga. Nah, aksi yang ketiga inilah baru ketahuan dia,” ujarnya. Kapolsek Siantar Selatan AKP Giring Damanik membenarkan adanya penangkapan pencuri yang dilakukan warga Kelurahan Kristen ini. Setelah dibawa warga, kemudian di interogasi, JT mengakui perbuatannya. “Kita juga sudah menyita barang bukti laptop dari pedagang yang membeli dari JT. Tersangka dijerat pasal 362 KUHPidana,” ujarnya. (ral/dro)

datangdariarahberlawanan. Diduga,korbansaathendakjatuhlangsungmelompatdarikenderaannyasehingga tubuhnya tidak berbenturan dengan HondaJazztersebut.Korbanlaluterjatuhke aspaldanmengalamiluka-lukadibeberapa bagian tubuhnya. Sesudah kejadian, korbanlaludibawakeRSVitaInsani. Kondisi sepedamotor korban terlihat ringsek di bagian depan, begitu juga beberapabagiandarisepedamotoriniikut

pecah. Sementara kondisi Honda Jazz mengalamikerusakandibagiandepan. IbukorbanNbrSianturi,ditemuidiRSVita Insani,Kamissoremenyebutkan,anaknya hendak ke tempat kawannya di Jalan Ade Irma.Suaminyamerupakanpersonelpolisi yang bertugas di Polsek Tanah Jawa. “Tadi yangmenabrakjugasudahdatangkemari, diajugapolisidiPolresSimalungun.Suami sayajugapolisidiPolsekTanahJawa.Anak saya tidak mengalami luka parah, cuma

pinggangnyamemangmasihsakitdanjuga adayangsakitdipahanya,”jelaswanitayang ditaksirberusia40tahunanini. Kanit Laka Polres Siantar Iptu Sugeng Wahyudi membenarkan kecelakaan lalu lintasini.Didugapengendarasepedamotor tidakdapatmengendalikankenderaannya saat menikung sehingga tergelincir dan menabrak depan Honda Jazz. Kedua kenderaan telah diamankan untuk kepentinganpenyelidikan.(ral/dro)

Dua Kali Sukses Ketiga Kali Gol

Honda Jazz Milik Polisi Ditabrak Anak Polisi

Sambungan Halaman 8 Sembiring,SiantarMartoba. Informasi dihimpun METRO, sepedamotor Honda Astrea Grand tanpa plat yang dikemudikan korban melaju dengankecepatantinggidariarahPertamina menujuPasarParluasan.Tibadilokasiyang berupajalanmenikung,korbantidakdapat mengendalikan kenderaannya dan langsungmenabrakHondaJazzsilveryang

Bibir Calon Pengantin ‘Koyak‘ Tiga Jahitan

Sambungan Halaman 8 langsung pada Jumat 8 Juni 2012, sekira pukul22.00WIB.Saatitu,RosintanSinaga baru tiga hari di rumah calon mertuanya. Namun kembali diungkap dalam persidangan yang dipimpin Hakim Ramses Pasaribu beranggotakan Siti Hajar dan Monalisa di Pengadilan Negeri (PN) Simalungun, Kamis (27/9). Saat itu, jaksa penuntut umum (JPU) Amardi Barus menghadirkansaksikorbanRosintanSinagabersamasuaminyaDahlanSimanjuntak (26). “Saat itu Jumat (8/6) malam, sekira pukul 22.00 WIB, saya mendengar suara lemparanbatumengenaiataprumahcalon mertua. Kaki saya juga terkena lemparan

batu yang masuk dari jendela. Akhirnya, sayamemilihkeluardanmencaritahusiapa yangmelemparnya,”sebutnya. Rosintan menerangkan, malam itu, ia juga mendengar suara sejumlah warga setempatsedangbernyanyimenggunakan alat musik gitar. Kemudian, ia memilih keluardanmelihatnya. Tiba-tibasetelahdualangkahdaripintu rumahtersebut,adaseorangpriayangsama sekali tidak ia kenal memukulkan kayu bakar dan mengenai bibirnya. “Saat itu, kondisidiluarremang-remang.Priayang saya sendiri tidak kenal langsung melayangkan kayu ke arah saya dan bibir saya langsung mengeluarkan darah yang banyak.Saatitu,sayatidakbisaberbuatapa-

apa dan memilih masuk rumah,” terang wanitayangtengahhamiltersebut. Masih kata Rosintan, kemudian calon suaminyadankeluargamerekalangsung melarikannya ke Puskesmas Tiga Dolok untuk menjalani perobatan. “Saya tidak tahu apa penyebabnya karena baru tiga hari di sana, untuk keperluan pesta pernikahankami,”sebutnyasingkat. Sementara itu, suami korban Dahlan menyebutkan,malamitu,sebelumkejadian ia mengaku sedang bernyanyi di depan rumahnya menggunakan gitar dengan pemudasetempat.“Malamitu,kamisedang nyanyimenggunakangitar.Kemudianistri terdakwamemakimereka;‘woi,kaliangak bisa diam? Hu pamate ma hamu sude

Xenia BK 1042 KC, Mobil Siapa Ini? Sambungan Halaman 8 XeniayangmelajudariarahSiantarmenuju Perdaganganmenabrakpohondipinggir jalan. Polisikemudianlangsungmenujulokasi gunamelakukanolahTKP(TempatKejadian Perkara). Sampainya di sana, tak satupun petugas menemukan korban di lokasi kejadian, yang terlihat hanya beberapawargadanpengendarayangmelintasi TKP.Ketepatanmalamitu,menurutsejumlah warga, cuaca buruk dengan kondisi hujanderas. Walau demikian, petugas tetap mem-

Toko Jawa Dibobol Maling

Sambungan Halaman 8 Informasidihimpun,kejadianitudiketahuikorbanSukardi,saathendakmembuka toko pada Rabu (26/9), sekira pukul 04.30 WIB.Namuniaterkejutketikamelihatada bekascongkelanditokonya.Setelahdicek, rokokdariberbagaimerkraib.Diperkirakan kerugiankorban mencapaiRp30juta. Trimo, anak Sukardi pun melaporkan kejadian itu ke Mapolsek Bandar. Polisi yangmenerimalaporanitu. KepadaMETROKamis(27/9),Sukardi mengatakan, tetangganya ada yang sempat melihat mobil Toyota Avanza warna hitamparkirdisekitarTokoJawaitu,pada Selasa (25/9), malam, sekira pukul 01.30

WIB.Namun,tetangganyaitusamasekali tidak menaruh curiga, kemudian melanjutkantidur. MemangkataSukardi,setiapmalamia tidak tinggal di toko tersebut melainkan tinggalbersamaanaknyaTrimo(33)diToko Mokas yang beralamat di Jalan Merdeka, Keluruhan Perdagangan III, Kecamatan Bandar. Jadi setiap sore, setelah selesai berjualan, Sukardi selalu menggembok tokonya pakai 7 gembok sekaligus, antara lain5gembokuntukbagianluardan2untuk bagiandalam. KanitReskrimPolsekPerdaganganIpda DSiraitketikadikonfirmasi,membenarkan adanyalaporanSukardiyangmengalami kebongkaranditokonya.(mag-4/dro)

Gara-gara Dahan Rambutan..

Sambungan Halaman 8 danSilviaNingsih. ParulianbrPardede,korbanyangdihadirkan jaksa Viktor Situmorang menceritakan,saatituhariSelasa5Juni2012,sekira pukul18.00WIB.Diamengakubarupulang melayat, orangtuanya meninggal dunia. “Kemudian saya menyempatkan diri memberi makan ternak di belakang rumah,”kenangkorban. Dia menerangkan, saat memberikan makan ternak babi tersebut ia merasa suasana berbeda di sekitar rumahnya. Setelah diperhatikan, ternyata dahan pohon rambutan yang saat itu tengah berbuah lebat sudah dipotong terdakwa. “Saat itu, pohon rambutan saya tengah berbuah lebat, tapi sebagian dahannya sudah dipotong oleh terdakwa. Memang duluterdakwapernahmemintasayauntuk menebangpohontersebut,”akunya. Lanjut saksi korban, setelah berada di teras rumahnya ia melihat istri terdakwa

Klarasedangdudukdisebelahrumahnya. Saat itu, ia pun memanggil istri terdakwa untuk mempertanyakan maksud pohon rambutanmiliknyadipotong.“Setelahitu, suaminyalangsungdatangdanmengaku sebelumnyadiasudahmemperingatisaya supayadahanpohonrambutanyangmengenaisengrumahnyaditebang.Memang sayasendiritidakmengaminipermintaan tersebut,”ujarnya. Menurutdia,tidakbeberapalamakemudian terdakwa langsung mengambil air paritdaridepanrumahnyadanmenyiramkan kepada dirinya. Akhirnya air parit tersebutmembasahitubuhkorban.Akibat perbuatan terdakwa tersebut, ia pun melaporkan terdakwa ke Polsek Bangun. “Usaikejadianitu,diatidakmaumeminta maaf kepada saya hingga saya kesal dan melaporkanperkarainikeproseshukum. Tapisetelahterdakwaditangkapdanditahan, ia langsung mendatangi saya dan meminta maaf,” sebut korban singkat. (mua/dro)

Biaya Anak Mendesak..

Sambungan Halaman 8

(kumatikanlah nanti kalian semua),” ujar Dahlanmenirukanperkataanistriterdakwa. Tak berapa lama kemudian, terdakwa keluar bersama anak dan istrinya sambil memegangkayubakar.Saatitu,ialangsung laridanterdakwamengejar-ngejarmereka. Tak diduga istri yang dinikahinya pada Sabtu 23 Juni 2012, tersebut keluar dan langsung terkena getahnya. Bibir wanita yang kini sudah ia nikahi itu terluka tiga jahitandipukulterdakwa. Usai mendengarkan keterangan saksi, hakim menyarankan agar keluarga terdakwadankeluargakorbanberdamai. Apalagi jarak rumah mereka hanya dua meter dan berharap agar permasalahan merekajanganberlarut-larut.(mua/dro)

bawa mobil itu ke Mapolsek Bangun. Selanjutnya,petugasmengecekbeberapa rumah sakit terdekat guna mencari keberadaan identitas penumpang mobil naas itu.Namudaribeberaparumahsakityang dikunjungi petugas, mereka tidak menemukanseorangpunkobanlakalantas. Sementara di Mapolsek Bangun juga tidakseorangpunadawargayangmengaku mengalami kecelakaan dan atau sebagai pemilikmobilnaasitusampaiKamis(27/ 9),sekirapukul14.00WIB.Dugaansementara,mobilitudirentaldandisengajaditinggalkorbansetelahmenabrakpohon.(mag4/dro)

KepadaMETRO,Misdimengaku,terpaksamencuriakibatdesakankeperluanbiaya sekolahkeduaanaknya.Sebabbeberapahari terakhir, cuaca hujan, sehingga penghasilannya dari menjual es tidak mencukupi. “Saya pedagang es keliling. Karena cuaca musimhujan,dagangansayapuntidaklaku. Sementara kebutuhan keluarga dan biaya sekolah kedua anak sudah mendesak, makanyasayaterpaksamencuri,”ujarnya. Ia mengaku, aksi pencurian itu tidak dia rencanakan,dantiba-tibaniatmencurikarena desakankeperluanuang.Priakelahiran5Mei 1976ini,mengakubarupertamakalimencuri, namunlangsungtepergoksatpam.“Bukan niat mencuri, tapi karena desakan biaya sekolah anak-anak saja,” ucapnya sambil

menunduk. Supianto, Securiti Kebun PT Brigestone mengatakan, pelaku tertangkap tangan setelahberhasilmemanen25kilogramgetah lumb dari pohon karet. Belum sempat membawakeluarhasilcuriannyaitu,pelaku berhasil diamankan saat sedang masih memanengetahdiAfdelinD. Daritanganpelakudiamankan25kilogram getahlumb,dansepedamotorHondaRevo BK 4402 TAD. Kemudian pelaku bersama barang bukti diserahkan ke Mapolres Simalungun,untukdiprosessesuaihukum yangberlaku. Kasubag Humas Simalungun AKP H Panggabeanmembenarkantelahmenerima pelakudaripihaksecuritiKebunPTBrigestone bersama barang bukti getah dan sepedamotor.(osi/dro)

Sambungan Halaman Satu Dijunpbi Ituri, Supbnyb Subni Sbnb WbniubLbin Sambungan Halaman 1 Nurleli yang sudah dinikahinya sejak tiga tahun lalu. Setelah disumpah, korban pun menceritakan kronologis kejadian yang dialami pada Selasa (3/ 7) sekira pukul 15.00 WIB. “Saat itu saya berniat untuk menjumpai suami saya di pembangunan Perumahan PT Torganda milik DL Sitorus di Jalan Kartini Kelurahan Perdagangan I Kecamatan Bandar. Tujuan kedatangan saya ingin mempertemukan anak kami kepada suami saya yang bekerja di sana sebagai security,” sebutnya. Dia menerangkan, saat itu putra pertama mereka sedang sakit dan ingin bertemu dengan ayahnya. Dengan harapan besar, dia pergi menjumpai suaminya. Akan tetapi setibanya di depan rumah suaminya, terdakwa langsung bergegas masuk dan langsung menutup dan mengunci pintu kamarnya. “Saya lihat dia langsung buru-buru mengunci pintu kamar. Melihat itu saya pun memilih untuk masuk lewat jendela kamar. Saat itu saya langsung melihat ada seorang wanita yang sama sekali tidak saya kenal sedang tidur-tiduran dalam kamar suami saya,” sebutnya sambil mengeluarkan air mata. Dia menambahkan, melihat wanita itu, dia mulai emosi dan memaksa agar wanita itu keluar dari dalam kamar suaminya. Tapi bukannya dia keluar, justru suaminya menarik tangannya secara paksa hingga dia terjatuh. Tidak hanya itu, dia juga diseret hingga tangannya luka-luka. “Setelah itu, suami saya pernah cerita lewat telepon dia akan menikahi perempuan itu usai Lebaran. Kami sering cek-cok, tapi keluarganya tidak pernah mau datang dan mengaku tidak akan pernah mau datang lagi,” ujarnya sambil menangis terisak. Sambil berlinangan air mata, Suci Nurleli menyebutkan tidak ingin lagi hidup bersama suaminya tersebut. Dia sudah menyimpan dendam terhadap terdakwa yang sejak dulu selalu dia doakan agar berubah. Sementara itu, terdakwa Ramadona Sinaga membenarkan wanita idaman lain tersebut dan bernama Yenny Asri. Rencananya ia akan menggugat cerai istrinya di Pengadilan Agama. (mua)

Kanit PPA Ancam Wartawan Sambungan Halaman 1 Sekitar pukul 14.30 WIB, wartawan METR0 Ikrar Amin Lubis diminta Akbar Harahap dari wartawan Simantab News melalui telepon seluler untuk datang ke ruangan Ka BO Reskrim Iptu Asmon Bufitra, terkait berita penggrebekan sabung ayam yang terbit di METRO pada Kamis (27/9). Setelah berbincang dan berada di ruangan Ka BO Reskrim selama 30 menit atau sekitar pukul 15.00 WIB, tidak lama kemudian datang Kanit PPA Aiptu Malon Siagian dan langsung duduk di kursi yang ada di ruangan itu. Aiptu Malon langsung mengatakan, “Inilah wartawan kemarin itu yang menyebutkan aku terimauangRp50jutadaridokterhewanitu.SiLubis ini tidak benar ini. Kapanlah kau tidak silaf, kubuat kau nanti seperti si Andi sama Kapolres Fatori itu, sampai menyembah dia minta tolong. Pasti ada salahmunanti,kautungguaja.Pastiadawaktunya, sampaimenyembahkaukubikin,takkanmauaku,” jelasnya berwajah sinis sambil menunjuk-nunjuk tangan ke arah METRO. Dankata-kataitudiulangAiptuMalonbeberapa kali di ruangan saat itu. Sementara di dalam ruangan saat itu ada Kanit Tipikor Iptu Lengkap Siregar, Ka B0 Reskrim Iptu Asmon Bufitra, wartawan Simantab News Akbar Harahap dan Ketua KBPP Kota Siantar Tagor Mulia Harahap.

“Hanyadiainiyangmembuatberitaitukemarin. Dia bilang saya terima uang Rp50 juta. Ada si Jufri dari 24 jam, dia juga menelpon saya, saya bilang saja uang itu segini saya terima uang itu dari bapak si Ananta, buatlah beritanya kalau mau kau buat. KubilangbegitusamasiJufriitu,”ujarMalonmarahmarah sembari menunjukkan lima jari tangannya kedepan. Malon pun tak mau berjabat tangan saat METRO permisi pulang dari ruangan Ka BO Reskrim itu. Sementara polisi lain tetap mau berjabat tangan dengan METRO. KapolresSiantarAKBPAlberdTBSianipardihubungi melalui pesan pendek menyebutkan, akan mencek kepada anggota dimaksud terkait ini. “Saya akan cek kepada anggota dimaksud,” jelasnya melalui pesan pendek. Tidak lama kemudian Kapolres kembali mengirimkan pesan pendek mempertanyakan identitas wartawan yang konfirmasi kepadanya. LaluMETROmenjelaskanidentitasduawartawan yang ada di dalam ruangan saat itu dan juga beberapa identitas wartawan lain yang konfirmasi terkait kasus ini. PadaberitayangdimaksudAiptuMalonSiagian, Iskandar (33), dokter hewan di Dinas Perikanan dan Peternakan Simalungun, yang mencabuli siswa SMP berinisial AG (12) ‘dilepaskan’ Unit PPA Polres Siantar, Jumat (21/9) pukul 20.00 WIB. Dikabarkan dokter ini membayar Rp50 juta untuk

bisakeluardariruangtahanansementaratersebut. Setelah ditangkap Rabu (12/9) pukul 20.00 WIB, Iskandar langsung dijebloskan ke ruang tahanan sementara Polres Siantar. Iskandar sempat mendekamsembilanharidiruangtahananPolres. Beberapa tahanan yang diwawancarai dari luar di ruang tahanan sementara Polres Siantar sekitar pukul 15.00 WIB, Sabtu (22/9) menyebutkan, dokter Iskandar dibawa keluar dari ruang tahanan sementara Polres Siantar Jumat malam sekitar pukul 20.00 WIB. Beberapa tahanan ini diwawancarai saat berdiri di depan pintu masuk ke ruang tahanan sementara itu. “Udah dibawa tadi malam Bang. Dibawa ke MedankatanyaBang,sudahtidakdisinilagidokter itu. Dokter itu kan kasus cabul sama anak SMP itu, yang kasus Lusi kan Bang,” ujar tahanan berbaju hijau. Beberapa tahanan lain juga menimpali, dokterIskandartelahdibawakeluar,termasukpara tahanan wanita yang ada di ruang tahanan sementara Polres Siantar. Tidak lama kemudian, para tahanan ini ditegur petugas yang ada di sana untuk tidak berbicara lagi. Kanit PPA Polres Siantar Aiptu Malon Siagian dihubungi melalui telepon selulernya terkesan memberikan keterangan tidak jelas terkait dilepasnya dokter ini. Dia malah balik bertanya kepada METRO terkait sumber informasi yang menyebutkan dokter hewan Iskandar telah

dilepaskan. “Dari mana kau tahu, dari mana informasinya. Siapa yang menyebutkan, masih ada dia ditahan itu. Masih ada di ruang tahanan sementara dia,” ujarnyasekitarpukul13.30WIBmelaluiteleponseluler. Tidak lama kemudian telepon selulernya mati. Baik Kanit PPA Aiptu Malon Siagian maupun Kasat Reskrim saat itu AKP Azharudin belum memberikan keterangan yang jelas terkait dilepasnya dokter ini. Keduanya tidak kunjung memberikan jawaban terkait dilepasnya dokter hewan Iskandar. Kanit PPA Aiptu Malon Siagian juga tidak kunjung memberikan jawaban tentang dugaan uang Rp50 juta tersebut. Sebelumnya, dokter Iskandar mencabuli siswa kelas I SMP berinisial AG (12) di lantai II Gedung Bimbingan Belajar GO di Jalan Sudirman Siantar, Rabu (12/9) pukul 16.30 WIB lalu. Dokter ini sempat memeluk dan mengelus kedua paha korban. Disebabkan perlakuan tak senonoh ini, korban lalu berontak sehingga terlepas dari tangan tersangka. Selanjutnnya korban membuka kamar mandidankeluar.KorbanlaluberlarikelantaiIdan memberitahukan hal itu kepada temantemannya. Kemudian teman-temannya ini menghubungi orangtua korban melalui telepon seluler dan menceritakan kejadian yang baru saja dialami korban saat itu. Hingga pada akhirnya dokter dilaporkan kemudian ditangkap. (ral)

Iptu AB Tak Pernah ke Lokasi Penggerebekan Sambungan Halaman 1 uang kepada yang bersangkutan. “Sama yang ditangkap itu dan lokasi itupun saya tidak tahu. Saya tidak tahu dan tidak pernah ke lokasi itu,” jelasnya. Disebutkannya, terkait lima warga yang ditahan pasca penggerebekan judi sabung ayam itu, katanya masih diproses untuk penyelidikan lebih lanjut. Kelimanya masih berada di tahanan sementara Polres Siantar. Amatan METRO, 19 sepedamotor masih terlihat berada di depan ruangan Kanit Tipikor Iptu Lengkap Siregar. Kondisi kereta ini dirantai satu sama lain. Sementara itu, berkembang informasi, dari lima

warga yang ditahan ini, empat orang telah dilepaskan, hanya satu orang yang ditahan yaitu Mardongan Silaban yang diduga sebagai pemilik atau pengelola sabung ayam tersebut. Sementara empat warga yang telah dilepaskan itu antara lain Nelson Panjaitan,,Martahan Rajagukguk, Pandapotan Panjaitan dan Ronal Pangaribuan. Diberitakan sebelumnya, arena judi sabung ayam di Jalan Kabanjahe, Kelurahan Kristen, Siantar Selatan, digerebek polisi, Rabu (26/9) pukul 15.30 WIB. Warga sekitar lokasi ini mengaku kaget atas penggerebekan itu, karena selama ini mereka mengetahui bahwa arena judi itu dibekingi seorang oknum perwira polisi di Polresta Siantar. Dari lokasi ini, polisi menyita 19 unit sepedamo-

tor, sembilan ekor ayam, satu jam dinding, 13 unit telepon seluler, serta mengamankan lima warga yang berada di sekitar lokasi. Lima warga yang diamankan adalah Mardongan Silaban, Nelson Panjaitan, Martahan Rajagukguk, Pandapotan Panjaitan dan Ronal Pangaribuan. Anehnya, judi sabung ayam ini telah beroperasi selama setahun dan selama ini diduga dibekingi Ka BO Reskrim Iptu AB. Menurut keterangan sejumlah warga yang tinggal di sekitar lokasi judi sabung ayam dan meminta namanya tidak dituliskan, mereka mengaku kaget saat melihat polisi melakukan penggerebekan judi sabung ayam yang sudah berjalan setahun belakangan di kampung itu. Sebab, menurut informasi yang mereka dengar,

setiap ada kegiatan judi sabung ayam, pemilik judi sabung ayam Mardongan Silaban, warga setempat, selalu menyetor Rp400 ribu kepada oknum polisi yang bertugas di Polres Siantar ini. Ka BO Reskrim Iptu AB ketika dihubungi melalui telepon selulernya sekira pukul 17.30 WIB menyebutkan, tudingan warga ini tidak benar dan dia menilai mereka hanya mengarang disebabkan mereka ditangkap. Saat kembali ditanya tentang tudingan warga bahwa AB selalu datang meminta setoran dengan mengendarai Avanza hitam BK 1098 WD miliknya, AB juga membantah. “Bilang sama warga itu, ngarang mereka itu. Karena mereka ditangkap, makanya mereka bilang seperti itu. Tidak ada itu, ngarang itu,” ujarnya. (ral)




DUA KALI SUKSES KETIGA KALI GOL SIANTAR- Remaja putus sekolah JT (14), ditangkap saat hendak mencuri di rumah Alfin Irwansyah (22), warga Jalan Toba I, Kelurahan Kristen, Kecamatan Siantar Selatan, Kamis (27/9), sekira pukul 17.00 WIB. Ternyata aksi itu untuk yang ketiga kalinya dilakukan JT, aksi pertama dan kedua juga di rumah korban berjalan mulus. Informasi dihimpun, JT tinggal bersama orangtuanya di Jalan Bahagia, Kelurahan Kristen, Kecamatan Siantar Selatan. Saat itu, JT dengan cara mengendap-endap masuk ke pekarangan rumah korban. Lalu, dia menuju kamar belakang dan berusaha membuka pintu belakang rumah korban. „ Julian Tobing

Diculik di Rambung Merah Murid SD Nyaris Diperkosa AKSI TERSANGKA DIGAGALKAN WARGA DI TANAH JAWA TANAH JAWA- Seorang murid SD sebut saja Melati (9) nyaris saja kehilangan kesuciannya. Kalau bukan karena dipergoki warga, bocah yang diculik dari Rambung Merah, Kecamatan Siantar, ini hampir saja jadi objek pemuas nafsu pedagang sayur Rudi Saputra Nasution (39), di kebun sawit milik marga Silalahi di Tanah Jawa, Kamis (27/9) sekira pukul 12.00 WIB. Informasi dihimpun, siang itu, tersangka yang belakangan diketahui warga Jalan Suluk, Kelurahan Mutiara, Kecamatan Kisaran Barat, Asahan, mengendarai sepedamotornya di daerah


DIINTEROGASITersangka Rudy Saputra Nasution (tengah), diinterogasi Kanit Intel AKP Gandi Hutagaol di Mapolsekta Tanah Jawa, Kamis (27/9) sore.

Rambung Merah. Tiba-tiba, ia melihat korban turun dari angkot (angkutan kota, red). Selanjutnya, tersangka menghampiri

„) Baca Diculik ..Hal 7

„) Baca Dua Kali ..Hal 7

Xenia BK 1042 KC, Mobil Siapa Ini? Biaya Anak Mendesak CITRA HUTA CINTA DAME TERNODA DITEMUKAN DI SIMPANG ‘BM’ Tukang Es Curi Getah Gara-gara Dahan Rambutan Tetangga Disiram Air parit SIMALUNGUN– Terdakwa Morlan Sitorus (45) menyiram air selokan ke wajah Parulian br Pardede, tetangganya di Huta Cinta Dame I, Nagori Bah Jambi II, Kecamatan Tanah Jawa, Simalungun. Morlan tidak terima ditegur karena memotong dahan pohon rambutan milik korban yang mengenai atap seng rumahnya. Tapi terlepas dari

motif itu, ulah Morlan ini membuat citra Huta Cinta Dame ternoda. Perselisihan ini terungkap di persidangan yang digelar di Pengadilan Negeri (PN) Simalungun, Kamis (27/9), dengan agenda keterangan saksi korban. Sidang dipimpin Monalisa beranggotakan Siti Hajar

„) Baca Gara-gara ..Hal 7

BUKIT MARAJA- Polisi mengamankan mobil Xenia BK 1042 KC dengan kondisi rusak berat di simpang ‘BM’ (maksudnya: Simpang lokalisasi Bukit Maraja), Selasa (25/9), sekira pukul 20.00 WIB. Namun saat diamankan polisi tidak menemukan seorang pun penumpang mobil naas itu di lokasi. Keterangan dihimpun, petugas Satlantas Polsek Bangun malam itu, mendapat informasi bahwa terjadi laka tunggal di Simpang ‘BM’, satu unit mobil

SERBELAWAN- Misdi (36), warga Parluasan Barat, Kelurahan Serbelawan, Kecamatan Dolok Batu Nanggar, Simalungun, tertangkap tangan mencuri getah lumb (getah kering, red) di Afdeling D Kebun PT Brigestone, Kamis (27/9), sekira pukul 06.30 WIB. Dia ditangkap securiti (satpam) Kebun PT Brigestone saat sedang melakukan aksinya, menuangkan getah dari pohon karet ke goni plastik.


„ Kondisi mobil Xenia yang rinsek berat setelah diamankan petugas Satlantas Polsek Bangun, Kamis (27/9).

„) Baca Xenia ..Hal 7

TOKO JAWA DIBOBOL MALING BANDAR- Toko Jawa, salahsatu kedai kelontong di Jalan Sandang Pangan Nomor 49, Kelurahan Perdagangan III, Kecamatan Bandar, dibobol maling, Rabu (26/9), sekira pukul

04.30 WIB. Setelah dicek, korban kehilangan rokok berbagai merk dengan total kerugian mencapai Rp30 juta.

„) Baca Toko ..Hal 7

„ Misdi

„) Baca Biaya ..Hal 7

HONDA JAZZ MILIK POLISI DITABRAK ANAK POLISI SIANTAR- Jhonlisher Panjaitan (23), anak polisi yang bertugas di Polsek Tanah Jawa menabrak Honda Jazz silver BK 79 W milik Bripka Jepta Sitanggang, personel polisi Polres Simalungun di Jalan Ade Irma, Kamis (27/9), sekira pukul 11.00 WIB. Akibatnya korban terpaksa dirawat di RS Vita Insani. Jhonliser merupakan warga Lapangan Bola Bawah, Kecamatan Siantar Selatan. Sementara Bripka Jepta Sitanggang merupakan warga Jalan Rakutta

„) Baca Honda ..Hal 7


„ Jhonlisher Panjaitan, dirawat di RS Vita Insani.


Bibir Calon Pengantin ‘Koyak‘ Tiga Jahitan DOLOK PANRIBUAN– Rosintan Sinaga (25), mengalami cacat seumur hidup. Bibirnya yang dulu merah merona ‘koyak’ (terluka, red) setelah dipukul pakai kayu bakar oleh Jusen Damanik (52), tetangga

calon mertuanya di Dusun Silima Puluh, Nagori Dolok, Kecamatan Dolok Panribuan, Simalungun. Kejadian ini sebenarnya ber-

„) Baca Bibir ..Hal 7


28 September 2012

BNN Tes Urin Anak Sekolah SIANTAR- Sebagai wujud Kota Pematangsiantar terhindar dari penyalahgunaan narkoba, Badan Narkotika Nasional (BNN) melakukan sosialisasi hingga ke tes urin di beberapa sekolah, termasuk pegawai di instansi pemerintah dan swasta. Dalam jadwal kegiatan yang dilaksanakan sejak 3 September lalu itu, BNN telah mengunjungi beberapa

Baca BNN ... Hal 10


Edo, Pengawas PTPN III Kebun Bangun, menunjukkan pohon karet yang tumbang akibat puting beliung, Kamis (27/9).

Stop Galian C Pakai Alat Berat PERDAGANGAN- Pemerhati lingkungan yang tergabung dalam Asosiasi Pecinta Lingkungan (APL) Simalungun mendesak Pemkab Simalungun menghentikan aktifitas galian C menggunakan alat berat di Perdagangan. Sebab pengerukan aliran Bah Bolon itu dinilai akan merusak lingkungan. Ditemui METRO, Kamis (27/9), Ketua APL Hendra Pohan mengatakan, pihaknya mengancam akan melakukan aksi longmarch di sekitaran komplek SKPD di Raya. Tak hanya itu, mereka juga akan berorasi di kantor Bupati Simalungun, meminta galian C ini dihentikan. Ditambahkannya, APL juga mempertanyakan kinerja Badan Pelayanan Perizinan Terpadu (BPPT) Pemkab

Simalungun yang terkesan membiarkan saja aksi pengerukan pasir sungai itu. Padahal, pengerukan itu jelas-jelas membahayakan masyarakat sekitar. “Saya miris jika melihat lemahnya pengawasan pemerintah terhadap pengusaha galian C ini. Kami juga sudah lama memantau aktifitas galian C di Perdagangan ini. Mereka itu sudah


Baca Stop ... Hal 10

Galian C menggunakan alat berat masih saja bebas beroperasi di Perdagangan, tepatnya di aliran Bah Bolon, Kecamatan Bandar, Simalungun.

Nagori Siatasan Belum Dialiri Listrik

Puting Beliung di Gunung Malela

Atap Rumah Terbang, Ratusan Pohon Tumbang SIMALUNGUN- Akibat angin puting beliung yang disertai hujan deras, sedikitnya 150 pohon karet yang berada di Kebun Bangun, dan pohon kayu di sekitar pemukiman warga Afdeling I PTPN III Kecamatan Gunung Malela, Simalungun, tumbang. Tak ha-

nya itu, seng pada kediaman warga juga ikut beterbangan, Selasa (25/9) sekira pukul 22.00 WIB. ”Banyak seng rumah terbang, bahkan berkisar 150 pohon karet ikut tumbang. Lo-

Baca Atap ... Hal 10

Seputar Kios Tak Berizin di Jalan Vihara

Penegak Hukum Jangan Diam SIANTAR- Adanya transaksi sewa menyewa tanah milik negara tanpa izin, merupakan tindakan melawan hukum. Penegak hukum sudah seharusnya bertindak, mengingat Satpol PP terkesan tak melaksanakan tugasnya untuk menertibkan bangunan liar di

Jalan Vihara. Hal itu dikatakan Ketua Forum Komunikasi Simalungun Indonesia (FKSI) Daud Purba SH, Kamis (27/9). Ia menegaskan, keberadaan kios di Jalan Vihara perlu diperjelas

Baca Penegak...Hal 10


RUSAK- Kondisi jalan yang rusak parah menuju Nagori Huta Raja. Satu unit mobil anak rantau yang pulang kampung terlihat ekstra hati-hati melalui jalan tersebut. SIMALUNGUN- Walau sudah beberapa kali dibahas pada musyawarah rencana pembangunan (musrembang) tingkat nagori, kecamatan, dan kabupaten, perbaikan jalan rusak menuju Nagori Huta Raja, Kecamatan Purba, Simalungun, tidak pernah terealisasi. Jalan sepanjang kurang lebih 5 kilometer dari Jalan Besar Pamatang Purba ini menghubungkan huta ke

huta (dusun, red). Sudah 20 tahun digunakan warga dan masih tetap beralas tanah. Kondisinya pun rusak parah, lubang-lubang besar dan menganga terlihat di badan sepanjang jalan. Sepuluh tahun terakhir, kerusakan bertambah parah. Pasalnya, jalan ini dilalui truk-truk bermuatan

Baca Puluhan Tahun... Hal 10

Terima Gaji Rp400 Ribu Per Bulan

Kondisi Guru Honor Memprihatinkan

Rocky Marbun

SIANTAR- Sejumlah elemen masyarakat mengaku prihatin atas kondisi guru honor di Kota Siantar yang bergaji Rp400 ribu per bulan. Parahnya, gaji itu akan dipotong saat mereka tak masuk untuk mengajar dan saat hari libur nasional. Pemerintah dan DPRD seolah tidak peduli dengan kesejahteraan mereka. “Selain pemerintah, DPRD selaku wakil rakyat seharusnya meminimalisir persoalan di sektor pendidikan. Tapi, gejolak yang dirasakan para guru honor ini, hanya dianggap angin lalu saja,” sebut Ketua Tim Advokasi dan Investigasi Forum Komunikasi

Baca Nagori Siatasan ... Hal 10

Jumlah Wisudawan USI Naik 50 Persen SIANTAR- Sebanyak 1244 Mahasiswa baik S1 dan S2 Universitas Simalungun (USI) akan diwisuda di Auditorium Brigjen Radjamin Purba pada 18 Oktober 2012 mendatang. Jumlah itu mengalami peningkatan hingga 50 persen. Sebab pada tahun 2011, USI hanya mewisuda 760 sarjana. Dekan Fakultas Hukum yang juga Humas Panitia Wisudawan Januarison Saragih menjelaskan, mahasiswa yang paling banyak diwisuda pada tahun 2012, berasal dari Fakultas Ilmu Keguruan dan Pendidikan (FKIP), dengan berjumlah 585 mahasiswa. Sedangkan untuk fakultas hukum, hanya berjumlah 330 orang, fakultas Ekonomi 190 orang, fakultas pertanian 61 orang, dan fakultas teknik berjumlah 26 orang. Untuk jumlah mahasiswa S-2 berjumlah 52 orang. Dikatakan Januarison, untuk tahun berikutnya yang dimulai 2013,

Simalungun Indonesia, Rocky Marbun. Dikatakannya, pemberian gaji guru honor yang terkadang hanya Rp350 ribu itu, merupakan tindakan tidak berprikemanusiaan. Sebab apa yang telah diperbuat para guru honor untuk Kota

Baca Kondisi ...Hal 10

SIMALUNGUN- Ratusan penduduk yang menetap di Nagori Siatasan, Kecamatan Dolok Panribuan, Simalungun, mengeluh. Pasalnya hingga kini, mereka belum pernah menikmati penerangan menggunakan listrik. Kegelapan yang dialami warga Siatasan ini sebelumnya sudah berulangkali disampaikan ke Pemkab Simalungun melalui surat keluhan yang dilayangkan. Tetapi, sejauh ini belum ada kepastian dari pemerintah untuk membantu mereka mendapatkan penerangan. Padahal dusun yang berjarak lima kolometer dari jalan umum Siantar-Parapat ini, dihuni ratusan warga yang berprofesi sebagai petani kopi ateng, petani jagung, dan paragat tuak. Bahkan, banyak dari warga yang mengaku tidak mengenal acara televisi, karena belum bisa menikmatinya akibat ketiadaan listrik. “Setiap malam kami hanya bermodalkan lampu teplok dengan bahan bakar minyak

Januarison Saragih

Baca Jumlah... Hal 10

Pasar Tradisonal Kecamatan Belum Dibangun SIANTAR- Perencanaan Pembangunan Pasar Tradisional di beberapa kecamatan di Kota Siantar belum juga terealisasi. Padahal biaya pembangunannya sudah dianggarkan di APBD 2012 sebesar Rp2 miliar. Kepada METRO, Wakil Ketua DPRD Timbul Lingga SH menegaskan, pembangunan

Baca Pasar... Hal 10


28 September 2012

Nagori Siatasan... Sambungan Halaman 9 tanah. Tak pernah kami menonton televisi,” ujar warga sekitar Jumindar Sitinjak (46) dan Erikson Ambarita (35). Ditambahkan Erikson, di sekitar Nagori Siatasan juga sering terjadi kebakaran yang bersumber dari lampu teplok. Tenggat waktu setahun belakangan, sudah dua gubuk yang terbakar akibat disambar api dari lampu teplok. ”Kalau hanya gelap, kami sudah biasa. Yang kami takutkan, rumah kami terbakar. Sebab beberapa waktu lalu, gubuk milik warga bermarga Silaen, terbakar karena lampu teploknya disenggol kucing. Lalu pada April lalu, terjadi lagi kebakaran yang menghanguskan kediaman warga lain. Itu karena tanpa disadarinya, ia menggunakan minyak lampu oplosan. Setelah satu jam dinyalakan, api langsung membesar dan membakar dinding gubuk,” katanya. Dijelaskannya, warga yang tinggal di sekitar Dusun Siatasan bawah, saat ini sudah mulai membentuk kelompok. Mereka kompak membeli mesin genset berkapasitas kecil, yang hanya mampu menerangi beberapa rumah. Sementara warga yang tinggal di sekitar Dusun Siatasan atas, tidak mampu membeli mesin berharga puluhan juta itu. Saat ini masyarakat Siatasan hanya bisa berharap agar Pemkab Simalungun bersedia membantu warga dengan mengucurkan anggaran untuk kebutuhan jaringan listrik yang bertujuan mensejahterakan warga. (mag-02/hez)

Jumlah Wisudawan... Sambungan Halaman 9 pelaksanaan wisuda USI akan dilaksanakan dua kali. Itu karena jumlah mahasiswa yang akan diwisuda diperkirakan mencapai 2000 orang pada tahun mendatang. “Selama ini, wisuda hanya sekali setahun, tapi muali tahun depan, wisuda dilaksanakan dua kali. Itu sudah sesuai hasil kesepakatan rektorat, termasuk dekan,” sebut Januarison. Diterangkannya, pada acara wisuda tersebut, senat yang dihunjuk dalah Rektor USI yakni Drs Ulung Napitu Msi yang juga Ketua Senat USI. “Kita mengimbau supaya mahasiswa yang melangsungkan wisuda segera mendaftarkan diri ke sekretariat di fakultas masing-masing,” ujar Januarison. (pra/hez)

Pasar Tradisonal... Sambungan Halaman 9 pasar itu secepatnya dilaksanakan, mengingat masa anggaran tinggal beberapa bulan lagi. Diterangkannya, sebelumnya perencanaan pembangunan pasar tradisional untuk kecamatan ini sudah disetujui DPRD saat pengesahan APBD 2012. Tapi sampai saat ini, tepatnya September 2012, belum ada tandatanda pelaksanaan pembangunan. “Waktu itu direncanakan pembangannya di Kecamatan Siantar Selatan dan Siantar Marihat. Tapi itu semua kewenangan SKPD yang mengelola anggarannya, dalam hal ini adalah Disperindag,” ucap Timbul Lingga. Timbul yang juga Ketua DPC Partai PDI Perjuangan Kota Siantar ini juga menjelaskan, tujuan pembangunan pasar tradisonal itu adalah untuk membantu masyarakat mendapatkan kebutuhan hidup sehari-hari. Selain itu, dengan adanya pasar tradisional di kecamatan, akan meningkatkan pertumbuhan ekonomi. Sejauh ini percepatan pembangunan pasar tradisional ini sudah ditunggu-tunggu oleh masyarakat. Bahkan beberapa masyarakat sudah banyak menanyakannya ke DPRD. Terutama soal waktu realisasi pembangunan tersebut. Untuk itu kami mengimbau agar pemerintah, khususnya instansi yang dihunjuk sebagai pengelola, agar segera melaksanakan pembangunan pasar tradisional tersebut. Sementara Kadisperindag Agus Salam yang dikonfirmasi lewat pesan singat SMS, belum memberikan balasan. Nahkan saat dihubungi, Agus tidak mengangkat teleponnya. (pra/hez)

Stop Galian C Pakai Alat Berat Sambungan Halaman 9 mengeruk pasir berlebihan,” katanya. Dijelaskannya, akibat dari pengerukan itu, tepi sungai akan memiliki kedalaman berbebada dengan yang lain. Kondisi ini bisa membahayakan warga sekitar saat berkunjung ke tepi sungai Bahbolon. ”Kedalamannya jelas jauh berbeda dengan lokasi yang di sekitarnya. Jika ada anak-anak atau warga yang bermain di sekitar lokasi, tentunya

akan tenggelam. Sebab kerukan pasir ini sudah terlalu dalam,” katanya. Untuk itu, Pemkab Simalungun diminta tegas menyikapinya. Jika eksploitasi galian C ini terus berlangsung, dikhawatirkan berdampak pada rusaknya lingkungan. Kemudian air sungai bisa menjadi ancaman bagi masyarakat sekitar. ”Soalnya pasir yang mereka keruk akan habis di lokasi. Setelah itu mereka akan pindah ke lokasi lain,” jelasnya. Terpisah, beberapa warga Perdagangan

mengaku siap mendukung aksi APL untuk menyelamatkan lingkungan. Menurut salah seorang di antaranya, Usnul Sinaga (43), ia siap mendukung APL untuk mendesak Pemkab Simalungun menghentikan aktifitas galian C di Perdagangan ini. ”Kami sudah banyak dirugikan akibat keberadaan galian C menggunakan alat berat itu. Mereka memonopoli harga dagang pasir di Perdagangan dan sekitarnya. Kami secara perlahan-lahan menjadi tersisih,” katanya.

Atap Rumah Terbang

Penegak Hukum Jangan Diam

Sambungan Halaman 9

Sambungan Halaman 9 supaya masyarakat mengetahuinya. Sehingga suatu saat nanti, warga tidak terjebak dan protes apabila kiosnya dibongkar. Kepolisian maupun kejaksaan selaku penegak hukum di Kota Siantar, diminta supaya turun dan melakukan penyelidikan terhadap pelanggaran pidana yang terjadi. “Pembiaran pelanggaran hukum di Kota Siantar sangat jelas, akibatnya masyarakat tidak takut untuk bertindak, walaupun itu melanggar hukum,” sebut Daud. Ia juga mengatakan, pihaknya sudah menyusun laporan untuk melaporkan masalah ini ke polisi dan kejaksaan. Sebelumnya, Pihak Dinas Pasar dan PIT Kota Siantar sudah menyatakan bahwa bangunan kios di sekitar komplek pemakaman Mr X di Komplek RSUD dr Djasamen Saragih, tidak mempunyai izin. Oleh sebab itupula, Dinas Pasar sudah berulangkali menyurati Satpol PP untuk melakukan penertiban. Namun hingga kini proses pembangunan kios itu terus berlangsung. Bahkan menurut Karlos Sembiring, pedagang makanan di lokasi, saat ditemui, Kamis (27/9) siang mengatakan, untuk menempati dua tempat kios yang dipakainya untuk berjualan, ia sudah membayar uang sewa Rp2,5 juta. Uang itu diserahkannya kepada seseorang bermarga Barus. Anehnya, saat ditanya siapa nama oknum bermarga Barus itu, Karlos enggan menyebutkannya. Saat ditanya bagaiamana bila suatu saat


„ Sederetan lapak pedaganag tak berizin di Jalan Vihara Kelurahan Simalungun, Siantar Selatan, yang berdiri di atas tanah negara. pemerintah menanyakan izinnya, Karlos mengatakan, soal izin ia tidak mengetahuinya. Sebab dikatakannya, semuanya sudah ditangani oleh Dewi Ginting. “Dia (Dewi Ginting) itu pemborongnya, dia yang urus ini,” katanya. Sedang informasi lainnya, beberapa warga mengatakan bahwa lapak tersebut sudah ada yang memiliki. Bila seseorang hendak menggunakannya sebagai tempat berjualan, harus

membayar kepada orang yang mengaku sebagai pemilik lapak tersebut. Sementara besaran sewa lapak itu mencapai Rp400 ribu per bulan. Keberadaan kios itu juga menimbulkan polemik bagi petugas Instalasi Jenazah dan Kedokteran Forensik di sekitar lokasi. Pasalnya mereka tidak bisa lewat untuk membawa mayat Mr X yang akan di kebumikan di pemakaman Mr X. Itu akibat jalan mereka terhalang lapak kios yang didirikan di sana. (pra/hez)

BNN Tes Urin Anak Sekolah Sambungan Halaman 9 sekolah, seperti SMA Negeri 2, SMA Negeri 4, instansi swasta FIF, Kampus Sultan Agung dan Yayasan Perguruan Taman Siswa. Kepala BNN Ahmad Yani Damanik kepada METRO menerangkan, ada delapan sekolah setingkat SMU sedarajat, 3 perguruan tinggi, 6 instansi pemerintahan dan swasta, yang sudah mereka kunjungi. Sosialisasasi itu akan terus berjalan hingga akhir November 2012 mendatang. Ada tiga aspek yang dipaparkan setiap melakukan sosialisasi, yakni hukum, kesehatan, serta agama. Setelah dilakukan penjelasan, para peserta akan menjalani tes

atau ujian dari apa yang telah disampaikan. “Setelah mendapatkan pemaparan, peserta akan menjalani ujian untuk mengetahui sejauh mana materi yang diserapnya dari pemaparan itu,” kata Ahmad Yani. Untuk memenuhi kualifikasi, para peserta juga menjalani tes urin yang dilakukan tim dokter yang sudah disiapkan. Selanjutnya BNN memasang plang seruan untuk menjauhi narkoba di setiap sudut tempat yang sudah mendapatkan sosialisasi. Kemudian BNN juga menyerahkan sertifikat. Follow up dari sosialisasi itu, BNN menargetkan ada 1400 kader yang tersebar di sekolah dan juga instansi pemerintahan maupun swasta. Kader-kader itu akan

memberikan informasi yang jelas tentang bahaya narkoba baik di sekitar pekerjaannya, lingkungan kediamannya, termasuk juga di tengah-tengah keluarga. Dikatakan Ahmad Yani, pihaknya juga akan memberangkatkan setiap warga yang tersangkut penyalahgunaan narkoba ke rehalibitasi narkoba yang berada di Bogor. Ongkos dan biaya rehabilitasinya ditanggung oleh Negara. “Kemarin sudah memberangkatkan satu orang. Kita berharap agar masyarakat ikut membawa anggota keluarganya yang sudah kecanduan narkotika ke BNN Siantar. “Kita langsung kirim ke rehabilitasi di Bogor. Tidak akan dikenakan biaya!” serunya. (pra/hez)

Puluhan T ahun, Jalan Ini Dibiarkan Rusak Tahun, Sambungan Halaman 9 kayu balok dari hutan yang diduga illegal logging, meski sudah selesai beraktifitas. Hal itu dikatakan seorang warga Nagori Huta Raja, Madi Purba kepada koran ini Rabu (26/9) di Jalan Sisingamangaraja depan USI, sembari menujukkan foto kondisi jalan yang rusak parah tersebut. Anehnya, tambah Madi, di tengah-tengah keluhan masyarakat ini, aparat kecamatan tetap menagih pajak melalui izin mendirikan bangunan (IMB) rumah papan milik warga. Itupun tetap dibayarkan warga sebagai

kewajibannya menjadi warga negara yang baik.Ditambahkan oleh Purba, Nagori Huta Raja ini dihuni kurang lebih 250 kepala keluarga. Setiap harinya melalui jalan itu, keluar berton-ton hasil pertanian mereka, seperti sayur mayur, tomat, kentang cabai dan lain-lain. “Karena kerusakan jalan ini, jarak tempuh sepanjang 5 kilometer ditempuh dalam waktu 1 jam. Setiap ada perantau yang pulang kampung, selalu membawa mobil pribadi. Mereka pasti mengeluhkan kondisi jalan yang rusak parah ini,” katanya. Katanya, penyebab rusak parahnya jalan

Sensasi Goyang Siantar





** Menyuguhkan lagu-lagu Dangdut dan Daerah **

On-Air : 05.30 - 18.00 : Lagu Dangdut & India On-Air : 18.00 - 24.00 : Lagu Daerah

Kantor & Studio : Jl. A Yani No. 2-4 Pematangsiantar Sumut Telp Kantor : 0622 - 75 500 55 Fax: 7550968 Telp Studio : 0622 - 7551799; SMS 0821 6356 3000

Website : Email :

Sebelumnya Kepala BPPT Jon Suka Jaya Purba yang dikonfirmasi mengatakan, pihaknya belum ada mengeluarkan izin operasional galian C menggunakan alat berat untuk kawasan Perdagangan. Bahkan untuk mengeluarkan izin itu, BPPT harus berkoordinasi dengan Dinas Tarukim, guna menentukan kelayakan lokasi yang akan menjadi objek pengerukan pasir. Hal itu dimaksudkan agar dampak negatif pada alam dan lingkungan tidak terjadi. (mag-02/hez)

ini adalah, karena bebeapa tahun lalu selalu dilalui truk bermuatan kayu dengan berat antara 30ton sampai 40 ton. “Kami sangat kecewa dengan keadaan ini, padahal sudah berpuluh kali kami mengajukannnya untuk diperbaiki melalui musrenbang, namun sekalipun belum pernah tersentuh pembangunan,” ujarnya. “Kami hanya bisa berharap dan pasrah menunggu adanya kebijakan dari pejabatpejabat negara ini, agar segera merealisasikan pembangunan jalan antar huta tersebut. Itu semua demi kesejahteraan kaum tani di Nagori Huta Raja.” (mer)

kasinya berada di sepanjang Jalan Umum Siantar-Perdaganag Km13 sampai Km 15,” kata Edo Damanik, pengawas Kebun Bangun yang bertugas di Afdeling I, Kamis (27/9). Dikatakannya, kerusakan yang ditimbulkan bencana ini juga beragam. Mulai pohon yang miring, ranting dan batang yang patah, bahkan banyak pohon berukuran kecil dan besar yang tumbang. Beruntung tidak ada korban jiwa dalam peristiwa itu. Ditambahkan Edo, pihaknya sudah menurunkan tim untuk membersihkan bekas puting beliung, serta memberikan bantuan kepada masyarakat berupa ranting dan batang untuk dijadikan kayu bakar. Pihaknyajuga mengirimkan mobil truk untuk mengangkut batang pohon besar sebagai inventaris kebun. Warga lainnya, Kodo Subono (70), yang menetap di Nagori Senio Kecamatan Gunung Malela, Simalungun, menerangkan, selain diterpa angin puting beliung dan hujan lebat, pemukiman di sekitar kedidamannya juga terkena banjir. “Malam itu kami mendengar suara hempasan pohon yang tumbang. Tak itu saja, kampung kami jugakebanjiran,”ungkappriatuainikepadaMETRO sembari mengutip ranting pohon karet yang berserakan di areal Kebun Bangun. (mag-4/hez)

Kondisi Guru... Sambungan Halaman 9 Siantar ini, merupakan kebutuhan bagi Negara, yakni mencerdaskan anak bangsa. DPRD seyogianya memperjuangkan gaji guru sesuai dengan Upah Minimum Kota (UMK) Siantar sebesar Rp1,2 juta. Bahkan guru honor ini seharusnya pantas mendapatkan Rp1,5 juta per bulan. Sebab mereka tidak mendapatkan dana tunjangan, sertifikasi dan dana lain-lain yang diterima oleh PNS. “Aku tidak tahu apa pekerjaan DPRD ini, memperjuangan gaji guru honor saja tidak bisa. Tapi kalau biaya perjalanan dinas hingga ratusan juta, selalu didiamkan,” tambahnya. Rocky meyinggung keseharian guru-guru honor saat ini sangat memprihatinkan. Sebab gaji sebesar Rp400 ribu yang diterima mereka, diperkirakan hanya cukup untuk biaya transportasi. “Bila DPRD tidak bisa memperjuangkannya pada 2013, saya menilai DPRD gagal sebagai wakil rakyat,” tegasnya. Sementara Ketua DPK Siantar SRMI (Serikat Rakyat Miskin) Fransiskus Silalahi, ikut menegaskan bahwa DPRD tidak loyal terhadap tugasnya membela rakyat. “Dengan gaji Rp400 ribu, bukan lagi mengurangi kemiskinan. Tetapi menambah kemiskinan di Kota Siantar. Angka pendapatan Rp400 ribu merupakan golongan warga miskin,” sebut Fransiskus. Disebutkannya, status guru honor yang gajinya ditampung APBD, mestinya sesuai kelayakan hidup. Namun dengan gaji Rp 400 ribu, pemerintah seolah menganggap guru honor tidak ada nilainya. Dalam hal ini DPRD sebagai corong masyarakat tidak bisa diandalkan oleh masyarakat. (pra/hez)



28 September 2012

Ekspor Paha Kodok Sumut Tetap Eksis MEDAN-Ekspor paha kodok Sumatera Utara ke Belgia tetap eksis, bahkan nilai ekspornya tahun ini naik 8,37 persen menjadi 1,178 juta dolar AS. “Nilai ekspor paha kodok Sumut ke Belgia pada Januari-Agustus yang sebesar 1,178 juta dolar AS itu berasal dari pengiriman sebanyak 218,6 ton,”kata staf bidang Perdagangan Luar Negeri Dinas Perindustrian dan Perdagangan (Disperindag) Sumut, Fitra Kurnia, di Medan, baru-baru ini. Menurut dia, paha kodok itu termasuk salah satu golongan barang andalan ekspor Sumut dan yang masih tetap eksis di tengah terjadi krisis. Meskipun, kata dia, ekspor paha kodok itu sebelumnya sampai ke beberapa negara lainnya termasuk Singapura, dan China. Mengutip kata eksportir, Fitra mengatakan, pasokan kodok

untuk di ekspor semakin ketat karena faktor alam dan banyaknya permintaan di dalam negeri. Sekretaris Eksekutif Gabungan Perusahaan Ekspor Indonesia (GPEI) Sumut, Sofyan Subang mengatakan, paha kodok Sumut sudah lama menjadi salah satu golongan barang ekspor utama Sumut. Namun seperti hasil laut, ekspor paha kodok itu sering terganggu dengan faktor alam. Pesatnya perkembangan pembangunan, dewasa ini sudah menggangu ekosistem sehingga kodok dengan jenis tertentu yang biasanya untuk ekspor semakin sulit diperoleh.”Volume ekspor paha kodok semakin terganggu karena konsumsi di dalam negeri seperti di Sumut juga naik menyusul banyaknya restoran besar dan kecil yang menyajikan menu paha kodok itu,” katanya. (ant/nik)

Grand Vitara Facelift Kejutan Manis di Akhir Tahun JAKARTA- PT Suzuki Indomobil Sales (SIS) memamerkan Grand Vitara Facelift di ajang Indonesia International Motor Show (IIMS) 2012. Mobil tersebut dikabarkan akan segera diluncurkan di Indonesia dengan stasus CBU dari Jepang. Rumornya, Grand Vitara Facelift ini akan menjadi mobil pamungkas Suzuki di akhir tahun mendatang.”Selama IIMS ini, Grand Vitara Facelift banyak banget yang nanyain. Karena dari segi tampilan depannya berubah dengan yang sebelumnya,” kata Dimelza Sharin Public Relations Head PT Suzuki Indomobil Sales (SIS) di booth Suzuki di IIMS, Kamis (27/9). Menurut wanita yang akrab disapa Sharin, Suzuki Grand Vitara Facelift ini kemungkinan besar akan diiluncurkan tahun ini dan akan menjadi pamungkas Suzuki di 2012 dalam me-

„ Suzuki Grand Vitara.

Kamera Nikon D3200 Rp6 Juta JAKARTA-Nikon meluncurkan sejumlah kamera DSLR (Digital Single Lens Reflex) unggulan terbarunya. Deretan kamera Nikon lensatunggalterbaruiniantaralain seri D4, D800, D3200 ini siap beredar di pasar Indonesia. Produsen perangkat kamera asal Jepang ini menghadirkan produk andalan yang diperuntukkan bagi para profesional, fotografer serta hobi. Tiga kamera yang dirilis ini memiliki fitur serta spesifikasi masing-masing yang berbeda, tergantung dari kebutuhan penggunanya. Bersamaan dengan peresmian berdirinya gedung Nikon Team di kawasan Mangga Dua Square Jakarta, koordinator Nikon Team Johnny Hendarta memaparkan keunggulan kamera Nikon DSLR tersebut. Ia mengungkapkan bahwa kamera Nikon DSLR terbaru ini memiliki keunggulan masing-masing dengan banderol harga yang bervariasi. “Semakin tinggi spesifikasinya, jelas fasilitasnya makin tinggi. Selain itu bodinya lebih tangguh,” ujar Johnny di Jakarta, Rabu (26/9). Ia mengungkapkan, serangkaian kamera Nikon DSLR ini telah diluncurkandankinimulaiberedar di pasar Indonesia. Lebih lanjut ia menjelaskan bahwa umumnya orang memutuskan untuk membeli kamera Nikon DSLR dengan harga yang reasonable, yang didasari atas hobi dan kegemarannya terhadap bidang seni fotografi. Untuk seri D4 dan D800, memiliki fitur unggulan seperti modul

„ Kamera Nikon D3200

sensor Nikon Advanced MultiCAM 3500FX dengan TTL phase detection. Khusus D800, Advanced Multi-CAM ini juga diperkuat dengan AF-assist illuminator. Yang menarik dari Nikon D4, kamera ini dilengkapi dengan Live View photography yang dapat diatur ke mode silent. Sehingga, ketika melakukan pengambilan gambar, kamera ini tidak mengeluarkan suara sedikitpun. Selain itu, seri D4 yang memiliki total pixels Rp16,6 juta ini memiliki fitur mode release Single Frame, Continuous low speed, Continuous high speed, Quiet shutter-release, Self-timer serta MUP (Mirror Up). Sementara D800 memiliki totalpixel36,8jutasertamemilikifitur unggulan Dust-reduction system seperti image sensor cleaning dan kemampuan merekam video dengan format MOV. Untuk D3200, kamera ini memiliki total pixel 24,7 juta dan dilengkapi fitur Image sensor cleaning. Selain itu, sensitivitas ISO juga dapat diatur ke mode otomatis maupun manual (ISO 100 - 6400). Kamera Nikon terbaru ini juga mendukung konektiviras HiSpeed USB serta audio input Stereo mini-pin jack 3,5mm. Untuk daya baterai, Nikon mengandalkan Rechargeable Li-ion Battery EN-EL15/18/14. Johnny mengatakan, untuk banderol harga, kameramutakhiriniberadadikisaran range 60 juta-an. Sedangkan khusus seri Nikon D3200, dibanderol sekira 6 juta. (oz/nik)

luncurkan mobil.”Tunggu saja, yang pasti mobil ini akan menjadi pamungkas kami di 2012. Pokonya ada kejutan manis di akhir tahun nanti. Dengan adanya Grand Vitara Facelift ini semakin melengkapi varian Suzuki mulai dari komercial car maupun passanger car,” tambah Sharin sambil tersenyum. Lebih lanjut, karena Grand Vitara itu sudah tidak diproduksi lagi di Indonesia, maka nantinya akan diimport l;angsung dari Jepang. “ Nanti akan diimport langsung dari Jepang, karena untuk menjaga kualitas dan kuantitasnya,” tandasnya. (oz/nik)

„ Ketua Panitia menyanyikan lagu HUT, bersama Wakil Bupati Simalungun Nuriaty Damanik, dan Mewakili Walikota, DPRD Siantar, Dan Rindam I/BB, Dandim, pada peringatan HUT Ke-53 Tahun PEPABRI dan HUT Ke-5 Tahun GM FKPPI Ranting Khusus Setia Negara di Lapangan Mini Perumnas Rindam, Rabu (26/9).

Peringatan HUT ke-53 PEPABRI Diisi Pemberian Hadiah SIANTAR- Peringatan Hari Ulang Tahun (HUT) ke-53 Tahun Persatuan Purnawirawan, Warakauri TNI dan Polri (PEPABRI), PERIP, WARAKAURI dan HUT ke-5 GM FKPPI Ranting Khusus Setia Negara II dan IV, para anggota PEPABRI, PERIP, Warakauri dan GM FKPPI melaksanakan upacara nasional. Acara diisi pemberian hadiah kenang-kenangan kepada ibu-ibu PERIP dan Warakauri, serta pe-

motongan nasi tumpeng di Lapangan Mini Perumnas Rindam I/BB Pematangsiantar, Rabu (26/ 9). Sekretaris Panitia Helpiaro Lahagu mengatakan pihaknya menyambut baik acara tersebut, dan berjalan sukses. Dihadiri kaum bapak, ibu purnawirawan dengan wajah gembira. Dalam suasana haru, mereka bertemu dan mengenang semasa masih aktif di kemiliteran.

Sebelumnya, Ketua Panitia Kapten (Purn) Dulkarie Tiar mengatakan, Sabtu (22/9) para pensiunan, istri prajurit yang masih aktif, janda pensiunan dan pemuda-pemudi GM FKPPI beserta masyarakat sekitarnya melaksanakan gerak jalan santai. Even ini dalam rangka memeriahkan HUT ke 53 Tahun PEPABRI. Dilajutkan, ziarah bersama di Taman Makam Pahlawan Pematangsiantar, Senin (24/9)

Hadir dalam acara Ketua DPC PEPABRI Siantar-Simalungun Letkol (Purn) SY Marpaung, Ketua PERIP, WARAKAURI Letkol (Purn) JM Lumban Toruan Ranting Khusus Setia Negara II dan IV. Wakil Bupati Simalungun Nuriaty Damanik. Mewakili DAN RINDAM I/BB, Mewakili DANDIM 0207 Simalungun. Anggota DPRD Siantar, Mewakili Pemko Siantar Gunawan Purba, dan Camat. (rel)


J U M AT 28 September 2012




ACER E1 - 431

DP 0%

• Wifi • Intel Core B820 • Webcamera • 2 GB DDR3 • 14.1” HD LED Display • 320 GB HDD • Battery 6 cell • DVD Rw Super Multi

Cicilan Rp. 393.000,Syarat : Fotocopy KTP & Slip Gaji

FINACOM SOLUTION Jl. Patuan Anggi No. 21 Pematangsiantar Call: 0622 – 5891902, HP. 082161843444 / 082364464487


Jl. Jawa (Simpang Mayat) Pematangsiantar

HP 0813 7513 7016

Harga Mulai

Rp 15 Jt

Peluang Usaha

Mengadakan Segala Jenis Sparepart Depot Air Minum Ayo Buruan......................

• Depot Air Minum • RO & Mineral • Air Minum Dalam Kemasan (AMDK)


LAPTOP ACER , DELL , HP , COMPAQ , TOSHIBA , AXIOO dll (Bergaransi Resmi Nasional)


Tinta Printer Canon & Epson ( Beli 4 Gratis 1) Modem Gsm Flash, Xl,vodafone, Smartfren , Super Murah!! Printer Canon & Epson Tinta Infus Tabung Besar! Wowww!!!! Assesoris Komputer Dengan Harga Super Murah Kredit Komputer Dan Laptop (proses Cepat) Tanpa Dp !!!!!!!

Smart Computer

DIBUTUHKAN SEGERA Sebuah perusahaan yang bergerak dibidang pembiayaan Elektronik memerlukan tenaga kerja untuk posisi 1. Supervisor Marketing 3. Staff Admin 2. Surpeyor 4. Marketing Keterangan: • Pria / wanita usia 20-35 tahun • Pendidikan SMU / sederajat (2) • Pendidikan min. DIII (1, 3) • Memiliki sepeda motor + SIM C Surat lamaran dikirim ke:

PT Finansia Multi Finance (Kredit Plus) Jl. HOS Cokro Aminoto No. 53 A Jl. Merdeka No. 120 G Perdagangan

Jln. Merdeka No 80 ( 0622-7072808 Fax.0622-7346080 E_mail :


Menjual HP baru, BlackBerry, Samsung, Nokia, Mito, Maxtron, Venera

mosi argaNo.P153roP. Siantar HJl. Sutomo (Depan Bank NISP)



Telah tercecer dompet warna hitam berisikan STNKB, SIM C dan KTP An. Coleyne Manopo. Tercecer sekitar Jl. Melanthon Siregar - Simp. Lapangan Bola, pada tanggal 25 September 2012, pukul 10.00 WIB Bagi yang menemukan hub: HP 0813 7633 3697; 0852 2151 6827 atau antarkan langsung ke Jl. Melanthon Siregar Gg. PD No. 777b P. Siantar Tidak dituntut tapi diberikan imbalan yang sepantasnya


TIARA SUKSES MOTOR Nokia 1280 Rp. 195.000

Nokia X1-01 Rp. 380.000 + MMC 2 Gb

Nokia X2-02 Rp. 705.000 + MMC 2 Gb

Nokia C1-01 Rp. 485.000 + MMC 2 Gb

Nokia C2-03 Rp. 820.000 + MMC 2 Gb

Nokia X2-01 Rp. 685.000 + MMC 2 Gb

Nokia N100 Rp. 240.000

Nokia X2.00 Rp. 890.000 + MMC 2 Gb

Nokia N101 Rp. 325.000 + MMC 2 Gb

lus aP a u n Sem erda si P an Gar Coy al ion s a N

Jl. Kastria No. 18 BDB Pematanggsiantar Sepeda motor tahun 2000 keatas Minibus, Pick up dan truk 1997 keatas Mobil angkot tahun 2000 keatas

HP 0813 9614 9899; 0813 6200 9333 Tidak ada potongan, bunga ringan, Syarat lengkap dan lansung cair


TERAPIS KESEHATAN A. Untuk Refleksi dan Massage B. Umur 30-45 tahun (pria/wanita) C. Berpenampilan rapi, menarik, sopan, jujur dan rajin D. Pengalaman tidak diutamakn E. Mengikuti peraturan dan perintah dengan baik Kirim surat lamaran, photocopy KTP, daftar riwayat hidup dan pasphoto anda ke: RAJA OUKOP, Jl. Merdeka No. 118 P. Siantar. Telp. 0823 6765 9999; 0622 - 432993 (Tidak Melayani SMS)

Terima laptop seCOND KHUSUS


P. Siantar & Simalaungun


HP 0852 6210 2686 LOWONGAN KERJA PT. Prudential Agency membuka lowongan kerja untuk menjadi Agen Asuransi Prudential. Tidak terikat waktu (Free Lance), dan hanya bagi orang yang ingin sukses dan ingin berpenghasilan uang besar. Dengan syarat: • Pria/Wanita usia 20 - 45 thn, punya KTP dan masih berlaku. • Mempunyai relasi yang luas • Bersedia mengikuti ujianAAJI, Anda akan mendapatkan: • Komisi selama 5 thn per nasabah • Bonus Tambahan Rp.1 juta • Jalan jalan Gratis kedalam/Luar negeri • Jenjang karir yang bergengsi

Segera hub. 0812

6354 0888

Prudential Manager

PT WESLY TOUR & TRAVEL Melayani Penjualan Tiket Pesawat dan Tiket Kapal Laut

Peter Refleksi

SinShe Aciu / Aling Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0813 6017 0199; 0852 7695 4557 Melayani pengobatan

Paket Holyland : Ziarah Tour 11 Hari 20, 21 Des, USD 2850 22 Sept, USD 2450 21 Des, USD 3100 (12 Hr) 18,15, 22 Okt, USD 2450 25 Des, USD 3100 6,19, 26 Nov, USD 2450 3 Des, USD 2550 Harga & tgl sewaktu2 dapat berubah

Jl. Kesatria No. 18 BDB Simp. Lor. 21 P. Siantar Hub: Telp/Fax: 0622-7552525; 0878-92207468 HP 0813-6200-9333

Full Body Refleksi Khaki Terapi Lilin Kop / Bekam Buka : Jam 09.00 - 21.00 WIB NB:Lagi membutuhkan beberapa anggota di peter refleksi yang berpengalaman di Bidang Refleksi

LOWONGAN KERJA Dibutuhkan karyawan untuk: MARKETING Fasilitas: • Honor • Uang makan • Insentif Persyaratan: • Tamatan SMU/SMAsederajat • Bertanggung jawab • Fotocopy ijazah dan KTP Lamaran diantar langsung ke:

Toko Chandra Elektronik & Furniture Jl. SM Raja No. 4 P. Siantar


Telah tercecer Sertifikat Hak Milik An. Partimon Purba, luas tanah 124 M2, lokasi di Jl. H Ulakma Sinaga Gg. Kantil Huta VI Nagori Rambung Merah. Tercecer pada bulan Juli 2012, sekitar Simp. Sambo - Simp. Perumnas Batu 6. Bagi yang menemukan hub: HP 0813 9741 5006 Tidak dituntut tapi diberikan imbalan yang sepantasnya.


28 September 2012

Nia Ramadhani

Kompak Jalan Bareng Mertua NIA RAMADHANI terlihat mendatangi sebuah konser amal. Kehadiran Nia Ramadhani tak cuma didampingi oleh suaminya, tapi juga oleh mertuanya, Aburizal Bakrie. Ketiganya terlihat memasuki sebuah klub untuk menghadiri acara konser amal untuk bencana di Sulawesi Tengah. “Keluar begini enggak sering, tapi begitu sempat pasti diluangkan waktunya,” kata Aburizal Bakrie alias Ical saat dijumpai tom abloidnova.cdi Konser KOIN (Kepedulian Orang Indonesia): Senandung Untuk Negeri, Hard Rock Cafe, Jakarta Selatan, kemarin malam. Bagi Nia dan Ardie, sosok Ical adalah pria yang sangat dekat dengan keluarga. Jika tidak memiliki kegiatan lain diluar politik, Ical akan memilih menghabiskan waktunya bersama keluarga besarnya. “Sebenarnya papa itu sosok yang sangat dekat dengan keluarga. Kan kalau lagi enggak ada kegiatan apa-apa pasti ngumpul sama keluarga,” kata Nia. “Beliau selalu mengedepankan keluarga. Beliau juga suka Slank, jadi langsung diajak kesini,” timpal Ardi. Berada di tengah-tengah anak muda yang asik mendengarkan musik sekaligus lelang untuk amal, Aburizal terlihat sangat menikmati suasana. Bahkan, kata Nia, ayah mertuanya itu asik berjoget-joget. “Usia saya juga baru 26 kok, enggak ada masalah, asal jangan seringsering,” canda Ical. “Terpaksa di dalam papa joget-joget,” sahut Nia tertawa. (nov/int)

Ciuman Nikita

Dihargai Rp5 Juta SENSASI selalu lekat dengan Nikita Mirzani. Setelah foto syurnya dengan beberapa selebritis, kali ini Nikita yang menjadi salah satu host dalam sebuah acara amal, sengaja melelang ciumannya untuk dihargai sejumlah nominal tertentu. “Ya, itu tadi enggak sengaja saja, ya kebetulan ada yang mau bayar kenapa enggak, ini kan buat amal, bukan buat gue sendiri,” ujar Nikita ketika dijumpai di Konser KOIN (Kepedulian Orang Indonesia): Senandung Untuk Negeri, Hard Rock Cafe, Jakarta Selatan, Rabu (26/9) malam. Awalnya, Nikita menawarkan kepada tamu yang hadir sebuah tiket pertama konser musisi Sting yang akan manggung diAncol, Jakarta, 15 Desember mendatang. Tiket perdana itu dihargai Rp10 juta. Sayangnya, setelah menunggu, tak satupun tamu yang tertarik. Untuk memanaskan acara, Nikita sengaja turun dari panggung dan menghampiri seorang pria paruh baya bernama Buddy Jansen (60)

dan mulai menggodanya. “Ayo dong Pak, mau ya Pak tiket Sting Rp10 juta lho Pak,” kata Nikita yang tak melihat respon dari bapak berbaju batik itu. “Kenapa enggak mau? Enggak suka? Sukanya apa? Saya? Ya sudah deh saya Rp10 juta saja,” tawar Nikita menggoda. Karena Nikita menilai angka Rp10 juta terlalu mahal untuk sebuah tiket konser, janda satu anak itu menurunkan penawaran lelangnya menjadi Rp5 juta. Tak disangka, sambutannya sangat baik. Dari pengamatan, Nikita yang mengenakan pakaianberpotongandadarendahdanmemperlihatkan tato bertuliskan ‘Nikita’ di dadanya itu memberikan tawaran menggiurkan berupa ciuman plus sebuah tiket. “Demi Sulawesi Tengah, Rp 5 juta for kissing!” teriak Nikita. “Mau Bapak yang cium atau saya


Minta Harta Mantan Suami Yulia Rachman SELAIN menginginkan perceraian, pesulap Demian Aditya ternyata juga menginginkan harta bersama sang istri, Yulia Rachman, dibagi dua. Parahnya, Demian juga meminta harta yang dimiliki Yulia bersama dengan mantan suaminya terdahulu. “Yang diminta (Demian, red) Aditya harta yang jauh sebelum perkawinannya dan bukan haknya. Selain itu, yang dia minta di luar konteks, pertama perwalian. Padahal kan menurut UU, anak-anak di bawah umur ikut ibu,” ujar kuasa hukum Yulia, Petrus Balapationa, saat ditemui di Pengadilan Agama Jakarta Selatan, Kamis (27/9). Sementara itu, Yulia sendiri heran kenapa Demian tidak menghadiri persidangan hari ini. Pasalnya, keinginan

Demian untuk mendapatkan harta gono gini dan hak pengasuhan anak harusnya dibicarakan langsung dalam persidangan. “Saya nggak ngerti kenapa dia nggak hadir karena katanya karena pekerjaan. Harusnya kan bisa dijadwalkan dan dibicarakan dengan kuasa hukum, kita tahunya di sini karena ada kerjaan. Tapi di sini tadi pengacaranya bilang dia nggak mau datang karena sudah ngotot cerai. Artinya memang ada miss komunikasi dari pihak mereka,” ujar Yulia. Lalu bagaimana perasaan Yulia mengenai jalannya perceraian yang semakin lama ini? “Kalau ditanya, jauh lebih bahagia perasaannya dibanding kemarin. Makin lama makin terlihat, ya Allah tolong dibukakan. Saya mau mediasi untuk anak dan harta gono gini. Ayo selesaikan baik-baik,” harap presenter cantik ini. (kpl/int)

yang cium?” tanya Niki yang langsung disahuti oleh Farhan. “Karena ini konser amal untuk Sulawesi Tengah, ciumannya di tengah dong,” tantang Farhan. Selama beberapa detik, Nikita menempelkan bibir seksinya ke bibir pria berusia 60 tahun itu tanpa malu-malu di depan tamu lain. Kejadian itu sempat diabadikan seluruh tamu yang hadir dengan menggunakan kamera ponsel maupun jepretan awak media. ”Taste very nice , saya mau one more time tapi jangan lah, cukup,” kata pengusaha berdarah Indonesia-Belanda bernama Buddy Jansen (60) itu seraya tertawa. “Saya bilang, saya suka kamu, dia bilang mau di pipi, tapi saya enggak mau, saya maunya di bibir,” celetuk pengusaha tambang itu. (nov/int)

14 15


28 September 2012

Indonesia Open Grand Prix Gold 2012

Srikandi-srikandi Indonesia Melenggang Tampil di hadapan suporter fanatik Indonesia, srikandisrikandi bulutangkis Merah Putih tampil kesetanan di babak ketiga kejuaraan Indonesia Open Grand Prix Gold 2012, Kamis (27/9), di Palembang, Sumatera Selatan. Ganda putri Indonesia, Anneke Feinya Agustin/Nitya Krishinda Maheswari melangkah ke babak keempat usai menyingkirkan kompatriot mereka Gebby Ristiani Imawan/ Tiara Rosalia Nuraidah melalui pertarungan dua set, 2117 dan 21-12. Langkah Anneke/ Nitya juga diikuti Anggia Shitta Awanda/Devi A Shela

Azarenka Tersingkir DUAunggulandalamturnamenPan Pacific Open yatua Victoria Azarenka asal Belarusia dan petenis Rusia Maria Sharapova tesingkir di babak perempat final, Kamis (27/9). Azarenka harus tersingkir setelah mengalami kelelahan kronis, sementara si cantik Sharapova harus mengakui keunggulan petenis Australia Samantha Stosur. Sharapova harus mengubur mimpinya untuk meraih gelar ketiganya di Tokyo setelah dalam perempat final yang penuh drama dan kualitas tinggi itu menyerah dua set langsung 6-4 dan 7-6 dari Samantha Stosur.

YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 / bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari YAYASAN MAHAGA SEJAHTERA: membutuhkan tenaga kerja wanita usia 15 s.d 40 tahun untuk bekerja sebagai baby sister, perawat pribadi / orang tua. syarat: KTP, ijazah, gaji mulai 800 rb s.d 1.300.000 / bulan, bersih. hub. Yayasan Mahaga Perumahan Graha Harmoni, Jl. H Ulakma Sinaga, Pinus Blok F No. 5 Rambung Merah P. Siantar HP 0812 6548 9615; 0813 7515 1742 YAYASAN SEPA HUSADA: Menerima tenaga kerja khusus wanita, baik gadis/janda, dengan usia 17 s/d 45 tahun, untuk dilatih & dipekerjakan sebagai perawat jompo/orang tua sakit, baby sitter. Syarat: Ijasah asli, KTP/Kartu Keluarga, gaji berkisar Rp. 1.000.000 s/d 1.700.000/bulan. Lamaran diantar langsung ke Jl. Pasar 3 no. 45 A Krakatau, Hub. 0811 602 145; 0852 6114 3441 DIBUTUHKAN SEGERA: Tukang jahit, tukang bordir, tukang sablon, tukang pola, berpengalaman atau tidak berpengalaman, alamat Jl. Ade Irma P. Siantar HP 0813 3814 0437; 0852 7006 6007 Bergerak dibidang disCV SENTOSA ABADI: tributor, membutuhkan karyawan/ti. Syarat: •Usia max. 26 tahun •Fotocopy ijazah •Pas photo •daftar riwayat hidup. Fasilitas: •Sallery 1.800.000,- - 2.600.000/bulan, pengalaman tidak diutamkan, bawa lamaran anda langsung ke: Jl. Medan KM 6 No. 58 (+ 5 M sebelum Simp. HKBP) P. Siantar

MITSUBISHI 100% BARU Suku bungan 0% • Pajero Sport • Outlander • Triton • Fuso • Colt Diesel • L300 • T120 Hub : Fernando Gultom, 0813 6169 4479

Unggulan kedelapan Stosur di babak semifinal akan menghadapi petenis Rusia lainnya Nadia Petrova yang menghentikan laju unggulan keenam Sara Erano dengan tiga set 3-6, 7-5 dan 6-3.Stosuryanghanyamenangsatukali dari 11 kali pertemuan sebelumnya dengan Sharapova berhasil memulai inisiatif pertandingan dan merebut set pertama setelah pengembalian backhand Sharapova melebar. Di babak kedua laga lebih ketat dan harus diselesaikan melalui tie-break dengan angka sangat ketat 12-10. Sementara itu juara Australia Terbuka tahun ini Victoria Azarenka

mengundurkan diri sebelum laga melawan petenis Jerman Angelique Kerber dimulai karena kelelahan. Finalis Amerika Terbuka ini juga terlihat susah payah dalam laga babak ketiganya kemarin. “Sebelum turnamen saya memang merasa kurang sehat,” kata Azarenka yang mendapatkan pemeriksaan tekanan darah saat menghadapi Roberta Vinci, Rabu (26/9). “Energi saya sangat lemah dan saya bukan diri saya saat ini. Mungkin ini dampak kelelahan selama musim ini. Sayasendiritidaktahuapayangterjadi,” kata Azarenka. (int)

DAIHATSU PAKET MURAH 100% DP Angsuran • All N Xenia 24 jt 4.440.000 • Terios 24 jt 4.981.000 • Luxio 20 jt 4.902.000 • Pick up 11 jt 2.600.000 Hub: TONI SINAGA; HP 0813 7638 6909; 0821 6308 7454. Setiap pembelian Luxio dapat hadiah 1 unit Yamaha Mio




• All New Avanza ..Ready, Bonus Lengkap ! • All New Avanza VELOZ ...Bonus Lengkap !! • New Rush ..... Ready!! • Grand New Innova ...Ready!! • Grand New Fortuner VNTurbo ... Ready!! • Menangkan Lexus GS250, New Yaris, New iPad, Samsung Galaxy S III, dan hadiah lainnya. Hub : RICKY. M / Hp: 0812 6505 3191 – 0853 7199 9499 SALES EXECUTIVE TOYOTA PROMO HONDA SIANTAR. DataKHUSUS dijemput, Cash & Credit READY STOCK ALL TYPE HONDA PROSES CEPAT..!! • Honda Brio • Honda Jazz • Honda Freed • Honda CRV • Honda City • Honda Civic • Honda Accord • Honda Odyssey Dapatkan promo khusus Honda CRV bunga 0% sampai 3 tahun. Hub: (Sales Executive Honda Arista Perwakilan Siantar) 0813 7076 1561 (Aidil A) • Carry P. Up Dp. 15,5Jt Angs 2,6Jt-an • Carry P. Up 3WD Dp. 18Jtan Angs 2,4Jt-an • APV P. Up Dp. 21,5Jt Angs 2,7Jt-an • APV Arena GL Dp. 33Jtan Angs 3,7Jt-an Hub: 0853 7003 2838 HYUNDAI • Avega Dp. 11 Jtan Angs 2Jtan • Grand Avega Dp. 22 Jtan Angs 2Jtan • Tucson Dp. 59 Jtan Angs 5Jtan • New Product Santafe Diesel Segera hadir buat anda. Gratis GPS + Cam Parkir + TV + DVD + Bluetooth + HP Samsung Data dijemput, cepat dan mudah. IROEL HP. 0813 6217 2677


• All New Xenia Ready stok • Terios Ready stok • Luxio Dp 15%(hadiah menarik) • Sirion Dp 15 % • Pick up Dp 15 % • Mini Bus Dp 15 % hub. SONNY SEMBIRING, HP 0812 6471890; 0819 661 978 Proses cepat data dijemput. Menyediakan TEST DRIVE!!


• All New Avanza Ready, buruan!! • Veloz bonus plg lengkap!! • Grand New Innova.. Ready!!! • Grand New Fortuner... Ready!!! • YARIS bonus plg lengkap!! • New Rush Dp. Ringan • New Hilux Pick Up Diesel tersedia Hub. Indra - Sales Executive 0812 6088 7380; 0622 - 7160800, Data di jemput, mau proses yg cepat disini tempatnya

CASH & CREDIT: Menyediakan rumah dan tanah kavling sesuai tipe dengan yang anda inginkan dan stok yang tersedia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

• • • • • • • • • • • •

SUZUKI 100% BARU PT. Trans Sumatera Agung Carry Pick Up 95,6Jt APV Pick Up 105,6Jt APV GL Arena 149,3Jt APV Luxury 177,6Jt Ertiga GA 157,3Jt Ertiga GL 168,3Jt Ertiga GX 180,3Jt Splash 152,8Jt Karimun Estillo 120,3Jt Swift 181Jt SX4 Cross Over 213,3Jt Grand Vitara 305,3Jt Cash & Credit, Data dijemput David Sinaga, 0813 6132 4071

CARI SEWA / DIRENTALKAN: •Mobil pick up •Gran Max •Mobil Box •lengkap dengan supir, harga nego, hub. HP 0822 6762 4360 (Sirait)

LESTARI MOTOR: Diskon DP 500 rb Menjual segala jenis sepeda motor Honda, Suzuki, Yamaha dan second, cash n kredit: • Honda Absolute Revo • Honda SX 125 • Scoopy, Vario Techno • Mio, Mio Soul • Jupiter Z • Satria FU, Spin, hub. 0622 - 22305; 24077; HP 0853 7070 9507; 0852 7601 5848. Jl. Merdeka No. 330 P. Siantar DIKONTRAKKAN: Rumah tinggal dan Ruko di Jl. Cadika No. 2 (Blk Graha Sikhar) dekat dengan sekolah, tempat aman dan nyaman, PLN dan PAM per masing-masing rumah, kamar kost khusus Karyawati di Jl. Rajamin Purba No. 100 (depan SMP N 2) Fas: Lengkap, HP 0878 8259 7750; 0853 7070 5003 CASH & CREDIT: Rumah type 70/112 genteng roof, gipsum keramik, 3 kmt Rp 200 jt, Dp Rp 50 jt, angsuran selama 10 thn + 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan. Jl. Melanthon Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/120 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Pdt Wismar Saragih Gg Karsim Blok 4-7, 800m dari kantor pusat GKPS dan Akbid Florensia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442.

yang menaklukkan pasangan Jepang, Yuki Fukushima/Yui Miyauchi dengan rubber set, 17-21, 21-13, dan 21-19 di babak ketiga. Hasil serupa pun

diperoleh ganda putri Merah Putih lainnya, Pia Zebadiah/Rizki Amelia yang menyisihkan pasangan Indonesia lainnya, Khairunnisa Imma

Muthiah/Geovani Mareta Dea dengan straight set, 21-12 dan 21-13. Untuk nomor tunggal putri, Rusydina Antardayu Riodingin tampil mengejutkan dengan menyingkirkan unggulan ketiga asal Singapura, Xing Aiying melalui pertarungan tiga set, 2022, 23-21, dan 21-15. Renna Suwarno juga mengikuti jejak Rusydina melaju ke babak keempat usai menundukkan tunggal putri Indonesia lainnya, Tike Arieda Ningrum dengan dua set, 21-12 dan 21-17. Fanetri Lindaweni juga memastikan tiket ke babak keempat setelah menyisihkan pebulutangkis putri Jepang, Nozomi Okuhara dengan straight set, 22-20 dan 21-14. Hasil positif juga ditorehkan Adrianti Firdasari di nomor tunggal putri setelah menyingkirkan Sayaka Takahashi dari Jepang lewat pertarungan tiga set, 13-21, 21-13, dan 23-21. (int)

Ganda Putra Sapu Tiket Perempatfinal TUJUH ganda putra Indonesia berhasil memastikan diri melaju ke babak perempatfinal kejuaraan Indonesia Open Grand Prix Gold 2012 setelah menyisihkan lawan mereka masing-masing, di Palembang, Sumatera Selatan, Kamis (27/9). Ganda putra unggulan keempat, Angga Pratama/Ryan Agung Saputra tampil cemerlang saat mengalahkan pasangan Indonesia lainnya, Wahyu Nayaka/Ade Yusuf dengan dua set langsung, 21-17 dan 21-12. Hasil serupa juga ditorehkan Jordan Praveen/ Juang Didit yang menyingkirkan rekan mereka di pelatnas, Ricky Karanda/ Muhammad Ulinnuha melalui rubber set, 21-19, 16-21, dan 21-18. Pasangan Tanah Air lainnya yang

melangkah ke perempatfinal adalah Hendra Wijaya/Rian Sukmawan yang mempermalukan senior mereka di pelatnas, Markis Kido/Tri Kusharyanto dengan pertarungan tiga set, 21-15, 1821, dan 21-18. Sementara itu, Faisal Hafiz/ Rhoma Putra Eka juga menambah daftar ganda putra Indonesia di babak perempatfinal usai memulangkan pasangan Malaysia, Mohd Lutfi Zaim/Teo Kok Siang dengan kemenangan tiga set, 13-21, 21-16, dan 22-20. Langkah serupa juga diraih ganda putraMerahPutihmuda,AndreiAdistia/ Christopher Rusdianto yang menundukkanpasanganSingapura,Yeo Zhao Jiang/Yi Liu melalui dua set langsung, 25-23 dan 22-20. Indonesia kembali menempatkan

CASH & CREDIT: Rumah tipe 36/102 genteng roof, gypsum, keramik, 2 Kmt Rp 100 jt, DP 20 jt, angsuran selama 10 thn + Rp 1 jt per bulan, selama 15 thn + 800 rb per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442

CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 150 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan. Jl. M. Siregar Gg. Barito Blok 6 belakang SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442.

CASH & CREDIT: 10 x 21,8 m Rp 76 jt, 20 x 22 m Rp 154 jt. Jl. Melanthon Siregar Gg. Barito Blok 6 Belakang SMA Budi Mulia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: 1.908 M2 Rp 300 jt, cocok untuk gudang /usaha. Jl. H Ulakman Sinaga, depan Gereja Khatolik, Rambung Merah Hub: Alboin Sidabalok di No. Telp. 0813 7612 2445; 0812 6207 631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/104 genteng roof, gypsum, keramik, 2 Kmt Rp 160 jt, DP 40 jt, angsuran selama 10 thn + Rp 1,7 jt per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Laucimba R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar. CASH & CREDIT: Rumah tipe 70/200 genteng roof, gypsum, keramik, 3 Kmt Rp 200 jt, DP 50 jt, angsuran selama 10 thn + Rp 2,2 jt per bulan, selama 15 thn + 1,8 jt per bulan, Jl.Pdt Wismar Saragih Gg Karsim Blok B 4-7, 800m dari ktr pusat GKPS dan Akbid Abdi Florensi. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442. CASH & CREDIT: Rumah type 36/78 genteng roof, gipsum keramik, 2 kmt Rp 95 jt, Dp Rp 20 jt, angsuran selama 10 thn + 950 rb per bulan, selama 15 thn + 752 rb per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 45/104 genteng roof, gipsum keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 thn + 1.6 jt per bulan, selama 15 thn + 1.3 jt per bulan. Jl. Kampung Baru R. Merah. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah tipe 56/112 genteng roof, gypsum, keramik, 2 Kmt Rp 175 jt, DP 40 jt, angsuran selama 10 thn + Rp 2 jt per bulan, selama 15 thn + 1,6 jt per bulan, Jl. Melanthon Siregar Gg Barito Blok 6, blk SMA Budi Mulia. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 CASH & CREDIT: 5 x 20 m Rp 17 jt, 10 x 20 m Rp 34 jt, 15 x 20 m Rp 51 jt, 20 x 20 m Rp 68 jt. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari kantor Pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar CASH & CREDIT: Rumah type 36/120 genteng roof, gypsum, keramik, 2 kmt Rp 95 jt, Dp 20 jt, angsuran selama 10 tahun + Rp 950 rb per bulan, selama 15 tahun + Rp 752 rb per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7 800 M dari ktr pusat GKPS & Akbid Florensia Hub: Alboin Sidabalok - 0813 76122445; 08126207631; 7070442 P. Siantar CASH & CREDIT: Rumah tipe 45/96 genteng roof, gypsum, keramik, 2 Kmt, Rp 150 jt, DP 30 Jt, angsuran selama 10 thn + 1,7 juta per bulan, selama 15 thn + 1,4 jt per bulan, Jl. Durian, Lap. Bola Atas. Hub: Alboin Sidabalok di No.Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

CASH & CREDIT: Rumah type 45/120 genteng roof, gypsum, keramik, 2 kmt Rp 140 jt, Dp Rp 30 jt, angsuran selama 10 tahun + Rp 16 jt per bulan selama 15 tahun + Rp 1,3 jt per bulan. Jl. Pdt. J Wismar Saragih Gg. Karsim Blok 4-7, 800 M dari Kantor pusat GKPS dan Akbid Florensia Hub: Alboin Sidabalok, HP. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar DIJUAL RUKO: 4 pintu, ukuran gedung 15 x 15 M, ukuran tanah 16 x 20 M, siap pakai, lokasi strategis, cocok untuk usaha, harga 1,5 M. Jl. Viyata Yudha P. Siantar. Hub. HP 0821 6231 4626 (TP) CASH & CREDIT TANAH: 5 x 25 m Rp 25 jt, 5 x 20 m Rp 20 jt, cocok untuk memelihara hurje. Jl. Laucimba Rambung Merah Hub: Alboin Sidabalok di Telp. 0813 76122445; 08126207631; (0622) 7070442 P. Siantar

wakilnya di nomor ganda putra lewat Gideon Markus Fernaldi/Putra Agripinna Prima yang menyingkirkan wakil Filipina, Ronel Estanislao/Paul Jefferson Vivas melalui pertarungan dua set, 21-12 23-21. Ganda putra terakhir Indonesia yang lolos ke perempatfinal adalah Yonathan Suryatama/Hendra Apriadi yang menaklukkan Rahmat Adianto/Berry Angriawan lewat rubber set, 17-21, 2112, dan 21-19. Satu tempat lagi di di nomor ganda putra diraih pasangan Korea Selatan, Kim Ki Jung/Kim Sa Rang yang menyisihkan pasangan Indonesia, Ronald Alexander/Selvanus Geh dengan melalui tiga set, 23-21, 22-24, dan 21-12. (int)

FATNET GIBSUM: Menerima pemasangan •Plafon gibsum •Instalasi listrik, hub. Jhonny Purba HP 0813 9609 9231. Jl. H Ulakma Sinaga No. 167 (depan Gereja RK Rambung Merah) P. Siantar J J J COLLETION R br MANURUNG: Menjual segala jenis pakaian, pria, wanita, accesories, bakal pengantin dan perlengkapan anak, alamat Jl. Gereja Ruko Martimbang No. 18 P. Siantar Telp. 0622 - 27669 JOVNI CELLULER: Menjual HP baru, dengan harga terjangkau mulai dari Rp 200 rb + Memori 2 Gb, dengan fitur lengkap seperti: •Kamera •Radio FM •Dual SIM GSM •MP3, dengan beragam model HP terbaru segera kunjungi: Jl. Cipto No. 59 P. Siantar (Lewat Simp. Surabaya) PELUANG USAHA AIR MINUM: Pemasangan Depot Air Minum • Air Pegunungan (Mineral) • Sistem RO Oxsygen dan Grosir Peralatan • Depot Air Minum GRACE WATER Jl. Cengkeh Raya P. Simalingkar HP. 081370107352 Melayani pemasangan dalam dan luar kota

ULI DE ANGEL TOUR & TRAVEL: Melayani jasa penjualan online: •Tiket pesawat domestik dan internasional •Paket wisata dan hotel •Paket Ziarah Lourdes & holy land • Rental mobil (Avanza, Xenia, Innova dll), hub. Uli Gultom HP 0812 1059 0815; Daniel Samosir HP 0852 7565 0001.

DIJUAL: Tanah bersertifikat berikut bangunan rumah dengan luas tanah 18 x 48 M2 (+ 1000 M2) di Jl. Medan KM 9.5 Kel. Sinaksak (TP), hub. 061 - 7860686; HP 0813 7572 4472

HORISON PHOTO: Spesial: •Pengadaan mesin photo copy, servis spare parts Fotocopy Rp 125/ lbr •Pasphoto/cetak photo. Jl. Justin Sihombing (Simp. Jl. Pantai Timur) No. 7 B P. Siantar HP 0813 6100 1200 (Jhon Purba)

DIJUAL: Tanah Sertifikat Milik, lokasi di Kelurahan Pematang Marihat Kota Madya Pematangsiantar, luas + 17 rante, harga 47 jt/ rante, cocok untuk /perumahan, hub. Ibu Sri HP 0812 6425 1635

UD ARMADA SARANA TEHNIK: Melayani: •Servis perbaikan isi freon •AC •Frezer •Kulkas •Mesin cuci •Dispenser, hub. Armada Purba HP 0812 6406 6568, Jl. Handayani No. 8 P. Siantar

Peter Refleksi SinShe Aciu / Aling: Mengobati segala penyakit •Asam lambung •Asam urat •Ambeian •Gula •Kolestrol dll Jl. Cipto No. 22 Lt. 2 P. Siantar HP 0852 7695 4557; 0813 6017 0199 Buka : Jam 09.00 - 21.00 WIB PIJAT DAN LULURAN “MBAK SARI”: Jika Anda Capek, Pegal, Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan Badan, Urut Bayi, Terkilir serta Luluran. Hub: kami di Jl. Usgara No. 1 (Masuk dari Jl. Bali samp. SMK Negeri) P. Siantar HP. 0812 635 5430 Pijat dan Luluran “ IBU RESTU” Jika anda capek, Pegel Linu , Lesuh, Lelah Kurang bergairah, turun perut,Menyegarkan badan,Urut bayi,terkilir,serta luluran. Jl. Simpang Viyata Yudha Komplek kelapa 2 dekat sekolah RK Katolik Asisi P. Siantar HP 0821 6681 7943. PIJAT DAN LULURAN “PAK SETU”: Jika Anda Capek, Pegal Linu, Lesu, Lelah, Kurang Bergairah, Turun Perut, Menyegarkan badan, Urut bayi, Terkilir, serta Luluran. Hub. Jl. Menambin No. 12 A Timbang Galung P. Siantar Hp. 0813 7658 8917 PIJAT, LULURAN & OUKUP “MBAK ERYKA”: Jika Anda capek, pegal linu, lesu, lelah, kurang bergairah, turun perut, menyegarkan badan, urut bayi, terkilir, serta luluran, menerima panggilan keluar (khusus kaum ibu). Hub: Jl. Handayani Kel. Bahkapul P. Siantar - HP. 0852.7600 0031; 0813.9688 9800.

HABONARON DO BONA BIRO JASA SIMALUNGUN PUTRA Mengurus Surat-surat, Stnk, Sim, Pasport, Speksi, Penasehat Hukum-Pengacara. Jl. Merdeka No.166 Telp. (0622) 26836 – 27712. P. Siantar “Atas Kepercayaan Anda Kami Berbuat & Berbakti” TANAM GAHARU INVESTASI MELEBIHI EMAS! Jual bibit gaharu aquilaria malaccensis tinggi mulai 20-100 CM, sedia fusarium ingul dan teknik mokulasi, sedia bibit kemenyan toba dll. Jl. Viyata Yudha Pematangsiantar. hub. HP 0813 1476 2472; 0812 2756 8840

LA ROSS SALON & FLORIST: Menerima: Make up dan sanggul, Rias pengantin, perawatan rambut, shomoting rambut. Juga menerima Roncean melati, Bunga tangan, Bunga papan, Bunga saub, Dekorasi pelaminan dll. Jl. Sisingamangaraja No. 324 Telp.08126382759 REZEKI SAHABAT SERVICE: Jl. Gereja No. 60, melayani ganti oli, pispot, service memuaskan, HP 0853 6221 1168 Pasang Iklan Anda Hub. Hub.: 0622 -



JUMAT 28 September 2012


Bentrok Para Unbeaten Arsenal vs Chelsea. Siapa pun yang menang akan mempertahankan label unbeaten (belum terkalahkan) dan memberikan kekalahan pertama bagi si pecundang.

Almeyda Ungkap Kasus Doping


emang ada cara lain supaya keduanya mempertahankan status tersebut: bermain imbang. Tetapi, Chelsea, si pemuncak klasemenyangkinihanyaunggulsatu poin atas Manchester United, bisa jadi tak akan mengambil opsi tersebut.Sementara,Arsenalbarusaja mendapatkan hasil imbang dengan Manchester City akhir pekan lalu. The Blues sejauh ini tampil impresif. Imbang 0-0 melawan QueensParkRangersmenjadihasilterburuk mereka sejauh ini. Dengan lini serang yang begitu ‘wah’, mereka hanya menang tipis 1-0 atas StokeCityakhirpekanlalu.Namun, Roberto Di Matteo tetap puas dengan kemenangan tersebut. Di Matteo menyebut bahwa timnya mampu mencari cara bagaimana membongkar pertahanan tim yang bermain super defensif. Siapa pun yang menjadi pencetak golnya tak masalah, dan hadirlah Ashley Cole sebagai pahlawanpadalagamelawanStokeitu. Manajer asal Italia itu juga tidak perlupusingmemikirkansiapayang akan dipasang di depan. Chelsea punyastokcukupmelimpahdisana —Eden Hazard, Fernando Torres,

Ditulis Pada Autobiografi Kasus penggunaan doping dan pengaturan pertandingan terbaru muncuk di Italia. Kali ini Matias Almeyda yang mengungkapkannya, dalam sebuah autobiografi yang dia rilis belum lama ini. Almeyda tercatat sempat sembilan musim merumput di Liga Italia. Gelandang asal Argentina itu memperkuat empat klub berbeda yakni Lazio, Parma, Inter Milan dan Brescia. Tujuh tahun setelah meninggalkan Italia, pria yang kini melatih River Plate itu membuat kejutan menyusul terbitnya sebuah autobiografi yang diberi judul ‘Almeyda: Life and Soul’. Dalam buku tersebut, dia mengklaim telah mendapatkan obat-obatan yang mampu meningkatkan performa di atas lapangan. Kejadian tersebut diyakini terjadi dalam periode 2000 sampai 2002, saat dia memperkuat Parma. “Di Parma kami diberikan IV drip (memasukkan substansi cair langsung ke dalam saluran darah) sebelum pertandingan. Mereka bilang itu adalah campuran vitamin, tapi sebelum memasuki lapangan saya bisa melompat setinggi langit-langit,” tulis ‘Almeyda dalam bukunya dan kemudian dimuat oleh Gazzetta dello Sport. “Para pemain tidak ada yang bertanya tapi beberapa tahun kemudian ada kasus di mana mantan pemain tewas karena masalah pada jantungnya, menderita masalah otot dan lain lagi. Saya pikir ini adalah konsekuensi atas apa yang sudah diberikan pada mereka.” Yang tak kalah mengejutkan dari autobiografi tersebut adalah pengakuan Almeyda atas pengaturan pertandingan di pekan terakhir Seri A musim 2000/2001. Saat itu Roma yang menghadapi Parma butuh kemenangan untuk memastikan meraih gelar juara. “Beberapa rekan saya di Parma bilang kalau pemain Roma ingin kami kalah dalam pertandingan tersebut. Saat itu kami memang tidak lagi mempertaruhkan apapun, itu akan sama saja (kalah atau menang).” “Saya katakan tidak dan mayoritas pemain juga menyatakan hal senada. Tapi di atas lapangan, saya lihat beberapa pemain tidak berlari seperti biasanya. Jadi saya meminta diganti dan langsung pergi ke ruang ganti. Uang? Saya tidak tahu, mereka menyebutnya sebagai pertolongan.” (int)

TERCECER Telah tercecer surat penyerahan hak tanah An. MESDI (Manahul Balias) luas tanah 144 M2 (12 x 12 M), terletak di Jl. Damai Persil Pasar 1 A Kel. Perdagangan 3 Kec. Bandar Simalungun. Terccecer Perdagangan sekitarnya. Bagi yang mohon dikembalikan kepada MESDI (Manahul Balias) Perdagangan Tidak dituntut tapi diberikan imbalan yang sepantasnya

„ Lukas Podolski

Falcao Tak Pikirkan Gelar El Pichichi MADRID- Melihat produktivitasnya di lapangan, Radamel Falcao menjadi salah satu pemain yang dijagokan jadi top skorer La Liga musim ini. Namun Falcao enggan memikirkanhalitudanmemilihfokus untuk Atletico Madrid. Dalam tiga musim terakhir, nama Lionel Messi dan Cristiano Ronaldo selalubersaingdalamperebutangelar pencetak gol terbanyak atau El Pichichi. Kini nama Falcao ikut muncul untuk memperebutkan titel tersebut. Jika menilik daftar pencetak gol La Ligamusimini,makanamaFalcaoada di daftar teratas. Dia sudah melesakkan tujuh gol dalam lima pekan. Jumlah gol penyerang asal Kolombia itu mengungguli Messi yang ada di urutan kedua dengan enam gol. Sementara Ronaldo baru mencetak

„ Radamel Falcao

tiga gol untuk Real Madrid. Meski sedang memimpin daftar pencetak gol, Falcao belum mau berpikir soal gelar top skorer. Dia hanya ingin fokus untuk membantu Los Rojiblancos bersaing di La Liga. “Saya tidak pernah mengatakan bahwa saya ingin bersaing dengan Cristiano dan Messi. Saya hanya

ingin mencetak gol dan membantu tim, tidak lebih,” ujar Falcao seperti dilansir Football Espana. “Satu-satunya hal yang saya pikirkan adalah mencapai tujuan saya. Kami melawan 19 tim, tidak hanya Real Madrid dan Barcelona,” katanya menambahkan. (int)

TERCECER Telah tercecer BPKB Sepeda Motor dan STNK An. Jautar Situmorang, nopol BK 4483 TAA, nomor rangka MHI38C 116AK708342, nomor mesin 28C1E1699939. Tercecer pada se Minggu lalu di sekitar Jl. Sidamanik - Tanah Jawa. Bagi yang menemukan hub: 0852 6212 7989 Zainal Tidak dituntut tapi diberikan imbalan yang sepantasnya




Obat kuat terbaru saat ini paten, membuat ereksi lebih lama, tanpa efek samping isi 10 tablet tanpa bekas




Terobosan terbaru obat VIMAX menambah ukuran alat vitl secara permanent sekaligus menambah kejantanan pria, isi 30 capsule



Cukup 1 pak Fatloss langsung terbukti turun berat badan 8 - 12 Kg dalam jangka 1 Minggu, 100& alami dan tanpa efek samping, dijamin




100% original import 1 kali pakar langsung terbukti besar, kencang, padat dan mengembalikan payudara, baik gadis atau ibu-ibu dijamin



Capsul USAtelah dan terbukti meninggikan badan dengan cepat, memperkuat daya ingat, 1-2 minggu bertambah tinggi 5 - 8 CM pasti (semua umur)


0878 6849 0858 0812 6332 0422

Jl. Thamrin Baru No. 71 Medan


Spontan kuat keras dan tahan lama 3 X lebih kuat dari obat kuat lainnya, aman di konsumsi tanpa efek samping

PROCOMIL SPRAY Sekali semprot ampuh tambah gairah seks pria tanah lama, tanpa menimbulkan rasa kebas, panas, aman dan tanpa efek samping

TERSEDIA: •Gemuk Badan •Obat Jerawat •Pemerah Bibir •Pembesar Pantat •Sedia aneka kondom antik ar Ant IS !Melayani pesanan luar kota dan kebutuhan sex P/W dewasa T PIN BB 295597B6



Via Transfer - Paket Kilat

ASEN HP 0852 7558 7299 HERBAL

Jl. Tanah Jawa No. 83 (depan ruko baru, Simp Jl Cokro) ) P. Siantar Jl. Cokro No. 349 Simp. Malik Kisaran Jl. Sirandorung NO, 63 Simp. Jl. Pardamean Rantau Prapat

Oscar, Juan Mata, dan beberapa lainnya—. Kalaupun ada yang perlu dikhawatirkan adalah mengendurnyapertahananseperti yang dialami ketika melawan Juventus di Liga Champions. Arsenal memang bukan tim yang defensif seperti Stoke. Tapi, merekatahucarabertahandengan baik. Mereka baru kebobolan dua gol dan sudah mencetak sembilan gol dalam tiga laga terakhir. Jika ditambah laga Piala Liga Inggris, maka The Gunners sudah menciptakan 15 gol dalam empat pertandingan terakhir. SteveBould,mantanbektimasal London Utara itu dan kini jadi asisten baru Arsene Wenger, dianggap jadi orang yang paling berjasa dalam memperkuat pertahanan Ar-

senal. “Kami bekerja keras melatih cara kami bertahan dan Anda bisa melihat itu dari tiga clean sheet yang kami dapat,” kata Thomas Vermaelen. Di sisi lain, keliatan Cazorla sebagaisalahsatuamunisiliniserang terbilang mantap. Ia, dan juga Aaron Ramsey, beberapa kali melepaskan passing ciamik dalam laga melawan City. Beberapa umpan terobosan pun mampu menembus barisan bek yang digalang Vincent Kompany. Sial bagi mereka, beberapa kali penyelesaian akhinya tidak se-ciamik operan itu sendiri. Di Emirates Stadium, Chelsea justru memiliki catatan yang lebih bagusdibandingArsenal.Darilima pertemuan terakhir kedua tim di Emirates Stadium di semua kompetisi, Arsenal hanya mampu meraih satu kemenangan, menelan tiga kekalahan dan sekali imbang. (int)

„ Pemain Liverpool berebut bola saat pertandingan melawan West Bromwich pada ajang Piala Liga Inggris, Kamis (27/9)

Piala Liga Inggris

Sahin Loloskan Liverpool Liverpoolmelajukebabakempat PialaLigaInggrissetelahmenangtipis 2-1atasWestBromwichAlbion.Nuri Sahinjadipahlawankemenangan‘Si Merah’lewatduagolnya. Bertandang ke The Hawthorns, markas West Bromwich, Kamis (27/9) dinihari, The Reds sempat ketinggalan 0-1 ketika pertandingan baru masuk menit ke tiga setelah Sebastien Gabriel Tamas bikin gol. Liverpool berhasil menyamakan skor setelah Nuri Sahin mencetakgol,yangjugagolperdananya

bersama klub itu, di menit ke-18. Tendangan spekulasinya dari luar kotak penalti tak mampu ditepis Ben Foster. Youssouf Mulumbu hampir membuatWestBromwichkembali unggul di menit ke 42 jika saja tendangannya tak diblok oleh Jamie Carragher. Skor 1-1 bertahan hingga babak pertama usai. Kemenangan Liverpool akhirnya dipastikan setelah Sahin mencetak gol keduanya di menit ke-82 setelah bekerja sama dengan Oussama Assaidi. (int)


JUMAT 28 September 2012


Team Chelsea Man United Everton West Brom Arsenal

M 5 5 5 5 5

M 4 4 3 3 2

S 1 0 1 1 3

K 0 1 1 1 0

SG 9-2 12-6 9-5 7-4 9-2


Nilai 13 12 10 10 9




TOP SCORER Gol 5 4 4

Nama R van Persie D Ba J Defoe

Klub Manchester United Newcastle United Tottenham Hotspur

SPANISH LA LIGA No 1 2 3 4 5

Team Barcelona Atlético Madrid Mallorca Málaga Sevilla

M 5 5 5 5 5

M 5 4 3 3 3

S 0 1 2 2 2

K 0 0 0 0 0

SG 14-3 15-7 7-3 6-2 6-2

Nilai 15 13 11 11 11

TOP SCORER Gol 7 6 4

Nama R Falcao L Messi T Hemed

Klub Atlético Madrid Barcelona Mallorca

ITALIAN SERIE A No 1 2 3 4 5

Team Juventus Napoli Sampdoria Internazionale Lazio

M 5 5 5 5 5

M 4 4 3 3 3

S 1 1 2 0 0

K 0 0 0 2 2

SG 11-2 11-2 8-5 8-5 7-5

Nilai 13 13 10 9 9

Manchester United mendapatkan lawan yang tidak ringan, Newcastle United, pada babak ke tiga Piala Liga Inggris. Namun akhirnya Red Devils pun menang dengan skor 2-1 atas The Magpies. Hal itu disambut gembira oleh bos MU, Sir Alex Ferguson.


U memainkan beberapa pemain mudanya saat menjamu Newcastle diOldTrafford,Kamis(27/9)dinihari WIB. Meski begitu, mereka tetap menang 2-1 berkat gol-gol Anderson dan Tom Cleverley. “Saya sangat senang,” aku Ferguson di situs resmi klub. “Pertama-tama, mengingat ini adalah pertemuan antarklub Premier League dan Newcastle mungkin lebih kuat daripada kami secara fisik, kami menampilkan sepakbola

„ Alex Ferguson

Indonesia 5-0 Brunei Darussalam TOP SCORER Gol 5 4 3

Nama E Cavani S Jovetic A Cassano

No 1 2 3 4 5

Team München Frankfurt Hannover 96 Schalke 04 Düsseldorf

M 5 5 5 5 5

JERMAN M 5 4 3 3 2

S 0 1 1 1 3

K 0 0 1 1 0

SG 17-2 14-7 14-8 10-5 4-0

TOP SCORER Gol 5 4 3

Nama M Mandžukiæ T Müller S Aigner

Klub Bayern München Bayern München Eintracht Frankfurt

TOP SCORER Gol 2 2 2

Nama Mkhitaryan Lionel Messi Rafael Bastos

Perjalanan Setan Merah

Pelepas Dahaga

Klub Napoli Fiorentina Internazionale


yang fantastis. Kami terus memainkan permainan kami dan gigih dengan itu dan juga memiliki ketenangan dalam bermain,” jelasnya. Menurut Fergie, ia sangat senang dan selalu berpikir layak menang. “Newcastle adalah tim yang sangat bertenaga,jadibagusbisamelewatimereka,”kata pria asal Skotlandia ini. MUakankembalimenghadapilawanberat di babak ke empat. The Red Devils akan melawan Tottenham Hotspur. (int)

Klub Shakhtar Donetsk Barcelona CFR 1907 Cluj

Nilai 15 13 10 10 9

Indonesia mendapat kemenangan dalam laga uji coba melawan Brunei Darussalam di Stadion Hassanal Bolkiah, Rabu (26/9). Hat-trick Irfan Bachdim mewarnai kemenangantelaklimagoltanpabalasIndonesiaatas Brunei. Bermain tanpa lima pilar (Titus Bonai, Okto Maniani, Valentino, Yoshua Pahabol, dan Cornelis Geddy) pasukan “Merah Putih” tampil lumayan spartan. Beberapa kali Irfan dan kawan-kawan mengancam gawang Brunei. Memasuki menit ke-25, Indonesia mendapatkan hadiah penalti. Irfan yang menjadi algojo, tak menyia-nyiakan kesempatan dan membuka skor pertandingan. Suntingan Irfan melecut semangat rekan-rekannya. Jelang berakhirnya babak pertama, Indonesia kembali menggandakan kemenangan. Kali ini, tendangan jarak jauh Vendry Mofu sukses menggetarkan jala Brunei untuk kedua kalinya. Tim “Garuda” kian menggila pada paruh kedua. Enam menit selepas jeda, Irfan kembali mencetakgolkeduabagidirinyadanmengubah kedudukan menjadi 3-0 untuk Indonesia. Pasukan Nil Maizar semakin di atas angin. Buktinya, pada menit ke-63, Indonesia makin melejit. Gelandang serang mungil, Hendra Adi Bayauw, mampu menceploskan bola ke jala Brunei dengan memaksimalkan umpan M Rahmat. Sudah unggul empat gol tanpa balas tak memuaskan Indonesia. Pesta gol tim “Merah Putih” ditutup trigol Irfan pada menit ke-72. Laga pun berakhir dengan kemenangan Indonesia lima gol tanpa balas melawan Brunei. Kemenanganinimenjadipelepasdahagatim nasional Indonesia. Itu kemenangan pertama sejak tim “Merah Putih” mengalahkan Mauritania pada Turnamen Al-Nakbah di Palestina, Mei silam.

„ Anderson

„ Irfan Bachdim Setelah meladeni Mauritania, Indonesia menjalani delapan laga, termasuk melawan BruneiDarussalam.Daridelapanpertandingan itu, tim “Garuda Pancasila” meraih satu kemenangan, tiga kali imbang, dan empat kekalahan. Total, sepanjang tahun ini, timnas Indonesia telah menjalani 15 laga, baik partai resmi maupun uji coba. Tiga kemenangan didapat timnas dari seluruh pertandingan itu. (int)

Setelah kalah dari Everton di pekan pertama, Manchester United melaju dengan empat kemenangan beruntun. Bisakah rekor tersebut berlanjut kala menghadapi Tottenham Hotspur pada Sabtu (29/9)? MU kalah 0-1 dari Everton pada pekan pertama, namun langsung bangkit di pekan berikutnya. Menghadapi Fulham, ‘Setan Merah’ menang 3-2 dalam laga yang diwarnai oleh gol debut Robin van Persie. Eks bomber Arsenal itu kemudian jadi bintang di pekan berikutnya, ketika dia mencetak hat-trick ke gawang Southampton dan MU, lagi-lagi, menang dengan skor 3-2. Di dua laga selanjutnya, MU menang 4-0 atas Wigan Athletic dan 2-1 atas Liverpool. Dua kemenangan itu masih ditambah dengan kemenangan di Liga Champions (1-0 atas Galatasaray) dan Piala Liga Inggris (2-1 atas Newcastle United). Seperti yang diperlihatkan dalam laga melawan Southampton, The Red Devils kerap menang, meski performa mereka tidak impresif. Sabtu (29/9), MU akan menghadapi Tottenham Hotspur di Old Trafford. Sang calon

lawanpunyacatatanduakemenangandalam dua laga terakhir. Jermain Defoe juga mulai tajam lagi. Striker internasional Inggris itu sudah mencetak tiga gol dalam dua pertandingan terakhir di Premier League. Spurs punya kans untuk menyulitkan. Namun,MUpunyarekorbaguskalamenghadapi Spurs di Old Trafford. Dalam empat pertemuan terakhir di liga, MU selalu meraih kemenangan. Catatan terbaik Spurs di Theatre of Dreams dalam pertandingan liga tujuhtahunterakhiradalahmenahanimbang 1-1 pada musim 2005/2006. Hanya saja, akhir pekan ini MU tidak akan diperkuat oleh Nemanja Vidic. Kapten asal Serbia itu dipastikan absen selama dua bulan karena mengalami cedera lutut. Kemungkinan, Sir Alex Ferguson akan kembali mengandalkan Rio Ferdinand dan Jonny Evans di sebagai duet bek tengah. Sementara Wayne Rooney yang cedera ketika melawan Fulham sudah bisa dimainkan lagi. Rooney turun sebagai starter dalam lagamelawanNewcastle,meskitidakbermain selama 90 menit. (int)

„ Douglas Maicon

Lini Belakang City Harus Dibenahi MANCHESTER- Bek anyar Manchester City Douglas Maicon, menyoroti kelemahan yang ada pada timnya. Ia menilai titik lemah tim asuhan Roberto Mancini itu terletak pada lini pertahanan. Hingga pekan ke lima Premier League, gawang The Citizens memang cukup banyak kebobolan. Tercatat, gawang yang dikawal oleh Kiper Joe Hart itu sudah kemasukan tujuh gol. Terakhir, jawara Premier League musim lalu itu harus kalah 2-4 oleh AstonVilladanmembuatmerekatersingkirdiajangCapitalOneCup2012/ 2013. Maicon sendiri yakin lini belakang akan menjadi perhatian khusus bagi Mancini di musim ini. “Saya mengetahui bahwa Roberto akan fokus terhadap hal tersebut (pertahanan). Ia ingin kami segera memperbaiki semuanya dan terus berkembang secepat mungkin,” ujar mantan bek Inter Milan ini. “Kami tak ingin poin kami ketinggalan jauh poin dengan pemuncak klasemen. Pelatih tak menyukai kami kebobolan dan kami cukup bersemangat mengatasi hal itu. Kami akan lebih bekerja dengan keras dan kembali fokus,” pungkasnya, seperti dilansir Daily Mail. (int)






Edisi 73 „ Tahun IX


Duel dengan Orang Gila, Rahmat Roboh Ditikam Pasca Banjir Barus, Pemkab Dirikan Posko BARUS- Pasca banjir melanda sejumlah desa di Kecamatan Barus, Pemkab Tapteng bersama Badan Nasional Penanggulangan Bencana (BNPB) Provinsi Sumut mendirikan posko satgas penanggulangan

bencana di Kantor Camat Barus. Demikian dikatakan Camat Barus Drs Herman Suwito didampingi anggota BNPB Pro‹ ‹ Baca


Besok, Listrik Padam Mulai Jam 9 Pagi Hingga Jam 5 Sore SIBOLGA- Sehubungan dengan adanya pemeliharaan berkala, besok, Sabtu (29/ 9) mulai pukul 09.00 WIB hingga pukul 17.00 WIB, PT PLN (persero) Area Sibolga akan melakukan pemadaman listrik di beberapa daerah di Kota Sibolga dan Tapteng. Hal ini ditegaskan oleh Manajer PLN Area Sibolga melalui Staf Humas Muji, ‹ ‹ Baca

Besok, ..Hal 6

Kompak Minta Kasus Sintong Dihentikan SIBOLGA- Ratusan massa yang tergabung dalam Koalisi Masyarakat Peduli Keadilan (Kompak) melakukan aksi unjukrasa di kantor Kejaksaan Negeri (Kejari) Sibolga dan Pengadilan Negeri (PN) Sibolga, Kamis (27/9). ‹ ‹ Baca

Mengamuknya Anto sempat membuat heboh dan ketakutan warga sekitar. Pasalnya, Anto membawa sebilah pisau dan melempari rumah


„ Tersangka Asfian alias Anto.

salah satu warga. Tak ayal, Rahmat (35) tetangganya yang hendak menenangkan Anto, terkena empat tikaman. Data dihimpun METRO di lokasi kejadian, sore itu tiba-tiba Anto keluar dari rumahnya membawa sebilah pisau dan langsung melempari rumah Rahmat. Rahmat yang baru tiba di lokasi, langsung berusaha menenangkan Anto. Melihat Rahmat, Anto bukannya tenang malah semakin mengamuk. Bahkan, antara Rahmat dan Anto terjadi perkelahian. “Mereka (Anto dan Rahmat) sempat duel, sebelum akhirnya Anto

membabi buta mengayunkan pisau yang dipegang ke tubuh Rahmat,” kata beberapa warga yang ditanyai METRO. Sementara, petugas Polres Asahan yang tiba di lokasi kejadian atas laporan warga, hampir tidak bisa berbuat apa-apa karena melihat Anto masih memegang pisau masuk ke dalam Baca rumahnya setelah berduel dengan Rahmat yang dilarikan warga untuk mendapat pertolongan. Hal...6 Ketika di dalam ru-



AROGAN- Reaksi massa Aliansi Masyarakat Sibolga Julu atas sikap arogan dari awak harian Rakyat Tapanuli yang pemberitaannya dinilai tak mempedomani kote etik jurnalistik, Kamis (27/9).

Pasca..Hal 6

„ Tampak salah seorang warga sedang membersihkan lumpur di rumahnya akibat banjir yang melanda desa tersebut.

„ Muji

KISARAN- Pria yang dikenal memiliki penyakit jiwa (kurang waras,red) bernama Asfian alias Anto (50), warga Jalan Mangun Sarkoro Kelurahan Kisaran Baru Kecamatan Kota Kisaran Barat, tiba-tiba mengamuk, Kamis (27/9) sekitar pukul 16.00 WIB.

Kompak Minta..Hal 7

Keluarga Trauma, Terkucil

dari Pergaulan Sosial Dampak Berita HIV/AIDS, Kantor Harian RT Didemo

SIBOLGA- Puluhan massa yang tergabung dalam Aliansi Masyarakat Sibolga Julu mendatangi kantor Harian Rakyat Tapanuli di Sibolga, Kamis (27/9) siang. Mereka menuntut agar redaksi media itu itu menyampaikan permohonan maaf atas penyajian berita yang dinilai tidak mempedomani kode etik jurnalistik. Berita yang dinilai tidak etis itu adalah pemberitaan berisi vonis terhadap salah seorang warga Sibolga, dinyatakan positif menderita penyakit AIDS (Aquired Immune Deficiency Syndrome), tanpa ada bukti pemeriksaan medis yang dapat dipertanggungjawabkan. Dalam berita terbitan Senin 3 September 2012 itu, nama dan alamat penderita dituliskan secara lengkap. Akibatnya, warga sekitar kediaman orang yang divonis menderita AIDS, menjadi resah. Meski or‹‹ Baca

Keluarga Trauma..Hal 6

Berakhir Ricuh & Nyaris Adu Jotos

SIMAMORA) pan kantor harian tagalung berorasi di de y ORASI- Sonn Lee Hu rot es pe mb eri taa n ya ng din ila i tak mp Ra ky at Ta pa nu li me /9). k jurnalistik, Kamis (27 eti te ko mempedomani


AKSI unjuk rasa Aliansi Masyarakat Sibolga Julu ke kantor Harian Rakyat Tapanuli semula berjalan tertib dan kondusif. Massa membentuk kelompok di depan kantor dan mengutarakan tuntutan mereka melalui orasi. Puluhan petugas dari Polres Sibolga tampak mengawal jalannya aksi. Namun, adu argumen dengan nada suara tinggi muncul di sela penjelasan pemimpin redaksi media itu, Soaloon M Simatupang. Sebab, penjelasan itu ‹ ‹ Baca

Berakhir ..Hal 6

Menelusuri Jejak Sejarah Perkembangan Islam di Negeri Komunis China (1)

Nisan pun Padukan Kutipan Alquran dan Simbol Agama Lain FOTO:JONTER SINAGA

DEMO POLRES: Ratusan warga dari Desa Pandumaan dan Sipitu Huta, Kecamatan Pollung saat melakukan aksi demo ke Mapolres Humbahas, Kamis (27/9).

Warga Pandumaan-Sipitu Huta Demo Polres Humbahas

Tolak Pemanggilan 8 Warga DOLOK SANGGUL- Lima ratusan warga Desa Pandumaan dan Sipitu Huta, Kecamatan Pollung, Kabupaten Humbang Hasundutan, mela-

kukan aksi demo ke Mapolres Humbang Hasundutan, Kamis (27/9), menolak pemanggilan ‹ ‹ Baca

Tolak ..Hal 6

Islam memiliki sejarah panjang dan hebat di China, negeri yang sampai saat ini masih mempertahankan komunisme sebagai ideologi negara. RUKIN FIRDA, Quanzhou MASJID QINJING, Quanzhou. Waktu menjelang salat Ashar ketika tiba di sana pekan lalu. Tahu dari Indonesia dan muslim, sang takmir, Huang Wenkeng, pun mengajak bersiap salat karena sebentar lagi Ma Yubilai, imam masjid terbesar di Provinsi Fujian itu, bakal datang. Selesai berwudu, saya masuk kembali ke dalam masjid. Huang dan Ma (artinya Muhammad) yang berbaju gamis dan peci bundar putih telah bersiap. Celingukan ke kanan-kiri, ternyata memang hanya ada tiga orang di masjid tersebut. Jadilah, kami salat


„ Wartawan Jawa Pos Rukin Firda (kanan) bersama Imam Masjid Qinjing Quanzhou Ma Yubilai.

hanya bertiga. Bukan karena saat Ashar masih banyak jemaah yang bekerja. Sebelum salat, Huang memang sempat bercerita, masjid besar itu terasa semakin ”besar” karena sepinya jamaah yang mendirikan salat di sana setiap hari. ”Saat salat Jumat pun jemaahnya tidak lebih dari 80 orang. Itu pun sudah ditambah warga asing yang tinggal di sini. Di hari-hari biasa, jumlah jemaahnya bahkan tidak lebih dari hitungan jari sebelah tangan, apalagi yang di kampungkampung,” kata Huang. ‹ ‹ Baca

Nisan pun ..Hal 7



28 September 2012

Sejahterakan Warga Melalui Beternak Ayam BARUS- TNI bekerja sama dengan Pemkab Tapteng dan Bank Indonesia (BI) menyejahterakan masyarakat melalui beternak ayam di pedesaan. “Ini sudah menjadi salahsatu tugas TNI sesuai UU No 34 Tahun 2004 untuk membantu pemerintah dalam meningkatkan perekonomian rakyat,” ujar Danrem 023/KS Kolonel Andhika Perkasa saat meninjau pondok ternak ayam bertelur dan ayam potong milik Takmar Hutabarat di Desa Bukit Hasang, Kecamatan Barus, Rabu (26/9). Danrem didampingi Bupati Tapteng Raja Bonaran Situmeang, Dandim 0211/TT Letkol (Inf ) Goodman Siagian menjelaskan, bentuk kerja sama TNI dengan pemkab dan BI untuk membantu pemerintah dalam mencari bantuan untuk diberikan kepada kelompok peternak ayam maupun sapi. “Bantuan yang diberikan sebanyak 1.000 ekor. Dalam waktu tiga bulan, ternak tersebut sudah bisa memproduksi. Ukurannya mencapai 1 kg per ekor dengan harga jual Rp20 ribu per kg. Artinya, setiap pondok (tempat, red) sudah dapat menghasilkan Rp200 juta,” jelas Andhika seraya mengatakan, bantuan yang diberikan ke mas-

yarakat mulai memberi bibit hingga pemasarannya. “Selain memberi bibit, kita juga bantu warga memasarkan. Dengan demikian, usaha warga bisa berkembang dan berkelanjutan,” harapnya. Sementara Bupati Tapteng Raja Bonaran menjelaskan bentuk kerja sama yang diprogramkan ketiga lembaga itu. Misalnya, modal dibantu Bank Indonesia, sedangkan tehnik kesehatan ternak dan pengembangannya ditangani pemkab itu sendiri, dan TNI bantu memasarkan. Selain ternak ayam, pemkab juga bakal menerima bantuan ternak sapi sebanyak 5.000 ekor yang akan diberikan kepada masyarakat melalui kelompok peternak sapi di desa-desa. “Berdoalah agar pembangunan ini dapat berjalan lancar,” imbau bupati. Turut hadir dalam peninjauan pondok ternak di Barus antara lain, Ketua TP PKK Tapteng Normaida Br Simatupang, Kadis Pertanian dan Peternakan Dompak Simajuntak SP MM, Kadis Kesehatan Dr Margan Sibarani, Kadis Parwisata Budiman Ginting SH, Kabag Humasy Iwan RM Sinaga SH, Ketua Komisi A DPRD Tapteng Bahktiar Ahmad Sibarani. (mas/des)

PPM Apresiasi Capaian Pembangunan PANDAN- Pengurus Cabang Pemuda Panca Marga (PC PPM) Tapteng mengapresiasi sejumlah capaian pembangunan di Tapteng. Seperti perbaikan jalan, penataan objek-objek wisata, peningkatan di sektor pertanian, kesehatan dan pendidikan, serta lainnya. “Kami tidak sepakat jika ada pihak yang menilai tidak ada capaian pembangunan di Tapteng pada era kepemimpinan kepala daerah sekarang. Buktinya bisa kita lihat sendiri. Perbaikan dan pembangunan sejumlah ruas jalan, baik jalan negara, provinsi maupun jalan kabupaten,” ujar Ketua PC PPM Tapteng terpilih Zimmi Saragih di Pandan, kemarin. Zimmi didampingi Wakil Ketua dr Timbul Pasaribu, Wakil Sekretaris Rafil Nainggolan SSos, Danru Resimen Yudha Putera, dan staf Sekretariat Hanum alias Cewek Imut Sinta, dan Deli. Kemudian, sambung Zimmi, Pemkab Tapteng juga mulai menata sejumlah objek wisata andalan. Seperti, Pantai Kahona dan Pantai Kalangan di Pandan. Lalu, ada juga rencana pencanangan Pulau Mursala sebagai kawasan ekowisata dilengkapi fasilitas dan sarana yang dibutuhkan. Di sektor pertanian, Zimmi mengapresiasi ide cemerlang pemkab yang mengajak masyarakat umum bergotong-royong memperbaiki irigasi persawahan

Sitangkurak, Kecamatan Barus Utara, baru-baru ini. Dampaknya, ada peningkatan anggaran dan bantuan yang sangat drastis ke sektor itu. “Tahun ini BDB provinsi untuk pertanian Rp12 miliar, DAK Rp4,3 miliar, serta bantuan puluhan hand traktor, serta pupuk organik dan benih-benih unggul. Apa itu bukan capaian pembangunan namanya,” timpal Zimmi seraya menyebutkan PC PPM dalam waktu dekat akan membuat suatu kerja sama berupa kebun percontohan pertanian bersama petani dan Pemkab Tapteng melalui dinas terkait. Zimmi juga menaruh salut atas pembangunan gedung baru RSUD Pandan yang masih dalam tahap pengerjaan, peningkatan puskesmas menjadi RSU Barus. Kemudian peningkatan fisik gedung Asrama Haji Pinangsori yang diharapkan dapat rampung tahun depan. Selain itu, masih Zimmi, beberapa gedung sekolah baru sedang dan akan dibangun di sejumlah kecamatan di daerah berjuluk Negeri Wisata Sejuta Pesona itu. “Ini pun adalah capaian pembangunan yang luar biasa,” pungkas Zimmi seraya menyerukan agar penilaian capaian pembangunan di Tapteng yang santer dilontarkan beberapa pihak belakangan ini hendaknya objektif dan berimbang. (mora)

Siswa Berprestasi Peroleh Beasiswa TAPSEL- Para siswa-siswi berprestasi tingkat SD,SMP dan SMA sederajat memeroleh besosiswa dari PTPN III Kebun Batang Toru Distrik Tapanuli Selatan (Tapsel). Bantuan ini merupakan bentuk kepedulian perusahaan perkebunan di bidang pendidikan. Demikian disampaikan Asisten Personalia Kebun Batang Toru Edi S Ginting kepada wartawan di Padangsidimpuan, baru-baru ini. Dijelaskan, total bantuan yang disalurkan bagi siswa berprestasi disekitar perkebunan PTPN III Bt Toru itu senilai Rp94.000.000 yang disalurkan kebeberapa sekolah antara lain, SD Negeri 101210 Aek Pining, SD Negeri 101140 Batang Toru. Selanjutnya, SMPN 1 Batang Toru, SMPN 2 Batang Toru, Mts Negeri Batang Toru, Mts Syekh Ahmad Basir Parsariran, SMAN 1 Batang Toru, SMKN 1 Batang Toru dan Madrasah Aliyah

Nahdatul Ulama Batang Toru. “Inilah salah satu bukti jika PTPN menilai pendidikan sebagai hal yang penting bagi kehidupan manusia, karena mampu membuka jendela pengetahuan dunia yang digunakan sebagai ilmu membangun bangsa dan Negara. Kemajuan dunia pendidikan adalah tanggung jawab bersama antar pemerintah, perusahaan dan masyarakat luas,” terangnya. Diharapkannya, program beasiswa ini dapat meningkatkan prestasi akademik para anak didik sekaligus mampu mempererat hubungan antara masyarakat dengan PTPN III yang selama ini terjalin dengan baik. “Moga beasiswa ini memperkokoh tali silaturahmi antara PTPN III dengan masyarakat dan mampu meningkatkan motivasi para siswa untuk dapat lebih berprestasi kedepan,” harapnya. (int)

Foto: Masril Rambe

TINJAU: Bupati Tapteng Bonaran Situmeang bersama Danrem 023 Andhika meninjau lokasi peternakan ayam di Desa Bukit Hasang, Kecamatan Barus.

Kasus Calo PNS Dishub dan Bidan PTT Kutip Rp50 Juta

Fernando Ngaku Terima Rp49 Juta SARUDIK- Fernando Siregar (43) warga Hapesong, Kecamatan Batangtoru, Tapsel, yang dituding menerima uang untuk keperluan mengurus agar bisa masuk jadi PNS mengaku telah menerima Rp49 juta bukan Rp50 juta seperti yang disebutkan Sariani br Hutabarat (korban, red). “Saya benar menerima uang Rp49 juta bukan Rp50 juta. Sebab yang Rp1 juta itu diperuntukkan buat ongkos yang diberikan korban secara sukarela,” kata Fernando kepada Majelis Hakim di ruang sidang Pengadilan Negeri (PN) Sibolga, Kamis (27/9). Pantauan METRO, usai Jaksa Penuntut Umum (JPU) Aggia Y Kesuma SH membacakan dakwaan, dilanjutkan dengan keterangan saksi-saksi. Sariani br Hutabarat (50) warga Dusun Goring-goring, Kelurahan Sibuluan Nauli, Tapteng, dalam kesaksiannya menerangkan, aksi penipuan yang dilakukan Fernando dengan modus dia bisa memasukkan dua anaknya menjadi Pegawai Negeri Sipil (PNS). Yakni, P br Panggabean sebagai bidan Pegawai Tidak Tetap (PTT) di Taput dan DC Panggabean sebagai PNS di Dinas Perhubungan Tapteng. Sejak itu, Fernando mulai meminta biaya keperluan pengurusan kerja kedua anaknya hingga jumlahnya mencapai Rp50 juta. Namun, beberapa bulan setelah perjanjian itu, Fernando belum juga merealisasikan pekerjaan itu. Hingga akhirnya Sariani muak dan me-

ngadukan terdakwa ke polisi. Dikisahkan Sariani, aksi penipuan ini berawalnya ketika Mesniati br Sinaga (40) warga Lingkungan III, Kelurahan Sibuluan Nauli, yang juga saudara korban mempertemukan Fernando dengan korban. Kepada Sariani, Mesniati mengatakan kalau Fernando bisa memasukkan anaknya jadi PNS. Mengingat Mesniati masih saudara, Sariani bersama putri kembarnya langsung datang menemui Mesniati. Di rumah Mesniati, Sariani dipertemukan dengan Fernando. Di rumah itu, Fernando menyarankan agar mempersiapkan berkas untuk dikirim ke Jakarta. “Biaya pengiriman diminta dia (Fernando, red) Rp2 juta. Karena percaya, saya langsung berikan ke dia berikut berkas yang dia minta. Kemudian, saat memberi berkas itu, saya bercerita bahwa surat izin bidan putri saya belum ada. Lagi-lagi dia menawrkan bisa mengurusnya dengan meminta uang Rp3 juta. Mendengar ucapannya itu, saya juga memberi uang yang dia minta itu,” beber korban. Sekitar dua minggu sejak penyerahan berkas, Mesniati dia minta agar menghubungi

Fernando untuk mempertanyakan perkembangan berkas anaknya. Saat dihubungi melalui selulernya, Fernando mengaku berkas P br Panggabean sudah dikirim ke Jakarta. Namun untuk mempercepat proses SK Bidan PTT yang dijanjikan, Fernando kembali meminta uang pengurusan sebesar Rp5 juta. Lalu secepatnya Sariani menyuruh putrinya Veronika br Panggabean mentransfer uang yang diminta ke nomor rekening milik Fernando di Bank Sumut Cabang Balige. “Sekitar bulan Maret, Mama meminta saya mentransfer uang ke nomor rekening Fernando sebesar Rp5 juta, kemudian bulan April Rp5 juta,” timpal Veronika yang turut memberi kesaksian di ruang sidang. Kemudian, bulan April, Fernando kembali datang dan meminta uang pengurusan sebesar Rp35 juta. Selain untuk mengurus putrinya menjadi bidan PTT, juga mengurus berkas anaknya DC Panggabean sebagai Pegawai Negeri Sipil (PNS) di Dinas Perhubungan Tapteng. “Uang itu saya serahkan di rumah Mesniati. Tetapi setelah penyerahan uang itu, Fernando menghilang dan pekerjaan yang dijanjikan tak kunjung ada. Saya mulai curiga dan melaporkan Fernando ke polisi,” terang Sariani. Keterangan Sariani dikuatkan Mesniati br Sinaga termasuk penyerahan uang kepada terdakwa. Sebab, transaksi pe-


Fernando Siregar di kursi pesakitan PN Sibolga. nyerahan uang yang dilakukan di rumahnya sebanyak 3 kali, namun hanya dua kali pakai kwitansi. Tetapi penyerahan uang Rp35 juta tersebut tidak ada kwitansi. Mesniati menerangkan, pertemuannya dengan Fernando juga sangat singkat. Awalnya, Fernando datang ke warung miliknya yang ada di sekitar pinggiran Sungai Sibuluan bersama abang iparnya L Parhusip. Saat itu Fernando menawarkan jasa untuk mengurus surat ijin pariwisata warungnya. Namun saat itu dia menolak, lalu Fer-

nando mengatakan kalau masalah pembayaran bisa dilakukan setelah surat izin keluar. Kemudian keesokan harinya Fernando datang menjemput foto copy KTP dan pas photo. “Pagi harinya dijemput, siangnya sekitar pukul 14.00 Wib surat izin itu sudah diantar dia (Fernando,red) kepada saya. Surat izin itu saya bayar Rp700 ribu,” terang Mesdiati. Sebelumnya, JPU menjerat Fernando dengan Pasal 378 subsider Pasal 372 KUHPidana tentang penipuan atau penggelapan. (cr-1)

Tingkatkan Mutu Kesehatan 5 KDH se-Tabagsel gelar Pertemuan Regional SIDIMPUAN- Salahsatu kebutuhan utama masyarakat adalah pelayanan kesehatan yang baik danbermutu.Sayangnya,harapan tersebut masih belum sempurna diperoleh oleh masyarakat. Kadang, masyarakat menghiba dan seperti mengemis kepada pemerinmtah untuk memeroleh pelayanan, apalagi masyarakat dari keluarga miskin. Sepakat baha mutu pelayanan mutu kesehatan perluditingkatkan,LimadaerahseTapanuliBagianSelatan(Tabagsel) Rabu (26/9) kemarin menggelar pertemuan regional lintas batas di bidang kesehatan. Rapat ini merupakan tindak lanjut Keputusan Bersama 5 kepala daerah (KDH) yakni Bupati Tapsel, Bupati Madina, Walikota Psp,BupatiPalutadanBupatiPalas pada tertanggal 15 Desember 2011 lalu, tentang Kerjasama Antar Daerah (Lintas Batas) di Bidang

Kesehatan Kabupaten Tapsel, Madina, Kota Psp, Kabupaten Paluta dan Palas. RapatyangdigelardiruangBeringin Kantor Bupati Tapsel, di Jalan Kenanga, Kota Psp, dibuka Bupati Tapsel, H Syahrul M Pasaribu diwakili Asisten I, Aswad Daulay, dihadiri mewakili Bupati 5 daerah, anggota DPRD, tim work kesehatan dari Propinsi Sumut yaitu dr Nasroel Siregar SKM, drs Amir Hood APt, Drs Smru Nasution Mkes, dr Azwar Lubis, Gayo Nelkior Gultom SH Mkes, Kholikul Kamal SKN dan Swandi Simanjuntak SKM Mkes, para Kadiskesse-TabagselsepertiKadiskes Tapsel, dr Alisyahbana Siregar SP THT serta lainnya. Ketika pembuatan Surat Keputusan (SK) lima kepala daerah tersebut disaksikan Plt Gubsu, Gatot Pudjo Nugroho ST. SK menyebutkan,kerjasamamerupakan

upayamewujudkanprogramyang sinergisdibidangkesehatandalam rangka mengingkatkan kualitas pelayanan kesehatan kepada masyarakat. Tujuan SK 5 kerpala daerah ini, untuk meningkatkan mutu pelayanan kesehatan dan derajat kesehatan masyarakat yang dapat dilakukan secara bersama-sama tanpa terhambat oleh batas wilayah adminsitrasi. Soal ruang lingkup, sesuai keputusan bersama tersebut meliputi bidang promosi kesehatan dan pemberdayaan masyarakat dan lingkungan sehat, upaya peningkatakan pelayanan kesehatan masyarakat dan perorangan khususnya bagi masyarakat miskin, berbatasan dan tertinggal khususnya masyarakat yang tidak ditampung dalam program Jamkesmas. Kemudian, pencegahan dan pemberantasan penyakit dan perbaikan gizi masyarakat, obat dan


PERTEMUAN- Pertemuan 5 daerah lintas batas se-Tabagsel yang membahas bidang kesehatan yang bertujuan meningkatkan mutu pelayanan dan derajat kesehatan masyarakat yang dilakukan bersama-sama tanpa terhambat batas wilayah adminsitrasi, Rabu (26/9). perbekalan kesehatan, sumber daya kesehatan dan manajemen serta kebijakan kesehatan. Seterusnya, penanggulangan penyakit akibat bencana, pelatihan dan simulasi penanganan (penyakit menular, bencana, gizi buruk dan pelayanan kesehatan), penyusunan prosedur tetap pe-

nanganan(penyakitmenular,bencana, gizi buruk dan pelayanan kesehatan), mobilisasi tenaga medis (medis dan para medis), obat dan perbekalan, mobilisasi sarana dan prasarana kesehatan (pemerintah dan swasta) serta penerimaan dan pendistribusian bantuan. (neo/mer)


28 September 2012 “Kami tidak tergesa-gesa soal ini. Kami inginkan yang terbaik. KPK sangat dibutuhkan saat ini. Kalau sampai keberadaanya tidak memiliki kekuatan, itu tidak baik juga,” Ketua Baleg Ignatius Mulyono.

Kirim Opini Anda ke email: metrotapanuli Maksimal tulisan 5.000 karakter

“Kami mendukung hukum mati bila memang yang dikorpsi jumlahnya besar dan mengakibatkan kerusakan yang masif terhadap perekonomian dan kehidupan bernegara. Jumlahnya mungkin di atas 100 miliar,”

Ketua Fraksi PKS Hidayat Nur Wahid.

Anggota Badan Legislatif Dimyati Natakusumah.

Wujudkan Pendidikan Berkeadilan

Sikap Kami Ancaman terhadap Supremasi Sipil PEMERINTAH dan DPR memang rajin membuat undangundang meski sering muatan undang-undang itu kandas di Mahkamah Konstitusi. Lebih memprihatinkan lagi, undangundang itu bukanlah aturan yang mempunyai tingkat urgensi tinggi. Salah satu rancangan undang-undang (RUU) yang disodorkan pemerintah ke DPR untuk dibahas saat ini ialah RUU tentangKeamananNasional.RUUitupernahdikembalikanDPR, tetapi diajukan lagi tanpa revisi. Sejumlah pasal dalam RUU itu beraroma militeristis. Artinya ingin membawa kembali TNI ke dalam urusan keamanan. Pasal 17 RUU Keamanan Nasional, misalnya, menyebutkan ancaman keamanan nasional di segala aspek kehidupan dikelompokkan ke dalam ancaman militer, ancaman bersenjata dan ancaman tidak bersenjata. Definisi itu abu-abu sehingga membuka ruang bagi TNI untuk berkiprah seperti di era Presiden Soeharto. Kita tegaskan bahwa semangat membawa TNI ke fungsi keamanan bertentangan dengan reformasi. Reformasi menempatkan TNI pada fungsi pertahanan, sedangkan fungsi keamanan dijalankan polisi. Membawa TNI ke ranah keamanan dikhawatirkan mengancamkebebasansipil,mencederaidemokrasi,danmenciptakan iklim represif. Kelak, dengan dalih mengganggu keamanan nasional,siapasajayangbersuarakritisbisadibungkam.Persyang mengkritik pemerintah bisa dengan mudah dipanggil menghadapi aparat keamanan. Definisi yang longgar dan ruang penafsiran yang elastis sangat memudahkan aparat keamanan melakukan tindakan menghabisi supremasi sipil dan kebebasan. Apalagi jika aparat keamanan diberi kewenangan khusus untuk menyadap, menyita, dan menggeledah. Kita mempunyai pengalaman panjang di rezim Orde Baru. Keterlibatan militer dalam banyak aspek kehidupan telah mengunci rapat-rapat hak sipil. Kita tidak ingin itu terulang. Bangsa ini sudah memiliki UU tentang Kepolisian, UU tentang Intelijen, UU tentang Keormasan, dan banyak undang-undang lainnya. Semua itu mengatur keamanan nasional dan membangun supremasi sipil. Jangan sampai hak-hak sipil dan kebebasan diberangus UU Keamanan Nasional. KitakhawatirRUUKeamananNasionaldibuatkarenamaraknya demonstrasimenentangkebijakanpemerintah.KitakhawatirRUU KeamananNasionaldisusunkarenamunculnyapenembakliardi Papua, Aceh, dan beberapa tempat lain. Gangguan keamanan itu mestinya bisa dipadamkan polisi. Jangan sampai ada anggapan kebebasansipilmembahayakannegara.Janganpulaadaanggapan supremasi sipil mengkhawatirkan bangsa. Kita ingatkan bahwa dinamikasipiltidakbolehdihadapidenganmengerahkanmiliter. Partaipolitikmestinyabertanggungjawabmengelolakebebasandan supremasisipil.Namun,partaipolitikhanyabisamemolitisasirakyat danmembawarakyatkedalamkepentingansempit. Meski partai politik mandul mengelola supremasi sipil, kewenangan itu tidak boleh diserahkan kepada TNI. Kita tidak ingin UU Keamanan Nasional memuat pasal-pasal virus yang menggerogoti supremasi sipil. Karena itu, sebaiknya DPR mengembalikan saja RUU itu ke pemerintah. (**)

“Saya nilai KPK ini masih rendah dalam penegakan hukum. Istilahnya kesalahan di depan mata tidak kelihatan tapi yang diufuk timur keliatan. kasus besar gak keliatan, tapi kasus kecil keliatan,”

Pendidikan merupakan modal penting dalam pembangunan. Tanpa pendidikan yang baik, sebanyak dan sebesar apapun sumber daya alam yang kita miliki akan berujung dengan kegagalan dan kesia-siaan. Tanpa pendidikan yang mumpuni hanya menghasilkan generasi lemah dan miskin kreasi. Terbukti, tata kelola sumber daya alam di negeri ini banyak dikuasai bangsa mancanegara. Sebab sumber daya manusia Indonesia masih gagap menghadapi perkembangan zaman.



CELAKANYA,pendidikandiIndonesiamasihdiskrimantif. Alhasil, diskriminatif yang makin masif mengorbankan pelbagai potensi. Apakah kita lupa atau memang tidak menyadari bahwa, pendidikan yang diskriminatif sungguh kontraproduktif? Pendidikan yang dijalankan adalah pendidikanpenuhkepalsuan.Pendidikanyangdiskriminatif, disadari atau tidak, sudah mengingkari kodratnya sebagai salah satu cara memuliakan manusia. Tesmasuk Tentusajakorbanpertamadanutamadarilakudiskriminatif adalahparamuriddanguru.Salahlangkahdalammengelola pendidikan sejak mula dilakukan ketika pendaftaran siswa baru. Pada pendidikan dasar dan menengah, baik di sekolah negeri maupun swasta akhir-akhir ini kerap mengadakan tes saringanmasuksekolah.Sejumlahsekolahdasaryangkadung disebut elitedanbonafideengganmenerimasiswabaru yang belum bisa membaca, menulis, dan menghitung (calistung). Maka terkumpullah siswa-siswa yang dikatakan pandai di satu sekolah. Terkum pul pula siswa yang digolongkan bodohdisekolahlain.Jelasinimenyalahiaturan.Sebabsyarat utama siswa untuk mengenyam pendidikan dasar adalah cukupumurdanlokasisekolahdekatdenganrumah.Dengan kata lain siapa yang mendaftar di awal, jika masih ada kuota, maka siswa tersebut mesti segera diterima. Sekolah bisa dikatakan bagus dan sukses bila menerima semua siswa tanpa labelisasi hingga semua siswa lulus sesuai dengan kemampuan yang dimiliki. Oleh karena itu, hentikan tes masuk untuk pendidikan dasar dan menengah! Sekolah harus mau dan mampu menghadapi semua siswa, tanpa mempermasalahkan tingkat kecerdasannya.

Fasilitas Sementara itu, untuk mengenyam pendidikan masih banyak penduduk negeri ini mesti berjalan kaki puluhan kilo meter dengan menuruni lembah, menyeberang sungai dan lautan. Ketika di ruang belajar-mengajar guru dan murid itu selalu dihinggapi kekhawatiran karena atap sekolah terancam runtuh. Manakala membutuhkan kepustakaan atau alat peraga mereka hanya bisa berharap karena fasilitas yang dijanjikan tak kunjung datang. Saat hendak mendapat dana bantuan, mereka kerap kecewa karena dana itu selalu telat dan nominal yang diterima sudah menyusut di tengah jalan. Ketika tidak adanya pemerataan pendidikan, jangan seenaknya menyamakan mereka dalam format ujian nasional, misalnya. Ketika tidak ada ketenangan dalam menempuh pendidikan, jangan terlalu berharap menghasilkan peserta didik yang berkualitas wahid. Anak-anak memang selalu menjadi korban. Mereka adalah korban dari kebijakan yang tidak berkeadilan. Mereka adalah korban dari sejumlah kepentingan yang menguntungkan sebagian golongan. Masa ceria anak-anak dan masa depannya sejak dini sudah dirampas orang-orang yang tak berperikemanusiaan. Beban pelajaran Tak percaya? Saat mendampingi anak-anak Sekolah Dasar IslamAl-Azhar27Cibinongdalamekskulsastradanjurnalistik saya kerap menghadapi anak yang mengeluh dengan sejumlah pelajaran yang terus bertambah. Keluh-kesah yang salah satunya dilontarkan oleh Sinta Oktaviani Wahyu Widodo, saya sarankan ditulis dalam bangunan cerpen. Beruntung dimuat koran Pikiran Rakyat, Minggu, 29-5-2011. Dalam cerpen berjudul “Canat-cenut di Kelas Empat,”

seperti yang diapresiasi Etti RS, cerpen itu menyajikan topik tentang pelajaran di sekolah. Melalui tokoh bernama Caca, tergambarlah beban pelajaran di kelas empat sekolah dasar yang begitu banyak. Caca seolah mewakili kenyataan zaman sekarang tentang muatan mata pelajaran di sekolah dasar yang begitu banyak dan membuat stres para siswa. Meski fiksi (anak), cerpen tetap berangkat dari kenyataan. Dan kenyatandalampendidikandasarhariiniadalahpendidikan yang membuat beban pikiran para peserta didik menjadi “cenat-cenut.” Pendidikan yang mestinya menggembirakan dan mencerahkan malah menjadi beban pemikiran. Anak-anaklah korban nyata dari perkembangan generasi tua yang memorak-porandakan Indonesia. Ketika gunung digunduli,sungaidanlautandikotori,sertakualitasalamyang terus mengalami kemerosotan anak-anaklah yang pertama mendapat“hukuman.”Atassaranparaaktivislingkungan,atas pertimbangan para pemikir, dan atas kebijakan para pejabat negara, dikeluarkanlah agar anak-anak sekolah dasar mendapatmatapelajaranpendidikanlingkunganhidup(PLH).Inti dari PLH saya setuju, akan tetapi dengan menambahkan jumlahpelajarankepadaanak-anaksudahmenjadikananak sebagai karung yang siap menampung pelbagai saran dari para pemangku kepentingan. Patut diingat, mata pelajaran standar yang saat ini mesti dihadapai anak-anak lebih dari sepuluh mata pelajaran. Dari sejumlah mata pelajaran itu umumnyaberisihapalan-hapalan. Sementara itu, menyambut internasionalisasi yang kian masif,anak-anaksekolahdasarpundiwajibkanmendapatkan muatan internasional, umumnya memilih pelajaran bahasa Inggris. Tak cukup pelajaran bahasa Inggris, sekolah yang dikatakan “bonafide,” “elite,” atau “unggul” mereka pun membagi-bagimatapelajaran:IPAdalambahasaIndonesiadan SciencepelajaranIPAdalambahasaInggris;Matematikadalam bahasa Indonesia danMath pelajaran Matematika dalam bahasaInggris.Tentusajabuku,guru,dancarapembelajarannya punberbeda.TakmaukalahdenganpelajaranbahasaInggris, untukmenyaringpembaratan(westerenisasi)parapejabatdi daerahmewajibkanmatapelajaranmuatanlokal.Misal,biladi JabarmunculmatapelajaranmuatanlokalbahasaSunda,maka diJatimadamuatanlokalke-NU-an. Kita tahu, salah satu penyakit akut Indonesia saat ini adalah ihwal korupsi. Koruptorlah yang menggerogoti kekayaan nusantara. Anak-anak juga yang mesti menanggung beban. Yaps, atas desakan pelbagai pihak maka sejak dini mesti ada pendidikan antikorupsi. Maka bertambahlah mata pelajaran yang mesti dihadapi peserta didik. Tak cukup itu, terkenang dengan masa silam, para peserta didik juga disarankan mendapatkan mata pelajaran budi pekerti. Bejibunnyamatapelajaranyangmestidihadapianak-anak adalah salah satu bentuk lain dari diskriminasi atau ketidakadilan pendidikan. Masa kanak-kanak yang baiknya diisi dengankeceriaanmalahdirecoki saran-saranbuahdaripara pemangku kepentingan dan para aktivis kemasyarakatan. Hak hidupnya untuk bermain terpaksa hilang karena mesti menghadappi banyaknya mata pelajaran. Okeh,ihwalbuku,guru,ataubiayameskisudahdanmahal bisa dicari, akan tetapi psikologi anak yang bisa stres berat karenabebanyangterpaksadiembansiapaberanimenjamin untuk mengatasi? Silakan renungkan. (***) Penulis adalahEsais; praktisi pendidikan di Kota Bogor, Jawa Barat.


Jl. Hiu No.88 Arah Laut sibolga • Tes Kadar Lemak Perut • Pemeriksaan Kepadatan tulang • Pemeriksaan Usia sel • Pemeriksaan Kadar air • Pemeriksaan Kepadatan tulang • Pemeriksaan massa otot dan ranting fisik Suplemen yang terbuat dari nutrisi buah-buahan dan sayur-sayuran 100% NUTRISI LENGKAP


• Dapat menurunkan Berat Badan 3-10kg/bulan • Dapat Menaikan Berat Badan • Menambah Nutrisi Tubuh Hubungi EFFENDY MANALU HP 0812 6307 414; 0813 7068 2243; 0852 7774 2645


Buka setiap hari SENIN s/d SABTU (Jam 08.00 - 21.00 WIB)



28 September 2012


Honda Jazz Polisi Ditabrak Anak Polisi SIANTAR- Jhonlisher Panjaitan (23), anak polisi yang bertugas di Polsek Tanah Jawa menabrak Honda Jazz silver BK 79 W milik Bripka Jepta Sitanggang, personel polisi Polres Simalungun di Jalan Ade Irma, Kamis (27/9), sekira pukul 11.00 WIB. Akibatnya korban terpaksa dirawat di RS Vita Insani. Jhonliser merupakan warga Lapangan Bola Bawah, KecamatanSiantarSelatan.SementaraBripka Jepta Sitanggang merupakan warga Jalan Rakutta Sembiring, Siantar Martoba. Informasi dihimpun METRO, sepedamotor Honda Astrea Grand tanpa plat yang dikemudikankorbanmelajudengankecepatan tinggi dari arah Pertamina menuju Pasar Parluasan. Tiba di lokasi yang berupa jalan menikung, korban tidak dapat mengendalikan kenderaannya dan langsung menabrak Honda Jazz silver yang datang dari arah berlawanan. Diduga, korban saat hendak jatuh langsung melompat dari kenderaannya sehingga tubuhnya tidak berbenturan dengan Honda Jazz tersebut. Korban lalu terjatuh ke aspal dan mengalami luka-luka di beberapa bagian tubuhnya.Sesudahkejadian,korban


lalu dibawa ke RS Vita Insani. Kondisi sepedamotor korban terlihat ringsek di bagian depan, begitu juga beberapa bagian dari sepedamotor ini ikut pecah. Sementara kondisi Honda Jazz mengalami kerusakan di bagian depan. IbukorbanNbrSianturi,ditemui di RS Vita Insani, Kamis sore menyebutkan, anaknya hendak ke tempat kawannya di Jalan Ade Irma. Suaminya merupakan personel polisi yang bertugas di Polsek Tanah Jawa. “Tadi yang menabrak juga sudah datang kemari, dia juga polisi di Polres Simalungun. Suami saya juga polisi di Polsek Tanah Jawa. Anak saya tidak mengalami luka parah, cuma pinggangnya memang masih sakit dan juga ada yangsakitdipahanya,”jelaswanita yang ditaksir berusia 40 tahunan ini. Kanit Laka Polres Siantar Iptu Sugeng Wahyudi membenarkan kecelakaan lalu lintas ini. Diduga pengendara sepedamotor tidak dapat mengendalikan kenderaannya saat menikung sehingga tergelincirdanmenabrakdepanHonda Jazz. Kedua kenderaan telah diamankan untuk kepentingan penyelidikan. (ral/dro)

SERBELAWAN- Misdi (36), warga Parluasan Barat, Kelurahan Serbelawan, Kecamatan Dolok Batu Nanggar, Simalungun, tertangkap tangan mencuri getah lumb (getah kering, red) di Afdeling D Kebun PT Brigestone, Kamis (27/9), sekira pukul 06.30 WIB. Dia ditangkap securiti (satpam) Kebun PT Brigestone saat sedang melakukan aksinya, menuangkan getah dari pohon karet ke goni plastik. Kepada METRO, Misdi mengaku, terpaksa mencuri akibat desakan keperluan biaya sekolah kedua anaknya. Sebab beberapa hari terakhir, cuaca hujan, sehingga penghasilannya dari menjual es tidak mencukupi. “Saya pedagang es keliling. Karena cuaca musim hujan, dagangan saya pun tidak laku. Sementara kebutuhan keluarga dan biaya sekolah kedua anak sudah mendesak, makanya saya terpaksa mencuri,” ujarnya. Ia mengaku, aksi pencurian itu tidak dia rencanakan, dan tiba-tiba niat mencuri karena desakan keperluan uang. Pria kelahiran 5 Mei 1976 ini, mengaku baru pertama kali mencuri, namun langsung tepergok satpam. “Bukan niat mencuri, tapi karena desakan biaya sekolah anak-anak saja,” ucapnya sambil menunduk. Supianto, Securiti Kebun PT


DIRAWATJhonlisher Panjaitan (23) dirawat di RS Vita Insani akibat kecelakaan lalu lintas di Jalan Ade Irma Suryani Siantar, Kamis ( 27/9).



Gara-gara Dahan Rambutan TetanggaDisiramAirSelokan SIMALUNGUN– Terdakwa Morlan Sitorus (45) menyiram air selokan ke wajah Parulian br Pardede, tetangganya di Huta Cinta Dame I, Nagori Bah Jambi II, Kecamatan Tanah Jawa, Simalungun. Morlan tidak terima ditegur karena memotong dahan pohon rambutan milik korban yang mengenai atap seng rumahnya. Tapi terlepas dari motif itu, ulah Morlan ini membuat citra Huta Cinta Dame ternoda. Perselisihan ini terungkap di persidangan yang digelar di Pengadilan Negeri (PN) Simalungun, Kamis (27/9), dengan agenda keterangan saksi korban. Sidang dipimpin Monalisa beranggotakan Siti Hajar dan Silvia Ningsih. Parulian br Pardede, korban yang dihadirkan jaksa Viktor Situmorang menceritakan, saat itu hari Selasa 5 Juni 2012, sekira pukul 18.00 WIB. Dia mengaku baru pulang melayat, orangtuanya meninggal dunia. “Kemudian saya menyempatkan diri memberi makan ternak di belakang rumah,” kenang korban. Dia menerangkan, saat memberikan makan ternak babi tersebut ia merasa suasana berbeda di sekitar rumahnya. Setelah diperhatikan, ternyata dahan pohon rambutan yang saat itu tengah berbuah lebat sudah dipotong terdakwa. “Saat itu, pohon ram-

butan saya tengah berbuah lebat, tapi sebagian dahannya sudah dipotong oleh terdakwa. Memang dulu terdakwa pernah meminta saya untuk menebang pohon tersebut,” akunya. Lanjut saksi korban, setelah berada di teras rumahnya ia melihat istri terdakwa Klara sedang duduk di sebelah rumahnya. Saat itu, ia pun memanggil istri terdakwa untuk mempertanyakan maksud pohon rambutan miliknya dipotong. “Setelah itu, suaminya langsung datang dan mengaku sebelumnya dia sudah memperingati saya supaya dahan pohon rambutan yang mengenai seng rumahnya ditebang. Memang saya sendiri tidak mengamini permintaan tersebut,” ujarnya. Menurut dia, tidak beberapa lama kemudian terdakwa langsung mengambil air parit dari depan rumahnya dan menyiramkan kepada dirinya. Akhirnya air parit tersebut membasahi tubuh korban. Akibat perbuatan terdakwa tersebut, ia pun melaporkan terdakwa ke Polsek Bangun. “Usai kejadian itu, dia tidak mau meminta maaf kepada saya hingga saya kesal dan melaporkan perkara ini ke proses hukum. Tapi setelah terdakwa ditangkap dan ditahan, ia langsung mendatangi saya dan meminta maaf,” sebut korban singkat. (mua/dro)


„ Misdi, pedagang es yang ketangkap tangan mencuri getah dan diserahkan ke Polres Simalungun. Kamis (27/9).

Xenia BK 1042 KC, Mobil Siapa Ini? DITEMUKAN DI SIMPANG ‘BM’

Satlantas Polsek Bangun malam itu, mendapat informasi bahwa terjadilakatunggaldiSimpang‘BM’, satu unit mobil Xenia yang melaju dari arah Siantar menuju Perdagangan menabrak pohon di pinggir jalan. Polisi kemudian langsung menuju lokasi guna melakukan olah TKP (Tempat Kejadian Perkara). Sampainya di sana, tak

satupun petugas menemukan korban di lokasi kejadian, yang terlihat hanya beberapa warga dan pengendara yang melintasi TKP. Ketepatan malam itu, menurut sejumlah warga, cuaca buruk dengan kondisi hujan deras. Walau demikian, petugas tetap membawa mobil itu ke Mapolsek Bangun. Selanjutnya, petugas mengecek beberapa rumah sakit terdekat guna mencari keberadaan identitas penumpang mobilnaasitu.Namudaribeberapa rumah sakit yang dikunjungi petugas, mereka tidak menemukan seorang pun koban laka lantas. SementaradiMapolsekBangun juga tidak seorang pun ada warga yang mengaku mengalami kecelakaan dan atau sebagai pemilik mobil naas itu sampai Kamis (27/ 9), sekira pukul 14.00 WIB. Dugaan sementara, mobil itu dirental dan disengaja ditinggal korban setelah menabrak pohon. (mag-4/dro)

ma ini dia tinggal di rumah mertua, sehingga harus pandaipandai membaca situasi. Jika rumah sepi, dia bisa leluasa memanjakan gairah asmara. Tapi jika situasi kurang kondusif, sedangkan gejolak nafsu tak bisa ditekan, di kamar mandi pun jadilah. Yang penting gairah jiwa itu terlampiaskan. Yang terjadi beberapa malam lalu seperti itu. Dia pikir mertua sudah tidur nyenyak, bersama PIL-nya Made Darti berhubu-

ngan intim di kamar mandi dengan cara berdiri. Namun celaka tiga belas, urusan itu baru saja tuntas tasss mendadak mertua keluar dan mau ke kamar mandi yang sama. Langsung Bagus Mayun lari gaya PON XVIII Pekanbaru, yang meski amburadul tapi ‘sukses’ juga. “Kami tidak berbuat apaapa,” kata Made Darti saat diinterogasi oleh mertua. Tentu saja alasan itu tak bisa diterima. Mana mungkin lelaki tetangga grumutan ke kamar mandi orang jika tanpa motif. Lebih-lebih dipergoki sedang berdua dengan Made Darti yang anak menantu sendiri. Paginya, saat Wayan Tirta pulang, kejadian malam itu diceritakan. Langsung hilanglah rasa kantuk itu, dan Bagus Mayun dilaporkan ke polisi Polsek Banjarangkan. Dalam pemeriksaan, Bagus Mayun memang mengakui segala perbuatannya, sehingga pasal perzinaan segera dijeratkan kepadanya. (int)


„ Kondisi mobil Xenia yang rinsek berat setelah diamankan petugas Satlantas Polsek Bangun, Kamis (27/9). BUKIT MARAJA- Polisi mengamankan mobil Xenia BK 1042 KC dengan kondisi rusak berat di simpang ‘BM’ (maksunya: Simpang lokalisasi Bukit Maraja), Selasa (25/9), sekira pukul 20.00 WIB.Namunsaatdiamankanpolisi tidak menemukan seorang pun penumpang mobil naas itu di lokasi. Keterangan dihimpun, petugas

Satpam Kebobolan ‘Aset’ Kasihan deh Wayan Tirta (28), dari Klungkung (Bali) ini. Sebagai Satpam tiap malam kerjanya jaga aset orang, tapi ‘aset’ milik sendiri di rumah diserobot tetangga. Bagaimana tidak? Di kala dia terkantuk-kantuk di pabrik, di rumah Made Darti (23), sang istri berbuat mesum di kamar mandi dengan lelaki tetangga. Kontradiktif kehidupan itu memang selalu terjadi di manamana. Dokter ahli penyakit dalam (internis), malah mati serangan jantung. Bapaknya tokoh agama yang suka dipanggil ceramah ke mana-mana, tapi anaknya badung minta ampun. Maka jangan heran bila Wayan Tirta yang jadi anggota Satuan Pengaman, tapi dia sendiri tak mampu mengamankan istri dari gangguan ‘burung’ jahil. Alkisah, Wayan Tirta yang tinggal di Dusun Kangin, Desa Bakas, Kecamatan Banjarangkan, Klungkung, selama ini bekerja menjadi satpam pabrik. Namanya juga satpam, malam hari mata melotot di pabrik de-

mi mengamankan aset orang. Sebaliknya, dia siang hari dia merem alias tidur di rumah, sehingga sering lupa akan kewajibannya sebagai seorang suami, di mana harus memberi nafkah lahir dan batin bagi istrinya. Made Darti istrinya memang masih muda, sehingga kebutuhan nafkah batin menjadi primadona dalam kehidupannya. Sayangnya, Wayan Tirta tak bisa memberikan secara maksimal dengan alasan capek dan ngantuk itu tadi. Jadi ibarat main bulutangkis, Satpam muda ini tak mampu lagi memberikan smash-smash tajam menukik. Bahkan yang sering terjadi, bola dikirim dengan cara backhand , sehingga sering pula malah nyangkut di net. Menghadapi kondisi suami yang demikian, lama-lama Made capek deh. Maka ketika lelaki tetangga, Bagus Mayun (34), suka towal-towel menggoda dirinya, dadanya serr-serrran juga. Maklum, suaminya sangat jarang memberikan ‘sesuatu’

Brigestone mengatakan, pelaku tertangkap tangan setelah berhasil memanen 25 kilogram getah lumb dari pohon karet. Belum sempat membawa keluar hasil curiannya itu, pelaku berhasil diamankan saat sedang masih memanen getah di Afdeling D. Dari tangan pelaku diamankan 25 kilogram getah lumb, dan sepedamotor Honda Revo BK 4402 TAD. Kemudian pelaku bersama barang bukti diserahkan ke Mapolres Simalungun, untuk diproses sesuai hukum yang berlaku. Kasubag Humas Simalungun AKP H Panggabean membenarkan telah menerima pelaku dari pihak securiti Kebun PT Brigestone bersama barang bukti getah dan sepedamotor. Untuk mempertanggungjawabkan perbuatannya, pelaku dijerat pasal 362 KUHPidana tentang Pencurian. (osi/dro)

yang selalu dirindukan. Sekali dua kali Made Darti masih bisa menghindari usaha PPD (Pegang Pegang Doang) yang dilakukan lelaki tetangga. Tapi karena serangan itu semakin intensif dan langsung pada sumbernya, akhirnya dia bertekuk lutut dan berbuka paha juga. Ternyata, tongkrongan dan ‘tangkringan’ Bagus Mayun memang selaras, serasi dan seimbang, sehingga Made menjadi ketagihan. Repotnya, sela-

SIANTAR- Remaja putus sekolah Julius Lumban Tobing (14), ditangkap saat hendak mencuri di rumah Alfin Irwansyah (22), warga Jalan Toba I, Kelurahan Kristen, Kecamatan Siantar Selatan, Kamis (27/9), sekira pukul 17.00 WIB. Ternyata aksi itu untuk yang ketiga kalinya dilakukan Julius, aksi pertama dan kedua juga di rumah korban berjalan mulus. Informasi dihimpun, Julius tinggal bersama orangtuanya di Jalan Bahagia, Kelurahan Kristen, Kecamatan Siantar Selatan. Saat itu, Julius dengan cara mengendap-endap masuk ke pekarangan rumah korban. Lalu, dia menuju kamar belakang dan berusaha membuka pintu belakang rumah korban. Namun saat berusaha membuka pintu ini, tersangka dipergoki warga sekitar rumah korban dan warga inipun langsung membekuk tersangka saat itu juga. Sementara sebagian warga menghubungi polisi. Tak lama kemudian, aparat polisi Polsek Siantar Selatan tiba di lokasi dan mengamankan tersangka. Di Polsek Siantar Selatan, Julius mengakui telah melakukan pencurian sebanyak 3 kali di rumah Alfin Irwansyah. Pertama kali pada Senin (2/7) lalu, Julius mengambil laptop merk Zyrex dan satu dompet berisi uang Rp500 ribu. Kemudian kedua kali pada Rabu (1/8), Julius kembali mencuri dan mengambil satu infocus, satu HP serta dua kaos milik Alfin. “Aku

mencuri untuk main game point blank di warnet Putri, barang yang aku curi kemudian aku jual ke tukang stiker yang ada di dekat Rumah Potong. Laptop itu kujual seharga Rp310 ribu, uangnya sudah habis bang. Kalau infocus dan HP gak ingat aku ke mana kujual dan sama siapa kujual bang dulu,” ujar remaja yang mengaku putus sekolah dari SMPN 3 ini. Korban Alfin Irwansyah mengaku, sudah dua kali kehilangan barang dari rumahnya. Namun tidak melaporkan hal tersebut ke polisi. Hal ini dimaksudkannya agar tersangka tidak melarikan diri. Sebab selama ini, dia juga sudah curiga dengan gerak-gerik tersangka yang tinggal satu kelurahan dengannya ini. “Sudah dua kali saya kehilangan, pertama laptop sama dompet, kedua HP sama baju kaos. Tidak saya lapor ke polisi Bang. Biar si pencuri itu tidak curiga. Nah, aksi yang ketiga inilah baru ketahuan dia,” ujarnya. Kapolsek Siantar Selatan AKP Giring Damanik membenarkan adanya penangkapan pencuri yang dilakukan warga Kelurahan Kristen ini. Setelah dibawa warga, kemudian di interogasi, Julius mengakui perbuatannya. “Kita juga sudah menyita barang bukti laptop dari pedagang yang membeli dari Julius. Tersangka dijerat pasal 362 KUHPidana,” ujarnya. (ral/ dro)


„ Julian Tobing (14), warga Jalan Bahagia Siantar, diamankan di Posek Siantar Selatan, Kamis ( 27/9).



28 September 2012

Berakhir Ricuh & Nyaris Adu Jotos

Duel dengan Orang Gila, Rahmat Roboh Ditikam

Sambungan Halaman 1 dinilai pengunjuk rasa tidak sesuai dengan apa harapan mereka. Soaloon tidak mengakui ada kekeliruan pada berita itu. “Berita itu adalah hasil konfirmasi wartawan kami dari sumber terkait dan sesuai hasil penelusuran di lapangan. Jadi kami tidak ada menyalahi etika pers. Karena itu kami siap menerima tantangan Anda untuk menempuh jalur hukum,” jawab Soaloon bersikeras dan menantang pendemo. Soaloon juga tidak memberi penjelasan terkait tudingan kekeliruan penulisan nama dan alamat lengkap orang yang divonis menderita AIDS tersebut seperti yang diinginkan pendemo. Bahkan, usai memberi jawaban singkatnya, Soaloon langsung masuk ke dalam kantor koran yang berada di Jalan Letjen S Parman No 77 itu. Jawaban dan sikap Soaloon itu menuai reaksi dari para pendemo. Pendemo bersikukuh bahwa ada kekeliruan soal penulisan nama dan alamat lengkap orang yang dituliskan menderita AIDS tersebut seperti isi berita. Suasana kian memanas karena salah seorang awak media tersebut dianggap meremehkan kehadiran kelompok pendemo. Karena merasa terusik, beberapa orang dari pengunjuk rasa menegur awak media tersebut. Tapi, awak koran itu tak terima dan balik menantang pengunjuk rasa. Saat itulah nyaris terjadi aksi saling adu jotos antara kedua pihak. Tapi kericuhan itu dapat segera diredam puluhan petugas kepolisian yang mengawal dan berjaga di lokasi. Setelah kericuhan mereda, koordinator massa kemudian mengajak para pendemo meninggalkan lokasi menuju titik kumpul mereka semula di Sibolga Julu. Aksi yang berlangsung sekitar 30 menit itu juga disaksikan puluhan warga dan pengguna jalan yang kebetulan berada di sekitar lokasi. (mor/nasa)

Sambungan Halaman 1 mah, Anto bersembunyi. Dan setelah pihak keluarga dilibatkan petugas membujuk Anto, akhirnya Anto bisa diamankan dan langsung digelandang ke Mapolres Asahan. Kepala Sentral Pelayanan Kepolisian (Ka.SPK) Polres Asahan Aiptu J Sinambela ketika ditanyai, mengaku pihaknya menerima informasi bahwa tersangka memiliki kelainan jiwa, dan untuk menghindari hal yang tidak diinginkan tersangka langsung diamankan. Pantauan METRO di Rumah Sakit Umum Daerah (RSUD) Kisaran, korban Rahmat setelah mendapat penanganan di ruang Unit Gawat Darurat (UGD) kemudian di tempatkan di ruang V. “Korban tiba sekitar pukul 14.15 WIB, diantar keluarganya dengan kondisi mengalami luka bekas tusukan benda tajam pada bagian dada sebelah kanan, pangkal paha sebelah kiri, lengan sebelah kanan,” kata dr Eka Wilda Sari ketika ditemui di UGD RSUD

Kisaran. Ditambahkannya, korban setelah ditangai lalu di foto yang nanti hasilnya, akan dikonsultasikan dengan dokter bedah. S e m e n t a r a Rahmat tampak terbaring lemah di ruangannya dirawat dan tidak banyak memberikan kometar. “Nggak tahu apa sebabnya, tiba-tiba abang itu (Anto,red) menyerangku dengan sebilah pisau,” katanya sembari meringis menahan sakit. Terpisah, keluarga menolak memberikan keterangan ketika METRO mencoba bertanya soal peristiwa itu. “Maaf ya kami masih bingung dan tolong jangan diganggu,” kata seorang perempuan yang mengaku kakak Rahmat. Terpisah, Asfian alias Anto ketika ditanyai memberikan jawaban mengambang dan enteng pertanyaan METRO. “Sudah lama dibiar-biarkan, tapi semakin menjadi jadi dia (Rahmat,red) mencuri barangbarang di rumahku,” katanya sembari tersenyum.(sus)

Sekolah Kebanjiran, Murid SD Tewas Tenggelam STABAT- Hujan deras yang mengguyur Kabupaten Langkat menelan korban jiwa. Irwansyah (11), murid yang masih duduk di kelas VI SD Negeri 053974, Lingkungan IV, Desa Payamabar, Kecamatan Stabat, Langkat, tewas tenggelam di belakang sekolahnya setelah mandimandibersamasejumlahteman-temannya,Kamis (27/9). Keterangan yang dihimpun POSMETRO LANGKAT (grup METRO), menyebutkan, sebelum ditemukan tewas tenggelam, korban dan dua temannyamandi-mandidibelakangsekolahyang terendambanjirkarenaSungaiBelengkingmeluap. Saatitujarumjammenujukkanpukul13.00WIB. Para murid SD sudah waktunya pulang sekolah. Namun, melihat kondisi belakang sekolah dipenuhi air, para bocah ini mengatur rencana untuk mandi di belakang sekolahnya tersebut.Selanjutnyakorbandanteman-temannya pulang ke rumah. Begitusampai di rumah, korban bersama kedua temannya kembali mendatangi lokasi banjir untuk mandi-mandi. Sesampainya di lokasi,korbandantemannyalangsungterjunkeair. Namun, korban terperosok ke lokasi yang lebih dalam. Karena tidak pandai berenang, akhirnya korban tenggelam dan terbawa arus. Tak lama setelah itu, kedua temannya berteriak minta tolong karena melihat korban tenggelam. Teriakankeduatemannyamengundangperhatian warga sekitar. Namun sayang, korban yang tenggelam dan terbawa arus sudah tidak terlihat. Warga yang memadati lokasi kejadian, terus berupaya melakukan pencarian bocah malang tersebut. Hingga setengah jam kemudian, korban akhirnya berhasil ditemukan dalam kondisi sudah

tidak bernyawa. Dibantupihaksekolah,jenazahkorbanlangsung dibawa kerumah duka untuk disemayamkan. Sekadar diketahui, semasa hidupnya korban dikenalsebagaisosokyangpendiamdantidaksuka keluyuran. Hanya saja saat itu, korban justru ikut ajakan teman-temannya untuk pergi mandi di lokasi banjir tersebut. Kini jenazah anak ketiga dari empatbersaudarapasanganTukirandanAtik,yang tinggal di Lingkungan III, Desa Payamabar, Kecamatan Stabat, Langkat ini, sudah dibawa ke rumah duka untuk disemayamkan. Rencananya jenazah korban dikebumikan besok (hari ini-red), guna menunggu kepulangan Tukiran bapak kandungnya yang berangkat kerja merantaukeAceh.“Sudahseringsayalaranganakanak kami ini supaya jangan pergi dan mandimandidilokasibanjiritu,tapikalausudahkejadian seperti ini ya mau dibilang bagaimana lagi dan ini sudah bukan tanggung jawab kami,” kata salah seorang guru olahraga. Kepala SD Negeri 053974, Mimi Fariza, saat dikonfirmasi terkesan cuek. Namun ia ikut membenarkanadasiswadisekolahnyayangtewas tenggelam di lokasi banjir tersebut. Sebelum kejadian ini, ia mengaku memang sudah punya rencanauntukmembanguntembokbatassekolah dengan lokasi banjir. Sehingga tidak sampai menimbulkankorbanjiwa.Sayangnya,rencanaitu belum terealiasasi. “Kalau mau penjelasan lebih lengkap tentang kejadian ini, tanya saja langsung samakeluarganya atausamaguru-gurudisekolah. Karena saya masih dua minggu bertugas di sini. Meskipun begitu, kalau bisa jangan dibuat beritanya,” cetus Mimi Fariza. (dn)

Keluarga Trauma, Terkucil dari Pergaulan Sosial Sambungan Halaman 1 ang yang dituberitakan menderita AIDS itu telah meninggal dunia dan dikebumikan, namun keluarga yang ditinggalkan kini mengalami trauma berat dan terkucilkan dari pergaulan sosial masyarakat. “Pemberitaan Harian Rakyat Tapanuli tidak memakai etika pers. Dalam berita semestinya tidak perlu menuliskan nama dan alamat lengkap orang yang menderita penyakit AIDS, walaupun misalnya orang itu positif dinyatakan menderita. Tetapi Harian Rakyat Tapanuli menulisnya secara lengkap, itu jelas salah,” tegas Sonny Lee Hutagalung, salah satu orator dalam aksi tersebut.

Pria yang juga berprofesi sebagai wartawan di Kalimantan itu mengaku kecewa dan prihatin atas pemberitaan tersebut. Sebab, pemberitaan itu telah berdampak timbulnya keresahan bagi warga lain. Bahkan, pemberitaan itu dinilai telah menginjak-injak hak azasi orang yang divonis menderita AIDS tersebut, bahkan dampaknya meluas terhadap keluarganya. “Harian Rakyat Tapanuli sudah membuat hak azasi orang itu terinjak-injak. Bahkan seluruh masyarakat Sibolga Julu sudah diresahkan dengan pemberitaan itu. Slogan Harian Rakyat Tapanuli yakni saatnya rakyat angkat bicara, dan sekarang kami rakyat yang bicara. Pakai etika pers kalau memang

mengaku sebagai jurnalis. Saya merasa sedih, kok di kampung halaman saya ini ada pers yang tidak beretika. Kami meminta pertanggungjawaban Rakyat Tapanuli. Mulai besok harus ada permintaan maaf, kalau tidak kita akan berurusan dengan hukum,” tegas Sonny Lee Hutagalung lagi. Sebelumnya, Rudolf Siagian, juga orator dalam unjuk rasa itu, mendiskripsikan berita Rakyat Tapanuli tersebut sebagai sesuatu yang pamalo-malohon (pandai-pandaianred) dan tidak berdasarkan fakta. “Yang kami tahu undang-undang pers itu pun mengatur soal etika dalam pemberitaan. Kami datang untuk meminta pertanggungjawaban, kenapa koran Rakyat Tapanuli

begitu gampangnya memuat berita seperti itu. Dan sampai hari ini kami tidak pernah membaca permohonan maaf dari redaksi harian Rakyat Tapanuli,” timpal Rudolf. Rudolf mengaku kedatangan mereka bertujuan untuk membersihkan nama baik keluarga orang yang divonis melalui berita positif mengidap AIDS, yang berisial HT tersebut. Bersama kelompok pendemo juga turut salah satu kerabat dekat almarhum HT. “Kami datang kemari karena keprihatinan kami terhadap keluarga HT yang kini sudah terkucilkan. Kami mau penjelasan dari redaksi soal kebenaran berita itu. Kalau tidak maka kami siap menempuh jalur hukum,” kata Rudolf. (mor/nasa)

Pasca Banjir Barus, Pemkab Dirikan Posko Sambungan Halaman 1

Besok, Listrik Padam Mulai... Sambungan Halaman 1 Kamis (27/9), di kantor PT PLN Sibolga Jalan Sutoyo Siswomiharjo. “Adapun beberapa daerah yang akan dipadamkan yakni Sibolga Julu, Jalan SM Raja, Ketapang, Pondok Batu, Jalan Sudirman, Parombunan, Sibuluan II, Tano Ponggol, Kota Sibolga, Bonan Dolok, dan sekitarnya,” ujarnya. Lanjutnya, pemadaman ini dilakukan sehubungan dengan adanya pemeliharaan berkala tegangan menengah (20Kv) jaringan listrik yang digunakan untuk mengaliri daerah-daerah pemadaman. “Pemadaman itu hanya berlangsung Sabtu (29/9) saja. Ini bertujuan menjaga kehandalan pasokan listrik dan menjaga kelancaran operasional arus listrik ke konsumen terutama di daerah-daerah yang dipadamkan,” katanya. Oleh karenanya, Muji mewakili PT PLN Area Sibolga memohon maaf yang sebesar besarnya kepada masyarakat, terutama konsumen pengguna listrik yang terkena pemadaman pada Sabtu (29/9).(son/nasa)

vinsi Sumut. Menurut Herman Suwito, banjir yang merendam ribuan rumah pada Rabu (26/9) kemarin telah menyengsarakan ribuan warga. “Tujuannya untuk menampung para korban yang terkena banjir. Sedangkan untuk dapur umum hingga saat ini belum kita buka karena belum ada warga yang melapor tidak makan karena rumahnya terendam. Kita juga masih tetap mendata semua kerugian yang dialami masyarakat termasuk infrastruktur yang rusak. Kita juga sudah melaporkannya langsung kepada Bupati Tapteng Raja Bonaran Situmeang,” ujar Herman. Sementara menurut salah seorang korban banjir, Hasrianto Samosir, jumlah kapal penangkap ikan miliknya yang hanyut terseret air ke laut sebanyak sembilan unit. Namun 6 diantaranya sudah ditemukan dalam keadaan rusak berat. Sedangkan tiga unit lagi masih belum ditemukan. Dikatakannya, kerugiannya akibat bencana alam tersebut diperkirakan mencapai sekitar Rp400 juta. “Jadi untuk memperbaiki satu unit kapal agar bisa kembali melaut diperkirakan mencapai Rp40 juta hingga Rp50 juta. Karena semua kapal yang sudah ditemukan kondisinya rusak berat. Sadangkan yang belum ditemukan belum tahu bagaimana kondisinya, bisa saja kapal tersebut tidak dapat lagi ditemukan, atau ditemukan tetapi tidak bisa lagi perbaiki sama sekali. Saya

sudah pasrah atas musibah ini, mungkin ini sebuah cobaan yang diberikan Allah SWT kepada saya,” ujarnya lirih. Dikatakan pengusaha kapal penangkap udang ini, untuk mengantisipasi agar tidak terjadi lagi banjir sebesar ini, Pemkab Tapteng diminta agar melakukan pengorekan di ujung sungai Aek Sirahar. “Dulu sebelum sungai ini dangkal tidak pernah terjadi banjir sebesar ini. Sekarang ini asal hujan datang, kami yang tinggal disekitar sungai akan was-was,” akunya. Sedangkan warga lainnya, Parulian Situmorang ,meminta kepada Pemkab Tapteng agar dapat memberikan bantuan langsung kepada warga yang terkena bencana alam tersebut. Sebab sebahagian besar warga yang terkena banjir adalah rata-rata nelayan, dan kapal-kapal milik mereka rusak parah. Sementara dari pantauan METRO, Kamis (27/9), sebahagian besar warga yang rumahnya terendam sudah kembali ke rumah masing-masing dan mulai beraktifitas. Sedangkan beberapa sekolah yang sempat diliburkan akibat terendam air sudah mulai melakukan proses belajar mengajar. Namun proses belajar mengajar tersebut belum maksimal karena pihak sekolah masih harus membersihkan lumpur di sejumlah ruangan. Sedangkan dari 20 kapal penangkap ikan milik nelayan yang hanyut terbawa arus sungai, 17 diantaranya sudah ditemukan dengan kondisi rusak berat dan rusak ringan.

Hal ini membuat nelayan-nelayan di Desa Pasar Terandam Barus hingga kemarin belum pergi melaut. Saat ini cuaca di Barus masih rawan sehingga warga tetap waspada kemungkinan akan datang banjir susulan. BNPB Sumut Serahkan Bantuan Badan Nasional Penanggulangan Bencana (BNPB) Provinsi Sumatera Utara memberikan bantuan kepada korban bencana banjir di Barus. Bantuan tersebut langsung diserahkan oleh koordinator tim kepada BNPB Tapteng yang diterima langsung Kepala Bagiannya Ir Bonaparte Manurung MM. Bantuan ini kemudian diserahkan kepada Camat Barus untuk selanjutnya disalurkan kepada para korban. Penyerahan bantuan tersebut dilakukan di kantor Camat Barus sebagai posko satgas penanggulangan bencana alam, Kamis (27/9). Adapun bantuan yang diserahkan antara lain, makanan siap saji, selimut, tenda, matras, dan pakaian bayi. Kaban BNPB Tapteng Ir Bonaparte Manurung didampingi Camat Barus menegaskan, bantuan yang diserahkan oleh BNPB Provinsi Sumut tersebut akan secapatnya disalurkan kepada warga yang membutuhkan. “Kita akan serahkan semua bantuan ini kepada para korban. Sistim pembagiannya nantinya akan diatur oleh Camat Barus selaku koordinator posko satgas penanggulangan bencana Barus. Mudahmudahan apa yang kita serahkan nanti dapat membantu beban saudara-saudara kita yang

terkena musibah,” harapnya. Ketika ditanya apa upaya Pemkab Tapteng dalam menangani korban banjir di Barus, Bonaparte menegaskan bahwa Pemkab Tapteng melalui BNPB Tapteng serius dan tanggap dalam menangani bencana yang terjadi di daerah ini. Sebagai langkah awal, Pemerintah akan mendata seluruh kapal-kapal nelayan yang rusak dan bagaimana kerusakannya. Kemudian menginventarisasi seluruh kerusakan-kerusakan yang disebabkan oleh banjir tersebut guna diberikan bantuan. “Untuk jangka pendeknya, kita akan berikan bantuan kepada nelayan yang belum bisa melaut karena kapal-kapal masih rusak serta biaya pencarian kapal-kapal nelayan yang rusak. Bahkan dapur umum untuk korban akan kita siapkan kalau memang diperlukan. Saat ini sudah ada dua unit mobil tanggap darurat dari BNPB Provinsi Sumut untuk membantu korban banjir seperti mobil dapur lapangan lengkap dengan fasilitasnya. Jadi tergantung kebutuhan warga, kita sudah diperintahkan Bupati untuk bergerak cepat menangani bencana ini. Besok juga akan datang bantuan dari Palang Merah Indonesia (PMI) kepada korban,” pungkasnya. Sedangkan untuk jangka panjangnya, Bupati Tapteng Raja Bonaran Situmeang akan mengusulkan seluruh infrastruktur yang rusak seperti rumah warga, kapal-kapal, jalan, sekolah, dan lainnya, kepada pemerintah pusat untuk selanjutnya diberikan bantuan.(mas/nasa)

Tolak Pemanggilan 8 Warga Sambungan Halaman 1 8 warga dari Desa Pandumaan sebagai saksi bentrok fisik di Tombak Sitangi, Desa Sipitu Huta. Dimana bentrok itu, warga berhadapan dengan salah seorang anggota Brimob, Briptu Hotbastian Simamora dan seorang security perusahaan bubur kertas PT Toba Pulp Lestari Tbk, Frengky Hutagaol, Rabu (19/9) 2012, sekira pukul 10.00 WIB. “Warga, hanya mempertahankan tanah ulayat milik bersama masyarakat Desa Pandumaan dan Sipitu Huta dari pembabatan hutan yang dilakukan TPL. Jika itu tetap berlanjut, kami tidak akan dapat makan dan tidak mampu menyekolahkan anak-anak kami lagi,”ujar Haposan Sinambela saat aksi berlangsung. Ia menjelaskan, warga kedua desa tersebut sama sekali tidak ingin bentrok dengan aparat kepolisian, apalagi Brimob yang bertugas. “Tapi sudah 4 tahun kami memperjuangkan tanah

warisan ini melalui demo dan kesepakatan bersama mengusulkan revisi lahan warga dari cengkeraman TPL. Tapi TPL tetap membuka areal dengan memperluas lahan yang sudah ditanami pohon kemenyaan oleh warga. Jadi, kami sebenarnya menganggap TPL sebagai musuh kami,” tandas Sinambela. Dikatakannya, melalui rapat antara Uspida Humbahas, PT TPL dan warga Desa Pandumaan dan Sipitu Huta, telah menghasilkan kesepakatan untuk tidak ada lagi aktivitas penebangan pohon di hutan kemenyan warga oleh pihak TPL.”Artinya, kesepakatan di lokasi sengketa itu adalah stanvas. Tapi justru TPL ingkar atas kesepakatan itu,” imbuhnya. Massa yang sempat bersitegang dengan aparat kepolisian, mengancam akan terus melakukan demo ke Mapolres Humbahas jika pemanggilan terhadap 8 warga tetap dilakukan. “Kami tidak mengerti hukum, kami hanya tau tanah warisan nenek moyang kami hendak

Menyuarakan Aspirasi Masyarakat Tapanuli

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan : Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

dirampas oleh TPL, sehingga kami berusaha mempertahankan tanah leluhur kami dari penggerogotan pihak PT TPL. Kami akan selalu mempertahankan tanah warisan nenek moyang kami, sampai revisi SK 44/Menhut-II/2005 dan tata batas konsesi PT TPL di sektor Tele dikeluarkan Menteri Kehutanan RI,” ujar Karsi Sihite, warga Desa Pandumaan. Tuntutan Warga Disetujui Aksi demo yang berlangsung lebih dari satu jam di Mapolres Humbahas, disambut langsung oleh Kapolres Humbahas, AKBP Heri Sulismono. Kehadiran massa, sempat memacetkan jalur lalu lintas kenderaan Dolok Sanggul-Siborongborong. Setelah menyampaikan tuntutan, pihak Polres Humbahas dan perwakilan massa akhirnya menyepakati ke-8 warga dimaksud tidak jadi dipanggil dan akan melakukan musyawarah bersama melalui pertemuan dengan Uspida Plus serta pihak PT TPL guna mencari solusi

Departemen Redaksi METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Redaktur Pelaksana:... Kordinator Liputan Ridwan Butarbutar, Asisten Kordinator Liputan (Bonapasogit): Horden Silalahi. Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Marihot Simamora, Freddy Tobing, Milson Silalahi, Masril Rambe , Rinawati Marbun (koresponden barus), Jonter (Humbahas), Bernard Lumbangaol, Hengki Tobing (Taput), Hermanto Turnip, Brams Situmorang (Tobasa) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Nasa Putra Maylanda, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel),

penyelesaian konflik. Setelah adanya kesepakatan tersebut, massa pun akhirnya membubarkan diri dengan tertib. Amatan METRO, peserta aksi di dominasi kaum ibu, pelajar bahkan Balita. Tanpa raguragu, sejumlah anak yang masih berstatus pelajar turut serta membawa poster penolakan pemanggilan 8 warga dari Desa Pandumaan sekaitan penyerangan ratusan warga ke area pembukaan jalan baru area konflik konsesi PT TPL tanggal 19 September lalu, hingga berujung pada penganiayaan warga terhadap Briptu Hotbastian Simamora dan Frengky Hutagaol, serta membakar satu unit alat berat jenis excavator yang ada di lokasi bentrokan. Kemana Lagi Petani Mengadu? Menanggapi konflik agraria tersebut, Direktur Wahana Lingkungan Hidup (Walhi) Sumatera Utara, Kusnadi, kepada METRO, Kamis (27/9) mengatakan, bahwa konflik agraria di Sumatera Utara khususnya antara warga di Kecamatan

Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin Purba, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ferdinan, Ardi, Roy Amarta. Departemen Iklan

Pollung dengan pihak PT TPL merupakan sebuah kepentingan pragmatis dan cenderung menguntungkan pemegang modal. “Mental serakah untuk merebut tanah rakyat dan perampas hasil bumi rakyat saat ini telah bermetamorfosa. Berbagai payung hukum tentang agraria hanyalah aturan yang digunakan untuk menindas dan mendinginkan riak perlawanan rakyat,”ujar Kusnadi. Para korporasi dan spekulan tanah menjadikan tanah komoditi dagang dan bisnis sepihak. Sehingga, petani dan orang miskin secara perlahan tapi pasti akan digusur. Hak masyarakat adat juga digusur dan mengikis pengakuan hokum adat.”Jika sudah hokum adat, tanah ulayat dan hak rayta miskin atau petani juga sudah tidak diakui, kemana lagi petani akan mengadu..?maka perlawanan akan terjadi dan menimbulkan masalah baru,”imbuh Kusnadi.(jona/hsl/nasa)

Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba Perwakilan Metro Tapanuli: Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:107-0003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733



28 September 2012

Pendeta Datangi Komisi III Sambungan Halaman 8 Sibolga Jamil Zeb Tumori dan anggotanya. Pdt Poltak Sinaga pada pertemuan itu membeberkan, bangunan GPSI saat ini hanya berukuran 6 meter x 9 meter dan itu benar-benar sudah tidak memadai lagi untuk menampung seluruh jemaat menjalankan kebaktian. Maka itu, pihaknya berencana merehabilitasi dan memperbaiki gedung gereja menjadi berukuran 9 meter x 18 meter. Sementara, bangunan Gereja sebahagian besar masih terbuat dari papan. “Dalam perencanaan ini, kita (pihak Gereja) tidak mungkin meminta bantuan jemaat, karena rata-rata jemaat GPSI berpenghasilan kecil,” katanya. Dia membeberkan, pada tahun 2005, Gereja GPSI yang berdiri berdasarkan SK Direktorat Jenderal (Dirjen) Bimbingan Masyarakat (Bimas) Kristen Protestan Departemen Agama (Depag) RI No : 61 Tahun 1987, pernah menerima bantuan dari Pemko Sibolga melalui mantan Wali Kota Sibolga, Drs Sahat P Panggabean MM sebesar Rp.7.5 Juta. Dan seluruh dana itu dialokasikan untuk rehabilitasi dan perbaikan gedung gereja berukuran 6 meter x 9 meter tersebut. “Tapi, kondisi bangunan ini sekarang sudah tidak representatif lagi, sementara jumlah jemaat semakin berkembang sehingga pihak Gereja memandang perlu untuk melakukan rehabilitasi dan perbaikan,” terang Pdt Poltak. Maka itu ungkap Poltak, pihaknya sangat mengharapkan bantuan berupa dana hibah dari Pemkot melalui DPRD Kota Sibolga guna dianggarkan di Anggaran Pendapatan dan Belanja Daerah (APBD) Tahun Anggaran (TA) 2013 ini. “Adapun besar dana rehabilitasi dan perbaikan Gereja yang kita butuhkan hanya sebesar Rp121.145,” ujarnya. Usai pertemuan dan menyampaikan permohonan bantuan kepada Komisi III DPRD Kota Sibolga, Pdt. Poltak Sinaga yang ditanya wartawan menyampaikan ungkapan terimakasih dan rasa bangganya, karena bisa bertemu dengan wakil rakyat dari Komisi III DPRD Kota Sibolga. Sekalipun para wakil rakyat di komisi III tersebut bukan berasal dari daerah pemilihan (Dapil) I Kota Sibolga atau tempat keberadaan Gereja dan jemaatnya. “Kita dilayani dengan baik dan mereka inilah sesungguhnya wakil rakyat sejati, mau mendengar keluhan rakyat dan mau memperjuangkan kepentingan masyarakat. Semoga Tuhan memberkati langkah dan perjuangan mereka. Sebagai tokoh agama, saya merasa bangga punya wakil rakyat seperti mereka,” tutur Pdt Poltak. Pdt. Poltak pun berharap, proposal Gereja yang ditanda tangani oleh panitia pembagunan Liberti Sinaga, Seketaris Katrince Dolok Saribu dan Bendahara Ratna Pasaribu itu mendapatkan perhatian berupa dana hibah dari APBD TA 2013 Pemkot Sibolga. Ketua Komisi III DPRD Kota Sibolga Jamil Zeb Tumori didampingi Henry Tamba dan Mega Wati yang dikonfirmasi mengyampaikan, meningkatnya kunjungan masyarakat ke DPRD Kota Sibolga menunjukkan semakin meningkatnya kepercayaan rakyat akan fungsi dan wewenang wakil rakyat di DPRD. “Kita akui, komisi III DPRD yang membidangi pembangunan dan kesejahteraan sering dikunjungi rakyat dalam menyampaikan aspirasi dan bahkan tidak jarang pula hanya sekedar bersilaturahmi. Hal itu dikarenakan, pintu dan ruang tamu Komisi III selalu terbuka dan siap menerima masyarakat. Terlebih Komisi III DPRD Sibolga selalu berada di tempat kecuali bila sedang melaksanakan tugas luar dari lembaga,” ujar Jamil diamini rekan-rekannya. Terkait kedatangan Pdt. Poltak Sinaga, Jamil mengakui, Gereja GPSI merupakan salah satu rumah ibadah yang sangat wajar dan layak menerima bantuan dari Pemkot Sibolga. Dan hal itu sudah dilihatnya secara langsung dimana bangunan gereja tersebut masih terbuat dari papan dan berukuran kecil. “Untuk sebuah rumah ibadah, tentunya itu tidak layak dan harus lebih bagus dan aman bagi umatnya dalam menjalankan kepercayaanya dan itu Hak Azasi Manusia (HAM) yang dijamin dalam Undang-Undang Dasar (UUD) 1945. Dan saya yakin, Wali Kota Sibolga Drs Syarfi Hutauruk akan membantu mengalokasikan dana hibah bagi gereja GPSI tersebut. Sebab, beliau (Syarfi) orang yang tidak mau membeda-bedakan Agama dan sebagai wakil rakyat, saya juga akan menyampaikan hal ini kepada Ketua DPRD Kota Sibolga Syahlul U Situmeang sebagai Koordinator Komisi III,” tandasnya. (tob/nasa)

DITENDERKAN Sambungan Halaman 8 sudah diajukan oleh perusahaan yang mengikuti tender yakni pada tanggal 2 hingga 4 Oktober mendatang. “Selanjutnya pengumuman pemenang tender akan dilakukan pada tanggal 5 Oktober mendatang dan pihak panitia tender nantinya akan melayangkan undangan,” tukas Basarulah. Menurut Basarulah, dalam proses tender ini perusahaan penawar terendah tidak mutlak harus menjadi pemenang, namun nantinya akan dilihat dari proses klarifikasi yang dilakukan. “Kemudian kami juga mengimbau kepada seluruh rekanan agar menghargai hal-hal yang disampaikan panitia terkait pelaksanaan pelelangan barang dan jasa. Dan nantinya juga kamiberharap, dalam

pengerjaannya haruslah benarbenar dilakukan sesuai harapan kita bersama, khususnya masyarakat banyak yang akan memakainya,” tegas Basarullah. Dari 21 perusahaan yang mendaftar hanya ada 5 perusahaan yang lolos dan ikut dalam pelaksanaan tender. “Untuk langkah selanjutnya, pengumuman pemenang tender akan dilakukan paling lama tanggal 7 September mendatang,” kata Basarullah. Terpisah, Sekretaris LSM Kupas Tuntas Sibolga-Tapteng, Juan Ferry Lumbangaol mengimbau kepada panitia tender tersebut agar bersikap profesional dan transparan dalam melaksanakan pelelangan barang dan jasa yang dilakukan. “Panitia tender harus betulbetul teliti memeriksa seluruh keberadaan keaslian dokumen, baik

Surat Izin Usaha Jasa Kontruksi (SIUJK), Sertifikat Badan Usaha (SBU), keterangan pengalaman kerja, peralatan, tenaga ahli, asuransi dan fiscal serta track record perusahaan sesuai yang diamanatkan Peraturan Presiden (Perpres) No 54 tahun 2010 tentang pengadaan barang dan jasa,” kata Juan. Menurut Juan, dengan terseleksi kontraktor profesional maka kualitas proyek bisa terjamin, selain mencegah kontraktor ‘dadakan’ alias ‘naga bonar’ yang biasanya muncul saat pelaksanaan tender. “Hal itu sudah lumrah terjadi disaat dilakukan proses tender, akan bermunculan kontraktor dadakan. Kemudian kita juga berharap, agar dalam penetapan pemenang tender nantinya bukan karena pengkondisian,” tandas Juan. (tob/nasa)

RAKYAT SEGEL DPRD Sambungan Halaman 8 Pasalnya, para koordinator aksi merupakan ‘pemain lama’ alias tokoh-tokoh masyarakat yang dulu terkenal vokal. Di antaranya; Ketua MPC Pemuda Pancasila Madina, Syahriwan Nasution alias Kocu, Kordinator VII LIRa Sumatera Utara, Abdul Muis Pulungan, Ketua Lembaga Pemantau Penyelenggara Negara RI (LPPN RI) cabang Madina, Syaifuddin Lubis, kemudian mantan Ketua PC PMII Madina periode tahun 2005 Ahmad Yasin Nasution, Sekretaris Gapeknas Madina Sutan Batanghari, dan sejumlah tokoh masyarakat lainnya. Sebelum penyegelan, massa memasuki gedung dewan dengan membawa spanduk kertas bertulisan “551 KUHP dilarang masuk, disegel masyarakat Madina!” Ini dilakukan sesuai dengan keputusan para pegunjukrasa untuk menyegel setiap ruang fraksi yang anggota dewannya tidak hadir pada rapat paripurna LKPj Bupati Madina tahun anggaran 2011 termasuk salah seorang wakil ketua DPRD Fakhrizal Efendi SH.

Ketua MPC Pemuda Pancasila Syahriwan Nasution akraf disapa Kocu sebagai koordinator penyegelan bersama sejumlah anggota PP usai melakukan penyegelan di tiga ruang fraksi, yaitu Fraksi Madina Bersatu, Fraksi PKS, dan Fraksi Hanura. Kocu menjelaskan penyegelan ini atas kekesalan seluruh masyarakat Madina terhadap kinerja pimpinan anggota dewan khususya yang tidak menghadiri rapat paripurna LKPj Bupati Madina tahun 2011. “Ini merupakan penghianatan terhadap rakyat dan sudah menunjukkan sikap ketidakpeduliannya terhadap masyarakat dan pembangunan daerah,” sebutnya. “Bahkan ada sejumlah anggota dewan yang makelar paket proyek sebanyak 67 paket senilai Rp18 miliar. Ini salah satu tuntutan kami, karena dalam undang-undang sudah jelas bahwa anggota dewan itu tugasnya megawasi realisasi anggaran bukan meminta dan membagi-bagi paket. Kita sangat menyayangkan itu,” kata Kocu. Kocu menambahkan, selama ini

masyarakat sudah menanggung beban mental dan beban moral atas perbuatan pimpinan dan anggota dewan atas kisruh yang terjadi, belum lagi tindakan anggota dewan yang doyan menghamburhamburkan uang rakyat, misalnya studi banding ke Bali, padahal hasilnya untuk masyarakat Madina tidak ada. “Kami umumkan kepada seluruh masyarakat khususnya yang memiliki hak pilih agar jangan memilih lagi wakil rakyat yang sekarang untuk pemilu 2014 mendatang. Kita tidak ingin wakil kita di DPRD ini yang bermental proyek,” teriaknya. Menanggapi sejumlah tuntutan pegunjukrasa, Ketua Badan Kehormatan DPRD Madina, Rahmad Riski Daulay mengatakan dalam waktu dekat akan memproses tuntutan pengunjukrasa terutama atas ketidakhadiran sebanyak 20 anggota dewan pada rapat paripurna LKPj Bupati. “Dalam waktu dekat kami akan memproses tuntutan masyarakat itu, kami berterima kasih atas perhatian dari seluruh masyarakat Madina,” pungkasnya. (wan)

KPU Tetapkan 20 Anggota PPK Sambungan Halaman 8 akhirnya menetapkan 20 nama yang akan bertugas di 4 kecamatan yang ada di Kota Sibolga. Adapun ke dua puluh anggota PPK yang telah ditetapkan oleh KPU Kota Sibolga adalah, untuk Kecamatan Sibolga Utara yakni Efendi Sinurat (L), Leonardo Lumban Tobing (L), Masrim Simbolon (L), Syarip Siregar (L), dan Sartika Tanjung SPd (P),” terangnya. Sedangkan untuk Kecamatan Sibolga Kota yakni Amelia Puji Hastuti (P), Janner Silitonga (L),

Khairani Nasution (P), Ridho Asman (L), dan Ramdani Amri (L). Sementara untuk Kecamatan Sibolga Sambas masing-masing A Diapari Simanungkalit (L), Andar Tua Silaban (L), Janri Siburian (L), Robbi Safari SKM (L), dan Yuliani (P). “Dan untuk Kecamatan Sibolga Selatan yakni Ali Wardana (L), Maswardin Tanjung SPd (L), Rusdi Rais Harahap (L), Sri Mulyati (P), dan Rialima Situmeang (P). Usai menetapkan anggota PPK, saat ini KPU Kota Sibolga sedang bekerja untuk merekrut petugas PPS (Panitia Pemungutan Suara)

se Kota Sibolga yang saat ini sedang memasuki tahap seleksi wawancara. Direncanakan tanggal 2 Oktober 2012 yang akan datang di Gedung Nasional Sibolga akan dilaksanakan pelantikan dan pengambilan sumpah para anggota PPK dan PPS se Kota Sibolga,” ujarnya. Lanjutnya, untuk tahap seleksi petugas PPS, yang lolos dalam kelengkapan berkas untuk mengikuti tes wawancara sebanyak 60 orang, sedangkan petugas PPS yang dibutuhkan se Kota Sibolga adalah 3 orang dikali 17 kelurahan atau 51 orang. (son/nasa)

Digulung Sambungan Halaman 8 Tak hanya itu, sambung Singkat, pihaknya juga tetap melakukan razia atau pengawasn terhadap para pegawai di lingkungan Pemko Sibolga yang masih terlihat berkeliaran saat jam kerja, dan juga menertibkan anak-anak sekolah yang bermain internet disaat jam belajar sedang berlangsung. “Kami berharap, agar hal ini menjadi perhatian kita bersama dan kami tegaskan agar para pengamen jalanan, para pegai dan pelajar,”tegasnya.untuk . Begitupun, kata Singkat, pihaknya hingga saat ini masih memberikan arahan dan bimbingan kepada meeka, dan sekaligus menyatrankan agar para pengamen jalanan

itu masing-masing kembali ke kampung halamannya. “Kita memberikan kepada ketiganya dalam waktu 3 hari ini untuk meninggalkan Kota Sibolga. Untuk itu, kami berharap agar-agar pengamen jalanan lainnya yang ada untuk meninggalkan kota Sibolga,” teganya. Menurut Singkat, ketiga pengamen jalanan yang tertangkap pihaknya itu bukanlah warga Kota Sibolga namun dari daerah luar, bahkan dari luar Pulau Sumatera. “Ketiga pengamen yang kita tangkap yakni, Roni warga Jalan Tegal Lega Dumai, Franly warga Jalan Sukarno Hatta Tanjung Pinang dan Bambang yang mengaku sebagai warga Bandar Hapinis, Tapanuli Selatan,” tandas Singkat. (tob/nasa)

Belum Patuhi Instruksi Mendagri Sambungan Halaman 8 Yuswandi kemudian, akan terus mendorong. Sehingga daerah dapat benar-benar menerapkan pertanggungjawaban APBD secara online melalui proses fasilitasi. Kemendagri juga telah menyusun jenis-jenis laporan keuangan apa saja yang dapat dicantumkan dalam laporan keuangan daerah tersebut. Diantaranya seperti dokumen perencanaan anggaran hingga pelaksanaan APBD setiap tahunnya. “Karena pelaporan pelaksanaan APBD secara online ini, juga bagian dari upaya melaksanakan keterbukaan informasi kepada publik. Beberapa pemerintah provinsi memang telah mulai mencantumkan pelaksanaan APBDnya dalam situs resmi mereka.” Sehingga Yuswandi berharap, agar pelaporan APBD secara online, tidak hanya berhenti di tingkat provinsi semata. Namun terus hingga ke tingkat kabupaten/kota. Selain itu, Kemendagri menurutnya Yuswandi, saat ini juga terus mendorong pemerintah provinsi untuk segera menyerahkan Rancangan Peraturan Daerah (Ranperda) Pelaksanaan APBD secara tepat waktu kepada Pemerintah untuk dievaluasi. Hal ini penting, karena paling tidak terdapat delapan provinsi yang belum menyerahkan laporan pelaksanaan APBD Tahun 2011 kepada Mendagri. Masing-masing, Provinsi Nanggoroe Aceh Darusssalam, Kepulauan Riau, Lampung, Sulawesi Barat, Papua, Papua Barat,

Maluku dan Maluku Utara. Biasanya, Ranperda Pelaksa naan APBD ini sendiri dise rahkan kepada Mendagri oleh daerah, setelah diterimanya hasil audit dari BPK setiap tahunnya. “Ya sekitar itu jumlahnya. Saya belum mengecek kembali. Mungkin daerah sedang memerosesnya. Deadline penyerahannya 30 sampai September nanti,” ungkapnya. Sementara itu dihubungi terpisah, Sekretaris Jenderal (Sekjen) Sekretariat Nasional Forum Indonesia untuk Transparansi Anggaran (FITRA), Yuna Farchan, menyambut positif gagasan Mendagri yang meminta daerah melaporkan pelaksanaan APBD secara online setiap tahunnya. Menurutnya, Penyediaan bentuk laporan seperti ini tentu akan mempermudah pemerintah dan pemda terkait dalam melayani permintaan dokumen atau informasi seputar APBD oleh publik. “Jadi tidak hanya pelaksanaan APBD saja, pelaporan secara online itu sebaiknya juga turut mencantumkan dokumen anggaran lainnya. Seperti perencanaan anggaran, se hingga publik dapat mengkaji dan memelajarinya. Jadi kita melihat instruksi tersebut memang ini cukup tepat. Dan tentu sebaiknya Kemendagri juga harus dapat memberikan contoh kepada daerah, misal mencantumkan laporan keuangan setiap tahun secara online di website Kemendagri,”ungkapnya sedikit mengkritisi. (gir/jpnn)

Kompak Minta Kasus Sintong Dihentikan Sambungan Halaman 1 Gabungan massa ini meminta agar pihak Kejari dan PN Sibolga dalam tugasnya sebagai penegak hukum tetap berjalan pada koridornya. Dalam orasinya, massa yang didampingi beberapa anggota DPRD Tapteng ini menyampaikan 3 tuntutannya. Yakni, hentikan kriminalisasi terhadap pejuang rakyat, hentikan kriminalisasi anggota DPRD yang bertujuan untuk melemahkan fungsi pengawasan DPRD, dan meminta segera menangkap dan mengadili mafia hukum. Berawal dari kantor Kejari Sibolga, ratusan pengunjuk rasa melalui orataor aksi, Abednego Panjaitan menyampaikan agar jaksa menuntut orang yang bersalah sesuai kesalahannya serta tetap pada koridor hukum. Dikatakannya, kasus illegal logging yang melibatkan Ketua DPRD Tapteng Sintong Gultom tidak pantas disidangkan. “Karyawan Sintong Gultom di UD Berdikari yakni K Hareva dan kawan-kawannya yang dulunya dituding memungut hasil hutan tanpa dokumen, namun oleh PN Sibolga, PN Medan bahkan di Mahkamah Agung mereka bebas murni. Artinya, pelaku yang terkait dalam

Sambungan Halaman 1 Itulah potret muslim di Quanzhou saat ini. Padahal, kota yang terletak di bagian selatan Provinsi Fujian itu memegang peran penting dalam sejarah masuk dan perkembangan Islam di Tiongkok. Di kota itulah terdapat Pelabuhan Zaitun yang menjadi pertemuan pedagang dari berbagai bangsa dan negara. Dari pelabuhan itu jugalah, tokoh legendaris muslim Tiongkok LaksamanaChengHo(adayangmenulisZengHe) mengawali pelayaran ke lima dari tujuh pelayaran keliling dunia. Pelaut sekaligus pedagang asal Maroko Ibnu Battuta yang begitu terpesona dengan kebesaran Pelabuhan Zaitun juga memutuskan menetap di kota tersebut. Untuk menghormatinya, pemerintah Kota Quanzhou pun mendirikan patungnya di Museum Islam kota itu.

kasus rotan yang melibatkan Sintong dinyatakan tidak bersalah, dan bebas murni. Namun mengapa orang yang menyuruh (Sintong,red) dinyatakan sebagai tersangka. Jelas disini ada permainan hukum, ada mafia kasus,” tukas Abednego dalam orasinya. Menurut Abednego, kasus ini membuat pihaknya prihatin. “Untuk itu kami ingin sampaikan hal ini kepada Kejari Sibolga. Jelas dalam kasus ini permainan politik dari orangorang yang tidak bertanggung jawab,” bebernya. Sekitar 30 menit menyampaikan orasinya di depan kantor Kejari Sibolga, mewakili Kajari Sibolga, Kasi Pidum Nazar M Harahap SH dan Kasi Intel Indra Nasution SH menerima beberapa orang perwakilan ke ruangannya. Disana perwakilan massa yang hadir menyampaikan keprihatinan mereka terhadap kasus yang melibatkan Sintong Gultom. Menanggapi aspirasi massa ini, Indra dan Nazar mengatakan bahwa mereka hanya melaksanakan tugas dari Mahkamah Agung. “Utusan Mahkamah Agung yang memerintahkan Jaksa Penuntut Umum untuk melakukan pemeriksaan terkait kasus Sintong

ini. Maka kami melanjutkan pemeriksaan dan melakukan panggilan kepada saudara Sintong. Namun dalam hal ini, kami tetap kommit dan tidak ada intervensi dari siapapun dalam menangani kasus rotan yang melibatkan Ketua DPRD Tapteng tersebut,” tutur Indra. Untuk itu, Indra pun mengajak seluruh pihak mengawal proses persidangan kasus tersebut demi keadilan dan penegakan hukum. Usai menyampaikan orasinya di kantor Kejari Sibolga, massa Kompak kemudian melanjutkan aksinya di kantor PN Sibolga. Di PN Sibolga, massa Kompak kembali menyampaikan aspirasi yang sama. Mereka mengatakan sangat tidak setuju apabila ada intervensi kepada hakim. Untuk itu mereka meminta hakim yang ada di PN Sibolga untuk tetap pada koridor hukum dan jangan mau diintervensi oleh pihak manapun juga. Berbagai keluhan dan harapan pun disampaikan di depan kantor PN Sibolga yang kemudian berdialog langsung dengan Wakil Ketua PN Sibolga Marper Pandiangan SH MH. Dalam dialog tersebut, massa meminta agar proses penetapan hukum di PN Sibolga selalu

ditegakkan, termasuk kasus Edianto yang dituntut selama 5 tahun penjara oleh JPU. Demikian juga dengan kasus-kasus lainnya termasuk kasus yang melibatkan Sintong Gultom. Herbinsar Sitanggang dan Malau Samosir anggota DPRD Tapteng yang turut mendampingi massa dalam aksi ini, mengatakan bahwa mereka sebagai anggota dewan turut mendukung aspirasi rakyat. “Rakyat menuntut keadilan, untuk itu kami mendampingi rakyat. Jelas orang yang disuruh (K Hareva dan kawan-kawan,red) bebas, tapi mengapa Sintong menjadi tersangka. Ini merupakan hal yang tidak patut diterima rakyat,” tutur Herbinsar dalam orasinya di depan Wakil Ketua PN Sibolga. Sementara Sanggam Tambunan yang turut dalam aksi ini menyampaikan bahwa perkara kasus rotan yang melibatkan Sintong Gultom sudah dicoret dari register perkara. Dan perkara ini juga sudah nebis in idem. “Artinya, perkara yang sudah pernah disidangkan tidak boleh disidangkan kembali,” tuturnya. Dilanjutkannya, kasus ini untuk yang ke 4 kalinya diajukan ke pengadilan. Dan selama 3 kali putusan tidak pernah Sintong

dinyatakan bersalah. “Namun demikian kami tetap menghargai pengadilan ini,” beber Sanggam yang mengaku sebagai kuasa hukum Sintong dalam kasus ini. Menanggapi keluhan massa, Marper Pandiangan menegaskan pihaknya akan tetap berjalan sesuai hukum. “Kami tetap mengacu kepada hukum acara pidana. Jadi apapun yang harus dilakukan majelis, itu yang akan kami lakukan,” terang Marper. Seperti dikatakan pihaknya sebelumnya, jangan paksa majelis menegakkan hukum dengan melanggar hukum. “Masalah ini masih dalam tahapan pemeriksaan. Sedangkan putusannya nanti saya belum tahu. Jangan intervensi hakim. Kami akan laksanakan hukum sesuai hukum yang berlaku,” pungkasnya. Setelah mendengar pernyataan hakim PN Sibolga, massa Kompak yang dikawal beberapa personel polisi kemudian membubarkan diri.(cr/01)

Nisan pun Padukan Kutipan Alquran dan Simbol Agama Lain Patung tersebut didirikan di dekat pintu masuk museum tersebut. Dengan begitu, siapa saja yang berniat masuk dan belajar di museum tersebut langsung melihatnya. Itu memperlihatkan betapa istimewanya posisi Ibnu Battuta bagi Quanzhou. Sebagian besar koleksi di museum itu adalah batu-batu nisan keluarga Ibnu Battuta yang dimakamkan di Quanzhou. Selain nama jenazah, di batu-batu nisan tersebut juga terpahat petikan beberapa ayat Al Quran atau hadis. Yang menarik, bentuk makam muslim sebagaimanayangterlihatdalammuseumtersebut sangatmiripdenganmakamTionghoayangdikenal dibanyakdaerahdiIndonesia.Selainbatunisannya yangbesar,jugaterdapatpagarbatuyangtidakterlalu tinggi. Secara total, persentase komunitas muslim diChinamemangkecil.Hanyasekitar1,5persendari

seluruh penduduk China. Namun, mengingat jumlah penduduk negeri itu yang sudah lebih dari 1,4 miliar jiwa, secara hitungan orang per orang jumlah muslim China pun menjadi cukup besar. Sensus terakhir menunjukkan, muslim China mencapai 21,6 juta jiwa. Lebih banyak daripada negara yang kental nuansa Islamnya, Malaysia. Muslim di Malaysia mencapai 17 juta. Selain presentasinya yang kecil, distribusi muslim Tionghoayangmenyebarhampirdiseluruhprovinsi diChinamenjadikanmerekatidakterlihatdominan. Kecuali di wilayah otonomi khusus Xinjiang yang memang mayoritas penduduknya muslim. Juga Provinsi Qinghai yang persentase muslimnya berimbang dengan etnis Tibet yang beragama BuddhaTibet.Demikianjugadiwilayahotonomikhusus etnis Hui di Ningxia. Etnis Hui adalah etnis yang mayoritas warganya beragama Islam. Bahkan,

etnis Hui selalu dikaitkan dengan Islam dan dianggap beragama Islam. Sementara di Xinjiang, merekayangberagamaIslamadalahetnisUyghur. Di provinsi-provinsi lain, persentasenya begitu kecil sehingga nyaris tidak terlihat. Meski begitu, jejak Islam bisa dirasakan di China. Itu tidak lepas dari posisi strategis China di rute perdagangan kuno Jalur Sutera, baik rute darat maupun laut. Jalur Sutera darat yang melewati Asia Tengah menyentuh dan mewarnai China di sisi barat laut. Jalur Sutera laut bersinggungan dengan China Selatan dan Timur. Lewat rute laut itulah, Kota Quanzhou di Provinsi Fujian bersinggungan dengan sejarah perkembangan Islam. Meski saat ini jumlah muslim di Kota Quanzhou tidak terlalu banyak, banyak tapak sejarah Islam

yang masih bisa dilihat di sana. Masjid Qinjing merupakan salah satu ikon peninggalan muslim di kota berpenduduk lebih dari 6 juta jiwa tersebut. Arsitektur masjid yang dibangun pada 1009 tersebut mirip dengan masjid di negeri-negeri Timur Tengah. Misalnya yang ada di Kota Damaskus, Syria. Ini beda dengan sebagian besar masjid di China yang dibangun dengan arsitektur setempat yang sekilas lebih mirip dengan kelenteng di Indonesia. Termasuk Masjid Akbar Xi’an yang konon merupakan masjid terbesar di China. Karena keunikannya tersebut, Pemerintah Kota Quanzhou menjadikannya sebagai objek wisata. Banyak warga setempat dan juga warga dari kota lain mengunjungi masjid tersebut. Tentu saja bukan untuk salat, namun berwisata. (*)


28 September 2012

KPU Tetapkan 20 Anggota PPK SIBOLGA- KPU (Komisi Pemilihan Umum) Kota Sibolga menetapkan 20 orang anggota PPK (Panitia Pemilihan Kecamatan) yang bertugas di 4 kecamatan di Kota Sibolga untuk melaksanakan tahapan Pilgubsu yang akan datang. Hal ini sesuai dengan hasil rapat pleno KPU Kota Sibolga tanggal 20 September 2012 tentang penetapan nama-nama anggota PPK se Kota Sibolga, yang menetapkan 20 orang dinyatakan lulus. Menurut Ketua KPU Kota Sibolga melalui Sekretaris KPU Syam Suharmi, Kamis (27/ 9), sesuai dengan hasil pleno KPU Kota Sibolga, dari beberapa orang yang ikut seleksi untuk menjadi anggota PPK Kota Sibolga dalam Pilgubsu yang akan datang, KPU


TENDER PEMELIHARAAN- Panitia tender pemeliharaan rutin jalan dan jembatan di Sibolga saat melakukan proses tender dihadiri perwakilan dari perusahaan-perusahaan yang ikut tender, Kamis (27/9) di Sibolga.


DITENDERKAN SIBOLGA- Pemerintah Kota (Pemko) Sibolga melalui dinas terkait, Kamis (27/9) pagi kemarin melaksanakan pelelangan barang dan jasa (tender) pemeliharaan rutin jalan dan jembatan di Kota Sibolga di aula Dinas Pekerjaan Umum (PU) Kota Sibolga. Data yang diperoleh METRO, dari 4 perusahaan yang mendaftar dan mengajukan penawaran terendah yakni CV Sinar Hikmah Baru dengan nilai penawaran Rp.436.658.700, disusul CV

Lian dengan nilai penawaran sebesar Rp.468.269.000, kemudian CV Miftaful Jannah dengan nilai penawaran sebesar Rp.469.828.000 dan CV Fazri Jaya dengan nilai penawaran sebesar Rp.471.367.000. Pada kesempatan itu, Ir Basarullah Lubis dari panitia tender mengatakan, untuk proses selanjutnya pihaknya akan melakukan klarifikasi terhadap berkas penawaran yang ‹ ‹ Baca

Ditenderkan...Hal 7

‹ ‹ Baca


PENGAMEN JALANAN- Petugas Sat Pol PP Kota Sibolga saat melakukan pendataan terhadap ke tiga pengamen jalanan ala anak Punk yang tertangkap, Kamis (27/9) di Sibolga.


DIGULUNG SIBOLGA- Dianggap meresahkan masyarakat, sebanyak 3 orang pengamen jalanan ala anak punk digelandang petugas Sat Pol PP Kota Sibolga, Kamis (27/9).

DIDATANGI- Komisi III DPRD Kota Sibolga didatangi Pdt Poltak Sinaga dari Gereja GPSI untuk meminta bantuan dana rehabilitasi dan perbaikan gereja, Kamis (27/9) di DPRD SIbolga.

Ketiga pengamen jalanan ala anak punk itu ditangkap di dua tempat berbeda yakni di kawasan Pelabuhan Lama Sibolga dan emperan salah satu hotel di kawasan taman bunga Kota Sibolga. Kasat Pol PP Kota

Sibolga Singkat Sijabat SSos kepada METRO mengatakan, penangkapan terhadap 3 pengamen jalanan atau yang lazim disebut anak-anak punk itu berdasarkan adanya laporan dari masyarakat yang resah dengan keberadaan mereka. “Ada laporan dari masyarakat terkait keberadaan para pengamen jalanan bergaya anak-anak punk itu kepada kita. Dimana penampilan mereka yang urakan dinilai mengganggu kenyamanan warga baik yang sedang bersantai atau sarapan di sejumlah warung yang ada di Kota

Sibolga,” ujar Singkat. Selain itu, sambung Singkat, penangkapan terhadap para pengamen jalanan ini juga sudah menjadi tugas rutin yang sudah diprogramkan oleh Sat Pol PP Kota Sibolga guna mengantisipasi keberadaan para pengamen, gelandangan, pengemis dan lainnya. “Sehingga laporan dari masyarakat terkait keberadaan anak-anak punk ini langsung kita respon dan hal itu juga sudah menjadi agenda yang sudah diprogramkan,” pungkasnya. ‹ ‹ Baca

Digulung...Hal 7

32 PEMKAB/KOTA DI SUMUT Pendeta Datangi Belum Patuhi Instruksi Mendagri Komisi III

MOHON BANTUAN PEMBANGUNAN GEREJA SIBOLGA- Pendeta Gereja Pentakosta Sion Indonesia (GPSI), Kamis (27/9) kemarin, berkunjung ke Komisi III DPRD untuk bersilaturahmi sekaligus mengajukan permohonan bantuan rehabilitasi serta perbaikkan gedung Gereja GPSI yang berkedudukan di jalan Pemancar TVRI kota Sibolga tersebut. Gereja GPSI dikabarkan sudah tidak representatif atau keberadaannya sudah tidak memungkinkan untuk menampung Jemaat berjumlah

54 Kepala Keluarga (KK) menjalankan kebaktian, sehingga pihak Gereja sangat membutuhkan bantuan dari Pemerintah Kota (Pemkot) Sibolga berupa dana hibah untuk dapat ditampung di Anggaran Pendapatan dan Belanja Daerah (APBD) Tahun Anggaran (TA) 2013. Kedatangan Pendeta GPSI yang diketahui bernama Poltak Sinaga diterima langsung Ketua Komisi III DPRD Kota ‹ ‹ Baca

Pendeta ...Hal 7

KPU ...Hal 7

„ Gamawan Fauzi

JAKARTA- Mayoritas Pemerintah Daerah di Sumatera Utara, ternyata belum juga belum mematuhi instruksi Menteri Dalam Negeri (Mendagri) Gamawan Fauzi agar segera melaporkan pertanggungjawaban pelaksanaan APBD secara online, melalui website Pemda masing-masing. Dari 33 kabupaten/kota yang ada, baru Kabupaten Samosir yang melakukan hal tersebut, ditambah pemerintah Provinsi Sumatera Utara. Sementara 32 kabupaten/kota lainnya, sama sekali belum juga melakukan hal tersebut. Hal ini tentu saja sangat disayangkan Direktur Jenderal (Dirjen) Keuangan Daerah Kemendagri, Yus-

wandi A Temanggung. “Padahal itu sudah ada instruksi menterinya, dan kita coba mulai tahun ini,” ungkapnya secara khusus kepada koran di Jakarta, Kamis (27/9). Apalagi tidak hanya di Sumut, dari seluruh daerah di Indonesia, juga masih sangat sedikit yang melakukan hal tersebut. Padahal Mendagri menurut Yuswandi mengeluarkan instruksi tersebut, semata-mata guna menjamin transparansi di tengah era keterbukaan sekarang ini, dalam pengelolaan keuangan daerah. Untuk itu Direktorat Keuangan Daerah Kemendagri, ungkap ‹ ‹ Baca

Belum ...Hal 7

„ Suryadharma Ali


Haji Lansia Diprioritaskan MENTERI Agama Suryadharma Ali menegaskan bahwa pemerintah tahun depan akan memprioritaskan pemberangkatan jemaah haji yang berusia lanjut (lansia). “Ini langkah pembenahan agar para calon haji lanjut usia mendapat kesempatan di awal,” kata Suryadharma, Rabu (26/9). Meskipun demikian, Ketua Umum Partai Persatuan Pembangunan ini menjamin perubahan urutan pemberian porsi itu tidak akan mempengaruhi atau memotong antrean calon haji pada tahun yang telah berjalan. Pemberian porsi lansia itu akan disesuaikan juga dengan potensi kuota yang tidak terserap. Untuk kuota itu, Suryadharma menjelaskan angkanya sekitar 1.000 calon jemaah haji. Jumlah itu meliputi petugas haji, pengawasan, pengendalian, dan penggabungan. Sedangkan soal adanya 817 jemaah haji yang batal berangkat tahun ini, Ali memastikan jatah mereka itu bisa dipakai calon jemaah haji yang lainnya. Para calon yag batal berangkat itu semua tercatat sudah memiliki visa. Pembatalan itu terjadi karena beberapa kasus, seperti meninggal dunia, sakit atau sedang tugas pekerjaan. “Posisi yang kosong karena batal itu bisa digunakan calon jemaah lain asal yang terdaftar sudah dicoret dulu namanya oleh Kedutaan Arab Saudi sebagai bukti pembatalan. Harus tetap ada izinnya dari sana,” kata dia. (int)

RAKYAT SEGEL DPRD ‘JANGAN PILIH WAKIL RAKYAT INI LAGI’ MADINA- Dua ratusan massa dari Forum Masyarakat Penyelamat Madina atau FMPM unjuk rasa di gedung DPRD Madina, Kamis (27/9). Dalam unjuk rasa ini, massa menyegel sejumlah ruangan di DPRD dan mengajak warga Madina untuk tidak memilih wakil rakyat yang sekarang pada pemilihan legislatif mendatang. Aksi massa yang dimulai pukul 11.00 WIB hingga pukul 13.15 WIB ini tak hanya membikin suasana politik panas tapi juga terbilang unik. ‹ ‹ Baca

RAKYAT ...Hal 7

„ Para Wartawan saat meliput aksi unjuk rasa FMPM.



METRO BONAPASOGIT Teraktual dari Tarutung, Balige, Humbahas dan Samosir

Jumat 28 September 2012

Edisi 73 „ Tahun IX



Besok, Pemkab Taput Gelar Temu Pers

Monang Sitorus Diperiksa

TAPUT- Sabtu (29/9) Pemkab Taput melalui bagian Humas dan Keprotokolan mengundang sejumlah wartawan yang bertugas di daerah itu untuk menghadiri temu pers yang digelar di Rumah Kapal Salib Kasih, Siatas Barita. Tujuan digelarnya temu pers yakni untuk menginformasikan berbagai kegiatan yang telah dilaksanakan pemkab selama tahun 2012. Demikian diungkapkan Kabag Humas dan Keprotokolan Pemkab Taput Humisar Silalahi, Kamis (29/9). “Kita sudah menyebarkan undangan kepada seluruh wartawan,” ujarnya. Hanya saja dia mengatakan, hadir dalam temu pers nantinya Asisten III Humala Hutauruk dan Humas. Sementara Bupati Taput Torang Lumbantobing serta pejabat Satuan Kerja Perangkat Daerah (SKPD) tidak bisa hadir karena alasan tertentu. “Yang hadir nanti di

„) Baca Besok ..Hal 10


Anak-anak Histeris Ibunya Dikebumikan DOLOKSANGGUL- Jenazah Ati br Manullang (35), wanita yang ditemukan membusuk di Parit Tao Hau Silom Parhonasan, Dusun Laguboti, Kecamatan Pollung, Humbahas, disambut histeris keempat anaknya. Usai diotopsi di Rumah Sakit Umum (RSU) Djasamen Saragih Pematangsiantar, jenazah korban langsung disemayamkan di pemakaman keluarga di Dusun Sibaragas, Desa Sihite, Kecamatan Doloksanggul, Kamis (27/9) pukul 09.05 Wib. Pantauan METRO, ambulan yang membawa korban dari Pematangsiantar langsung memasuki pemakaman keluarga tanpa disemayamkan di rumah duka terlebihdahulu karena sudah bau. Saat pe„) Baca Anak-anak ..Hal 10

(Foto: Hermanto Turnip)

KELUAR: Mantan Bupati Tobasa Monang Sitorus keluar dari Kantor Kejaksaan Negeri Balige, Kamis (27/9). Monang dimintai keteragan tentang dugaan korupsi SIMPUS Tahun 2006 senilai Rp340 juta.

TARUTUNG- Sejumlah Panitia Pemilihan Kecamatan (PPK) Pilgubsu yang dinyatakan lulus oleh KPU Taput, mengaku dikutip sebesar Rp250 ribu oleh Pengadilan Negeri (PN) Tarutung saat mengurus Surat Keterangan Tidak Pernah Dipidana Penjara (SKTPDP). “Kami dipungut biaya Rp250 ribu untuk mengurus SKTPDP ke PN Tarutung untuk persyaratan menjadi onggota PPK. Pegawai yang mengutip itu marga Sinaga,” kata Untung Parsaoran Sitinjak, salah seorang anggota PPK Kecamatan Tarutung, Kamis (27/9). Dijelaskan, sebelumnya dia bersama temannya sesama PPK sepakat mendatangi kantor PN Tarutung untuk me-

ngurus SKTPDP. “Salahsatu syarat melamar PPK kan SKTPDP. Makanya kami ramai-ramai mengurusnya. Begitu pengurusan, kami dikenai biaya Rp250 ribu. Terus terang kami keberatan dan membatalkan mengurusnya,” akunya. Senada disampaikan PPK lainnya, R Manalu. Dia mengatakan, pungutan itu diminta langsung oleh petugas administrasi PN Tarutung. “Mengetahui pengurusan itu dibebani biaya, kami langsung menghentikan pengurusan itu, karena menurut kami pungutan itu tidak pantas dilakukan oleh lembaga pemerintah,” sebutnya.

„) Baca Urus SKTPDP ..Hal 10

Kasdim 0210/TU Gelar Latihan Taktis Intelijen Foto:int

Produk Madu Asli Lintongnihuta Dipamerkan PANGURURAN- Produk Madu asli dari Desa Lintongnihuta, Kecamatan Ronggur Nihuta, Kabupaten Samosir, siap mengisi pameran hari tani nasional di Onan Baru Pangururan, Jumat (28/9) guna mempromosikan peluang pengembangan usaha tani komoditas tersebut bagi masyarakat. “Serikat tani Samosir siap memamerkan hasil peternakan Madu yang sudah sejak lama mereka tekuni, sekaligus untuk memancing minat para investor menanamkan investasinya dalam

„) Baca Produk ..Hal 10

„) Baca Monang Sitorus ..Hal 10

Urus SKTPDP Dikutip Rp250 Ribu

„ Relson Muliadi Nababan

LEBAH: Seorang peternak menghunjuk sarang lebah miliknya.

TOBASA- Mantan Bupati Toba Samosir Monang Sitorus diperiksa 1,5 jam terkait dugaan korupsi pengadaan Sistim Informasi Manajemen Puskesmas (SIMPUS) Tahun 2006 di Dinas Kesehatan senilai Rp340 juta. Bupati periode 2005-2010 itu datang ke Kejaksaan menggunakan mobil kijang Inova putih BK 279 MS sekira pukul 09.40 Wib bersama penasehat hukumnya Timbul Hutajulu dan langsung ke ruangan Kasi Pidsus.

TARUTUNG- Kepala Staf Kodim 0210/TU Tapanuli Utara (Taput) Mayor Inf Risa Wilsi SH, resmi membuka Latihan Taktis, Kamis (27/9). Pembukaan itu digelar di Halaman Kantor Kodim setempat dalam sebuah upacara dilanjutkan penyematan tanda peserta latihan kepada tiga peserta perwakilan. Bertindak sebagai Irup Kasdim 0210/TU Mayor Inf Risa Wilsi SH. Latihan Taktis unit Intelijen ini digelar selama dua hari sejak Kamis-Jumat (2728/9). Tujuannya untuk memelihara dan meningkatkan kemampuan personel unit Intelijen Kodim 0210/TU dalam kegiatan operasi intelijen baik kepentingan tugas sendiri maupun menunjang tugas pokok komando atas. “Meski kegiatan ini bersifat latihan, akan tetapi para peserta harus mampu mengaplikasikan dengan sunguhsungguh materi di lapangan,” kata Kasdim 0210/TU Mayor Inf Risa Wilsi saat membacakan amanat Komandan Kodim (Dandim) 0210/TU Letkol Inf Victor Tampubolon.

Foto:Bram Situmorang

„ Pembangunan Salib Holong milik Bupati Tobasa Kasmin Pandapotan Simanjuntak, yang sumber dananya berasal dari APBD Tobasa.


Milik Bupati Tobasa Dianggarkan di APBD BALIGE- Forum Rembuk Toba bersama elemen masyarakat menuding Bupati Tobasa Kasmin Pandapotan Simanjuntak menyalahgunakan wewenang sebagai bupati. Pasalnya, dana pembangunan Salib Holong di Kecamatan Silaen miliknya dianggarkan di APBD senilai Rp1 miliar lebih. Demikian diungkapkan Sekretaris Forum Rembuk Toba Wels Sianipar di Ge-

dung DPRD Tobasa kepada METRO saat hendak menemui Ketua Komisi B yang membidangi pembangunan dan keuangan Jojor Marintan br Napitupulu, Rabu (26/9). “Sumber dana pembangunan Salib Holong di lahan Bupati Tobasa Kasmin Simanjuntak berasal dari Anggaran Pendapatan dan Belanja Daerah (APBD). Untuk

„) Baca Milik ..Hal 10

Foto/ Bernad L Gaol

SEMATKAN: Kepala Staf Kodim 0210/TU Taput Mayor Inf Risa Wilsi SH menyematkan tanda peserta latihan, Kamis (27/9). Dtekankan kepada para peserta latihan agar memanfaatkan kegiatan tersebut dengan baik. Sehingga para peserta memiliki kemampuan dan

keterampilan sebagai insan intelijen. Kasdim juga menyampaikan agar

„) Baca Kasdim ..Hal 10

Foto Bram Situmorang

„ Salahsatu proyek di Salib Holong yang belum rampung.


28 September 2012

Sambungan Halaman 9 sektor perdagangan komoditas dimaksud,” kata Staf Kelompok Studi dan Pengembangan Prakarsa Masyarakat (KSPPM) Roganda Simanjuntak di Pangururan, Kamis (27/9). Menurut dia, peluang pengembangan bisnis perdagangan madu cukup menjanjikan, sehingga jumlah petani yang mengusahai komoditas itu makin bertambah banyak, mengingat manfaatnya yang cukup besar bagi kesehatan masyarakat hingga sering dicari untuk dikonsumsi. Oleh sebab itu, lanjut Roganda, pihaknya telah melaksanakan pelatihan budidaya lebah madu “Apis mellifera” yang dalam bahasa daerahnya disebut ‘Ranggiting’ bagi sejumlah peternak yang menekuni usaha tersebut, Memang, kata dia, pendampingan lebih efektif masih sangat diperlukan para peternak madu dimaksud, meski mereka sudah cukup lama menekuni budidaya beternak madu, karena secara umum kelompok-kelompoknya belum terorganisir dengan baik. Selain itu, lanjutnya, mereka perlu diberi pemahaman, karena perkembangan dan hasil lebah madu sangat banyak dipengaruhi iklim dan peng-

gunaan pupuk pestisida di sekitar wilayah peternakan. “Kerjasama di antara masyarakat serta peran Pemerintah melalui instansi terkait sangat diperlukan, agar budidaya pengembangannya bisa semakin meningkat,” ujarnya. Sementara itu, Ketua Dharma Wanita Kabupaten Samosir, Rohani Silitonga menyebutkan, sebagai mitra masyarakat, pihaknya bersedia membantu pendistibusian dan pemasaran madu di kabupaten berpenduduk sekitar sekitar 119.653 jiwa tersebut. Menurutnya, pemasaran produk madu telah sampai ke sejumlah toko di daerah itu, namun kemasannya masih membutuhkan disain lebih menarik serta perlu dittuliskan dalam tiga bahasa, yakni bahasa Batak, Indonesia dan Inggris, guna memperlancar penjualannya. Simbolon, peternak Madu dari Desa Lintongnihuta menyebutkan, dirinya berani menjamin keaslian produk yang mereka hasilkan, karena tidak ada bahan campuran lain. “Madu asli tersebut dijual seharga Rp120 ribu per botol dan dapat dipesan di Desa Lintong Nihuta atau di Sekretariat Serikat Tani Kabupaten Samosir (STKS) Pangururan,” katanya. (ant/int)

Milik Bupati Tobasa Dianggarkan di APBD Sambungan Halaman 9 itu, kita ingin mempertanyakan dana sejumlah fasilitas di lahan milik pribadi bupati itu. Kita curiga, dana itu menggunakan uang rakyat. jadi DPRD harus menjelaskan hal ini semua,” tegas Wels didampingi Hartoyo SH Sipahutar dari Komisi Nasional Pengawas Aparatur Negara, Walsa Tampubolon dari LSM Masyarakat Peduli Tobasa, Jhony Tambunan dari LSM Gerakan Abdi Tuhan Allah, Nikson Marpaung dari Lembaga Mitra Pembangunan Bonapasogit dan Mansur Pardede dari Badan Investigasi Nasional Tobasa. Kedatangan mereka ke kantor DPRD untuk menagih janji Ketua Komisi B beberapa waktu lalu terkait pemanggilan Kepala Dinas terkait yang mengalokasikan anggaran ke Bukit Holong tersebut. Dikatakan Wels, sejak Kasmin menjabat bupati banyak ditemukan kebijakan-kebijakan para pengambil keputusan di daerah itu tidak berpihak pada rakyat. Tetapi justru menguntungkan pribadi bupati sendiri. Misalnya, tahun 2010, Dinas PU mengucurkan dana sebesar Rp500 juta untuk pembagunan jalan di Bukit Holong, yang bersumber dari Percepatan Pembangunan Infrastruktur Daerah. “Semua orang tahu kalau Bukit Holong itu milik bupati. Kemudian, tahun ini, beberapa dinas juga menganggarkan dana di lahan itu. misalnya, pembuatan jalan dan paret. Entah darimana sumbernya. Karena ketika melakukan pembangunan pekerja tidak memampangkan plang proyek. Tapi yang paling telak adalah dari Dinas Pariwisata. Mereka menganggarkan dana untuk pembangunan 2 unit rumah doa dengan anggaran Rp149.999.000, pembangunan Aula Retreat 1 unit senilai Rp179.999.000, pembangunan jalan beton setapak Rp149.999.000, serta pembangunan Shelter 2 unit dengan anggaran Rp149.999.000. Coba hitung sendirilah berapa totalnya. Apakah wajar? Sementara di tempat lain yang dibutuhkan masyarakat masih banyak jalan rusak bahkan sangat sulit dilalui. Saya berani mengatakan kalau bupati sudah melakukan tindakan menyalahgunakan wewenang dalam masalah ini,” beber Wels, yang juga salah seorang yang membuka kasus Rp3 miliar yang menggiring mantan Bupati Tobasa Monang Sitorus ke penjara tahun lalu. Senada dikatakan Hartoyo dari Komnas Waspan. Ia mengatakan, kebijakan bupati tersebut tidak bisa

LOWONGAN KERJA Daerah operasional : Tobasa, Taput, Humbahas, Sibolga dan Tapteng. Dibutuhkan beberapa orang untuk ditempatkan pada posisi : 1. Sales 3. Sales Promotion Girl 2. Merchandiser 4. Sales Representative Persyaratan : 1. Pria (1, 2, 4) wanita (3, 4) 2. Berorientasi target (1, 2, 3, 4) 3. Pendidikan min. SMA sederajat (1, 2, 3) D3 (4) 4. Usia max 30 tahun (1, 2, 3, 4) 5. Memiliki sepeda motor (1, 2, 4) 6. Memiliki SIM C (1, 2, 4) 7. Bersedia menjalani masa training (1, 2, 3, 4) 8. Jujur dan Bertanggung Jawab (1, 2, 3, 4) 9. Berpenampilan menarik (3, 4) 10. Menguasai Ms. Office dan Internet (4)


Jl. Suprapto No. 74 B Sibolga - Jl. Pemuda No. 8 G Balige Informasi lebih lanjut hubungi Bpk. Siswandi HP 0819 880 881

TOYOTA P. SIANTAR Authorized Toyota Dealer • All new Avanza ready !!! • Veloz accesories full !!! • Grand new innova ready !!!! • Yaris bonus paling lengkap dan full discount • New Rush ready !!! Hub. David Maruhawa, HP 0813 9648 7188; 0831 9355 3180. PIN BB 26C3BF8D (Sales Executive). Data dijemput !!! proses cepat !!!. NB: Harga Siantar = Harga Medan

dibiarkan dan harus diperiksa. “Apakah ini kemauan sendiri atau ada pejabat yang menerima arahan dari bupati. DPRD harus menjelaskan seluruh persoalan ini,” tegas Hartoyo. Sebab, sambungnya, DPRD merupakan salahsatu pengambil kebijakan dalam mengesahkan APBD. Ketua Komisi B DPRD Tobasa Jojor Marintan br Napitupulu ditemui di Gedung DPRD, Kamis (27/9) enggan berkomentar lebih jauh dengan alasan mau rapat. Hanya saja dia berjanji akan memanggil Kadis Pariwisata terkait proyek tersebut. “Kami mau rapat, nanti saya panggil Kepala Dinas Pariwisatanya untuk penjelasan ini,” singkatnya. Demikian Kabag Humas Pemkab Tobasa Elisber Tambunan dikonfirmasi melalui telepon selulernya mengaku tidak berhak memaparkan duduk persoalan proyek tersebut. Elisber malah mengarahkan agar wartawan koran ini menghubungi Kepala Dinas Pariwisata Robert Pardede. Ditemui di kantornya di Balige, Kamis (27/9), Kadis Pariwisata Tobasa Robert Pardede membenarkan bahwa pembangunan Salib Holong itu dikelola pemkab. ”Saya melihat apa yang ada saja. Saya melihat Bukit Holong itu memungkinkan untuk tempat pariwisata, jadi saya coba untuk mengembangkannya,” ucapnya. Namun ketika ditanya soal status kepemilikan lahan Bukit Holong apakah pemiliknya sudah menghibahkan atau dipinjampakaikan, lagi-lagi Robert menolak menjelaskannya. ”Pokoknya saya melihat tempat itu cocok dikembangkan, itu saja,” kilahnya. Tetapi ketika ditanyakan lagi bagaimana nanti jika pemilik lahan mengatakan tidak mengetahui di lahannya ada bangunan pemerintah dan menyuruh agar dibongkar saja, Robert mulai sedikit gagap dan mengatakan “Itu lah gunanya kita saling mengingatkan. Mungkin ke depan akan lebih baik lagi,” tandasnya. Wels Sianipar yang ikut dalam pertemuan itu mengaku kurang puas mendengar jawaban Robert. “Sudah jelas Kadis Pariwisata tidak dapat menunjukkan status tanah tersebut. Apakah dihibahkan, dipinjampakaikan, atau bagaimanalah untuk alas dari sebuah pembangunan yang dianggarkan dari dana APBD. Karena seharusnya APBD itu untuk rakyat Tobasa bukan untuk pribadi. Untuk itu, DPRD harus tegas dan menjelaskan semua pokok permasalahan ini ke publik,” imbau Wels. (brams/des)

PELUANG USAHA AIR MINUM: Pemasangan Depot Air Minum • Air Pegunungan (Mineral) • Sistem RO Oxsygen dan Grosir Peralatan • Depot Air Minum GRACE WATER Jl. Cengkeh Raya P. Simalingkar HP 0813 7010 7352 Melayani pemasangan dalam dan luar kota YAYASAN BELLA: Menerima tenaga kerja khusus wanita, baik gadis/janda dengan usia 17 s/d 45 tahun. untuk dilatih & di pekerjakan sebagai perawat jompo/orang tua sakit, baby sister syarat: ijasah asli, KTP/kartu keluarga gaji berkisar Rp. 1.000.000 S/D 1.700.000 /bulan lamaran diantar langsung ke Jl. Medan KM 3.5 Depan Rumah Sakit Horas Insani Hp. 081396355444; 0878 9257 8000. Menerima setiap hari MAU SEHAT & KELIHATAN BUGAR: Bergabunglah bersama kamidi Senam Sehat & Bugar Aerobic F3 (Fit, Fresh & Fun) alamat Jl. SM Raja No. 162 Sibolga

Serikat Tani Samosir Pamerkan Produk Unggulan Pertanian PANGURURAN- Serikat tani Kabupaten Samosir, Sumatera Utara, akan memamerkan berbagai produk unggulan pertanian serta mempromosikan potensi daerah setempat guna membuka peluang pengembangan investasi dan percepatan roda perekonomian sektor pertanian di wilayah tersebut. “Berbagai produk unggulan spesifik lokal, seperti madu, kacang tanah dan sejumlah komoditi hortikultura serta hasil pertanian organik lainnya akan dipamerkan dalam memeriahkan peringatan hari tani nasional di Pangururan, Jumat (28/9),” kata Staf Kelompok Studi dan Pengembangan Prakarsa Masyarakat (KSPPM), Roganda Simanjuntak di Pangururan,

kemarin. Menurutnya, potensi pertanian di daerah itu cukup besar, tapi karena kurangnya promosi mengakibatkan banyak pelaku bisnis komoditi pertanian yang tidak mengetahuinya, padahal peluang ekonomi dan investasi dalam sektor dimaksud cukup menjanjikan untuk dikembangkan di wilayah tersebut. Sebab, kata dia, topografi daerah dengan dataran tinggi itu, memang memiliki sumber daya yang sangat besar untuk budidaya berbagai tanaman keras, seperti kopi dan karet, begitu juga dengan tanaman hortikultura, seperti aneka tanaman buah dan sayuran. Roganda menyebutkan, sejumlah

anggota Serikat tani dari Kabupaten Tapanuli Utara dan Toba Samosir akan bergabung dengan kelompok tani Humbang Hasundutan beserta Aliansi Masyarakat Adat Nusantara (AMAN) Tano Batak, untuk memamerkan berbagai hasil pertanian unggulan dari masingmasing daerah. Selain memamerkan hasil-hasil pertanian, lanjutnya, mereka juga akan memamerkan alat pengolah pupuk kompos serta alat tenun bukan mesin penghasil selendang “ulos” Batak yang disebut “hasuksak”. “Pesta rakyat yang diisi berbagai produk pertanian itu, juga merupakan bentuk ekspresi produktif dari sekelompok petani sebagai

luapan kesadaran serta pendidikan kritis kebangsaan,” sebutnya. Dikatakannya, semangat momentum hari tani perlu dijadikan sebagai renungan bersama, mengingat mayoritas penduduk Indonesia merupakan petani yang identik dengan kemiskinan, sehingga dinilai perlu adanya pembaruan agraria sejati guna membawa perubahan kehidupan petani yang lebih baik. “Pemerintah daerah setempat perlu menggalakkan kegiatan yang terkait dengan kemajuan sektor pertanian melalui tata kelola pengaturan serta pengawasan yang baik guna mencapai perolehan hasil maksimal dengan memacu produksi,” tambah Roganda. (ant/int)

Monang Sitorus Diperiksa Sambungan Halaman 9 Kepala Seksi Pidana Khusus (Kasi Pidsus) Kejaksaan Negeri Balige Polmen Butarbutar mengatakan, pemanggilan tersebut untuk lebih mendalami kasus pengadaan SIMPUS di Dinas Kesehatan Toba Samosir. Pada saat itu, Monang Sitorus menjabat sebagai bupati. Hanya saja, sebut Polmen, Monang masih berstatus sebagai saksi. “Ya, statusnya sebagai saksi. Karena bersangkutan pada masa itu sebagai bupati,” kata Polmen, Kamis (27/9) di Kejaksaan Balige. Polmen menjelaskan, selain Monang, Kejaksaan juga telah melayangkan surat panggilan kepada sejumlah kepala puskesmas untuk melengkapi berkas. Selain itu, kejaksaan telah memeriksa sejumlah puskesmas penerima SIMPUS untuk mengetahui kondisi keberadaan serta situasi SIMPUS itu sendiri. “Kami tidak ingin (kasus) ini berlamalama. Tapi hambatannya seperti inilah, seharusnyaKepalaPuskesmasBaligedan Laguboti hari ini akan memberikan keterangan.Namunsampaisaatinibelum hadirmemenuhipanggilan,“tambahnya.

Perubahan status saksi atas Monang Sitorus menjadi tersangka belum bisa dipastikan. Menurut Polmen, pihaknya masihterusmendalamikasusini.“Sayakan masih baru bertugas disini (Kejaksaan Balige, red). Kasus ini sudah lama dan sekarang menjadi tugas saya untuk menuntaskannya,” terangnya. SIMPUSiniadalahsejenissoftweardan rencananya digunakan di 14 puskemas yangadadiTobasa.Kasusinimulaidisidik oleh Kejaksaan berdasarkan laporan masyarakat tentang adanya dugaan korupsi pengadaan SIMPUS. Informasi yang diperoleh, Monang Sitorus mengirimkan surat kepada Dinas Kesehatan untuk membentuk panitia lelang SIMPUS. Monang dalam surat tersebut juga memberikan izin prinsip penunjukan langsung. Usaimemberikanketerangan,Monang langsungbergegasmencarimobilnya.Saat diwawancarai,diamenolakmemberikan keteranganataspemanggilandirinya.Dia menyarankan agar pertanyaan langsung ditujukan ke penasehat hukumnya. “Ke penasehat hukum saya aja,“ singkat Monang seraya menghunjuk penasehat hukumnyaTimbulHutajulu. TimbulHutajulumembenarkanbahwa

(Foto: Bram Situmorang)

„ Mantan Bupati Tobasa Monang Sitorus didampingi kuasa hukumnya. Monang Sitorus dipanggil sebagai saksi dalamkasuspengadaanSIMPUSdiDinas Kesehatan. Kata Timbul, Monang menjawab seluruh pertanyaan yang diajukan penyidik. “Semua pertanyaan dijawab Monang. Kalauditanyakan,harusdijawab,“ujarnya sambil bergegas menuju mobilnya. TerkaitdengankemungkinanMonang akan dipanggil kembali untuk dimintai

keterangan, Timbul mengatakan tidak bisa memastikan karena hal tersebut merupakan kewenangan kejaksaan. Pantauan METRO, pemeriksaan terhadap Monang berakhir pada pukul 11.30 Wib. Monang dicerca belasan pertanyaan oleh penyidik kejaksaan. Polmen mengatakan kasus ini berkaitan dengan Monang Sitorus sebagai bupati kalaitu.(cr-03/des)

Besok, Pemkab Taput Gelar Temu Pers Sambungan Halaman 9 acara itu hanya Asisiten III dan bagian Humas,” ujarnya. Hotbin Purba, salah seorang jurnalis yang bertugas di Pemkab Taput mengatakan, dia berharap pada temu pers nantinya dihadiri Bupati Taput serta jajaran SKPD. “Yang namanya temu pers, bupati dan kabinetnya harusnya hadir. Karena dalam sesi

tanya jawab nantinya bisa langsung dijawab pejabat terkait. Kalau cuma Humas dan Asisten III, mereka itu kan hanya menampung pertanyaan kita saja,” ketusnya. Selain itu, sambungnya, acara temu pers yang dilakukan sekali dalam setahun harusnya dimanfataakan bupati untuk duduk bersama dengan para pekerja di media. Selain untuk mempererat keakraban juga menjadi

kesempatan bupati untuk meluruskan segala hal yang menurutnya tidak sesuai dengan fakta. “Saya rasa disinilah bupati dapat meluruskan semua pemberitaan yang mungkin kurang tepat. Selain itu, ada kalanya wartawan ingin menanyakan dan dijawab langsung bupati,” sebutnya. Apabila seorang bupati sering tidak hadir dalam acara temu pers, kata

Hotbin, pers bisa berasumsi bahwa bupati takut menjawab pertanyaan yang diajukan wartawan. “Bisa-bisa saja kita berasumsi seperti itu. Sebab, biasanya apabila seorang pimpinan itu ingin menyampaikan kegiatan pembangunan yang telah dilakukan dengan benar, dia pasti lebih suka menyampaikan sendiri. Kalau tidak hadir, wartawan bisa berasumsi buruk,” pungkasnya. (cr-02/des)

Foto/ Bernad L Gaol

TINJAU: Kepala Staf Kodim 0210/TU Taput Mayor Inf Risa Wilsi SH meninjau kesiapan peserta upacara, Kamis (27/9).

Kasdim 0210/TU Gelar Latihan Taktis Intelijen Sambungan Halaman 9 peserta memusatkan perhatian sepenuhnya dalam pelaksanaan latihan

dengan memperhatikan faktor keamanan dan kerahasian. Sehingga pelaksanaanya bisa berjalan dengan tertib dan lancar. Selain itu, peserta


Telah tercecer SPH – GR No. 476/ SPH-GR/CSB/III/1994 tanggal 22 Maret 1994 An. Nuranima Agus Karmila Z. oleh Camat Kec. Sibolga. Tercecer sekitar bulan Juli 2011 antara Sibolga – Tapteng. Bagi yang menemukan harap hub. kami ke HP 0823 6401 1002. Tidak dituntut tapi tapi diberikan hadiah yang sepantasnya.


Produk Madu Asli Lintongnihuta Dipamerkan

Pertama & Nomor 1 di Indonesia

juga diimbau mengembangkan daya kreatif setiap menghadapi persoalan dengan berpedoman pada ketentuan yang berlaku.

”Untuk itu, peserta dituntut agar melaksanakan kegiatan ini dengan benar khususnya saat menjalankan tugas di lapangan,” tandasnya. (cr-01/des)

Urus SKTPDP Dikutip Rp250 Ribu Sambungan Halaman 9 Mereka berharap pihak pengadilan dapat memberi penjelasan atau data akurat secara tertulis tentang biaya-biaya yang harus dikeluarkan oleh masyarakat dalam pengurusan Surat Keterangan Tidak Pernah Dipidana Penjara selama 5 tahun tersebut. Terpisah, Humas Pengadilan Negeri Tarutung Relson Muliadi Nababan SH dikonfirmasi METRO terkait adanya kutipan mengurus SKTPDP tersebut mengaku belum mengetahui adanya pungutan itu.

Namun dia menegaskan, dalam pengurusan surat keterangan tidak pernah dipidana penjara dengan ancaman 5 tahun lebih, tidak ada dibebankan biaya administrasi kepada warga. “Secara prosedur resmi, kita tidak ada membebankan biaya apapun kepada warga dalam pengurusan administrasi seperti itu. Tapi nanti akan saya cek, dan informasi ini menjadi koreksi bagi kami. Tolong juga diberitahukan kepada kami siapa petugas pengadilan meminta biaya administrasi itu,” ujarnya. (cr-01/des)

Anak-anak Histeris Ibunya..

Sambungan Halaman 9

nguburan, keluarga dan anak-anak korban terus menangis. “Kita tidak bisa menahan jenazah ini lama-lama. Karena kondisinya tidak memungkinkan dan sudah bau,”kataIManullang,salahseorangkeluargakorban. Penguburan pun hanya disaksikan keluarga dekat dan pihak kepolisian yang membawa mayat setelah diotopsi dari Pematangsiantar. Acara penguburan hanyadilakukansederhanatanpaacarakhususseperti layaknya pemakaman biasa.

Sementara Tiara, anak sulung korban hanya dapat mengelus air mata, diiringi isak tangis yang sekali-kali menyebutkan “ibu” diikuti ketiga adik-adiknya yang masih sangat kecil-kecil di samping seorang wanita yang turut menangisi jenazah korban. “Saya mau pembunuh ibu kami segera ditangkap dan dijatuhi hukuman sepantasnya<’ ucapnya seraya mengusap airmatanya. untuk diketahui, korban meninggalkan empat orang anak. Di antaranya, tiga perempuan dan satu lakilaki yang masih berusia satu tahun. Sekarang keempat anak korban tinggal bersama oppungnya. (jona/des)


28 September 2012

Divonis 3 Tahun Penjara MIRANDA BANDING „ Brigjen Ahmad Reza Pourdastan.

Iran Siap Perang dengan Israel TEHERAN- Militer Iran kembali menyampaikan kesiapannya menghadapi ancaman perang Israel. Penegasan itu disampaikan Panglima Pasukan Darat Militer Iran Brigjen Ahmad-Reza Pourdastan. ”Iran punya kesiapan yang diperlukan untuk menghadapi ancaman-ancaman dari rezim Zionis (Israel),” cetus Pourdastan seperti dilansir Press TV, Kamis (27/9). Israel telah berulang kali mengancam akan menyerang fasilitas-fasilitas nuklir Iran. Retorika perang kian gencar disampaikan Israel terkait tuduhan bahwa Iran tengah mengembangkan senjata nuklir lewat program nuklir yang dijalankannya. ”Kami memiliki rencana pertahanan laut, udara dan darat untuk mempertahankan perbatasan-perbatasan Republik Islam,” tegas pejabat militer Iran tersebut. Israel, juga Amerika Serikat dan negara-negara Eropa telah lama mencurigai Iran diam-diam tengah mengembangkan senjata atom lewat aktivits nuklirnya. Namun pemerintah Iran berulang kali membantah hal tersebut. Teheran menegaskan, program nuklirnya semata-mata untuk tujuan damai, yakni sebagai pembangkit energi bagi kepentingan sipil. Mengenai latihan penyisiran ranjau yang tengah dilakukan militer AS di Teluk Persia, Pourdastan menyebut latihan itu sebagai “pasif.” Latihan militer AS tersebut dimulai pada 16 September lalu dijadwalkan selesai pada 27 September besok. Angkatan Laut AS telah menegaskan, latihan militer tersebut semata-mata bersifat defensif dan tidak diarahkan ke negara manapun. (kmc/int)

JAKARTA- Mantan Deputi Gubernur Senior Bank Indonesia, akan mengajukan banding atas Pengadilan Tindak Pidana Korupsi Jakarta yang menjatuhkan terhadapnya. Miranda menilai dirinya tidak terbukti bersalah menyuap anggota DPR 1999-2004 saat mengikuti pemilihan DGS BI 2004. Hal tersebut disampaikan Miranda dalam persidangan yang berlangsung di Pengadilan Tipikor, Kamis (27/9), seusai mendengar putusan majelis hakim. ”Saya ingin mengatakan, saya kaget, tidak menyangka. Tuhan tahu saya tidak bersalah, saya akan naik banding,” kata Miranda tegas. Sementara menyatakan masih akan pikir-pikir atas putusan majelis hakim tersebut. Dalam amar putusannya, majelis hakim yang diketuai Gusrizal menyatakan Miranda bersalah melakukan tindak pidana korupsi sesuai dengan Pasal 5 Ayat 1 huruf b Undang-Undang Pemberantasan Tindak Pidana Korupsi (UU Tipikor) juncto Pasal 55 Ayat 1 ke-1 KUHP dalam dakwaan pertama. Putusan ini yang meminta hakim menghukum empat tahun penjara.

Menurut hakim, Miranda terbukti menyuap bersama-sama aktor lainnya. Adalah Nunun Nurbaeti yang divonis dua tahun enam bulan penjara karena dianggap sebagai pemberi suap dalam kasus ini. Selama ini, Miranda berdalih kalau dirinya tidak mengetahui ihwal pemberian cek perjalanan kepada anggota DPR 1999-2004, sementara majelis hakim tidak sependapat dengan pembelaan Miranda tersebut. Menurut hakim, meskipun pemberian suap tidak dilakukan Miranda secara langsung, dia dapat dianggap ikut menyuap karena perbuatannya berhubungan dan berkaitan erat dengan perbuatan aktor lain, di ant-

„ Miranda usai menjalani persidangan di Pengadilan Tipikor Jakarta. aranya Nunun Nurbaeti, Hamka Yandhu, Dudhie Makmun Murod, Udju Djuhaeri, dan Endin Soefihara. ”Kita tidak melihat masing-masing peserta dan berdiri sendiri-sendiri, melainkan perbuatan yang berhubungan dan sebagai kesatuan perbuatan peserta lainnya,” kata hakim Anwar. Pada Mei 2004, Miranda mengadakan pertemuan dengan anggo-

ta DPR 1999-2004 asal Fraksi PDI Perjuangan dan Fraksi TNI/Polri. Dalam dua pertemuan itu, Miranda menyampaikan visi dan misinya sebagai calon DGS BI 2004. Pertemuan Miranda itu dianggap berkaitan dengan pemberian cek perjalanan kepada anggota DPR 1999-2004 oleh Nunun Nurbaeti yang dekat dengan Miranda itu melalui Arie Malangjudo. Pemberian cek berlangsung di

Mendagri Minta Kepala Daerah

Hati-hati Kelola Keuangan

„ PM Jepang Yoshihiko Noda

PM Jepang: Tak Ada Kompromi dengan China TOKYO- Perdana Menteri Jepang, Yoshihiko Noda, berkeras bahwa tidak ada kompromi dengan China soal kepemilikan kepulauan yang disengketakan. Ia juga mengecam terjadinya serangan terhadap kepentingan-kepentingan Jepang di China. Ketika berbicara kepada para wartawan pada Sidang Majelis Umum PBB di New York, Kamis (27/9), Noda mengatakan China telah salah paham tentang sengketa tersebut dan menuntut diakhirinya ancaman-ancaman terhadap warga negara dan kepentingan Jepang di China oleh para pengunjuk rasa nasionalis. “Sejauh ini, soal kepulauan Senkaku, kepulauan itu merupakan bagian menyeluruh wilayah kami menurut sejarah dan hukum internasional,” kata Noda merujuk pada sebuah kepulauan di Laut China Timur yang disebut China sebagai Diaoyu. ”Jelas sekali dan tidak ada masalah kewilayahan. Karena itu tidak bisa ada kompromi yang bisa menjadi langkah mundur dari posisi dasar ini,” katanya kepada wartawan. “Penyelesaian masalah ini tidak boleh dengan paksaan, melainkan secara tenang, dengan memberikan alasan berdasarkan penghormatan terhadap hukum internasional.” Menteri Luar Negeri China, Yang Jiechi, mengatakan kepada mitranya Menlu Jepang, Koichiro Gemba, di Perserikatan Bangsa-Bangsa pada Selasa bahwa Jepang bersalah telah “secara parah melanggar” kedaulatannya, demikian menurut kementerian luar negeri Beijing. “Pihak China tentu saja tidak akan mentolerir aksiaksi sepihak Jepang di Kepulauan Diaoyu,” kata Yang kepada Gemba, menurut keterangan kantornya. Seorang pejabat Jepang di New York mengonfirmasikan kepada AFP bahwa pembicaraan berlangsung “tajam”, tetapi mencatat bahwa kedua belah pihak sepakat untuk terus melakukan dialog. Sengketa tersebut meletus menjadi perang kata-kata antara Beijing dan Tokyo setelah pemerintah Jepang mengambil alih kepulauan yang tadinya dimiliki secara pribadi menjadi kepulauan milik publik. Namun Noda berkeras bahwa langkah tersebut telah disalahartikan. “Bagian dari kepulauan Senkaku yang dimiliki oleh seorang warga negara dialihkan kepemilikannya kepada pemerintah sebagai upaya untuk memastikan kepulauan itu dikelola secara stabil,” ujarnya, menurut terjemahan resmi. “Ini bukan pengambilan baru. Tadinya milik pribadi seorang warga Jepang dan kepemilikan itu dialihkan dalam kerangka hukum Jepang,” ujarnya. (kmc/int)

tengah-tengah uji kelayakan dan kepatutan calon DGS BI 2004. Setelah pemberian tersebut, Miranda terpilih sebagai DGS BI 2004. Dalam kasus ini, Nunun divonis dua tahun enam bulan penjara karena dianggap terbukti sebagai pemberi suap. Sementara lebih dari 25 anggota DPR 1999-2004 yang dianggap terbukti menerima cek perjalanan telah menjalani hukuman. (dtc/int)

„ Seorang jamaah haji sujud syukur begitu sampai di Madinah.

Jamah Haji Tak Perlu Cemas Virus Flu Corona JEDDAH - Jamaah haji dan keluarga di tanah air tidak perlu panik dengan munculnya virus flu bernama corona yang sudah menewaskan warga Saudi dan warga Qatar yang pernah ke Saudi. Kasi Pelayanan Kesehatan Daerah Kerja Jeddah dr Ananto Prasetya di Bandara Haji King Abdul Azis Jeddah, Kamis (27/9), mengatakan kasus virus corona belum pernah ditemukan pada jamaah haji. “Kasusnya ditemukan pada tiga orang, dua diantaranya tewas, satu warga Saudi (60) tahun dan warga Qatar (49) yang pernah berkunjung ke Saudi,” kata Ananto. Berkaitan dengan itu dia mengimbau agar jamaah haji Indonesia tidak panik

karena belum ditemukan kasus pada anggota jamaah haji dari negara lain juga. Meski demikian, dia menilai tidak ada salahnya bersikap hati-hati karena dari tiga kasus, dua meningal. Dijelaskannya, bahwa virus corona adalah virus baru yang ditemukan pada manusia dan berbeda dengan virus penyebab penyakit SARS. Virus corona diduga menyerang ginjal dan pada manusia yang bertubuh lemah. “Jadi jika kita menjaga vitalitas dubuh maka virus ini tidak bisa menyerang,” katanya. Karena itu dia mengimbau jamaah haji untuk menjaga kondisi tubuh. Dia meminta jamaah untuk makan dan minum yang cukup, banyak makanan yang

berserat, sayur dan buah-buahan. Dia menganjurkan sering minum karena saat ini udara di Saudi cukup panas di siang hari, yakni 37—38 derajat celsius pada pukul 12:00 waktu setempat Saat ini sebagian besar jamaah berusia lanjut, 50 tahun ke atas, karena itu dia mengimbau agar jangan beraktivitas banyak di luar ruangan di siang hari. Beribadahlah sesuai dengan kemampuan fisik, pilih yang wajib-wajib saja agar tidak kelelahan. Saat ini sebagian besar jamaah haji Indonesia di Madinah menunaikan shalat lima waktu selama delapan hari untuk mendapatkan arbain (40 kali shalat fardhu). (kmc/int)

Hari Ini KPK Periksa Irjen Djoko Susilo JAKARTA- Komisi Pemberantasan Korupsi (KPK) akhirnya mengumumkan waktu pemeriksaan terhadap tersangka kasus simulator SIM Irjen Djoko Susilo. Mantan Kakorlantas Polri itu akan diperiksa Jumat (28/9). ”Untuk pemeriksaan DS saya dapat informasi besok Jumat,” kata Juru Bicara KPK Johan Budi SP, di Gedung KPK, Jl HR Rasuna Said, Kuningan, Jaksel, Kamis (27/9). Menurut Johan, DS diperiksa sebagai tersangka. Waktu pemeriksaan mulai pukul 09.00 WIB. Dalam kasus simulator SIM ini, KPK menetapkan empat tersangka atas dugaan melakukan penyalahgunaan kewenangan sehingga menimbulkan kerugian negara. Selain Djoko, tiga orang lain yang ditetapkan tersangka adalah Brigadir Jenderal (Pol) Didik Purnomo dan dua pihak swasta, yaitu Budi Susanto dan Sukotjo S Bambang. Ketiga tersangka terakhir itu juga ditetapkan sebagai tersangka oleh Kepolisian Negara RI. Terkait Djoko, KPK sudah memeriksa sejumlah saksi. Di antaranya adalah para perwira polisi antara lain, Kepala Kepolisian Resor Temanggung Ajun Komisaris Besar Susilo Wardono, Kepala Subdit Pendidikan dan

„ Irjen Djoko Susilo mendatangi kantor KPK untuk menjalani pemeriksaan. Rekayasa Direktorat Lalu Lintas Polda Jawa Tengah Ajun Komisaris Besar Indra Darmawan, dan Kepala Polres Kebumen Ajun Komisaris Besar Heru Trisasono. KPK juga sudah memeriksa empat perwira polisi yang menjadi panitia pengadaan proyek simulator SIM 2011. Keempatnya adalah Ajun Komisaris Besar Wisnhu Bud-

dhaya, Ajun Komisaris Besar Wandi Rustiwan, Komisaris Endah Purwaningsih, dan Komisaris Ni Nyoman Suwartini. KPK juga sudah memeriksa Sukotjo S Bambang dan Intan Pardede, Sekretaris Budi Susanto, sebagai saksi untuk Djoko. Namun sampai saat ini KPK belum juga memanggil Djoko sebagai tersangka. (kmc/int)

JAKARTA- Pemerintah menghormati putusan Mahkamah Konstitusi (MK) yang meminta penghapusan aturan izin presiden bagi penegak hukum untuk memeriksa kepala daerah bermasalah. Konsekuensinya, pemerintah akan meminta seluruh kepala daerah untuk berhati-hati dalam membuat kebijakan yang berkaitan dengan keuangan daerah. ”Kita hargai putusan MK. Kita intensifkan pembinaan pengelola keuangan daerah dan pengambilan keputusan,” kata Mendagri Gamawan Fauzi ketika dihubungi, Kamis (27/9). Ia menyebutkan, adanya putusan MK ini juga berpengaruh terhadap rencana revisi UU No32/ 2004 tentang Pemerintah Daerah. Awalnya pemerintah tetap memasukkan klausul izin presiden untuk memeriksa kepala daerah. “Kita akan perhatikan putusan ini saat revisi UU Pemda,” ujarnya. Selama ini, adanya izin presiden tersebut dimasukkan dalam RUU Pemda yang merupakan revisi UU No32/2004. Pasalnya, kepala daerah merupakan perwakilan pemerintah pusat dalam melayani publik di daerah. Jika selama 60 hari izin presiden tidak keluar, penegak hukum bisa memproses lebih lanjut kepala daerah yang diduga bermasalah itu. (mdc/ int)

Angelina Sondakh

Minta jadi Tahanan Rumah JAKARTA- Angelina Sondakh, terdakwa kasus suap penganggaran proyek Kementerian Pemuda dan Olahraga serta Kementerian Pendidikan Nasional, meminta agar dijadikan tahanan rumah. Jika dikabulkan, Angelina tidak lagi mendekam di Rumah Tahanan Pondok Bambu, Jakarta Timur. Permintaan ini disampaikan Angelina atau Angie melalui pengacaranya, Tengku Nasrullah, dalam persidangan yang berlangsung di Pengadilan Tindak Pidana Korupsi (Tipikor) Jakarta, Kamis (27/9). “Kami memohon kepada yang mulia majelis hakim, terhadap urgensi penahanan terdakwa, mengingat anak terdakwa masih berumur dua tahun dan terdakwa adalah single parent. Besar harapan kami mengalihkan jadi tahanan rumah sehingga terdakwa bisa mengasuh anaknya,” kata Nasrullah. Menurut Nasrullah, sesuai Pasal 21 Kitab Undang-Undang Hukum Acara Pidana (KUHAP), sudah tidak ada lagi kepentingan untuk menahan Angelina. Pasal tersebut mengatur bahwa seseorang dapat ditahan jika berpotensi melarikan diri, menghilangkan alat bukti, atau mengulangi perbuatannya. Alasan Angelina akan melarikan diri dianggapnya tidak dapat lagi menjadi dasar penahanan karena Angie tidak akan melakukan hal tersebut. “Tidak akan mungkin karena terdakwa sudah dicegah dan sedang menjalani proses persidangan,” kata Nasrullah. Selain itu, menurut Nasrullah, kliennya tidak perlu lagi di tahanan karena tidak mungkin menghilangkan alat bukti mengingat perkaranya sudah disidangkan. (kmc/int)


28 September 2012

Interaktif Tapanuli BUTUH SARANA AIR BERSIH, Sejumlah pedagang di pusat jajanan malam Sibolga Square, sedang menata dagangannya. Sementara para pedagang makanan dan minuman ini berharap agar pemerintah membangun sarana air bersih di lokasi tersebut.

Pedagang Sibolga Square Butuh Sarana Air Bersih SIBOLGA- Puluhan pedagang di pusat jajanan malam kawasan Sibolga Square membutuhkan sarana untuk air bersih yang digunakan untuk keperluan berjualan. Pasalnya, selama pusat jajanan ini berdiri, para pedagang terpaksa membeli air dengan menggunakan jerigen dari pihak penyalurnya. “Tentunyakan lebih efektif dan efisien jika Pemerintah Kota (Pemko) Sibolga melalui instnasi terkait membangun sarana air bersih di kawasan Sibolgs Square, ketimbang kami membeli per jerigennya setiap hari,” kata Afrinayanti salah seorang pedagang di Sibolga

Square kepada METRO, kepada METRO belum pernah memeroleh perhatian ataupun pembinaan dari pemerintah setempat melalui instansi terkait. Menurutnya, seperti warung miliknya setiap harinya membutuhkan minimal 2 jerigen besar air bersih, dan

itupun digunakan untuk membersihkan atau menyuci peralatan masak memasak maupun peralatan yang dipakai pengunjung disana. “2 jerigen air bersih itu untuk kebersihan. Sedangkan untuk kebutuhan air minum bagi pengunjung tentunya kami bawa dari rumah dan bahkan cukup banyak pedagang yang membeli air mineral dalam kemasan,” tukasnya. Untuk itu, mereka berharap hal ini menjadi perhatian instansi terkait sebab keberadaan sarana air bersih di kawasan Sibolga Square

memang sangat dibutuhkan para pedagang. “Hal itu lebih baik, misalnya pihak PDAM membangun beberapa kran air bersih di sepanjang kawasan Sibolga Square untuk kebutuh-

Sibolga Ilir Butuh Sarana Olahraga Bapak Wali Kota yang trehormat, tolong perhatikan sarana olahraga di Sibolga Ilir. Mohon lengkapi sarana olahraga di daerah terpencil seperti daerah kami ini, agar dapat mengembangkan bakat-bakat anak Sibolga. Atas perhatian bapak, kami ucapkan terima kasih. Pengirim: 082363109XXX

Jalinsum Sibolga-Psp Butuh Perbaikan Bapak Bupati Tapteng yang terhormat, kami selaku masyarakat meminta agar Jalan lintas SibolgaPadangsidimpuan segera diperbaiki. Kami sangat prihatin terhadap jalan rusak di beberapa titik. Pengirim: 082369946XXX

an pedagang. Sebab selain efisien, efektif dan kebersihan air terjamin, biaya yang dikeluarkan oleh para pedagang tentunya jauh lebih murah,” tandasnya. (***)

SEBAIKNYA Pemko Sibolga lewat PDAM Tirta Nauli memang harus menyediakan sarana air bersih di kawasan Sibolga Square yang ramai dikunjungi warga. Hal ini beralasan, sebab dengan didirikannya sarana air bersih, tentunya pedagang lebih terbantu baik dari segi tenaga, materi maupun kebersihan air. Karena kita melihat, setiap harinya para pedagang ini selalu membeli air dengan menggunakan jerigen dan kitapun sebagai warga tidak mengetahui dari mana air tesebut diperoleh dan bagaimana soal kebersihannya. Jhonny WP Simatupang SP, warga Sibolga

ANEH TAPI NYATA Digigit Ular Paling Beracun

Remaja Selamat

SYDNEY-Seorang remaja Australia Taun (17) sungguh beruntung karena selamat setelah digigit salah satu ular paling berbisa di dunia. Remaja itu selamat setelah pemeriksaan sejumlah dokter di Kota Kurri Kurri, Rabu (26/

9). “Kami memiliki penawar racunnya,” kata Toksikologis Geoff Isbister di RS Mater, Newcastle, Australia. Padahal, ular itu sangat berbisa dengan mengandung neurotoksik yang bisa melumpuhkan dan membuat

kesulitan bernafas. Artinya satu tetes saja ludah ular bisa menewaskan 100 orang pria dewasa.Dibuktikan, peristiwa gigitan ular yang ditemukan di gurun pasir Australia Tengah. Peristiwa tersebut, Polisi tengah menyelidiki bagaimana hewan yang biasa hidup di gurun pasir itu bisa sampai di kawasan perkotaan pesisir pantai itu. “Kepolisian sekarang tengah berusaha untuk menyelidiki bagaimana insiden ini bisa terjadi. Dan kami akan meminta keterangan korban setelah pulih,” lanjut polisi. Ia merangkan seekor ular di Taipan Darat mencapai panjang 2,5 meter dan memiliki taring sepanjang 12 milimeter. (kps/nik)

Tiga Kali Melahirkan

Tiga Kali Menang Lotere OSLO-Melahirkan anak dan mendapat keberuntungan tampaknya berjalan beriringan bagi Hege Jeanette Oksnes, (29) seorang ibu asal Pulau Austevoll, Norwegia. Bagaimana tidak, setiap melahirkan ibu tersebut selalu memenangi lotere. “Ini sangat tak masuk akal. Kami bahkan jarang sekali membeli lotere,” kata Osknes yang sehari-hari bekerja sebagai pelayan restoran di sebuah SPBU di pulau kecil itu. Belum lama ini, keluarganya baru saja memenangi lotere sebesar 2,12 juta dollar AS atau

lebih dari Rp 20 miliar. Ini adalah kemenangan ketiga dalam enam tahun terakhir. Perempuan ini pertama kali melahirkan pada 2006 lalu dan ayahnya memenangi lotere sebesar 4,2 juta krona atau sekitar Rp7 miliar. Tiga tahun kemudian, Osknes sendiri yang memenangi lotere dengan nilai 8,2 juta krona atau hampir Rp14 miliar. Dan, kemenangan itu hanya sehari sebelum dia melahirkan anak keduanya. Untuk melengkapi hat-trick, adik Osknes yang berusia 18 tahun Tord meme-

nangi lotere pada akhir pekan lalu, sebulan setelah Osknes melahirkan anak ketiga. Dan, setelah tiga anak dan tiga kemenangan lotere, tampaknya Osknes memutuskan untuk berhenti. “Suami saya berpikir kami sudah banyak memenangi uang kejutan,” katanya. Dengan uang kemenangan loterenya, Osknes bisa membeli mobil baru dan bisa berjalanjalan. Tetapi, dia menabung sebagian besar uangnya di bank dan berharap suatu hari bisa membangun rumah impiannya. (kps/nik)

Kucing Peliharaan

Selamatkan Nyawa Majikan OHIO - Siapa menduga bahwa seekor kucing dapat menyelamatkan nyawa majikannya? Namun hal ini dialami oleh pasangan suami istri Rod dan Michelle Ramsey dari Johnsville, Ohio, Amerika Serikat (AS). Pasangan suami istri itu mengatakan bahwa kucing peliharaan mereka, Tiger, berhasil menyelamatkan hidup mereka menyusul insiden kebocoran tabung gas yang berisi karbon monoksida yang beracun. Rod dan Michelle ini mengaku sudah sepekan terakhir keduanya susah tidur akibat menderita sakit kepala yang tidak biasa terjadi. Namun ketika keduanya mencoba memejamkan mata Tiger tidak mengizinkannya. Kucing itu justru mengganggu Michelle seolah berusaha membawa-

nya keluar rumah.”Tiger ada dirumah pada saat itu. Ia bersuara sangat keras dan mulai bertingkah gila, memaksaku untuk membawanya bermain keluar rumah,” ujar Michelle, Rabu (26/9). Michelle yang mulai tidak tahan dengan tingkah Tiger memilih untuk menelepon dokter hewan, menceritakan perilaku kucing peliharaannya. Namun ketika mendengar penjelasan Michelle, sang dokter hewan langsung meminta mereka untuk memeriksa apakah telah terjadi ke-

bocoran gas.”Dokter itu meminta kami untuk segera keluar rumah,” imbuh Michelle. Tanpa banyak waktu Michelle langsung menghubungi pihak pemadam kebakaran memeriksa kondisi rumah mereka.”Kami pikir kami keracunan makanan akibat spaghetti yang kami makan pekan lalu. Namun ternyata kami keracunan gas karena kebocoran tabung. Petugas medis saja bingung menyaksikan kami masih bertahan hidup,” ungkap Michelle. Untuk memeriksa kondisi kesehatan mereka, pasangan ini mendapat perawatan di The Ohio State University Medical Center.”Semua kucing memang menarik perhatian namun Tiger lebih dari yang lain,” tambah Michelle. (oz/nik)


28 September 2012

Angelina Sondakh

Nangis Sepanjang Jalan USAIsidang,AngelinaSondakhberjalanperlahanmenuju mobil tahanan. Mengenakan seragam putih tahanan KPK, Angie menceritakan alasannya meminta tahanan rumah. Begitu menyebut nama anak-anaknya, Angie langsung menangis. “Tentunya saya memperhatikan perkembangan Keanu, setelah 6 bulan terpisah ya. Biasa ngomongin anak jadi kangen. Kalau misalkan saya, kita lebih baik ditanyakan kepada psikolog. Kalau hakim mengabulkan saya tahanan rumah, baik untuk anak saya,” jelasnya sambil menahan tangis di Pengadilan Negeri Tindak Pidana Korupsi (Tipikor), Jalan HR Rasuna Said, Jakarta Selatan, Kamis (27/9) pagi. Angie didakwa melakukan korupsi pada kasus KemendiknasdanKemenporadengantotalkerugiannegara Rp12,58 miliar dan US$2,35 juta sehingga harus ditahan selama masa persidangan. “Mama saya sudahtua, sebenarnya kan memang tinggal di Manado.Sayamaumendampingi,berharap bisadikabulkan.KalauZahwadanAliyah itu ada teh Reza, kalau Keanu kan sendirian. Mama saya kan kondisi kesehatantidakbegitubaik,”katanya sambil terisak. Angie berharap majelis hakimtidakragumemberistatustahananrumahkepadanya. “Saya tidak akan lari dan saya juga tidak akan mengulangi perbuatanyangdituduhkan.Sepertiyang sudah disampaikan oleh pengacara saya, dan mudah-mudahan majelis hakim bisa mempertimbangkan untuk mengubah status,” tuturnya. Usai sidang, Angie mempersiapkan langkah hukum selanjutnya. “Selanjutnya tahap pembuktian. Kami menerima keputusan majelis hakim dan melanjutkan ke tahapan berikutnya. Tapi saya sebagai ibu dan anak, saya memerlukan seorang ibu karena ayahnya sudah meninggal dan berharap majelis hakim bisa mengabulkan,” pungkasnya. (kpl/int)


Ciuman Nikita

Dihargai Rp5 Juta

SENSASI selalu lekat dengan Nikita Mirzani. Setelah foto syurnya dengan beberapa selebritis, kali ini Nikita yang menjadi salah satu host dalam sebuah acara amal, sengaja melelang ciumannya untuk dihargai sejumlah nominal tertentu. “Ya, itu tadi enggak sengaja saja, ya kebetulan ada yang mau bayar kenapa enggak, ini kan buat amal, bukan buat gue sendiri,” ujar Nikita ketika dijumpai di Konser KOIN (Kepedulian Orang Indonesia): Senandung Untuk Negeri, Hard Rock Cafe, Jakarta Selatan, Rabu (26/9) malam. Awalnya, Nikita menawarkan kepada tamu yang hadir sebuah tiket pertama konser musisi Sting yang akan manggung di Ancol, Jakarta, 15 Desember mendatang. Tiket perdana itu dihargai Rp10 juta. Sayangnya, setelah menunggu, tak satupun tamu yang tertarik. Untuk memanaskan acara, Nikita sengaja turun dari panggung dan menghampiri seorang pria paruh baya

bernama Buddy Jansen (60) dan mulai menggodanya. “Ayo dong Pak, mau ya Pak tiket Sting Rp10 juta lho Pak,” kata Nikita yang tak melihat respon dari bapak berbaju batik itu. “Kenapa enggak mau? Enggak suka? Sukanya apa? Saya? Ya sudah deh saya Rp10 juta saja,” tawar Nikita menggoda. Karena Nikita menilai angka Rp10 juta terlalu mahal untuk sebuah tiket konser, janda satu anak itu menurunkan penawaran lelangnya menjadi Rp5 juta. Tak disangka, sambutannya sangat baik. Dari pengamatan, Nikita yang mengenakan pakaian berpotongan dada rendah dan memperlihatkan tato bertuliskan ‘Nikita’ di dadanya itu memberikan tawaran menggiurkan berupa ciuman plus sebuah tiket. “Demi Sulawesi Tengah, Rp 5 juta for kissing!” teriak

Nikita. “Mau Bapak yang cium atau saya yang cium?” tanya Niki yang langsung disahuti oleh Farhan. “Karena ini konser amal untuk Sulawesi Tengah, ciumannya di tengah dong,” tantang Farhan. Selama beberapa detik, Nikita menempelkan bibir seksinya ke bibir pria berusia 60 tahun itu tanpa malu-malu di depan tamu lain. Kejadian itu sempat diabadikan seluruh tamu yang hadir dengan menggunakan kamera ponsel maupun jepretan awak media. ”Taste very nice , saya mau one more time tapi jangan lah, cukup,” kata pengusaha berdarah IndonesiaBelanda bernama Buddy Jansen (60) itu seraya tertawa. “Saya bilang, saya suka kamu, dia bilang mau di pipi, tapi saya enggak mau, saya maunya di bibir,” celetuk pengusaha tambang itu. (nov/int)


(23 September - 22 Oktober) Peruntungan: Tak perlu banyak bicara jika tidak diimbangi dengan kerja yang cukup. Ingatlah bahwa semua itu perlu bukti, bukan hanya ucapan di bibir saja. Asmara: Usahakan untuk tidak berdebat dengannya, mengalah sajalah.


(21 Desember -19 Januari)

Peruntungan: Yakini intuisi yang timbul dari hati Anda yang paling dalam. Dengan kata lain feeling akan memegang peranan dalam kesuksesan Anda di hari ini. Asmara: Bertuturkatalah yang halus dan tanpa suara yang kasar karena akan mampu mengurangi ketegangan yang seringkali muncul bila ada perbedaan pendapat.


(20 Januari - 18 Februari)

Peruntungan: Tak perlu pesimis dalam melihat berbagai tantangan yang terpampang di hadapan Anda. Justru Anda harus lebih giat bekerja lagi karena itu pertanda bahwa kesuksesan sudah berada di depan mata. Asmara: Walau hanya sebatas berbicara saja sebaiknya dihindari dulu bergaul dengan orang yang tidak disukai si dia.


19 Februari - 20 Maret

Peruntungan: Situasi yang Anda hadapi saat ini masih belum memungkinkan bagi Anda untuk bisa berani melangkah maju. Terimalah situasi yang ada ini dengan pikiran panjang dan jangan hanya memikirkan keberhasilan sesaat saja. Asmara: Mengakui kesalahan sendiri bukanlah suatu perbuatan yang sangat rendah, justru itu akan membikin si dia semakin percaya saja pada diri Anda.


(21 Maret - 20 April)

Peruntungan: Perasaan bimbang masih mewarnai suasana hati Anda di hari ini. Memang untuk menghilangkannya tak semudah membalik tangan, akan tetapi dengan menanamkan kebanggaan dan keyakinan akan kemampuan diri sendiri itu akan bisa mengikis kebimbangan secara perlahan-lahan.Asmara: Ucapan tetap harus diperhatikan agar tidak sampai merusak suasana yang sudah tenang ini.


(21 April - 20 Mei)

Peruntungan: Masih cukup ada rintangan yang harus diwaspadai, walau begitu tak perlu berkecil hati dan tak perlu risau akan ejekan yang muncul. Asmara: Jagalah selalu keserasiannya. Kalau ada pihak yang ingin mengacaukan suasana jangan dibiarkan saja.


(21 Mei - 20 Juni)

Peruntungan: Jangan meremehkan persoalan yang datang, walau sepintas tampak sepele jika tidak segera dituntaskan maka bisa semakin membesar saja. Bukankah persoalan besar bermula dari persoalan kecil, untuk itu jangan tanggung-tanggung untuk bertindak.Asmara: Suasana percintaan Anda tetap terjaga sekalipun cekcok mulut masih sulit untuk dihilangkan.


Nia Ramadhani

Kompak Jalan Bareng Mertua NIA RAMADHANI terlihat mendatangi sebuah konser amal. Kehadiran Nia Ramadhani tak cuma didampingi oleh suaminya, tapi juga oleh mertuanya, Aburizal Bakrie. Ketiganya terlihat memasuki sebuah klub untuk menghadiri acara konser amal untuk bencana di Sulawesi Tengah. “Keluar begini enggak sering, tapi begitu sempat pasti diluangkan waktunya,” kata Aburizal Bakrie alias Ical saat dijumpai tom abloidnova.cdi Konser KOIN (Kepedulian Orang Indonesia): Senandung Untuk Negeri, Hard Rock Cafe, Jakarta Selatan, kemarin malam. Bagi Nia dan Ardie, sosok Ical adalah pria yang sangat dekat dengan keluarga. Jika tidak memiliki kegiatan lain diluar politik, Ical akan memilih menghabiskan waktunya bersama keluarga besarnya. “Sebenarnya papa itu sosok yang sangat dekat dengan keluarga. Kan kalau lagi enggak ada kegiatan apa-apa pasti ngumpul sama keluarga,” kata Nia. “Beliau selalu mengedepankan keluarga. Beliau juga suka Slank, jadi langsung diajak kesini,” timpal Ardi. Berada di tengah-tengah anak muda yang asik mendengarkan musik sekaligus lelang untuk amal, Aburizal terlihat sangat menikmati suasana. Bahkan, kata Nia, ayah mertuanya itu asik berjoget-joget. “Usia saya juga baru 26 kok, enggak ada masalah, asal jangan sering-sering,” canda Ical. “Terpaksa di dalam papa joget-joget,” sahut Nia tertawa. (nov/int)

(21 Juni- 20 Juli)

Peruntungan: Jangan bertingkah macammacam jika tidak ingin mengalami kegagalan yang sangat terasa. Sekalipun peluang masih belum tertutup, sebaiknya Anda bisa mengimbanginya dengan konsentrasi tinggi. Asmara: Jalinlah hubungan kisah kasih ini dengan sesuatu yang indah dan menyenangkan.


(21 Juli-21 Agustus)

Peruntungan: Tak perlu cemas, sesulit apapun masalah tersebut pasti ada jalan keluar untuk memecahkannya. Teruslah berusaha, jangan pantang menyerah dan yang paling penting keyakinan harus tetap tinggi. Asmara: Ada sedikit perbaikan walau belum seperti yang diharapkan.


(23 Agustus-22 September)

P . eruntungan: Saat ini Anda benar-benar merasakan indahnya hidup, apalagi ditunjang dengan suasana yang benar-benar semarak dan segala urusan pekerjaan yang sudah lumayan lancar sehingga tidak ada beban yang terlalu dipikirkan. Asmara: Cukup mesra dan bahagia. Jagalah suasana ini dengan mencari topik pembicaraan yang menyenangkan.


(23 Oktober - 22 November)

Peruntungan: Cobalah untuk bisa lebih teliti agar segala urusan yang sudah hampir jadi tidak sampai mentah lagi hanya karena diri Anda yang kurang bisa mengikuti rencana yang dibuat sendiri. Asmara: Apa sulitnya berbicara yang halus? Tak perlu dengan katakata kasar karena itu akan menyulitkan Anda saja.


( 23 November - 20 Desember)

Peruntungan: Walaupun Anda sudah merasa berada di atas angin sebaiknya kewaspadaan tetap dipertahankan. Jangan sampai berlaku sembrono karena akan berdampak cukup luas jika sampai terjadi hal-hal yang tidak diduga sebelumnya. Asmara: Jangan terlalu dimasukkan hati tingkahnya yang kadang menjengkelkan hati karena itu hanya sementara saja.


Minta Harta Mantan Suami Yulia Rachman SELAIN menginginkan perceraian, pesulap Demian Aditya ternyata juga menginginkan harta bersama sang istri, Yulia Rachman, dibagi dua. Parahnya, Demian juga meminta harta yang dimiliki Yulia bersama dengan mantan suaminya terdahulu. “Yang diminta (Demian, red) Aditya harta yang jauh sebelum perkawinannya dan bukan haknya. Selain itu, yang dia minta di luar konteks, pertama perwalian. Padahal kan menurut UU, anak-anak di bawah umur ikut ibu,” ujar kuasa hukum Yulia, Petrus Balapationa, saat ditemui di Pengadilan Agama Jakarta Selatan, Kamis (27/9). Sementara itu, Yulia sendiri heran kenapa Demian tidak menghadiri persidangan hari ini. Pasalnya, keinginan Demian untuk mendapatkan harta gono gini dan hak pengasuhan anak harusnya dibicarakan langsung dalam persidangan. “Saya nggak ngerti kenapa dia nggak hadir karena katanya karena pekerjaan. Harusnya kan bisa dijadwalkan dan dibicarakan dengan kuasa hukum, kita tahunya di sini karena ada kerjaan. Tapi di sini tadi pengacaranya bilang dia nggak mau datang karena sudah ngotot cerai. Artinya memang ada miss komunikasi dari pihak mereka,” ujar Yulia. Lalu bagaimana perasaan Yulia mengenai jalannya perceraian yang semakin lama ini? “Kalau ditanya, jauh lebih bahagia perasaannya dibanding kemarin. Makin lama makin terlihat, ya Allah tolong dibukakan. Saya mau mediasi untuk anak dan harta gono gini. Ayo selesaikan baik-baik,” harap presenter cantik ini. (kpl/int)

Eunjung ‘T-ara’

Gugat Produser Drama ‘Five Fingers’ Personel T-ara Eunjung sebelumnya telah dipastikan ambil bagian di drama SBS ‘Five Fingers’. Namun, karena kontroversi T-ara pasca dikeluarkannya Hwayoung, Eunjung dikeluarkan dari drama tersebut. Sebagai buntutnya, pihak agensi Eunjung Core Contents media akhirnya memutuskan untuk menggugat produser drama tersebut. Mereka menganggap pembatalan itu merusak reputasi Eunjung. ”Kami mengajukan gugatan karena dikeluarkannya Eunjung dari ‘Five Fingers’ Agustus lalu. Masalahnya bukan tentang uang tapi memulihkan reputasi Eunjung dan kompensasi dari rusaknya kredibilitas Eunjung,” ujar juru bicara Core Contents Media dilansir Soompi, Kamis (27/9). Bagi Core Contents, dikeluarkannya Eunjung dari drama tersebut memperkeruh keadaan usai kontroversi T-ara. Peran Eunjung dalam drama itu digantikan oleh aktris Jin Se Yeon. ”Ia terluka secara emosional dari kontroversi T-ara tapi dikeluarkannya ia hanya membuatnya semakin buruk. Ia sudah jadi aktris sejak kecil dan kami belum pernah mengalami atau mendengar kasus seperti ini sebelumnya. Mencegah hal seperti ini terjadi lagi dan untuk mengembalikan reputasi Eunjung, kami memilih untuk mengajukan gugatan,” pungkasnya. (dtc/int)

Jennifer Lopez

Bawa 88 Kru dari Amerika BANYAK syarat yang diajukan Jennifer Lopez ketika akan manggung di Indonesia. Mulai dari sound system hingga keamanan. Namun, ada hal unik yang diminta JLo. Ia meminta agar tidak disiapkan air di Indonesia. JLo selalu membawa air khusus. “Enggak ada yang aneh-aneh, semua yang diminta bisa diganti. Kecuali air minum,” ujar Reza Prawiro, Presdir Stellar yang mendatangkan JLo ke Indonesia. Reza menjelaskan, saat ini tim nya masih melakukan persiapan untuk konser JLo yang akan dilangsungkan pada 30 September. “Sampai saat ini persiapan masih berjalan. Ada 88 orang termasuk band. Mereka bawa imax, itu pertama kali dipakai untuk pembukaan olimpic. Dia bawa tim khusus untuk visual,” jawabnya. Ditambahkan Reza dirinya belum bisa menjelaskan apa saja yang akan dibawa JLo untuk konsernya nanti. Namun, untuk memenuhi segala kebutuhana, JLo dancer hingga kru yang dibawa dari Amerika. “Dari 88 orang itu akan ada 16 dancer. Kalau perlengkapan berapa kontainer kita belum tahu pasti, soalnya mereka akan bawa alat-alat sendiri,” tandasnya. (nov/int)



28 September 2012

Indonesia Open Grand Prix Gold 2012

Srikandi-srikandi Indonesia Melenggang Tampil di hadapan suporter fanatik Indonesia, srikandisrikandi bulutangkis Merah Putih tampil kesetanan di babak ketiga kejuaraan Indonesia Open Grand Prix Gold 2012, Kamis (27/9), di Palembang, Sumatera Selatan. Ganda putri Indonesia, Anneke Feinya Agustin/Nitya Krishinda Maheswari melangkah ke babak keempat usai menyingkirkan kompatriot mereka Gebby Ristiani Imawan/ Tiara Rosalia Nuraidah melalui pertarungan dua set, 2117 dan 21-12. Langkah Anneke/ Nitya juga diikuti Anggia Shitta Awanda/Devi A Shela

yang menaklukkan pasangan Jepang, Yuki Fukushima/Yui Miyauchi dengan rubber set, 17-21, 21-13, dan 21-19 di babak ketiga. Hasil serupa pun

diperoleh ganda putri Merah Putih lainnya, Pia Zebadiah/Rizki Amelia yang menyisihkan pasangan Indonesia lainnya, Khairunnisa Imma

Muthiah/Geovani Mareta Dea dengan straight set, 21-12 dan 21-13. Untuk nomor tunggal putri, Rusydina Antardayu Riodingin tampil mengejutkan dengan menyingkirkan unggulan ketiga asal Singapura, Xing Aiying melalui pertarungan tiga set, 2022, 23-21, dan 21-15. Renna Suwarno juga mengikuti jejak Rusydina melaju ke babak keempat usai menundukkan tunggal putri Indonesia lainnya, Tike Arieda Ningrum dengan dua set, 21-12 dan 21-17. Fanetri Lindaweni juga memastikan tiket ke babak keempat setelah menyisihkan pebulutangkis putri Jepang, Nozomi Okuhara dengan straight set, 22-20 dan 21-14. Hasil positif juga ditorehkan Adrianti Firdasari di nomor tunggal putri setelah menyingkirkan Sayaka Takahashi dari Jepang lewat pertarungan tiga set, 13-21, 21-13, dan 23-21. (int)

Ganda Putra Sapu Tiket Perempatfinal

Azarenka Tersingkir DUA unggulan dalam turnamen Pan Pacific Open yatua Victoria Azarenka asal Belarusia dan petenis Rusia Maria Sharapova tesingkir di babak perempat final, Kamis (27/9). Azarenka harus tersingkir setelah mengalami kelelahan kronis, sementara si cantik Sharapova harus mengakui keunggulan petenis Australia Samantha Stosur. Sharapova harus mengubur mimpinya untuk meraih gelar ketiganya di Tokyo setelah dalam perempat final yang penuh drama dan kualitas tinggi itu menyerah dua set langsung 6-4 dan 7-6 dari Samantha Stosur.

Unggulan kedelapan Stosur di babak semifinal akan menghadapi petenis Rusia lainnya Nadia Petrova yang menghentikan laju unggulan keenam Sara Erano dengan tiga set 36, 7-5 dan 6-3. Stosur yang hanya menang satu kali dari 11 kali pertemuan sebelumnya dengan Sharapova berhasil memulai inisiatif pertandingan dan merebut set pertama setelah pengembalian backhand Sharapova melebar. Di babak kedua laga lebih ketat dan harus diselesaikan melalui tie-break dengan angka sangat ketat 12-10. Sementara itu juara Australia

Terbuka tahun ini Victoria Azarenka mengundurkan diri sebelum laga melawan petenis Jerman Angelique Kerber dimulai karena kelelahan. Finalis Amerika Terbuka ini juga terlihat susah payah dalam laga babak ketiganya kemarin. “Sebelum turnamen saya memang merasa kurang sehat,” kata Azarenka yang mendapatkan pemeriksaan tekanan darah saat menghadapi Roberta Vinci, Rabu (26/9). “Energi saya sangat lemah dan saya bukan diri saya saat ini. Mungkin ini dampak kelelahan selama musim ini. Saya sendiri tidak tahu apa yang terjadi,” kata Azarenka. (int)

TUJUH ganda putra Indonesia berhasil memastikan diri melaju ke babak perempatfinal kejuaraan Indonesia Open Grand Prix Gold 2012 setelah menyisihkan lawan mereka masing-masing, di Palembang, Sumatera Selatan, Kamis (27/9). Ganda putra unggulan keempat, Angga Pratama/Ryan Agung Saputra tampil cemerlang saat mengalahkan pasangan Indonesia lainnya, Wahyu Nayaka/Ade Yusuf dengan dua set

Maria Kristin GANTUNG RAKET MANTAN pebulu tangkis putri nasional, Maria Kristin Yulianti, akhirnya mengundurkan diri sebagai pemain. Cedera lutut kanan yang berkepanjangan membuat Maria Kristin mengambil keputusan untuk gantung raket. Asisten Manajer PB Djarum Kudus Hastomo Arbi ketika dihubungi dari Semarang, Kamis (27/9), mengatakan sudah setahun ini peraih medali perunggu Olimpiade 2008 Beijing tersebut tidak latihan. Sebenarnya, kata mantan pebulu tangkis nasional tersebut, Maria Kristin sudah berusaha menjalani terapi,

dan beberapa kali mencoba untuk latihan. Tetapi ternyata dia merasa semakin sakit. Akhirnya, tambah pahlawan Piala Thomas 1984 (saat itu mengalahkan Han Jian dari China), Maria Kristin mengambil keputusan untuk mundur dari bulu tangkis. “Setahun yang lalu (awal Januari 2011) yang bersangkutan sudah mundur dari pelatnas,” katanya. Ia mengatakan, sekarang ini Maria Kristin menjadi pelatih di PB Djarum Kudus khusus menangani pemain muda usia 12 tahun. Prestasi terakhir yang dicapai pemain kelahiran Tuban, Jatim, 25 Juni 1985 tersebut adalah menjadi runner-up pada Russian White Nights Challenge 2011. Pada partai final dia dikalahkan rekannya Fransiska Ratnasari melalui pertarungan tiga game 15-21, 23-21, 1121. Prestasi tertinggi Maria Kristin adalah saat meraih medali perunggu Olimpiade 2008 Beijing. Saat itu Maria Kristin mengalahkan tunggal putri tuan rumah Lu Lan dengan tiga game 11-21, 2113, 21-15. Prestasi lain yang dicapai Maria Kristin adalah meraih medali emas SEA Games 2007 pada tunggal putri dan beregu putri. Dia ikut mengantarkan tim Uber Indonesia melangkah ke semifinal 2010, semifinalis tim Indonesia di Piala Sudirman Guangzhou 2009, di samping prestasi lainnya. (int)

RED BULL JENGKEL DENGAN KONSISTENSI ALONSO RED BULL Racing mengakui konsistensi driver Ferrari, Fernando Alonso musim ini merupakan hal yang menganggu bagi tim yang dibela Sebastian Vettel dan Mark Webber ini. Vettel berhasil menempati podium teratas di Grand Prix Formula OneSingapuraakhirpekanlalu.Hasil itu membuat selisih driver asal Jerman tersebut dengan Alonso menjadi tinggal 29 poin. Alonso sendiri masih bercokol di peringkat pertama klasemen pembalap dengan torehan 194 poin. Principal team Red Bull, Christian Horner masih percaya pada kemampuan Vettel, namun diakuinya penampilan Alonso membuat Red Bull kesulitan mengejar. “Sekarang, Seb (Vettel) memiliki manfaat dari pengalamannya,” jelas

Horner ketika ditanya apakah Vettel akan bisa bertahan dalam persaingan ketat musim ini. “Dia telah mendapat beberapa kesulitan selama musim ini, dan dia

tak pernah menyerah. Saya belum pernah melihat dia begitu fokus ketikaturundiGPSingapura,”terang Horner. Horner juga memuji performa Vettel yang sanggup finis

terdepan di GP Singapura kendati start dari urutan ketiga. Dia juga senang dengan hasil yang dicetak Vettel, karena mampu memelihara peluang mempertahankan gelar juara dunia F1. “Dia tampil sangat mengesankan saat race. Hasil itu membuat peluang kami untuk kembali memenangkan gelarpadamusiminikembaliterbuka lebar,” katanya. “Tetapi, satu-satunya yang menjengkelkan dan sedikit membuat kami kurang bahagia dalam euforia kemenangan adalah karena Fernando (Alonso) juga finis dengan meraih podium di akhir grand prix,” pungkasnya. (int)

langsung, 21-17 dan 21-12. Hasil serupa juga ditorehkan Jordan Praveen/ Juang Didit yang menyingkirkan rekan mereka di pelatnas, Ricky Karanda/ Muhammad Ulinnuha melalui rubber set, 21-19, 16-21, dan 21-18. Pasangan Tanah Air lainnya yang melangkah ke perempatfinal adalah Hendra Wijaya/Rian Sukmawan yang mempermalukan senior mereka di pelatnas, Markis Kido/Tri Kusharyanto dengan pertarungan tiga set, 21-15, 1821, dan 21-18. Sementara itu, Faisal Hafiz/ Rhoma Putra Eka juga menambah daftar ganda putra Indonesia di babak perempatfinal usai memulangkan pasangan Malaysia, Mohd Lutfi Zaim/Teo Kok Siang dengan kemenangan tiga set, 13-21, 21-16, dan 22-20. Langkah serupa juga diraih

ganda putra Merah Putih muda, Andrei Adistia/Christopher Rusdianto yang menundukkan pasangan Singapura, Yeo Zhao Jiang/Yi Liu melalui dua set langsung, 25-23 dan 2220. Indonesia kembali menempatkan wakilnya di nomor ganda putra lewat Gideon Markus Fernaldi/Putra Agripinna Prima yang menyingkirkan wakil Filipina, Ronel Estanislao/Paul Jefferson Vivas melalui pertarungan dua set, 21-12 23-21. Ganda putra terakhir Indonesia yang lolos ke perempatfinal adalah Yonathan Suryatama/Hendra Apriadi yang menaklukkan Rahmat Adianto/Berry Angriawan lewat rubber set, 17-21, 2112, dan 21-19. Satu tempat lagi di di nomor ganda putra diraih pasangan Korea Selatan, Kim Ki Jung/Kim Sa Rang yang menyisihkan pasangan Indonesia, Ronald Alexander/Selvanus Geh dengan melalui tiga set, 23-21, 22-24, dan 21-12. (int)

Wow, Mantan Finalis Miss Kroasia

Latih Tim Sepakbola Putra PARA pemain sebuah klub di Kroasia ini pasti akan selalu semangat saat menjalani latihan dan bermain. Karena mereka dilatih oleh seorang wanita cantik, mantan finalis Miss Sport Kroasia. Ya, klub Divisi 5 Kroasia, NK Viktorija Vojakovac telah menunjuk Tihana Nemcic sebagai pelatih. Tihana tampaknya menjadi wanita pertama yang melatih tim sepakbola pria. “Kini, saya menjadi pelatih kepala. Saya punya kebebasan untuk merumuskan taktik bagi tim,” kata Tihana kepada World Soccer. “Para pemain tahu cara menerapkan strategi itu, tapi masih banyak yang harus dibenahi.” “Mereka juga tak pernah menimbulkan masalah seperti menggoda saya,” lanjut Tihana. Para pemain takut menggoda wanita 24 tahun ini karena kemampuan olah bolanya cukup mumpuni. Tihana masih tercatat sebagai pemain di tim Dinamo Zagreb putri. Ia juga anggota tim nasional Kroasia putri. Menurut Tihana, penunjukannya sebagai pelatih sebagai hal yang wajar. Karena ia sudah lama berada di level atas sepakbola putri. “Jika pria dan wanita punya kemampuan dan kualifikasi sama untuk melatih, tak ada alasan bagi saya untuk tak melatih tim putra,” lanjut Tihana. “Saya melatih tim hebat yang selalu berkembang dan berpeluang memuncaki liga.” Jarang sekali wanita melatih tim pria, atau mungkin tidak ada. Dan Tihana bisa menjadi pioner untuk posisi itu. Untuk itu, ia pun rela menanggalkan profesi model untuk sementara. Tihana merupakan finalis Miss Sport Kroasia 2008. Saat itu, ia sempat masuk deretan 15 kontestan terbaik. (int)


JUMAT 28 September 2012


Bentrok Para Unbeaten

Almeyda Ungkap Kasus Doping Ditulis Pada Autobiografi Kasus penggunaan doping dan pengaturan pertandingan terbaru muncuk di Italia. Kali ini Matias Almeyda yang mengungkapkannya, dalam sebuah autobiografi yang dia rilis belum lama ini. Almeyda tercatat sempat sembilan musim merumput di Liga Italia. Gelandang asal Argentina itu memperkuat empat klub berbeda yakni Lazio, Parma, Inter Milan dan Brescia. Tujuh tahun setelah meninggalkan Italia, pria yang kini melatih River Plate itu membuat kejutan menyusul terbitnya sebuah autobiografi yang diberi judul ‘Almeyda: Life and Soul’. Dalam buku tersebut, dia mengklaim telah mendapatkan obat-obatan yang mampu meningkatkan performa di atas lapangan. Kejadian tersebut diyakini terjadi dalam periode 2000 sampai 2002, saat dia memperkuat Parma. “Di Parma kami diberikan IV drip (memasukkan substansi cair langsung ke dalam saluran darah) sebelum pertandingan. Mereka bilang itu adalah campuran vitamin, tapi sebelum memasuki lapangan saya bisa melompat setinggi langit-langit,” tulis ‘Almeyda dalam bukunya dan kemudian dimuat oleh Gazzetta dello Sport. “Para pemain tidak ada yang bertanya tapi beberapa tahun kemudian ada kasus di mana mantan pemain tewas karena masalah pada jantungnya, menderita masalah otot dan lain lagi. Saya pikir ini adalah konsekuensi atas apa yang sudah diberikan pada mereka.” Yang tak kalah mengejutkan dari autobiografi tersebut adalah pengakuan Almeyda atas pengaturan pertandingan di pekan terakhir Seri A musim 2000/2001. Saat itu Roma yang menghadapi Parma butuh kemenangan untuk memastikan meraih gelar juara. “Beberapa rekan saya di Parma bilang kalau pemain Roma ingin kami kalah dalam pertandingan tersebut. Saat itu kami memang tidak lagi mempertaruhkan apapun, itu akan sama saja (kalah atau menang).” “Saya katakan tidak dan mayoritas pemain juga menyatakanhalsenada.Tapidiataslapangan,sayalihat beberapa pemain tidak berlari seperti biasanya. (int)


25 25 25 20 25

%, %, %, %, %,

angsuran angsuran angsuran angsuran angsuran

2 3 3 2 3

Jt-an Jt-an Jt-an Jt-an Jt-an

Proses cepat data dijemput

Hub: L. Rivai Sembiring 0812 6457 0000

PAKET SUZUKI 100% BARU Penuh Dengan Cash Back Pick Up Carry, APV Pick Up, APV Arena, Ertiga, Splash, Swift, XOver, Grand Vitara Dealer Resmi PT. Trans Sumatera Agung. Data dijemput Hub: David - 0813 6132 4071 CV. PARNA JAYA MOTOR: Menjual sepeda motor honda, yamaha, suzuki Viar, baru dan bekas; Cash & Credit; Tukar tambah; Urus Perpanjang STNK, BBN. Alamat: • Jl. Jend. Sudirman No. 389 ABCD, Indrapura ( 0622-31788) • Jl. Acces Road, Simp. Durian, Kuala Tanjung. MENTARI MOTOR Melayani servis, cas batre (basah ~ kering). Menjual alat2 sepeda motor, Asessoris, Oli, & alat2 mesin gendong. Alamat: Jl. Jalinsum Simpang Kebun kopi, Indrapura MITSUBISHI RANTO “PROMO” LEBARAN: Pajero Sport, Triton, Colt Diesel Dump Truck, Chasis, L-300, & Colt T120SS PickUp. DP 11% atau bunga mulai 0%. Hubungi: UNAS 0813 6333 3000 DIJUAL CEPAT: Yamaha VIXION warna Hitam tahun 2008. Body dan Mesin mulus. Hub: 0813 7015 5910; 0813 6163 1463 NEW NISSAN: Grand Livina, Juke, XTrail. Navara, Murano. Ready Stock, cash/credit. Hub: Mili 0852 7033 7739 DEALER RESMI SUZUKI Indrapura melayani penjualan sepeda motor merek Suzuki khusus yang baru secara chas n credit. Khusus promo setiap pembelian chas n credit mendapatkan emas (berlaku September 2012). Ayo buruan dapatkan sepeda motor Suzuki. Hub koorditor sales Bpk ARIFIN Hp : 085276045145. Jl. Jalinsum simp. Kebun kopi kuala YAMAHA HORAS MOTOR, menjual sepeda motor merek Yamaha, chas & credit terbaru, dapatkan Helm LOVENZO Cuma Cuma dengan pembelian new zupiter z.1. (kesempatan terbatas) hub dialer telp : 0622.31883. Jln. Jendr Sudirman Kota Indrapura. Barubara.

PRIMKOPAD (M.SIDIK) menyediakan

Arsenal vs Chelsea. Siapa pun yang menang akan mempertahankan label unbeaten (belum terkalahkan) dan memberikan kekalahan pertama bagi si pecundang.


„ Lukas Podolski

DIJUAL: Tanah kapling uk 6x12M, harga mulai 35jt-an, bisa nego. Lokasi strategus sebelah kolam renang Wahyu. Hub: Kolam Renang Wahyu, Jl. St. Alisyah Bana, dengan Bpk IRWAN EDWIN (Buyung) Hp: 0 8 1 3 7 5 9 6 2 9 8 8 . *Juga menerima pelatihan renang yg diasuh oleh Pelatih bersertifikat & berpengalaman.

DIJUAL KEBUN KELAPA SAWIT: seluas 2 Hektar, umur tanam 12 & 5 tahun, dengan penghasilan 5 ton/bln. Tanah r a t a , l o k a s i : K a m p u n g Te m p e l , Kec. Tinggi Raja. Harga Rp. 300 juta (NEGO). Hub: BAHARUDDIN S. HP: 0813


Menjual : Barang & Alat-alat Bangunan, Kontraktor, Levelansir. Dengan harga standart yg dapat di jangkau, dll. Jl. Masjid Lama No. 41 Talawi Batu Bara. Hubungi : Hj. Ani HP : 0852 7508 7880.

UD. JANNAH: Menjual alat2 pancing, Kantor, Olahraga, Sekolah, Komputer, dan Perlengkapan Sholat, dengan h a r g a G r o s i r. A l a m a t : J l . L i n ta s Medan-Kisaran, Simpang Kebun Kopi, Batubara. HP: 0852 7680 942


Komplek Perumahan BAHREN PURI KAMPUNG BARU (Belakang HOTEL SUZUYA), RANTAU PRAPAT. Hub: 0813 6048 3699

Panglong menjual segala jenis papan, khususnya papan Boat/ Sampan dan alat-alat bangunan, Menerima tempahan, Khususnya ukuran panjang dari ukuran standartnya.Dusun II Jl. Merdeka Tanjung Tiram Batu Bara. Hub : Bapak Irfan, HP : 0812 6456 2615.


“DINDA Keyboard” Entertainment

6200 5227

DI JUAL RUMAH TYPE 54, 2 Kamar tidur.

menyediakan berbagai macam obat yg bermutu dan harga terjangkau. Menerima rawat inap., Pemeriksaan ibu hamil, Bersalin, Sunat, Imunisasi, EKG, USG. Tersedia, LAB, CLINIK, & ambulan. DAPAT KONSULTASI GRATIS dgn apoteker. Desa Tanjung Gading Sei Suka, Indrapura, Kab. Batubara. Hub: 0622-632088

Musik Melayu Modern, & TOKO D.J 2 Elektronik, Cash & Credit segala jenis elektronik. Hub: Iwan (0811 6282 272 – 0852 7599 9772), di Simpang Tiga Pahang, Talawi, Batubara.


obat dan Lengkap. Dengan harga terjangkau. Menerima pasien dan k o n s u l t a s i k esehatan. hub: J l . Jalinsum, Desa Tj. Gading, Simpang Kuala Tanjung, Indrapura, Batubara. Telp: 0622-632751

Menjual kursi, lemari dan semua jenis barang-barang perabot rumah tangga lainnya,di jual dgn harga yg murah & terjangkau. Jl. Besar Simpang Dolok, Lima Puluh, Batu Bara, Serta menyediakan tempat Rekreasi pemandian “ Kolam Lima Putri “ Untuk keluarga anda, Jl.Besar Air Hitam Simpang Dolok. Hub: Bapak Agan, HP : 0812 6474 707

Klinik Herbal CHIN CHIE

Toko Mas

APOTIK KARYA: Menjual berbagai

alternatif reflexiologi therapy tanpa operasi & injeksi, dapat mengobati semua jenis penyakit kronis. (izin dinkes : 448/3224/111/2007) Jl. Jend sudirman gg. Keluarga. Dsn 2 pare-pare, Air Putih. Indrapura. Hub: 0812 6311 0162.

"Balai Pengobatan ELLY” Izin No : 800/3244/DINKES SOS/2008, Penanggung Jawab: Dr. HIDAYAT, M. Kes. Menyediakan berbagai Jenis obat, dan mengobati penyakit untuk kesehatan anda dan keluarga, serta bersedia datang ke rumah anda untuk panggilan pengobatan di rumah anda dalam waktu 24 Jam. Empat Negri, Kec. Lima Puluh, Kab.Batu Bara, Hub: IBU ELLY, HP : 0852 7668 2236 KLINIK MIFTAH HAKIM, UGD buka 24 jam, pemeriksaan ibu hamil, sunatan, ibu bersalin,imunisasi, rawat inap, tersedia mobil ambulan. Konsultasi dokter tentang kesehatan, penyakit. Jl. BESAR LIMA PULUH KOTA (Depan Mesjid besar limapuluh), Kabupaten Batubara


perlengkapan dan asessoris TNI, POLRI, SATPOL PP, DISHUB, ORMAS, SATPAM,DLL. Hub M.SIDDIQ Hp: 0853 7170 6226. Jl. Jalinsum Kebun Kopi,Kuala Tanjung, Indrapura (samping BRI), Batubara

Kontraktor, Lepelasir, Biro Jasa, Dagang umum, Pertanian, Serta menyediakan & menjual barang-barang serta peralatan bangunan,dll. Alamat : Jl. Merdeka Pasar Mereng Desa Suka Maju Kec. Tanjung Tiram. Batu Bara. hub:(Ibu Ani) HP : 0853 6067 1005

DIJUAL CEPAT Rumah berukuran :

COLOUMBIA, CASH & CREDIT FURNITURE & ELEKTRONIK harga terjangkau, paket murah meriah (cicilan ringan). Pasar 8, Jl. Jend. Sudirman, Indrapura, Batubara

Lebar 5, panjang 50, bangun 45, di Jl. A.Yani/Psr.Merah Simp.4 TalawiBatubara (depan SPBU). Hub: 0821 6839 0096.

emang ada cara lain supaya keduanya mempertahankan status tersebut: bermain imbang. Tetapi, Chelsea, si pemuncak klasemenyangkinihanyaunggulsatu poin atas Manchester United, bisa jadi tak akan mengambil opsi tersebut.Sementara,Arsenalbarusaja mendapatkan hasil imbang dengan Manchester City akhir pekan lalu. The Blues sejauh ini tampil impresif. Imbang 0-0 melawan QueensParkRangersmenjadihasilterburuk mereka sejauh ini. Dengan lini serang yang begitu ‘wah’, mereka hanya menang tipis 1-0 atas StokeCityakhirpekanlalu.Namun, Roberto Di Matteo tetap puas dengan kemenangan tersebut. Di Matteo menyebut bahwa timnya mampu mencari cara bagaimana membongkar pertahanan tim yang bermain super defensif. Siapa pun yang menjadi pencetak golnya tak masalah, dan hadirlah Ashley Cole sebagai pahlawanpadalagamelawanStokeitu. Manajer asal Italia itu juga tidak perlupusingmemikirkansiapayang akan dipasang di depan. Chelsea punyastokcukupmelimpahdisana —Eden Hazard, Fernando Torres, Oscar, Juan Mata, dan beberapa lainnya—. Kalaupun ada yang

CAHAYA BARU: Menjual berbagai macam mas dan perak dgn berbagai bentuk tempahan: cincin, kalung, gelang rante, anting2, mutu memuaskan, kunjungi kami di: Pajak Pagi Kebun Kopi, Indrapura, Batubara “TOKO HALIM” Menjual

: Alat alat Cansaw (Alat pemotong kayu), segala perlengkapan sekolah, Kosmetik, Sendal, Sepatu , Celana Jeans, serta menyediakan berbagai jenis pakain pria & wanita, dll. d jual dgan harga yg terjangkau, Alamat : Desa dahari Indah, Kec. Talawi, Batu Bara, Hub: Abdul Halim, HP : 0813 7652 4105

TOKO PRIMA BUANA menjual pakaian jadi pria, wanita, dewasa, anak-anak, Busana Batik & kosmetik, Pakailah busana anda yang serasi cantik dan nyaman, Harga Boleh tanding, barang boleh banding. Hub: ROMAULI Br Sinurat. Hp. 0813 6152 6334. Jl Besar perdagangan No.88 g Lima Puluh Kota BatuBara.

TOKO CANTIKA COLLECTION :Menjual jilbab, busana muslim, pakaian pria & wanita, pakaian serta perlengkapan baby, accesoris jilbab, mukena,dll. Jl. Merdeka No.03 Depan kantor PLN Tanjung Tiram & Jl. Rakyat No.40 (Depan Pajak Tanjung Tiram) Batu Bara. Hub:(Jonni Hendra, S.pd.) HP:0823 6269 4535

Toko Batik NUR’ ALFI: Menjual batik pekalongan, dengan berbagai jenis, pakaian sempit (pas-pasan), Couple, baju anak2, Blus, kemeja, dll. Harga murah dan terjangkau. Jl. A. Yani/ Psr Mereng Simp. 4 Talawi, Batubara. Hub: Rosini 0812 6002 9388


Menerima pemasangan design, Plafon gyfsum rumah dan Perkantoran dgn tenaga yg berpengalaman.serta menjual sgala macam keperluan gyfsum. Hubungi: 087818917066 (Bpk Anwar); 0853 5910 8633 (Ibu Ida), Jl. A. Yani/Psr. Mereng Simp. 4 Talawi - Batu Bara.

“RAGHIB JAYA ALUMINIUM” Aluminium, Contraktor, Partition, Swing door/Rolling Door, Serta Menyediakan Barang Seperti : Pintu Kamar Mandi, Tenda/Awning, Lemari Kaca, Rak Piring, Steling, Raill Gorden, Tangga, Jemuran Baju & Segala Jenis Kaca. Alamat: Jl. Merdeka No. 165-166 Batu Bara, Hubungi : DICKY BUDIANTO, HP : 0812 655 3575 - 0812 6536 6166.

PERCETAKAN & ADVERTISING “ B I M A ” : Menerima segala je nis cetakan partai besar & kecil, undangan, sablon, stempel, MMT, baliho, Neonbox, baju kaos, kop surat, dll. (Hub: HABIB SYAH: 0852 7074 7585). Jl. Jend. Sudirman No. 288, Indrapura, Batubara.



R A H M AT K T: M e n j u a l b e r b a g a i macam jenis burung pilihan,menerima tempahan berbagai jenis Kandang (sangkar burung). Hub: 0823 6403 5666. Jl. Simpang Kuala Tanjung, Indrapura, Batubara. PELUANG USAHA AIR MINUM: Pemasangan Depot Air Minum Air Pegunungan (Mineral) Sistem RO Oxsygen dan Grosir Peralatan Depot Air Minum GRACE WATER: Jl. Cengkeh Raya P. Simalingkar. HP. 0813 7010 7352. *) Melayani pemasangan dalam dan luar kota

“MATAHARI TRAVEL” melayani pembelian tiket pesawat,Batavia, Garuda,Merpati,Lion,City Link, Sriwijaya, Wing air, dengan tujuan wilayah dalam dan luar negeri, Hub: Rini-0821 6564 4472 – 0877 4929 0081 ; DEDY : 0823 6441 6766. Jl Medan LimaPuluh Kota NO. 11, Batubara DINA DOORSMER : Menyediakan doorsmeer Hidrolik sistem. Servis AC mobil, Assesoris, Cat Ketok, bengkel Injeksi, ganti oli, Tune-Up, Over Haul, dan cat duko. Alamat: Jl. Jalinsum, Kuala Tanjung, Indrapura, Batubara (0622-632832)

SEHAT SERVIS DOORSMEER: Ganti oli, pispot, balancing ban, tubeless, angin hidrogen, cot, dan ban luar radial. Masih membutuhkan beberapa tenaga Doorsmer (Tukang Cuci Mobil). Jl. A. Yani No.6/8, Kisaran.

BINTANG PANGKAS: Khusus pangkas pria. Rapi, indah, bersih, trendy & memuaskan. Mode masa kini. Hub: Rahmad, 0878 1892 0095. Samping Pertamina, Parepare, Indrapura, Batubara LOWONGAN KERJA : Dibutuhkan segera • Tenaga Marketing • Kolektor. Fasilitas: Mobil Kerja, Uang makan (8000 s/ d 15000); Gaji pokok (350.000 s/d 1 Jt), Komisi (4 % s/d 8 % ), dan intensif lainnya. Bawa lamaran anda ke: Columbia Cash & Credit • Jl. Cokroaminoto, Kisaran, Telp.(0623) 44260 • Jl. Koptu Mahmun Lubis , Aek Kanopan.

perlu dikhawatirkan adalah mengendurnyapertahananseperti yang dialami ketika melawan Juventus di Liga Champions. Arsenal memang bukan tim yang defensif seperti Stoke. Tapi, merekatahucarabertahandengan baik. Mereka baru kebobolan dua gol dan sudah mencetak sembilan gol dalam tiga laga terakhir. Jika ditambah laga Piala Liga Inggris, maka The Gunners sudah menciptakan 15 gol dalam empat pertandingan terakhir. SteveBould,mantanbektimasal London Utara itu dan kini jadi asisten baru Arsene Wenger, dianggap jadi orang yang paling berjasa dalam memperkuat pertahanan Arsenal. “Kami bekerja keras melatih cara kami bertahan dan Anda bisa melihat itu dari tiga clean sheet yang kami dapat,” kata Thomas Vermaelen. Di sisi lain, keliatan Cazorla sebagaisalahsatuamunisiliniserang terbilang mantap. Ia, dan juga Aaron Ramsey, beberapa kali melepaskan passing ciamik dalam laga melawan City. Beberapa umpan terobosan pun mampu menembus barisan bek yang digalang Vincent Kompany. Sial bagi mereka, beberapa kali penyelesaian akhinya tidak se-ciamik operan itu sendiri.


servis HP Menjual segala merek dan jenis HP, jual pulsa, asessoris, dan perlengkapan lainnya. Hub: Andy , HP: 0877 4871 1198. Alamat: Jalinsum tanah merah simp.4 Indrapura, Batubara.


Menjual segala jenis merek HP, Servis HP, Asessories, Pulsa, Dll. (Hub: FITRI0853 5806 0605) JALINSUM simp 4 Tanah Merah Indrapura Batubara.

H E N D Y O G E Ts

Stiker & Aksessories: Penjualan & Pemasangan Variasi Mobil dan sepeda motor. Jl. Jend. Sudirman, Indrapura (Samping Lap. Sepakbola); HP: 0813 7644 4177 ; Telp. 0622 - 646 144. AKAN DIBUKA DI KISARAN PUJASERA (Pusat Jajanan Serba Ada): anda berminat segera hubungi, Tempat terbatas, Alamat: Jl. Imam Bonjol No. 366 Kisaran (Doorsmeer Pondok Keluarga). Siapa Cepat Dia Dapat . HP. 0852 7059 6434 (Faisal).

“RIAS PENGANTIN RAHAYU”: Menerima pemasangan pelaminan dalam dan luar kota, Foto shoting Video, layar tancap, keyboard, dan menyediakan pelaminan lengkap (Jevara Melayu, dll). Alamat: Jl. Dahari Selebar Talawi, Batubara. Untuk pemesanan, hub: Mahar Salim, HP: 0878 6833 7140 ; 0821 6696 3879.

“ P O H WA S A L O N ” Menerima:Krimbat Rambut, Masker, Smoting, Sosis rambut, Cuci muka, Sanggul, Pangkas pria & wanita. Jl. Rakyat No. 02 Tanjung Tiram Batu Bara, Hub: Ibu Po Hwa, HP : 0853 5926 5298.

“MARI SALON SANGGUL” Cab. Medan & Jakarta. Menerima: Gunting rambut, rebonding, hair spa, lulur, facial, merias pengantin (Sanggul + Make Up), dan menerima siswa/i yang ingin belajar dan punya keahlian khusus dgn biaya terjangkau. Hub: MARI SALON SANGGUL, Pajak Gelugur Lt.2 Blok B No. 43&44, Rantauprapat. HP: 0821 6547 7080; 0852 6277 2884


Perawatan rambut, wajah, & tubuh, terlengkap di Batubara, Hub: 0852 7508 4444, Jalinsum Binjai Baru, Batubara “AA” Fashion: Menjual berbagai jenis pakaian muslim, wanita, pria, anak2, dan dewasa, berbagai merek dan ternama, dan terbaru. Melayani eceran dan grosir. Jl. Jend. Sudirman, Kota Indrapura, Kab. Batubara. HP: 0813 6154 2640 LKP “CANTIK MANIS“ belajar tata rias rambut pengantin, kecantikan kulit- rambut, menjadikan tenaga kerja terampil, siap pakai wirausaha dan trend model professional, hub 0812 6374 0598, Jl. Besar Perdagangan, Lima Puluh Kota BatuBara.


Menyediakan nasi sop ayam, kambing, sapi, soto,kare kambing, sop buah, tersedia aneka juice, kopi susu, (menu istimewa harga terjangkau) hub: Ibu KASMI-0823 6985 1755. Jl Medan Kisaran Km.99 simpang Kuala Tanjung, Indrapura.

„ Eden Hazard Di Emirates Stadium, Chelsea justru memiliki catatan yang lebih bagusdibandingArsenal.Darilima pertemuan terakhir kedua tim di Emirates Stadium di semua kompetisi, Arsenal hanya mampu meraih satu kemenangan, menelan tiga kekalahan dan sekali imbang. (int)

SALMA D’CAFÉ menyediakan

sarapan pagi, nasi serba 7000 dengan hidangan istimewa. Nasi goring, mie goring, bakso, pangsit, siomai, Batagor, bandrek, aneka juice. Menerima nasi kotak dan rantangan. Hub: Ibu salma , 081263497777 Jl. Kula Tanjung Kebun Kopi Indrapura, Batubara.

BROKOLI CERIA: sajian spaghetti sehat. Menyediakan sajian: Mie Ayam, Mie Ketela, Mie Wortel, Mie buah, Martabak sayur, Aneka Juice, Kopi Luwak, Softdrink. Harga Terjangkau. Alamat: Jl. Jalinsum KM 99.5 Sei Suka, Batubara. HP: 0812 6217 910

RUMAH MAKAN BERSAMA: Menyajikan berbagai masakan, Nasi Goreng, Mie Goreng, Soto. Berbagai minuman, Aneka juice, teh manis, kopi susu, ginseng. SERBA EKONOMIS. Alamat: Simpang Kuala Tanjung, Indrapura, Batubara “RUMAH MAKAN DENAI MINANG” Menjual masakan khas padang, dengan menu istimewa: Nasi serba Rp.8000, rendang, gulai pari, daging sapi, ikan mas, ciri khas masakan rendang padang, serta menerima pesanan nasi kotak. Hub: Ibu AS , HP : 0817 4798 835. Jalinsum LimaPuluh BatuBara

RM. (TB) TELAGA BIRU: Khas masakan Minang, terkenal masakannya lezat. Menunya tersedia kopi susu, teh susu, & Juice. Terima Pesan nasi kotak. Jl. Jend. Sudirman No. 72, Indrapura, Batubara. Hub: 0813 9782 3094

R.M MINANG RAYA : Tersedia khas masakan minang, ayam panggang, ikan panggang, kare kambing, Gulai kakap, ikanmas ARSIK, de n g a n m e n u is t i m e w a , s e r t a menerima pesanan katering/ nasi kotak. Hub: VERY, HP: 08216666 5855, Jalinsum, tanah merah, simp. 4 Indrapura, Batubara. Telah Hadir di Kisaran, “RUMAH JAMUR” menyediakan masakan ala jamur: Lontong sate jamur, Bakso jamur, Sop jamur Ayam kampung, Mie jamur ayam kampong, Krispy jamur, es jamur, dll. Buka setiap hari Kecuali “Jumat” jam 12.00 siang sampai malam. Kunjungi: Jl. Budi Utomo No. 116 Siumbut-umbut Kisaran. HP : 0877 4878 2775

BUTUH DANA TUNAI: Lamhot Jaya Motor j a m i n a n h a n y a BPKB Sepeda motor anda, persyaratan ringan, 1 jam cair, juga melayani jual beli sepeda motor. Hubungi alamat Pusat: Jl Diponogoro No.149, Kisaran.Telp 0623 43921 Hp : 081361505214 BUTUH DANA TUNAI?: Lamhot Jaya Motor jaminan hanya BPKB Sepeda motor anda persyarat ringan, 1 jam cair. Juga melayani jual beli sepeda motor. Hub: alamat Cabang kami di Jl. Lintas Siantar, Simp Tangsi. HP : 085373430808. Alamat Unit kami: Jl. Lintas Sei Mati, Ds Mekar Sari. HP :


JUMAT 28 September 2012


Team Chelsea Man United Everton West Brom Arsenal

M 5 5 5 5 5

M 4 4 3 3 2

S 1 0 1 1 3

K 0 1 1 1 0

SG 9-2 12-6 9-5 7-4 9-2


Nilai 13 12 10 10 9




TOP SCORER Gol 5 4 4

Nama R van Persie D Ba J Defoe

Klub Manchester United Newcastle United Tottenham Hotspur

SPANISH LA LIGA No 1 2 3 4 5

Team Barcelona Atlético Madrid Mallorca Málaga Sevilla

M 5 5 5 5 5

M 5 4 3 3 3

S 0 1 2 2 2

K 0 0 0 0 0

SG 14-3 15-7 7-3 6-2 6-2

Nilai 15 13 11 11 11

TOP SCORER Gol 7 6 4

Nama R Falcao L Messi T Hemed

Klub Atlético Madrid Barcelona Mallorca

ITALIAN SERIE A No 1 2 3 4 5

Team Juventus Napoli Sampdoria Internazionale Lazio

M 5 5 5 5 5

M 4 4 3 3 3

S 1 1 2 0 0

K 0 0 0 2 2

SG 11-2 11-2 8-5 8-5 7-5

Nilai 13 13 10 9 9

Manchester United mendapatkan lawan yang tidak ringan, Newcastle United, pada babak ke tiga Piala Liga Inggris. Namun akhirnya Red Devils pun menang dengan skor 2-1 atas The Magpies. Hal itu disambut gembira oleh bos MU, Sir Alex Ferguson.


„ Alex Ferguson

Indonesia 5-0 Brunei Darussalam TOP SCORER Gol 5 4 3

Nama E Cavani S Jovetic A Cassano

BUNDESLIGA No 1 2 3 4 5

Team München Frankfurt Hannover 96 Schalke 04 Düsseldorf

Pelepas Dahaga

Klub Napoli Fiorentina Internazionale

M 5 5 5 5 5

JERMAN M 5 4 3 3 2

S 0 1 1 1 3

K 0 0 1 1 0

SG 17-2 14-7 14-8 10-5 4-0

TOP SCORER Gol 5 4 3

Nama M Mandžukiæ T Müller S Aigner

Klub Bayern München Bayern München Eintracht Frankfurt

TOP SCORER Gol 2 2 2

Nama Mkhitaryan Lionel Messi Rafael Bastos

Klub Shakhtar Donetsk Barcelona CFR 1907 Cluj

Nilai 15 13 10 10 9

Indonesia mendapat kemenangan dalam laga uji coba melawan Brunei Darussalam di Stadion Hassanal Bolkiah, Rabu (26/9). Hat-trick Irfan Bachdim mewarnai kemenangantelaklimagoltanpabalasIndonesiaatas Brunei. Bermain tanpa lima pilar (Titus Bonai, Okto Maniani, Valentino, Yoshua Pahabol, dan Cornelis Geddy) pasukan “Merah Putih” tampil lumayan spartan. Beberapa kali Irfan dan kawan-kawan mengancam gawang Brunei. Memasuki menit ke-25, Indonesia mendapatkan hadiah penalti. Irfan yang menjadi algojo, tak menyia-nyiakan kesempatan dan membuka skor pertandingan. Suntingan Irfan melecut semangat rekan-rekannya. Jelang berakhirnya babak pertama, Indonesia kembali menggandakan kemenangan. Kali ini, tendangan jarak jauh Vendry Mofu sukses menggetarkan jala Brunei untuk kedua kalinya. Tim “Garuda” kian menggila pada paruh kedua. Enam menit selepas jeda, Irfan kembali mencetakgolkeduabagidirinyadanmengubah kedudukan menjadi 3-0 untuk Indonesia. Pasukan Nil Maizar semakin di atas angin. Buktinya, pada menit ke-63, Indonesia makin melejit. Gelandang serang mungil, Hendra Adi Bayauw, mampu menceploskan bola ke jala Brunei dengan memaksimalkan umpan M Rahmat. Sudah unggul empat gol tanpa balas tak memuaskan Indonesia. Pesta gol tim “Merah Putih” ditutup trigol Irfan pada menit ke-72. Laga pun berakhir dengan kemenangan Indonesia lima gol tanpa balas melawan Brunei. Kemenanganinimenjadipelepasdahagatim

„ Irfan Bachdim nasional Indonesia. Itu kemenangan pertama sejak tim “Merah Putih” mengalahkan Mauritania pada Turnamen Al-Nakbah di Palestina, Mei silam. Setelah meladeni Mauritania, Indonesia menjalani delapan laga, termasuk melawan BruneiDarussalam.Daridelapanpertandingan itu, tim “Garuda Pancasila” meraih satu kemenangan, tiga kali imbang, dan empat kekalahan. Total, sepanjang tahun ini, timnas Indonesia telah menjalani 15 laga, baik partai resmi maupun uji coba. Tiga kemenangan didapat timnas dari seluruh pertandingan itu. (int)

U memainkan beberapa pemain mudanya saat menjamu Newcastle diOldTrafford,Kamis(27/9)dinihari WIB. Meski begitu, mereka tetap menang 2-1 berkat gol-gol Anderson dan Tom Cleverley. “Saya sangat senang,” aku Ferguson di situs resmi klub. “Pertama-tama, mengingat ini adalah pertemuan antarklub Premier League dan Newcastle mungkin lebih kuat daripada kami secara fisik, kami menampilkan sepakbola

yang fantastis. Kami terus memainkan permainan kami dan gigih dengan itu dan juga memiliki ketenangan dalam bermain,” jelasnya. Menurut Fergie, ia sangat senang dan selalu berpikir layak menang. “Newcastle adalah tim yang sangat bertenaga,jadibagusbisamelewatimereka,”kata pria asal Skotlandia ini. MUakankembalimenghadapilawanberat di babak ke empat. The Red Devils akan melawan Tottenham Hotspur. (int)

Perjalanan Setan Merah Setelah kalah dari Everton di pekan pertama, Manchester United melaju dengan empat kemenangan beruntun. Bisakah rekor tersebut berlanjut kala menghadapi Tottenham Hotspur pada Sabtu (29/9)? MU kalah 0-1 dari Everton pada pekan pertama, namun langsung bangkit di pekan berikutnya. Menghadapi Fulham, ‘Setan Merah’ menang 3-2 dalam laga yang diwarnai oleh gol debut Robin van Persie. Eks bomber Arsenal itu kemudian jadi bintang di pekan berikutnya, ketika dia mencetak hat-trick ke gawang Southampton dan MU, lagi-lagi, menang dengan skor 3-2. Di dua laga selanjutnya, MU menang 4-0 atas Wigan Athletic dan 2-1 atas Liverpool. Dua kemenangan itu masih ditambah dengan kemenangan di Liga Champions (1-0 atas Galatasaray) dan Piala Liga Inggris (2-1 atas Newcastle United). Seperti yang diperlihatkan dalam laga melawan Southampton, The Red Devils kerap menang, meski performa mereka tidak impresif. Sabtu (29/9), MU akan menghadapi Tottenham Hotspur di Old Trafford. Sang calon lawanpunyacatatanduakemenangandalam dua laga terakhir. Jermain Defoe juga mulai tajam lagi. Striker internasional Inggris itu sudah mencetak tiga gol dalam dua pertandingan terakhir di Premier League. Spurs punya kans untuk menyulitkan. Namun,MUpunyarekorbaguskalamenghadapi Spurs di Old Trafford. Dalam empat pertemuan terakhir di liga, MU selalu meraih kemenangan. Catatan terbaik Spurs di Theatre of Dreams dalam pertandingan liga tujuhtahunterakhiradalahmenahanimbang

„ Anderson 1-1 pada musim 2005/2006. Hanya saja, akhir pekan ini MU tidak akan diperkuat oleh Nemanja Vidic. Kapten asal Serbia itu dipastikan absen selama dua bulan karena mengalami cedera lutut. Kemungkinan, Sir Alex Ferguson akan kembali mengandalkan Rio Ferdinand dan Jonny Evans di sebagai duet bek tengah. Sementara Wayne Rooney yang cedera ketika melawan Fulham sudah bisa dimainkan lagi. Rooney turun sebagai starter dalam lagamelawanNewcastle,meskitidakbermain selama 90 menit. (int)







JUMAT, 28 September 2012 Edisi 262


Duel Lawan Orang Gila, Tetangga Roboh Ditikam KISARAN- Pria yang dikenal memiliki penyakit jiwa (kurang waras,red) bernama Asfian alias Anto (50), warga Jalan Mangun Sarkoro Kelurahan Kisaran Baru Kecamatan Kota Kisaran Barat, tiba-tiba mengamuk, Kamis (27/9) sekitar pukul 16.00 WIB. Mengamuknya Anto sempat membuat heboh dan ketakutan warga sekitar. Pasalnya, Anto membawa sebilah pisau dan melempari rumah salah satu warga. Tak ayal, Rahmat (35) tetangganya yang hendak menenangkan Anto, terkena empat tikaman. Baca


MADINA- Dua ratusan massa dari Forum Masyarakat Penyelamat Madina atau FMPM unjuk rasa di gedung DPRD Madina, Kamis (27/9). Dalam unjuk rasa ini, massa menyegel sejumlah ruangan di DPRD dan mengajak warga Madina untuk tidak memilih wakil rakyat yang sekarang pada pemilihan legislatif mendatang. Baca


Siap Tempuh Jalur Hukum DALAM orasinya, Ketua LPPN RI Syaifuddin Lubis menyampaikan, selama sembilan bulan terhitung Januari lalu pimpinan dan anggota dewan telah menyakiti hati rakyat dan melakukan pelanggaranpelanggaran terhadap Undang-Undang nomor 27 tahun 2009 MPR, DPR, DPD dan DPRD begitu juga



Dedi-Affan Diyakini Mampu Kembangkan Home Industri SIDIMPUAN- Pasangan Calon Walikota dan Wakil Walikota Padangsidimpuan (Psp) nomor empat, Dedi Jaminsyah Putra Harahap SSTP MSP-H Affan Siregar SE diyakini mampu mengembangkan home industri

Fenita Arie

Tolak Job SINETRON KUALITAS sebagai presenter sudah tak diragukan lagi. Namun Fenita Arie enggan menjajal ke bidang akting. Apalagi sampai kejar tayang, seperti kebanyakan sinetron saat ini. Dia lebih memilih berkumpul bersama keluarga daripada harus syuting stripping. Demi-


Siap ...Hal 6

Sekolah Kebanjiran, Murid SD Tewas Tenggelam

di kota yang khas dengan buah salak ini. “Saya sudah membaca semua Baca

Duel ...Hal 6

UNJUKRASA DI DPRD: Ratusan massa FMPM menyerbu dan menyegel gedung DPRD Madina, kemarin (27/9).

RAKYAT ...Hal 6

Dedi Jaminsyah Putra Harahap mendengarkan apsirasi salah satu penyandang tuna netra, beberapa waktu lalu.

Tahun IV

Dedi-Affan ...Hal 7


Sejumlah guru memberikan keterangan kepada media terkait murid sekolahnya yang tenggelam.

STABAT- Hujan deras yang mengguyur Kabupaten Langkat menelan korban jiwa. Irwansyah (11), murid yang masih duduk di kelas VI SD Negeri 053974, Lingkungan IV, Desa Payamabar, Kecamatan Stabat, Langkat, tewas tenggelam di belakang sekolahnya setelah mandi-mandi bersama sejumlah temantemannya, Kamis (27/9). Keterangan yang dihimpun POSMETRO LANGKAT (grup METRO), menyebutkan, sebelum ditemukan tewas tenggelam, korban dan dua temannya mandi-mandi di belakang sekolah yang terendam banjir karena Sungai Belengking meluap. Saat itu jarum jam menujukkan pukul 13.00 WIB. Baca

Sekolah ...Hal 6


Tersangka Asfian diamankan petugas di Mapolres Asahan, kemarin.

Tangisan Anak Warnai Pemakaman Wanita Hamil DOLOKSANGGUL- Jenazah Ati br Manullang (35), perempuan yang ditemukan membusuk di Parit Tao Hau Silom Parhonasan, Dusun Laguboti, Kecamatan Pollung, Humbahas, disambut histeris keempat anaknya. Usai diotopsi di Rumah Sakit Umum (RSU) Djasamen Saragih Pematangsiantar, jenazah korban langsung disemayamkan di pemakaman keluarga di Dusun Sibaragas, Desa Sihite, Kecamatan Doloksanggul, Kamis (27/9) pukul 09.05 Wib. Baca

Tangisan ...Hal 7

Menelusuri Jejak Sejarah Perkembangan Islam di Negeri Komunis China (1)

Nisan pun Padukan Kutipan Alquran dan Simbol Agama Lain Islam memiliki sejarah panjang dan hebat di China, negeri yang sampai saat ini masih mempertahankan komunisme sebagai ideologi negara. LAPORAN: RUKIN FIRDA, Quanzhou

MASJID QINJING, Quanzhou. Waktu menjelang salat Ashar ketika tiba di sana pekan lalu. Tahu dari Indonesia dan


Wartawan Jawa Pos Rukin Firda (kanan) bersama Imam Masjid Qinjing Quanzhou Ma Yubilai.

muslim, sang takmir, Huang Wenkeng, pun mengajak bersiap salat karena sebentar lagi Ma Yubilai, imam masjid terbesar di Provinsi Fujian itu, bakal datang. Selesai berwudu, saya masuk kembali ke dalam masjid. Huang dan Ma (artinya Muhammad) yang berbaju gamis dan peci bundar putih telah bersiap. Celingukan ke kanan-kiri, Baca

Nisan ...Hal 7





28 September 2012

Penyaluran BOS Diduga Menyimpang PALAS- Diduga terjadi penyimpangan penyaluran dana Bantuan Operasional Sekolah (BOS) Tahun Anggaran (TA) 2012 di Dinas Pendidikan Padang Lawas (Palas). Pasalnya, ada indikasi permainan antara oknum kepala sekolah (Kasek) dengan penyelenggara BOS di lapangan.

„ Seorang ibu rumah tangga berbelanja di pasar

Harga Sembako di Pasar Glugur Stabil

IRT Ngaku Bisa Menabung RANTAU-Ibu rumah tangga yang berbelanja di Pasar Gelugur Rantaprapat mengaku bisa menyisihkan uang belanja sehari-hari, untuk ditabung karena harga sembilan bahan pokok beberapa minggu terakhir stabil. Kepada METRO, Kamis (27/ 9) ibu rumah tangga (IRT) yang berbelanja, Ira (25), Dewi (29) dan Siti (32) berharap harga sembako yang stabil tetap bertahan sampai akhir tahun. “Kebutuhan sembako merupakan kebutuhan pokok yang harus ada setiap hari, jika ada kenaikan akan langsung berpengaruh terhadap pengeluaran. Maunya memang jangan ada yang naik,” kata Ira, diamini rekannya. Dijelaskannya, pemerintah seharusnya aktif melakukan pengawasan terhadap harga sembako sehingga tidak memberatkan kepada

masyarakat. “Banyak-banyaklah digelar operasi pasar, apalagi menjelang hari raya keagamaan,” katanya. Terpisah, salah seorang pedagang sembako Erwin Siregar (40) membenarkan harga kebutuhan bahan pokok masih tergolong stabil. Stabilnya harga dikarenakan pasokan barang di Pasar Gelugur masih mencukupi. “Tidak ada kenaikan mau pun penurunan harga secara siginifikan. Harga beras memang kadang naik, kadang ada penurunan, tergantung pasar dan permintaan,” katanya. Dijelaskannya, harga besar untuk kualitas sedang per 10 kilogram Rp88 ribu, sementara minyak goreng Rp10 ribu per kilogram, gula Rp12 ribu dan telur Rp27 per papan untuk 30 butir.(CR-02)

Wasit C-III PSSI Latihan di Kisaran KISARAN- Pengurus Cabang Persatuan Sepakbola Seluruh Indonesia (Pengcab PSSI) Asahan menggelar pelatihan wasit C-III (kursus dasar bagi seorang wasitred) selama 7 hari, tepatnya sejak Minggu (23/9) hingga Sabtu (29/9) di aula Dinas Pendidikan (Disdik) Asahan. Pelatihan ini diikuti 30 wasit dari berbagai daerah seperti Medan, Tebing Tinggi, Tanjungbalai, Labuhanbatu, Dairi, Palas, dan Deli Serdang.Tujuannya,karenasaatini telah terjadi kekurangan wasit di Asahan. Padahal di Asahan banyakberdiriSekolahSepakbola(SSB) dan club sepakbola. Ketua Pengcab PSSI Asahan, H Wahyudi melalui Sekretaris Panitia Pelaksana, Isnanto, Rabu (26/9) mengatakan, peserta latihan wasit C-III ini berjumlah 30 orang dan berasal dari beberapa kabupaten/ kota se-Sumut. Dikatakannya, peserta dari Asahan, Aan Deki Praja Pane, Andika Juliansyah, Ardan Fauji, Dodi Candra, Hery Syahpu-

tra, Heriyanto SPd, Ibrahim Sitompul, Irfan Habib, Juli Hartono, Satria, Sopian Arifin, SPd,Sugimin. Peserta dari Kota Tanjungbalai, Ari Sinulingga, Lefri Alamsyah. Dari Batu Bara, Predy Siswanto, dari Tebing Tinggi, Permana Z Nasution, Rahmat Efriyansyah G, Deli Serdang, M Sandi Feri Pratama. DariSimalungun,IwanSyahputra, Heri Kiswanto SPd, dari Padang Lawas,RahmadFauzi,dariSerdang Bedagai, Nanda Chair Mukhalis, dari Kota Medan, Rinaldi P, Lely Yarna, Liga Nicco Pardiyansyah. Dari Labuhanbatu, Indra Sakti Ritonga. Dari Dairi, Achmad Reza Zailani,dariBinjai,AzwardinLubis. Sedang instruktur dalam pelatihan wasit C-III ini adalah, Nurman Alex (asal Langkat), M Umar (asal Medan), Rorim Situmeang (asal Medan) dan asiten instruktur Feriyanto, Surya Prayetno. SetelahlulusdarilatihanwasitCIII, maka para peserta berwenang untuk jadi wasit pada pertandingan antara kabupaten. (van)


BAYAR RETRIBUSI-Kapal Fery penyeberangan jurusan Ajibata-Samosir, dalam waktu dekat akan mulai membayar kewajibannya yakni biaya retribusi ke Pemkab Tobasa. Kewajiban ini dituangkan dalam kesepakatan bersama antara PT GHM dengan Pemkab Tobasa.

Mucam KNPI Padang Bolak Pilih Tohong Harahap Jadi Ketua PALUTA- Dalam Musyawarah Kecamatan Komite Nasional Pemuda Indonesia (Muscam KNPI) Kecamatan Padang Bolak, Padang Lawas Utara (Paluta) yang dilaksanakan di Aula Puskesmas Gunung Tua, Jalan Perwira, Kamis (27/9), Tohong Pangondian Harahap SPd terpilih secara aklamasi menjadi Ketua KNPI Kecamatan Padang Bolak periode 2012-2015. Muscam KNPI Padang Bolak ini dipimpin Carateker KNPI Padang Bolak Ganti Paruntungan Pulungan SKM didampingi Wakil Ketua DPD KNPI Paluta Kennedy SKom dan Muhammad Pane Spdi. Pesertanya, sebanyak 13 organisasi kepemudaan (OKP) dan organisasi Kemasyarakatan (Ormas) di Kecamatan Padang Bolak. Muscam dihadiri langsung oleh Ketua DPD KNPI Paluta Khairul Rajak Siregar SSos MSi, Sekretaris KNPI Samsul Bahri Daulay SAg, Muspika, MUI dan jajaran DPD KNPI Paluta dan dibuka secara resmi Camat Padang Bolak Tunggul

P Harahap diwakili Sekcam Padang Bolak. Pada agenda pemilihan ketua, mayoritas perwakilan OKP dan Ormas memberi dukungan penuh kepada Tohong hingga akhirnya terpilih sebagai ketua KNPI Padang Bolak 3 tahun ke depan. Ketua DPD KNPI Paluta Khairul Rajak Siregar SSos MSI yang akrab disapa Bung Irul dalam sambutannya menyambut baik Muscam KNPI yang berlangsung tertib dan demokratis, karena itu ia berharap agar Ketua KNPI Kecamatan Padang Bolak yang terpilih dapat membawa pemuda menjadi pelopor pembangunan. Khairul juga menegaskan, KNPI merupakan organisasi independen yang di dalamnya terdapat OKP. Pemuda sebagai komponen masyarakat secara fungsional akan turut mengambil peran strategis dalam menentukan. “Pengurus KNPI Kecamatan Padang Bolak terpilih diharapkan dapat mengemban fungsi secara maksimal dalam mempersatu kader pemuda. Dan kepada seluruh OKP di Padang Bolak diharapkan,

bisa menyamakan persepsi untuk terwujudnya suasana kondusif dalam rangka percepatan di Kabupaten Padang Lawas Utara,” ungkapnya. Ketua PK KNPI Padang Bolak terpilih Tohong Pangondian Harahap mengungkapkan terima kasihnya kepada seluruh rekan-rekan yang telah memberikan dukungan terhadap dirinya. “Terima kasih atas dukungan yang telah diberikan oleh rekan-rekan terhadap saya. Insya Allah saya akan menjalankan amanah ini dengan sebaik-baiknya,” katanya. Tohong juga mengharapkan bantuan dari seluruh unsur OKP, masyarakat, serta LSM maupun pers di Padang Bolak umumnya di Paluta. Dia berjanji akan berupaya membangun citra pemuda yang mandiri dan berdayaguna untuk masyarakat serta mampu tampil sebagai pelopor pembangunan. Acara Muscam KNPI Pdang Bolak berlangsung lancar dan sukses, dan ditutup Sekretaris DPD KNPI Paluta, Samsul Bahri Daulay SAg. (tan/mer)


BERFOTO-Peserta Muscam KNPI Padang Bolak foto bersama jajaran DPD KNPI Paluta. Secara aklamasi Tohong Pangondian Harahap terpilih menjadi ketua PK KNPI Padang Bolak.

58 Siswa Terjaring Satpol PP AEK KANOPAN-Sebanyak 58 siswa SMP dan SMA dari Kecamatan Kualuh Hulu dan Kualuh Selatan, terjaring razia kasih sayang yang digelar Satuan Polisi Pamong Praja (Satpol PP) Kabupaten Labuhanbatu Utara selama dua hari, Selasa hingga Rabu, (25-26/09) kemarin. Dari 58 siswa tersebut, empat orang diantaranya merupakan siswi perempuan. Kepala Satpol PP Kabupaten Labura Ir Bambang Wahyuandi kepada METRO, Kamis (27/9) mengatakan, dua orang diantara yang ditangkap merupakan or-

ang yang sudah pernah dijaring pada razia kasih sayang sebelumnya. Diduga penyebabnya bukan karena malas belajar. Dijelaskan Bambang, pihaknya telah banyak mendapat laporan dari masyarakat tentang banyaknya siswa yang bolos ketika jam pelajaran sedang berlangsung. Bahkan ada yang pernah terlibat perjudian bahkan menggunakan narkoba. Ditambahkannya, razia yang digelar sekaligus untuk mencegah siswa tidak larut dalam tindakan yang menyalahi

aturan termasuk mencegah menggunakan narkoba serta ikut perjudian. Sesuai data, siswa yang terjaring berasal dari YP Muhamadiyah Aek Kanopan, YP Perguruan Kualuh, SMU Negeri 1 Kualuh Hulu, YP Pelita Aekkanopan, YP Harapan Aek Kanopan, YP SMK Zauhari, SMP Negeri Kualuh, dan YP SMP Kualuh. Sementara razia yang di gelar di wilayah kecamatan Kota Batu serta Kecamatan NA IX-X tidak membuahkan hasil, diduga informasi tentang razia sudah bocor. (put)

Dugaan ini diucapkan Anggota DPRD Palas, Ir Samson Fareddy Hasibuan, Kamis (27/9). “Saya menduga menduga telah terjadi penyimpangan penyaluran dana BOS TA 2012 di Disdik Palas. Ditemukan indikasi ke arah sana,” katanya. Disebutkan politisi PPP DPRD Palas, dugaan penyimpangan tersebut terjadi dalam beberapa kebijakan, misalnya, dalam hal pengadaan alat tulis kantor (ATK) dan buku sekolah. Dimana, pihak sekolah tidak mengganti buku lama, tapi dalam laporannya telah membeli buku baru. Kecurigaan lainnya, penyaluran dana BOS yang tidak sesuai Petunjuk Teknis (Juknis) pelaksanaannya di lapangan, sehingga perlu evaluasi dan pengawasannya di lapangan. “Pihak pengelola dana BOS jangan asal mencairkan saja, tapi juga melakukan monitoring dengan baik di lapangan,” tegas Samson kepada METRO. Dijelaskannya, selain indikasi korupsi, mark up dana BOS juga diduga terjadi pada jumlah siswa penerima BOS, baik tingkat SD dan SMP. Karena data-datanya disinyalir tidak akurat. Pasalnya, pada tahun anggaran sebelumnya, jumlah siswa penerima dana BOS-nya tidak jauh berbeda. “Aparat penegak hukum juga harus aktif mengawasi penyaluran dana BOS. Apalagi program pendidikan secara nasional sudah gratis, namun masih tetap saja dilakukan pungutan liar oleh sekolah. Bahkan, ada dalihnya untuk biaya ATK, padahal dana BOS ada,” ucapnya. Ditegaskannya, ada sekitar Rp6,9 Miliar setiap triwulannya anggaran dana BOS untuk Palas, kenyataannya di lapangan, banyak sekolah ditemukan kondisi ATK-nya tidak pernah diganti, tapi setiap tahun menerima dana BOS. “Ini harus diperbaiki demi mewujudkan visi-misi Pemkab Palas menuju masyarakat cerdas. Jika perlu, Bupati harus mengevaluasi pejabat yang membidangi dana BOS,” tukas Samson. Sementara itu Manager BOS Disdikbud Palas, Muliadi Hasibuan membantah adanya penyimpangan dalam realisasi dana BOS, setelah dimanajemen dirinya. Namun, kalau untuk sebelum dirinya, Muliadi tidak begitu tahu. “Saya masih baru menjabat manajer BOS, dan saya masih yakin tidak ada penyimpangan. Dalam hal persoalan memungut biaya dari siswa dalam pendidikan dan serta peraturan dibolehkan, asalkan tidak ditetapkan berapa pungutan yang dilakukan. Pungutan itu dibolehkan tapi jangan di patok, sesuai dengan kemampuan para siswa,” sebutnya. Ketika ditanya, apakah itu tidak pungli karena sudah ada dana BOS, Muliadi dengan mantap dan yakin kalau hal itu tidak menyalahi dalam aturan Sisdiknas. Disebutkannya, jumlah siswa untuk SD penerima dana BOS sebanyak 37.311 siswa, dimana setiap siswa mendapat Rp145.000 setiap triwulannya, kemudian untuk SMP jumlahnya 6.387 siswa,dengan dana setiap siswa Rp177.500 per triwulan. “Itulah anggarannya. Jadi, kalau ada ditemukan penyimpangan itu nanti tanggung jawab sekolah, karena di kirim langsung ke rekening sekolah terkait dari provinsi,” terangnya. “Inilah yang harus ditindak tegas, manajer BOS jangan cuma pandai berargumen saja, tapi monitoring secara langsung kelapangan. Karena dana manajemen BOS itu ada dianggarkan negara, kalau tidak mampu diganti saja,” ujar aktivis Gerakan Rakyat Berjuang (GRB) Palas, Mardan Hanafi Hasibuan SH. (amr/mer)



28 September 2012

Honda Jazz Polisi Ditabrak Anak Polisi SIANTAR- Jhonlisher Panjaitan (23), anak polisi yang bertugas di Polsek Tanah Jawa menabrak Honda Jazz silver BK 79 W milik Bripka Jepta Sitanggang, personel polisi Polres Simalungun di Jalan Ade Irma, Kamis (27/9), sekira pukul 11.00 WIB. Akibatnya korban terpaksa dirawat di RS Vita Insani. Jhonliser merupakan warga Lapangan Bola Bawah, KecamatanSiantarSelatan.SementaraBripka Jepta Sitanggang merupakan warga Jalan Rakutta Sembiring, Siantar Martoba. Informasi dihimpun METRO, sepedamotor Honda Astrea Grand tanpa plat yang dikemudikankorbanmelajudengankecepatan tinggi dari arah Pertamina menuju Pasar Parluasan. Tiba di lokasi yang berupa jalan menikung, korban tidak dapat mengendalikan kenderaannya dan langsung menabrak Honda Jazz silver yang datang dari arah berlawanan. Diduga, korban saat hendak jatuh langsung melompat dari kenderaannya sehingga tubuhnya tidak berbenturan dengan Honda Jazz tersebut. Korban lalu terjatuh ke aspal dan mengalami luka-luka di beberapa bagian tubuhnya.Sesudahkejadian,korban

lalu dibawa ke RS Vita Insani. Kondisi sepedamotor korban terlihat ringsek di bagian depan, begitu juga beberapa bagian dari sepedamotor ini ikut pecah. Sementara kondisi Honda Jazz mengalami kerusakan di bagian depan. IbukorbanNbrSianturi,ditemui di RS Vita Insani, Kamis sore menyebutkan, anaknya hendak ke tempat kawannya di Jalan Ade Irma. Suaminya merupakan personel polisi yang bertugas di Polsek Tanah Jawa. “Tadi yang menabrak juga sudah datang kemari, dia juga polisi di Polres Simalungun. Suami saya juga polisi di Polsek Tanah Jawa. Anak saya tidak mengalami luka parah, cuma pinggangnya memang masih sakit dan juga ada yangsakitdipahanya,”jelaswanita yang ditaksir berusia 40 tahunan ini. Kanit Laka Polres Siantar Iptu Sugeng Wahyudi membenarkan kecelakaan lalu lintas ini. Diduga pengendara sepedamotor tidak dapat mengendalikan kenderaannya saat menikung sehingga tergelincirdanmenabrakdepanHonda Jazz. Kedua kenderaan telah diamankan untuk kepentingan penyelidikan. (ral/dro)


BIAYA ANAK MENDESAK TUKANG ES CURI GETAH SERBELAWAN- Misdi (36), warga Parluasan Barat, Kelurahan Serbelawan, Kecamatan Dolok Batu Nanggar, Simalungun, tertangkap tangan mencuri getah lumb (getah kering, red) di Afdeling D Kebun PT Brigestone, Kamis (27/9), sekira pukul 06.30 WIB. Dia ditangkap securiti (satpam) Kebun PT Brigestone saat sedang melakukan aksinya, menuangkan getah dari pohon karet ke goni plastik. Kepada METRO, Misdi mengaku, terpaksa mencuri akibat desakan keperluan biaya sekolah kedua anaknya. Sebab beberapa hari terakhir, cuaca hujan, sehingga penghasilannya dari menjual es tidak mencukupi. “Saya pedagang es keliling. Karena cuaca musim hujan, dagangan saya pun tidak laku. Sementara kebutuhan keluarga dan biaya sekolah kedua anak sudah mendesak, makanya saya terpaksa mencuri,” ujarnya. Ia mengaku, aksi pencurian itu tidak dia rencanakan, dan tiba-tiba niat mencuri karena desakan keperluan uang. Pria kelahiran 5 Mei 1976 ini, mengaku baru pertama kali mencuri, namun langsung tepergok satpam. “Bukan niat mencuri, tapi karena desakan biaya sekolah anak-anak saja,” ucapnya sambil menunduk. Supianto, Securiti Kebun PT


Gara-gara Dahan Rambutan TetanggaDisiramAirSelokan SIMALUNGUN– Terdakwa Morlan Sitorus (45) menyiram air selokan ke wajah Parulian br Pardede, tetangganya di Huta Cinta Dame I, Nagori Bah Jambi II, Kecamatan Tanah Jawa, Simalungun. Morlan tidak terima ditegur karena memotong dahan pohon rambutan milik korban yang mengenai atap seng rumahnya. Tapi terlepas dari motif itu, ulah Morlan ini membuat citra Huta Cinta Dame ternoda. Perselisihan ini terungkap di persidangan yang digelar di Pengadilan Negeri (PN) Simalungun, Kamis (27/9), dengan agenda keterangan saksi korban. Sidang dipimpin Monalisa beranggotakan Siti Hajar dan Silvia Ningsih. Parulian br Pardede, korban yang dihadirkan jaksa Viktor Situmorang menceritakan, saat itu hari Selasa 5 Juni 2012, sekira pukul 18.00 WIB. Dia mengaku baru pulang melayat, orangtuanya meninggal dunia. “Kemudian saya menyempatkan diri memberi makan ternak di belakang rumah,” kenang korban. Dia menerangkan, saat memberikan makan ternak babi tersebut ia merasa suasana berbeda di sekitar rumahnya. Setelah diperhatikan, ternyata dahan pohon rambutan yang saat itu tengah berbuah lebat sudah dipotong terdakwa. “Saat itu, pohon rambutan saya

tengah berbuah lebat, tapi sebagian dahannya sudah dipotong oleh terdakwa. Memang dulu terdakwa pernah meminta saya untuk menebang pohon tersebut,” akunya. Lanjut saksi korban, setelah berada di teras rumahnya ia melihat istri terdakwa Klara sedang duduk di sebelah rumahnya. Saat itu, ia pun memanggil istri terdakwa untuk mempertanyakan maksud pohon rambutan miliknya dipotong. “Setelah itu, suaminya langsung datang dan mengaku sebelumnya dia sudah memperingati saya supaya dahan pohon rambutan yang mengenai seng rumahnya ditebang. Memang saya sendiri tidak mengamini permintaan tersebut,” ujarnya. Menurut dia, tidak beberapa lama kemudian terdakwa langsung mengambil air parit dari depan rumahnya dan menyiramkan kepada dirinya. Akhirnya air parit tersebut membasahi tubuh korban. Akibat perbuatan terdakwa tersebut, ia pun melaporkan terdakwa ke Polsek Bangun. “Usai kejadian itu, dia tidak mau meminta maaf kepada saya hingga saya kesal dan melaporkan perkara ini ke proses hukum. Tapi setelah terdakwa ditangkap dan ditahan, ia langsung mendatangi saya dan meminta maaf,” sebut korban singkat. (mua/dro)

Brigestone mengatakan, pelaku tertangkap tangan setelah berhasil memanen 25 kilogram getah lumb dari pohon karet. Belum sempat membawa keluar hasil curiannya itu, pelaku berhasil diamankan saat sedang masih memanen getah di Afdeling D. Dari tangan pelaku diamankan 25 kilogram getah lumb, dan sepedamotor Honda Revo BK 4402 TAD. Kemudian pelaku bersama barang bukti diserahkan ke Mapolres Simalungun, untuk diproses sesuai hukum yang berlaku. Kasubag Humas Simalungun AKP H Panggabean membenarkan telah menerima pelaku dari pihak securiti Kebun PT Brigestone bersama barang bukti getah dan sepedamotor. Untuk mempertanggungjawabkan perbuatannya, pelaku dijerat pasal 362 KUHPidana tentang Pencurian. (osi/dro)

DUA KALI SUKSES Xenia BK 1042 KC, Mobil Siapa Ini? KETIGA KALI GOL Foto:Tonggo Sibarani.

„ Misdi, pedagang es yang ketangkap tangan mencuri getah dan diserahkan ke Polres Simalungun, Kamis (27/9).


„ Kondisi mobil Xenia yang rinsek berat setelah diamankan petugas Satlantas Polsek Bangun, Kamis (27/9). BUKIT MARAJA- Polisi mengamankan mobil Xenia BK 1042 KC dengan kondisi rusak berat di simpang ‘BM’ (maksunya: Simpang lokalisasi Bukit Maraja), Selasa (25/9), sekira pukul 20.00 WIB.Namunsaatdiamankanpolisi tidak menemukan seorang pun penumpang mobil naas itu di lokasi. Keterangan dihimpun, petugas

Satlantas Polsek Bangun malam itu, mendapat informasi bahwa terjadilakatunggaldiSimpang‘BM’, satu unit mobil Xenia yang melaju dari arah Siantar menuju Perdagangan menabrak pohon di pinggir jalan. Polisi kemudian langsung menuju lokasi guna melakukan olah TKP (Tempat Kejadian Perkara). Sampainya di sana, tak

satupun petugas menemukan korban di lokasi kejadian, yang terlihat hanya beberapa warga dan pengendara yang melintasi TKP. Ketepatan malam itu, menurut sejumlah warga, cuaca buruk dengan kondisi hujan deras. Walau demikian, petugas tetap membawa mobil itu ke Mapolsek Bangun. Selanjutnya, petugas mengecek beberapa rumah sakit terdekat guna mencari keberadaan identitas penumpang mobilnaasitu.Namudaribeberapa rumah sakit yang dikunjungi petugas, mereka tidak menemukan seorang pun koban laka lantas. SementaradiMapolsekBangun juga tidak seorang pun ada warga yang mengaku mengalami kecelakaan dan atau sebagai pemilik mobil naas itu sampai Kamis (27/ 9), sekira pukul 14.00 WIB. Dugaan sementara, mobil itu dirental dan disengaja ditinggal korban setelah menabrak pohon. (mag-4/dro)

SIANTAR- Remaja putus sekolah Julius Lumban Tobing (14), ditangkap saat hendak mencuri di rumah Alfin Irwansyah (22), warga Jalan Toba I, Kelurahan Kristen, Kecamatan Siantar Selatan, Kamis (27/9), sekira pukul 17.00 WIB. Ternyata aksi itu untuk yang ketiga kalinya dilakukan Julius, aksi pertama dan kedua juga di rumah korban berjalan mulus. Informasi dihimpun, Julius tinggal bersama orangtuanya di Jalan Bahagia, Kelurahan Kristen, Kecamatan Siantar Selatan. Saat itu, Julius dengan cara mengendap-endap masuk ke pekarangan rumah korban. Lalu, dia menuju kamar belakang dan berusaha membuka pintu belakang rumah korban. Namun saat berusaha membuka pintu ini, tersangka dipergoki warga sekitar rumah korban dan warga inipun langsung membekuk tersangka saat itu juga. Sementara sebagian warga menghubungi polisi. Tak lama

kemudian, aparat polisi Polsek Siantar Selatan tiba di lokasi dan mengamankan tersangka. Di Polsek Siantar Selatan, Julius mengakui telah melakukan pencurian sebanyak 3 kali di rumah Alfin Irwansyah. Pertama kali pada Senin (2/7) lalu, Julius mengambil laptop merk Zyrex dan satu dompet berisi uang Rp500 ribu. Kemudian kedua kali pada Rabu (1/8), Julius kembali mencuri dan mengambil satu infocus, satu HP serta dua kaos milik Alfin. “Aku mencuri untuk main game point blank di warnet Putri, barang yang aku curi kemudian aku jual ke tukang stiker yang ada di dekat Rumah Potong. Laptop itu kujual seharga Rp310 ribu, uangnya sudah habis bang. Kalau infocus dan HP gak ingat aku ke mana kujual dan sama siapa kujual bang dulu,” ujar remaja yang mengaku putus sekolah dari SMPN 3 ini. (ral/dro)

YAYASAN SEPA HUSADA : Menerima tenaga kerja khusus wanita, baik gadis/ janda, dengan usia 17 s/d 45 tahun, untuk dilatih & dipekerjakan sebagai perawat jompo/orang tua sakit, baby sitter. Syarat: Ijasah asli, KTP/Kartu Keluarga, gaji berkisar Rp. 1.000.000 s/d 1.700.000/bulan. Lamaran diantar langsung ke Jl. Pasar 3 no. 45 A Krakatau Medan. Hubungi: 0811 602 145; 0852 6114 3441 PELUANG USAHA AIR MINUM Pemasangan Depot Air Minum Air Pegunungan (Mineral) Sistem RO Oxsygen dan Grosir Peralatan Depot Air Minum GRACE WATER: Jl. Cengkeh Raya P. Simalingkar. HP. 0813 7010 7352. *) Melayani pemasangan dalam dan luar kota RIZKI PONSEL Jalan Merdeka, Kota Padangsidimpuan. Menerima HP bekas dengan harga tinggi. Blackberry, Nokia, Samsung, Sony Erikson, dll. Dengan syarat lengkap dan baik. Hubungi IRWANTO: Hp 0813 6215 1119


28 September 2012

Divonis 3 Tahun Penjara MIRANDA BANDING „ Brigjen Ahmad Reza Pourdastan.

Iran Siap Perang dengan Israel TEHERAN- Militer Iran kembali menyampaikan kesiapannya menghadapi ancaman perang Israel. Penegasan itu disampaikan Panglima Pasukan Darat Militer Iran Brigjen Ahmad-Reza Pourdastan. ”Iran punya kesiapan yang diperlukan untuk menghadapi ancaman-ancaman dari rezim Zionis (Israel),” cetus Pourdastan seperti dilansir Press TV, Kamis (27/9). Israel telah berulang kali mengancam akan menyerang fasilitas-fasilitas nuklir Iran. Retorika perang kian gencar disampaikan Israel terkait tuduhan bahwa Iran tengah mengembangkan senjata nuklir lewat program nuklir yang dijalankannya. ”Kami memiliki rencana pertahanan laut, udara dan darat untuk mempertahankan perbatasan-perbatasan Republik Islam,” tegas pejabat militer Iran tersebut. Israel, juga Amerika Serikat dan negara-negara Eropa telah lama mencurigai Iran diam-diam tengah mengembangkan senjata atom lewat aktivits nuklirnya. Namun pemerintah Iran berulang kali membantah hal tersebut. Teheran menegaskan, program nuklirnya semata-mata untuk tujuan damai, yakni sebagai pembangkit energi bagi kepentingan sipil. Mengenai latihan penyisiran ranjau yang tengah dilakukan militer AS di Teluk Persia, Pourdastan menyebut latihan itu sebagai “pasif.” Latihan militer AS tersebut dimulai pada 16 September lalu dijadwalkan selesai pada 27 September besok. Angkatan Laut AS telah menegaskan, latihan militer tersebut semata-mata bersifat defensif dan tidak diarahkan ke negara manapun. (kmc/int)

JAKARTA- Mantan Deputi Gubernur Senior Bank Indonesia, akan mengajukan banding atas Pengadilan Tindak Pidana Korupsi Jakarta yang menjatuhkan terhadapnya. Miranda menilai dirinya tidak terbukti bersalah menyuap anggota DPR 1999-2004 saat mengikuti pemilihan DGS BI 2004. Hal tersebut disampaikan Miranda dalam persidangan yang berlangsung di Pengadilan Tipikor, Kamis (27/9), seusai mendengar putusan majelis hakim. ”Saya ingin mengatakan, saya kaget, tidak menyangka. Tuhan tahu saya tidak bersalah, saya akan naik banding,” kata Miranda tegas. Sementara menyatakan masih akan pikir-pikir atas putusan majelis hakim tersebut. Dalam amar putusannya, majelis hakim yang diketuai Gusrizal menyatakan Miranda bersalah melakukan tindak pidana korupsi sesuai dengan Pasal 5 Ayat 1 huruf b Undang-Undang Pemberantasan Tindak Pidana Korupsi (UU Tipikor) juncto Pasal 55 Ayat 1 ke-1 KUHP dalam dakwaan pertama. Putusan ini yang meminta hakim menghukum empat tahun penjara.

Menurut hakim, Miranda terbukti menyuap bersama-sama aktor lainnya. Adalah Nunun Nurbaeti yang divonis dua tahun enam bulan penjara karena dianggap sebagai pemberi suap dalam kasus ini. Selama ini, Miranda berdalih kalau dirinya tidak mengetahui ihwal pemberian cek perjalanan kepada anggota DPR 1999-2004, sementara majelis hakim tidak sependapat dengan pembelaan Miranda tersebut. Menurut hakim, meskipun pemberian suap tidak dilakukan Miranda secara langsung, dia dapat dianggap ikut menyuap karena perbuatannya berhubungan dan berkaitan erat dengan perbuatan aktor lain, di ant-

„ Miranda usai menjalani persidangan di Pengadilan Tipikor Jakarta. aranya Nunun Nurbaeti, Hamka Yandhu, Dudhie Makmun Murod, Udju Djuhaeri, dan Endin Soefihara. ”Kita tidak melihat masing-masing peserta dan berdiri sendiri-sendiri, melainkan perbuatan yang berhubungan dan sebagai kesatuan perbuatan peserta lainnya,” kata hakim Anwar. Pada Mei 2004, Miranda mengadakan pertemuan dengan anggo-

ta DPR 1999-2004 asal Fraksi PDI Perjuangan dan Fraksi TNI/Polri. Dalam dua pertemuan itu, Miranda menyampaikan visi dan misinya sebagai calon DGS BI 2004. Pertemuan Miranda itu dianggap berkaitan dengan pemberian cek perjalanan kepada anggota DPR 1999-2004 oleh Nunun Nurbaeti yang dekat dengan Miranda itu melalui Arie Malangjudo. Pemberian cek berlangsung di

Mendagri Minta Kepala Daerah

Hati-hati Kelola Keuangan

„ PM Jepang Yoshihiko Noda

PM Jepang: Tak Ada Kompromi dengan China TOKYO- Perdana Menteri Jepang, Yoshihiko Noda, berkeras bahwa tidak ada kompromi dengan China soal kepemilikan kepulauan yang disengketakan. Ia juga mengecam terjadinya serangan terhadap kepentingan-kepentingan Jepang di China. Ketika berbicara kepada para wartawan pada Sidang Majelis Umum PBB di New York, Kamis (27/9), Noda mengatakan China telah salah paham tentang sengketa tersebut dan menuntut diakhirinya ancaman-ancaman terhadap warga negara dan kepentingan Jepang di China oleh para pengunjuk rasa nasionalis. “Sejauh ini, soal kepulauan Senkaku, kepulauan itu merupakan bagian menyeluruh wilayah kami menurut sejarah dan hukum internasional,” kata Noda merujuk pada sebuah kepulauan di Laut China Timur yang disebut China sebagai Diaoyu. ”Jelas sekali dan tidak ada masalah kewilayahan. Karena itu tidak bisa ada kompromi yang bisa menjadi langkah mundur dari posisi dasar ini,” katanya kepada wartawan. “Penyelesaian masalah ini tidak boleh dengan paksaan, melainkan secara tenang, dengan memberikan alasan berdasarkan penghormatan terhadap hukum internasional.” Menteri Luar Negeri China, Yang Jiechi, mengatakan kepada mitranya Menlu Jepang, Koichiro Gemba, di Perserikatan Bangsa-Bangsa pada Selasa bahwa Jepang bersalah telah “secara parah melanggar” kedaulatannya, demikian menurut kementerian luar negeri Beijing. “Pihak China tentu saja tidak akan mentolerir aksiaksi sepihak Jepang di Kepulauan Diaoyu,” kata Yang kepada Gemba, menurut keterangan kantornya. Seorang pejabat Jepang di New York mengonfirmasikan kepada AFP bahwa pembicaraan berlangsung “tajam”, tetapi mencatat bahwa kedua belah pihak sepakat untuk terus melakukan dialog. Sengketa tersebut meletus menjadi perang kata-kata antara Beijing dan Tokyo setelah pemerintah Jepang mengambil alih kepulauan yang tadinya dimiliki secara pribadi menjadi kepulauan milik publik. Namun Noda berkeras bahwa langkah tersebut telah disalahartikan. “Bagian dari kepulauan Senkaku yang dimiliki oleh seorang warga negara dialihkan kepemilikannya kepada pemerintah sebagai upaya untuk memastikan kepulauan itu dikelola secara stabil,” ujarnya, menurut terjemahan resmi. “Ini bukan pengambilan baru. Tadinya milik pribadi seorang warga Jepang dan kepemilikan itu dialihkan dalam kerangka hukum Jepang,” ujarnya. (kmc/int)

tengah-tengah uji kelayakan dan kepatutan calon DGS BI 2004. Setelah pemberian tersebut, Miranda terpilih sebagai DGS BI 2004. Dalam kasus ini, Nunun divonis dua tahun enam bulan penjara karena dianggap terbukti sebagai pemberi suap. Sementara lebih dari 25 anggota DPR 1999-2004 yang dianggap terbukti menerima cek perjalanan telah menjalani hukuman. (dtc/int)

„ Seorang jamaah haji sujud syukur begitu sampai di Madinah.

Jamah Haji Tak Perlu Cemas Virus Flu Corona JEDDAH - Jamaah haji dan keluarga di tanah air tidak perlu panik dengan munculnya virus flu bernama corona yang sudah menewaskan warga Saudi dan warga Qatar yang pernah ke Saudi. Kasi Pelayanan Kesehatan Daerah Kerja Jeddah dr Ananto Prasetya di Bandara Haji King Abdul Azis Jeddah, Kamis (27/9), mengatakan kasus virus corona belum pernah ditemukan pada jamaah haji. “Kasusnya ditemukan pada tiga orang, dua diantaranya tewas, satu warga Saudi (60) tahun dan warga Qatar (49) yang pernah berkunjung ke Saudi,” kata Ananto. Berkaitan dengan itu dia mengimbau agar jamaah haji Indonesia tidak panik

karena belum ditemukan kasus pada anggota jamaah haji dari negara lain juga. Meski demikian, dia menilai tidak ada salahnya bersikap hati-hati karena dari tiga kasus, dua meningal. Dijelaskannya, bahwa virus corona adalah virus baru yang ditemukan pada manusia dan berbeda dengan virus penyebab penyakit SARS. Virus corona diduga menyerang ginjal dan pada manusia yang bertubuh lemah. “Jadi jika kita menjaga vitalitas dubuh maka virus ini tidak bisa menyerang,” katanya. Karena itu dia mengimbau jamaah haji untuk menjaga kondisi tubuh. Dia meminta jamaah untuk makan dan minum yang cukup, banyak makanan yang

berserat, sayur dan buah-buahan. Dia menganjurkan sering minum karena saat ini udara di Saudi cukup panas di siang hari, yakni 37—38 derajat celsius pada pukul 12:00 waktu setempat Saat ini sebagian besar jamaah berusia lanjut, 50 tahun ke atas, karena itu dia mengimbau agar jangan beraktivitas banyak di luar ruangan di siang hari. Beribadahlah sesuai dengan kemampuan fisik, pilih yang wajib-wajib saja agar tidak kelelahan. Saat ini sebagian besar jamaah haji Indonesia di Madinah menunaikan shalat lima waktu selama delapan hari untuk mendapatkan arbain (40 kali shalat fardhu). (kmc/int)

Hari Ini KPK Periksa Irjen Djoko Susilo JAKARTA- Komisi Pemberantasan Korupsi (KPK) akhirnya mengumumkan waktu pemeriksaan terhadap tersangka kasus simulator SIM Irjen Djoko Susilo. Mantan Kakorlantas Polri itu akan diperiksa Jumat (28/9). ”Untuk pemeriksaan DS saya dapat informasi besok Jumat,” kata Juru Bicara KPK Johan Budi SP, di Gedung KPK, Jl HR Rasuna Said, Kuningan, Jaksel, Kamis (27/9). Menurut Johan, DS diperiksa sebagai tersangka. Waktu pemeriksaan mulai pukul 09.00 WIB. Dalam kasus simulator SIM ini, KPK menetapkan empat tersangka atas dugaan melakukan penyalahgunaan kewenangan sehingga menimbulkan kerugian negara. Selain Djoko, tiga orang lain yang ditetapkan tersangka adalah Brigadir Jenderal (Pol) Didik Purnomo dan dua pihak swasta, yaitu Budi Susanto dan Sukotjo S Bambang. Ketiga tersangka terakhir itu juga ditetapkan sebagai tersangka oleh Kepolisian Negara RI. Terkait Djoko, KPK sudah memeriksa sejumlah saksi. Di antaranya adalah para perwira polisi antara lain, Kepala Kepolisian Resor Temanggung Ajun Komisaris Besar Susilo Wardono, Kepala Subdit Pendidikan dan

„ Irjen Djoko Susilo mendatangi kantor KPK untuk menjalani pemeriksaan. Rekayasa Direktorat Lalu Lintas Polda Jawa Tengah Ajun Komisaris Besar Indra Darmawan, dan Kepala Polres Kebumen Ajun Komisaris Besar Heru Trisasono. KPK juga sudah memeriksa empat perwira polisi yang menjadi panitia pengadaan proyek simulator SIM 2011. Keempatnya adalah Ajun Komisaris Besar Wisnhu Bud-

dhaya, Ajun Komisaris Besar Wandi Rustiwan, Komisaris Endah Purwaningsih, dan Komisaris Ni Nyoman Suwartini. KPK juga sudah memeriksa Sukotjo S Bambang dan Intan Pardede, Sekretaris Budi Susanto, sebagai saksi untuk Djoko. Namun sampai saat ini KPK belum juga memanggil Djoko sebagai tersangka. (kmc/int)

JAKARTA- Pemerintah menghormati putusan Mahkamah Konstitusi (MK) yang meminta penghapusan aturan izin presiden bagi penegak hukum untuk memeriksa kepala daerah bermasalah. Konsekuensinya, pemerintah akan meminta seluruh kepala daerah untuk berhati-hati dalam membuat kebijakan yang berkaitan dengan keuangan daerah. ”Kita hargai putusan MK. Kita intensifkan pembinaan pengelola keuangan daerah dan pengambilan keputusan,” kata Mendagri Gamawan Fauzi ketika dihubungi, Kamis (27/9). Ia menyebutkan, adanya putusan MK ini juga berpengaruh terhadap rencana revisi UU No32/ 2004 tentang Pemerintah Daerah. Awalnya pemerintah tetap memasukkan klausul izin presiden untuk memeriksa kepala daerah. “Kita akan perhatikan putusan ini saat revisi UU Pemda,” ujarnya. Selama ini, adanya izin presiden tersebut dimasukkan dalam RUU Pemda yang merupakan revisi UU No32/2004. Pasalnya, kepala daerah merupakan perwakilan pemerintah pusat dalam melayani publik di daerah. Jika selama 60 hari izin presiden tidak keluar, penegak hukum bisa memproses lebih lanjut kepala daerah yang diduga bermasalah itu. (mdc/ int)

Angelina Sondakh

Minta jadi Tahanan Rumah JAKARTA- Angelina Sondakh, terdakwa kasus suap penganggaran proyek Kementerian Pemuda dan Olahraga serta Kementerian Pendidikan Nasional, meminta agar dijadikan tahanan rumah. Jika dikabulkan, Angelina tidak lagi mendekam di Rumah Tahanan Pondok Bambu, Jakarta Timur. Permintaan ini disampaikan Angelina atau Angie melalui pengacaranya, Tengku Nasrullah, dalam persidangan yang berlangsung di Pengadilan Tindak Pidana Korupsi (Tipikor) Jakarta, Kamis (27/9). “Kami memohon kepada yang mulia majelis hakim, terhadap urgensi penahanan terdakwa, mengingat anak terdakwa masih berumur dua tahun dan terdakwa adalah single parent. Besar harapan kami mengalihkan jadi tahanan rumah sehingga terdakwa bisa mengasuh anaknya,” kata Nasrullah. Menurut Nasrullah, sesuai Pasal 21 Kitab Undang-Undang Hukum Acara Pidana (KUHAP), sudah tidak ada lagi kepentingan untuk menahan Angelina. Pasal tersebut mengatur bahwa seseorang dapat ditahan jika berpotensi melarikan diri, menghilangkan alat bukti, atau mengulangi perbuatannya. Alasan Angelina akan melarikan diri dianggapnya tidak dapat lagi menjadi dasar penahanan karena Angie tidak akan melakukan hal tersebut. “Tidak akan mungkin karena terdakwa sudah dicegah dan sedang menjalani proses persidangan,” kata Nasrullah. Selain itu, menurut Nasrullah, kliennya tidak perlu lagi di tahanan karena tidak mungkin menghilangkan alat bukti mengingat perkaranya sudah disidangkan. (kmc/int)


28 September 2012

Pasca Banjir Barus, Pemkab Dirikan Posko BARUS -Pasca banjir melanda sejumlah desa di KecamatanBarus,PemkabTaptengbersamaBadan NasionalPenanggulanganBencana(BNPB)Provinsi Sumut mendirikan posko satgas penanggulangan bencanadiKantorCamatBarus. Demikian dikatakan Camat Barus Drs Herman Suwito didampingi anggota BNPB Provinsi Sumut. Menurut Herman Suwito, banjir yang merendam ribuan rumah pada Rabu (26/9) kemarin telah menyengsarakanribuanwarga. “Tujuannyauntukmenampungparakorbanyang terkenabanjir.Sedangkanuntukdapurumumhingga saatinibelumkitabukakarenabelumadawargayang melaportidakmakankarenarumahnyaterendam.Kita juga masih tetap mendata semua kerugian yang dialamimasyarakattermasukinfrastrukturyangrusak. Kita juga sudah melaporkannya langsung kepada Bupati Tapteng Raja Bonaran Situmeang,” ujar Herman. Sementaramenurutsalahseorangkorbanbanjir, Hasrianto Samosir, jumlah kapal penangkap ikan miliknya yang hanyut terseret air ke laut sebanyak sembilan unit. Namun 6 diantaranya sudah ditemukandalamkeadaanrusakberat.Sedangkantiga unitlagimasihbelumditemukan. Dikatakannya,kerugiannyaakibatbencanaalam tersebut diperkirakan mencapai sekitar Rp400 juta.


Sejumlah siswa MAN Barus membersihkan mushala di sekolah mereka.

“Jadi untuk memperbaiki satu unit kapal agar bisa kembali melaut diperkirakan mencapai Rp40 juta hingga Rp50 juta. Karena semua kapal yang sudah ditemukankondisinyarusakberat.Sadangkanyang belumditemukanbelumtahubagaimanakondisinya, bisasajakapaltersebuttidakdapatlagiditemukan,atau ditemukantetapitidakbisalagiperbaikisamasekali.

Duel Lawan Orang Gila, Tetangga Roboh Ditikam

Sambungan Halaman 1

Aksi massa yang dimulai pukul 11.00 WIB hingga pukul 13.15 WIB ini tak hanya membikin suasana politik panas tapi juga terbilang unik. Pasalnya, para koordinator aksi merupakan ‘pemain lama’ alias tokohtokoh masyarakat yang dulu terkenal vokal. Di antaranya; Ketua MPC Pemuda Pancasila Madina, Syahriwan Nasution alias Kocu, Kordinator VII LIRa Sumatera Utara, Abdul Muis Pulungan, Ketua Lembaga Pemantau Penyelenggara Negara RI (LPPN RI) cabang Madina, Syaifuddin Lubis, kemudian mantan Ketua PC PMII Madina periode tahun 2005 Ahmad Yasin Nasution, Sekretaris Gapeknas Madina Sutan Batanghari, dan sejumlah tokoh masyarakat lainnya. Sebelum penyegelan, massa memasuki

dengan peraturan pemerintah RI nomor 16 tahun 2010 tentang pedoman penyusunan Peraturan DPRD tentang tata tertib. Selain itu masyarakat juga sudah kecewa atas tindakan sejumlah anggota dewan yang sejak dilantik jarang sekali ngantor. Namun, aktif dalam proses tender proyek, belum lagi atas persoalan yang terjadi di internal DPRD Madina. “Mencermati dinamika politik khususnya yang terjadi selama 9 bulan terakhir ini ternyata tidak lagi mencerminkan etika politik yang sehat dan wajar. Proses demokratisasi yang seharusnya ditunjukkan kepada publik telah bergeser oleh arogansi kekuasaan yang sesungguhnya menurut kami telah membalut kepentingan kelompok dan memarjinalkan kepentingan dan hak-hak rakyat Madina,” ungkapnya. Saat ini, kata Syaifuddin, eksekutif galau, pemuda, mahasiswa, aktivis, praktisi dan akademisi galau, disebabkan tidak pernah menemukan model politik dan system demokrasi yang dipertontonkan pimpinan dan anggota dewan. “Kami bingung melihat DPRD Madina sesunggunya tidak memahami tata tertib yang mereka susun dan mereka sahkan sendiri. DPRD Madina tidak mengerti demokrasi yang sebenarnya dan yang harus mereka perankan di lembaga yang terhormat ini,” tukasnya. Oleh sebab itu, sambung pengunjukrasa, FMPM sebagai perwakilan dari lima ratusan ribu penduduk di Madina menggugat DPRD

Sambungan Halaman 1 Para murid SD sudah waktunya pulang sekolah. Namun, melihat kondisi belakang sekolah dipenuhi air, para bocah ini mengatur rencana untuk mandi di belakang sekolahnya tersebut. Selanjutnya korban dan teman-temannya pulang ke rumah. Begitu sampai di rumah, korban bersama kedua temannya kembali mendatangi lokasi banjir untuk mandimandi. Sesampainya di lokasi, korban dan temannya langsung terjun ke air. Namun, korban terperosok ke lokasi yang lebih dalam. Karena tidak pandai berenang, akhirnya korban tenggelam dan terbawa arus. Tak lama setelah itu, kedua temannya

Koran Kebanggaan Orang Tabagsel

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel Chairman :) Rida K Liamsi

Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Muhiddin Hasibuan Pandapotan MT Siallagan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

banding ke Bali, padahal hasilnya untuk masyarakat Madina tidak ada. “Kami umumkan kepada seluruh masyarakat khususnya yang memiliki hak pilih agar jangan memilih lagi wakil rakyat yang sekarang untuk pemilu 2014 mendatang. Kita tidak ingin wakil kita di DPRD ini yang bermental proyek,” teriaknya. Menanggapi sejumlah tuntutan pegunjukrasa, Ketua Badan Kehormatan DPRD Madina, Rahmad Riski Daulay mengatakan dalam waktu dekat akan memproses tuntutan pengunjukrasa terutama atas ketidakhadiran sebanyak 20 anggota dewan pada rapat paripurna LKPj Bupati. “Dalam waktu dekat kami akan memproses tuntutan masyarakat itu, kami berterima kasih atas perhatian dari seluruh masyarakat Madina,” pungkasnya. (wan)


Seorang pengunjukrasa menunjukkan ruangan di gedung DPRD yang disegel.

Madina dengan lima poin (lihat tabel). “Selain itu kami juga memerintahkan Badan Kehormatan Dewan agar memproses oknum anggota dewan yang terlibat proyek atau calo proyek baik langsung maupun tidak langsung. Dan memerintahkan BK DPRD Madina untuk memproses oknum anggota dewan yang jarang masuk dan tidak mengikuti rapat-rapat di DPRD Madina. Sebab itu melanggar pasal 86 Tata tertib dan juga UU nomor 27 tahun 2010,” ujar pengunjukrasa. Dan jika gugatan dan perintah itu tidak dilaksanakan maka pihaknya akan membawa semua persoalan ke jalur hukum. Sekitar 90 menit berorasi, Ketua DPRD Madina AS Imran Khaitami Daulay, Wakil ketua Syafaruddin Ansyari Nasution dan 18 anggota dewan lainnya keluar dari rapat paripurna pembahasan LKPj Bupati Madina tahun 2011 dan menemui pengunjukrasa. Ketua DPRD AS Imran Khaitami Daulay mengatakan banyak hal yang harus dituntaskan atas persoalan yang dihadapi lembaga DPRD Madia terutama atas tugastugas pokok DPRD Madina. “Kami menyampaikan selama dua minggu ini, kami empat fraksi telah memutuskan mejalankan tugas dan fungsi lembaga ini. Tentunya sikap yang kami lakukan pasti akan trerhambat oleh teman-teman yang berbeda pemandangan dari 3 fraksi. Namun, kami tetap berupaya untuk menyelesaikan persoalan yang timbul beberapa waktu ini untuk bisa ditemui solusi,” pungkasnya.(wan)

Sekolah Kebanjiran, Murid SD Tewas Tenggelam

METRO TABAGSEL Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba

paripurna LKPj Bupati Madina tahun 2011. “Ini merupakan penghianatan terhadap rakyat dan sudah menunjukkan sikap ketidakpeduliannya terhadap masyarakat dan pembangunan daerah,” sebutnya. “Bahkan ada sejumlah anggota dewan yang makelar paket proyek sebanyak 67 paket senilai Rp18 miliar. Ini salah satu tuntutan kami, karena dalam undangundang sudah jelas bahwa anggota dewan itu tugasnya megawasi realisasi anggaran bukan meminta dan membagi-bagi paket. Kita sangat menyayangkan itu,” kata Kocu. Kocu menambahkan, selama ini masyarakat sudah menanggung beban mental dan beban moral atas perbuatan pimpinan dan anggota dewan atas kisruh yang terjadi, belum lagi tindakan anggota dewan yang doyan menghamburhamburkan uang rakyat, misalnya studi

Sambungan Halaman 1

Sambungan Halaman 1

Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh : Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan : Pimred Metro Siantar : Pimred Metro Tabagsel : Pj. Pimred Metro Tapanuli : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

gedung dewan dengan membawa spanduk kertas bertulisan “551 KUHP dilarang masuk, disegel masyarakat Madina!” Ini dilakukan sesuai dengan keputusan para pegunjukrasa untuk menyegel setiap ruang fraksi yang anggota dewannya tidak hadir pada rapat paripurna LKPj Bupati Madina tahun anggaran 2011 termasuk salah seorang wakil ketua DPRD Fakhrizal Efendi SH. Ketua MPC Pemuda Pancasila Syahriwan Nasution akraf disapa Kocu sebagai koordinator penyegelan bersama sejumlah anggota PP usai melakukan penyegelan di tiga ruang fraksi, yaitu Fraksi Madina Bersatu, Fraksi PKS, dan Fraksi Hanura. Kocu menjelaskan penyegelan ini atas kekesalan seluruh masyarakat Madina terhadap kinerja pimpinan anggota dewan khususya yang tidak menghadiri rapat

Siap Tempuh Jalur Hukum

Tolak Job SINETRON kian diungkapkan di Senayan City, Jakarta. “Belakangan masih syuting program teve. Sekarang banyakan off air. Aku gak milih sinetron. Kalau kerja paling lama satu jam, memang kesepakatan bersama. Jadwal di rumah lebih banyak,” katanya. Untuk itu, Fenita pun mengaku lebih senang mengambil program atau acara yang mudah dan ringan lantaran bisa mengajak anakanaknya ke lokasi. “Jiwa ibu rumah tangga saya juga kental. Saya memang menyadari kerjaan saya ngabisin waktu. Menyiasati kumpul keluarga gimana. Di weekend ini kumpul, memang ada planning ke Bali, dua sampai tiga bulan sekali harus kumpul keluarga,” tandas istri Arie Untung lalu tersenyum. (int)

BNPBSumutSerahkanBantuan BadanNasionalPenanggulanganBencana(BNPB) ProvinsiSumateraUtaramemberikanbantuankepada korban bencana banjir di Barus. Bantuan tersebut langsung diserahkan oleh koordinator tim kepada BNPB Tapteng yang diterima langsung Kepala BagiannyaIrBonaparteManurungMM. BantuaninikemudiandiserahkankepadaCamat Barus untuk selanjutnya disalurkan kepada para korban. Penyerahan bantuan tersebut dilakukan di kantor Camat Barus sebagai posko satgas penanggulanganbencanaalam,Kamis(27/9). Adapun bantuan yang diserahkan antara lain, makanansiapsaji,selimut,tenda,matras,danpakaian bayi. Kaban BNPB Tapteng Ir Bonaparte Manurung didampingiCamatBarusmenegaskan,bantuanyang diserahkanolehBNPBProvinsiSumuttersebutakan secapatnya disalurkan kepada warga yang membutuhkan. “Kitaakanserahkansemuabantuaninikepadapara korban. Sistim pembagiannya nantinya akan diatur oleh Camat Barus selaku koordinator posko satgas penanggulanganbencanaBarus.Mudah-mudahan apayangkitaserahkannantidapatmembantubeban saudara-saudara kita yang terkena musibah,” harapnya.(mas/nasa)


Sambungan Halaman 1 DatadihimpunMETROdilokasikejadian,soreitu tiba-tiba Anto keluar dari rumahnya membawa sebilah pisau dan langsung melempari rumah Rahmat. Rahmat yang baru tiba di lokasi, langsung berusaha menenangkan Anto. Melihat Rahmat, Anto bukannya tenang malah semakin mengamuk. Bahkan, antara Rahmat dan Anto terjadi perkelahian. “Mereka (Anto dan Rahmat) sempat duel, sebelum akhirnya Anto membabi buta mengayunkan pisau yang dipegang ke tubuh Rahmat,” kata beberapa warga yang ditanyai METRO. Sementara, petugas Polres Asahan yang tiba di lokasi kejadian atas laporan warga, hampir tidak bisa berbuat apa-apa karena melihat Anto masih memegangpisaumasukkedalamrumahnyasetelah berduel dengan Rahmat yang dilarikan warga untuk mendapat pertolongan. Ketika di dalam rumah, Anto bersembunyi. Dan setelah pihak keluarga dilibatkan petugas membujuk Anto, akhirnya Anto bisa diamankan dan langsung digelandang ke Mapolres Asahan. Kepala Sentral Pelayanan Kepolisian (Ka.SPK) Polres Asahan Aiptu J Sinambela ketika ditanyai, mengaku pihaknya menerima informasi bahwa tersangka memiliki kelainan jiwa, dan untuk menghindari hal yang tidak diinginkan tersangka langsung diamankan. PantauanMETROdiRumahSakitUmumDaerah (RSUD) Kisaran, korban Rahmat setelah mendapat penanganan di ruang Unit Gawat Darurat (UGD) kemudian di tempatkan di ruang V. “Korban tiba sekitar pukul 14.15 WIB, diantar keluarganya dengan kondisi mengalami luka bekas tusukan benda tajam pada bagian dada sebelah kanan, pangkal paha sebelah kiri, lengan sebelah kanan,” kata dr Eka Wilda Sari ketika ditemui di UGD RSUD Kisaran. Ditambahkannya, korban setelah ditangai lalu di foto yang nanti hasilnya, akan dikonsultasikan dengan dokter bedah. Sementara Rahmat tampak terbaring lemah di ruangannya dirawat dan tidak banyak memberikan kometar. “Nggak tahu apa sebabnya, tiba-tiba abang itu (Anto,red) menyerangku dengan sebilah pisau,” katanya sembari meringis menahan sakit. Terpisah, keluarga menolak memberikan keterangan ketika METRO mencoba bertanya soal peristiwa itu. “Maaf ya kami masih bingung dan tolong jangan diganggu,” kata seorang perempuan yang mengaku kakak Rahmat. Terpisah, Asfian alias Anto ketika ditanyai memberikan jawaban mengambang dan enteng pertanyaan METRO. “Sudah lama dibiar-biarkan, tapisemakinmenjadijadidia(Rahmat,red)mencuri barang-barang di rumahku,” katanya sembari tersenyum.(sus)

Saya sudah pasrah atas musibah ini, mungkin ini sebuah cobaan yang diberikan Allah SWT kepada saya,”ujarnyalirih. Dikatakanpengusahakapalpenangkapudangini, untuk mengantisipasi agar tidak terjadi lagi banjir sebesarini,PemkabTaptengdimintaagarmelakukan pengorekandiujungsungaiAekSirahar.

“Dulu sebelum sungai ini dangkal tidak pernah terjadibanjirsebesarini.Sekaranginiasalhujandatang, kami yang tinggal disekitar sungai akan was-was,” akunya. Sedangkan warga lainnya, Parulian Situmorang ,meminta kepada Pemkab Tapteng agar dapat memberikanbantuanlangsungkepadawargayang terkena bencana alam tersebut. Sebab sebahagian besar warga yang terkena banjir adalah rata-rata nelayan,dankapal-kapalmilikmerekarusakparah. SementaradaripantauanMETRO,Kamis(27/9), sebahagianbesarwargayangrumahnyaterendam sudahkembalikerumahmasing-masingdanmulai beraktifitas.Sedangkanbeberapasekolahyangsempat diliburkanakibatterendamairsudahmulaimelakukan proses belajar mengajar. Namun proses belajar mengajar tersebut belum maksimal karena pihak sekolah masih harus membersihkan lumpur di sejumlah ruangan. Sedangkan dari 20 kapal penangkapikanmiliknelayanyanghanyutterbawa arussungai,17diantaranyasudahditemukandengan kondisirusakberatdanrusakringan.Halinimembuat nelayan-nelayan di Desa Pasar Terandam Barus hinggakemarinbelumpergimelaut. SaatinicuacadiBarusmasihrawansehinggawarga tetap waspada kemungkinan akan datang banjir susulan.

berteriak minta tolong karena melihat korban tenggelam. Teriakan kedua temannya mengundang perhatian warga sekitar. Namun sayang, korban yang tenggelam dan terbawa arus sudah tidak terlihat. Warga yang memadati lokasi kejadian, terus berupaya melakukan pencarian bocah malang tersebut. Hingga setengah jam kemudian, korban akhirnya berhasil ditemukan dalam kondisi sudah tidak bernyawa. Dibantu pihak sekolah, jenazah korban langsung dibawa kerumah duka untuk disemayamkan. Sekadar diketahui, semasa hidupnya korban dikenal sebagai sosok yang pendiam dan tidak suka keluyuran. Hanya saja saat itu, korban justru ikut ajakan teman-

Departemen Redaksi METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput) METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) METRO ASAHAN

temannya untuk pergi mandi di lokasi banjir tersebut. Kini jenazah anak ketiga dari empat bersaudara pasangan Tukiran dan Atik, yang tinggal di Lingkungan III, Desa Payamabar, Kecamatan Stabat, Langkat ini, sudah dibawa ke rumah duka untuk disemayamkan. Rencananya jenazah korban dikebumikan besok (hari ini-red), guna menunggu kepulangan Tukiran bapak kandungnya yang berangkat kerja merantau ke Aceh. “Sudah sering saya larang anak-anak kami ini supaya jangan pergi dan mandi-mandi di lokasi banjir itu, tapi kalau sudah kejadian seperti ini ya mau dibilang bagaimana lagi dan ini sudah bukan tanggung jawab kami,” kata salah seorang guru olahraga.

Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Eva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Online Website: Hotland Dolok Saribu, Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Efendi Tambunan, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Nico , Ardi, Roy Amarta. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

Kepala SD Negeri 053974, Mimi Fariza, saat dikonfirmasi terkesan cuek. Namun ia ikut membenarkan ada siswa di sekolahnya yang tewas tenggelam di lokasi banjir tersebut. Sebelum kejadian ini, ia mengaku memang sudah punya rencana untuk membangun tembok batas sekolah dengan lokasi banjir. Sehingga tidak sampai menimbulkan korban jiwa. Sayangnya, rencana itu belum terealiasasi. “Kalau mau penjelasan lebih lengkap tentang kejadian ini, tanya saja langsung sama keluarganya atau sama guru-guru di sekolah. Karena saya masih dua minggu bertugas di sini. Meskipun begitu, kalau bisa jangan dibuat beritanya,” cetus Mimi Fariza. (dn)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


28 September 2012

Tingkatkan Mutu Kesehatan

Siswa Berprestasi Peroleh Beasiswa Sambungan halaman 8 Batang Toru, Mts Syekh Ahmad Basir Parsariran, SMAN 1 Batang Toru, SMKN 1 Batang Toru dan Madrasah Aliyah Nahdatul Ulama Batang Toru. “Inilah salah satu bukti jika PTPN menilai pendidikan sebagai hal yang penting bagi kehidupan manusia, karena mampu membuka jendela pengetahuan dunia yang digunakan sebagai ilmu membangun bangsa dan Negara. Kemajuan dunia pendidikan adalah tanggung jawab bersama antar pemerintah, perusahaan dan masyarakat luas,” terangnya. Diharapkannya, program beasiswa ini dapat meningkatkan prestasi akademik para anak didik sekaligus mampu mempererat hubungan antara masyarakat dengan PTPN III yang selama ini terjalin dengan baik. “Moga beasiswa ini memperkokoh tali silaturahmi antara PTPN III dengan masyarakat dan mampu meningkatkan motivasi para siswa untuk dapat lebih berprestasi kedepan,” harapnya. (int)

Pengamen Ala...

Sambungan halaman 8 menyebutkan, kerjasama merupakan upaya mewujudkan program yang sinergis di bidang kesehatan dalam rangka mengingkatkan kualitas pelayanan kesehatan kepada masyarakat. Tujuan SK 5 kerpala daerah ini, untuk meningkatkan mutu pelayanan kesehatan dan

derajat kesehatan masyarakat yang dapat dilakukan secara bersama-sama tanpa terhambat oleh batas wilayah adminsitrasi. Soal ruang lingkup, sesuai keputusan bersama tersebut meliputi bidang promosi kesehatan dan pemberdayaan masyarakat dan lingkungan sehat, upaya peningkatakan pelayanan kesehatan masyarakat dan perorangan khususnya bagi masyarakat

miskin, berbatasan dan tertinggal khususnya masyarakat yang tidak ditampung dalam program Jamkesmas. Kemudian, pencegahan dan pemberantasan penyakit dan perbaikan gizi masyarakat, obat dan perbekalan kesehatan, sumber daya kesehatan dan manajemen serta kebijakan kesehatan. Seterusnya, penanggulangan penyakit akibat bencana, pelatihan dan simulasi penanganan

(penyakit menular, bencana, gizi buruk dan pelayanan kesehatan), penyusunan prosedur tetap penanganan (penyakit menular, bencana, gizi buruk dan pelayanan kesehatan), mobilisasi tenaga medis (medis dan para medis), obat dan perbekalan, mobilisasi sarana dan prasarana kesehatan (pemerintah dan swasta) serta penerimaan dan pendistribusian bantuan. (neo/mer)

Produk Kerajinan Dekranasda Terkendala Pemasaran Sambungan halaman 8 masaran, sejumlah industri kerajinan yang terbuat dari eceng gondok tidak mendapat tempat serta tidak berkelanjutan perkembangannya. Padahal potensi bahan baku untuk memproduksi beragam souvenir, seperti tas, topi dan berbagai anyaman lain yang terbuat dari eceng gondok, sangat berlimpah dalam jumlah yang cukup besar di wilayah setempat. Selain itu, lanjutnya, para pengambil kebijakan di kabupaten berjarak sekitar 248 kilometer dari Kota Medan, ibu kota

provinsi Sumatera Utara itu perlu memberdayakan para perajin yang mampu memproduksi bermacam hasil karya industri rumahan itu, mengingat keberadaan eceng gondok yang banyak tersebar di sekitar perairan danau Toba. “Instansi terkait perlu melakukan survei dalam upaya untuk mencari solusi terbaik, mengingat selama ini masih banyak perajin yang pendapatannya sangat kecil, sehingga mereka kurang meminati industri kerajinan dimaksud,” ujar Arigato. Sementara itu, Nelly Andon Sitorus, seorang konsultan pada Royal Bank of Scotland

yang tinggal di London, menyebutkan, dirinya sangat berkeinginan membantu memasarkan hasil industri kerajinan masyarakat Tobasa itu hingga ke luar negeri, terutama berbagai produk souvenir berbahan baku eceng gondok. Menurut dia, tim dari Project Heart Tapanuli yang digagasnya, akan berupaya secara maksimal membangkitkan semangat para perajin di daerah tersebut, melalui pelatihan dan workshop yang mereka rencanakan digelar pada Sabtu (20/10) di rumah belajar Desa Lumbanlobu Kecamatan Bonatualunasi, den-

gan melibatkan sejumlah siswa Sekolah Menengah Industri Kerajinan Kabupaten Tobasa. Nelly menyatakan, bersama sejumlah dermawan yang perduli, pihaknya mencoba untuk berbagi dalam melakukan proyekproyek kecil, sebagai bakti diri guna memajukan kampung halaman (Bonapasogit). “Kami sangat tertarik untuk mengadakan seminar sederhana, yang mungkin mampu membangkitkan kembali semangat para perajin serta akan memotivasi mereka menggalakkan industri kerajinan di daerah Tobasa,” katanya. (ant/int)

Sambungan halaman 8 jalanan atau yang lazim disebut anak-anak punk itu berdasarkan adanya laporan dari masyarakat yang resah dengan keberadaan mereka. “Ada laporan dari masyarakat terkait keberadaan para pengamen jalanan bergaya anak-anak punk itu kepada kita. Dimana penampilan mereka yang urakan dinilai mengganggu kenyamanan warga baik yang sedang bersantai atau sarapan di sejumlah warung yang ada di Kota Sibolga,” ujar Singkat. Selain itu, sambung Singkat, penangkapan terhadap para pengamen jalanan ini juga sudah menjadi tugas rutin yang sudah diprogramkan oleh Sat Pol PP Kota Sibolga guna mengantisipasi keberadaan para pengamen, gelandangan, pengemis dan lainnya. “Sehingga laporan dari masyarakat terkait keberadaan anak-anak punk ini langsung kita respon dan hal itu juga sudah menjadi agenda yang sudah diprogramkan,” pungkasnya. Tak hanya itu, sambung Singkat, pihaknya juga tetap melakukan razia atau pengawasn terhadap para pegawai di lingkungan Pemko Sibolga yang masih terlihat berkeliaran saat jam kerja, dan juga menertibkan anak-anak sekolah yang bermain internet disaat jam belajar sedang berlangsung. “Kami berharap, agar hal ini menjadi perhatian kita bersama dan kami tegaskan agar para pengamen jalanan, para pegai dan pelajar,”tegasnya.untuk . Begitupun, kata Singkat, pihaknya hingga saat ini masih memberikan arahan dan bimbingan kepada meeka, dan sekaligus menyatrankan agar para pengamen jalanan itu masing-masing kembali ke kampung halanannya. “Kita memberikan kepada ketiganya dalam waktu 3 hari ini untuk meninggalkan Kota Sibolga. Untuk itu, kami berharap agaragar pengamen jalanan lainnya yang ada untuk meninggalkan kota Sibolga,” teganya. Menurut Singkat, ketiga pengamen jalanan yang tertangkap pihaknya itu bukanlah warga Kota Sibolga namun dari daerah luar, bahkan dari luar Pulau Sumatera. “Ketiga pengamen yang kita tangkap yakni, Roni warga Jalan Tegal Lega Dumai, Franly warga Jalan Sukarno Hatta Tanjung Pinang dan Bambang yang mengaku sebagai warga Bandar Hapinis, Tapanuli Selatan,” tandas Singkat.(tob/nasa)

Urus SKTPDP Dikutip Rp250 Ribu Sambungan halaman 8 mengurus Surat Keterangan Tidak Pernah Dipidana Penjara (SKTPDP). “Kami dipungut biaya Rp250 ribu untuk mengurus SKTPDP ke PN Tarutung untuk persyaratan menjadi onggota PPK. Pegawai yang mengutip itu marga Sinaga,” kata Untung Parsaoran Sitinjak, salah seorang anggota PPK Kecamatan Tarutung, Kamis (27/9). Dijelaskan, sebelumnya dia bersama temannya sesama PPK sepakat mendatangi kantor PN Tarutung untuk mengu-

rus SKTPDP. “Salahsatu syarat melamar PPK kan SKTPDP. Makanya kami ramairamai mengurusnya. Begitu pengurusan, kami dikenai biaya Rp250 ribu. Terus terang kami keberatan dan membatalkan mengurusnya,” akunya. Senada disampaikan PPK lainnya, R Manalu. Dia mengatakan, pungutan itu diminta langsung oleh petugas administrasi PN Tarutung. “Mengetahui pengurusan itu dibebani biaya, kami langsung menghentikan pengurusan itu, karena menurut kami pungutan itu tidak pantas dilakukan oleh

lembaga pemerintah,” sebutnya. Mereka berharap pihak pengadilan dapat memberi penjelasan atau data akurat secara tertulis tentang biaya-biaya yang harus dikeluarkan oleh masyarakat dalam pengurusan Surat Keterangan Tidak Pernah Dipidana Penjara selama 5 tahun tersebut. Terpisah, Humas Pengadilan Negeri Tarutung Relson Muliadi Nababan SH dikonfirmasi METRO terkait adanya kutipan mengurus SKTPDP tersebut mengaku belum mengetahui adanya pungutan itu.

Namun dia menegaskan, dalam pengurusan surat keterangan tidak pernah dipidana penjara dengan ancaman 5 tahun lebih, tidak ada dibebankan biaya administrasi kepada warga. “Secara prosedur resmi, kita tidak ada membebankan biaya apapun kepada warga dalam pengurusan administrasi seperti itu. Tapi nanti akan saya cek, dan informasi ini menjadi koreksi bagi kami. Tolong juga diberitahukan kepada kami siapa petugas pengadilan meminta biaya administrasi itu,” ujarnya. (cr-01/des)

Pengusaha Warung Makan Keluhkan Biaya Pajak & Retribusi Sambungan halaman 8 anan kepada masyarakat yang dibebani pajak atau restribusi. Penyusunan peraturan daerah tentang besaran pungutan yang diwajibkan kepada pengusaha jangan terlalu memberatkan,” sebut Hartoyo. Jika besaran pungutan pajak dan retribusi terlalu berat, maka akan terjadi keluhan-keluhan dari masyarakat atau pengusaha kecil. ”Pengusaha rumah makan tidak semua modalnya sama. Ada modal kecil. Jadi, kalau pungutan yang dibebankan tidak berdasarkan angka netral, maka kewajiban yang dibebankan kepada pengusaha kecil setiap tahunnya akan memberatkan dan dinilai tidak adil,” jelasnya. Untuk itu, kategori retribusi maupun pajak yang dikenakan pemda harus dibedakan. “Yang mana disebut restoran, warung nasi dan jenis warung lainnya. Tentu, biaya retribusi dan pajaknya harus dibedakan dalam perda,” papar Hartoyo. Amatan METRO, pengusaha Rumah Makan Mariboto, Nursani boru Hutagaol, yang membuka usahanya di Jalan Pematangsiantar KM 2.7 Kota Balige, hanya memiliki empat buah meja makan saja. Namun, Nursani mengaku harus mem-

bayar pajak dan restribusi kepada Pemkab Tobasa senilai Rp1 juta. Padahal, ia mengaku pengunjung ke rumah makan miliknya sepi. Sembari menunjukkan bukti-bukti kwitansi pembayaran pajak dan retribusi, Nursani merinci, untuk pajak restoran yang dipungut Dinas Pendapatan Tobasa senilai Rp600 ribu per tahun. Untuk biaya izin restoran yang dipungut Dinas Pariwisata Tobasa, dikenai biaya Rp200 ribu per tahun. Sedangkan Rp200 ribu lagi, dipungut oleh Kantor Camat Balige dengan mengatasnamakan izin gangguan. “Belum lagi harus meladeni kutipankutipan sumbangan dari berbagai pihak. Sebenarnya sangat berat beban yang harus dibayarkan. Saya sadar harus membayar pajak dan retribusi. Tapi saya juga kan harus membayar tagihan-tagihan lainnya? Seperti air dan listrik. Untuk itu, saya memohon agar pemerintah memerhatikan nasib kami,” kata Nursani. Terpisah, Dasril, pengusaha Rumah Makan Roby Minang yang membuka usahanya di Desa Sitolu Ama, Kecamatan Laguboti mengaku, Dinas Pendapatan dan Kantor Camat Laguboti, setiap tahunnya menagih biaya sekitar Rp560 ribu per tahunnya.

”Kepada Dinas Pendapatan harus membayar Rp360 ribu per tahun. Sedangkan ke Kantor Camat Laguboti Rp200 ribu per tahun. Tapi dari Dinas Pariwisata tidak ada,” imbuh Dasril. Senada diungkapkan pengusaha Rumah Makan Sudi Mampir, Waginah di Desa Sitolu Ama, Kecamatan Laguboti. Padahal, pemilik usaha itu hanya bermodalkan meja dan kursi makan yang sudah lapuk. ”Saya juga harus bayar Rp560 ribu setiap tahunnya ke Dinas Pendapatan dan Kantor Camat Laguboti,” aku Waginah. Dasril dan Waginah berpendapat, pajak dan retribusi yang dikenakan Pemkab terlalu memberatkan untuk mereka tanggung. ”Usaha saya ini seperti kata orang, hidup segan mati tak mau. Saya hanya bertahan untuk menghidupi keluarga saja. Saya juga harus bayar kontrakan rumah ini sebesar Rp6 juta per tahun. Belum lagi biaya tagihan yang lainnya. Kasihani lah kami pengusaha kecil-kecil ini,” kata ibu Wagina memelas. Washinton Pangaribuan, Kabid Pendapatan pada Dinas DPPKD (Dinas Pendapatan dan Pengelola Kekayaan Daerah) yang ditemui METRO, Selasa (25/9) di Gedung DPRD Tobasa menjelaskan, bahwa pungutan-pungutan tersebut berdasarkan Perda

No 1 Tahun 2012 tentang Pajak Daerah, Perda Nomor 7 Tahun 2010 tentang restribusi pemakaian kekayaan daerah, Perda Nomor 6 Tahun 2010 tentang pelayanan persampahan dan kebersihan, serta Perda Nomor 8 Tahun 2010 tentang restribusi pelayanan pasar umum. Ditanya tentang adanya pungutan yang dilakukan oleh Dinas Parawisata, Washinton menjelaskan, bahwa itu adalah wewenang berdasarkan Perda Nomor 9 Tahun 2001 tentang izin usaha rumah makan dan/atau restoran. ”Tapi saat ini Kabupaten Toba Samosir dalam hal penagihan atau pembayaran biaya perizinan telah dilakukan dalam satu pintu, yakni oleh Badan Perizinan Terpadu Dan Penanaman Modal. Tapi baru efektif pada bulan Agustus lalu. Ke depan Dinas Parawisata tidak berwenang lagi memungut itu,” jelas Washinton. Ditanya lagi, bagaimana pihaknya menentukan kriteria-kriteria penetapan retribusi dan pajak tersebut, dia mengatakan, semua ada atuarannya. ”Kami memakai sistem Self Assesment yang artinya, kami memberikan sejenis lembaran isian yang harus diisi oleh pengusah tersebut. Berdasarkan lembaran itu, kami menentukan apakah dia dibebankan ke restoran atau lainnya,” jelasnya. (brams/hsl)

SAMBUNGAN METRO TABAGSEL Nisan pun Padukan Kutipan Alquran dan Simbol Agama Lain Sambungan Halaman 1 ternyata memang hanya ada tiga orang di masjid tersebut. Jadilah, kami salat hanya bertiga. Bukan karena saat Ashar masih banyak jemaah yang bekerja. Sebelum salat, Huang memang sempat bercerita, masjid besar itu terasa semakin ”besar” karena sepinya jamaah yang mendirikan salat di sana setiap hari. ”Saat salat Jumat pun jemaahnya tidak lebih dari 80 orang. Itu pun sudah ditambah warga asing yang tinggal di sini. Di hari-hari biasa, jumlah jemaahnya bahkan tidak lebih dari hitungan jari sebelah tangan, apalagi yang di kampung-kampung,” kata Huang. Itulah potret muslim di Quanzhou saat ini. Padahal, kota yang terletak di bagian selatan Provinsi Fujian itu memegang peran penting dalam sejarah masuk dan perkembangan Islam di Tiongkok. Di kota itulah terdapat Pelabuhan Zaitun yang menjadi pertemuan pedagang dari berbagai bangsa dan negara. Dari pelabuhan itu jugalah, tokoh legendaris muslim Tiongkok Laksamana Cheng Ho (ada yang menulis Zeng He) mengawali pelayaran ke

lima dari tujuh pelayaran keliling dunia. Pelaut sekaligus pedagang asal Maroko Ibnu Battuta yang begitu terpesona dengan kebesaran Pelabuhan Zaitun juga memutuskan menetap di kota tersebut. Untuk menghormatinya, pemerintah Kota Quanzhou pun mendirikan patungnya di Museum Islam kota itu. Patung tersebut didirikan di dekat pintu masuk museum tersebut. Dengan begitu, siapa saja yang berniat masuk dan belajar di museum tersebut langsung melihatnya. Itu memperlihatkan betapa istimewanya posisi Ibnu Battuta bagi Quanzhou. Sebagian besar koleksi di museum itu adalah batu-batu nisan keluarga Ibnu Battuta yang dimakamkan di Quanzhou. Selain nama jenazah, di batu-batu nisan tersebut juga terpahat petikan beberapa ayat Al Quran atau hadis. Yang menarik, bentuk makam muslim sebagaimana yang terlihat dalam museum tersebut sangat mirip dengan makam Tionghoa yang dikenal di banyak daerah di Indonesia. Selain batu nisannya yang besar, juga terdapat pagar batu yang tidak terlalu tinggi. Secara total, persentase komunitas

muslim di China memang kecil. Hanya sekitar 1,5 persen dari seluruh penduduk China. Namun, mengingat jumlah penduduk negeri itu yang sudah lebih dari 1,4 miliar jiwa, secara hitungan orang per orang jumlah muslim China pun menjadi cukup besar. Sensus terakhir menunjukkan, muslim China mencapai 21,6 juta jiwa. Lebih banyak daripada negara yang kental nuansa Islamnya, Malaysia. Muslim di Malaysia mencapai 17 juta. Selain presentasinya yang kecil, distribusi muslim Tionghoa yang menyebar hampir di seluruh provinsi di China menjadikan mereka tidak terlihat dominan. Kecuali di wilayah otonomi khusus Xinjiang yang memang mayoritas penduduknya muslim. Juga Provinsi Qinghai yang persentase muslimnya berimbang dengan etnis Tibet yang beragama Buddha Tibet. Demikian juga di wilayah otonomi khusus etnis Hui di Ningxia. Etnis Hui adalah etnis yang mayoritas warganya beragama Islam. Bahkan, etnis Hui selalu dikaitkan dengan Islam dan dianggap beragama Islam. Sementara di Xinjiang, mereka yang beragama Islam

adalah etnis Uyghur. Di provinsi-provinsi lain, persentasenya begitu kecil sehingga nyaris tidak terlihat. Meski begitu, jejak Islam bisa dirasakan di China. Itu tidak lepas dari posisi strategis China di rute perdagangan kuno Jalur Sutera, baik rute darat maupun laut. Jalur Sutera darat yang melewati Asia Tengah menyentuh dan mewarnai China di sisi barat laut. Jalur Sutera laut bersinggungan dengan China Selatan dan Timur. Lewat rute laut itulah, Kota Quanzhou di Provinsi Fujian bersinggungan dengan sejarah perkembangan Islam. Meski saat ini jumlah muslim di Kota Quanzhou tidak terlalu banyak, banyak tapak sejarah Islam yang masih bisa dilihat di sana. Masjid Qinjing merupakan salah satu ikon peninggalan muslim di kota berpenduduk lebih dari 6 juta jiwa tersebut. Arsitektur masjid yang dibangun pada 1009 tersebut mirip dengan masjid di negeri-negeri Timur Tengah. Misalnya yang ada di Kota Damaskus, Syria. Ini beda dengan sebagian besar masjid di China yang dibangun dengan arsitektur setempat yang sekilas lebih mirip dengan

Dedi-Affan Diyakini Mampu Kembangkan Home Industri

Sambungan Halaman 1

visi-misi pasangan calon dan mengikuti sepak terjang mereka dalam rentang waktu beberapa bulan terakhir. Saya menilai pasangan DediAffan lebih serius dan dalam konteks ekonomi akan bisa mengembangkan industri rumah tangga,” ujar Heddy Raja Dalimunthe SH yang intens mememerhatikan masalah sosial, ekonomi dan pembangunan di Kota Psp. Menurut pria berkaca mata ini, industri rumah tangga harus dikembangkan. Selain sistemnya tidak tergolong padat modal, industri rumah tangga juga cocok dengan tipikal masyarakat Psp. Apalagi

banyak kaum ibu yang memang memiliki keahlian. Beberapa contoh industri rumah tangga yang cocok dikembangkan itu adalah kerajinan tangan, jahitmenjahit, dan juga produksi beragam makanan, seperti keripik ubi, karak koling (lapan-lapan) dan alame (dodol). “Umumnya kaum ibu di Psp ini bisa mengerjakan salah satu hal di atas. Tapi sayang, selama ini mereka dilupakan dan tidak dibina. Padahal kalau ini diseriusi, ibu-ibu akan memiliki kesibukan dan pekerjaan yang mampu menopang ekonomi keluarganya. Jadi, dalam hal ini, saya yakin Dedi-Affan akan menyentuh

dan menyeriusi bidang home industri ini,” papar Heddy yang juga berprofesi sebagai advokat ini. Komitmen pasangan Dedi-Affan untuk mengembangkan pemberdayaan ekonomi keluarga sering tercetus ketika mereka melakukan pertemuan dengan masyarakat. Melihat jaringan yang dimiliki pasangan tersebut, diyakini juga komitmen tersebut akan bisa mereka lakukan jika kelak mereka diberi amanah menjadi pemimpin di Psp. “Jika home industri sudah berkembang, maka lapangan kerja dengan sendirinya akan bertambah. Inilah yang sudah disadari DediAffan, dan saya yakin mereka akan

memegang komitmen itu,” cetusnya. Lebih jauh Heddy juga mengatakan salah satu tugas berat Walikota dan Wakil Walikota Psp mendatang adalah membangkitkan dan meningkatkan perekonomian keluarga. Sebab, hingga hari ini masih banyak keluarga yang belum berdaya dan tingkat perekonomiannya masih rendah dan ini berimbas kepada kualitas hidup. Karena itu, masyarakat Psp diminta tidak salah pilih lagi. Dalam artian, tambah Heddy, masyarakat harus memilih figur yang serius dan juga diyakini mampu mengembangkan perekonomian keluarga. (rel/neo)

kelenteng di Indonesia. Termasuk Masjid Akbar Xi’an yang konon merupakan masjid terbesar di China. Karena keunikannya tersebut, Pemerintah Kota Quanzhou menjadikannya sebagai objek wisata. Banyak warga setempat dan juga warga dari kota lain mengunjungi masjid tersebut. Tentu saja bukan untuk salat, namun berwisata. Untuk sekali masuk ke masjid tersebut, pengunjung harus membeli karcis sebesar CNY (China Yuan) 3 (sekitar Rp4.500). Yang perlu diperhatikan, pengunjung dilarang memasuki masjid. Bahkan, di saat sedang berlangsung salat, mereka dilarang masuk sama sekali. Keunikan lain Masjid Qinjing itu juga disadari saya setelah menjalankan salat. Ketika Huang dan Ma masih berdoa, saya keluar terlebih dahulu. Begitu sampai di pintu, tampak tempat dupa persis di depannya. Masih ada tiga batang dupa menancap. Belakangan saya tahu bahwa meski memeluk Islam, mereka tetap menjalankan beberapa ritual Khong Hu Cu. Salah satunya mendoakan leluhur dengan membakar dupa. Bagi mereka, Khong Hu Cu lebih dianggap sebagai budaya daripada agama. (*)

Tangisan Anak Warnai Pemakaman Sambungan Halaman 1

Pantauan METRO, ambulans yang membawa korban dari Pematangsiantar langsung memasuki pemakaman keluarga tanpa disemayamkan di rumah duka terlebih dahulu karena sudah bau. Saat penguburan, keluarga dan anak-anak korban terus menangis. “Kita tidak bisa menahan jenazah ini lama-lama. Karena kondisinya tidak memungkinkan dan sudah bau,” kata I Manullang, salah seorang keluarga korban. Penguburan pun hanya disaksikan keluarga dekat dan pihak kepolisian yang membawa mayat setelah diotopsi dari Pematangsiantar. Acara penguburan hanya dilakukan sederhana tanpa acara

khusus seperti layaknya pemakaman biasa. Sementara Tiara, anak sulung korban hanya dapat mengelus air mata, diiringi isak tangis yang sekali-kali menyebutkan “ibu” diikuti ketiga adik-adiknya yang masih sangat kecil-kecil di samping seorang wanita yang turut menangisi jenazah korban. “Saya mau pembunuh ibu kami segera ditangkap dan dijatuhi hukuman sepantasnya,” ucapnya seraya mengusap airmatanya. untuk diketahui, korban meninggalkan empat orang anak. Di antaranya, tiga perempuan dan satu lakilaki yang masih berusia satu tahun. Sekarang keempat anak korban tinggal bersama oppungnya. (jona/des)


28 September 2012

Tingkatkan Mutu Kesehatan 5 KDH se-Tabagsel Gelar Pertemuan Regional SIDIMPUAN- Salahsatu kebutuhan utama masyarakat adalah pelayanan kesehatan yang baik dan bermutu. Sayangnya, harapan tersebut masih belum sempurna diperoleh oleh masyarakat. Kadang, masyarakat menghiba dan seperti mengemis kepada pemerintah untuk memeroleh pelayanan, apalagi masyarakat dari keluarga miskin.


PERTEMUAN- Pertemuan 5 daerah lintas batas se-Tabagsel yang membahas bidang kesehatan yang bertujuan meningkatkan mutu pelayanan dan derajat kesehatan masyarakat yang dilakukan bersama-sama tanpa terhambat batas wilayah adminsitrasi, Rabu (26/9).

Siswa Berprestasi Peroleh Beasiswa Dari PTPN III Distrik Tapsel TAPSEL- Para siswa-siswi berprestasi tingkat SD,SMP dan SMA sederajat memeroleh besosiswa dari PTPN III Kebun Batang Toru Distrik Tapanuli Selatan (Tapsel). Bantuan ini merupakan bentuk kepedulian perusahaan

perkebunan di bidang pendidikan. Demikian disampaikan Asisten Personalia Kebun Batang Toru Edi S Ginting kepada wartawan di Padangsidimpuan, baru-baru ini. Dijelaskan, total bantuan yang disalurkan bagi siswa berprestasi disekitar perkebunan PTPN III Bt Toru itu senilai

Rp94.000.000 yang disalurkan kebeberapa sekolah antara lain, SD Negeri 101210 Aek Pining, SD Negeri 101140 Batang Toru. Selanjutnya, SMPN 1 Batang Toru, SMPN 2 Batang Toru, Mts Negeri

„ Baca Siswa Hal 7

Pengusaha Warung Makan Keluhkan Biaya Pajak & Retribusi


RUMAH MAKAN: Salahsatu rumah makan di Desa Sitolu Ama, Kecamatan Laguboti, Kabupaten Tobasa yang dikenakan biaya pajak dan retribusi restoran.

BALIGE- Pendapatan Asli Daerah (PAD) adalah salah satu sumber pembiayaan pembangunan daerah. Oeh karenanya, pemerintahan daerah diharapkan dapat membuat terobosan-terobosan baru yang dapat mengembangkan perekonomian masyarakat yang tentunya akan berimbas kepada peningkatan PAD tersebut. Demikian dikatakan Sekretaris DPD Komisi Nasional Pengawas Aparatur Negara (Komnas Waspan) Kabupaten Toba Samosir Hartoyo S H Sipahutar kepada METRO di Balige, Selasa (25/9). ”Dalam hal pencapaian peningkatan PAD, harus dibarengi dengan peningkatan pelay-

„ Baca Pengusaha Hal 7

Produk Kerajinan Dekranasda Terkendala Pemasaran BALIGE- Produk kerajinan yang dihasilkan Dewan Kerajinan Nasional Daerah Kabupaten Tobasa, saat ini terkendala dalam bidang pemasaran, akibat minimnya promosi sehingga tidak mampu bersaing di pasaran, baik dalam maupun luar negeri. “Kami berharap satuan kerja yang terkait, seperti Koperasi dan Dinas Peindustrian Per-

Urus SKTPDP Dikutip Rp250 Ribu TARUTUNGSejumlah Panitia Pemilihan Kecamatan (PPK) Pilgubsu „ Relson Nababan yang dinyatakan lulus oleh KPU Taput, mengaku dikutip sebesar Rp250 ribu oleh Pengadilan Negeri (PN) Tarutung saat

„ Baca Urus Hal 7

dagangan serta para pelaku Pariwisata lainnya mampu melakukan terobosan-terobosan dalam membantu meningkatkan produksi maupun pemasaran hasil kerajinan dari Dekranasda setempat,” kata staf Dekranasda Toba Samosir Arigato Simanjuntak di Balige, Selasa (25/9). Hingga kini, kata dia, kelemahan terbesar bagi sejumlah

perajin yang ada di Kabupaten berpenduduk sekitar 175.277 jiwa itu, salah satunya adalah masalah pemasaran. Sehingga sektor dimaksud dinilai tidak menjanjikan, karena dianggap belum mampu meningkatkan kesejahteraan dan kehidupan masyarakat yang memilih profesi tersebut sebagai sumber mata pencaharian pokok. Ia menjelaskan, akibat kurangnya pe-

„ Baca Produk Hal 7

Sepakat baha mutu pelayanan mutu kesehatan perlu ditingkatkan, Lima daerah seTapanuli Bagian Selatan (Tabagsel) Rabu (26/9) kemarin menggelar pertemuan regional lintas batas di bidang kesehatan. Rapat ini merupakan tindak lanjut Keputusan Bersama 5 kepala daerah (KDH) yakni Bupati Tapsel, Bupati Madina, Walikota Psp, Bupati Paluta dan Bupati Palas pada tertanggal 15 Desember 2011 lalu, tentang Kerjasama Antar Daerah (Lintas Batas) di Bidang Kesehatan Kabupaten Tapsel, Madina, Kota Psp, Kabupaten Paluta dan Palas. Rapat yang digelar di ruang Beringin Kantor

Bupati Tapsel, di Jalan Kenanga, Kota Psp, dibuka Bupati Tapsel, H Syahrul M Pasaribu diwakili Asisten I, Aswad Daulay, dihadiri mewakili Bupati 5 daerah, anggota DPRD, tim work kesehatan dari Propinsi Sumut yaitu dr Nasroel Siregar SKM, drs Amir Hood APt, Drs Smru Nasution Mkes, dr Azwar Lubis, Gayo Nelkior Gultom SH Mkes, Kholikul Kamal SKN dan Swandi Simanjuntak SKM Mkes, para Kadiskes seTabagsel seperti Kadiskes Tapsel, dr Alisyahbana Siregar SP THT serta lainnya. Ketika pembuatan Surat Keputusan (SK) lima kepala daerah tersebut disaksikan Plt Gubsu, Gatot Pudjo Nugroho ST. SK

Pengamen Ala Anak Punk Dirazia SIBOLGA- Dianggap meresahkan masyarakat, sebanyak 3 orang pengamen jalanan ala anak punk digelandang petugas Sat Pol PP Kota Sibolga, Kamis (27/9). Ketiga pengamen jalanan ala anak punk itu ditangkap di dua tempat berbeda yakni di kawasan Pelabuhan Lama Sibolga dan emperan salah satu hotel di kawasan taman bunga Kota Sibolga. Kasat Pol PP Kota Sibolga Singkat Sijabat SSos kepada METRO mengatakan, penangkapan terhadap 3 pengamen

„ Baca Pengamen Hal 7


PENGAMEN JALANAN: Petugas Sat Pol PP Kota Sibolga saat melakukan pendataan terhadap ke tiga pengamen jalanan ala anak Punk yang tertangkap, Kamis (27/9) di Sibolga.


28 September 2012


6 Calon Sepakat Tak Lakukan Isu SARA SIDIMPUAN- Keenam pasangan Calon Walikota dan Calon Wakil Walikota peserta pemilukada Kota Psp tahun ini untuk menjaga kondusifitas keamanan dan ketertiban daerah selama pesta demokrasi berlangsung. Kemudian membantu Kapolres Psp dalam menciptakan suasana aman, tertib, dan tenteram di tengah-tengah masyarakat. Demikian imbauan Kapolda Sumatera Utara (Kapoldasu), Iren Pol Drs Wisjnu Amat Sastro SH pada acara tatap muka dengan Walikota Psp, muspida plus, KPU, Panwaslu Kada, pasangan Calon Walikota dan Wakil Walikota, pimpinan Perguruan Tinggi (PT), pimpinan SKPD, camat, lurah, kepala desa, kepala lingkungan, (FOTO:IST)

„ Kapoldasu, Irjen Pol Drs Wisjnu Amat Sastro, bersama Walikota Psp, Kapolres Psp, unsur muspida Psp, KPU, Panwaslu Kada, dan enam pasangan Calon Walikota dan Calon Wakil Walikota diabadikan usai penandatanganan MoU pemilukada damai di auditorium STAIN Psp, Kamis (27/9).

„ Chaidir bercengkrama dengan warga di lopo Simpang Silandit.


Oleh : Arifin Saleh Siregar Dosen Fisip UMSU

Tapi, tanpa sadar topik diskusi justru bergeser ke soal kriteria, syarat-syarat dan kekuatan yang harus dimiliki Walikota Psp ke depan. Masing-masing peserta diskusi melontarkan kriteria yang diikuti dengan argument dan diperkuat dengan alasan-alasan yang masuk akal. Saya pun ikut larut dalam topik ini hingga diskusi usai. Dalam perjalanan pulang, saya akhirnya menyimpulkan setidaknya ada 4 syarat atau kekuatan yang harus dimiliki pemimpin Psp ke depan. Mengapa 4? Mengapa bukan 5, 6, atau 3? Saya tidak ingin berdebat soal angka. Kalau

Pemilukada Diharapkan Melahirkan

Chaidir Sapa Warga dengan Ramah

Pemimpin yang Sayang kepada Rakyat

SIDIMPUAN-Calon Walikota Padangsidimpuan nomor urut 6, Ir H Chaidir Ritonga MM menyambangi dan menyapa warga Kota Psp dengan ramah dan santun diberbagai sudut Kota Psp. Hal semacam ini telah menjadi kebiasaannya setiap pulang ke kampung halamannya (Kota Psp) tersebut. Amatan METRO, Senin (24/9), pimpinan DPRD Provinsi Sumatera Utara tersebut menyambangi warga yang sedang nongkrong di warung Simpang Silandit, Kecamatan Psp Selatan. Dengan baju khas putih begaris hitam di leher dan bagian depan dengan celana hitam dan kaca mata yang jarang terlepas, figur calon pemimpin Kota Psp tersebut tampak bebaur dengan santai sambil minum, berkenalan satu sama lainnya serta berbincang-bincang dengan masyarakat yang

SIDIMPUANPemilukada Kota Padangsidimpuan (Psp) di tanggal 18 Oktober mendatang diharapkan dapat melahirkan calon pemimpin yang betulbetul sayang „ Dedi Jaminsyah kepada rakyat. “Kota Psp ini milik kita bersama. Kita tentu berharap, siapapun nantinya yang

ada di dalam warung. “Au goarku Chaidir Ritonga anggia, hamu ahade margamunu, rap minum majo dohot kium-kium dison, (nama saya Chaidir Ritonga saudaraku, kalian apa gerangan marganya, kita sambil minum ya),” katanya sambil menyalami warga di lopo (kedai) tersebut. Setelah berbincang sekitar 20 menit, Chaidir pun pamit pada warga, sambil berlalu dengan mobil Hyundai, Chaidir mengucapkan terima kasih. Masyarakat pun membalasnya dengan lambaian tangan penuh keakraban. Semoga sikap merakyat, santun dan ramah tersebut tetap diterapkannya jika terpilih menjadi Walikota Psp untuk mewujutkan Sidimpuan yang lebih baik dan bermartabat dimasa mendatang. (ran)

EMPAT KEKUATAN PEMIMPIN SIDIMPUAN KE DEPAN Judul di atas terinspirasi usai diskusi tentang pemilukada Psp 2012, Senin (24/9) lalu di salah satu sisi Pendopo USU, Padang Bulan, Medan. Diskusi dengan beberapa mahasiswa asal Psp yang kuliah di berbagai Perguruan Tinggi (PT) di Medan itu awalnya lebih fokus terhadap track record (jejak rekam) masing-masing pasangan calon.

‹ Baca 6 Calon ...Hal 10

pun ini mau dikaitkan dengan nomor urut pasangan calon dalam pemilukada Psp, terserah saja. Saya tidak ikut-ikutan. Lantas, apa saja kekuatan yang 4 itu? Pertanyaan ini memang yang lebih pantas dikemukakan dan jawabannya ada di bawah ini. Kekuatan pertama adalah keseriusan. Pemimpin Psp ke depan harus serius atau sungguh-sungguh. Psp adalah kota yang sedang berkembang

yang masyarakatnya kritis dan selalu menuntut adanya kemajuan dan perubahan ke arah yang lebih baik. Jika pemimpinnya tidak memiliki keseriusan, maka dipastikan tuntutan dan harapan masyarakat itu sulit untuk diwujudkan.

‹ Baca Empat ...Hal 10

‹ Baca Pemimpin ...Hal 10

Masyarakat Pasti Pilih Pemimpin Pintar SIDIMPUAN-Pasangan Calon Walikota dan Wakil Walikota Padangsidimpuan (Psp) Nomor 2, Ir H Rusydi Nasution MM-I Riswan Daulay MM yang juga dikenal dengan Jokowi Ala Sidimpuan ini mengajak seluruh lapisan masyarakat Kota Psp untuk bersikap optimis dan percaya bahwa harapan itu masih ada untuk menuju perubahan lebih baik. Bahkan, perubahan pasti ada jika

‹ Baca Masyarakat ...Hal 10


28 September 2012


Masyarakat Pasti Pilih Pemimpin Pintar Sambungan Halaman 9 masyarakat pintar memilih figur pemimpin yang baik ke depan. “Jika masyarakat pintar, pasti memilih pemimpin yang pintar,“ ungkap Rusydi. Ditambahkannya, bahwa ketidak percayaan masyarakat sekarang terhadap pemerintah, khususnya kepada pemimpin daerah (Walikota,red), disebabkan janji-janji yang tidak direalisasi oleh Walikota tersebut. “Kalau kita lihat dengan janji-janji yang diucapkan ketika kampanye pilkada 5 tahun lalu, ternyata tak diindahkan terhadap masyarakat selama ini. Ketika saat menjadi calon, maka para calon Walikota hanya mengumbar-umbar janji, dengan mengatakan akan begini dan akan begitu,“ tandas Rusydi Nasution. Masih kata Rusydi, bahwa anehnya lagi, Kota Psp yang selama ini disebut-sebut sebagai Kota Pendidikan, sedikit demi sedikit mulai terkikis. “Masyarakat harus tahu dengan adanya sekolah Perguruan Tinggi (PT) di Psp akan mendorong perekonomian masyarakat kita. Orang berdagang dari luar kota akan berdatangan. Anak sekolah yang kost makin banyak, sehingga masyarakat mendirikan rumah kos-kosan. Bahkan masih banyak lagi multipler effect yang akan ditimbulkannya. Termasuk

makin banyaknya uang yang beredar di Kota Salak ini serta menambah penghasilan warga, yang pada akhirnya dapat membuat kesejahteraan makin meningkat,“ terangnya. Selain itu, lanjut Rusydi, bahwa Kota Psp juga adalah pusat perdagangan dari berbagai daerah di Tapanuli Bagian Selatan (Tabagsel) ini. “Tentunya hal ini akan dapat meningkatkan perekonomian kita keseluruhan warga Psp,“ lanjutnya lagi. Sehingga, kata dia, para pemimpin juga harus tetap menjaga serta mengambil kembali ikon Kota Psp tersebut. “PAD Kota Psp saat ini cukup untuk melakukan pembangunan diberbagai bidang, jika peruntukannya tepat sasaran. Namun permasalahan pada masyarakat selama ini, baik pembangunan pendidikan, kesehatan serta akses permodalan bagi pedagang. Saya bersedia dan siap untuk memberikan jawaban dan melayani permasalahan tersebut, jika masyarakat Kota Psp memberikan amanah itu,“ tutur Rusydi. Untuk itu, pungkus Vice Presidennya Bank CIMB ini, kiranya masyarakat harus lebih pintar dalam menentukan sikap dan melihat figur, kualitas dan kapasitas pemimpin 5 tahun yang akan datang, untuk memajukan Kota Psp ke depan, serta harus ada tolak ukurnya. (tan)

EMPAT KEKUATAN PEMIMPIN SIDIMPUAN KE DEPAN Sambungan Halaman 9 Pemimpin untuk Psp tidak boleh coba-coba. Maju sebagai calon juga tidak boleh mengandalkan spekulasi atau untung-untungan. Tak boleh juga maju untuk berharap uang mundur. Niatnya memang harus serius untuk membangun, menata dan melayani. Kalau sekarang, keseriusan itu harus ditunjukkan dengan intensitas pertemuan dengan warga, sebanyak mungkin bertemu dengan masyarakat, menyerap kebutuhan dan aspirasi masyarakat. Tidak segansegan dan tidak sungkan mendatangi mereka hingga pelosok kampung. Keseriusan itu juga bisa dilihat dari visi-misi dan program, tim yang dibentuk, anggaran dan dana, karena pemilukada memang butuh biaya yang tidak sedikit. Keseriusan itu juga akan tercermin dari penampilan, cara berpakaian dan cara bertutur sapa. Jika lebih lama di kota lain atau lebih sering bercengkerama dengan anak istri dan keluarga, berarti keseriusannya masih disangsikan. Jika tak berani muncul di masyarakat dan berbicara di depan umum tidak punya konsep atau nutnat atau lebih suka ‘bersembunyi’ di pinggiran kampung atau di kota lain, maka tak salah juga jika keseriusannya masih diragukan. K e k u a t a n kedua, penguasaan wilayah. Pemimpin Psp harus tahu dan harus menguasai wilayah yang akan dipimpinnya. Artinya, ia harus tahu kondisi wilayah, permasalahan dan kebutuhan masyarakat yang berdiam di wilayah itu dan juga potensi masing-masing kawasan. Pemimpin itu juga harus punya konsep apa yang harus dilakukan di kecamatan A, begitu juga dengan kecamatan B dan sebagainya. Jadi, harus mengetahui karakteristik masing-masing kawasan. Penguasaan wilayah ini bisa dilihat dari kehadirannya ke kelurahan-kelurahan, ke desadesa hingga ke gang-gang. Ketika si calon rajin turun ke bawah, berarti ia berkeinginan untuk memahami permasalahan dan kebutuhan masyarakat. Dan sebaliknya, ketika si calon jarang kelihatan turun ke masyarakat, berarti ia memang tak menguasasi wilayah yang akan dipimpinnya. Kekuatan ketiga, Memiliki Jaringan. Hingga hari ini, Kota Psp belum lepas dari beragam

persoalan. Dari masalah infrastruktur, penyediaan lapangan pekerjaan, pelayanan birokrat, hingga pengembangan kota. Bahkan belum lama ini, Psdp juga dinilai sebagai salah satu kota yang terancam bangkrut karena anggarannya lebih banyak untuk belanja pegawai daripada pembangunan. Nah, untuk mengatasi beragam persoalan itu, diperlukan pemimpin yang memiliki jaringan luas bukan hanya untuk tingkat Sumut, tapi juga sampai ke tingkat nasional atau pusat. Membangun Psp tidak bisa hanya mengandalkan APBD, tapi juga harus bisa sebanyak mungkin melobi anggaran dari provinsi dan pusat untuk pembangunan Psp. Selain itu juga harus melibatkan pihak ketiga seperti investor. Untuk ini, makanya diperlukan pemimpin yang memiliki jaringan luas. Pemimpin yang memiliki Jaringan luas itu bisa dilihat dari keberadaan si calon dan juga orang-orang di sekelilingnya, termasuk orang tuanya sendiri. Jika orang tuanya memiliki jaringan luas hingga ke pusat sana atau ke beberapa negara tetangga, bisa diartikan jaringan itu akan bisa dimanfaatkan juga untuk pembangunan Psp. Tapi, kalau jaringannya cuma kampungkampung, maka itu tidak akan banyak membantu menyelesaikan beragam persoalan yang ada. Kekuatan keempat, Mau Berbagi . Masyarakat Psp dikenal suka tolongmenolong. Solidaritasnya sangat tinggi. Jika ada anggota masyarakat yang membutuhkan bantuan, dengan segera anggota masyarakat lainnya akan segera membantu. Dalam konteks ini, Psp harus dibangun dengan kebersamaan. Jadi, pemimpin Psp ke depan harus memiliki kekuatan yang mau berbagi, mau membantu, tidak makan sendiri dan juga tidak membiarkan saudaranya dalam kesulitan. Intinya, pemimpin Psp itu bukan orang pelit atau dalam kalimat lain; orang pelit sebaiknya jangan jadi pemimpin di Psp. Sekarang pertanyaannya adalah; apakah ada calon Walikota Psp yang memiliki 4 kekuatan itu? Jawabannya pasti ada. Masyarakat Psp adalah masyarakat yang cerdas dan pintar. Mereka pasti sudah tahu siapa calon yang memiliki 4 kekuatan itu guna membangun dan melayani Psp yang lebih baik ke depan. (***)

Pemimpin Harus Jujur SIDIMPUAN- Menja d i pemimpin tidaklah mudah. Namun harus bisa mengayomi, melindungi dan menampung seluruh aspirasi rakyatnya dengan baik, berperilaku jujur, amanah dan adil serta mengedepankan kepentingan umum dibanding kepentigan golongan, keluarga, bahkan pribadi. Hal ini dikatakan Hj Nur Asbah Siregar, Nyonya almarhum Burhanuddin Napitupulu yang juga mertua dari Calon Walikota Psp nomor urut 6, Ir H Chaidir Ritonga MM saat berbincang dengan METRO, Minggu (24/ 9) lalu. “Yang terpenting, jabatan pemimpin janganlah dijadikan objek untuk mencari harta kekayaan, menghimpun kekuasaan. Akan tetapi jadilah sebagai pelayan di tengah masyarakat untuk

mewujutkan kesejahteraan dan kemakmuran rakyat,” ungkapnya. Dikatakannya, berdasarkan pengalaman hidupnya dengan tokoh kader Partai Golkar Nasional almarhum Burhanuddin Napitupulu, dimana sejak menjabat jabatan politis sangat banyak menghabiskan waktu, tenaga dan materi untuk kepentingan umum kemasyarakatan, berbeda jika dibandingkan sebelum terjun ke dunia politis. Jadi pada hakikatnya jabatan politis itu bukanlah wadah untuk mengumpulkan harta, menghimpun kekuasaan untuk golongan, keluarga atau pribadi, akan tetapi mempersiapkan diri menjadi pelayan, pengayom dan pelindung masyarakat yang baik. Dan pada diri Chaidir sendiri sikap tersebut telah ada dan tinggal

sosialisasi terhadap masyarakat harus lebih ditingkatkan karena masyarakat pemilih jugalah yang menentukan siapa pemimpinnya dimasa mendatang. “Insya Allah, dia (Chaidir) telah siap dan memiliki kriteria pempimpin itu. Mudahmudahan masyarakat mendukung dan Tuhan mengizinkan,” ungkapnya mengakhiri. Untuk diketahui, Chaidir Ritonga yang saat ini masih menjabat sebagai pimpinan di DPRD Provinsi Sumut, maju sebagai Calon Walikota bersama Calon Wakil Walikota Maragunung Harahap SE MM yang juga adalah Wakil Walikota Psp saat ini. Keduanya merasa terpanggil untuk membangun dengan pola bekerja keras, bekerja cerdas dan bekerja tuntas. (ran)


„ Hj Nur Asbah Siregar, mertua Chaidir Ritonga berikan doa restu untuk kemenangan pasangan Chaidir-Maragunung.

6 Calon Sepakat Tak Lakukan Isu SARA Sambungan Halaman 9 OKP, Ormas, dan alim ulama, dalam rangka mewujudkan pemilukada Kota Psp tahun 2012 yang aman dan kondusif. Acara berlangsung di auditorium Sekolah Tinggi Agama Islam Negeri (STAIN) Psp, di Sihitang, Kecamatan Psp Tenggara, Kamis (27/9). “Semua pasangan calon saya minta tetap menjaga kondusifitas kamtibmas. Jangan sampai memunculkan konflik horizontal di tengah masyarakat, dan tolong kendalikan setiap pergerakan massa pendukung dan tim suksesnya,” harap Kapoldasu. Disebutkannya, konflik biasanya terjadi pada masa kampanye, karena ada pengerahan massa besarbesaran oleh setiap kandidat. Pada masa tenang, karena momen ini sering digunakan pasangan calon untuk melakukan serangan fajar. Saat perhitungan suara dan penetapan pemenang pemilukada oleh KPU juga berpotensi konflik tinggi. “Saya sangat berharap pilkada ini bisa berlangsung dengan lancar dan damai.

Saya yakin masyarakat Kota Psp tingkat pola pikirnya sudah sangat maju, sehingga pilkada ini berlangsung dengan baik sebagaimana Pilgub DKI Jakarta baru-baru ini,” katanya. Lebih lanjut jenderal bintang dua ini berharap, pasangan manapun yang terpilih di pemilukada nantinya, semoga itulah pemimpin terbaik pilihan hati nurani rakyat untuk kota ini. Bagi calon yang tidak terpilih, diminta untuk bersabar dan silahkan persiapkan diri untuk maju di pemilukada lima tahun berikutnya. Terkait penandatanganan Nota Kesepakatan Bersama (MoU) pilkada damai antara KPU, Panwaslu, dan enam pasangan calon, di akhir acara temu ramah tersebut, Kapoldasu minta seluruh pasangan calon untuk tidak menganggapnya seremonial belaka. Jika terjadi pelanggaran MoU, maka pihak yang melanggar kesepakatan akan dituntut pertanggungjawabannya. Adapun isi MoU itu antara lain, seluruh pasangan calon berjanji melaksanakan

tahapan kampanye secara jujur, adil, dan tidak mengangkat isu SARA. Menjaga kondusifitas kamtibmas, fasilitas umum dan ketertiban lalulintas. Ikuti tahapan kampanye tanpa kekerasan dan aksi anarkisme, siap dipilih dan tidak dipilih, serta bersinergi dengan Polri menciptakan pilkada aman, tetib dan damai. Pada kesempatan itu, Kapoldasu mengatakan, untuk pengamanan pemilukada ini pihaknya mengerahkan 495 personel Polri. Diakuinya, personel di Polres Psp tidak mencukupi untuk memenuhi jumlah itu. Karenanya, akan dilakukan penambahan pasukan dari Poldasu dan Polres tetangga. Sementara Kapolres Psp, AKBP Andi Syahriful Taufik SIK MSi sebelumnya berterimakasih kepada seluruh undangan yang hadir. Karena telah meluangkan waktu dan pekerjaannya untuk bertemu ramah dengan Kapoldasu. Sekaligus menyaksikan penandatanganan MoU pilkada damai oleh KPU, Panwaslu dan seluruh pasangan calon.

Adapun pasangan calon yang hadir dan menandatangani MoU di hadapan Kapoldasu adalah pasangan Calon Walikota dan Wakil Walikota Nomor 1, Mohammad Habib NasutionH Soripada Harahap, Calon Wakil Walikota Nomor 2, Ir Riswan Daulay MM, Calon Wakil Walikota Nomor 3, Muhammad Isnandar Nasution SSos. Pasangan Nomor 4, Dedi Jaminsyah Putra Harahap SSTP MSP-H Affan Siregar SE, pasangan Nomor 5, H Amir Mirza Hutagalung SE–H Nurwin Nasution, Calon Wakil Walikota Nomor 6, H Mara Gunung Harahap SE MM. Sedangkan Walikota Psp, Drs Zulkarnain Nasution MM dalam sambutannya mengimbau seluruh masyarakat agar pada hari pemungutan suara nanti beramai-ramai menggunakan hak suaranya di TPS. Jangan apatis untuk memilih pemimpin, karena ini semua demi kebaikan kota ini ke depan. “Perbedaan dukungan itu sah-sah saja, tapi tolong jaga keamanan kota kita ini.

Pilihlah pemimpin kota ini sesua hati nurani dan bukan karena paksaan. Kepada pasangan calon, tim sukses, dan pendukung, kami tuntut tanggungjawabnya untuk menciptakan pilkada damai di kota tercinta kita,” pesan Walikota. Turut hadir dalam acara temu ramah tersebut, Kabiro Ops dan Wadir Intel Poldasu, Ketua DPRD, H Aswar Syamsi MM, Dandim 0212/TS, Letkol Inf Edi Hartono, Kaden C Brimobdasu, AKBP Antoni Surbakti, Wakapolres Tapsel, Kompol Zainuddin, mewakili Danyonif 123/RW, Kajari Psp, Ketua Pengadilan Negeri (PN) Psp, Ketua Pengadilan Agama (PA) Psp dan ratusan undangan lainnya. Usai acara silaturahmi dan penandatangan MoU pemilukada damai, Kapoldasu didampingi Walikota Psp, Zulkarnaen Nasution, Kapolres Psp, AKBP Andi Syahriful Taufik SIK MSi dan Panwaslukada mengunjungi tiap Posko Pemenangan Pasangan Calon Walikota dan Wakil Walikota di pemilukada 18 Oktober mendatang. (ran/ neo)


„ Dedi-Affan bersama puluhan masyarakat Lingkungan 7, Kelurahan WEK V, Kecamatan Psp Selatan, di acara silaturahmi Dedi-Affan, Rabu (26/9) malam.

Pemimpin yang Sayang kepada Rakyat Sambungan Halaman 9 lahir menjadi pemimpin Psp ini adalah pemimpin yang betul-betul sayang kepada rakyat, bukan pemimpin yang sombong, bukan pemimpin yang egois, bukan pemimpin yang ingin menang sendiri. Dan sikap pemimpin yang harus kita minta di perubahan yang akan datang bukan pemimpin yang dilayani, tapi pemimpin yang bisa melayani. Turun, jemput bola pada masyarakat, itu yang kita harapkan,” ujar Calon Walikota Psp Nomor Urut 4, Dedi Jaminsyah Putra didampingi pasangannya, H

Affan Siregar SE, di hadapan H Darmansyah Siregar dan puluhan masyarakat lainnya, di acara silaturahmi DediAffan dengan puluhan masyarakat Lingkungan 7, Kelurahan WEK V, Kecamatan Psp Selatan, Rabu (26/9) malam lalu. Dedi Jaminsyah Putra dihadapan masyarakat mengenalkan diri, keluarga, niat dan harapan mereka ikut di pemilukada ini. Lulusan STPDN ini juga tidak lupa mengucapkan terima kasih kepada semua masyarakat yang hadir yang telah menerima mereka dengan baik ditengah-tengah masyarakat. Tidak lupa Dedi

mengingatkan bahwa pesta demokrasi rakyat langsung ini pasti berakhir, dan berharap kiranya silaturahmi antar sesama masyarakat jangan sampai rusak karena pemilukada ini. “Mudah-mudahan, dalam proses pendewasaan berdemokrasi ini, dibutuhkan wawasan yang cerdas. Jangan salah pilih pemimpin, dan jangan coba-coba dalam memilih pemimpin, karena ini menyangkut perubahan masyarakat secara total dan keseluruhan. Telitilah, analisalah. Jangan seperti beli kucing dalam karung,” ungkap Dedi. Alumni S2 Magister Studi

Pembangunan MSP) USU ini mengungkapkan agar masyarakat tetap menganalisa siapa yang akan menjadi calon pemimpin. “Silahkan bandingbandingkan calon pemimpin agar tidak salah pilih. Itu tidak salah itu. Mudah-mudahan pertemuan silaturahmi ini merupakan jalan yang baik,” pungkas putra kelahiran Sitamiang, Kecamatan Psp Selatan ini. Ditegaskan Dedi, bahwa pasangan Dedi-Affan jelas menjadikan Kota Medan sebagai ‘kiblat’ mereka untuk melaksanakan pembangunan Kota Psp ini, jika dipercayakan

rakyat atas ridho Allah SWT memimpin Psp ini periode 2013-2018 nantinya. ‘kiblat’ “Jelas, pembangunan kami adalah pembangunan Kota Medan. Tidak yang jauh-jauh, tapi yang pas di depan mata kami, sistem birokrasinya, perekonomian, pembangunan akan kami salurkan ke Kota Psp, ke kota kelahiran kami Psp ini,” tegas Dedi. Diterangkan Dedi, bahwa hidup itu adalah pilihan, hitam atau putih, dan bukan abuabu. “Kalau suka kepada kami, alhamdulillah,” pungkasnya. (neo)


28 September 2012 “Kami tidak tergesa-gesa soal ini. Kami inginkan yang terbaik. KPK sangat dibutuhkan saat ini. Kalau sampai keberadaanya tidak memiliki kekuatan, itu tidak baik juga,” Ketua Baleg Ignatius Mulyono.

Ketua Fraksi PKS Hidayat Nur Wahid.

“Kami mendukung hukum mati bila memang yang dikorpsi jumlahnya besar dan mengakibatkan kerusakan yang masif terhadap perekonomian dan kehidupan bernegara. Jumlahnya mungkin di atas 100 miliar,”

Anggota Badan Legislatif Dimyati Natakusumah.

“Saya nilai KPK ini masih rendah dalam penegakan hukum. Istilahnya kesalahan di depan mata tidak kelihatan tapi yang diufuk timur keliatan. kasus besar gak keliatan, tapi kasus kecil keliatan,”

Kirim Opini Anda ke email: metrotabagsel Maksimal tulisan 5.000 karakter

Sikap Kami Ancaman terhadap Supremasi Sipil PEMERINTAH dan DPR memang rajin membuat undangundang meski sering muatan undang-undang itu kandas di Mahkamah Konstitusi. Lebih memprihatinkan lagi, undangundang itu bukanlah aturan yang mempunyai tingkat urgensi tinggi. Salah satu rancangan undang-undang (RUU) yang disodorkan pemerintah ke DPR untuk dibahas saat ini ialah RUU tentang Keamanan Nasional. RUU itu pernah dikembalikan DPR, tetapi diajukan lagi tanpa revisi. Sejumlah pasal dalam RUU itu beraroma militeristis. Artinya ingin membawa kembali TNI ke dalam urusan keamanan. Pasal 17 RUU Keamanan Nasional, misalnya, menyebutkan ancaman keamanan nasional di segala aspek kehidupan dikelompokkan ke dalam ancaman militer, ancaman bersenjata dan ancaman tidak bersenjata. Definisi itu abu-abu sehingga membuka ruang bagi TNI untuk berkiprah seperti di era Presiden Soeharto. Kita tegaskan bahwa semangat membawa TNI ke fungsi keamanan bertentangan dengan reformasi. Reformasi menempatkan TNI pada fungsi pertahanan, sedangkan fungsi keamanan dijalankan polisi. Membawa TNI ke ranah keamanan dikhawatirkan mengancam kebebasan sipil, mencederai demokrasi, dan menciptakan iklim represif. Kelak, dengan dalih mengganggu keamanan nasional, siapa saja yang bersuara kritis bisa dibungkam. Pers yang mengkritik pemerintah bisa dengan mudah dipanggil menghadapi aparat keamanan. Definisi yang longgar dan ruang penafsiran yang elastis sangat memudahkan aparat keamanan melakukan tindakan menghabisi supremasi sipil dan kebebasan. Apalagi jika aparat keamanan diberi kewenangan khusus untuk menyadap, menyita, dan menggeledah. Kita mempunyai pengalaman panjang di rezim Orde Baru. Keterlibatan militer dalam banyak aspek kehidupan telah mengunci rapat-rapat hak sipil. Kita tidak ingin itu terulang. Bangsa ini sudah memiliki UU tentang Kepolisian, UU tentang Intelijen, UU tentang Keormasan, dan banyak undang-undang lainnya. Semua itu mengatur keamanan nasional dan membangun supremasi sipil. Jangan sampai hak-hak sipil dan kebebasan diberangus UU Keamanan Nasional. Kita khawatir RUU Keamanan Nasional dibuat karena maraknya demonstrasi menentang kebijakan pemerintah. Kita khawatir RUU Keamanan Nasional disusun karena munculnya penembak liar di Papua, Aceh, dan beberapa tempat lain. Gangguan keamanan itu mestinya bisa dipadamkan polisi. Jangan sampai ada anggapan kebebasan sipil membahayakan negara. Jangan pula ada anggapan supremasi sipil mengkhawatirkan bangsa. Kita ingatkan bahwa dinamika sipil tidak boleh dihadapi dengan mengerahkan militer. Partai politik mestinya bertanggung jawab mengelola kebebasan dan supremasi sipil. Namun, partai politik hanya bisa memolitisasi rakyat dan membawa rakyat ke dalam kepentingan sempit. Meski partai politik mandul mengelola supremasi sipil, kewenangan itu tidak boleh diserahkan kepada TNI. Kita tidak ingin UU Keamanan Nasional memuat pasal-pasal virus yang menggerogoti supremasi sipil. Karena itu, sebaiknya DPR mengembalikan saja RUU itu ke pemerintah. (**)

Wujudkan Pendidikan Berkeadilan Pendidikan merupakan modal penting dalam pembangunan. Tanpa pendidikan yang baik, sebanyak dan sebesar apapun sumber daya alam yang kita miliki akan berujung dengan kegagalan dan kesia-siaan. Tanpa pendidikan yang mumpuni hanya menghasilkan generasi lemah dan miskin kreasi. Terbukti, tata kelola sumber daya alam di negeri ini banyak dikuasai bangsa mancanegara. Sebab sumber daya manusia Indonesia masih gagap menghadapi perkembangan zaman. :


CELAKANYA, pendidikan di Indonesia masih diskrimantif. Alhasil, diskriminatif yang makin masif mengorbankan pelbagai potensi. Apakah kita lupa atau memang tidak menyadari bahwa, pendidikan yang diskriminatif sungguh kontraproduktif? Pendidikan yang dijalankan adalah pendidikan penuh kepalsuan. Pendidikan yang diskriminatif, disadari atau tidak, sudah mengingkari kodratnya sebagai salah satu cara memuliakan manusia. Tes masuk Tentu saja korban pertama dan utama dari laku diskriminatif adalah para murid dan guru. Salah langkah dalam mengelola pendidikan sejak mula dilakukan ketika pendaftaran siswa baru. Pada pendidikan dasar dan menengah, baik di sekolah negeri maupun swasta akhir-akhir ini kerap mengadakan tes saringan masuk sekolah. Sejumlah sekolah dasar yang kadung disebut elite dan bonafide enggan menerima siswa baru yang belum bisa membaca, menulis, dan menghitung (calistung). Maka terkumpullah siswa-siswa yang dikatakan pandai di satu sekolah. Terkum pul pula siswa yang digolongkan bodoh di sekolah lain. Jelas ini menyalahi aturan.

Sebab syarat utama siswa untuk mengenyam pendidikan dasar adalah cukup umur dan lokasi sekolah dekat dengan rumah. Dengan kata lain siapa yang mendaftar di awal, jika masih ada kuota, maka siswa tersebut mesti segera diterima. Sekolah bisa dikatakan bagus dan sukses bila menerima semua siswa tanpa labelisasi hingga semua siswa lulus sesuai dengan kemampuan yang dimiliki. Oleh karena itu, hentikan tes masuk untuk pendidikan dasar dan menengah! Sekolah harus mau dan mampu menghadapi semua siswa, tanpa mempermasalahkan tingkat kecerdasannya. Fasilitas Sementara itu, untuk mengenyam pendidikan masih banyak penduduk negeri ini mesti berjalan kaki puluhan kilo meter dengan menuruni lembah, menyeberang sungai dan lautan. Ketika di ruang belajarmengajar guru dan murid itu selalu dihinggapi kekhawatiran karena atap sekolah terancam runtuh. Manakala membutuhkan kepustakaan atau alat peraga mereka hanya bisa berharap karena fasilitas yang dijanjikan tak kunjung datang. Saat hendak mendapat dana bantuan, mereka kerap kecewa karena dana itu selalu telat dan

nominal yang diterima sudah menyusut di tengah jalan. Ketika tidak adanya pemerataan pendidikan, jangan seenaknya menyamakan mereka dalam format ujian nasional, misalnya. Ketika tidak ada ketenangan dalam menempuh pendidikan, jangan terlalu berharap menghasilkan peserta didik yang berkualitas wahid. Anak-anak memang selalu menjadi korban. Mereka adalah korban dari kebijakan yang tidak berkeadilan. Mereka adalah korban dari sejumlah kepentingan yang menguntungkan sebagian golongan. Masa ceria anak-anak dan masa depannya sejak dini sudah dirampas orang-orang yang tak berperikemanusiaan. Beban pelajaran Tak percaya? Saat mendampingi anakanak Sekolah Dasar Islam Al-Azhar 27 Cibinong dalam ekskul sastra dan jurnalistik saya kerap menghadapi anak yang mengeluh dengan sejumlah pelajaran yang terus bertambah. Keluh-kesah yang salah satunya dilontarkan oleh Sinta Oktaviani Wahyu Widodo, saya sarankan ditulis dalam bangunan cerpen. Beruntung dimuat koran Pikiran Rakyat, Minggu, 295-2011. Dalam cerpen berjudul “Canatcenut di Kelas Empat,” seperti yang diapresiasi Etti RS, cerpen itu menyajikan topik tentang pelajaran di sekolah. Melalui tokoh bernama Caca, tergambarlah beban pelajaran di kelas empat sekolah dasar yang begitu banyak. Caca seolah mewakili kenyataan zaman sekarang tentang muatan mata pelajaran di sekolah dasar yang begitu banyak dan membuat stres para siswa. Meski fiksi (anak), cerpen tetap berangkat dari kenyataan. Dan kenyatan dalam pendidikan dasar hari ini adalah pendi-

dikan yang membuat beban pikiran para peserta didik menjadi “cenat-cenut.” Pendidikan yang mestinya menggembirakan dan mencerahkan malah menjadi beban pemikiran. Anak-anaklah korban nyata dari perkembangan generasi tua yang memorakporandakan Indonesia. Ketika gunung digunduli, sungai dan lautan dikotori, serta kualitas alam yang terus mengalami kemerosotan anak-anaklah yang pertama mendapat “hukuman.” Atas saran para aktivis lingkungan, atas pertimbangan para pemikir, dan atas kebijakan para pejabat negara, dikeluarkanlah agar anak-anak sekolah dasar mendapat mata pelajaran pendidikan lingkungan hidup (PLH). Inti dari PLH saya setuju, akan tetapi dengan menambahkan jumlah pelajaran kepada anak-anak sudah menjadikan anak sebagai karung yang siap menampung pelbagai saran dari para pemangku kepentingan. Patut diingat, mata pelajaran standar yang saat ini mesti dihadapai anak-anak lebih dari sepuluh mata pelajaran. Dari sejumlah mata pelajaran itu umumnya berisi hapalan-hapalan. Sementara itu, menyambut internasionalisasi yang kian masif, anak-anak sekolah dasar pun diwajibkan mendapatkan muatan internasional, umumnya memilih pelajaran bahasa Inggris. Tak cukup pelajaran bahasa Inggris, sekolah yang dikatakan “bonafide,” “elite,” atau “unggul” mereka pun membagi-bagi mata pelajaran: IPA dalam bahasa Indonesia dan Science pelajaran IPA dalam bahasa Inggris; Matematika dalam bahasa Indonesia danMath pelajaran Matematika dalam bahasa Inggris. Tentu saja buku, guru, dan

cara pembelajarannya pun berbeda. Tak mau kalah dengan pelajaran bahasa Inggris, untuk menyaring pembaratan (westerenisasi) para pejabat di daerah mewajibkan mata pelajaran muatan lokal. Misal, bila di Jabar muncul mata pelajaran muatan lokal bahasa Sunda, maka di Jatim ada muatan lokal ke-NU-an. Kita tahu, salah satu penyakit akut Indonesia saat ini adalah ihwal korupsi. Koruptorlah yang menggerogoti kekayaan nusantara. Anak-anak juga yang mesti menanggung beban. Yaps, atas desakan pelbagai pihak maka sejak dini mesti ada pendidikan antikorupsi. Maka bertambahlah mata pelajaran yang mesti dihadapi peserta didik. Tak cukup itu, terkenang dengan masa silam, para peserta didik juga disarankan mendapatkan mata pelajaran budi pekerti. Bejibunnya mata pelajaran yang mesti dihadapi anak-anak adalah salah satu bentuk lain dari diskriminasi atau ketidakadilan pendidikan. Masa kanak-kanak yang baiknya diisi dengan keceriaan malah direcoki saran-saran buah dari para pemangku kepentingan dan para aktivis kemasyarakatan. Hak hidupnya untuk bermain terpaksa hilang karena mesti menghadappi banyaknya mata pelajaran. Okeh, ihwal buku, guru, atau biaya meski sudah dan mahal bisa dicari, akan tetapi psikologi anak yang bisa stres berat karena beban yang terpaksa diemban siapa berani menjamin untuk mengatasi? Silakan renungkan. (***) Penulis adalah Esais; praktisi pendidikan di Kota Bogor, Jawa Barat.



28 September 2012

Angelina Sondakh

Nangis Sepanjang Jalan USAIsidang,AngelinaSondakhberjalanperlahanmenuju mobil tahanan. Mengenakan seragam putih tahanan KPK, Angie menceritakan alasannya meminta tahanan rumah. Begitu menyebut nama anak-anaknya, Angie langsung menangis. “Tentunya saya memperhatikan perkembangan Keanu, setelah 6 bulan terpisah ya. Biasa ngomongin anak jadi kangen. Kalau misalkan saya, kita lebih baik ditanyakan kepada psikolog. Kalau hakim mengabulkan saya tahanan rumah, baik untuk anak saya,” jelasnya sambil menahan tangis di Pengadilan Negeri Tindak Pidana Korupsi (Tipikor), Jalan HR Rasuna Said, Jakarta Selatan, Kamis (27/9) pagi. Angie didakwa melakukan korupsi pada kasus KemendiknasdanKemenporadengantotalkerugiannegara Rp12,58 miliar dan US$2,35 juta sehingga harus ditahan selama masa persidangan. “Mama saya sudahtua, sebenarnya kan memang tinggal di Manado.Sayamaumendampingi,berharap bisadikabulkan.KalauZahwadanAliyah itu ada teh Reza, kalau Keanu kan sendirian. Mama saya kan kondisi kesehatantidakbegitubaik,”katanya sambil terisak. Angie berharap majelis hakimtidakragumemberistatustahananrumahkepadanya. “Saya tidak akan lari dan saya juga tidak akan mengulangi perbuatanyangdituduhkan.Sepertiyang sudah disampaikan oleh pengacara saya, dan mudah-mudahan majelis hakim bisa mempertimbangkan untuk mengubah status,” tuturnya. Usai sidang, Angie mempersiapkan langkah hukum selanjutnya. “Selanjutnya tahap pembuktian. Kami menerima keputusan majelis hakim dan melanjutkan ke tahapan berikutnya. Tapi saya sebagai ibu dan anak, saya memerlukan seorang ibu karena ayahnya sudah meninggal dan berharap majelis hakim bisa mengabulkan,” pungkasnya. (kpl/int)


Ciuman Nikita

Dihargai Rp5 Juta

SENSASI selalu lekat dengan Nikita Mirzani. Setelah foto syurnya dengan beberapa selebritis, kali ini Nikita yang menjadi salah satu host dalam sebuah acara amal, sengaja melelang ciumannya untuk dihargai sejumlah nominal tertentu. “Ya, itu tadi enggak sengaja saja, ya kebetulan ada yang mau bayar kenapa enggak, ini kan buat amal, bukan buat gue sendiri,” ujar Nikita ketika dijumpai di Konser KOIN (Kepedulian Orang Indonesia): Senandung Untuk Negeri, Hard Rock Cafe, Jakarta Selatan, Rabu (26/9) malam. Awalnya, Nikita menawarkan kepada tamu yang hadir sebuah tiket pertama konser musisi Sting yang akan manggung di Ancol, Jakarta, 15 Desember mendatang. Tiket perdana itu dihargai Rp10 juta. Sayangnya, setelah menunggu, tak satupun tamu yang tertarik. Untuk memanaskan acara, Nikita sengaja turun dari panggung dan menghampiri seorang pria paruh baya

bernama Buddy Jansen (60) dan mulai menggodanya. “Ayo dong Pak, mau ya Pak tiket Sting Rp10 juta lho Pak,” kata Nikita yang tak melihat respon dari bapak berbaju batik itu. “Kenapa enggak mau? Enggak suka? Sukanya apa? Saya? Ya sudah deh saya Rp10 juta saja,” tawar Nikita menggoda. Karena Nikita menilai angka Rp10 juta terlalu mahal untuk sebuah tiket konser, janda satu anak itu menurunkan penawaran lelangnya menjadi Rp5 juta. Tak disangka, sambutannya sangat baik. Dari pengamatan, Nikita yang mengenakan pakaian berpotongan dada rendah dan memperlihatkan tato bertuliskan ‘Nikita’ di dadanya itu memberikan tawaran menggiurkan berupa ciuman plus sebuah tiket. “Demi Sulawesi Tengah, Rp 5 juta for kissing!” teriak

Nikita. “Mau Bapak yang cium atau saya yang cium?” tanya Niki yang langsung disahuti oleh Farhan. “Karena ini konser amal untuk Sulawesi Tengah, ciumannya di tengah dong,” tantang Farhan. Selama beberapa detik, Nikita menempelkan bibir seksinya ke bibir pria berusia 60 tahun itu tanpa malu-malu di depan tamu lain. Kejadian itu sempat diabadikan seluruh tamu yang hadir dengan menggunakan kamera ponsel maupun jepretan awak media. ”Taste very nice , saya mau one more time tapi jangan lah, cukup,” kata pengusaha berdarah IndonesiaBelanda bernama Buddy Jansen (60) itu seraya tertawa. “Saya bilang, saya suka kamu, dia bilang mau di pipi, tapi saya enggak mau, saya maunya di bibir,” celetuk pengusaha tambang itu. (nov/int)


(23 September - 22 Oktober) Peruntungan: Tak perlu banyak bicara jika tidak diimbangi dengan kerja yang cukup. Ingatlah bahwa semua itu perlu bukti, bukan hanya ucapan di bibir saja. Asmara: Usahakan untuk tidak berdebat dengannya, mengalah sajalah.


(21 Desember -19 Januari)

Peruntungan: Yakini intuisi yang timbul dari hati Anda yang paling dalam. Dengan kata lain feeling akan memegang peranan dalam kesuksesan Anda di hari ini. Asmara: Bertuturkatalah yang halus dan tanpa suara yang kasar karena akan mampu mengurangi ketegangan yang seringkali muncul bila ada perbedaan pendapat.


(20 Januari - 18 Februari)

Peruntungan: Tak perlu pesimis dalam melihat berbagai tantangan yang terpampang di hadapan Anda. Justru Anda harus lebih giat bekerja lagi karena itu pertanda bahwa kesuksesan sudah berada di depan mata. Asmara: Walau hanya sebatas berbicara saja sebaiknya dihindari dulu bergaul dengan orang yang tidak disukai si dia.


19 Februari - 20 Maret

Peruntungan: Situasi yang Anda hadapi saat ini masih belum memungkinkan bagi Anda untuk bisa berani melangkah maju. Terimalah situasi yang ada ini dengan pikiran panjang dan jangan hanya memikirkan keberhasilan sesaat saja. Asmara: Mengakui kesalahan sendiri bukanlah suatu perbuatan yang sangat rendah, justru itu akan membikin si dia semakin percaya saja pada diri Anda.


(21 Maret - 20 April)

Peruntungan: Perasaan bimbang masih mewarnai suasana hati Anda di hari ini. Memang untuk menghilangkannya tak semudah membalik tangan, akan tetapi dengan menanamkan kebanggaan dan keyakinan akan kemampuan diri sendiri itu akan bisa mengikis kebimbangan secara perlahan-lahan.Asmara: Ucapan tetap harus diperhatikan agar tidak sampai merusak suasana yang sudah tenang ini.


(21 April - 20 Mei)

Peruntungan: Masih cukup ada rintangan yang harus diwaspadai, walau begitu tak perlu berkecil hati dan tak perlu risau akan ejekan yang muncul. Asmara: Jagalah selalu keserasiannya. Kalau ada pihak yang ingin mengacaukan suasana jangan dibiarkan saja.


(21 Mei - 20 Juni)

Peruntungan: Jangan meremehkan persoalan yang datang, walau sepintas tampak sepele jika tidak segera dituntaskan maka bisa semakin membesar saja. Bukankah persoalan besar bermula dari persoalan kecil, untuk itu jangan tanggung-tanggung untuk bertindak.Asmara: Suasana percintaan Anda tetap terjaga sekalipun cekcok mulut masih sulit untuk dihilangkan.


Nia Ramadhani

Kompak Jalan Bareng Mertua NIA RAMADHANI terlihat mendatangi sebuah konser amal. Kehadiran Nia Ramadhani tak cuma didampingi oleh suaminya, tapi juga oleh mertuanya, Aburizal Bakrie. Ketiganya terlihat memasuki sebuah klub untuk menghadiri acara konser amal untuk bencana di Sulawesi Tengah. “Keluar begini enggak sering, tapi begitu sempat pasti diluangkan waktunya,” kata Aburizal Bakrie alias Ical saat dijumpai tom abloidnova.cdi Konser KOIN (Kepedulian Orang Indonesia): Senandung Untuk Negeri, Hard Rock Cafe, Jakarta Selatan, kemarin malam. Bagi Nia dan Ardie, sosok Ical adalah pria yang sangat dekat dengan keluarga. Jika tidak memiliki kegiatan lain diluar politik, Ical akan memilih menghabiskan waktunya bersama keluarga besarnya. “Sebenarnya papa itu sosok yang sangat dekat dengan keluarga. Kan kalau lagi enggak ada kegiatan apa-apa pasti ngumpul sama keluarga,” kata Nia. “Beliau selalu mengedepankan keluarga. Beliau juga suka Slank, jadi langsung diajak kesini,” timpal Ardi. Berada di tengah-tengah anak muda yang asik mendengarkan musik sekaligus lelang untuk amal, Aburizal terlihat sangat menikmati suasana. Bahkan, kata Nia, ayah mertuanya itu asik berjoget-joget. “Usia saya juga baru 26 kok, enggak ada masalah, asal jangan sering-sering,” canda Ical. “Terpaksa di dalam papa joget-joget,” sahut Nia tertawa. (nov/int)

(21 Juni- 20 Juli)

Peruntungan: Jangan bertingkah macammacam jika tidak ingin mengalami kegagalan yang sangat terasa. Sekalipun peluang masih belum tertutup, sebaiknya Anda bisa mengimbanginya dengan konsentrasi tinggi. Asmara: Jalinlah hubungan kisah kasih ini dengan sesuatu yang indah dan menyenangkan.


(21 Juli-21 Agustus)

Peruntungan: Tak perlu cemas, sesulit apapun masalah tersebut pasti ada jalan keluar untuk memecahkannya. Teruslah berusaha, jangan pantang menyerah dan yang paling penting keyakinan harus tetap tinggi. Asmara: Ada sedikit perbaikan walau belum seperti yang diharapkan.


(23 Agustus-22 September)

.P eruntungan: Saat ini Anda benar-benar merasakan indahnya hidup, apalagi ditunjang dengan suasana yang benar-benar semarak dan segala urusan pekerjaan yang sudah lumayan lancar sehingga tidak ada beban yang terlalu dipikirkan. Asmara: Cukup mesra dan bahagia. Jagalah suasana ini dengan mencari topik pembicaraan yang menyenangkan.


(23 Oktober - 22 November)

Peruntungan: Cobalah untuk bisa lebih teliti agar segala urusan yang sudah hampir jadi tidak sampai mentah lagi hanya karena diri Anda yang kurang bisa mengikuti rencana yang dibuat sendiri. Asmara: Apa sulitnya berbicara yang halus? Tak perlu dengan katakata kasar karena itu akan menyulitkan Anda saja.


( 23 November - 20 Desember)

Peruntungan: Walaupun Anda sudah merasa berada di atas angin sebaiknya kewaspadaan tetap dipertahankan. Jangan sampai berlaku sembrono karena akan berdampak cukup luas jika sampai terjadi hal-hal yang tidak diduga sebelumnya. Asmara: Jangan terlalu dimasukkan hati tingkahnya yang kadang menjengkelkan hati karena itu hanya sementara saja.


Minta Harta Mantan Suami Yulia Rachman SELAIN menginginkan perceraian, pesulap Demian Aditya ternyata juga menginginkan harta bersama sang istri, Yulia Rachman, dibagi dua. Parahnya, Demian juga meminta harta yang dimiliki Yulia bersama dengan mantan suaminya terdahulu. “Yang diminta (Demian, red) Aditya harta yang jauh sebelum perkawinannya dan bukan haknya. Selain itu, yang dia minta di luar konteks, pertama perwalian. Padahal kan menurut UU, anak-anak di bawah umur ikut ibu,” ujar kuasa hukum Yulia, Petrus Balapationa, saat ditemui di Pengadilan Agama Jakarta Selatan, Kamis (27/9). Sementara itu, Yulia sendiri heran kenapa Demian tidak menghadiri persidangan hari ini. Pasalnya, keinginan Demian untuk mendapatkan harta gono gini dan hak pengasuhan anak harusnya dibicarakan langsung dalam persidangan. “Saya nggak ngerti kenapa dia nggak hadir karena katanya karena pekerjaan. Harusnya kan bisa dijadwalkan dan dibicarakan dengan kuasa hukum, kita tahunya di sini karena ada kerjaan. Tapi di sini tadi pengacaranya bilang dia nggak mau datang karena sudah ngotot cerai. Artinya memang ada miss komunikasi dari pihak mereka,” ujar Yulia. Lalu bagaimana perasaan Yulia mengenai jalannya perceraian yang semakin lama ini? “Kalau ditanya, jauh lebih bahagia perasaannya dibanding kemarin. Makin lama makin terlihat, ya Allah tolong dibukakan. Saya mau mediasi untuk anak dan harta gono gini. Ayo selesaikan baik-baik,” harap presenter cantik ini. (kpl/int)

Eunjung ‘T-ara’

Gugat Produser Drama ‘Five Fingers’ Personel T-ara Eunjung sebelumnya telah dipastikan ambil bagian di drama SBS ‘Five Fingers’. Namun, karena kontroversi T-ara pasca dikeluarkannya Hwayoung, Eunjung dikeluarkan dari drama tersebut. Sebagai buntutnya, pihak agensi Eunjung Core Contents media akhirnya memutuskan untuk menggugat produser drama tersebut. Mereka menganggap pembatalan itu merusak reputasi Eunjung. ”Kami mengajukan gugatan karena dikeluarkannya Eunjung dari ‘Five Fingers’ Agustus lalu. Masalahnya bukan tentang uang tapi memulihkan reputasi Eunjung dan kompensasi dari rusaknya kredibilitas Eunjung,” ujar juru bicara Core Contents Media dilansir Soompi, Kamis (27/9). Bagi Core Contents, dikeluarkannya Eunjung dari drama tersebut memperkeruh keadaan usai kontroversi T-ara. Peran Eunjung dalam drama itu digantikan oleh aktris Jin Se Yeon. ”Ia terluka secara emosional dari kontroversi T-ara tapi dikeluarkannya ia hanya membuatnya semakin buruk. Ia sudah jadi aktris sejak kecil dan kami belum pernah mengalami atau mendengar kasus seperti ini sebelumnya. Mencegah hal seperti ini terjadi lagi dan untuk mengembalikan reputasi Eunjung, kami memilih untuk mengajukan gugatan,” pungkasnya. (dtc/int)

Jennifer Lopez

Bawa 88 Kru dari Amerika BANYAK syarat yang diajukan Jennifer Lopez ketika akan manggung di Indonesia. Mulai dari sound system hingga keamanan. Namun, ada hal unik yang diminta JLo. Ia meminta agar tidak disiapkan air di Indonesia. JLo selalu membawa air khusus. “Enggak ada yang aneh-aneh, semua yang diminta bisa diganti. Kecuali air minum,” ujar Reza Prawiro, Presdir Stellar yang mendatangkan JLo ke Indonesia. Reza menjelaskan, saat ini tim nya masih melakukan persiapan untuk konser JLo yang akan dilangsungkan pada 30 September. “Sampai saat ini persiapan masih berjalan. Ada 88 orang termasuk band. Mereka bawa imax, itu pertama kali dipakai untuk pembukaan olimpic. Dia bawa tim khusus untuk visual,” jawabnya. Ditambahkan Reza dirinya belum bisa menjelaskan apa saja yang akan dibawa JLo untuk konsernya nanti. Namun, untuk memenuhi segala kebutuhana, JLo dancer hingga kru yang dibawa dari Amerika. “Dari 88 orang itu akan ada 16 dancer. Kalau perlengkapan berapa kontainer kita belum tahu pasti, soalnya mereka akan bawa alat-alat sendiri,” tandasnya. (nov/int)


28 September 2012



REMAJA SELAMAT SYDNEY-Seorang remaja Australia Taun (17) sungguh beruntung karena selamat setelah digigit salah satu ular paling berbisa di dunia. Remaja itu selamat setelah pemeriksaan sejumlah dokter di Kota Kurri Kurri, Rabu (26/9). “Kami memiliki penawar racunnya,” kata Toksikologis Geoff Isbister di RS Mater, Newcastle, Australia. Padahal, ular itu sangat berbisa dengan mengandung neurotoksik yang bisa melumpuhkan dan membuat kesulitan bernafas. Artinya satu tetes saja ludah ular bisa menewaskan 100 orang pria dewasa.Dibuktikan, peristiwa gigitan ular yang ditemukan di gurun pasir Australia Tengah. Peristiwa tersebut, Polisi tengah menyelidiki bagaimana hewan yang biasa hidup di gurun pasir itu bisa sampai di kawasan perkotaan pesisir pantai itu. “Kepolisian sekarang tengah berusaha untuk menyelidiki bagaimana insiden ini bisa terjadi. Dan kami akan meminta keterangan korban setelah pulih,” lanjut polisi. Ia merangkan seekor ular di Taipan Darat mencapai panjang 2,5 meter dan memiliki taring sepanjang 12 milimeter. (kps/nik)

Kejadian aneh apabila bayi lahir dengan kaki kambing dan tiada tengkuk tersiar dari berita terbaru dari Jigawa,utara barat Nigeria di mana seorang wanita didakwa telah melahirkan makhluk dibawah – bayi tanpa leher jelas dan dengan kaki kambingnya.


DIGIGIT-Ular Tapian Darat Australia mengigit seorang remaja Australia, namun selamat setelah mendapat pertolongan dari medis, belum lama ini.

Menurut sumber cerita ini, wanita itu dikatakan telah mengeluh nasib beliau kerana ini adalah kali keempat dia melahirkan makhluk aneh seperti ini. Ini mungkin musim kelahiran pelik dan kejadian yang sangat misteri dan saintifik, kita tidak mempunyai penjelasan bagi kejadian ini. Hanya Allah yang tahu atas apa yang berlaku dan apa yang di jadikan di dunia ini.

Randy Disambut Wanita Tunawisma Kenakan Handuk

Buat Video TTeroris eroris Pria Arizona Ditangkap

disambut oleh perempuan tunawisma yang hanya mengenakan handuk. Perempuan berusia 24 tahun itu bernama Jennifer Burgess. Burgess menyambut Kizer hanya berbalut handuk bercorak tentara, milik putra Kizer. Kizer pun masuk dan berbicara dengan perempuan nomaden itu. “Dia (Burgess) berada di depan pintu dan saya bertanya, ‘apakah Anda tunawisma?’ dan dia menjawab ‘ya’,” ujar Kizer,s, Kamis (27/9). Setelah membiarkan Burgess, Kizer sadar bahwa, perempuan itu membawa bungkusan. Bungkusan itu berisikan uang tunai dari celengan putri Kizer. Polisi pun datang atas panggilan Kizer dan memborgol perempuan tunawisma itu. Burgess pun ditangkap dan dipenjarakan di Penjara Sacramento County atas tuduhan perampokan. Sementara itu putri Kizer juga masih jengkel karena uang yang sudah dikumpulkannya untuk gereja, tidak kembali. (oz/nik)

Dia dibebaskan dari tahanan dengan jaminan 5.000 dolar AS atau sekitar Rp 45 juta. Namun jika di pengadilan dia terbukti bersalah maka Turley terancam hukuman 45 bulan penjara. “Kami menganggap hal semacam ini sangat serius. Perbuatannya sama sekali tidak lucu,” kata juru bicara kepolisian Phoenix, James Holmes. Polisi mengatakan tiba di lokasi di mana keponakan Turley ‘berakting’ dalam waktu tiga menit setelah menerima banyak panggilan dari masyarakat yang melihat seseorang mengacung-acungkan senjata. Holmes mengatakan polisi tidak menahan keponakan Turley yang berusia 16 tahun itu. “Video itu menjelaskan kepada kami apa yang ingin dilakukan Turley. Dia menciptakan teroris khayalan berdasarkan pemikirannya sendiri,” tambah Holmes. (kps/nik)



SAMBUT-Handuk bercorak tentara yang digunakan Burgess untuk menyambut Randy Kizer. SACRAMENTO - Randy Kizer pulang ke rumahnya di Sacreamento, California, Amerika Serikat (AS) pada Selasa lalu. Namun dirinya


Dp 25 %, angsuran 2 Jt-an Dp 25 %, angsuran 3 Jt-an Dp 25 %, angsuran 3 Jt-an Dp 20 %, angsuran 2 Jt-an Dp 25 %, angsuran 3 Jt-an

Proses cepat data dijemput

Hub: L. Rivai Sembiring 0812 6457 0000

DIJUAL: Tanah kapling uk 6x12M, harga mulai 35jt-an, bisa nego. Lokasi strategus sebelah kolam renang Wahyu. Hub: Kolam Renang Wahyu, Jl. St. Alisyah Bana, dengan Bpk IRWAN EDWIN (Buyung) Hp: 0 8 1 3 7 5 9 6 2 9 8 8 . *Juga menerima pelatihan renang yg diasuh oleh Pelatih bersertifikat & berpengalaman.


PAKET SUZUKI 100% BARU Penuh Dengan Cash Back Pick Up Carry, APV Pick Up, APV Arena, Ertiga, Splash, Swift, X-Over, Grand Vitara Dealer Resmi PT. Trans Sumatera Agung. Data dijemput Hub: David - 0813 6132 4071

2 Hektar, umur tanam 12 & 5 tahun, dengan penghasilan 5 ton/bln. Tanah rata, lokasi: Kampung Tempel, Kec. Ti n g g i R a j a. Harga Rp. 300 juta (NEGO). Hub: BAHARUDDIN S. HP:

CV. PARNA JAYA MOTOR: Menjual sepeda motor honda, yamaha, suzuki Viar, baru dan bekas; Cash & Credit; Tukar tambah; Urus Perpanjang STNK, BBN. Alamat: • Jl. Jend. Sudirman No. 389 ABCD, Indrapura ( 0622-31788) • Jl. Acces Road, Simp. Durian, Kuala Tanjung.

DI JUAL RUMAH TYPE 54, 2 Kamar tidur.

MENTARI MOTOR Melayani servis, cas batre (basah ~ kering). Menjual alat2 sepeda motor, Asessoris, Oli, & alat2 mesin gendong. Alamat: Jl. Jalinsum Simpang Kebun kopi, Indrapura MITSUBISHI RANTO “PROMO” LEBARAN: Pajero Sport, Triton, Colt Diesel Dump Truck, Chasis, L-300, & Colt T120SS PickUp. DP 11% atau bunga mulai 0%. Hubungi: UNAS 0813 6333 3000 DIJUAL CEPAT: Yamaha VIXION warna Hitam tahun 2008. Body dan Mesin mulus. Hub: 0813 7015 5910; 0813 6163 1463 NEW NISSAN: Grand Livina, Juke, XTrail. Navara, Murano. Ready Stock, cash/credit. Hub: Mili 0852 7033 7739 DEALER RESMI SUZUKI Indrapura melayani penjualan sepeda motor merek Suzuki khusus yang baru secara chas n credit. Khusus promo setiap pembelian chas n credit mendapatkan emas (berlaku September 2012). Ayo buruan dapatkan sepeda motor Suzuki. Hub koorditor sales Bpk ARIFIN Hp : 085276045145. Jl. Jalinsum simp. Kebun kopi kuala


Menjual : Barang & Alat-alat Bangunan, Kontraktor, Levelansir. Dengan harga standart yg dapat di jangkau, dll. Jl. Masjid Lama No. 41 Talawi Batu Bara. Hubungi : Hj. Ani HP : 0852 7508 7880.


Menjual alat2 pancing, Kantor, Olahraga, Sekolah, Komputer, dan Perlengkapan Sholat, dengan harga Grosir. Alamat: Jl. Lintas Medan-Kisaran, Simpang Kebun Kopi, Batubara. HP: 0852 7680 942


Komplek Perumahan BAHREN PURI KAMPUNG BARU (Belakang HOTEL SUZUYA), RANTAU PRAPAT. Hub: 0813 6048 3699

Panglong menjual segala jenis papan, khususnya papan Boat/ Sampan dan alat-alat bangunan, Menerima tempahan, Khususnya ukuran panjang dari ukuran standartnya.Dusun II Jl. Merdeka Tanjung Tiram Batu Bara. Hub : Bapak Irfan, HP : 0812 6456 2615.


“DINDA Keyboard” Entertainment

0813 6200 5227

menyediakan berbagai macam obat yg bermutu dan harga terjangkau. Menerima rawat inap., Pemeriksaan ibu hamil, Bersalin, Sunat, Imunisasi, EKG, USG. Tersedia, LAB, CLINIK, & ambulan. DAPAT KONSULTASI GRATIS dgn apoteker. Desa Tanjung Gading Sei Suka, Indrapura, Kab. Batubara. Hub: 0622-632088

Musik Melayu Modern, & TOKO D.J 2 Elektronik, Cash & Credit segala jenis elektronik. Hub: Iwan (0811 6282 272 – 0852 7599 9772), di Simpang Tiga Pahang, Talawi, Batubara.


obat dan Lengkap. Dengan harga terjangkau. Menerima pasien dan k o n s u l t a s i k esehatan. hub: J l . Jalinsum, Desa Tj. Gading, Simpang Kuala Tanjung, Indrapura, Batubara. Telp: 0622-632751

Menjual kursi, lemari dan semua jenis barang-barang perabot rumah tangga lainnya,di jual dgn harga yg murah & terjangkau. Jl. Besar Simpang Dolok, Lima Puluh, Batu Bara, Serta menyediakan tempat Rekreasi pemandian “ Kolam Lima Putri “ Untuk keluarga anda, Jl.Besar Air Hitam Simpang Dolok. Hub: Bapak Agan, HP : 0812 6474 707

Klinik Herbal CHIN CHIE

Toko Mas

APOTIK KARYA: Menjual berbagai

alternatif reflexiologi therapy tanpa operasi & injeksi, dapat mengobati semua jenis penyakit kronis. (izin dinkes : 448/3224/111/2007) Jl. Jend sudirman gg. Keluarga. Dsn 2 pare-pare, Air Putih. Indrapura. Hub: 0812 6311 0162.

"Balai Pengobatan ELLY” Izin No : 800/3244/DINKES SOS/2008, Penanggung Jawab: Dr. HIDAYAT, M. Kes. Menyediakan berbagai Jenis obat, dan mengobati penyakit untuk kesehatan anda dan keluarga, serta bersedia datang ke rumah anda untuk panggilan pengobatan di rumah anda dalam waktu 24 Jam. Empat Negri, Kec. Lima Puluh, Kab.Batu Bara, Hub: IBU ELLY, HP : 0852 7668 2236

YAMAHA HORAS MOTOR, menjual sepeda motor merek Yamaha, chas & credit terbaru, dapatkan Helm LOVENZO Cuma Cuma dengan pembelian new zupiter z.1. (kesempatan terbatas) hub dialer telp : 0622.31883. Jln. Jendr Sudirman Kota Indrapura. Barubara.

KLINIK MIFTAH HAKIM, UGD buka 24 jam, pemeriksaan ibu hamil, sunatan, ibu bersalin,imunisasi, rawat inap, tersedia mobil ambulan. Konsultasi dokter tentang kesehatan, penyakit. Jl. BESAR LIMA PULUH KOTA (Depan Mesjid besar limapuluh), Kabupaten Batubara

PRIMKOPAD (M.SIDIK) menyediakan


perlengkapan dan asessoris TNI, POLRI, SATPOL PP, DISHUB, ORMAS, SATPAM,DLL. Hub M.SIDDIQ Hp: 0853 7170 6226. Jl. Jalinsum Kebun Kopi,Kuala Tanjung, Indrapura (samping BRI), Batubara

Kontraktor, Lepelasir, Biro Jasa, Dagang umum, Pertanian, Serta menyediakan & menjual barang-barang serta peralatan bangunan,dll. Alamat : Jl. Merdeka Pasar Mereng Desa Suka Maju Kec. Tanjung Tiram. Batu Bara. hub:(Ibu Ani) HP : 0853 6067 1005

DIJUAL CEPAT Rumah berukuran :

COLOUMBIA, CASH & CREDIT FURNITURE & ELEKTRONIK harga terjangkau, paket murah meriah (cicilan ringan). Pasar 8, Jl. Jend. Sudirman, Indrapura, Batubara

Lebar 5, panjang 50, bangun 45, di Jl. A.Yani/Psr.Merah Simp.4 TalawiBatubara (depan SPBU). Hub: 0821 6839 0096.

PHOENIX- Seorang laki-laki warga Arizona, AS Michael David Turley (39) ditangkap polisi, karena membuat film teroris.baru-baru ini. Dalam video buatannya terekam ternyata keponakannya yang berusia 16 tahun berjalan-jalan di jalanan kota sambil membawa peluncur granat palsu dan berdandan ala teroris dengan menggunakan penutup wajah. Narator dalam film itu mengatakan aksi ini bertujuan untuk mengetahui seberapa cepat reaksi polisi menghadapi keadaan semacam ini. Si pembuat film mengatakan polisi

CAHAYA BARU: Menjual berbagai macam mas dan perak dgn berbagai bentuk tempahan: cincin, kalung, gelang rante, anting2, mutu memuaskan, kunjungi kami di: Pajak Pagi Kebun Kopi, Indrapura, Batubara

“TOKO HALIM” Menjual : Alat - alat

Cansaw (Alat pemotong kayu), segala perlengkapan sekolah, Kosmetik, Sendal, Sepatu , Celana Jeans, serta menyediakan berbagai jenis pakain pria & wanita, dll. d jual dgan harga yg terjangkau, Alamat : Desa dahari Indah, Kec. Talawi, Batu Bara, Hub: Abdul Halim, HP : 0813 7652 4105

TOKO PRIMA BUANA menjual pakaian jadi pria, wanita, dewasa, anakanak, Busana Batik & kosmetik, Pakailah busana anda yang serasi cantik dan nyaman, Harga Boleh tanding, barang boleh banding. Hub: ROMAULI Br Sinurat. Hp. 0813 6152 6334. Jl Besar perdagangan No.88 g Lima Puluh Kota BatuBara.

membutuhkan waktu 15 menit untuk merespon. Video amatir yang dibuat delapan hari setelah tragedi penembakan saat pemutaran perdana film Batman itu diunggah ke YouTube. Di situs itu film tersebut diberi judul “Dark Knight Shooting Response, Rocket Launcher Police Test.” Setelah ditahan Turley didakwa melakukan aksi yang menyerupai tindakan terorisme, melakukan hal berbahaya, berkontribusi terhadap pidana ringan yang melibatkan simulasi bahan peledak.


Menerima pemasangan design, Plafon gyfsum rumah dan Perkantoran dgn tenaga yg berpengalaman.serta menjual sgala macam keperluan gyfsum. Hubungi: 087818917066 (Bpk Anwar); 0853 5910 8633 (Ibu Ida), Jl. A. Yani/Psr. Mereng Simp. 4 Talawi - Batu Bara.

“RAGHIB JAYA ALUMINIUM” Aluminium, Contraktor, Partition, Swing door/Rolling Door, Serta Menyediakan Barang Seperti : Pintu Kamar Mandi, Tenda/Awning, Lemari Kaca, Rak Piring, Steling, Raill Gorden, Tangga, Jemuran Baju & Segala Jenis Kaca. Alamat: Jl. Merdeka No. 165-166 Batu Bara, Hubungi : DICKY BUDIANTO, HP : 0812 655 3575 - 0812 6536 6166.

PERCETAKAN & ADVERTISING “BIMA”: Menerima segala jenis cetakan partai besar & kecil, undangan, sablon, stempel, MMT, baliho, Neonbox, baju kaos, kop surat, dll. (Hub: HABIB SYAH: 0852 7074 7585). Jl. Jend. Sudirman No. 288, Indrapura, Batubara.

T U K A N G B U R U N G RAHMAT KT: Menjual berbagai macam jenis burung pilihan,menerima tempahan berbagai jenis Kandang (sangkar burung). Hub: 0823 6403 5666. Jl. Simpang Kuala Tanjung, Indrapura, Batubara. PELUANG USAHA AIR MINUM: Pemasangan Depot Air Minum Air Pegunungan (Mineral) Sistem RO Oxsygen dan Grosir Peralatan Depot Air Minum GRACE WATER: Jl. Cengkeh Raya P. Simalingkar. HP. 0813 7010 7352. *) Melayani pemasangan dalam dan luar kota

“MATAHARI TRAVEL” melayani pembelian tiket pesawat,Batavia, Garuda,Merpati,Lion,City Link, Sriwijaya, Wing air, dengan tujuan wilayah dalam dan luar negeri, Hub: Rini-0821 6564 4472 – 0877 4929 0081 ; DEDY : 0823 6441 6766. Jl Medan LimaPuluh Kota NO. 11, Batubara

DINA DOORSMER : Menyediakan


servis HP Menjual segala merek dan jenis HP, jual pulsa, asessoris, dan perlengkapan lainnya. Hub: Andy , HP: 0877 4871 1198. Alamat: Jalinsum tanah merah simp.4 Indrapura, Batubara.


Menjual segala jenis merek HP, Servis HP, Asessories, Pulsa, Dll. (Hub: FITRI0853 5806 0605) JALINSUM simp 4 Tanah Merah Indrapura Batubara.


O G E T s Stiker & Aksessories: Penjualan & Pema-sangan Variasi Mobil dan sepeda motor. Jl. Jend. Sudirman, Indrapura (Samping Lap. Sepakbola); HP: 0813 7644 4177 ; Telp. 0622 - 646 144.

AKAN DIBUKA DI KISARAN PUJASERA (Pusat Jajanan Serba Ada): anda berminat segera hubungi, Tempat terbatas, Alamat: Jl. Imam Bonjol No. 366 Kisaran (Doorsmeer Pondok Keluarga). Siapa Cepat Dia Dapat . HP. 0852 7059 6434 (Faisal).

“RIAS PENGANTIN RAHAYU”: Menerima pemasangan pelaminan dalam dan luar kota, Foto shoting Video, layar tancap, keyboard, dan menyediakan pelaminan lengkap (Jevara Melayu, dll). Alamat: Jl. Dahari Selebar Talawi, Batubara. Untuk pemesanan, hub: Mahar Salim, HP: 0878 6833 7140 ; 0821 6696 3879.

“ P O H WA S A L O N ” Menerima:Krimbat Rambut, Masker, Smoting, Sosis rambut, Cuci muka, Sanggul, Pangkas pria & wanita. Jl. Rakyat No. 02 Tanjung Tiram Batu Bara, Hub: Ibu Po Hwa, HP : 0853 5926 5298.

“MARI SALON SANGGUL” Cab. Medan & Jakarta. Menerima: Gunting rambut, rebonding, hair spa, lulur, facial, merias pengantin (Sanggul + Make Up), dan menerima siswa/i yang ingin belajar dan punya keahlian khusus dgn biaya terjangkau. Hub: MARI SALON SANGGUL, Pajak Gelugur Lt.2 Blok B No. 43&44, Rantauprapat. HP: 0821 6547 7080; 0852 6277 2884

doorsmeer Hidrolik sistem. Servis AC mobil, Assesoris, Cat Ketok, bengkel Injeksi, ganti oli, Tune-Up, Over Haul, dan cat duko. Alamat: Jl. Jalinsum, Kuala Tanjung, Indrapura, Batubara (0622-632832)

Perawatan rambut, wajah, & tubuh, terlengkap di Batubara, Hub: 0852 7508 4444, Jalinsum Binjai Baru, Batubara


“AA” Fashion: Menjual berbagai


Ganti oli, pispot, balancing ban, tubeless, angin hidrogen, cot, dan ban luar radial. Masih membutuhkan beberapa tenaga Doorsmer (Tukang Cuci Mobil). Jl. A. Yani No.6/8, Kisaran.

jenis pakaian muslim, wanita, pria, anak2, dan dewasa, berbagai merek dan ternama, dan terbaru. Melayani eceran dan grosir. Jl. Jend. Sudirman, Kota Indrapura, Kab. Batubara. HP: 0813 6154 2640

pakaian pria & wanita, pakaian serta perlengkapan baby, accesoris jilbab, mukena,dll. Jl. Merdeka No.03 Depan kantor PLN Tanjung Tiram & Jl. Rakyat No.40 (Depan Pajak Tanjung Tiram) Batu Bara. Hub:(Jonni Hendra, S.pd.) HP:0823 6269 4535


LKP “CANTIK MANIS“ belajar tata rias rambut pengantin, kecantikan kulit- rambut, menjadikan tenaga kerja terampil, siap pakai wirausaha dan trend model professional, hub 0812 6374 0598, Jl. Besar Perdagangan, Lima Puluh Kota BatuBara.

Toko Batik NUR’ ALFI: Menjual

Fasilitas: Mobil Kerja, Uang makan (8000 s/ d 15000); Gaji pokok (350.000 s/d 1 Jt), Komisi (4 % s/d 8 % ), dan intensif lainnya. Bawa lamaran anda ke: Columbia Cash & Credit • Jl. Cokroaminoto, Kisaran, Telp.(0623) 44260 • Jl. Koptu Mahmun Lubis , Aek Kanopan.

TOKO CANTIKA COLLECTION :Menjual jilbab, busana muslim,

batik pekalongan, dengan berbagai jenis, pakaian sempit (pas-pasan), Couple, baju anak2, Blus, kemeja, dll. Harga murah dan terjangkau. Jl. A. Yani/ Psr Mereng Simp. 4 Talawi, Batubara. Hub: Rosini 0812 6002 9388

pangkas pria. Rapi, indah, bersih, trendy & memuaskan. Mode masa kini. Hub: Rahmad, 0878 1892 0095. Samping Pertamina, Parepare, Indrapura, Batubara

LOWONGAN KERJA : Dibutuhkan segera • Tenaga Marketing • Kolektor.


Menyediakan nasi sop ayam, kambing, sapi, soto,kare kambing, sop buah, tersedia aneka juice, kopi susu, (menu istimewa harga terjangkau) hub: Ibu KASMI-0823 6985 1755. Jl Medan Kisaran Km.99 simpang Kuala Tanjung, Indrapura.

SALMA D’CAFÉ menyediakan

sarapan pagi, nasi serba 7000 dengan hidangan istimewa. Nasi goring, mie goring, bakso, pangsit, siomai, Batagor, bandrek, aneka juice. Menerima nasi kotak dan rantangan. Hub: Ibu salma , 081263497777 Jl. Kula Tanjung Kebun Kopi Indrapura, Batubara.

BROKOLI CERIA: sajian spaghetti sehat. Menyediakan sajian: Mie Ayam, Mie Ketela, Mie Wortel, Mie buah, Martabak sayur, Aneka Juice, Kopi Luwak, Softdrink. Harga Terjangkau. Alamat: Jl. Jalinsum KM 99.5 Sei Suka, Batubara. HP: 0812 6217 910 RUMAH MAKAN BERSAMA: Menyajikan berbagai masakan, Nasi Goreng, Mie Goreng, Soto. Berbagai minuman, Aneka juice, teh manis, kopi susu, ginseng. SERBA EKONOMIS. Alamat: Simpang Kuala Tanjung, Indrapura, Batubara “RUMAH MAKAN DENAI MINANG” Menjual masakan khas padang, dengan menu istimewa: Nasi serba Rp.8000, rendang, gulai pari, daging sapi, ikan mas, ciri khas masakan rendang padang, serta menerima pesanan nasi kotak. Hub: Ibu AS , HP : 0817 4798 835. Jalinsum LimaPuluh BatuBara

RM. (TB) TELAGA BIRU: Khas masakan Minang, terkenal masakannya lezat. Menunya tersedia kopi susu, teh susu, & Juice. Terima Pesan nasi kotak. Jl. Jend. Sudirman No. 72, Indrapura, Batubara. Hub: 0813 9782 3094 R.M MINANG RAYA : Tersedia khas masakan minang, ayam pa n g g a n g, i k a n pa n g g a n g , k a r e kambing, Gulai kakap, ikanmas ARSIK, dengan menu istimewa, serta menerima pesanan katering/ nasi kotak. Hub: VERY, HP: 08216666 5855, Jalinsum, tanah merah, simp. 4 Indrapura, Batubara. Telah Hadir di Kisaran, “RUMAH JAMUR” menyediakan masakan ala jamur: Lontong sate jamur, Bakso jamur, Sop jamur Ayam kampung, Mie jamur ayam kampong, Krispy jamur, es jamur, dll. Buka setiap hari Kecuali “Jumat” jam 12.00 siang sampai malam. Kunjungi: Jl. Budi Utomo No. 116 Siumbut-umbut Kisaran. HP : 0877 4878 2775

BUTUH DANA TUNAI: Lamhot Jaya Motor j a m i n a n h a n y a BPKB Sepeda motor anda, persyaratan ringan, 1 jam cair, juga melayani jual beli sepeda motor. Hubungi alamat Pusat: Jl Diponogoro No.149, Kisaran.Telp 0623 43921 Hp : 081361505214

BUTUH DANA TUNAI?: Lamhot Jaya Motor jaminan hanya BPKB Sepeda motor anda persyarat ringan, 1 jam cair. Juga melayani jual beli sepeda motor. Hub: alamat Cabang kami di Jl. Lintas Siantar, Simp Tangsi. HP : 085373430808. Alamat Unit kami: Jl. Lintas Sei Mati, Ds Mekar Sari. HP : 085361450914


Donat Tiga Rasa Bahan : -kentang 500 gr -gula pasir 75 gr -telur 1 butir -terigu 350 gr -ragi instan (Fermipan) 1 sdm -susu bubuk 1 sdm -mentega 50 gr, lelehkan

SEBUAH penelitian baru-baru ini membuktikan bahwa semakin sering seseorang percaya pada pencitraan kisah asmara yang tidak realistis di serial televisi, maka di kehidupan nyata mereka akan semakin sulit untuk berkomitmen dalam suatu hubungan.

Cara membuat : 1. Kukus kentang, lumatkan hingga halus 2. Kocok gula + telur s/d mengembang (pakai mixer) , selanjutnya tanpa mixer 3. Masukkan jadi satu sama kentang 4. Masukkan lagi tepung terigu, ragi instan, susu bubuk, mentega yang sudah dilelehkan 5. Uleni s/d tidak lengket ditangan 6. Tutup dg lap basah selama 15 menit 7. Buka, bentuk donat 8. Goreng Cara menyajikannya : 1. Siapkan 2 piring ceper : 1. keju parut 2. Donat dioles atas dg mentega (pakai sapu kue) -meises ceres, lalu putar-putar dipiring 3. Gula pasir yang sudah siblender halus. Masukkan ke kantong plastik. Masukkan donat, kocok 4. Jadi ada 3 rasa.(int)

Tips Membentuk

Bokong BERI perhatian serius pada bokong Anda, sehingga bokong Anda akan menjadi lebih kencang dan berisi. Dalam melakukan olah raga, seringkali bagian bokong kurang mendapat perhatian. Agar otot sekitar bokong menjadi kencang, Andrea Metcalf, penulis buku Naked Fitness, berbagi tips untuk membentuk bokong menjadi kencang. Namun kuncinya adalah untuk konsisten melakukannya setidaknya seminggu tiga kali. Jika ingin terbentuk lebih cepat, lakukan setiap hari. Double Knee Leg Lift, dimulai dengan berlutut lalu perlahan turunkan posisi tubuh. Gunakan satu tangan untuk menumpu badan. Angkat satu lutut ke atas sebanyak 20 kali, kemudian tahan 10 hitungan dan ulangi 10 kali. Speed Skates, berdiri dengan kaki sejajar lalu silangkan kaki kiri ke depan kaki kanan seperti posisi skating. Letakkan kaki dalam posisi jinjit, sehingga terasa ada peregangan. Kemudian lompatlah ke sisi yang lain sehingga kaki kanan menyilang ke depan dan kaki kiri menapak di belakang. Lakukan secara bergantian. Curtsy, sejajarkan kedua kaki lalu langkahkan satu kaki ke belakang. Turunkan badan dengan menekukkan lutut Anda (lutut kaki yang menapak ke belakang jangan menyentuh lantai). Kedua kaki membentuk sudut sama sisi. Kembalikan posisi kaki hingga sejajar lalu ganti dengan kaki yang lain. Lakukan 20 kali pengulangan. Bridge Ball Curts, berbaring dengan punggung lurus lalu lakukan di atas stability ball. Perlahan angkat pinggul Anda, lalu gulingkan bola menggunakan kaki menjauh dan mendekat dari tubuh Anda. (int)


Anak Kreatif MEMILIKI anak yang memiliki daya kreativitas tinggi tentu menjadi impian setiap ibu. Meilhat anak-anak bertanya, bertingkah laku dengan kreatifitas akan menimbulkan kebahagiaan tersendiri. Berikut ini tips mendidik anak menjadi kreatif dalam kesehariannya: 1. Tidak membatasi ruang gerak anak Sifat anak-anak adalah suka mencoba hal baru dan tidak suka dibatasi. Jika anak terlalu dikekang dengan aturan ini-itu; hasilnya adalah sosok anak yang takut melakukan sesuatu karena laranganlarangan yang orang tua selalu sampaikan padanya. Oleh karena itu, biarkan anak bergerak sesuai keinginannya. Akan tetapi, tetap awasi mereka agar kreativitasnya tidak membahayakan atau bersifat merusak. 2. Memberikan pengarahanpengarahan yang sifatnya logis Anak yang kreatif indentik dengan karakter aktif, sedangkan anak yang aktif memiliki kecenderungan intelegensi yang tinggi. Mendidik anak menjadi kreatif dapat dilakukan dengan membiasakan diri untum mengarahkan anak dengan hal-

hal yang logis dan positif agar si anak terbiasa dengan hal-hal semacam itu. 3. Tenangkan diri sebelum menasehati anak Banyak orangtua yang menasehati anakanaknya dengan melibatkan emosi. Alih-alih membuat anak jera, yang ada justru anak akan semakin membangkang, atau menjadi sosok pendiam dengan kreativitas rendah. Menenangkan diri terlebih dahulu sebelum menasehati anak akan membuat mereka lebih nyaman sehingga apa yang kita sampaikan bisa diterima dengan lebih mudah. 4. Sabar dan tekun Anak-anak terkadang berulangkali melakukan kesalahan sama. Sebagai ibu, hendaklah tak pernah bosan mengingatkan dan meluruskan kesalahan anak, tentu dengan metode sepertio yang disebutkan sebelumnya. Hal ini akan membuka wawasan dan kreativitas anak tentang bagaimana ia harus berperilaku. 5. Liburan kreatif Sesekali, ajaklah anak-anak ke tempattempat yang unik, misalnya tempat wisata dengan fasilitas outbond, sentra kerajinan tangan, tempat wisata alam, dan sejenisnya. Usahakan mencari referensi tempat-tempat baru agar anak terus mendapat masukan baru. 6. Ajarkan permainan yang kreatif Permainan adalah salah satu cara efektif mendidik anak menjadi kreatif. Ajarkan anak-anak permainan yang mengasah kreativitas mereka. Di era modern ini, ada banyak referensi yang bisa anda dapatkan, misalnya dari majalah, buku, dan internet.(int)

Namun, mereka yang sangat menyukai kisah dalam drama romantis, akan merasa tidak pernah puas dalam kehidupan percintaannya, sebagaimana dilansir dari Livescience. Para peneliti melakukan penelitian terhadap 392 orang yang sudah menikah. Para responden diberi kuesioner mengenai kepuasan hubungan dengan pasangan, harapan dan komitmen, terkait dengan kepercayaan responden atas pencitraan hubungan romantis di televisi dan seberapa sering mereka menonton acara tersebut. Para responden yang mempercayai kisah drama romantis di televisi, cenderung kurang bisa untuk berkomitmen terhadap hubungan yang sedang dijalani. Mereka justru memperlihatkan adanya kecenderungan untuk berselingkuh atau memilih untuk kembali melajang. Para responden yang mempercayai pencitraan kisah cinta dalam serial televisi juga menilai bahwa hubungan yang mereka jalani membutuhkan pengorbanan besar, seperti hilangnya kebebasan dan waktu pribadi, serta pasangan yang tidak menarik. "Orang yang mempercayai kisah cinta di serial televisi merasa bahwa mereka harus membayar mahal atas hubungan yang sedang dijalani, dibandingkan dengan responden lain yang skeptis terhadap drama romantis," kata ilmuwan dari Albion College di Michigan, Jeremy Osborn. Namun mereka juga berharap kisah cinta yang sempurna seperti dalam drama romantis, sehingga mereka cenderung tidak merasa puas dengan hubungan yang sedang dijalani," ujarnya. Osborn juga mengatakan bahwa penelitian ini membuktikan bahwa serial televisi memiliki dampak dan pengaruh yang sangat besar, lebih dariyang diperkirakan sebelumnya. "Masyarakat kita terlalu tenggelam dalam pencitraan yang dipaparkan oleh media televisi dan internet, sebagian besar bahkan tidak bisa menyaring informasi sehingga memberikan dampak yang buruk," ujar Osborn. Osborn menambahkan bahwa sangat penting bagi masyarakat untuk mengetahui berbagai faktor yang memicu banyak terjadinya kegagalan dalam suatu hubungan.(int)

Sehat Berkat Sarapan Telur Telur menjadi makanan favorit sebagian orang karena kaya akan giziâ&#x20AC;? FAKTA ini juga didukung berbagai penelitian lainnya yang menunjukkan sarapan dengan telur memberikan sejuta manfaat bagi kesehatan Anda. Sumber energi. Telur rebus bisa menjadi pilihan untuk sarapan, terutama bagi Anda yang buru-buru atau sedang diet. Kuning telur dianggap efektif meningkatkan energi tubuh. Meningkatkan stamina. Protein dalam putih telur, atau disebut albumin, diyakini efektif membantu tubuh menyerap protein untuk membangun otot. Melindungi mata. Dua antioksidan, lutein dan zeaxanthin, dalam zat pigmen kuning telur membantu mencegah degerasi makula (penurunan ketajaman penglihatan) akibat penuaan. Keduanya juga melindungi mata dari kerusakan akibat paparan sinar UV. Menurunkan berat badan. Sarapan dengan telur malah membantu Anda menurunkan berat badan. Protein yang terkandung didalamnya bekerja sebagai penekan rasa lapar alami. Meningkatkan konsentrasi. Protein pada telur bisa membantu meningkatkan kadar dopamin. Inilah yang membantu meningkatkan konsentrasi dan membuat Anda tetap waspada. Perlambat penuaan otak. Kandungan kolin pada telur membantu perkembangan memori dan fungsi kognitif, serta membantu mengasah memori atau daya ingat otak lebih tajam dan mencegah demensia. Bikin kenyang. Memilih sarapan dengan dua butir telur di pagi hari membantu Anda merasa kenyang lebih lama daripada sarapan sereal atau roti panggang. Sehingga, sarapan telur bisa membantu menghentikan kebiasaan ngemil Anda diantara waktu makan. Tidak memperburuk kolesterol. Memang benar bahwa telur mengandung sejumlah kolesterol. Namun, kolesterol dalam telur tidak akan berdampak pada kadar kolesterol darah Anda. Jadi, tetap aman dikonsumsi, karena tidak meningkatkan risiko penyakit jantung.(int)



28 September 2012

Indonesia Open Grand Prix Gold 2012

Srikandi-srikandi Indonesia Melenggang Tampil di hadapan suporter fanatik Indonesia, srikandisrikandi bulutangkis Merah Putih tampil kesetanan di babak ketiga kejuaraan Indonesia Open Grand Prix Gold 2012, Kamis (27/9), di Palembang, Sumatera Selatan. Ganda putri Indonesia, Anneke Feinya Agustin/Nitya Krishinda Maheswari melangkah ke babak keempat usai menyingkirkan kompatriot mereka Gebby Ristiani Imawan/ Tiara Rosalia Nuraidah melalui pertarungan dua set, 2117 dan 21-12. Langkah Anneke/ Nitya juga diikuti Anggia Shitta Awanda/Devi A Shela

yang menaklukkan pasangan Jepang, Yuki Fukushima/Yui Miyauchi dengan rubber set, 17-21, 21-13, dan 21-19 di babak ketiga. Hasil serupa pun

diperoleh ganda putri Merah Putih lainnya, Pia Zebadiah/Rizki Amelia yang menyisihkan pasangan Indonesia lainnya, Khairunnisa Imma

Muthiah/Geovani Mareta Dea dengan straight set, 21-12 dan 21-13. Untuk nomor tunggal putri, Rusydina Antardayu Riodingin tampil mengejutkan dengan menyingkirkan unggulan ketiga asal Singapura, Xing Aiying melalui pertarungan tiga set, 2022, 23-21, dan 21-15. Renna Suwarno juga mengikuti jejak Rusydina melaju ke babak keempat usai menundukkan tunggal putri Indonesia lainnya, Tike Arieda Ningrum dengan dua set, 21-12 dan 21-17. Fanetri Lindaweni juga memastikan tiket ke babak keempat setelah menyisihkan pebulutangkis putri Jepang, Nozomi Okuhara dengan straight set, 22-20 dan 21-14. Hasil positif juga ditorehkan Adrianti Firdasari di nomor tunggal putri setelah menyingkirkan Sayaka Takahashi dari Jepang lewat pertarungan tiga set, 13-21, 21-13, dan 23-21. (int)

Ganda Putra Sapu Tiket Perempatfinal

Azarenka Tersingkir DUA unggulan dalam turnamen Pan Pacific Open yatua Victoria Azarenka asal Belarusia dan petenis Rusia Maria Sharapova tesingkir di babak perempat final, Kamis (27/9). Azarenka harus tersingkir setelah mengalami kelelahan kronis, sementara si cantik Sharapova harus mengakui keunggulan petenis Australia Samantha Stosur. Sharapova harus mengubur mimpinya untuk meraih gelar ketiganya di Tokyo setelah dalam perempat final yang penuh drama dan kualitas tinggi itu menyerah dua set langsung 6-4 dan 7-6 dari Samantha Stosur.

Unggulan kedelapan Stosur di babak semifinal akan menghadapi petenis Rusia lainnya Nadia Petrova yang menghentikan laju unggulan keenam Sara Erano dengan tiga set 36, 7-5 dan 6-3. Stosur yang hanya menang satu kali dari 11 kali pertemuan sebelumnya dengan Sharapova berhasil memulai inisiatif pertandingan dan merebut set pertama setelah pengembalian backhand Sharapova melebar. Di babak kedua laga lebih ketat dan harus diselesaikan melalui tie-break dengan angka sangat ketat 12-10. Sementara itu juara Australia

Terbuka tahun ini Victoria Azarenka mengundurkan diri sebelum laga melawan petenis Jerman Angelique Kerber dimulai karena kelelahan. Finalis Amerika Terbuka ini juga terlihat susah payah dalam laga babak ketiganya kemarin. “Sebelum turnamen saya memang merasa kurang sehat,” kata Azarenka yang mendapatkan pemeriksaan tekanan darah saat menghadapi Roberta Vinci, Rabu (26/9). “Energi saya sangat lemah dan saya bukan diri saya saat ini. Mungkin ini dampak kelelahan selama musim ini. Saya sendiri tidak tahu apa yang terjadi,” kata Azarenka. (int)

TUJUH ganda putra Indonesia berhasil memastikan diri melaju ke babak perempatfinal kejuaraan Indonesia Open Grand Prix Gold 2012 setelah menyisihkan lawan mereka masing-masing, di Palembang, Sumatera Selatan, Kamis (27/9). Ganda putra unggulan keempat, Angga Pratama/Ryan Agung Saputra tampil cemerlang saat mengalahkan pasangan Indonesia lainnya, Wahyu Nayaka/Ade Yusuf dengan dua set

Maria Kristin GANTUNG RAKET MANTAN pebulu tangkis putri nasional, Maria Kristin Yulianti, akhirnya mengundurkan diri sebagai pemain. Cedera lutut kanan yang berkepanjangan membuat Maria Kristin mengambil keputusan untuk gantung raket. Asisten Manajer PB Djarum Kudus Hastomo Arbi ketika dihubungi dari Semarang, Kamis (27/9), mengatakan sudah setahun ini peraih medali perunggu Olimpiade 2008 Beijing tersebut tidak latihan. Sebenarnya, kata mantan pebulu tangkis nasional tersebut, Maria Kristin sudah berusaha menjalani terapi,

dan beberapa kali mencoba untuk latihan. Tetapi ternyata dia merasa semakin sakit. Akhirnya, tambah pahlawan Piala Thomas 1984 (saat itu mengalahkan Han Jian dari China), Maria Kristin mengambil keputusan untuk mundur dari bulu tangkis. “Setahun yang lalu (awal Januari 2011) yang bersangkutan sudah mundur dari pelatnas,” katanya. Ia mengatakan, sekarang ini Maria Kristin menjadi pelatih di PB Djarum Kudus khusus menangani pemain muda usia 12 tahun. Prestasi terakhir yang dicapai pemain kelahiran Tuban, Jatim, 25 Juni 1985 tersebut adalah menjadi runner-up pada Russian White Nights Challenge 2011. Pada partai final dia dikalahkan rekannya Fransiska Ratnasari melalui pertarungan tiga game 15-21, 23-21, 1121. Prestasi tertinggi Maria Kristin adalah saat meraih medali perunggu Olimpiade 2008 Beijing. Saat itu Maria Kristin mengalahkan tunggal putri tuan rumah Lu Lan dengan tiga game 11-21, 2113, 21-15. Prestasi lain yang dicapai Maria Kristin adalah meraih medali emas SEA Games 2007 pada tunggal putri dan beregu putri. Dia ikut mengantarkan tim Uber Indonesia melangkah ke semifinal 2010, semifinalis tim Indonesia di Piala Sudirman Guangzhou 2009, di samping prestasi lainnya. (int)

RED BULL JENGKEL DENGAN KONSISTENSI ALONSO RED BULL Racing mengakui konsistensi driver Ferrari, Fernando Alonso musim ini merupakan hal yang menganggu bagi tim yang dibela Sebastian Vettel dan Mark Webber ini. Vettel berhasil menempati podium teratas di Grand Prix Formula OneSingapuraakhirpekanlalu.Hasil itu membuat selisih driver asal Jerman tersebut dengan Alonso menjadi tinggal 29 poin. Alonso sendiri masih bercokol di peringkat pertama klasemen pembalap dengan torehan 194 poin. Principal team Red Bull, Christian Horner masih percaya pada kemampuan Vettel, namun diakuinya penampilan Alonso membuat Red Bull kesulitan mengejar. “Sekarang, Seb (Vettel) memiliki manfaat dari pengalamannya,” jelas

Horner ketika ditanya apakah Vettel akan bisa bertahan dalam persaingan ketat musim ini. “Dia telah mendapat beberapa kesulitan selama musim ini, dan dia

tak pernah menyerah. Saya belum pernah melihat dia begitu fokus ketikaturundiGPSingapura,”terang Horner. Horner juga memuji performa Vettel yang sanggup finis

terdepan di GP Singapura kendati start dari urutan ketiga. Dia juga senang dengan hasil yang dicetak Vettel, karena mampu memelihara peluang mempertahankan gelar juara dunia F1. “Dia tampil sangat mengesankan saat race. Hasil itu membuat peluang kami untuk kembali memenangkan gelarpadamusiminikembaliterbuka lebar,” katanya. “Tetapi, satu-satunya yang menjengkelkan dan sedikit membuat kami kurang bahagia dalam euforia kemenangan adalah karena Fernando (Alonso) juga finis dengan meraih podium di akhir grand prix,” pungkasnya. (int)

langsung, 21-17 dan 21-12. Hasil serupa juga ditorehkan Jordan Praveen/ Juang Didit yang menyingkirkan rekan mereka di pelatnas, Ricky Karanda/ Muhammad Ulinnuha melalui rubber set, 21-19, 16-21, dan 21-18. Pasangan Tanah Air lainnya yang melangkah ke perempatfinal adalah Hendra Wijaya/Rian Sukmawan yang mempermalukan senior mereka di pelatnas, Markis Kido/Tri Kusharyanto dengan pertarungan tiga set, 21-15, 1821, dan 21-18. Sementara itu, Faisal Hafiz/ Rhoma Putra Eka juga menambah daftar ganda putra Indonesia di babak perempatfinal usai memulangkan pasangan Malaysia, Mohd Lutfi Zaim/Teo Kok Siang dengan kemenangan tiga set, 13-21, 21-16, dan 22-20. Langkah serupa juga diraih

ganda putra Merah Putih muda, Andrei Adistia/Christopher Rusdianto yang menundukkan pasangan Singapura, Yeo Zhao Jiang/Yi Liu melalui dua set langsung, 25-23 dan 2220. Indonesia kembali menempatkan wakilnya di nomor ganda putra lewat Gideon Markus Fernaldi/Putra Agripinna Prima yang menyingkirkan wakil Filipina, Ronel Estanislao/Paul Jefferson Vivas melalui pertarungan dua set, 21-12 23-21. Ganda putra terakhir Indonesia yang lolos ke perempatfinal adalah Yonathan Suryatama/Hendra Apriadi yang menaklukkan Rahmat Adianto/Berry Angriawan lewat rubber set, 17-21, 2112, dan 21-19. Satu tempat lagi di di nomor ganda putra diraih pasangan Korea Selatan, Kim Ki Jung/Kim Sa Rang yang menyisihkan pasangan Indonesia, Ronald Alexander/Selvanus Geh dengan melalui tiga set, 23-21, 22-24, dan 21-12. (int)

Wow, Mantan Finalis Miss Kroasia

Latih Tim Sepakbola Putra PARA pemain sebuah klub di Kroasia ini pasti akan selalu semangat saat menjalani latihan dan bermain. Karena mereka dilatih oleh seorang wanita cantik, mantan finalis Miss Sport Kroasia. Ya, klub Divisi 5 Kroasia, NK Viktorija Vojakovac telah menunjuk Tihana Nemcic sebagai pelatih. Tihana tampaknya menjadi wanita pertama yang melatih tim sepakbola pria. “Kini, saya menjadi pelatih kepala. Saya punya kebebasan untuk merumuskan taktik bagi tim,” kata Tihana kepada World Soccer. “Para pemain tahu cara menerapkan strategi itu, tapi masih banyak yang harus dibenahi.” “Mereka juga tak pernah menimbulkan masalah seperti menggoda saya,” lanjut Tihana. Para pemain takut menggoda wanita 24 tahun ini karena kemampuan olah bolanya cukup mumpuni. Tihana masih tercatat sebagai pemain di tim Dinamo Zagreb putri. Ia juga anggota tim nasional Kroasia putri. Menurut Tihana, penunjukannya sebagai pelatih sebagai hal yang wajar. Karena ia sudah lama berada di level atas sepakbola putri. “Jika pria dan wanita punya kemampuan dan kualifikasi sama untuk melatih, tak ada alasan bagi saya untuk tak melatih tim putra,” lanjut Tihana. “Saya melatih tim hebat yang selalu berkembang dan berpeluang memuncaki liga.” Jarang sekali wanita melatih tim pria, atau mungkin tidak ada. Dan Tihana bisa menjadi pioner untuk posisi itu. Untuk itu, ia pun rela menanggalkan profesi model untuk sementara. Tihana merupakan finalis Miss Sport Kroasia 2008. Saat itu, ia sempat masuk deretan 15 kontestan terbaik. (int)


JUMAT 28 September 2012


Team Chelsea Man United Everton West Brom Arsenal

M 5 5 5 5 5

M 4 4 3 3 2

S 1 0 1 1 3

K 0 1 1 1 0

SG 9-2 12-6 9-5 7-4 9-2


Nilai 13 12 10 10 9




TOP SCORER Gol 5 4 4

Nama R van Persie D Ba J Defoe

Klub Manchester United Newcastle United Tottenham Hotspur

SPANISH LA LIGA No 1 2 3 4 5

Team Barcelona Atlético Madrid Mallorca Málaga Sevilla

M 5 5 5 5 5

M 5 4 3 3 3

S 0 1 2 2 2

K 0 0 0 0 0

SG 14-3 15-7 7-3 6-2 6-2

Nilai 15 13 11 11 11

TOP SCORER Gol 7 6 4

Nama R Falcao L Messi T Hemed

Klub Atlético Madrid Barcelona Mallorca

ITALIAN SERIE A No 1 2 3 4 5

Team Juventus Napoli Sampdoria Internazionale Lazio

M 5 5 5 5 5

M 4 4 3 3 3

S 1 1 2 0 0

K 0 0 0 2 2

SG 11-2 11-2 8-5 8-5 7-5

Nilai 13 13 10 9 9

Manchester United mendapatkan lawan yang tidak ringan, Newcastle United, pada babak ke tiga Piala Liga Inggris. Namun akhirnya Red Devils pun menang dengan skor 2-1 atas The Magpies. Hal itu disambut gembira oleh bos MU, Sir Alex Ferguson.


TOP SCORER Gol 5 4 3

Nama E Cavani S Jovetic A Cassano

Klub Napoli Fiorentina Internazionale

„ Alex Ferguson

U memainkan beberapa pemain mudanya saat menjamu Newcastle diOldTrafford,Kamis(27/9)dinihari WIB. Meski begitu, mereka tetap menang 2-1 berkat gol-gol Anderson dan Tom Cleverley. “Saya sangat senang,” aku Ferguson di situs resmi klub. “Pertama-tama, mengingat ini adalah pertemuan antarklub Premier League dan Newcastle mungkin lebih kuat daripada kami secara fisik, kami menampilkan sepakbola

yang fantastis. Kami terus memainkan permainan kami dan gigih dengan itu dan juga memiliki ketenangan dalam bermain,” jelasnya. Menurut Fergie, ia sangat senang dan selalu berpikir layak menang. “Newcastle adalah tim yang sangat bertenaga,jadibagusbisamelewatimereka,”kata pria asal Skotlandia ini. MUakankembalimenghadapilawanberat di babak ke empat. The Red Devils akan melawan Tottenham Hotspur. (int)

Perjalanan Setan Merah SetelahkalahdariEvertondipekanpertama,ManchesterUnitedmelajudengan empat kemenangan beruntun. Bisakah rekortersebutberlanjutkalamenghadapi TottenhamHotspurpadaSabtu(29/9)? MUkalah0-1dariEvertonpadapekan pertama, namun langsung bangkit di pekanberikutnya.MenghadapiFulham, ‘SetanMerah’menang3-2dalamlagayang diwarnaiolehgoldebutRobinvanPersie. Eks bomber Arsenal itu kemudian jadi bintang di pekan berikutnya, ketika dia mencetak hat-trick ke gawang SouthamptondanMU,lagi-lagi,menang denganskor3-2. Didualagaselanjutnya,MUmenang4-0 atasWiganAthleticdan2-1atasLiverpool.

DuakemenanganitumasihditambahdengankemenangandiLigaChampions(1-0 atasGalatasaray)danPialaLigaInggris(2-1 atasNewcastleUnited).Sepertiyangdiperlihatkan dalam laga melawan Southampton,TheRedDevilskerapmenang,meski performamerekatidakimpresif. Sabtu(29/9),MUakanmenghadapiTottenhamHotspurdiOldTrafford.Sangcalon lawan punya catatan dua kemenangan dalamdualagaterakhir.JermainDefoejuga mulaitajamlagi.StrikerinternasionalInggris itusudahmencetaktigagoldalamduapertandinganterakhirdiPremierLeague.Spurs punyakansuntukmenyulitkan. Namun, MU punya rekor bagus kala menghadapiSpursdiOldTrafford.Dalam

empatpertemuanterakhirdiliga,MUselalu meraihkemenangan.CatatanterbaikSpurs diTheatreofDreamsdalampertandingan ligatujuhtahunterakhiradalahmenahan imbang1-1padamusim2005/2006. Hanyasaja,akhirpekaniniMUtidakakan diperkuatolehNemanjaVidic.Kaptenasal Serbia itu dipastikan absen selama dua bulankarenamengalamicederalutut.Kemungkinan,SirAlexFergusonakankembali mengandalkanRioFerdinanddanJonny Evansdisebagaiduetbektengah. SementaraWayneRooneyyangcedera ketikamelawanFulhamsudahbisadimainkanlagi.Rooneyturunsebagaistarterdalam laga melawan Newcastle, meski tidak bermainselama90menit.(int)

„ Anderson





Jumat, 28 September 2012


9 ○

Edisi 227 „ Tahun V

Program Taufan-Surya Banyak Tak Jelas




„ Surya

KISARAN-Pria yang dikenal memiliki penyakit jiwa (kurang waras,red) bernama Asfian alias Anto (50), warga Jalan Mangun Sarkoro Kelurahan Kisaran Baru Kecamatan Kota Kisaran Barat, tibatiba mengamuk tanpa diketahui penyebabnya, Kamis (27/9) sekitar pukul 16.00 WIB.


Lempari Rumah hal6

KISARAN-Gagalnya Bupati dan Wakil Bupati Asahan Taufan Gama Simatupang dan H Surya memimpin Asahan, dinilai karena tidak memiliki program tak jelas dan skala prioritas. Hal itu dikatakan anggota DPRD Asahan Rudi Hartono dan Drs Ismail ketikas ditanya soal kepemimpinan Taufa-Surya dalam kurun waktu 2 tahun ini. Disampaikan Rudi Hartono, program Taufan-Surya yang bermuara dari visi dan misi Religius, Sehat, Cerdas dan Mandiri dinilainya cukup baik. Tetapi, dalam

„ Taufan

‹‹ Baca Program ...Hal 6

Diserempet Truk Murid SD Patah Kaki BATUBARA-Ando Silahi (14) murid SD warga Desa Rawa Dolok Kecamatan Limapuluh, mengalami patah kaki, setelah sepedamotor yang dikendarainya diserempet dum truk di Jalan Desa Rawa Dolok, Kamis (29/9) siang. Data dihimpun METRO di lokasi kejadian, sebelum peristiwa kecelakaan terjadi, Ando terlihat mengendarai sepedamotor Honda BK 4802 BP membonceng adiknya Darman Silalahi (9) dan sepupunya Kamal

(12). Kala itu, Ando yang mengendari sepedamotor terlihat sedikit ugalugalan. Tiba di lokasi kejadian, tidak diketahui penyebabnya, sepedamotor diserempet dum truk sehingga ketiga murid SD itu terpental ke pinggir jalan. Sementara, supir truk langsung tancap gas meninggalkan lokasi. Warga yang melihat kejadian itu,

‹‹ Baca Diserempet ...Hal 6


„ Ando Silalahi meringis kesakitan saat berada di rumah warga selanjutnya dibawa ke klinik, Kamis (29/9)


„ Tersangka Asfian alias Anto diamankan petugas di Mapolres Asahan, Kamis (27/9).

(FOTO:SUSIL AWADY) „ Rahmat ta m ru a n g a n V pak terbaring di R karena menga S U D K is a ra n lami luka tusu kan, Kamis (27/9).

Hati-hati 3.880 Hektar Kawasan HTR Dikelola Pengusaha Sweeping Polisi Gadungan! KISARAN-Masyarakat diimbau berhati-hati dan jangan mudah terkecoh apabila diberhentikan sekumpulan pria berpakaian preman mengaku petugas Polisi yang sedang melakukan sweeping di jalananan sepi. Pasalnya, Rabu (26/9) sekitar pukul 23.00 WIB,

KISARAN-Seluas 3.880 hektar kawasan Hutan Tanaman Rakyat (HTR) di Kecamatan Sei Kepayang dipermasalahkan warga. Pasalnya, kawasan HTR yang harusnya dikelola warga ternyata dikelola pengusaha. Hal itu diungkapkan Direktur LSM Ekosistem Fadli Harun Manurung SH dan Direktur Asahan Programer Ir Muhammad Kadri kepada METRO, Kamis (27/9). Diterangkan keduanya, selama ini

‹‹ Baca Hati-hati ...Hal 7

Ibu Tak Yakin Anaknya Menjambret Kasus Penjambret Tewas Dimassa


Ini Demi Kepentingan Rakyat! BATUBARA-Aksi jalan kaki yang dilakukan seorang nelayan bernama Soemari didampigi Abbie dan Supriadi SL mengaku nekat demi kepentingan rakyat khususnya masyarakat Kabupaten Asahan.

Ketika ditemui METRO di Jalinsum Asahan-Batura Kecamatan Limapuluh, ketiganya berjalan kaki mulai dari Tugu Asahan diterpa terik panas matahari menuju Medan untuk menemui Gubernur Suma-

tera Utara (Gubsu), Ketua DPRD Sumut dan Kapolda Sumut, untuk menyampaikan berbagai permasalahan di Kabupaten Asahan.

‹‹ Baca Ini ...Hal 6

KISARAN-Nurlia (63), warga Jalan Masjid Lingkungan III Kelurahan Sei Ranto Kecamatan Datok Bandar, ibu almarhum Ganti (22) penjamabret kalung yang tewas dimassa warga di Jalan Besar Pasar XI Kelurahan Binjai Serbangan Kecamatan Air Joman beberapa waktu lalu, merasa yakin anaknya tidak menjambret dan memilih melaporkan peristiwa itu ke Polres Asahan.

‹‹ Baca Ibu ...Hal 7

pihak Pemkab Asahan dalam hal ini Dinas Kehutanan tidak berhati-hati memberikan Ijin Usaha Pemanfaatan hHasil Hutan Kayu pada Hutan Tanaman Rakyat (IUPHHK-HTR). Sehingga, program HTR justru dikuasai segelintir orang dan bekerja sama dengan pengusaha.

‹‹ Baca 3.880 Hektar ...Hal 6

Fenita Ari e

Tolak Job SINETRON KUALITAS sebagai presenter sudah tak diragukan lagi. Namun Fenita Arie enggan menjajal ke bidang akting. Apalagi sampai kejar tayang, seperti kebanyakan sinetron saat ini. Dia lebih memilih berkumpul bersama keluarga daripada harus syuting stripping. Demikian diungkapkan di Senayan City, Jakarta. “Belakangan masih syuting program teve. Sekarang banyakan off air. Aku gak milih sinetron. Kalau kerja paling lama satu jam, memang kesepakatan bersama. Jadwal di rumah lebih

‹‹ Baca Tolak ...Hal 6



28 September 2012

Divonis 3 Tahun Penjara MIRANDA BANDING „ Brigjen Ahmad Reza Pourdastan.

Iran Siap Perang dengan Israel TEHERAN- Militer Iran kembali menyampaikan kesiapannya menghadapi ancaman perang Israel. Penegasan itu disampaikan Panglima Pasukan Darat Militer Iran Brigjen Ahmad-Reza Pourdastan. ”Iran punya kesiapan yang diperlukan untuk menghadapi ancaman-ancaman dari rezim Zionis (Israel),” cetus Pourdastan seperti dilansir Press TV, Kamis (27/9). Israel telah berulang kali mengancam akan menyerang fasilitas-fasilitas nuklir Iran. Retorika perang kian gencar disampaikan Israel terkait tuduhan bahwa Iran tengah mengembangkan senjata nuklir lewat program nuklir yang dijalankannya. ”Kami memiliki rencana pertahanan laut, udara dan darat untuk mempertahankan perbatasan-perbatasan Republik Islam,” tegas pejabat militer Iran tersebut. Israel, juga Amerika Serikat dan negara-negara Eropa telah lama mencurigai Iran diam-diam tengah mengembangkan senjata atom lewat aktivits nuklirnya. Namun pemerintah Iran berulang kali membantah hal tersebut. Teheran menegaskan, program nuklirnya semata-mata untuk tujuan damai, yakni sebagai pembangkit energi bagi kepentingan sipil. Mengenai latihan penyisiran ranjau yang tengah dilakukan militer AS di Teluk Persia, Pourdastan menyebut latihan itu sebagai “pasif.” Latihan militer AS tersebut dimulai pada 16 September lalu dijadwalkan selesai pada 27 September besok. (kmc/int)

JAKARTA- Mantan Deputi Gubernur Senior Bank Indonesia, akan mengajukan banding atas Pengadilan Tindak Pidana Korupsi Jakarta yang menjatuhkan terhadapnya. Miranda menilai dirinya tidak terbukti bersalah menyuap anggota DPR 1999-2004 saat mengikuti pemilihan DGS BI 2004. Hal tersebut disampaikan Miranda dalam persidangan yang berlangsung di Pengadilan Tipikor, Kamis (27/9), seusai mendengar putusan majelis hakim. ”Saya ingin mengatakan, saya kaget, tidak menyangka. Tuhan tahu saya tidak bersalah, saya akan naik banding,” kata Miranda tegas. Sementara menyatakan masih akan pikir-pikir atas putusan majelis hakim tersebut. Dalam amar putusannya, majelis hakim yang diketuai Gusrizal menyatakan Miranda bersalah melakukan tindak pidana korupsi sesuai dengan Pasal 5 Ayat 1 huruf b Undang-Undang Pemberantasan Tindak Pidana Korupsi (UU Tipikor) juncto Pasal 55 Ayat 1 ke-1 KUHP dalam dakwaan pertama. Putusan ini yang meminta hakim menghukum empat tahun penjara.

Menurut hakim, Miranda terbukti menyuap bersama-sama aktor lainnya. Adalah Nunun Nurbaeti yang divonis dua tahun enam bulan penjara karena dianggap sebagai pemberi suap dalam kasus ini. Selama ini, Miranda berdalih kalau dirinya tidak mengetahui ihwal pemberian cek perjalanan kepada anggota DPR 1999-2004, sementara majelis hakim tidak sependapat dengan pembelaan Miranda tersebut. Menurut hakim, meskipun pemberian suap tidak dilakukan Miranda secara langsung, dia dapat dianggap ikut menyuap karena perbuatannya berhubungan dan berkaitan erat dengan perbuatan aktor lain, di ant-

„ Miranda usai menjalani persidangan di Pengadilan Tipikor Jakarta. aranya Nunun Nurbaeti, Hamka Yandhu, Dudhie Makmun Murod, Udju Djuhaeri, dan Endin Soefihara. ”Kita tidak melihat masing-masing peserta dan berdiri sendiri-sendiri, melainkan perbuatan yang berhubungan dan sebagai kesatuan perbuatan peserta lainnya,” kata hakim Anwar. Pada Mei 2004, Miranda mengadakan pertemuan dengan anggo-

ta DPR 1999-2004 asal Fraksi PDI Perjuangan dan Fraksi TNI/Polri. Dalam dua pertemuan itu, Miranda menyampaikan visi dan misinya sebagai calon DGS BI 2004. Pertemuan Miranda itu dianggap berkaitan dengan pemberian cek perjalanan kepada anggota DPR 1999-2004 oleh Nunun Nurbaeti yang dekat dengan Miranda itu melalui Arie Malangjudo. Pemberian cek berlangsung di

Mendagri Minta Kepala Daerah

Hati-hati Kelola Keuangan

„ PM Jepang Yoshihiko Noda

PM Jepang: Tak Ada Kompromi dengan China TOKYO- Perdana Menteri Jepang, Yoshihiko Noda, berkeras bahwa tidak ada kompromi dengan China soal kepemilikan kepulauan yang disengketakan. Ia juga mengecam terjadinya serangan terhadap kepentingan-kepentingan Jepang di China. Ketika berbicara kepada para wartawan pada Sidang Majelis Umum PBB di New York, Kamis (27/9), Noda mengatakan China telah salah paham tentang sengketa tersebut dan menuntut diakhirinya ancaman-ancaman terhadap warga negara dan kepentingan Jepang di China oleh para pengunjuk rasa nasionalis. “Sejauh ini, soal kepulauan Senkaku, kepulauan itu merupakan bagian menyeluruh wilayah kami menurut sejarah dan hukum internasional,” kata Noda merujuk pada sebuah kepulauan di Laut China Timur yang disebut China sebagai Diaoyu. ”Jelas sekali dan tidak ada masalah kewilayahan. Karena itu tidak bisa ada kompromi yang bisa menjadi langkah mundur dari posisi dasar ini,” katanya kepada wartawan. “Penyelesaian masalah ini tidak boleh dengan paksaan, melainkan secara tenang, dengan memberikan alasan berdasarkan penghormatan terhadap hukum internasional.” Menteri Luar Negeri China, Yang Jiechi, mengatakan kepada mitranya Menlu Jepang, Koichiro Gemba, di Perserikatan Bangsa-Bangsa pada Selasa bahwa Jepang bersalah telah “secara parah melanggar” kedaulatannya, demikian menurut kementerian luar negeri Beijing. “Pihak China tentu saja tidak akan mentolerir aksiaksi sepihak Jepang di Kepulauan Diaoyu,” kata Yang kepada Gemba, menurut keterangan kantornya. (kmc/int)

tengah-tengah uji kelayakan dan kepatutan calon DGS BI 2004. Setelah pemberian tersebut, Miranda terpilih sebagai DGS BI 2004. Dalam kasus ini, Nunun divonis dua tahun enam bulan penjara karena dianggap terbukti sebagai pemberi suap. Sementara lebih dari 25 anggota DPR 1999-2004 yang dianggap terbukti menerima cek perjalanan telah menjalani hukuman. (dtc/int)

„ Seorang jamaah haji sujud syukur begitu sampai di Madinah.

Jamah Haji Tak Perlu Cemas Virus Flu Corona JEDDAH - Jamaah haji dan keluarga di tanah air tidak perlu panik dengan munculnya virus flu bernama corona yang sudah menewaskan warga Saudi dan warga Qatar yang pernah ke Saudi. Kasi Pelayanan Kesehatan Daerah Kerja Jeddah dr Ananto Prasetya di Bandara Haji King Abdul Azis Jeddah, Kamis (27/9), mengatakan kasus virus corona belum pernah ditemukan pada jamaah haji. “Kasusnya ditemukan pada tiga orang, dua diantaranya tewas, satu warga Saudi (60) tahun dan warga Qatar (49) yang pernah berkunjung ke Saudi,” kata Ananto. Berkaitan dengan itu dia mengimbau agar jamaah haji Indonesia tidak panik

karena belum ditemukan kasus pada anggota jamaah haji dari negara lain juga. Meski demikian, dia menilai tidak ada salahnya bersikap hati-hati karena dari tiga kasus, dua meningal. Dijelaskannya, bahwa virus corona adalah virus baru yang ditemukan pada manusia dan berbeda dengan virus penyebab penyakit SARS. Virus corona diduga menyerang ginjal dan pada manusia yang bertubuh lemah. “Jadi jika kita menjaga vitalitas dubuh maka virus ini tidak bisa menyerang,” katanya. Karena itu dia mengimbau jamaah haji untuk menjaga kondisi tubuh. Dia meminta jamaah untuk makan dan minum yang cukup, banyak makanan yang

berserat, sayur dan buah-buahan. Dia menganjurkan sering minum karena saat ini udara di Saudi cukup panas di siang hari, yakni 37—38 derajat celsius pada pukul 12:00 waktu setempat Saat ini sebagian besar jamaah berusia lanjut, 50 tahun ke atas, karena itu dia mengimbau agar jangan beraktivitas banyak di luar ruangan di siang hari. Beribadahlah sesuai dengan kemampuan fisik, pilih yang wajib-wajib saja agar tidak kelelahan. Saat ini sebagian besar jamaah haji Indonesia di Madinah menunaikan shalat lima waktu selama delapan hari untuk mendapatkan arbain (40 kali shalat fardhu). (kmc/int)

Hari Ini KPK Periksa Irjen Djoko Susilo JAKARTA- Komisi Pemberantasan Korupsi (KPK) akhirnya mengumumkan waktu pe-

meriksaan terhadap tersangka kasus simuKepolisian Negara RI. lator SIM Irjen Djoko Susilo. Mantan KakoTerkait Djoko, KPK sudah memeriksa rlantas Polri itu akan diperiksa Jumat sejumlah saksi. Di antaranya adalah para per(28/9). wira polisi antara lain, Kepala Kepolisian Re”Untuk pemeriksaan sor Temanggung Ajun KomisDS saya dapat informasi aris Besar Susilo Wardono, Kebesok Jumat,” kata Juru pala Subdit Pendidikan dan Bicara KPK Johan Budi Rekayasa Direktorat Lalu LinSP, di Gedung KPK, Jl HR tas Polda Jawa Tengah Ajun Rasuna Said, Kuningan, Komisaris Besar Indra DarJaksel, Kamis (27/9). mawan, dan Kepala Polres KeMenurut Johan, DS dibumen Ajun Komisaris Besar periksa sebagai tersangHeru Trisasono. ka. Waktu pemeriksaan KPK juga sudah memeriksa mulai pukul 09.00 WIB. empat perwira polisi yang menDalam kasus simulator jadi panitia pengadaan proyek SIM ini, KPK menetapsimulator SIM 2011. Keempatkan empat tersangka atas nya adalah Ajun Komisaris Bedugaan melakukan pen- „ Irjen Djoko Susilo sar Wisnhu Buddhaya, Ajun Koyalahgunaan kewenanmisaris Besar Wandi Rustiwan, gan sehingga menimbulkan kerugian Komisaris Endah Purwaningsih, dan Komisnegara. Selain Djoko, tiga orang lain aris Ni Nyoman Suwartini. yang ditetapkan tersangka adalah KPK juga sudah memeriksa Sukotjo S Brigadir Jenderal (Pol) Didik PurnoBambang dan Intan Pardede, Sekretaris mo dan dua pihak swasta, yaitu Budi Budi Susanto, sebagai saksi untuk Djoko. Susanto dan Sukotjo S Bambang. Namun sampai saat ini KPK belum juga Ketiga tersangka terakhir itu juga memanggil Djoko sebagai tersangka. ditetapkan sebagai tersangka oleh (kmc/int)

JAKARTA- Pemerintah menghormati putusan Mahkamah Konstitusi (MK) yang meminta penghapusan aturan izin presiden bagi penegak hukum untuk memeriksa kepala daerah bermasalah. Konsekuensinya, pemerintah akan meminta seluruh kepala daerah untuk berhati-hati dalam membuat kebijakan yang berkaitan dengan keuangan daerah. ”Kita hargai putusan MK. Kita intensifkan pembinaan pengelola keuangan daerah dan pengambilan keputusan,” kata Mendagri Gamawan Fauzi ketika dihubungi, Kamis (27/9). Ia menyebutkan, adanya putusan MK ini juga berpengaruh terhadap rencana revisi UU No32/ 2004 tentang Pemerintah Daerah. Awalnya pemerintah tetap memasukkan klausul izin presiden untuk memeriksa kepala daerah. “Kita akan perhatikan putusan ini saat revisi UU Pemda,” ujarnya. Selama ini, adanya izin presiden tersebut dimasukkan dalam RUU Pemda yang merupakan revisi UU No32/2004. Pasalnya, kepala daerah merupakan perwakilan pemerintah pusat dalam melayani publik di daerah. Jika selama 60 hari izin presiden tidak keluar, penegak hukum bisa memproses lebih lanjut kepala daerah yang diduga bermasalah itu. (mdc/ int)

Angelina Sondakh

Minta jadi Tahanan Rumah JAKARTA- Angelina Sondakh, terdakwa kasus suap penganggaran proyek Kementerian Pemuda dan Olahraga serta Kementerian Pendidikan Nasional, meminta agar dijadikan tahanan rumah. Jika dikabulkan, Angelina tidak lagi mendekam di Rumah Tahanan Pondok Bambu, Jakarta Timur. Permintaan ini disampaikan Angelina atau Angie melalui pengacaranya, Tengku Nasrullah, dalam persidangan yang berlangsung di Pengadilan Tindak Pidana Korupsi (Tipikor) Jakarta, Kamis (27/9). “Kami memohon kepada yang mulia majelis hakim, terhadap urgensi penahanan terdakwa, mengingat anak terdakwa masih berumur dua tahun dan terdakwa adalah single parent. Besar harapan kami mengalihkan jadi tahanan rumah sehingga terdakwa bisa mengasuh anaknya,” kata Nasrullah. Menurut Nasrullah, sesuai Pasal 21 Kitab Undang-Undang Hukum Acara Pidana (KUHAP), sudah tidak ada lagi kepentingan untuk menahan Angelina. Pasal tersebut mengatur bahwa seseorang dapat ditahan jika berpotensi melarikan diri, menghilangkan alat bukti, atau mengulangi perbuatannya. Alasan Angelina akan melarikan diri dianggapnya tidak dapat lagi menjadi dasar penahanan karena Angie tidak akan melakukan hal tersebut. “Tidak akan mungkin karena terdakwa sudah dicegah dan sedang menjalani proses persidangan,” kata Nasrullah. Selain itu, menurut Nasrullah, kliennya tidak perlu lagi di tahanan karena tidak mungkin menghilangkan alat bukti mengingat perkaranya sudah disidangkan. (kmc/int)


28 September 2012 “Kami tidak tergesa-gesa soal ini. Kami inginkan yang terbaik. KPK sangat dibutuhkan saat ini. Kalau sampai keberadaanya tidak memiliki kekuatan, itu tidak baik juga,” Ketua Baleg Ignatius Mulyono.

Kirim Opini Anda ke email: metroasahan Maksimal tulisan 5.000 karakter

“Kami mendukung hukum mati bila memang yang dikorpsi jumlahnya besar dan mengakibatkan kerusakan yang masif terhadap perekonomian dan kehidupan bernegara. Jumlahnya mungkin di atas 100 miliar,”

Ketua Fraksi PKS Hidayat Nur Wahid.

Anggota Badan Legislatif Dimyati Natakusumah.

Wujudkan Pendidikan Berkeadilan

Sikap Kami Ancaman terhadap Supremasi Sipil PEMERINTAH dan DPR memang rajin membuat undangundang meski sering muatan undang-undang itu kandas di Mahkamah Konstitusi. Lebih memprihatinkan lagi, undangundang itu bukanlah aturan yang mempunyai tingkat urgensi tinggi. Salah satu rancangan undang-undang (RUU) yang disodorkan pemerintah ke DPR untuk dibahas saat ini ialah RUU tentangKeamananNasional.RUUitupernahdikembalikanDPR, tetapi diajukan lagi tanpa revisi. Sejumlah pasal dalam RUU itu beraroma militeristis. Artinya ingin membawa kembali TNI ke dalam urusan keamanan. Pasal 17 RUU Keamanan Nasional, misalnya, menyebutkan ancaman keamanan nasional di segala aspek kehidupan dikelompokkan ke dalam ancaman militer, ancaman bersenjata dan ancaman tidak bersenjata. Definisi itu abu-abu sehingga membuka ruang bagi TNI untuk berkiprah seperti di era Presiden Soeharto. Kita tegaskan bahwa semangat membawa TNI ke fungsi keamanan bertentangan dengan reformasi. Reformasi menempatkan TNI pada fungsi pertahanan, sedangkan fungsi keamanan dijalankan polisi. Membawa TNI ke ranah keamanan dikhawatirkan mengancamkebebasansipil,mencederaidemokrasi,danmenciptakan iklim represif. Kelak, dengan dalih mengganggu keamanan nasional,siapasajayangbersuarakritisbisadibungkam.Persyang mengkritik pemerintah bisa dengan mudah dipanggil menghadapi aparat keamanan. Definisi yang longgar dan ruang penafsiran yang elastis sangat memudahkan aparat keamanan melakukan tindakan menghabisi supremasi sipil dan kebebasan. Apalagi jika aparat keamanan diberi kewenangan khusus untuk menyadap, menyita, dan menggeledah. Kita mempunyai pengalaman panjang di rezim Orde Baru. Keterlibatan militer dalam banyak aspek kehidupan telah mengunci rapat-rapat hak sipil. Kita tidak ingin itu terulang. Bangsa ini sudah memiliki UU tentang Kepolisian, UU tentang Intelijen, UU tentang Keormasan, dan banyak undang-undang lainnya. Semua itu mengatur keamanan nasional dan membangun supremasi sipil. Jangan sampai hak-hak sipil dan kebebasan diberangus UU Keamanan Nasional. KitakhawatirRUUKeamananNasionaldibuatkarenamaraknya demonstrasimenentangkebijakanpemerintah.KitakhawatirRUU KeamananNasionaldisusunkarenamunculnyapenembakliardi Papua, Aceh, dan beberapa tempat lain. Gangguan keamanan itu mestinya bisa dipadamkan polisi. Jangan sampai ada anggapan kebebasansipilmembahayakannegara.Janganpulaadaanggapan supremasi sipil mengkhawatirkan bangsa. Kita ingatkan bahwa dinamikasipiltidakbolehdihadapidenganmengerahkanmiliter. Partaipolitikmestinyabertanggungjawabmengelolakebebasandan supremasisipil.Namun,partaipolitikhanyabisamemolitisasirakyat danmembawarakyatkedalamkepentingansempit. Meski partai politik mandul mengelola supremasi sipil, kewenangan itu tidak boleh diserahkan kepada TNI. Kita tidak ingin UU Keamanan Nasional memuat pasal-pasal virus yang menggerogoti supremasi sipil. Karena itu, sebaiknya DPR mengembalikan saja RUU itu ke pemerintah. (**)

“Saya nilai KPK ini masih rendah dalam penegakan hukum. Istilahnya kesalahan di depan mata tidak kelihatan tapi yang diufuk timur keliatan. kasus besar gak keliatan, tapi kasus kecil keliatan,”

Pendidikan merupakan modal penting dalam pembangunan. Tanpa pendidikan yang baik, sebanyak dan sebesar apapun sumber daya alam yang kita miliki akan berujung dengan kegagalan dan kesia-siaan. Tanpa pendidikan yang mumpuni hanya menghasilkan generasi lemah dan miskin kreasi. Terbukti, tata kelola sumber daya alam di negeri ini banyak dikuasai bangsa mancanegara. Sebab sumber daya manusia Indonesia masih gagap menghadapi perkembangan zaman.



CELAKANYA,pendidikandiIndonesiamasihdiskrimantif. Alhasil, diskriminatif yang makin masif mengorbankan pelbagai potensi. Apakah kita lupa atau memang tidak menyadari bahwa, pendidikan yang diskriminatif sungguh kontraproduktif? Pendidikan yang dijalankan adalah pendidikanpenuhkepalsuan.Pendidikanyangdiskriminatif, disadari atau tidak, sudah mengingkari kodratnya sebagai salah satu cara memuliakan manusia. Tesmasuk Tentusajakorbanpertamadanutamadarilakudiskriminatif adalahparamuriddanguru.Salahlangkahdalammengelola pendidikan sejak mula dilakukan ketika pendaftaran siswa baru. Pada pendidikan dasar dan menengah, baik di sekolah negeri maupun swasta akhir-akhir ini kerap mengadakan tes saringanmasuksekolah.Sejumlahsekolahdasaryangkadung disebut elitedanbonafideengganmenerimasiswabaru yang belum bisa membaca, menulis, dan menghitung (calistung). Maka terkumpullah siswa-siswa yang dikatakan pandai di satu sekolah. Terkum pul pula siswa yang digolongkan bodohdisekolahlain.Jelasinimenyalahiaturan.Sebabsyarat utama siswa untuk mengenyam pendidikan dasar adalah cukupumurdanlokasisekolahdekatdenganrumah.Dengan kata lain siapa yang mendaftar di awal, jika masih ada kuota, maka siswa tersebut mesti segera diterima. Sekolah bisa dikatakan bagus dan sukses bila menerima semua siswa tanpa labelisasi hingga semua siswa lulus sesuai dengan kemampuan yang dimiliki. Oleh karena itu, hentikan tes masuk untuk pendidikan dasar dan menengah! Sekolah harus mau dan mampu menghadapi semua siswa, tanpa mempermasalahkan tingkat kecerdasannya.

Fasilitas Sementara itu, untuk mengenyam pendidikan masih banyak penduduk negeri ini mesti berjalan kaki puluhan kilo meter dengan menuruni lembah, menyeberang sungai dan lautan. Ketika di ruang belajar-mengajar guru dan murid itu selalu dihinggapi kekhawatiran karena atap sekolah terancam runtuh. Manakala membutuhkan kepustakaan atau alat peraga mereka hanya bisa berharap karena fasilitas yang dijanjikan tak kunjung datang. Saat hendak mendapat dana bantuan, mereka kerap kecewa karena dana itu selalu telat dan nominal yang diterima sudah menyusut di tengah jalan. Ketika tidak adanya pemerataan pendidikan, jangan seenaknya menyamakan mereka dalam format ujian nasional, misalnya. Ketika tidak ada ketenangan dalam menempuh pendidikan, jangan terlalu berharap menghasilkan peserta didik yang berkualitas wahid. Anak-anak memang selalu menjadi korban. Mereka adalah korban dari kebijakan yang tidak berkeadilan. Mereka adalah korban dari sejumlah kepentingan yang menguntungkan sebagian golongan. Masa ceria anak-anak dan masa depannya sejak dini sudah dirampas orang-orang yang tak berperikemanusiaan. Beban pelajaran Tak percaya? Saat mendampingi anak-anak Sekolah Dasar IslamAl-Azhar27Cibinongdalamekskulsastradanjurnalistik saya kerap menghadapi anak yang mengeluh dengan sejumlah pelajaran yang terus bertambah. Keluh-kesah yang salah satunya dilontarkan oleh Sinta Oktaviani Wahyu Widodo, saya sarankan ditulis dalam bangunan cerpen. Beruntung dimuat koran Pikiran Rakyat, Minggu, 29-5-2011. Dalam cerpen berjudul “Canat-cenut di Kelas Empat,”

seperti yang diapresiasi Etti RS, cerpen itu menyajikan topik tentang pelajaran di sekolah. Melalui tokoh bernama Caca, tergambarlah beban pelajaran di kelas empat sekolah dasar yang begitu banyak. Caca seolah mewakili kenyataan zaman sekarang tentang muatan mata pelajaran di sekolah dasar yang begitu banyak dan membuat stres para siswa. Meski fiksi (anak), cerpen tetap berangkat dari kenyataan. Dan kenyatandalampendidikandasarhariiniadalahpendidikan yang membuat beban pikiran para peserta didik menjadi “cenat-cenut.” Pendidikan yang mestinya menggembirakan dan mencerahkan malah menjadi beban pemikiran. Anak-anaklah korban nyata dari perkembangan generasi tua yang memorak-porandakan Indonesia. Ketika gunung digunduli,sungaidanlautandikotori,sertakualitasalamyang terus mengalami kemerosotan anak-anaklah yang pertama mendapat“hukuman.”Atassaranparaaktivislingkungan,atas pertimbangan para pemikir, dan atas kebijakan para pejabat negara, dikeluarkanlah agar anak-anak sekolah dasar mendapatmatapelajaranpendidikanlingkunganhidup(PLH).Inti dari PLH saya setuju, akan tetapi dengan menambahkan jumlahpelajarankepadaanak-anaksudahmenjadikananak sebagai karung yang siap menampung pelbagai saran dari para pemangku kepentingan. Patut diingat, mata pelajaran standar yang saat ini mesti dihadapai anak-anak lebih dari sepuluh mata pelajaran. Dari sejumlah mata pelajaran itu umumnyaberisihapalan-hapalan. Sementara itu, menyambut internasionalisasi yang kian masif,anak-anaksekolahdasarpundiwajibkanmendapatkan muatan internasional, umumnya memilih pelajaran bahasa Inggris. Tak cukup pelajaran bahasa Inggris, sekolah yang dikatakan “bonafide,” “elite,” atau “unggul” mereka pun membagi-bagimatapelajaran:IPAdalambahasaIndonesiadan SciencepelajaranIPAdalambahasaInggris;Matematikadalam bahasa Indonesia danMath pelajaran Matematika dalam bahasaInggris.Tentusajabuku,guru,dancarapembelajarannya punberbeda.TakmaukalahdenganpelajaranbahasaInggris, untukmenyaringpembaratan(westerenisasi)parapejabatdi daerahmewajibkanmatapelajaranmuatanlokal.Misal,biladi JabarmunculmatapelajaranmuatanlokalbahasaSunda,maka diJatimadamuatanlokalke-NU-an. Kita tahu, salah satu penyakit akut Indonesia saat ini adalah ihwal korupsi. Koruptorlah yang menggerogoti kekayaan nusantara. Anak-anak juga yang mesti menanggung beban. Yaps, atas desakan pelbagai pihak maka sejak dini mesti ada pendidikan antikorupsi. Maka bertambahlah mata pelajaran yang mesti dihadapi peserta didik. Tak cukup itu, terkenang dengan masa silam, para peserta didik juga disarankan mendapatkan mata pelajaran budi pekerti. Bejibunnyamatapelajaranyangmestidihadapianak-anak adalah salah satu bentuk lain dari diskriminasi atau ketidakadilan pendidikan. Masa kanak-kanak yang baiknya diisi dengankeceriaanmalahdirecoki saran-saranbuahdaripara pemangku kepentingan dan para aktivis kemasyarakatan. Hak hidupnya untuk bermain terpaksa hilang karena mesti menghadappi banyaknya mata pelajaran. Okeh,ihwalbuku,guru,ataubiayameskisudahdanmahal bisa dicari, akan tetapi psikologi anak yang bisa stres berat karenabebanyangterpaksadiembansiapaberanimenjamin untuk mengatasi? Silakan renungkan. (***) Penulis adalah Esais; praktisi pendidikan di Kota Bogor, Jawa Barat.



28 September 2012



Honda Jazz Polisi Ditabrak Anak Polisi SIANTAR- Jhonlisher Panjaitan (23), anak polisi yang bertugas di Polsek Tanah Jawa menabrak Honda Jazz silver BK 79 W milik Bripka Jepta Sitanggang, personel polisi Polres Simalungun di Jalan Ade Irma, Kamis (27/9), sekira pukul 11.00 WIB. Akibatnya korban terpaksa dirawat di RS Vita Insani. Jhonliser merupakan warga Lapangan Bola Bawah, KecamatanSiantarSelatan.SementaraBripka Jepta Sitanggang merupakan warga Jalan Rakutta Sembiring, Siantar Martoba. Informasi dihimpun METRO, sepedamotor Honda Astrea Grand tanpa plat yang dikemudikankorbanmelajudengankecepatan tinggi dari arah Pertamina menuju Pasar Parluasan. Tiba di lokasi yang berupa jalan menikung, korban tidak dapat mengendalikan kenderaannya dan langsung menabrak Honda Jazz silver yang datang dari arah berlawanan. Diduga, korban saat hendak jatuh langsung melompat dari kenderaannya sehingga tubuhnya tidak berbenturan dengan Honda Jazz tersebut. Korban lalu terjatuh ke aspal dan mengalami luka-luka di beberapa bagian tubuhnya.Sesudahkejadian,korban

lalu dibawa ke RS Vita Insani. Kondisi sepedamotor korban terlihat ringsek di bagian depan, begitu juga beberapa bagian dari sepedamotor ini ikut pecah. Sementara kondisi Honda Jazz mengalami kerusakan di bagian depan. IbukorbanNbrSianturi,ditemui di RS Vita Insani, Kamis sore menyebutkan, anaknya hendak ke tempat kawannya di Jalan Ade Irma. Suaminya merupakan personel polisi yang bertugas di Polsek Tanah Jawa. “Tadi yang menabrak juga sudah datang kemari, dia juga polisi di Polres Simalungun. Suami saya juga polisi di Polsek Tanah Jawa. Anak saya tidak mengalami luka parah, cuma pinggangnya memang masih sakit dan juga ada yangsakitdipahanya,”jelaswanita yang ditaksir berusia 40 tahunan ini. Kanit Laka Polres Siantar Iptu Sugeng Wahyudi membenarkan kecelakaan lalu lintas ini. Diduga pengendara sepedamotor tidak dapat mengendalikan kenderaannya saat menikung sehingga tergelincirdanmenabrakdepanHonda Jazz. Kedua kenderaan telah diamankan untuk kepentingan penyelidikan. (ral/dro)


BIAYA ANAK MENDESAK TUKANG ES CURI GETAH SERBELAWAN- Misdi (36), warga Parluasan Barat, Kelurahan Serbelawan, Kecamatan Dolok Batu Nanggar, Simalungun, tertangkap tangan mencuri getah lumb (getah kering, red) di Afdeling D Kebun PT Brigestone, Kamis (27/9), sekira pukul 06.30 WIB. Dia ditangkap securiti (satpam) Kebun PT Brigestone saat sedang melakukan aksinya, menuangkan getah dari pohon karet ke goni plastik. Kepada METRO, Misdi mengaku, terpaksa mencuri akibat desakan keperluan biaya sekolah kedua anaknya. Sebab beberapa hari terakhir, cuaca hujan, sehingga penghasilannya dari menjual es tidak mencukupi. “Saya pedagang es keliling. Karena cuaca musim hujan, dagangan saya pun tidak laku. Sementara kebutuhan keluarga dan biaya sekolah kedua anak sudah mendesak, makanya saya terpaksa mencuri,” ujarnya. Ia mengaku, aksi pencurian itu tidak dia rencanakan, dan tiba-tiba niat mencuri karena desakan keperluan uang. Pria kelahiran 5 Mei 1976 ini, mengaku baru pertama kali mencuri, namun langsung tepergok satpam. “Bukan niat mencuri, tapi karena desakan biaya sekolah anak-anak saja,” ucapnya sambil menunduk. Supianto, Securiti Kebun PT



DIRAWAT-Jhonlisher Panjaitan (23) dirawat di RS Vita Insani akibat kecelakaan lalu lintas di Jalan Ade Irma Suryani Siantar, Kamis ( 27/9).



Gara-gara Dahan Rambutan TetanggaDisiramAirSelokan SIMALUNGUN– Terdakwa Morlan Sitorus (45) menyiram air selokan ke wajah Parulian br Pardede, tetangganya di Huta Cinta Dame I, Nagori Bah Jambi II, Kecamatan Tanah Jawa, Simalungun. Morlan tidak terima ditegur karena memotong dahan pohon rambutan milik korban yang mengenai atap seng rumahnya. Tapi terlepas dari motif itu, ulah Morlan ini membuat citra Huta Cinta Dame ternoda. Perselisihan ini terungkap di persidangan yang digelar di Pengadilan Negeri (PN) Simalungun, Kamis (27/9), dengan agenda keterangan saksi korban. Sidang dipimpin Monalisa beranggotakan Siti Hajar dan Silvia Ningsih. Parulian br Pardede, korban yang dihadirkan jaksa Viktor Situmorang menceritakan, saat itu hari Selasa 5 Juni 2012, sekira pukul 18.00 WIB. Dia mengaku baru pulang melayat, orangtuanya meninggal dunia. “Kemudian saya menyempatkan diri memberi makan ternak di belakang rumah,” kenang korban. Dia menerangkan, saat memberikan makan ternak babi tersebut ia merasa suasana berbeda di sekitar rumahnya. Setelah diperhatikan, ternyata dahan pohon rambutan yang saat itu tengah berbuah lebat sudah dipotong terdakwa. “Saat itu, pohon ram-

butan saya tengah berbuah lebat, tapi sebagian dahannya sudah dipotong oleh terdakwa. Memang dulu terdakwa pernah meminta saya untuk menebang pohon tersebut,” akunya. Lanjut saksi korban, setelah berada di teras rumahnya ia melihat istri terdakwa Klara sedang duduk di sebelah rumahnya. Saat itu, ia pun memanggil istri terdakwa untuk mempertanyakan maksud pohon rambutan miliknya dipotong. “Setelah itu, suaminya langsung datang dan mengaku sebelumnya dia sudah memperingati saya supaya dahan pohon rambutan yang mengenai seng rumahnya ditebang. Memang saya sendiri tidak mengamini permintaan tersebut,” ujarnya. Menurut dia, tidak beberapa lama kemudian terdakwa langsung mengambil air parit dari depan rumahnya dan menyiramkan kepada dirinya. Akhirnya air parit tersebut membasahi tubuh korban. Akibat perbuatan terdakwa tersebut, ia pun melaporkan terdakwa ke Polsek Bangun. “Usai kejadian itu, dia tidak mau meminta maaf kepada saya hingga saya kesal dan melaporkan perkara ini ke proses hukum. Tapi setelah terdakwa ditangkap dan ditahan, ia langsung mendatangi saya dan meminta maaf,” sebut korban singkat. (mua/dro)

Toko Jawa Dibobol Maling BANDAR- Toko Jawa, salahsatu kedai kelontong di Jalan Sandang Pangan Nomor 49, Keluruhan Perdagangan III, Kecamatan Bandar, dibobol maling, Rabu (26/9), sekira pukul 04.30 WIB. Setelah dicek, korban kehilangan rokok berbagai merk dengan total kerugian mencapai Rp30 juta. Informasi dihimpun, kejadian itu diketahui korban Sukardi, saat hendak membuka toko pada Rabu (26/9), sekira pukul 04.30 WIB. Namun ia terkejut ketika melihat ada bekas congkelan di tokonya. Setelah dicek, rokok dari berbagai merk raib. Diperkirakan kerugian korban mencapai Rp30 juta. Trimo, anak Sukardi pun melaporkan kejadian itu ke Mapolsek Bandar. Polisi yang menerima laporan itu. Kepada METRO Kamis (27/ 9), Sukardi mengatakan, tetangganya ada yang sempat melihat mobil Toyota Avanza warna

hitam parkir di sekitar Toko Jawa itu, pada Selasa (25/9), malam, sekira pukul 01.30 WIB. Namun, tetangganya itu sama sekali tidak menaruh curiga, kemudian melanjutkan tidur. Memang kata Sukardi, setiap malam ia tidak tinggal di toko tersebut melainkan tinggal bersama anaknya Trimo (33) di Toko Mokas yang beralamat di Jalan Merdeka, Keluruhan Perdagangan III, Kecamatan Bandar. Jadi setiap sore, setelah selesai berjualan, Sukardi selalu menggembok tokonya pakai 7 gembok sekaligus, antara lain 5 gembok untuk bagian luar dan 2 untuk bagian dalam. Kanit Reskrim Polsek Perdagangan Ipda D Sirait ketika dikonfirmasi, membenarkan adanya laporan Sukardi yang mengalami kebongkaran di tokonya. Dia mengatakan, pihaknya masih melakukan penyelidikan terhadap kasus itu. (mag-4/ dro)

Brigestone mengatakan, pelaku tertangkap tangan setelah berhasil memanen 25 kilogram getah lumb dari pohon karet. Belum sempat membawa keluar hasil curiannya itu, pelaku berhasil diamankan saat sedang masih memanen getah di Afdeling D. Dari tangan pelaku diamankan 25 kilogram getah lumb, dan sepedamotor Honda Revo BK 4402 TAD. Kemudian pelaku bersama barang bukti diserahkan ke Mapolres Simalungun, untuk diproses sesuai hukum yang berlaku. Kasubag Humas Simalungun AKP H Panggabean membenarkan telah menerima pelaku dari pihak securiti Kebun PT Brigestone bersama barang bukti getah dan sepedamotor. Untuk mempertanggungjawabkan perbuatannya, pelaku dijerat pasal 362 KUHPidana tentang Pencurian. (osi/dro)

Foto:Tonggo Sibarani.

„ Misdi, pedagang es yang ketangkap tangan mencuri getah dan diserahkan ke Polres Simalungun. Kamis (27/9).


„ Kondisi mobil Xenia yang rinsek berat setelah diamankan petugas Satlantas Polsek Bangun, Kamis (27/9). BUKIT MARAJA- Polisi mengamankan mobil Xenia BK 1042 KC dengan kondisi rusak berat di simpang ‘BM’ (maksunya: Simpang lokalisasi Bukit Maraja), Selasa (25/9), sekira pukul 20.00 WIB.Namunsaatdiamankanpolisi tidak menemukan seorang pun penumpang mobil naas itu di lokasi. Keterangan dihimpun, petugas

Satlantas Polsek Bangun malam itu, mendapat informasi bahwa terjadilakatunggaldiSimpang‘BM’, satu unit mobil Xenia yang melaju dari arah Siantar menuju Perdagangan menabrak pohon di pinggir jalan. Polisi kemudian langsung menuju lokasi guna melakukan olah TKP (Tempat Kejadian Perkara). Sampainya di sana, tak

satupun petugas menemukan korban di lokasi kejadian, yang terlihat hanya beberapa warga dan pengendara yang melintasi TKP. Ketepatan malam itu, menurut sejumlah warga, cuaca buruk dengan kondisi hujan deras. Walau demikian, petugas tetap membawa mobil itu ke Mapolsek Bangun. Selanjutnya, petugas mengecek beberapa rumah sakit terdekat guna mencari keberadaan identitas penumpang mobilnaasitu.Namudaribeberapa rumah sakit yang dikunjungi petugas, mereka tidak menemukan seorang pun koban laka lantas. SementaradiMapolsekBangun juga tidak seorang pun ada warga yang mengaku mengalami kecelakaan dan atau sebagai pemilik mobil naas itu sampai Kamis (27/ 9), sekira pukul 14.00 WIB. Dugaan sementara, mobil itu dirental dan disengaja ditinggal korban setelah menabrak pohon. (mag-4/dro)


Bibir Calon Pengantin ‘Koyak’ Tiga Jahitan DOLOK PANRIBUAN– Rosintan Sinaga (25), mengalami cacat seumur hidup. Bibirnya yang dulu merah merona ‘koyak’ (terluka, red) setelah dipukul pakai kayu bakar oleh Jusen Damanik (52), tetangga calon mertuanya di Dusun Silima Puluh, Nagori Dolok, Kecamatan Dolok Panribuan, Simalungun. Kejadian ini sebenarnya berlangsung pada Jumat 8 Juni 2012, sekira pukul 22.00 WIB. Saat itu, Rosintan Sinaga baru tiga hari di rumah calon mertuanya. Namun kembali diungkap dalam persidangan yang dipimpin Hakim Ramses Pasaribu beranggotakan Siti Hajar dan Monalisa di Pengadilan Negeri (PN) Simalungun, Kamis (27/9). Saat itu, jaksa penuntut umum (JPU) Amardi Barus menghadirkan saksi korban Rosintan Sinaga bersama suaminya Dahlan Simanjuntak (26). “Saat itu Jumat (8/6) malam, sekira pukul 22.00 WIB, saya mendengar suara lemparan batu mengenai atap rumah calon mertua. Kaki saya juga terkena lemparan batu yang masuk dari jendela. Akhirnya, saya memilih keluar

dan mencari tahu siapa yang melemparnya,” sebutnya. Rosintan menerangkan, malam itu, ia juga mendengar suara sejumlah warga setempat sedang bernyanyi menggunakan alat musik gitar. Kemudian, ia memilih keluar dan melihatnya. Tiba-tiba setelah dua langkah dari pintu rumah tersebut, ada seorang pria yang sama sekali tidak ia kenal memukulkan kayu bakar dan mengenai bibirnya. “Saat itu, kondisi di luar remangremang. Pria yang saya sendiri tidak kenal langsung melayangkan kayu ke arah saya dan bibir saya langsung mengeluarkan darah yang banyak. Saat itu, saya tidak bisa berbuat apa-apa dan memilih masuk rumah,” terang wanita yang tengah hamil tersebut. Masih kata Rosintan, kemudian calon suaminya dan keluarga mereka langsung melarikannya ke Puskesmas Tiga Dolok untuk menjalani perobatan. “Saya tidak tahu apa penyebabnya karena baru tiga hari di sana, untuk keperluan pesta pernikahan kami,” sebutnya singkat. Sementara itu, suami korban

Dahlan menyebutkan, malam itu, sebelum kejadian ia mengaku sedang bernyanyi di depan rumahnya menggunakan gitar dengan pemuda setempat. “Malam itu, kami sedang nyanyi menggunakan gitar. Kemudian istri terdakwa memaki mereka; ‘woi, kalian gak bisa diam? Hu pamate ma hamu sude (kumatikanlah nanti kalian semua),” ujar Dahlan menirukan perkataan istri terdakwa. Tak berapa lama kemudian, terdakwa keluar bersama anak dan istrinya sambil memegang kayu bakar. Saat itu, ia langsung lari dan terdakwa mengejarngejar mereka. Tak diduga istri yang dinikahinya pada Sabtu 23 Juni 2012, tersebut keluar dan langsung terkena getahnya. Bibir wanita yang kini sudah ia nikahi itu terluka tiga jahitan dipukul terdakwa. Usai mendengarkan keterangan saksi, hakim menyarankan agar keluarga terdakwa dan keluarga korban berdamai. Apalagi jarak rumah mereka hanya dua meter dan berharap agar permasalahan mereka jangan berlarut-larut. (mua/dro)

SIANTAR- Remaja putus sekolah Julius Lumban Tobing (14), ditangkap saat hendak mencuri di rumah Alfin Irwansyah (22), warga Jalan Toba I, Kelurahan Kristen, Kecamatan Siantar Selatan, Kamis (27/9), sekira pukul 17.00 WIB. Ternyata aksi itu untuk yang ketiga kalinya dilakukan Julius, aksi pertama dan kedua juga di rumah korban berjalan mulus. Informasi dihimpun, Julius tinggal bersama orangtuanya di Jalan Bahagia, Kelurahan Kristen, Kecamatan Siantar Selatan. Saat itu, Julius dengan cara mengendap-endap masuk ke pekarangan rumah korban. Lalu, dia menuju kamar belakang dan berusaha membuka pintu belakang rumah korban. Namun saat berusaha membuka pintu ini, tersangka dipergoki warga sekitar rumah korban dan warga inipun langsung membekuk tersangka saat itu juga. Sementara sebagian warga menghubungi polisi. Tak lama kemudian, aparat polisi Polsek Siantar Selatan tiba di lokasi dan mengamankan tersangka. Di Polsek Siantar Selatan, Julius mengakui telah melakukan pencurian sebanyak 3 kali di rumah Alfin Irwansyah. Pertama kali pada Senin (2/7) lalu, Julius mengambil laptop merk Zyrex dan satu dompet berisi uang Rp500 ribu. Kemudian kedua kali pada Rabu (1/8), Julius kembali mencuri dan mengambil satu infocus, satu HP serta dua kaos milik Alfin. “Aku

mencuri untuk main game point blank di warnet Putri, barang yang aku curi kemudian aku jual ke tukang stiker yang ada di dekat Rumah Potong. Laptop itu kujual seharga Rp310 ribu, uangnya sudah habis bang. Kalau infocus dan HP gak ingat aku ke mana kujual dan sama siapa kujual bang dulu,” ujar remaja yang mengaku putus sekolah dari SMPN 3 ini. Korban Alfin Irwansyah mengaku, sudah dua kali kehilangan barang dari rumahnya. Namun tidak melaporkan hal tersebut ke polisi. Hal ini dimaksudkannya agar tersangka tidak melarikan diri. Sebab selama ini, dia juga sudah curiga dengan gerak-gerik tersangka yang tinggal satu kelurahan dengannya ini. “Sudah dua kali saya kehilangan, pertama laptop sama dompet, kedua HP sama baju kaos. Tidak saya lapor ke polisi Bang. Biar si pencuri itu tidak curiga. Nah, aksi yang ketiga inilah baru ketahuan dia,” ujarnya. Kapolsek Siantar Selatan AKP Giring Damanik membenarkan adanya penangkapan pencuri yang dilakukan warga Kelurahan Kristen ini. Setelah dibawa warga, kemudian di interogasi, Julius mengakui perbuatannya. “Kita juga sudah menyita barang bukti laptop dari pedagang yang membeli dari Julius. Tersangka dijerat pasal 362 KUHPidana,” ujarnya. (ral/ dro)


„ Julian Tobing (14), warga Jalan Bahagia Siantar, diamankan di Posek Siantar Selatan, Kamis ( 27/9).


28 September 2012

Asahan, Labuhan Batu & Tanjung Balai Siap Hadirkan Kota Layak Anak MEDAN-Pemprov Sumut dan tujuh pemkab/pemko se-Sumut berjanji akan membuat sebuah kota yang diperuntukkan bagi anak-anak atau disebut Kota Layak Anak. Hal itu ditandai dengan adanya penandatanganan Nota Kesepahaman antara Pemprov Sumut oleh Plt Gubsu Gatot Pujo Nugroho dengan tujuh Bupati/ Wali Kota se-Sumut, pada acara Peringatan Hari Anak Nasional Provinsi Sumatera Utara, Kamis (27/9) di Balai Prajurit Kodam I Bukit Barisan Medan. Ketujuh kepala daerah itu selain Gatot, antara lain Bupati Asahan,

Taufan Gama Simatupang, Bupati Labuhan Batu, Tigor Panusunan Siregar, Bupati Tobasa Pandapotan Kasmin Simanjuntak, Bupati Nias Selatan Idealisman Dachi, Wali Kota Binjai HM Idaham, Wali Kota Tanjungbalai Thamrin Munthe, Wali Kota Gunung Sitoli Martinus Lase. Penandatangaan nota kesepahaman dilakukan, setelah sebelumnya Gubsu menetapkan tujuh kabupaten/kota tersebut yaitu Asahan, Labuhan Batu, Tobasa, Nias Selatan, Binjai, Tajung Balai dan Gunung Sitoli menuju layak anak. “Pemerintah pusat telah menetapkan Provinsi Sumatera Utara sebagai salah satu dari sepuluh

provinsi yang mengembangkan kabupaten/kota layak anak. Pada tahun 2010, telah saya tindaklanjuti dengan menetapkan delapan kebuoaten/kota menuju layak anak, kemudian pada tahun 2012 ditetapkan lagi tujuh kabupaten/kota menuju layak anak,” jelas Gatot yang didamping Ny Sutias Handayani. Nota Kesepahaman yang dilakukan dengan tujuh pemerintah kabupaten/kota tersebut berisi tentang kerjasama dalam pencapaian kinerja di bidang pembangunan kesejahteraan dan perlindungan anak dalam mewujudkan kabupaten/ kota layak anak di Provinsi Sumatera Utara. Dalam kesempatan tersebut

Gatot menghimbau bupati/walikota di Sumut, terutama yang sudah ditetapkan sebagai daerah menuju layak anak agar dapat menghadirkan program-program yang dapat secara langsung dirasakan manfaatnya oleh anak. Hal tersebut dalam rangka mensukseskan progam pemerintah mewujudkan 100 Kabupaten/kota layak anak pada tahun 2014. Lebih jauh lagi, Gatot menyebutkan sedikitnya ada lima hal yang harus menjadi agenda khusus pemerintan dan didukung masyarakat dan dunia usaha agar anak memperoleh haknya sebagaimana diamanatkan dalam Undang-undang Nomor 23 tahun

2002. Diantaranya, pelayanan pendidikan dan pengajaran bermutu, pelayanan kesehatan bermutu dan jaminan sosial, kebebasan berpartisipasi, beristirahat dan memanfaatkan waktu luang dan perlindungan dari diskriminasi dan eksploitasi. Deputi Tumbuh Kembang Anak Kementerian Pemberdayaan Perempuan dr DR Wahyu Hartopo Msi berharap, melalui penetapan kabupaten/kota layak anak di Sumut dapat mendorong lahirnya generasi yang baik untuk mampu bersaing di tingkat global dan meneruskan estafet kepemimpinan bangsa. Untuk menuju kabupaten/kota

layak anak menurutnya harus didukung segenap pemangku kepentingan dan dalam kesempatan tersebut, Wahyu, mengingatkan anak adalah amanah dan menyiapkan sebagai generasi yang tangguh adalah tangungjawab bersama. Puncak perayaan peringatan Hari Anak Nasional Provinsi Sumatera Utara kemarin berlangsung meriah yang dihadiri sedikitnya 1.500 anak dari berbagai sekolah PAUD, SD, TK, SD dan SMU serta anak berkebutuhan khusus dari kabupaten/kota se-Sumut (ari/ smg)

32 Pemda di Sumut Belum Patuhi Instruksi Mendagri

Kirim Laporan Keuangan Pakai Website JAKARTA-Mayoritas Pemerintah Daerah di Sumatera Utara, ternyata belum juga belum mematuhi instruksi Menteri Dalam Negeri (Mendagri) Gamawan Fauzi. Agar segera melaporkan pertanggungjawaban pelaksanaan APBD secara online, melalui website Pemda masing-masing. Dari 33 kabupaten/kota yang ada, baru Kabupaten Samosir yang melakukan hal tersebut, ditambah pemerintah Provinsi Sumatera Utara. Sementara 32 kabupaten/kota lainnya, sama sekali belum juga melakukan hal tersebut. Hal ini tentu saja sangat disayangkan Direktur Keuangan Daerah Kemendagri, Yuswandi A. Temenggung. “Padahal itu sudah ada instruksi

menterinya, dan kita coba mulai tahun ini,”ungkapnya secara khusus kepada koran di Jakarta, Kamis (27/9). Apalagi tidak hanya di Sumut, dari seluruh daerah di Indonesia, juga masih sangat sedikit yang melakukan hal tersebut. Padahal Mendagri menurut Yuswandi mengeluarkan instruksi tersebut, semata-mata guna menjamin transparansi di tengah era keterbukaan sekarang ini, dalam pengelolaan keuangan daerah. Untuk itu Direktorat Keuangan Daerah Kemendagri, ungkap Yuswandi kemudian, akan terus mendorong. Sehingga daerah dapat benar-benar menerapkan

Program Taufan-Surya Banyak Tak Jelas praktek masih jauh dari harapan. Sebut saja program Religius dan yang pendukungnya adalah Dinas Pendidikan dan telah pula sempat diprogramkan bahwa setiap hari Jumat ada program pendidikan di sekolah yang berorientasi keagamaan, tapi saat ini program ini tak jelas. Drs Ismail menilai, kegagalan kepemimpinan Taufan-Surya dapat dilihat dari program Hutan Kota,Alun-Alun Kota dan Masjid Agung yang hingga saat ini tidak terlaksana. Khusus ketiga proyek itu, sudah banyak menghabiskan anggaran masingmasing Hutan Kota Rp2,5 miliar, Alun-alun Kota Rp5 miliar dan Masjid Agung Rp15 miliar dan dana untuk ketiga proyek yang berlokasi di eks HGU PT BSP Kisaran ditampung pada APBD Asahan Tahun 2012. Seyogianya, pembangunan dilanjutkan sekitar bulan Juni–Juli 2012 lalu, tapi kenyataannya hingga saat ini belum ada tanda-tanda untuk dilakuka pembangunan. “Jika tetap dikerjakan, maka dikhawatirkan tidak akan terlaksana sesuai dengan jadwal. Dan yang paling tepat, segera dialihkan proyek itu untuk pembangunan infrastruktur seperti sarana jalan yang sangat dubutuhkan warga,” katanya. Disebutkannya, program pembangunan Taufan-Surya tidak memiliki skala prioritas. Padahal yang paling prioritas untuk masyarakat adalah pembangunan jalan. Bayangkan saja, jalan di Silo Baru dan Silo Bonto Kecamatan Silo Laut sudah 22 tahun rusak dan belum pernah dibangun. Hal itu, membuat warga resah dan kesulitan mengangkut hasil panen kopra dan kelapa sawit. “Hal yang sama masih banyak di desa-desa lain kawasan Kabupaten Asahan,” pungkas Ismail. Ditambahkan Ismail, harusnya Dinas PU Asahan yang merupakan SKPD yang mendorong program Taufan–Surya di bidang infrastruktur memiliki program nyata agar program yang dicanangkan TaufanSurya terlaksana dan tidak terjadi kegagalan. (van)

Sambungan Halaman 1 Mengamuknya Anto, sempat membuat heboh dan membuat warga Jalan Mangun Sarkoro ketakutan. Pasalnya, Anto membawa sebilah pisau dan melempari rumah salah satu warga. Tak ayay, Rahmat (35) tetangganya yang hendak menenangkan Anto, terkena 4 tikaman. Data dihimpun METRO di lokasi kejadian, Sore itu suasa di daerah itu biasa-biasa, tiba-tiba Anto keluar dari rumahnya membawa sebilah pisau dan langsung melempari rumah Rahmat. Rahmat yang baru tiba di lokasi, langsung berusaha menenangkan Anto. Melihat Rahmat, Anto bukannya tenang malah semakin mengamuk. Bahkan, antara Rahmat dan Anto terjadi perkelahian. “Mereka (Anto dan Rahmat)

Papua Barat, Maluku dan Maluku Utara. Biasanya, Ranperda Pelaksanaan APBD ini sendiri diserahkan kepada Mendagri oleh daerah, setelah diterimanya hasil audit dari BPK setiap tahunnya.“Ya sekitar itu jumlahnya. Saya belum mengecek kembali. Mungkin daerah sedang memerosesnya. Deadline penyerahannya 30 sampai September nanti,” ungkapnya. Sementara itu dihubungi terpisah, Sekretaris Jenderal (Sekjen) Sekretariat Nasional Forum Indonesia untuk Transparansi Anggaran (FITRA), Yuna Farchan, menyambut positif gagasan Mendagri yang meminta daerah melaporkan pelaksanaan APBD

sempat duel, sebelum akhirnya Anto membabi buta mengayunkan pisau yang dipegang ke tubuh Rahmat,” kata beberapa warga yang ditanyai METRO. Sementara, petugas Polres Asahan yang tiba di lokasi kejadian atas laporan warga, hampir tidak bisa berbuat apaapa karena melihat Anto masih memegang pisau masuk ke dalam rumahnya setelah berduel dengan Rahmat yang dilarikan warga untuk mendapat pertolongan. Ketika di dalam rumah, Anto bersembunyi. Dan setelah pihak keluarga dilibatkan petugas membujuk Anto, akhirnya Anto bisa diamankan dan langsung di gelandang ke Mapolres Asahan. Kepala Sentral Pelayanan Kepolisian (Ka.SPK) Polres Asahan Aiptu J Sinambela ketika ditanyai, mengaku pihaknya

menerima informasi bahwa tersangka memiliki kelainan jiwa, dan untuk menghindari hal yang tidak diinginkan tersangka langsung diamankan. Pantauan METRO di Rumah Sakit Umum Daerah (RSUD) Kisaran, korban Rahmat setelah mendapat penanganan di ruang Unit Gawat Darurat (UGD) kemudian di tempatkan di ruang V. “Korban tiba sekitar pukul 14.15 WIB, diantar keluarganya dengan kondisi mengalami luka bekas tusukan benda tajam pada bagian dada sebelah kanan, pangkal paha sebelah kiri, lengan sebelah kanan,” kata dr Eka Wilda Sari ketika ditemui di UGD RSUD Kisaran. Ditambahkannya, korban setelah ditangai lalu di foto yang nanti hasilnya, akan dikonsultasikan dengan dokter bedah.

secara online setiap tahunnya. Menurutnya, Penyediaan bentuk laporan seperti ini tentu akan mempermudah pemerintah dan pemda terkait dalam melayani permintaan dokumen atau informasi seputar APBD oleh publik. “Jadi tidak hanya pelaksanaan APBD saja, pelaporan secara online itu sebaiknya juga turut mencantumkan dokumen anggaran lainnya. Seperti perencanaan anggaran, sehingga publik dapat mengkaji dan memelajarinya. Jadi kita melihat instruksi tersebut memang ini cukup tepat. Dan tentu sebaiknya Kemendagri juga harus dapat memberikan contoh kepada daerah, misal mencantumkan laporan keuangan setiap tahun secara online di website Kemendagri,”ungkapnya sedikit mengkritisi.(gir)

Diserempet Truk Murid SD Patah Kaki Sambungan Halaman 1

Sementara Rahmat tampak terbaring lemah di ruangannya dirawat dan tidak banyak memberikan kometar. “Ngak tahu apa sebabnya, tiba-tiba abang itu (Anto,red) menyerangku dengan sebilah pisau,” katanya sembari meringis menahan sakit. Terpisah, keluarga menolak memberikan keterangan ketika METRO mencoba bertanya soal peristiwa itu. “Maaf ya kami masih bingung dan tolong jangan diganggu,” kata seorang perempuan yang mengaku kakak Rahmat. Terpisah, Asfian alias Anto ketika ditanyai memberikan jawaban mengambang dan enteng pertanyaan METRO. “Sudah lama dibiar-biarkan, tapi semakin menjadi jadi dia ( Rahmat,red) mencuri barangbarang di rumahku,” katanya sembari tersenyum.(sus)

langsung memberikan pertolongan kepada ketiga korban. Diketahui, Anto selain mengalami patah kaki, juga mengalami luka-luka serius. Sementara adikya Darman dan sepupunya Kamal tidak sedikitpun mengalami luka, namun terlihat trauma langsung dibawa warga ke salah satu klinik di daerah itu. Menurut warga, Ando dan Darman di daerah itu tinggal bersama oppungnya S Silalahi (72), karena kedua orangtua mereka merantau ke Bengkulu. Disebutkan warga, S Silahi sudah kerap menegur dan melarang Ando untuk tidak mengendarai sepedamotor kencangkencang, tetapi kerap tidak didengarkan. Kepala Poslantas Limapuluh Aipda J Sihaloho ketika dikonfirmasi, membenarkan peristiwa itu dan pihaknya sedang melakukan penyelidikan dan pengejaran terhadap truk yang menyerempet sepedamotor korban.(CK-1)

3.880 Hektar Kawasan HTR Dikelola Pengusaha Sambungan Halaman 1

Ini Demi Kepentingan Rakyat! Sambungan Halaman 1 Selain soal maraknya pukat harimau, ketiganya akan menyampaikan persoalan tanah di Asahan. “Di Asahan, tuntutan kami tidak didengarkan. Sehingga kami rela berjalan kaki ke Medan. Dan ini semua demi rakyat,” ujar ketiganya. (CK1)

Tolak Job SINETRON Sambungan Halaman 1


„ Soemari dan Supriadi serta Abie saat berada di Jalinsum Asahan - Batubara Kecamatan Limapuluh dalam rangka aksi jalan kaki menuju Medan menemui Gubsu, Kamis (27/9).

Anggota SPS No.: 438/2003/02/A/2007

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Wakil Pimpinan Perusahaan: Pimred Metro Siantar : Pj Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wapimred Metro Tapanuli : Tim Ombudsman :

APBD secara online, tidak hanya berhenti di tingkat provinsi semata. Namun terus hingga ke tingkat kabupaten/kota. Selain itu, Kemendagri menurutnya Yuswandi, saat ini juga terus mendorong pemerintah provinsi untuk segera menyerahkan Rancangan Peraturan Daerah (Ranperda) Pelaksanaan APBD secara tepat waktu kepada Pemerintah untuk dievaluasi. Hal ini penting, karena paling tidak terdapat delapan provinsi yang belum menyerahkan laporan pelaksanaan APBD Tahun 2011 kepada Mendagri. Masingmasing, Provinsi Nanggoroe Aceh Darusssalam, Kepulauan Riau, Lampung, Sulawesi Barat, Papua,

Lempari Rumah & Tikam Tetangga

Sambungan Halaman 1

banyak,” katanya. Untuk itu, Fenita pun mengaku lebih senang mengambil program atau acara yang mudah dan ringan lantaran bisa mengajak anak-anaknya ke lokasi. “Jiwa ibu rumah tangga saya juga kental. Saya memang menyadari kerjaan saya ngabisin waktu. Menyiasati kumpul keluarga gimana. Di weekend ini kumpul, memang ada planning ke Bali, dua sampai tiga bulan sekali harus kumpul keluarga,” tandas istri Arie Untung lalu tersenyum. (int)

pertanggungjawaban APBD secara online melalui proses fasilitasi. Kemendagri juga telah menyusun jenis-jenis laporan keuangan apa saja yang dapat dicantumkan dalam laporan keuangan daerah tersebut. Diantaranya seperti dokumen perencanaan anggaran hingga pelaksanaan APBD setiap tahunnya. “Karena pelaporan pelaksanaan APBD secara online ini, juga bagian dari upaya melaksanakan keterbukaan informasi kepada publik. Beberapa pemerintah provinsi memang telah mulai mencantumkan pelaksanaan APBD-nya dalam situs resmi mereka.” Sehingga Yuswandi berharap, agar pelaporan

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Goldian Purba Marganas Nainggolan Maranatha Tobing Darwin Purba Pandapotan MT Siallagan Pandapotan MT Siallagan Muhiddin Hasibuan Eva Wahyuni Daniel Simanjuntak Vincent Wijaya

Departemen Redaksi METRO ASAHAN Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Darwin PurbaEva Wahyuni, Syafruddin Yusuf,Hermanto Sipayung, Redaktur Pelaksana: Syafruddin Yusuf, Asisten Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter: Irvan Nasution (Kisaran), Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai) METRO SIANTAR Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Pandapotan MT Siallagan, Leonardus Sihotang, Redaktur Pelaksana: Leonardus Sihotang, Kordinator Liputan: Chandro Purba, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nurjannah, Asisten Redaktur: Pala MD Silaban, Hezbi Rangkuty, Edi Saragih, Reporter: Ikror Amin, Tonggo Sibarani, Imelda Purba,Pra Evasi Haloho, Soetomo Samsu (Jakarta)), Irwansyah(TanahJawa), Jetro Sirait (Parapat), Marihot Sinaga (Raya), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok). Sekretaris Redaksi: Yanti Nurhapni METRO TAPANULI Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing, Pandapotan MT Siallagan, Daniel Simanjuntak, Syafruddin Yusuf, Redaktur Pelaksana: -, Kordinator Liputan: Nasa Putramaylanda, Reporter: Ridwan Butar Butar, Marihot Simamora, Aris Barasa, Freddy Tobing, Dungo Siburian, Saut Situmeang, Masril Rambe (koresponden Barus), Rinawati Marbun (koresponden barus), Horden Silalahi (Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput)

METRO TABAGSEL Dewan Redaksi: Marganas Nainggolan (ketua), Maranatha Tobing , Muhiddin Hasibuan, Plt Redaktur Pelaksana: Nurjannah, Kordinator Liputan: Borneo Dongoran, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Tohong Harahap (Paluta),Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina) Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin, Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Rudy handa Syahputra, Handoko, Aulia Yusuf, Mounting: Samuel Sihotang, Dedi Damanik, Amran Nainggolan, Nico HS, Kordinator Teknisi, Maintenance IT: Irwan Nainggolan, Staf Operasional Website: Hotlan Doloksaribu,Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlinson Saragih, Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Penagihan: Sri Aman, Staf Pengembangan: Simson Winata, Ismail, Ponco, Kordinator Ekspedisi: Jhon Tua Purba, Staf Ekspedisi: Ardi, Roy Amarta, Ferdinan. Departemen Iklan Manager Iklan: Jamot S, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan Group: Tio Maria, Kabag Design Iklan: Holden Simanjuntak, Staf Desaign:Reliston Purba

Dilanjutkannya, ada beberapa indikator yang menjadi persoalan serius di antarnya, berdasarkan laporan yang diterima bahwa Koperasi Hutan Tani Amanah (KHTA) sebagai pemegang hak pengelolaan HTR melakukan atau memakai pola mandiri. Tapi kenyataan di lapangan, bekerja sama dengan perusahaan di Medan. Untuk itu, Dinas Kehutanan diminta melakukan pengecekan guna memastikan pola yang diterapkan KHTA. Bila ternyata menggandeng pengusaha dan tidak melibatkan masyarakat banyak dan hanya segelintir orang untuk memperkaya diri sendiri, agar segera izinnya HTR-nya dicabut. Sebab, berdasarkan SK Kemenhut RI Nomor.471/Menhut-UU/2010, 3.880 hektar lahan itun merupakan kawasan hutan p r o d u k s i tidak produktif. ”Program ini harus pula menjamin kelestarian sumber daya alam dengan menanam jenis kayu hutan serupa seperti segan, jabon dan sejenisnya dan bukan mengolah hutan sembarangan untuk kepentingan bisnis. Sementara Ketua Komisi A DPRD Asahan Drs Sofyan Ismail ketika ditanya mengenai HTR mengatakan, agar izin HTR itu dicabut bila diketahui melanggar aturan. ”Jangan main-main dengan program ini, kalau menyalah izinnya langsung saja dicabut,” tegas Sofyan. (van)

Perwakilan Metro Tapanuli Ka Perwakilan/Ka Biro Usaha: Kristian Sembiring, Staf Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari, Staf Pengembangan: Zulfiandi, Arnold Simbolon (pengembanan daerah Taput) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Koordinator Pengembangan: Ahmad Suhaimi Lubis, Adm/Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Kordinator Pengembangan: Marshall Leo Siagian, Adm/keuangan: Revina Sihombing, Staf Piutang Iklan/Koran: Annisa, Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


JUMAT 28 September 2012

Pegawai PDAM Terlibat Pemasangan Jaringan Pipa Ilegal

Wali Kota Lepas 154 Calhaj Sambungan Halaman 8

bangga dengan banyaknya masyarakat yang melaksanakan ibadah haji tahun ini dari Tanjungbalai. “Saya berharap kepada calhaj untuk menjaga kesehatan. Karena perubahan iklim di Makkah pasti akan mempengaruhi kesehatan,” tambah Thamrin. Salah seorang calhaj Ir H Mirzal mengaku keberangkatan

haji tahun ini cukup baik. “Kami berterimakasih kepada Wali Kota Tanjungbalai yang telah melepas pemberangkatan kami ke Asrama Haji Medan,” katanya. Hadir dalam acara pelepasan calhaj Kakakn Kamenag Tanjungbalai, Kapolres Tanjungbalai, Dan Lanal, Sekdakot, Asisten I, Asisten II, dan Kabag Humas serta para undangan. (ilu)

Sambungan Halaman 8

pipa secara ilegal di Jalan HM Nur Gang Suka damai Kelurahan Pahang,KecamatanDatukBandar Tanjungbalai. Sesuai hasil investigasi tim yang dibentuk, tercatat warga yang melakukan pemasanganpipasecarailegaltelah membayar Rp1.350.000 kepada

Pengerjaan Jalan Setapak diPantaiJohorDidugaAsalJadi Sambungan Halaman 8

annya tidak sesuai bestek dan diduga asal jadi. Pembangunan ini merupakan proyek Dinas Pekerjaan Umum (PU) Tanjungbalai. Biaya pengerjaan proyek ini mencapai Rp154.060.000 dan dananya dari APBD 2012. Anto (30) warga Jalan Jenderal Sudirman Tanjungbalai, Kamis (27/9) mengatakan, warga di Jalan Jendral Sudirman bingung dengan biaya pembuatan jalan setapak di Jalan Tomat. Pasalnya pada plank proyek tidak ada dicantumkan berapa biaya pengerjaannya. Selain itu, kuat dugaan pengerjaan proyek ini tidak sesuai bestek dan asal jadi. Di mana dalam pengerjaan jalan tersebut tidak pernah ada pengawas yang melakukan pengawasan atas pengerjaan proyek itu. Sehingga pihak kontraktor bisa saja sesuka hatinya dalam mengerjakan proyek tersebut.

pasir sungai itu. Padahal, pengerukan itu jelas-jelas membahayakan masyarakat sekitar. “Saya miris jika melihat lemahnya pengawasan pemerintah terhadap pengusaha galian C ini. Kami juga sudah lama memantau aktifitas galian C di Perdagangan ini. Mereka itu sudah mengeruk pasir berlebihan,” katanya. Dijelaskannya, akibat dari pengerukan itu, tepi sungai akan memiliki kedalaman berbebada dengan yang lain. Kondisi ini bisa membahayakan warga sekitar saat berkunjung ke tepi sungai Bahbolon. “Kedalamannya jelas jauh berbeda dengan lokasi yang di sekitarnya. Jika ada anak-anak atau warga yang bermain di sekitar lokasi, tentunya akan tenggelam. Sebab kerukan pasir ini sudah terlalu dalam,” katanya. Untuk itu, Pemkab Simalungun diminta tegas menyikapi-

nya. Jika eksploitasi galian C ini terus berlangsung, dikhawatirkan berdampak pada rusaknya lingkungan. Kemudian air sungai bisa menjadi ancaman bagi masyarakat sekitar. “Soalnya pasir yang mereka keruk akan habis di lokasi. Setelah itu mereka akan pindah ke lokasi lain,” jelasnya. Warga Dukung APL Terpisah, beberapa warga Perdagangan mengaku siap mendukung aksi APL untuk menyelamatkan lingkungan. Menurut salah seorang di antaranya, Usnul Sinaga (43), ia siap mendukung APL untuk mendesak Pemkab Simalungun menghentikan aktifitas galian C di Perdagangan ini. “Kami sudah banyak dirugikan akibat keberadaan galian C menggunakan alat berat itu. Mereka memonopoli harga dagang pasir di Perdagangan dan sekitarnya. Kami secara perlahan-lahan menjadi tersisih,” katanya. (mag-02/hez)

Selain itu juga ditemukan pemasangan pipa secara ilegal atas nama Asmalinda warga Gang Amanah Jalan M Abas, dan atas nama Asnah Situmorang warga SumberSariKecamatanSeiTualang Raso. Zaharuddinmengatakan,sesuai laporan tim kepadanya, ada pegawai PDAM yang terlibat,

bahkan pegawai tersebut menduduki jabatan strategis di PDAM. Zaharuddin berjanji akan menindaktegasbawahannyayang melakukan pemasangan pipa secara ilegal ke rumah warga. SementaraMuhammadKosasih mengatakan, uang yang diberikan warga untuk pemasangan pipa air itu tidak disetor ke Kas PDAM Tirta

Kualo Tanjungbalai. Pihaknya memperkirakan ada 200 ratus sambungan pipa air yang terpasang secara olegal ke rumah masyarakat. “Kami memprediksi perbuatan ini dilakukan orang dalam di antaranya ada memiliki jabatan strategisdiPDAM,”kataMuhamad Kosasih. (ilu)

Jalan Nagori Huta Raja Rusak Parah

Terpisah, beberapa pekerja pembangunan jalan itu mengaku tidak tahu berapa biaya yang digunakan untuk pembangunan jalan itu. Menurut para pekerja yang meminta namanya jangan di korankan, mereka hanya sebagai pekerja, dan yang mengetahui biaya pengerjaannya adalah kontraktor. Namun saat itu kontraktor pengerjaan proyek jalan itu sedang tidak berada di tempat. Terpisah, Kepala Dinas PU Tanjungbalai Ir H Abd Aziz MM melalui Sekretaris PU Susanto mengatakan proyek di Jalan Tomat berbiaya Rp154.060.000. Proyek ini menggunakan Anggaran Pendapatan Belanja Daerah (APBD). “Harapan saya pekerjaan itu lebih bagus agar pembangunan dapat bertahan lama. Jika pihak kontraktor macam-macam akan kita panggil. Di mana yang kurang bagus pengerjaannya akan kita minta untuk diperbaiki,” katanya. (ilu)

SIMALUNGUN-Walau sudah beberapa kali dibawa ke dalam musyawarah rencana pembangunan (musrembang) tingkat nagori, kecamatan dan kabupaten, namun perbaikan Jalan menuju Nagori Huta Raja Kecamatan Purba, yang rusak parah tidak pernah diperbaiki. Jalan sepanjang kurang lebih 5 km mulai dari pasar hitam di Pamatang Purba ini menghubungkan huta ke huta (dusun, red) telah 20 tahun digunakan warga masih tetap beralas tanah. Kondisinya, rusak parah, lobanglobang besar dan menganga terlihat di badan sepanjang jalan.


„ Kondisi jalan yang rusak parah menuju Nagori Huta Raja. Satu unit mobil anak rantau yang pulang kampung terpaksa ekstra hati-hati melalui jalan tersebut. Kerusakan jalan tersebut, 10 tahun terakhir bertambah parah. Pasalnya, jalan ini sempat dilalui

truk-truk bermuatan kayu-kayu balokdarihutanyangdidugaillegal logging dan saat ini sudah selesai

KPUD Tes Wawancara Calon PPS dan PPK

Sambungan Halaman 8

495 peserta untuk PPS dari 7 kecamatan dan 54 peserta untuk PPK. Humas KPUD Batubara Taufik Asbdi Hidayat SSos mengatakan, acara ini diselenggarakan berdasarkan petunjuk KPU pusat dan untuk menjaring peserta PPS. Karena pelaksa-

Stop Galian C Pakai Alat Berat! Sambungan Halaman 8

oknum tertentu. Selanjutnya ditemukan juga warga yang memasang pipa air secarailegalatasnamaLisnaHayati warga Jalan Sepakat Lingkungan I Kelurahan Pahang dan sudah setahun melakukan sambungan ilegal dan sudah menyetor Rp1.400.000 kepada oknum pegawai PDAM.

naan Pilgubsu sudah semakin dekat. Nantinya pihak KPU akan menetapkan siapa saja yang berhak menjadi peserta PPS dan PPK. “Sesuai data yang kita miliki, jumlah peserta untuk PPS ada 495 orang yang terdiri dari 7 kecamatan. Sedangkan untuk PPK ada 45 orang dari seluruh kecamatan se Batubara,” kata-

nya. Sementara beberapa peserta yakni Edi (36), Faisal (38) dan Heri (34) mengatakan, mereka mengikuti seleksi peserta PPS karena ingin menyukseskan pelaksanaan Pilgubsu yang akan dilaksanakan 2013 mendatang. Faisal menambahkan, ia berharap agar bisa lulus menjadi peserta PPS. (ck1)

BSP Kisaran Pecundangi Padasa 5-3 Sambungan Halaman 8

wah PT Padasa terpaksa bermain sapu bersih untuk menyetrilkan keadaan. Jual beli serangan terus diperagakan para pemain. Namun serangan para pemain PT BSP Kisaran lewat gelandang serangnya Iwan Susanto, Zulfan dan Saman yang bermain tanpa lelah untuk mengalir seranganserangan berbahaya ke striker lincahnya Zulfan membuahkan hasil. Baru menit ke-2, pemain PT BSP Zulfan berhasil mencetak gol. Pada menit ke 15, Iwan Susanto pemadin PT BSP kembgali mencetak gol. Namun Rusli Rudianto pemain sayap kanan PT Padasa

berhasil mencetak gol balasan di menit (18). Di menit ke 20 pemain PT BSP kembali menyarangkan bola ke gawang PT Padasa. Namun Nelson Manurung pemain Padasa berhasil memperkecil kekelahan di menit ke-27. Hingga babak pertama berakhir tim PT BSP unggul 3-2. Memasuki babak kedua pertandingan semangkin ketat. Para pemain PT BSP Kisaran yang tidak puas dengan pundipundi golnya terus menyerang lini pertahanan PT Padasa yang sedikit mulai rapuh. Para penyerang PT BSP Kisaran. M Saleh Malawat pemain PT BSP lewat sundulan kepalanya berhasil mencetak gol sehingga

kedudukan menjadi 4-2. Tertinggal 2 gol membuat para pemain PT Padasa meningkat tempo permainan mereka dengan stretegi serangan balik yang cepat. Lewat pemain Nelson Manurung, Usmanto mampu dimanfaatkan Rusli Rudianto lewat sentuhan kaki kanannya dan berhasil memperkecil kekalahan mereka. Skor menjadi 4-3 untuk kemenangan PT BSP. Kejar-kejaran angka ini membuat pertandingan semakin sengit. Menjelang in juri time, pemain PT BSP Kisaran menutup kemenangan lewat tendangan Zulfan. Hingga babak kedua berakhir, tim PT BSP unggul 5-3. (mar)

beraktifitas. Hal ini dikatakan seorang warga Nagori Huta Raja, Madi Purba kepada koran ini Rabu (26/9) di Jalan Sisingamangaraja depan USI sambil menujukkan foto kondisi jalan yang rusak parah tersebut. Anehnya, tambah Madi, di tengah-tengah keluhan masyarakat ini, aparat kecamatan tetap menagih pajak melalui izin mendirikan bangunan (IMB) rumah papan milik warga. Dan Itupun, tetap dibayarkan warga sebagai kewajibannya menjadi warga negara yang baik. Ditambahkan oleh Purba, Nagori Huta Rajha dihuni kurang lebih 250 KK dan setipa harinmya jalan untuk mengeluarkan bertonton hasil-hasil pertanian puluhan mereka seperti sayur mayur, tomat, kentang cabai dan lain-lain. “karena kerusakan jalanm ini, jarak tempuh jalan sepnjang 5 km menjadi1jam.Setiapadaperantau yang pulang kampung membawa mobil pribadi, mereka pasti mengeluhkan kondisi jalan yang rusak parah ini,” katanya.

Katanya, penyebab rusak parahnya jalan ini adalah, karena bebeapa tahun lalu selalu dilalui truk bermuatan kayu dengan berat antara 30-40 ton. “Kami sangat kesecwa dengan keadaan ini, padahal sudah berpuluh kali kami mengajukannnya untuk diperbaiki melalui musrembang, namun sekalipun belum pernah tersentuh pembangunan,” ujarnya. Yang paling menyedihkan, kata Purba,sebelumPilkadaterakhir,JR Saragih sebelum jadi Bupati Simalungun sudah datang ke daerah tersebut. Saat itu dia berjanji,jikamenangdiPilkada,dia tidak memberikan uang, tapi akan memberikan pembangunan. Nyatanya, sampai saat ini belum juga diperbaiki. “Kami hanya bisa berharap dan pasrah menunggu adanya kebijakan dari pejabat-pejabat negara ini agar segera merealisasikan pembangunan jalan antar huta tersebut demi kesejahteraan kaum tani di Nagori Huta Raja,” harap Purba. (mer)

Peserta Pelatihan Wasit Praktek Lapangan Sambungan Halaman 8

Mutiara Kisaran. Tujuannya guna memantapkan dan menerapkan teori yang diperoleh beberapa hari ini. Ketua Pengcab PSSI Asahan, H Wahyudi SST MKes melalui Sekretaris Panitia Pelaksana Isnanto, Kamis (27/9) di Kisaran mengatakan, peserta latihan ini berjumlah 30 orang dan berasal dari beberapa kabupaten/kota se-Sumut. Isnanto mengatakan, setelah beberapa hari mengikuti pelatihan teori, para peserta pelatihan melakukan praktek lapangan. Dikatakannya, pelatihan ini nantinya diharap dapat melengkapi perangkat pertandingan sepakbola di masing-masing kabupaten/kota di Sumut. Pelatihan ini juga diharapkan

Sambungan Metro Asahan

dapat melahirkan wasit yang handal yang dapat bertindak arif, jujur dan adil. Menurut Isnanto, saat ini telah terjadi kekurangan wasit di Asahan. Padahal di Asahan banyak berdiri Sekolah Sepakbola (SSB) dan club sepakbola. Isnanto menambahkan, peserta latihan wasit C-III ini berjumlah 30 orang dan berasal dari beberapa kabupaten/kota seSumut. Sedang instruktur dalam pelatihan wasit C-III ini adalah, Nurman Alex (asal Langkat), M Umar (asal Medan), Rorim Situmeang (asal Medan) dan asiten instruktur Feriyanto, Surya Prayetno. Setelah lulus dari latihan wasit C-III, maka para peserta berwenang untuk jadi wasit pada pertandingan antara kabupaten. (van)

Ibu Tak Yakin Anaknya Menjambret Sambungan Halaman 1 Kapolres Asahan AKBP Yustan Alpiani saat dikonfirmasi melalui Kasat Reskrim AKP Fahrizal, mengaku pihaknya ada menerima pengaduan dari pihak keluarga almarhum Ganti dan saat ini kasusnya sudah ditangani. Namun, hingga saat ini pihaknya belum ada menetapkan orang sebagai tersangka. Sementara Tekad Kawi SH mengatakan, dia dihunjuk pihak keluarga untuk mendampingi Nurlia untuk membuat laporan di Polres Asahan terkait kematian Ganti. “Laporan sudah diterima pihak Kepolisian dengan surat bukti lapor No.1125/IX/2012/SU/Res Asa tertanggal 25 September 2012 “ terang Tekad Kawi. Diungkapkan Tekad, sebagia seorang pengacara dirinya terikat kode etik dan undangundang advokad serta sumpah profesi, sehingga siapa saja yang datang memohon bantuan, sebagai seorang pengacara tidak boleh menolak. Menurut Tekad, orangtua Ganti tidak terima dengan kematian tidak wajar yang dialami anaknya, sebab mereka tidak yakin kalau anaknya melakukan penjambretan. Sebab, anaknya bukan pengangguran melainkan punya pekerjaan tetap sebagai anak buah kapal ( ABK ) yang pulang ke darat dua bulan sekali. “Dan bila anaknya benar

melakukan penjambretan, apakah tidak ada hukum sehingga dihakimi oleh massa,” ujar Tekad. Terpisah, Raden tokoh pemuda di Kisaran menuturkan, tindakan massa yang menghakimi pelaku jambret kemungkinan akibat kurang percayanya masyarakat dengan hukum yang berlaku. “Tindakannya meresahkan masyarakat dan tidak jarang korbannya celaka, namun hukuman yang dijatuhkan majelis hakim cukup ringan,” katanya. Sebagaimana diberitakan sebelumnya, tersangka penjambret kalung emas bernama Ganti (22), warga Jalan Masjid Lingkungan III Kelurahan Sei Ranto Kecamatan Datok Bandar, tewas dipukuli warga di Jalan Besar Pasar XI Kelurahan Binjai Serbangan Kecamatan Air Joman, Jumat (21/9) sekitar pukul 14.00 WIB. Data dihimpun, korban penjambretan bernama Fika Ernimawati (18), warga Pondok Karang Air Kelurahan Karang Anyar Kecamatan Kisaran Timur mengendarai sepedamotor Supra BK 6376 QG, bersama sepupunya Eka Cahyani (14), bermaksud berkunjung ke rumah familinya di Desa Pasar Lembu. Persis di simpang Butong, mereka ditegur dua pria yang mereka tidak kenal. “Mau kemana Dek,” kata Fika menirukan ucapan kedua pria itu.

Disebutkan Fika, setelah merampas kalung emasnya, kedua pria itu langsung tancap gas ke arah Desa Punggulan. Fika sendiri, langsung berteriak meminta tolong. “Aku menjerit minta tolong, biar pelaku dikejar warga,” kata Fika sembari menunjukkan lehernya yang tergores karena terkena tangan pelaku. Kapolsek Air Joman AKP H Tambunan ketika berada di RSUD Kisaran menerangkan, tersangka penjambret sempat mendapat perawatan di Puskesmas Rawat Inap Air Joman. Tetapi karena kondisinya terus memburuk lalu dirujuk ke RSUD Kisaran. Namun setelah mendapat penanganan intensif lebih kurang 2 jam, tersangka akhirnya meninggal. Menurut Tambunan, ketika mendapat informasi ada tersangka penjambret dipukuli warga, pihaknya langsung menuju TKP. “Ada tersangka jambret dihajar massa di daerah Desa Lubuk Palas. Setibanya di TKP ratusan warga sudah memadati lokasi kejadian sementara tersangka yang semula belum diketahui identitasnya nyaris dibakar,” katanya sembari menambahkan rekan Ganri bernama Rudi Margolang berhasiol lari dari kejaran warga, namun akhirnya ditangkap petugas dan saat ini sedang mendekam di sel tahanan. (sus)


„ Tekad Kawi SH mendampingi Nurlia ibu almarhum Ganti yang tewas dimassa karena tertangkap menjambret, membuat laporan di Polres Asahan.

Hati-hati Sweeping Polisi Gadungan! Sambungan Halaman 1 banyak remaja yang mengaku terjaring oleh sekumpulan pria berpakaian preman mengaku sebagai petugas polisi ternyata melakukan pemerasan. Kepada METRO, Gugun (34) menceritakan, keponakannya sudah menjadi korban pria yang mengaku polusi. Di mana, keponakannya diberhetikan sejumlah pria berpakaian preman yang melakukan sweeping di Jalan Mahoni. Disebutkan Gugun, pelaku yang mengaku petugas menahan sepedamotor,

kemudian dompet dengan dalih untuk mengetahui identitas serta alamat kemudian diminta untuk menjemput orangtua untuk mengambil sepedamotor berikut menunjukkan surat-suratnya. Namun kembali ke lokasi, para pria itu sudah tidak ada.”Untung saja yang digondol hanya dompet, sementara sepedamotor ditinggal begitu saja,” ujar Gugun. Melihat kejadiannnya, oknum-oknum polisi gadungan itu memanfaatkan

para anak baru gede (ABG) yang mengendarai sepedamotor secara berkelompok. “Di Jalan Mahoni itu banyak dijadikan ngumpulnya para ABG, sehingga mereka berani melakukan hal itu dengan dalih isu curanmor, “pungkas Gugun. Sementara Kapolres Asahan AKBP Yustan Alpiani dikonfirmasi melalui Kasat Reskrim AKP Fahrizal mengatakan, pihaknya pada Rabu malam tidak ada melakukan sweeping apalagi di Jalan Mahoni. “Kami tidak ada melakukan sweeping, dan bila

kami melakukan sweeping pasti melibatkan satuan gabungan termasuk satuan lalu-lintas,” tegas Fahrizal.Ditambahkan Fahrizal, bila benar apa yang dialami warga seperti yang disampaikan, berarti itu tindakan petugas gadungan yang mengaku sebagai polisi. “Masyarakat harus waspada, dan bila mendapati adanya kejanggalan secepatnya hubungi kantor polisi terdekat,” Imbaunya. (sus)

JUMAT Edisi 227 thn V

28 September 2012


Berangkat (Tanjung) Tiba (Medan)

KA Putri Deli

I. 06.50 WIB

11.17 WIB

KA Putri Deli

II. 12.50 WIB

17.27 WIB

KA Putri Deli III. 17.50 WIB

22.15 WIB

Sumber: Stasiun Kereta Api Tanjungbalai



Thomas Advent Perangin-angin Bangun llahir di Kabanjahe, Sumatera Utara, 12 Oktober 1952. Advent Bangun adalah aktor Indonesia yang acapkali berperan dalam film-film laga pada tahun 1980an. Namanya sejajar dengan pemainlagalainnyaBarryPrima,George Rudy, dan Ratno Timoer. Terlahir dengan nama Advent Bangun, pria kelahiran Kabanjahe - Sumatera Utara ini sejak kecil mendapatkan didikan keras. Bapaknya yang seorang jaksa sangat ketat menanamkan nilainilai disiplin dan kejujuran. Tahun 1971, Adven Bangun menjadi juara nasional karate. Setahun kemudian ia tampil di berbagai kejuaraan tingkat dunia hampir di seluruh asia, Amerika, dan Eropa. Dunia karate pula yang mengantarnya menjadi artis film laga.Takkurangdari60judulfilmpernah ia perankan. Kesuksesan semula membiusnya. Ia menjadi sombong hingga suatu saat, sebuah kekuatan doa meluruhkannya dalam pangkuan gereja. Istrinya, Lois Riani Amalia Sinulingga lah yang selalu bergumul dalam doa hingga pertobatan tumbuh di hati Advent Bangun. Kini, ia adalah seorang pendeta, dengan nama barunya Pendeta Muda Thomas Bangun. Sebagai pendeta muda, ia juga mempunyai karunia khusus dalam pelepasan dan penyembuhan. Banyak orang yang diselamatkan jiwa dan raganya.(int)

B a k ombur

Pegawai PDAM Terlibat Pemasangan Jaringan Pipa Ilegal TANJUNGBALAI- Tim investigasi Perusahan Daerah Air Minum (PDAM) Tirta Kualo Tanjungbalai membongkar kasus pemasangan pipa air ilegal. Pembongkaran dipimpin Ketua Badan Pengawasan PDAM Drs H Abdinusa melalui Mhd Kosasih dan Satpol PP.


iperkirakan ada 200 jaringan pemasangan pipa air PDAM ke rumah warga secara ilegal. Pemasangan jaringan secara ilegal ini diduga melibatkan pejabat PDAM. Direktur PDAM Tanjungbalai

Zaharuddin SE, Kamis (27/9) mengatakan, pihaknya mendapat informasi dari masyarakat tentang adanya sambungan pipa air ke rumah penduduk yang sudah lama digunakan masyarakat dengan cara ilegal.


„ Kantor PDAM Tirta Kualo di Jalan A Yani Tanjungbalai. Tim dari PDAM menemukan adanya pemasangan jaringan pipa air ilegal ke rumah warga.


„ Wali Kota Tanjungbalai melepas Calhaj yang akan berangkat ke Asrama Haji Medan, Kamis (27/9).

Wali Kota Lepas 154 Calhaj

TANJUNGBALAI- Waki Kota Tanjungbalai, Drs H Thamrin Munthe MHum, Kamis (27/9) melepas 154 orang Calon Jamah Haji (Calhaj) dari Lapang Sultan Abdul Jalil Rahmadsyah menuju Asrama Haji Pangkalan Mansyur Medan. Thamrin dalam sambutannya mengatakan, pemberangkatkan calhaj tahun ini berbeda dengan tahun

Setelah mendapat informasi tersebut, PDAM membentuk tim untuk mengungkap adanya pemasangan pipa air secara ilegal. Lalu Zaharuddin menunjuk Muhammad Kosasih sebagai ketua dan Drs Mukmin Mulyadi, Martin Sipahutar SH sebagai wakil ketua dalam tim yang dibentuk. Setelah terbentuknya tim, pihak PDAM melakukan investigasi dan menemukan adanya pemasangan

„) Baca Pegawai ....Hal 7

lalu. Tahun ini calhaj tidak lagi membawa beban berat seperti beed. Calhaj cukup membawa tas saja. Karena barang bawaan Calhaj telah terlebih dahulu diantar ke Medan. “Doakan kami agar kami bisa mengikuti jejak bapakbapak dan ibu-ibu ke Makkah,” kata Thamrin. Menurut Thamrin, Pemko Tanjungbalai merasa

a c a B

a t o K Wali 7 Hal

BSP Kisaran Pecundangi Padasa 5-3


Wak Alang: Pejabat di PDAM terlibat pemasangan jaringan pipa air secara ilegal ke rumah warga. Uang hasil pemasangan tidak distor ke kas PDAM. Wak Ongah: Pantas lah PDAM selalu merugi. Bagaimana itu pak. Apa tindakan kepada oknum pegawai itu. (**)

„ Plank pengerjaan proyek pembangunan jalan setapak di Jalan Tomat. Foto dijepret, Kamis (27/9).

Pengerjaan Jalan Setapak di Pantai Johor Diduga Asal Jadi TANJUNGBALAI- Proyek pembuatan jalan setapak di Jalan Tomat Lingkungan III Kelurahan Pantai Johor Kecamatan Datuk Bandar

Kota Tanjungbalai dipertanyakan warga. Warga menduga pengerja-

„) Baca Pengerjaan ....Hal 7

KISARAN- Pada pertandingan lanjutan turnamen sepakbola memperebutkan piala DPRD Asahan antara kesebelasan PT BSP Kisaran melawan PT Padasa Teluk Dalam, Kamis (27/9) di Stadion Mutiara Medan dimenangkan PT BSP dengan skore 5-3. Sejak awal pertandingan, para pemain PT BSP Kisaran yang banyak didominasi para pemain mantan klub di Asahan ini langsung melakukan tekanan ke lini pertahanan PT Padasa yang dikawal kwartet Normandi, Rusli Rudianto, Usmanto dan Haris Manurung. Pemain ba-

„) Baca BSP ....Hal 7


„ Pemain PT BSP foto bersama sebelum pertandingan digelar di Stadion Mutiara Kisaran, Kamis (27/9).

Stop Galian C Pakai Alat Berat! PERDAGANGAN- Pemerhati lingkungan yang tergabung dalam Asosiasi Pecinta Lingkungan (APL) Simalungun mendesak Pemkab Simalungun menghentikan aktifitas galian C menggunakan alat berat di Perdagangan. Sebab pengerukan aliran Bah Bolon itu dinilai akan

merusak lingkungan. Ditemui METRO, Kamis (27/9), Ketua APL Hendra Pohan mengatakan, pihaknya mengancam akan melakukan aksi longmarch di sekitaran komplek SKPD di Raya. Tak hanya itu, mereka juga akan berorasi di kantor Bupati Simalungun, me-

minta galian C ini dihentikan. Ditambahkannya, APL juga mempertanyakan kinerja Badan Pelayanan Perizinan Terpadu (BPPT) Pemkab Simalungun yang terkesan membiarkan saja aksi pengerukan

„) Baca Stop ....Hal 7

KPUD Tes Wawancara Calon PPS dan PPK (IRVAN NASUTION)

„ Para wasit C III yang mengikuti pelatihan tampak serius saat praktek lapangan.

Peserta Pelatihan Wasit Praktek Lapangan KISARAN- Setelah beberapa hari mengikuti pelatihan teori, para peserta pelatihan wasit C-III, Kamis (27/9) mengikuti praktek lapangan di Satdion

„) Baca Peserta ....Hal 7

BATUBARA- Komisi Pemilihan Umum (KPU) Batubara melakukan tes wawancara dan kesiapan peserta Panitia Pemilihan Kecamatan (PPK) dan Panitia Pemungutan Suara (PPS) Kabupaten Batubara. Seleksi ini dilaksanakan di kantor KPU Batubara di Jalan Perintis Kemerdekaan Limapuluh, Kamis (27/ 9). Tujuannya untuk mempersiapkan PPS dan PPK dalam menghadapi Pilgubsu 2013 mendatang. Jumlah peserta yang mendapaftar


„) Baca KPUD....Hal 7

„ Ratusan peserta PPS dan PPK tampak memadati halaman kantor KPUD Batubara untuk mengikuti tes, Kamis (27/9).

Jumat, 28 September 2012


IRT Ngaku Bisa Menabung RANTAU- Ibu rumah tangga yang berbelanja di Pasar Gelugur Rantaprapat mengaku bisa menyisihkan uang belanja seharihari, untuk ditabung karena harga sembilan bahan pokok beberapa minggu terakhir stabil. Kepada METRO, Kamis (27/9) ibu rumah tangga (IRT) yang berbelanja, Ira (25), Dewi (29) dan Siti (32) berharap harga sembako yang stabil tetap bertahan sampai akhir tahun. “Kebutuhan sembako merupakan kebutuhan pokok yang harus ada setiap hari, jika ada kenaikan akan langsung berpengaruh terhadap pengeluaran. Maunya memang jangan ada yang naik,” kata Ira, diamini rekannya. Dijelaskannya, pemerintah seharusnya aktif melakukan pengawasan terhadap harga sembako sehingga tidak memberatkan kepada masyarakat. „) Baca IRT Ngaku ..Hal 10 FOTO: AHMAD EFENDI

„ Belanjaseorang ibu rumah tangga sedang memilih sayur di Pasar Gelugur, Kamis (27/9).

Oknum Hakim Terseret Kasus Korupsi Tigor DISEBUT-SEBUT PEMBAGI PROYEK, IKUT DILAPORKAN KE-KPK RANTAUPRAPAT- Selain mengadukan Bupati Labuhanbatu Tigor Panusunan Siregar, seorang hakim yang pernah bertugas di Pengadilan Negeri Rantauprapat berinisial D, juga diadukan ke Komisi Pemberantasan Korupsi (KPK).

58 SISWA TERJARING SATPOL PP AEK KANOPAN- Sebanyak 58 siswa SMP dan SMA dari Kecamatan Kualuh Hulu dan Kualuh Selatan, terjaring razia kasih sayang yang digelar Satuan Polisi Pamong Praja (Satpol PP) Kabupaten Labuhanbatu Utara selama dua hari, Selasa „) Baca 58 Siswa ..Hal 10

„) Baca Oknum Hakim ....Hal 10


„ Kelompok Tani Karya Lestari mendirikan tenda di atas lahan yang diusahai oleh PT SLJ.

Poktan Karya Lestari Duduki Lahan Usaha PT SLJ FOTO: RIZKI W SIREGAR

„ Warga mengantre untuk memeriksakan mata di Puskesmas Negeri Lama.

Operasi Katarak Digelar di Negeri Lama RANTAUPRAPAT- Dinas Kesehatan Labuhanbatu menggelar operasi katarak gratis untuk masyarakat yang kurang mampu di Kelurahan Negeri Lama Kecamatan Bilah Hilir, selama dua hari yakni Rabu-Kamis (26-27/9). „) Baca Operasi Katarak ....Hal 10

AEK KANOPAN- Puluhan anggota kelompok tani Karya Lestari menduduki lahan yang saat ini masih diusahai oleh PT Sawita Ledong Jaya (SLJ) yang terletak di daerah Desa Air Hitam Kecamatan Kualuh Ledong,

Labura, sejak Kamis (20/9) lalu. Kepada METRO, Kamis (27/9) di lokasi tanah yang telah didirikan tenda dan pondokan, Ketua Kelompok Tani Karya Lestas Tumino dan Sekretarisnya Pendi menje-

laskan, pendudukan lahan yang masih dalam sengketa sebagi bentuk kekesalan kepada PT SLJ yang menurut mereka „) Baca Poktan Karya ....Hal 10


PANAI HILIR- Penyaluran beras miskin (raskin) untuk delapan (8) Desa di Kecamatan Panai Hilir terhambat. Pasalnya uang

pembayaran sebesar Rp60 juta diduga digelapkan oleh IP, mantan Sekretaris Camat Panai Hilir.


„ Truk peti kemas dievakuasi dari Jalinsum Bulu Cina menuju Polsek Aek Nabara.


“Kita menduga mantan sekcam itu tidak

RANTAUPRAPAT- Sebuah truk peti kemas (interculler) terbalik di Jalinsum Bulu Cina Aek Nabara, Rabu (26/9) sekira pukul 19.00 WIB. Akibatnya, jalinsum mengalami kemacetan

„) Baca Mantan Sekcam ..Hal 10

„) Baca Truk Peti ..Hal 10

Satpam Kebobolan ‘Aset’

Kasihan deh Wayan Tirta (28), dari Klungkung (Bali) ini. Sebagai Satpam tiap malam kerjanya jaga aset orang, tapi ‘aset’ milik sendiri di rumah diserobot tetangga. Bagaimana tidak? Di kala dia terkantuk-kantuk di pabrik, di rumah Made Darti (23), sang istri berbuat mesum di kamar mandi dengan lelaki tetangga. Kontradiktif kehidupan itu memang selalu terjadi di manamana. Dokter ahli penyakit dalam (internis), malah mati serangan jantung. Bapaknya

tokoh agama yang suka dipanggil ceramah ke manamana, tapi anaknya badung „) Baca Satpam ....Hal 10


28 September 2012


Polisi telah Curigai Pelaku RANTAUPRAPAT-PolresLabuhanbatu masih mendalami penyelidikan kasus perampokan yang menimpa Bendahara Sekretaris Dewan (Sekwan) Kabupaten Labuhanbatu Selatan (Labusel) Mahrijal, Jumat (14/9) lalu. Perampokanyangmengakibatkan kerugian Rp200 juta berupa uang untuk operasional bimbingan teknis (Bimtek) sejumlah anggota dewan raib digondol kawanan perampok bersenpi. Kasubbag Humas Polres Labuhanbatu AKP MT Aritonang, kepada METRO, Kamis (27/9) di Rantauprapat mengatakan, pihaknya sedang mendalami penyelidikan guna membuka tabir siapa dalang pelaku perampokan. “Masih mendalami penyelidikan, sekarang petugas masih bersebar,” kata MT Aritonang. Disinggung apakah pelaku sudah tercium keberadaannya, Aritonang mengaku pihaknya belum berani berspekulasi terhadap hal itu. Namun untuk kecurigaan dirinya tidak menampik hal itu. “Kecurigaansiapapelakuyaada,

tapiitutidakuntukkonsumsipublik, karenamasihpenyelidikan.Curiga kan boleh saja dan kawan-kawan masih menyelidiknya di lapangan,”ucapnya. Sementara Sekwan Kabupaten LabuselZuhriberharapagarapelaku dan rekannya segera ditangkap. DisinggungsoalkegiatanBimtek anggota DPRD Kabupaten Labusel, Zuhri menjelaskan kegiatan Bimtek dibatalkan karena belum ada keputusan untuk menggunakan dana talangan. Rencana BimteksemulakeJakartamterpaksa ditunda. Sebelumnya diberitakan, Mahrizal bersama rekannya Fauzi dirampokdihalamankantorDPRD Labuselsekitarpukul15.10WIBusai menarikuangdarisalahsatubankdi Kota Pinang. Belum lagi keluar dari mobildinasnyaBK1014LS,mereka didatangisekawananorangbersenpi dan memecahkan kaca mobilnya. Walau sudah melakukan perlawanan,namunuangsebesarRp200juta yang diletakkannya di bawah kaki dengan dibungkus plastik berhasil dirampaskawananperampok.(riz)

Penyaluran BOS Diduga Menyimpang PALAS- Diduga terjadi penyimpangan penyaluran dana Bantuan Operasional Sekolah (BOS) Tahun Anggaran(TA)2012diDinasPendidikanPadangLawas(Palas).Pasalnya,adaindikasipermainanantara oknum kepala sekolah (Kasek) dengan penyelenggara BOS di lapangan. Dugaan ini diucapkan Anggota DPRD Palas, Ir Samson Fareddy Hasibuan,Kamis(27/9).“Sayamenduga menduga telah terjadi penyimpangan penyaluran dana BOS TA 2012 di Disdik Palas. Ditemukan indikasi ke arah sana,” katanya. Disebutkan politisi PPP DPRD Palas, dugaan penyimpangan tersebut terjadi dalam beberapakebijakan,misalnya,dalamhal pengadaan alat tulis kantor (ATK) dan buku sekolah. Dimana, pihak sekolah tidak mengganti buku lama, tapi dalam laporannya telah membelibukubaru. Kecurigaan lainnya, penyaluran dana BOS yang tidak sesuai Petunjuk Teknis (Juknis) pelaksanaannya di lapangan, sehingga perlu evaluasi dan pengawasannya di lapangan. “Pihak pengelola dana BOS jangan asal mencairkan saja, tapi juga melakukan monitoring dengan baik di lapangan,” tegas Samson kepada METRO. Dijelaskannya, selain indikasi korupsi,markupdanaBOSjugadiduga terjadi pada jumlah siswa penerima BOS, baik tingkat SD dan SMP. Karena data-datanya disinyalir tidak akurat. Pasalnya, pada

tahun anggaran sebelumnya, jumlah siswa penerima dana BOSnya tidak jauh berbeda. “Aparat penegak hukum juga harus aktif mengawasi penyaluran danaBOS.Apalagiprogrampendidikan secara nasional sudah gratis, namun masih tetap saja dilakukan pungutanliarolehsekolah.Bahkan, ada dalihnya untuk biaya ATK, padahal dana BOS ada,” ucapnya. Ditegaskannya, ada sekitar Rp6,9 Miliar setiap triwulannya anggaran dana BOS untuk Palas, kenyataannyadilapangan,banyak sekolah ditemukan kondisi ATKnyatidakpernahdiganti,tapisetiap tahun menerima dana BOS. “Ini harus diperbaiki demi mewujudkan visi-misi Pemkab Palas menuju masyarakat cerdas. Jika perlu, Bupati harus mengevaluasipejabatyangmembidangi dana BOS,” tukas Samson. Sementara itu Manager BOS Disdikbud Palas, Muliadi Hasibuan membantah adanya penyimpangan dalam realisasi dana BOS, setelah dimanajemen dirinya. Namun, kalau untuk sebelum dirinya, Muliadi tidak begitu tahu. “Saya masih baru menjabat manajerBOS,dansayamasihyakin tidak ada penyimpangan. Dalam hal persoalan memungut biaya dari siswa dalam pendidikan dan serta peraturan dibolehkan, asalkan tidak ditetapkan berapa pungutan yang dilakukan. Pungutan itudibolehkantapijangandipatok, sesuai dengan kemampuan para siswa,” sebutnya.

Oknum Hakim Terseret Kasus Korupsi Tigor Sambungan Halaman 9 Tigor P Siregar diadukan karena diduga menyalahgunakan APBD tahun 2011, sementara oknum hakim D diadukan sebagai orang dekat Tigor yang berperan sebagai pihak yang membagibagikan proyek, sesuai hasil rekaman yang diperoleh aktivis. Kepada METRO, Kamis (27/9), Rendi Harahap, koordinator aksi unjuk rasa di gedung KPK Jalan Rasuna Said, Jakarta,

Selasa (25/9) lalu mengatakan, D, oknum hakim ditengarai membagikan proyek kepada sejumlah orang termasuk kepada mantan tim sukses Tigor-Suhari ketika maju menjadi calon Bupati Labuhanbatu. “Bukti rekamannya jelas, dan jika disimak isi pembicaraan tersebut secara langsung membongkar kecurangan dalam sistim tender proyek yang didanai APBD Labuhanbatu,” kata Rendi. Dijelaskan Rendi, dari dua rekaman video yang berdurasi 15 menit dan 45

menit, dapat ditangkap bahwa dugaan kecurangan tender proyek APBD Labuhanbatu yang selama ini menjadi buah bibir dimasyarakat memang ada. Melalui alat bukti yang mereka sampaikan, KPK dapat dengan mudah menelusuri kecurangan tersebut yang berpotensi merugikan Negara. Ketika ditanya secara mendetail soal data D, Rendi hanya memberitahukan bahwa D pernah bertugas di Pengadilan Negeri Rantauprapat. Bahkan, D pernah diadukan ke Komisi Yudisia karena kasus

yang sama pada tahun lalu. Data yang dihimpun METRO, pada tanggal 20 Oktober 2011 pernah terjadi aksi demo di depan Pengadilan Negeri Rantau Prapat. Sejumlah aktivis yang menamakan diri Dewan Rakyat Penyelamat Tigor-Suhari (Dramatis) menggelar aksi damai, untuk mendesak membongkar adanya dugaan makelar proyek APBD serta jabatan di pemerintahan Tigor yang melibatkan seorang oknum hakim PN Rantauprapat berinisial D. (riz)

Operasi Katarak Digelar di Negeri Lama

Poktan Karya Lestari Duduki Lahan Usaha PT SLJ Sambungan Halaman 9 merebut tanah tersebut pada tahun 1998. “Poktan Karya Lestari dan Poktan Penghijauan telah mengusahai tanah ini sejak tahun 1996, tetapi tiba-tiba PT SLJ meratakan lahan dan menakut-nakuti masyarakat,” kata Tumino. Dijelaskannya, pada tanggal 13 Juli

2012 pihaknya pernah menduduki lahan karena merasa memiliki hak, tetapi diduga oknum centeng PT SLJ membakar tenda dan pondok yang dibangun. “Kami akan memperjuangkan lahan ini, PT SLJ yang merampas dari kami. Rekomendasi dari DPRD Komisi A Labura, DPRD Provinsi meminta PT SLJ untuk menghentikan aktivitas di atas

lahan,” kata Pendi. Ditambahkan Pendi, pihaknya akan bertanam seperti biasa di lokasi dan akan tinggal sampai permasalahan dituntaskan. Pantauan METRO, puluhan warga telah memasang tenda biru. Peralatan berupa alat memasak dan peralatan untuk tidur juga ada serta perlengkapan mengolah tanah pertanian. (st)

Sambungan Halaman 9 Kepala Dinas Kesehatan Labuhanbatu dr H Alwi Mujahid Hasibuan MKes didampingi Kepala Bidang Pelayanan Kesehatan dan Farmasi (Yankesmas) dr Stephen serta dr Ibnu kepada menjelaskan, operasi katarak untuk tahun 2012 direncanakan untuk 65 orang. Tujuan pelaksanaan operasi katarak gratis untuk menurunkan angka kebutaan akibat katarak. “Harapannya dapat membantu masyarakat, khususnya yang kurang mampu agar terbebas dari kebutaan. Program ini bagian dari upaya pemerintah melayani masyarakat dalam bidang kesehatan sebaik mungkin,”ujar Alwi. Sementara dr Stephen menambah, tim yang melaksanakan operasi tersebut dari BKMM atau KIM yang terdiri dari dr Pinto SPM dan dr Yusni SPM serta dibantu 7 orang perawat mata dari Medan. “Dinkes bekerjasama dengan Puskesmas Negeri Lama memberikan perawatan lanjutan selama satu bulan yang dilengkapi dengan obat-obat hingga sembuh,” kata Stephen. Sementara beberapa warga yang ikut memeriksakan mata di Puskesmas Rawat Inap Negeri Lama untuk dioperasi yakni Ardian (57), Andi (46) dan Sriyani mengatakan, pelayanan kesehatan gratis untuk warga kuram mampu perlu diperbanyakan kegiatannya, terutama untuk operasi katarak. “Banyak warga kurang mampu yang mengalami kebutaan karena tidak memiliki dana untuk operasi, dengan adanya operasi gratis ini maka kami sangat terbantu,” kata Ardian. (riz)

Mantan Sekcam Diduga Gelapkan Uang Raskin Sambungan Halaman 9 membayarkan uang raskin untuk bulan Agustus 2012 lalu kepada pihak Bulog. Makanya pada bulan September ini, pihak Bulog belum menyalurkan raskin ke kecamatan Panai Hilir. Padahal setahu kita, semua kepala desa sudah menyetorkan uang raskin itu kepada IP,” ujar sumber berinisial KN (41), warga Kecamatan Panai Hilir, Labuhanbatu, Rabu (26/9). Dijelaskan KN, IP ketika masih menjabat sebagai Sekcam Panai Hilir bertugas mengumpulkan uang pembayaran raskin yang selanjutnya disetorkan kepada pihak Bulog. IP sekarang dikabarkan telah dimutasi ke Dinas Sosial Pemkab Labuhanbatu, sejak minggu pertama tahun 2012 lalu. Terpisah, Kepala Kantor Seksi Logistik Kabupaten Labuhanbatu Ade Mulyani,

Rabu (26/9) membenarkan pihaknya memang sengaja memberhentikan sementara penyaluran raskin di Kecamatan Panai Hlir. Pasalnya, pihak kecamatan masih memiliki tunggakan pembayaran raskin untuk bulan Agustus 2012 lalu sebesar Rp60.294.900,. “Kita memang sengaja menyetop penyaluran beras di Kecamatan Panai Hilir. Karena pihak kecamatan masih punya tunggakan pembayaran raskin di bulan Agustus,” kata Ade. Dijelaskan Ade, sebanyak 47.235 kilogram raskin yang disalurkan untuk 8 desa di kecamatan Panai Hilir dikalikan Rp1.600 per kilogram. Pihak Kecamatan Panai Hilir harus membayar uang raskin tersebut setiap bulannya sebanyak Rp75.576.000. Namun untuk bulan Agustus 2012 lalu, baru menyetor sebanyak Rp15.281.100. “Makanya ada selisih tunggakan

pembayaran sebanyak Rp60 jutaan lebih. Dan tunggakan itu harus dibayar dulu baru kita bisa menyalurkan raskin untuk bulan September,” jelasnya. Ditambahkan Ade, pihaknya tidak tahu pasti penyebab tidak dibayarkannya tunggakan raskin untuk bulan Agustus. Namun diakuinya jika pembayaran raskin di Kecamatan Panai Hilir selama ini ditanggungjawabi oleh mantan Sekcam IP. “Tapi info yang kita dapat, pak IP itu sudah dimutasi dan tidak lagi menjabat Sekcam Panai Hilir. Mungkin bisa jadi itu yang jadi penyebab tunggakan itu hingga kini belum dibayarkan,” pungkasnya. Sementara IP, belum dapat dikonfirmasi terkait tunggakan pembayaran raskin bulan Agustus di Panai Hilir yang pernah menjadi tanggungjawabnya. (CR-01)

58 SISWA TERJARING SATPOL PP Sambungan Halaman 9 hingga Rabu, (25-26/09) kemarin. Dari 58 siswa tersebut, empat orang diantaranya merupakan siswi perempuan. Kepala Satpol PP Kabupaten Labura Ir Bambang Wahyuandi kepada METRO, Kamis (27/9) mengatakan, dua orang diantara yang ditangkap merupakan orang yang sudah pernah dijaring pada razia kasih sayang sebelumnya. Diduga penyebabnya bukan karena malas belajar. “Kita prihatin terhadap perilaku anakanak yang bolos sekolah, padahal orangtua telah memberangkatkan anaknya untuk menimba ilmu dengan memberikan bekal, tetapi ternyata bolos dan nongkrong warnet atau kedai kopi,” kata

Bambang. Dijelaskan Bambang, pihaknya telah banyak mendapat laporan dari masyarakat tentang banyaknya siswa yang bolos ketika jam pelajaran sedang berlangsung. Bahkan ada yang pernah terlibat perjudian bahkan menggunakan narkoba. “Kita akan membina seluruh siswa yang terjaring, dengan membuat surat pernyataan untuk tidak mengulang kembali perbuatan bolos dari sekolah disaksikan orangtua, guru dan pihak sekolah. Pihak sekolah juga diminta untuk aktif melakukan pengawasan terhadap siswanya,” katanya. Ditambahkannya, razia yang digelar sekaligus untuk mencegah siswa tidak larut dalam tindakan yang menyalahi

aturan termasuk mencegah menggunakan narkoba serta ikut perjudian. Sesuai data, siswa yang terjaring berasal dari YP Muhamadiyah Aek Kanopan, YP Perguruan Kualuh, SMU Negeri 1 Kualuh Hulu, YP Pelita Aekkanopan, YP Harapan Aek Kanopan, YP SMK Zauhari, SMP Negeri Kualuh, dan YP SMP Kualuh. Sementara razia yang di gelar di wilayah kecamatan Kota Batu serta Kecamatan NA IX-X tidak membuahkan hasil, diduga informasi tentang razia sudah bocor. Lokasi yang menjadi sasaran yakni Warung Internet (warnet), lokasi biliar, warung sekitar sekolah serta kompleks perumahan Tanjung Sari Permai. Satu unit sepedamotor milik siswa sempat dibawa ke kantor Satpop PP, kemudian diambil oleh orangtua siswa. (put)

IRT Ngaku Bisa Menabung Sambungan Halaman 9 “Banyak-banyaklah digelar operasi pasar, apalagi menjelang hari raya keagamaan,” katanya. Terpisah, salah seorang pedagang sembako Erwin Siregar (40) membenarkan harga kebutuhan bahan pokok masih tergolong stabil. Stabilnya harga dikarenakan pasokan barang di Pasar Gelugur masih mencukupi. “Tidak ada kenaikan mau pun penurunan harga secara siginifikan. Harga beras memang kadang naik, kadang ada penurunan, tergantung pasar dan permintaan,” katanya. Dijelaskannya, harga besar untuk kualitas sedang per 10 kilogram Rp88 ribu, sementara minyak goreng Rp10 ribu per kilogram, gula Rp12 ribu dan telur Rp27 per papan untuk 30 butir. Hal senada disampaikan oleh Ida. Pedagang sayur mayur ini mengaku, setelah lebaran tidak ada kenaikan harga sayur-mayur yang drastic, kecuali cabai yang sempat naik. Saat ini cabai merah dan cabai hijau Rp16 ribu per kilogram, bawang merah Rp11 ribu per kilogram dan tomat Rp3 ribu per kilogram. (CR-02)

Truk Peti Kemas Terbalik Sambungan Halaman 9 sepanjang 8 kilometer dan pengendara terpaksa mengantri satu jam lebih sebelum truk peti kemas dievakusi. Informasi yang dihimpun METRO di lokasi kejadian, truk peti kemas meluncur menuju arah kota Medan. Diduga karena supir tidak konsentrasi pada jalan yang licin pada malam tersebut, tiba-tiba truk terbalik tepat di jalan menikung dan sekaligus menanjak. Adi Ritonga (28), warga Sigambal yang kebetulan berada di belakang truk peti kemas mengatakan, dirinya tiba-tiba dikejutkan suara keras yang bersumber arah depan, ternyata truk berikut peti kemasnya telah terbalik. “Jarak saya hanya sekitar 3 meter dari truk, untuk tidak mundur sebelum

terbalik,” kata Adi. Hal senada disampaikan oleh Hendra Lubis (32), Rifai Rambe (35) dan Yanto (37), warga yang tinggal di Bulu Cina Aek Nabara. Menurut mereka, truk yang tergelincir tersebut terjadi setelah hujan reda. “Kami mendengar suara dentuman keras, kami lihat ke jalan ternyata ada truk interkuler terbalik di badan jalan. Lalu, warga beramai-ramai melihat truk, beruntung supir selamat,” terang Hendra. Personil Lantas Polsek Aek Nabara R Hasibuan yang berada di lokasi mengatur lalulintas kendaraan mengaku belum mengetahui penyebab terbaliknya truk. “Saya belum tahu apa penyebab truk tersebut terbalik, supirnya saya suruh mengambil surat jalan. Kalau mau

informasi jelas , datang saja ke kantor ” kata Hasibuan, kemudian berlalu. Terpisah, kernet truk peti kemas bernama Waluyo (32), warga Jakarta Selatan ini mengatakan dirinya tidak mengetahui pasti penyebab tergelincirnya truk. “Saya tidak tahu penyebab tergelincirnya truk, karena saya sedang tidur. Supir saya sedang pergi mengambil berkas-berkas surat jalan. Kami dari Jakarta mau mengantar barang ke kota Medan,” kata Waluyo. Pantauan METRO, akibat truk yang terbalik di badan Jalinsum Bulu Cina Aek Nabara, kemacetan terjadi sepanjang delapan kilo meter. Satu unit mobil derek diturunkan untuk mengevakuasi truk untuk dibawa ke Polsek Aek Nabara. (CR-02)

Satpam Kebobolan ‘Aset’ Sambungan Halaman 9 minta ampun. Maka jangan heran bila Wayan Tirta yang jadi anggota Satuan Pengaman, tapi dia sendiri tak mampu mengamankan istri dari gangguan ‘burung’ jahil. Alkisah, Wayan Tirta yang tinggal di Dusun Kangin, Desa Bakas, Kecamatan Banjarangkan, Klungkung, selama ini bekerja menjadi satpam pabrik. Namanya juga satpam, malam hari mata melotot di pabrik demi mengamankan aset orang. Sebaliknya, dia siang hari dia merem alias tidur di rumah, sehingga sering lupa akan kewajibannya sebagai seorang suami, di mana harus memberi nafkah lahir dan batin bagi istrinya. Made Darti istrinya memang masih muda, sehingga kebutuhan nafkah batin

menjadi primadona dalam kehidupannya. Sayangnya, Wayan Tirta tak bisa memberikan secara maksimal dengan alasan capek dan ngantuk itu tadi. Jadi ibarat main bulutangkis, Satpam muda ini tak mampu lagi memberikan smashsmash tajam menukik. Bahkan yang sering terjadi, bola dikirim dengan cara backhand, sehingga sering pula malah nyangkut di net. Menghadapi kondisi suami yang demikian, lama-lama Made capek deh. Maka ketika lelaki tetangga, Bagus Mayun (34), suka towal-towel menggoda dirinya, dadanya serr-serrran juga. Maklum, suaminya sangat jarang memberikan ‘sesuatu’ yang selalu dirindukan. Sekali dua kali Made Darti masih bisa menghindari usaha PPD (Pegang Pegang Doang) yang dilakukan lelaki tetangga.

Tapi karena serangan itu semakin intensif dan langsung pada sumbernya, akhirnya dia bertekuk lutut dan berbuka paha juga. Ternyata, tongkrongan dan ‘tangkringan’ Bagus Mayun memang selaras, serasi dan seimbang, sehingga Made menjadi ketagihan. Repotnya, selama ini dia tinggal di rumah mertua, sehingga harus pandaipandai membaca situasi. Jika rumah sepi, dia bisa leluasa memanjakan gairah asmara. Tapi jika situasi kurang kondusif, sedangkan gejolak nafsu tak bisa ditekan, di kamar mandi pun jadilah. Yang penting gairah jiwa itu terlampiaskan. Yang terjadi beberapa malam lalu seperti itu. Dia pikir mertua sudah tidur nyenyak, bersama PIL-nya Made Darti berhubungan intim di kamar mandi dengan cara berdiri. Namun celaka tiga

belas, urusan itu baru saja tuntas tasss mendadak mertua keluar dan mau ke kamar mandi yang sama. Langsung Bagus Mayun lari gaya PON XVIII Pekanbaru, yang meski amburadul tapi ‘sukses’ juga. “Kami tidak berbuat apa-apa,” kata Made Darti saat diinterogasi oleh mertua. Tentu saja alasan itu tak bisa diterima. Mana mungkin lelaki tetangga grumutan ke kamar mandi orang jika tanpa motif. Lebih-lebih dipergoki sedang berdua dengan Made Darti yang anak menantu sendiri. Paginya, saat Wayan Tirta pulang, kejadian malam itu diceritakan. Langsung hilanglah rasa kantuk itu, dan Bagus Mayun dilaporkan ke polisi Polsek Banjarangkan. Dalam pemeriksaan, Bagus Mayun memang mengakui segala perbuatannya, sehingga pasal perzinaan segera dijeratkan kepadanya. (int)


28 September 2012


Kejadian aneh apabila bayi lahir dengan kaki kambing dan tiada tengkuk tersiar dari berita terbaru dari Jigawa,utara barat Nigeria di mana seorang wanita didakwa telah melahirkan makhluk dibawah – bayi tanpa leher jelas dan dengan kaki kambingnya. Menurut sumber cerita ini, wanita itu dikatakan telah mengeluh nasib beliau kerana ini adalah kali keempat dia melahirkan makhluk aneh seperti ini. Ini mungkin musim kelahiran pelik dan kejadian yang sangat misteri dan saintifik, kita tidak mempunyai penjelasan bagi kejadian ini. Hanya Allah yang tahu atas apa yang berlaku dan apa yang di jadikan di dunia ini.

Randy Disambut Wanita Tunawisma Kenakan Handuk

Buat Video TTeroris eroris Pria Arizona Ditangkap

disambut oleh perempuan tunawisma yang hanya mengenakan handuk. Perempuan berusia 24 tahun itu bernama Jennifer Burgess. Burgess menyambut Kizer hanya berbalut handuk bercorak tentara, milik putra Kizer. Kizer pun masuk dan berbicara dengan perempuan nomaden itu. “Dia (Burgess) berada di depan pintu dan saya bertanya, ‘apakah Anda tunawisma?’ dan dia menjawab ‘ya’,” ujar Kizer,s, Kamis (27/9). Setelah membiarkan Burgess, Kizer sadar bahwa, perempuan itu membawa bungkusan. Bungkusan itu berisikan uang tunai dari celengan putri Kizer. Polisi pun datang atas panggilan Kizer dan memborgol perempuan tunawisma itu. Burgess pun ditangkap dan dipenjarakan di Penjara Sacramento County atas tuduhan perampokan. Sementara itu putri Kizer juga masih jengkel karena uang yang sudah dikumpulkannya untuk gereja, tidak kembali. (oz/nik)

Dia dibebaskan dari tahanan dengan jaminan 5.000 dolar AS atau sekitar Rp 45 juta. Namun jika di pengadilan dia terbukti bersalah maka Turley terancam hukuman 45 bulan penjara. “Kami menganggap hal semacam ini sangat serius. Perbuatannya sama sekali tidak lucu,” kata juru bicara kepolisian Phoenix, James Holmes. Polisi mengatakan tiba di lokasi di mana keponakan Turley ‘berakting’ dalam waktu tiga menit setelah menerima banyak panggilan dari masyarakat yang melihat seseorang mengacung-acungkan senjata. Holmes mengatakan polisi tidak menahan keponakan Turley yang berusia 16 tahun itu. “Video itu menjelaskan kepada kami apa yang ingin dilakukan Turley. Dia menciptakan teroris khayalan berdasarkan pemikirannya sendiri,” tambah Holmes. (kps/nik)



SAMBUT-Handuk bercorak tentara yang digunakan Burgess untuk menyambut Randy Kizer. SACRAMENTO - Randy Kizer pulang ke rumahnya di Sacreamento, California, Amerika Serikat (AS) pada Selasa lalu. Namun dirinya


Dp 25 %, angsuran 2 Jt-an Dp 25 %, angsuran 3 Jt-an Dp 25 %, angsuran 3 Jt-an Dp 20 %, angsuran 2 Jt-an Dp 25 %, angsuran 3 Jt-an

Proses cepat data dijemput

Hub: L. Rivai Sembiring 0812 6457 0000

PAKET SUZUKI 100% BARU Penuh Dengan Cash Back Pick Up Carry, APV Pick Up, APV Arena, Ertiga, Splash, Swift, X-Over, Grand Vitara Dealer Resmi PT. Trans Sumatera Agung. Data dijemput Hub: David - 0813 6132 4071 CV. PARNA JAYA MOTOR: Menjual sepeda motor honda, yamaha, suzuki Viar, baru dan bekas; Cash & Credit; Tukar tambah; Urus Perpanjang STNK, BBN. Alamat: • Jl. Jend. Sudirman No. 389 ABCD, Indrapura ( 0622-31788) • Jl. Acces Road, Simp. Durian, Kuala Tanjung. MENTARI MOTOR Melayani servis, cas batre (basah ~ kering). Menjual alat2 sepeda motor, Asessoris, Oli, & alat2 mesin gendong. Alamat: Jl. Jalinsum Simpang Kebun kopi, Indrapura MITSUBISHI RANTO “PROMO” LEBARAN: Pajero Sport, Triton, Colt Diesel Dump Truck, Chasis, L-300, & Colt T120SS PickUp. DP 11% atau bunga mulai 0%. Hubungi: UNAS 0813 6333 3000 DIJUAL CEPAT: Yamaha VIXION warna Hitam tahun 2008. Body dan Mesin mulus. Hub: 0813 7015 5910; 0813 6163 1463 NEW NISSAN: Grand Livina, Juke, XTrail. Navara, Murano. Ready Stock, cash/credit. Hub: Mili 0852 7033 7739 DEALER RESMI SUZUKI Indrapura melayani penjualan sepeda motor merek Suzuki khusus yang baru secara chas n credit. Khusus promo setiap pembelian chas n credit mendapatkan emas (berlaku September 2012). Ayo buruan dapatkan sepeda motor Suzuki. Hub koorditor sales Bpk ARIFIN Hp : 085276045145. Jl. Jalinsum simp. Kebun kopi kuala

DIJUAL: Tanah kapling uk 6x12M, harga mulai 35jt-an, bisa nego. Lokasi strategus sebelah kolam renang Wahyu. Hub: Kolam Renang Wahyu, Jl. St. Alisyah Bana, dengan Bpk IRWAN EDWIN (Buyung) Hp: 0 8 1 3 7 5 9 6 2 9 8 8 . *Juga menerima pelatihan renang yg diasuh oleh Pelatih bersertifikat & berpengalaman.

DIJUAL KEBUN KELAPA SAWIT: seluas 2 Hektar, umur tanam 12 & 5 tahun, dengan penghasilan 5 ton/bln. Tanah rata, lokasi: Kampung Tempel, Kec. Ti n g g i R a j a. Harga Rp. 300 juta (NEGO). Hub: BAHARUDDIN S. HP:

PHOENIX- Seorang laki-laki warga Arizona, AS Michael David Turley (39) ditangkap polisi, karena membuat film teroris.baru-baru ini. Dalam video buatannya terekam ternyata keponakannya yang berusia 16 tahun berjalan-jalan di jalanan kota sambil membawa peluncur granat palsu dan berdandan ala teroris dengan menggunakan penutup wajah. Narator dalam film itu mengatakan aksi ini bertujuan untuk mengetahui seberapa cepat reaksi polisi menghadapi keadaan semacam ini. Si pembuat film mengatakan polisi


Menjual : Barang & Alat-alat Bangunan, Kontraktor, Levelansir. Dengan harga standart yg dapat di jangkau, dll. Jl. Masjid Lama No. 41 Talawi Batu Bara. Hubungi : Hj. Ani HP : 0852 7508 7880.


Menjual alat2 pancing, Kantor, Olahraga, Sekolah, Komputer, dan Perlengkapan Sholat, dengan harga Grosir. Alamat: Jl. Lintas Medan-Kisaran, Simpang Kebun Kopi, Batubara. HP: 0852 7680 942


DI JUAL RUMAH TYPE 54, 2 Kamar tidur. Komplek Perumahan BAHREN PURI KAMPUNG BARU (Belakang HOTEL SUZUYA), RANTAU PRAPAT. Hub: 0813 6048 3699

Panglong menjual segala jenis papan, khususnya papan Boat/ Sampan dan alat-alat bangunan, Menerima tempahan, Khususnya ukuran panjang dari ukuran standartnya.Dusun II Jl. Merdeka Tanjung Tiram Batu Bara. Hub : Bapak Irfan, HP : 0812 6456 2615.


“DINDA Keyboard” Entertainment

0813 6200 5227

menyediakan berbagai macam obat yg bermutu dan harga terjangkau. Menerima rawat inap., Pemeriksaan ibu hamil, Bersalin, Sunat, Imunisasi, EKG, USG. Tersedia, LAB, CLINIK, & ambulan. DAPAT KONSULTASI GRATIS dgn apoteker. Desa Tanjung Gading Sei Suka, Indrapura, Kab. Batubara. Hub: 0622-632088

Musik Melayu Modern, & TOKO D.J 2 Elektronik, Cash & Credit segala jenis elektronik. Hub: Iwan (0811 6282 272 – 0852 7599 9772), di Simpang Tiga Pahang, Talawi, Batubara.


APOTIK KARYA: Menjual berbagai obat dan Lengkap. Dengan harga terjangkau. Menerima pasien dan k o n s u l t a s i k esehatan. hub: J l . Jalinsum, Desa Tj. Gading, Simpang Kuala Tanjung, Indrapura, Batubara. Telp: 0622-632751

Menjual kursi, lemari dan semua jenis barang-barang perabot rumah tangga lainnya,di jual dgn harga yg murah & terjangkau. Jl. Besar Simpang Dolok, Lima Puluh, Batu Bara, Serta menyediakan tempat Rekreasi pemandian “ Kolam Lima Putri “ Untuk keluarga anda, Jl.Besar Air Hitam Simpang Dolok. Hub: Bapak Agan, HP : 0812 6474 707

Klinik Herbal CHIN CHIE

Toko Mas

alternatif reflexiologi therapy tanpa operasi & injeksi, dapat mengobati semua jenis penyakit kronis. (izin dinkes : 448/3224/111/2007) Jl. Jend sudirman gg. Keluarga. Dsn 2 pare-pare, Air Putih. Indrapura. Hub: 0812 6311 0162.

"Balai Pengobatan ELLY” Izin No : 800/3244/DINKES SOS/2008, Penanggung Jawab: Dr. HIDAYAT, M. Kes. Menyediakan berbagai Jenis obat, dan mengobati penyakit untuk kesehatan anda dan keluarga, serta bersedia datang ke rumah anda untuk panggilan pengobatan di rumah anda dalam waktu 24 Jam. Empat Negri, Kec. Lima Puluh, Kab.Batu Bara, Hub: IBU ELLY, HP : 0852 7668 2236

YAMAHA HORAS MOTOR, menjual sepeda motor merek Yamaha, chas & credit terbaru, dapatkan Helm LOVENZO Cuma Cuma dengan pembelian new zupiter z.1. (kesempatan terbatas) hub dialer telp : 0622.31883. Jln. Jendr Sudirman Kota Indrapura. Barubara.


PRIMKOPAD (M.SIDIK) menyediakan


buka 24 jam, pemeriksaan ibu hamil, sunatan, ibu bersalin,imunisasi, rawat inap, tersedia mobil ambulan. Konsultasi dokter tentang kesehatan, penyakit. Jl. BESAR LIMA PULUH KOTA (Depan Mesjid besar limapuluh), Kabupaten Batubara

perlengkapan dan asessoris TNI, POLRI, SATPOL PP, DISHUB, ORMAS, SATPAM,DLL. Hub M.SIDDIQ Hp: 0853 7170 6226. Jl. Jalinsum Kebun Kopi,Kuala Tanjung, Indrapura (samping BRI), Batubara

Kontraktor, Lepelasir, Biro Jasa, Dagang umum, Pertanian, Serta menyediakan & menjual barang-barang serta peralatan bangunan,dll. Alamat : Jl. Merdeka Pasar Mereng Desa Suka Maju Kec. Tanjung Tiram. Batu Bara. hub:(Ibu Ani) HP : 0853 6067 1005

DIJUAL CEPAT Rumah berukuran : Lebar 5, panjang 50, bangun 45, di Jl. A.Yani/Psr.Merah Simp.4 TalawiBatubara (depan SPBU). Hub: 0821 6839 0096.

COLOUMBIA, CASH & CREDIT FURNITURE & ELEKTRONIK harga terjangkau, paket murah meriah (cicilan ringan). Pasar 8, Jl. Jend. Sudirman, Indrapura, Batubara

CAHAYA BARU: Menjual berbagai macam mas dan perak dgn berbagai bentuk tempahan: cincin, kalung, gelang rante, anting2, mutu memuaskan, kunjungi kami di: Pajak Pagi Kebun Kopi, Indrapura, Batubara “TOKO HALIM” Menjual : Alat - alat Cansaw (Alat pemotong kayu), segala perlengkapan sekolah, Kosmetik, Sendal, Sepatu , Celana Jeans, serta menyediakan berbagai jenis pakain pria & wanita, dll. d jual dgan harga yg terjangkau, Alamat : Desa dahari Indah, Kec. Talawi, Batu Bara, Hub: Abdul Halim, HP : 0813 7652 4105


pakaian jadi pria, wanita, dewasa, anakanak, Busana Batik & kosmetik, Pakailah busana anda yang serasi cantik dan nyaman, Harga Boleh tanding, barang boleh banding. Hub: ROMAULI Br Sinurat. Hp. 0813 6152 6334. Jl Besar perdagangan No.88 g Lima Puluh Kota BatuBara.

membutuhkan waktu 15 menit untuk merespon. Video amatir yang dibuat delapan hari setelah tragedi penembakan saat pemutaran perdana film Batman itu diunggah ke YouTube. Di situs itu film tersebut diberi judul “Dark Knight Shooting Response, Rocket Launcher Police Test.” Setelah ditahan Turley didakwa melakukan aksi yang menyerupai tindakan terorisme, melakukan hal berbahaya, berkontribusi terhadap pidana ringan yang melibatkan simulasi bahan peledak.


Menerima pemasangan design, Plafon gyfsum rumah dan Perkantoran dgn tenaga yg berpengalaman.serta menjual sgala macam keperluan gyfsum. Hubungi: 087818917066 (Bpk Anwar); 0853 5910 8633 (Ibu Ida), Jl. A. Yani/Psr. Mereng Simp. 4 Talawi - Batu Bara.

“RAGHIB JAYA ALUMINIUM” Aluminium, Contraktor, Partition, Swing door/Rolling Door, Serta Menyediakan Barang Seperti : Pintu Kamar Mandi, Tenda/Awning, Lemari Kaca, Rak Piring, Steling, Raill Gorden, Tangga, Jemuran Baju & Segala Jenis Kaca. Alamat: Jl. Merdeka No. 165-166 Batu Bara, Hubungi : DICKY BUDIANTO, HP : 0812 655 3575 - 0812 6536 6166.

PERCETAKAN & ADVERTISING “BIMA”: Menerima segala jenis cetakan partai besar & kecil, undangan, sablon, stempel, MMT, baliho, Neonbox, baju kaos, kop surat, dll. (Hub: HABIB SYAH: 0852 7074 7585). Jl. Jend. Sudirman No. 288, Indrapura, Batubara.

T U K A N G B U R U N G RAHMAT KT: Menjual berbagai macam jenis burung pilihan,menerima tempahan berbagai jenis Kandang (sangkar burung). Hub: 0823 6403 5666. Jl. Simpang Kuala Tanjung, Indrapura, Batubara. PELUANG USAHA AIR MINUM: Pemasangan Depot Air Minum Air Pegunungan (Mineral) Sistem RO Oxsygen dan Grosir Peralatan Depot Air Minum GRACE WATER: Jl. Cengkeh Raya P. Simalingkar. HP. 0813 7010 7352. *) Melayani pemasangan dalam dan luar kota

“MATAHARI TRAVEL” melayani pembelian tiket pesawat,Batavia, Garuda,Merpati,Lion,City Link, Sriwijaya, Wing air, dengan tujuan wilayah dalam dan luar negeri, Hub: Rini-0821 6564 4472 – 0877 4929 0081 ; DEDY : 0823 6441 6766. Jl Medan LimaPuluh Kota NO. 11, Batubara DINA DOORSMER : Menyediakan

KEMBAR PONSEL: servis HP Menjual segala merek dan jenis HP, jual pulsa, asessoris, dan perlengkapan lainnya. Hub: Andy , HP: 0877 4871 1198. Alamat: Jalinsum tanah merah simp.4 Indrapura, Batubara. CHI CHI PONSEL , Menjual segala jenis merek HP, Servis HP, Asessories, Pulsa, Dll. (Hub: FITRI0853 5806 0605) JALINSUM simp 4 Tanah Merah Indrapura Batubara.

H E N D Y O G E T s Stiker & Aksessories: Penjualan & Pema-sangan Variasi Mobil dan sepeda motor. Jl. Jend. Sudirman, Indrapura (Samping Lap. Sepakbola); HP: 0813 7644 4177 ; Telp. 0622 - 646 144. AKAN DIBUKA DI KISARAN PUJASERA (Pusat Jajanan Serba Ada): anda berminat segera hubungi, Tempat terbatas, Alamat: Jl. Imam Bonjol No. 366 Kisaran (Doorsmeer Pondok Keluarga). Siapa Cepat Dia Dapat . HP. 0852 7059 6434 (Faisal).

“RIAS PENGANTIN RAHAYU”: Menerima pemasangan pelaminan dalam dan luar kota, Foto shoting Video, layar tancap, keyboard, dan menyediakan pelaminan lengkap (Jevara Melayu, dll). Alamat: Jl. Dahari Selebar Talawi, Batubara. Untuk pemesanan, hub: Mahar Salim, HP: 0878 6833 7140 ; 0821 6696 3879.

“ P O H WA S A L O N ” Menerima:Krimbat Rambut, Masker, Smoting, Sosis rambut, Cuci muka, Sanggul, Pangkas pria & wanita. Jl. Rakyat No. 02 Tanjung Tiram Batu Bara, Hub: Ibu Po Hwa, HP : 0853 5926 5298.

“MARI SALON SANGGUL” Cab. Medan & Jakarta. Menerima: Gunting rambut, rebonding, hair spa, lulur, facial, merias pengantin (Sanggul + Make Up), dan menerima siswa/i yang ingin belajar dan punya keahlian khusus dgn biaya terjangkau. Hub: MARI SALON SANGGUL, Pajak Gelugur Lt.2 Blok B No. 43&44, Rantauprapat. HP: 0821 6547 7080; 0852 6277 2884

doorsmeer Hidrolik sistem. Servis AC mobil, Assesoris, Cat Ketok, bengkel Injeksi, ganti oli, Tune-Up, Over Haul, dan cat duko. Alamat: Jl. Jalinsum, Kuala Tanjung, Indrapura, Batubara (0622-632832)

Perawatan rambut, wajah, & tubuh, terlengkap di Batubara, Hub: 0852 7508 4444, Jalinsum Binjai Baru, Batubara


“AA” Fashion: Menjual berbagai


Ganti oli, pispot, balancing ban, tubeless, angin hidrogen, cot, dan ban luar radial. Masih membutuhkan beberapa tenaga Doorsmer (Tukang Cuci Mobil). Jl. A. Yani No.6/8, Kisaran.

jenis pakaian muslim, wanita, pria, anak2, dan dewasa, berbagai merek dan ternama, dan terbaru. Melayani eceran dan grosir. Jl. Jend. Sudirman, Kota Indrapura, Kab. Batubara. HP: 0813 6154 2640

pakaian pria & wanita, pakaian serta perlengkapan baby, accesoris jilbab, mukena,dll. Jl. Merdeka No.03 Depan kantor PLN Tanjung Tiram & Jl. Rakyat No.40 (Depan Pajak Tanjung Tiram) Batu Bara. Hub:(Jonni Hendra, S.pd.) HP:0823 6269 4535

BINTANG PANGKAS: Khusus pangkas pria. Rapi, indah, bersih, trendy & memuaskan. Mode masa kini. Hub: Rahmad, 0878 1892 0095. Samping Pertamina, Parepare, Indrapura, Batubara

LKP “CANTIK MANIS“ belajar tata rias rambut pengantin, kecantikan kulit- rambut, menjadikan tenaga kerja terampil, siap pakai wirausaha dan trend model professional, hub 0812 6374 0598, Jl. Besar Perdagangan, Lima Puluh Kota BatuBara.

Toko Batik NUR’ ALFI: Menjual batik pekalongan, dengan berbagai jenis, pakaian sempit (pas-pasan), Couple, baju anak2, Blus, kemeja, dll. Harga murah dan terjangkau. Jl. A. Yani/ Psr Mereng Simp. 4 Talawi, Batubara. Hub: Rosini 0812 6002 9388

Fasilitas: Mobil Kerja, Uang makan (8000 s/ d 15000); Gaji pokok (350.000 s/d 1 Jt), Komisi (4 % s/d 8 % ), dan intensif lainnya. Bawa lamaran anda ke: Columbia Cash & Credit • Jl. Cokroaminoto, Kisaran, Telp.(0623) 44260 • Jl. Koptu Mahmun Lubis , Aek Kanopan.

TOKO CANTIKA COLLECTION :Menjual jilbab, busana muslim,

LOWONGAN KERJA : Dibutuhkan segera • Tenaga Marketing • Kolektor.


Menyediakan nasi sop ayam, kambing, sapi, soto,kare kambing, sop buah, tersedia aneka juice, kopi susu, (menu istimewa harga terjangkau) hub: Ibu KASMI-0823 6985 1755. Jl Medan Kisaran Km.99 simpang Kuala Tanjung, Indrapura.

SALMA D’CAFÉ menyediakan sarapan pagi, nasi serba 7000 dengan hidangan istimewa. Nasi goring, mie goring, bakso, pangsit, siomai, Batagor, bandrek, aneka juice. Menerima nasi kotak dan rantangan. Hub: Ibu salma , 081263497777 Jl. Kula Tanjung Kebun Kopi Indrapura, Batubara. BROKOLI CERIA: sajian spaghetti sehat. Menyediakan sajian: Mie Ayam, Mie Ketela, Mie Wortel, Mie buah, Martabak sayur, Aneka Juice, Kopi Luwak, Softdrink. Harga Terjangkau. Alamat: Jl. Jalinsum KM 99.5 Sei Suka, Batubara. HP: 0812 6217 910 RUMAH MAKAN BERSAMA: Menyajikan berbagai masakan, Nasi Goreng, Mie Goreng, Soto. Berbagai minuman, Aneka juice, teh manis, kopi susu, ginseng. SERBA EKONOMIS. Alamat: Simpang Kuala Tanjung, Indrapura, Batubara “RUMAH MAKAN DENAI MINANG” Menjual masakan khas padang, dengan menu istimewa: Nasi serba Rp.8000, rendang, gulai pari, daging sapi, ikan mas, ciri khas masakan rendang padang, serta menerima pesanan nasi kotak. Hub: Ibu AS , HP : 0817 4798 835. Jalinsum LimaPuluh BatuBara

RM. (TB) TELAGA BIRU: Khas masakan Minang, terkenal masakannya lezat. Menunya tersedia kopi susu, teh susu, & Juice. Terima Pesan nasi kotak. Jl. Jend. Sudirman No. 72, Indrapura, Batubara. Hub: 0813 9782 3094

R.M MINANG RAYA : Tersedia khas masakan minang, ayam pa n g g a n g , i k a n pa n g g a n g , k a r e kambing, Gulai kakap, ikanmas ARSIK, dengan menu istimewa, serta menerima pesanan katering/ nasi kotak. Hub: VERY, HP: 08216666 5855, Jalinsum, tanah merah, simp. 4 Indrapura, Batubara. Telah Hadir di Kisaran, “RUMAH JAMUR” menyediakan masakan ala jamur: Lontong sate jamur, Bakso jamur, Sop jamur Ayam kampung, Mie jamur ayam kampong, Krispy jamur, es jamur, dll. Buka setiap hari Kecuali “Jumat” jam 12.00 siang sampai malam. Kunjungi: Jl. Budi Utomo No. 116 Siumbut-umbut Kisaran. HP : 0877 4878 2775

BUTUH DANA TUNAI: Lamhot Jaya Motor j a m i n a n h a n y a BPKB Sepeda motor anda, persyaratan ringan, 1 jam cair, juga melayani jual beli sepeda motor. Hubungi alamat Pusat: Jl Diponogoro No.149, Kisaran.Telp 0623 43921 Hp : 081361505214

BUTUH DANA TUNAI?: Lamhot Jaya Motor jaminan hanya BPKB Sepeda motor anda persyarat ringan, 1 jam cair. Juga melayani jual beli sepeda motor. Hub: alamat Cabang kami di Jl. Lintas Siantar, Simp Tangsi. HP : 085373430808. Alamat Unit kami: Jl. Lintas Sei Mati, Ds Mekar Sari. HP : 085361450914


Donat Tiga Rasa Bahan : -kentang 500 gr -gula pasir 75 gr -telur 1 butir -terigu 350 gr -ragi instan (Fermipan) 1 sdm -susu bubuk 1 sdm -mentega 50 gr, lelehkan

SEBUAH penelitian baru-baru ini membuktikan bahwa semakin sering seseorang percaya pada pencitraan kisah asmara yang tidak realistis di serial televisi, maka di kehidupan nyata mereka akan semakin sulit untuk berkomitmen dalam suatu hubungan.

Cara membuat : 1. Kukus kentang, lumatkan hingga halus 2. Kocok gula + telur s/d mengembang (pakai mixer) , selanjutnya tanpa mixer 3. Masukkan jadi satu sama kentang 4. Masukkan lagi tepung terigu, ragi instan, susu bubuk, mentega yang sudah dilelehkan 5. Uleni s/d tidak lengket ditangan 6. Tutup dg lap basah selama 15 menit 7. Buka, bentuk donat 8. Goreng Cara menyajikannya : 1. Siapkan 2 piring ceper : 1. keju parut 2. Donat dioles atas dg mentega (pakai sapu kue) -meises ceres, lalu putar-putar dipiring 3. Gula pasir yang sudah siblender halus. Masukkan ke kantong plastik. Masukkan donat, kocok 4. Jadi ada 3 rasa.(int)

Tips Membentuk

Bokong BERI perhatian serius pada bokong Anda, sehingga bokong Anda akan menjadi lebih kencang dan berisi. Dalam melakukan olah raga, seringkali bagian bokong kurang mendapat perhatian. Agar otot sekitar bokong menjadi kencang, Andrea Metcalf, penulis buku Naked Fitness, berbagi tips untuk membentuk bokong menjadi kencang. Namun kuncinya adalah untuk konsisten melakukannya setidaknya seminggu tiga kali. Jika ingin terbentuk lebih cepat, lakukan setiap hari. Double Knee Leg Lift, dimulai dengan berlutut lalu perlahan turunkan posisi tubuh. Gunakan satu tangan untuk menumpu badan. Angkat satu lutut ke atas sebanyak 20 kali, kemudian tahan 10 hitungan dan ulangi 10 kali. Speed Skates, berdiri dengan kaki sejajar lalu silangkan kaki kiri ke depan kaki kanan seperti posisi skating. Letakkan kaki dalam posisi jinjit, sehingga terasa ada peregangan. Kemudian lompatlah ke sisi yang lain sehingga kaki kanan menyilang ke depan dan kaki kiri menapak di belakang. Lakukan secara bergantian. Curtsy, sejajarkan kedua kaki lalu langkahkan satu kaki ke belakang. Turunkan badan dengan menekukkan lutut Anda (lutut kaki yang menapak ke belakang jangan menyentuh lantai). Kedua kaki membentuk sudut sama sisi. Kembalikan posisi kaki hingga sejajar lalu ganti dengan kaki yang lain. Lakukan 20 kali pengulangan. Bridge Ball Curts, berbaring dengan punggung lurus lalu lakukan di atas stability ball. Perlahan angkat pinggul Anda, lalu gulingkan bola menggunakan kaki menjauh dan mendekat dari tubuh Anda. (int)


Anak Kreatif MEMILIKI anak yang memiliki daya kreativitas tinggi tentu menjadi impian setiap ibu. Meilhat anak-anak bertanya, bertingkah laku dengan kreatifitas akan menimbulkan kebahagiaan tersendiri. Berikut ini tips mendidik anak menjadi kreatif dalam kesehariannya: 1. Tidak membatasi ruang gerak anak Sifat anak-anak adalah suka mencoba hal baru dan tidak suka dibatasi. Jika anak terlalu dikekang dengan aturan ini-itu; hasilnya adalah sosok anak yang takut melakukan sesuatu karena laranganlarangan yang orang tua selalu sampaikan padanya. Oleh karena itu, biarkan anak bergerak sesuai keinginannya. Akan tetapi, tetap awasi mereka agar kreativitasnya tidak membahayakan atau bersifat merusak. 2. Memberikan pengarahanpengarahan yang sifatnya logis Anak yang kreatif indentik dengan karakter aktif, sedangkan anak yang aktif memiliki kecenderungan intelegensi yang tinggi. Mendidik anak menjadi kreatif dapat dilakukan dengan membiasakan diri untum mengarahkan anak dengan hal-

hal yang logis dan positif agar si anak terbiasa dengan hal-hal semacam itu. 3. Tenangkan diri sebelum menasehati anak Banyak orangtua yang menasehati anakanaknya dengan melibatkan emosi. Alih-alih membuat anak jera, yang ada justru anak akan semakin membangkang, atau menjadi sosok pendiam dengan kreativitas rendah. Menenangkan diri terlebih dahulu sebelum menasehati anak akan membuat mereka lebih nyaman sehingga apa yang kita sampaikan bisa diterima dengan lebih mudah. 4. Sabar dan tekun Anak-anak terkadang berulangkali melakukan kesalahan sama. Sebagai ibu, hendaklah tak pernah bosan mengingatkan dan meluruskan kesalahan anak, tentu dengan metode sepertio yang disebutkan sebelumnya. Hal ini akan membuka wawasan dan kreativitas anak tentang bagaimana ia harus berperilaku. 5. Liburan kreatif Sesekali, ajaklah anak-anak ke tempattempat yang unik, misalnya tempat wisata dengan fasilitas outbond, sentra kerajinan tangan, tempat wisata alam, dan sejenisnya. Usahakan mencari referensi tempat-tempat baru agar anak terus mendapat masukan baru. 6. Ajarkan permainan yang kreatif Permainan adalah salah satu cara efektif mendidik anak menjadi kreatif. Ajarkan anak-anak permainan yang mengasah kreativitas mereka. Di era modern ini, ada banyak referensi yang bisa anda dapatkan, misalnya dari majalah, buku, dan internet.(int)

Namun, mereka yang sangat menyukai kisah dalam drama romantis, akan merasa tidak pernah puas dalam kehidupan percintaannya, sebagaimana dilansir dari Livescience. Para peneliti melakukan penelitian terhadap 392 orang yang sudah menikah. Para responden diberi kuesioner mengenai kepuasan hubungan dengan pasangan, harapan dan komitmen, terkait dengan kepercayaan responden atas pencitraan hubungan romantis di televisi dan seberapa sering mereka menonton acara tersebut. Para responden yang mempercayai kisah drama romantis di televisi, cenderung kurang bisa untuk berkomitmen terhadap hubungan yang sedang dijalani. Mereka justru memperlihatkan adanya kecenderungan untuk berselingkuh atau memilih untuk kembali melajang. Para responden yang mempercayai pencitraan kisah cinta dalam serial televisi juga menilai bahwa hubungan yang mereka jalani membutuhkan pengorbanan besar, seperti hilangnya kebebasan dan waktu pribadi, serta pasangan yang tidak menarik. "Orang yang mempercayai kisah cinta di serial televisi merasa bahwa mereka harus membayar mahal atas hubungan yang sedang dijalani, dibandingkan dengan responden lain yang skeptis terhadap drama romantis," kata ilmuwan dari Albion College di Michigan, Jeremy Osborn. Namun mereka juga berharap kisah cinta yang sempurna seperti dalam drama romantis, sehingga mereka cenderung tidak merasa puas dengan hubungan yang sedang dijalani," ujarnya. Osborn juga mengatakan bahwa penelitian ini membuktikan bahwa serial televisi memiliki dampak dan pengaruh yang sangat besar, lebih dariyang diperkirakan sebelumnya. "Masyarakat kita terlalu tenggelam dalam pencitraan yang dipaparkan oleh media televisi dan internet, sebagian besar bahkan tidak bisa menyaring informasi sehingga memberikan dampak yang buruk," ujar Osborn. Osborn menambahkan bahwa sangat penting bagi masyarakat untuk mengetahui berbagai faktor yang memicu banyak terjadinya kegagalan dalam suatu hubungan.(int)

Sehat Berkat Sarapan Telur Telur menjadi makanan favorit sebagian orang karena kaya akan giziâ&#x20AC;? FAKTA ini juga didukung berbagai penelitian lainnya yang menunjukkan sarapan dengan telur memberikan sejuta manfaat bagi kesehatan Anda. Sumber energi. Telur rebus bisa menjadi pilihan untuk sarapan, terutama bagi Anda yang buru-buru atau sedang diet. Kuning telur dianggap efektif meningkatkan energi tubuh. Meningkatkan stamina. Protein dalam putih telur, atau disebut albumin, diyakini efektif membantu tubuh menyerap protein untuk membangun otot. Melindungi mata. Dua antioksidan, lutein dan zeaxanthin, dalam zat pigmen kuning telur membantu mencegah degerasi makula (penurunan ketajaman penglihatan) akibat penuaan. Keduanya juga melindungi mata dari kerusakan akibat paparan sinar UV. Menurunkan berat badan. Sarapan dengan telur malah membantu Anda menurunkan berat badan. Protein yang terkandung didalamnya bekerja sebagai penekan rasa lapar alami. Meningkatkan konsentrasi. Protein pada telur bisa membantu meningkatkan kadar dopamin. Inilah yang membantu meningkatkan konsentrasi dan membuat Anda tetap waspada. Perlambat penuaan otak. Kandungan kolin pada telur membantu perkembangan memori dan fungsi kognitif, serta membantu mengasah memori atau daya ingat otak lebih tajam dan mencegah demensia. Bikin kenyang. Memilih sarapan dengan dua butir telur di pagi hari membantu Anda merasa kenyang lebih lama daripada sarapan sereal atau roti panggang. Sehingga, sarapan telur bisa membantu menghentikan kebiasaan ngemil Anda diantara waktu makan. Tidak memperburuk kolesterol. Memang benar bahwa telur mengandung sejumlah kolesterol. Namun, kolesterol dalam telur tidak akan berdampak pada kadar kolesterol darah Anda. Jadi, tetap aman dikonsumsi, karena tidak meningkatkan risiko penyakit jantung.(int)


28 September 2012

Angelina Sondakh

Nangis Sepanjang Jalan USAIsidang,AngelinaSondakhberjalanperlahanmenuju mobil tahanan. Mengenakan seragam putih tahanan KPK, Angie menceritakan alasannya meminta tahanan rumah. Begitu menyebut nama anak-anaknya, Angie langsung menangis. “Tentunya saya memperhatikan perkembangan Keanu, setelah 6 bulan terpisah ya. Biasa ngomongin anak jadi kangen. Kalau misalkan saya, kita lebih baik ditanyakan kepada psikolog. Kalau hakim mengabulkan saya tahanan rumah, baik untuk anak saya,” jelasnya sambil menahan tangis di Pengadilan Negeri Tindak Pidana Korupsi (Tipikor), Jalan HR Rasuna Said, Jakarta Selatan, Kamis (27/9) pagi. Angie didakwa melakukan korupsi pada kasus KemendiknasdanKemenporadengantotalkerugiannegara Rp12,58 miliar dan US$2,35 juta sehingga harus ditahan selama masa persidangan. “Mama saya sudahtua, sebenarnya kan memang tinggal di Manado.Sayamaumendampingi,berharap bisadikabulkan.KalauZahwadanAliyah itu ada teh Reza, kalau Keanu kan sendirian. Mama saya kan kondisi kesehatantidakbegitubaik,”katanya sambil terisak. Angie berharap majelis hakimtidakragumemberistatustahananrumahkepadanya. “Saya tidak akan lari dan saya juga tidak akan mengulangi perbuatanyangdituduhkan.Sepertiyang sudah disampaikan oleh pengacara saya, dan mudah-mudahan majelis hakim bisa mempertimbangkan untuk mengubah status,” tuturnya. Usai sidang, Angie mempersiapkan langkah hukum selanjutnya. “Selanjutnya tahap pembuktian. Kami menerima keputusan majelis hakim dan melanjutkan ke tahapan berikutnya. Tapi saya sebagai ibu dan anak, saya memerlukan seorang ibu karena ayahnya sudah meninggal dan berharap majelis hakim bisa mengabulkan,” pungkasnya. (kpl/int)


Ciuman Nikita

Dihargai Rp5 Juta

SENSASI selalu lekat dengan Nikita Mirzani. Setelah foto syurnya dengan beberapa selebritis, kali ini Nikita yang menjadi salah satu host dalam sebuah acara amal, sengaja melelang ciumannya untuk dihargai sejumlah nominal tertentu. “Ya, itu tadi enggak sengaja saja, ya kebetulan ada yang mau bayar kenapa enggak, ini kan buat amal, bukan buat gue sendiri,” ujar Nikita ketika dijumpai di Konser KOIN (Kepedulian Orang Indonesia): Senandung Untuk Negeri, Hard Rock Cafe, Jakarta Selatan, Rabu (26/9) malam. Awalnya, Nikita menawarkan kepada tamu yang hadir sebuah tiket pertama konser musisi Sting yang akan manggung di Ancol, Jakarta, 15 Desember mendatang. Tiket perdana itu dihargai Rp10 juta. Sayangnya, setelah menunggu, tak satupun tamu yang tertarik. Untuk memanaskan acara, Nikita sengaja turun dari panggung dan menghampiri seorang pria paruh baya

bernama Buddy Jansen (60) dan mulai menggodanya. “Ayo dong Pak, mau ya Pak tiket Sting Rp10 juta lho Pak,” kata Nikita yang tak melihat respon dari bapak berbaju batik itu. “Kenapa enggak mau? Enggak suka? Sukanya apa? Saya? Ya sudah deh saya Rp10 juta saja,” tawar Nikita menggoda. Karena Nikita menilai angka Rp10 juta terlalu mahal untuk sebuah tiket konser, janda satu anak itu menurunkan penawaran lelangnya menjadi Rp5 juta. Tak disangka, sambutannya sangat baik. Dari pengamatan, Nikita yang mengenakan pakaian berpotongan dada rendah dan memperlihatkan tato bertuliskan ‘Nikita’ di dadanya itu memberikan tawaran menggiurkan berupa ciuman plus sebuah tiket. “Demi Sulawesi Tengah, Rp 5 juta for kissing!” teriak

Nikita. “Mau Bapak yang cium atau saya yang cium?” tanya Niki yang langsung disahuti oleh Farhan. “Karena ini konser amal untuk Sulawesi Tengah, ciumannya di tengah dong,” tantang Farhan. Selama beberapa detik, Nikita menempelkan bibir seksinya ke bibir pria berusia 60 tahun itu tanpa malu-malu di depan tamu lain. Kejadian itu sempat diabadikan seluruh tamu yang hadir dengan menggunakan kamera ponsel maupun jepretan awak media. ”Taste very nice , saya mau one more time tapi jangan lah, cukup,” kata pengusaha berdarah IndonesiaBelanda bernama Buddy Jansen (60) itu seraya tertawa. “Saya bilang, saya suka kamu, dia bilang mau di pipi, tapi saya enggak mau, saya maunya di bibir,” celetuk pengusaha tambang itu. (nov/int)


(23 September - 22 Oktober) Peruntungan: Tak perlu banyak bicara jika tidak diimbangi dengan kerja yang cukup. Ingatlah bahwa semua itu perlu bukti, bukan hanya ucapan di bibir saja. Asmara: Usahakan untuk tidak berdebat dengannya, mengalah sajalah.


(21 Desember -19 Januari)

Peruntungan: Yakini intuisi yang timbul dari hati Anda yang paling dalam. Dengan kata lain feeling akan memegang peranan dalam kesuksesan Anda di hari ini. Asmara: Bertuturkatalah yang halus dan tanpa suara yang kasar karena akan mampu mengurangi ketegangan yang seringkali muncul bila ada perbedaan pendapat.


(20 Januari - 18 Februari)

Peruntungan: Tak perlu pesimis dalam melihat berbagai tantangan yang terpampang di hadapan Anda. Justru Anda harus lebih giat bekerja lagi karena itu pertanda bahwa kesuksesan sudah berada di depan mata. Asmara: Walau hanya sebatas berbicara saja sebaiknya dihindari dulu bergaul dengan orang yang tidak disukai si dia.


19 Februari - 20 Maret

Peruntungan: Situasi yang Anda hadapi saat ini masih belum memungkinkan bagi Anda untuk bisa berani melangkah maju. Terimalah situasi yang ada ini dengan pikiran panjang dan jangan hanya memikirkan keberhasilan sesaat saja. Asmara: Mengakui kesalahan sendiri bukanlah suatu perbuatan yang sangat rendah, justru itu akan membikin si dia semakin percaya saja pada diri Anda.


(21 Maret - 20 April)

Peruntungan: Perasaan bimbang masih mewarnai suasana hati Anda di hari ini. Memang untuk menghilangkannya tak semudah membalik tangan, akan tetapi dengan menanamkan kebanggaan dan keyakinan akan kemampuan diri sendiri itu akan bisa mengikis kebimbangan secara perlahan-lahan.Asmara: Ucapan tetap harus diperhatikan agar tidak sampai merusak suasana yang sudah tenang ini.


(21 April - 20 Mei)

Peruntungan: Masih cukup ada rintangan yang harus diwaspadai, walau begitu tak perlu berkecil hati dan tak perlu risau akan ejekan yang muncul. Asmara: Jagalah selalu keserasiannya. Kalau ada pihak yang ingin mengacaukan suasana jangan dibiarkan saja.


(21 Mei - 20 Juni)

Peruntungan: Jangan meremehkan persoalan yang datang, walau sepintas tampak sepele jika tidak segera dituntaskan maka bisa semakin membesar saja. Bukankah persoalan besar bermula dari persoalan kecil, untuk itu jangan tanggung-tanggung untuk bertindak.Asmara: Suasana percintaan Anda tetap terjaga sekalipun cekcok mulut masih sulit untuk dihilangkan.


Nia Ramadhani

Kompak Jalan Bareng Mertua NIA RAMADHANI terlihat mendatangi sebuah konser amal. Kehadiran Nia Ramadhani tak cuma didampingi oleh suaminya, tapi juga oleh mertuanya, Aburizal Bakrie. Ketiganya terlihat memasuki sebuah klub untuk menghadiri acara konser amal untuk bencana di Sulawesi Tengah. “Keluar begini enggak sering, tapi begitu sempat pasti diluangkan waktunya,” kata Aburizal Bakrie alias Ical saat dijumpai tom abloidnova.cdi Konser KOIN (Kepedulian Orang Indonesia): Senandung Untuk Negeri, Hard Rock Cafe, Jakarta Selatan, kemarin malam. Bagi Nia dan Ardie, sosok Ical adalah pria yang sangat dekat dengan keluarga. Jika tidak memiliki kegiatan lain diluar politik, Ical akan memilih menghabiskan waktunya bersama keluarga besarnya. “Sebenarnya papa itu sosok yang sangat dekat dengan keluarga. Kan kalau lagi enggak ada kegiatan apa-apa pasti ngumpul sama keluarga,” kata Nia. “Beliau selalu mengedepankan keluarga. Beliau juga suka Slank, jadi langsung diajak kesini,” timpal Ardi. Berada di tengah-tengah anak muda yang asik mendengarkan musik sekaligus lelang untuk amal, Aburizal terlihat sangat menikmati suasana. Bahkan, kata Nia, ayah mertuanya itu asik berjoget-joget. “Usia saya juga baru 26 kok, enggak ada masalah, asal jangan sering-sering,” canda Ical. “Terpaksa di dalam papa joget-joget,” sahut Nia tertawa. (nov/int)

(21 Juni- 20 Juli)

Peruntungan: Jangan bertingkah macammacam jika tidak ingin mengalami kegagalan yang sangat terasa. Sekalipun peluang masih belum tertutup, sebaiknya Anda bisa mengimbanginya dengan konsentrasi tinggi. Asmara: Jalinlah hubungan kisah kasih ini dengan sesuatu yang indah dan menyenangkan.


(21 Juli-21 Agustus)

Peruntungan: Tak perlu cemas, sesulit apapun masalah tersebut pasti ada jalan keluar untuk memecahkannya. Teruslah berusaha, jangan pantang menyerah dan yang paling penting keyakinan harus tetap tinggi. Asmara: Ada sedikit perbaikan walau belum seperti yang diharapkan.


(23 Agustus-22 September)

.P eruntungan: Saat ini Anda benar-benar

merasakan indahnya hidup, apalagi ditunjang dengan suasana yang benar-benar semarak dan segala urusan pekerjaan yang sudah lumayan lancar sehingga tidak ada beban yang terlalu dipikirkan. Asmara: Cukup mesra dan bahagia. Jagalah suasana ini dengan mencari topik pembicaraan yang menyenangkan.


(23 Oktober - 22 November)

Peruntungan: Cobalah untuk bisa lebih teliti agar segala urusan yang sudah hampir jadi tidak sampai mentah lagi hanya karena diri Anda yang kurang bisa mengikuti rencana yang dibuat sendiri. Asmara: Apa sulitnya berbicara yang halus? Tak perlu dengan katakata kasar karena itu akan menyulitkan Anda saja.


( 23 November - 20 Desember)

Peruntungan: Walaupun Anda sudah merasa berada di atas angin sebaiknya kewaspadaan tetap dipertahankan. Jangan sampai berlaku sembrono karena akan berdampak cukup luas jika sampai terjadi hal-hal yang tidak diduga sebelumnya. Asmara: Jangan terlalu dimasukkan hati tingkahnya yang kadang menjengkelkan hati karena itu hanya sementara saja.


Minta Harta Mantan Suami Yulia Rachman SELAIN menginginkan perceraian, pesulap Demian Aditya ternyata juga menginginkan harta bersama sang istri, Yulia Rachman, dibagi dua. Parahnya, Demian juga meminta harta yang dimiliki Yulia bersama dengan mantan suaminya terdahulu. “Yang diminta (Demian, red) Aditya harta yang jauh sebelum perkawinannya dan bukan haknya. Selain itu, yang dia minta di luar konteks, pertama perwalian. Padahal kan menurut UU, anak-anak di bawah umur ikut ibu,” ujar kuasa hukum Yulia, Petrus Balapationa, saat ditemui di Pengadilan Agama Jakarta Selatan, Kamis (27/9). Sementara itu, Yulia sendiri heran kenapa Demian tidak menghadiri persidangan hari ini. Pasalnya, keinginan Demian untuk mendapatkan harta gono gini dan hak pengasuhan anak harusnya dibicarakan langsung dalam persidangan. “Saya nggak ngerti kenapa dia nggak hadir karena katanya karena pekerjaan. Harusnya kan bisa dijadwalkan dan dibicarakan dengan kuasa hukum, kita tahunya di sini karena ada kerjaan. Tapi di sini tadi pengacaranya bilang dia nggak mau datang karena sudah ngotot cerai. Artinya memang ada miss komunikasi dari pihak mereka,” ujar Yulia. Lalu bagaimana perasaan Yulia mengenai jalannya perceraian yang semakin lama ini? “Kalau ditanya, jauh lebih bahagia perasaannya dibanding kemarin. Makin lama makin terlihat, ya Allah tolong dibukakan. Saya mau mediasi untuk anak dan harta gono gini. Ayo selesaikan baik-baik,” harap presenter cantik ini. (kpl/int)

Eunjung ‘T-ara’

Gugat Produser Drama ‘Five Fingers’ Personel T-ara Eunjung sebelumnya telah dipastikan ambil bagian di drama SBS ‘Five Fingers’. Namun, karena kontroversi T-ara pasca dikeluarkannya Hwayoung, Eunjung dikeluarkan dari drama tersebut. Sebagai buntutnya, pihak agensi Eunjung Core Contents media akhirnya memutuskan untuk menggugat produser drama tersebut. Mereka menganggap pembatalan itu merusak reputasi Eunjung. ”Kami mengajukan gugatan karena dikeluarkannya Eunjung dari ‘Five Fingers’ Agustus lalu. Masalahnya bukan tentang uang tapi memulihkan reputasi Eunjung dan kompensasi dari rusaknya kredibilitas Eunjung,” ujar juru bicara Core Contents Media dilansir Soompi, Kamis (27/9). Bagi Core Contents, dikeluarkannya Eunjung dari drama tersebut memperkeruh keadaan usai kontroversi T-ara. Peran Eunjung dalam drama itu digantikan oleh aktris Jin Se Yeon. ”Ia terluka secara emosional dari kontroversi T-ara tapi dikeluarkannya ia hanya membuatnya semakin buruk. Ia sudah jadi aktris sejak kecil dan kami belum pernah mengalami atau mendengar kasus seperti ini sebelumnya. Mencegah hal seperti ini terjadi lagi dan untuk mengembalikan reputasi Eunjung, kami memilih untuk mengajukan gugatan,” pungkasnya. (dtc/int)

Jennifer Lopez

Bawa 88 Kru dari Amerika BANYAK syarat yang diajukan Jennifer Lopez ketika akan manggung di Indonesia. Mulai dari sound system hingga keamanan. Namun, ada hal unik yang diminta JLo. Ia meminta agar tidak disiapkan air di Indonesia. JLo selalu membawa air khusus. “Enggak ada yang aneh-aneh, semua yang diminta bisa diganti. Kecuali air minum,” ujar Reza Prawiro, Presdir Stellar yang mendatangkan JLo ke Indonesia. Reza menjelaskan, saat ini tim nya masih melakukan persiapan untuk konser JLo yang akan dilangsungkan pada 30 September. “Sampai saat ini persiapan masih berjalan. Ada 88 orang termasuk band. Mereka bawa imax, itu pertama kali dipakai untuk pembukaan olimpic. Dia bawa tim khusus untuk visual,” jawabnya. Ditambahkan Reza dirinya belum bisa menjelaskan apa saja yang akan dibawa JLo untuk konsernya nanti. Namun, untuk memenuhi segala kebutuhana, JLo dancer hingga kru yang dibawa dari Amerika. “Dari 88 orang itu akan ada 16 dancer. Kalau perlengkapan berapa kontainer kita belum tahu pasti, soalnya mereka akan bawa alat-alat sendiri,” tandasnya. (nov/int)



28 September 2012

Indonesia Open Grand Prix Gold 2012

Srikandi-srikandi Indonesia Melenggang Tampil di hadapan suporter fanatik Indonesia, srikandisrikandi bulutangkis Merah Putih tampil kesetanan di babak ketiga kejuaraan Indonesia Open Grand Prix Gold 2012, Kamis (27/9), di Palembang, Sumatera Selatan. Ganda putri Indonesia, Anneke Feinya Agustin/Nitya Krishinda Maheswari melangkah ke babak keempat usai menyingkirkan kompatriot mereka Gebby Ristiani Imawan/ Tiara Rosalia Nuraidah melalui pertarungan dua set, 2117 dan 21-12. Langkah Anneke/ Nitya juga diikuti Anggia Shitta Awanda/Devi A Shela

yang menaklukkan pasangan Jepang, Yuki Fukushima/Yui Miyauchi dengan rubber set, 17-21, 21-13, dan 21-19 di babak ketiga. Hasil serupa pun

diperoleh ganda putri Merah Putih lainnya, Pia Zebadiah/Rizki Amelia yang menyisihkan pasangan Indonesia lainnya, Khairunnisa Imma

Muthiah/Geovani Mareta Dea dengan straight set, 21-12 dan 21-13. Untuk nomor tunggal putri, Rusydina Antardayu Riodingin tampil mengejutkan dengan menyingkirkan unggulan ketiga asal Singapura, Xing Aiying melalui pertarungan tiga set, 2022, 23-21, dan 21-15. Renna Suwarno juga mengikuti jejak Rusydina melaju ke babak keempat usai menundukkan tunggal putri Indonesia lainnya, Tike Arieda Ningrum dengan dua set, 21-12 dan 21-17. Fanetri Lindaweni juga memastikan tiket ke babak keempat setelah menyisihkan pebulutangkis putri Jepang, Nozomi Okuhara dengan straight set, 22-20 dan 21-14. Hasil positif juga ditorehkan Adrianti Firdasari di nomor tunggal putri setelah menyingkirkan Sayaka Takahashi dari Jepang lewat pertarungan tiga set, 13-21, 21-13, dan 23-21. (int)

Ganda Putra Sapu Tiket Perempatfinal

Azarenka Tersingkir DUA unggulan dalam turnamen Pan Pacific Open yatua Victoria Azarenka asal Belarusia dan petenis Rusia Maria Sharapova tesingkir di babak perempat final, Kamis (27/9). Azarenka harus tersingkir setelah mengalami kelelahan kronis, sementara si cantik Sharapova harus mengakui keunggulan petenis Australia Samantha Stosur. Sharapova harus mengubur mimpinya untuk meraih gelar ketiganya di Tokyo setelah dalam perempat final yang penuh drama dan kualitas tinggi itu menyerah dua set langsung 6-4 dan 7-6 dari Samantha Stosur.

Unggulan kedelapan Stosur di babak semifinal akan menghadapi petenis Rusia lainnya Nadia Petrova yang menghentikan laju unggulan keenam Sara Erano dengan tiga set 36, 7-5 dan 6-3. Stosur yang hanya menang satu kali dari 11 kali pertemuan sebelumnya dengan Sharapova berhasil memulai inisiatif pertandingan dan merebut set pertama setelah pengembalian backhand Sharapova melebar. Di babak kedua laga lebih ketat dan harus diselesaikan melalui tie-break dengan angka sangat ketat 12-10. Sementara itu juara Australia

Terbuka tahun ini Victoria Azarenka mengundurkan diri sebelum laga melawan petenis Jerman Angelique Kerber dimulai karena kelelahan. Finalis Amerika Terbuka ini juga terlihat susah payah dalam laga babak ketiganya kemarin. “Sebelum turnamen saya memang merasa kurang sehat,” kata Azarenka yang mendapatkan pemeriksaan tekanan darah saat menghadapi Roberta Vinci, Rabu (26/9). “Energi saya sangat lemah dan saya bukan diri saya saat ini. Mungkin ini dampak kelelahan selama musim ini. Saya sendiri tidak tahu apa yang terjadi,” kata Azarenka. (int)

TUJUH ganda putra Indonesia berhasil memastikan diri melaju ke babak perempatfinal kejuaraan Indonesia Open Grand Prix Gold 2012 setelah menyisihkan lawan mereka masing-masing, di Palembang, Sumatera Selatan, Kamis (27/9). Ganda putra unggulan keempat, Angga Pratama/Ryan Agung Saputra tampil cemerlang saat mengalahkan pasangan Indonesia lainnya, Wahyu Nayaka/Ade Yusuf dengan dua set

Maria Kristin GANTUNG RAKET MANTAN pebulu tangkis putri nasional, Maria Kristin Yulianti, akhirnya mengundurkan diri sebagai pemain. Cedera lutut kanan yang berkepanjangan membuat Maria Kristin mengambil keputusan untuk gantung raket. Asisten Manajer PB Djarum Kudus Hastomo Arbi ketika dihubungi dari Semarang, Kamis (27/9), mengatakan sudah setahun ini peraih medali perunggu Olimpiade 2008 Beijing tersebut tidak latihan. Sebenarnya, kata mantan pebulu tangkis nasional tersebut, Maria Kristin sudah berusaha menjalani terapi,

dan beberapa kali mencoba untuk latihan. Tetapi ternyata dia merasa semakin sakit. Akhirnya, tambah pahlawan Piala Thomas 1984 (saat itu mengalahkan Han Jian dari China), Maria Kristin mengambil keputusan untuk mundur dari bulu tangkis. “Setahun yang lalu (awal Januari 2011) yang bersangkutan sudah mundur dari pelatnas,” katanya. Ia mengatakan, sekarang ini Maria Kristin menjadi pelatih di PB Djarum Kudus khusus menangani pemain muda usia 12 tahun. Prestasi terakhir yang dicapai pemain kelahiran Tuban, Jatim, 25 Juni 1985 tersebut adalah menjadi runner-up pada Russian White Nights Challenge 2011. Pada partai final dia dikalahkan rekannya Fransiska Ratnasari melalui pertarungan tiga game 15-21, 23-21, 1121. Prestasi tertinggi Maria Kristin adalah saat meraih medali perunggu Olimpiade 2008 Beijing. Saat itu Maria Kristin mengalahkan tunggal putri tuan rumah Lu Lan dengan tiga game 11-21, 2113, 21-15. Prestasi lain yang dicapai Maria Kristin adalah meraih medali emas SEA Games 2007 pada tunggal putri dan beregu putri. Dia ikut mengantarkan tim Uber Indonesia melangkah ke semifinal 2010, semifinalis tim Indonesia di Piala Sudirman Guangzhou 2009, di samping prestasi lainnya. (int)

RED BULL JENGKEL DENGAN KONSISTENSI ALONSO RED BULL Racing mengakui konsistensi driver Ferrari, Fernando Alonso musim ini merupakan hal yang menganggu bagi tim yang dibela Sebastian Vettel dan Mark Webber ini. Vettel berhasil menempati podium teratas di Grand Prix Formula OneSingapuraakhirpekanlalu.Hasil itu membuat selisih driver asal Jerman tersebut dengan Alonso menjadi tinggal 29 poin. Alonso sendiri masih bercokol di peringkat pertama klasemen pembalap dengan torehan 194 poin. Principal team Red Bull, Christian Horner masih percaya pada kemampuan Vettel, namun diakuinya penampilan Alonso membuat Red Bull kesulitan mengejar. “Sekarang, Seb (Vettel) memiliki manfaat dari pengalamannya,” jelas

Horner ketika ditanya apakah Vettel akan bisa bertahan dalam persaingan ketat musim ini. “Dia telah mendapat beberapa kesulitan selama musim ini, dan dia

tak pernah menyerah. Saya belum pernah melihat dia begitu fokus ketikaturundiGPSingapura,”terang Horner. Horner juga memuji performa Vettel yang sanggup finis

terdepan di GP Singapura kendati start dari urutan ketiga. Dia juga senang dengan hasil yang dicetak Vettel, karena mampu memelihara peluang mempertahankan gelar juara dunia F1. “Dia tampil sangat mengesankan saat race. Hasil itu membuat peluang kami untuk kembali memenangkan gelarpadamusiminikembaliterbuka lebar,” katanya. “Tetapi, satu-satunya yang menjengkelkan dan sedikit membuat kami kurang bahagia dalam euforia kemenangan adalah karena Fernando (Alonso) juga finis dengan meraih podium di akhir grand prix,” pungkasnya. (int)

langsung, 21-17 dan 21-12. Hasil serupa juga ditorehkan Jordan Praveen/ Juang Didit yang menyingkirkan rekan mereka di pelatnas, Ricky Karanda/ Muhammad Ulinnuha melalui rubber set, 21-19, 16-21, dan 21-18. Pasangan Tanah Air lainnya yang melangkah ke perempatfinal adalah Hendra Wijaya/Rian Sukmawan yang mempermalukan senior mereka di pelatnas, Markis Kido/Tri Kusharyanto dengan pertarungan tiga set, 21-15, 1821, dan 21-18. Sementara itu, Faisal Hafiz/ Rhoma Putra Eka juga menambah daftar ganda putra Indonesia di babak perempatfinal usai memulangkan pasangan Malaysia, Mohd Lutfi Zaim/Teo Kok Siang dengan kemenangan tiga set, 13-21, 21-16, dan 22-20. Langkah serupa juga diraih

ganda putra Merah Putih muda, Andrei Adistia/Christopher Rusdianto yang menundukkan pasangan Singapura, Yeo Zhao Jiang/Yi Liu melalui dua set langsung, 25-23 dan 2220. Indonesia kembali menempatkan wakilnya di nomor ganda putra lewat Gideon Markus Fernaldi/Putra Agripinna Prima yang menyingkirkan wakil Filipina, Ronel Estanislao/Paul Jefferson Vivas melalui pertarungan dua set, 21-12 23-21. Ganda putra terakhir Indonesia yang lolos ke perempatfinal adalah Yonathan Suryatama/Hendra Apriadi yang menaklukkan Rahmat Adianto/Berry Angriawan lewat rubber set, 17-21, 2112, dan 21-19. Satu tempat lagi di di nomor ganda putra diraih pasangan Korea Selatan, Kim Ki Jung/Kim Sa Rang yang menyisihkan pasangan Indonesia, Ronald Alexander/Selvanus Geh dengan melalui tiga set, 23-21, 22-24, dan 21-12. (int)

Wow, Mantan Finalis Miss Kroasia

Latih Tim Sepakbola Putra PARA pemain sebuah klub di Kroasia ini pasti akan selalu semangat saat menjalani latihan dan bermain. Karena mereka dilatih oleh seorang wanita cantik, mantan finalis Miss Sport Kroasia. Ya, klub Divisi 5 Kroasia, NK Viktorija Vojakovac telah menunjuk Tihana Nemcic sebagai pelatih. Tihana tampaknya menjadi wanita pertama yang melatih tim sepakbola pria. “Kini, saya menjadi pelatih kepala. Saya punya kebebasan untuk merumuskan taktik bagi tim,” kata Tihana kepada World Soccer. “Para pemain tahu cara menerapkan strategi itu, tapi masih banyak yang harus dibenahi.” “Mereka juga tak pernah menimbulkan masalah seperti menggoda saya,” lanjut Tihana. Para pemain takut menggoda wanita 24 tahun ini karena kemampuan olah bolanya cukup mumpuni. Tihana masih tercatat sebagai pemain di tim Dinamo Zagreb putri. Ia juga anggota tim nasional Kroasia putri. Menurut Tihana, penunjukannya sebagai pelatih sebagai hal yang wajar. Karena ia sudah lama berada di level atas sepakbola putri. “Jika pria dan wanita punya kemampuan dan kualifikasi sama untuk melatih, tak ada alasan bagi saya untuk tak melatih tim putra,” lanjut Tihana. “Saya melatih tim hebat yang selalu berkembang dan berpeluang memuncaki liga.” Jarang sekali wanita melatih tim pria, atau mungkin tidak ada. Dan Tihana bisa menjadi pioner untuk posisi itu. Untuk itu, ia pun rela menanggalkan profesi model untuk sementara. Tihana merupakan finalis Miss Sport Kroasia 2008. Saat itu, ia sempat masuk deretan 15 kontestan terbaik. (int)

JUMAT 28 September 2012


„ Almeyda

Bentrok Para Unbeaten

Almeyda Ungkap Kasus Doping

Arsenal vs Chelsea. Siapa pun yang menang akan mempertahankan label unbeaten (belum terkalahkan) dan memberikan kekalahan pertama bagi si pecundang.

Ditulis Pada Autobiografi Kasus penggunaan doping dan pengaturan pertandingan terbaru muncuk di Italia. Kali ini Matias Almeyda yang mengungkapkannya, dalam sebuah autobiografi yang dia rilis belum lama ini. Almeyda tercatat sempat sembilan musim merumput di Liga Italia. Gelandang asal Argentina itu memperkuat empat klub berbeda yakni Lazio, Parma, Inter Milan dan Brescia. Tujuh tahun setelah meninggalkanItalia,priayangkini melatih River Plate itu membuat kejutan menyusul terbitnya sebuah autobiografi yang diberi judul ‘Almeyda: Life and Soul’. Dalam buku tersebut, dia mengklaim telah mendapatkan obat-obatan yang mampu meningkatkan performa di atas lapangan. Kejadian tersebut diyakini terjadi dalam periode 2000 sampai 2002, saat dia memperkuat Parma. “Di Parma kami diberikan IV drip (memasukkan substansi cair langsung ke dalam saluran darah) sebelum pertandingan. Mereka bilang itu adalah campuran vitamin, tapi sebelum memasuki lapangan saya bisa melompat setinggi langit-langit,” tulis ‘Almeyda dalam bukunya dan kemudian dimuat oleh Gazzetta dello Sport. “Para pemain tidak ada yang bertanya tapi beberapa tahun kemudian ada kasus di mana mantan pemain tewas karena masalah pada jantungnya, menderita masalah otot dan lain lagi. Saya pikir ini adalah konsekuensi atas apa yang sudah diberikan pada mereka.” Yang tak kalah mengejutkan dari autobiografi tersebut adalah pengakuan Almeyda atas pengaturan pertandingandipekanterakhirSeriAmusim2000/2001. Saat itu Roma yang menghadapi Parma butuh kemenangan untuk memastikan meraih gelar juara. “Beberapa rekan saya di Parma bilang kalau pemain Roma ingin kami kalah dalam pertandingan tersebut. Saat itu kami memang tidak lagi mempertaruhkan apapun, itu akan sama saja (kalah atau menang).” “Saya katakan tidak dan mayoritas pemain juga menyatakanhalsenada.Tapidiataslapangan,sayalihat beberapa pemain tidak berlari seperti biasanya. Jadi saya meminta diganti dan langsung pergi ke ruang ganti. Uang? Saya tidak tahu, mereka menyebutnya sebagai pertolongan.” (int)


emang ada cara lain supaya keduanya mempertahankan status tersebut: bermain imbang. Tetapi, Chelsea, si pemuncak klasemenyangkinihanyaunggulsatu poin atas Manchester United, bisa jadi tak akan mengambil opsi tersebut.Sementara,Arsenalbarusaja mendapatkan hasil imbang dengan Manchester City akhir pekan lalu. The Blues sejauh ini tampil impresif. Imbang 0-0 melawan QueensParkRangersmenjadihasilterburuk mereka sejauh ini. Dengan lini serang yang begitu ‘wah’, mereka hanya menang tipis 1-0 atas StokeCityakhirpekanlalu.Namun, Roberto Di Matteo tetap puas dengan kemenangan tersebut. Di Matteo menyebut bahwa timnya mampu mencari cara bagaimana membongkar pertahanan tim yang bermain super defensif. Siapa pun yang menjadi pencetak golnya tak masalah, dan hadirlah Ashley Cole sebagai pahlawanpadalagamelawanStokeitu. Manajer asal Italia itu juga tidak perlupusingmemikirkansiapayang akan dipasang di depan. Chelsea punyastokcukupmelimpahdisana —Eden Hazard, Fernando Torres,

„ Lukas Podolski

„ Pemain Liverpool berebut bola saat pertandingan melawan West Bromwich pada ajang Piala Liga Inggris, Kamis (27/9)

Piala Liga Inggris

Sahin Loloskan Liverpool Pasangan Pesepakbo la Terpopuler

„ Radamel Falcao

Falcao Tak Pikirkan Gelar El Pichichi MADRID- Melihat produktivitasnya di lapangan, Radamel Falcao menjadi salah satu pemain yang dijagokan jadi top skorer La Liga musim ini. Namun Falcao enggan memikirkan hal itu dan memilih fokus untuk Atletico Madrid. Dalam tiga musim terakhir, nama Lionel Messi dan Cristiano Ronaldo selalu bersaing dalam perebutan gelarpencetakgolterbanyakatauElPichichi.Kininama Falcao ikut muncul untuk memperebutkan titel tersebut. Jika menilik daftar pencetak gol La Liga musim ini, maka nama Falcao ada di daftar teratas. Dia sudah melesakkan tujuh gol dalam lima pekan. Jumlah gol penyerang asal Kolombia itu mengungguli Messi yang ada di urutan kedua dengan enam gol. Sementara Ronaldo baru mencetak tiga gol untuk Real Madrid. Meskisedangmemimpindaftarpencetakgol,Falcao belummauberpikirsoalgelartopskorer.Diahanyaingin fokus untuk membantu Los Rojiblancos bersaing di La Liga. “Saya tidak pernah mengatakan bahwa saya ingin bersaing dengan Cristiano dan Messi. Saya hanya ingin mencetak gol dan membantu tim, tidak lebih,” ujar Falcao seperti dilansir Football Espana. “Satu-satunya hal yang saya pikirkan adalah mencapai tujuan saya. Kami melawan 19 tim, tidak hanya Real Madrid dan Barcelona,” katanya menambahkan. (int)

Oscar, Juan Mata, dan beberapa lainnya—. Kalaupun ada yang perlu dikhawatirkan adalah mengendurnyapertahananseperti yang dialami ketika melawan Juventus di Liga Champions. Arsenal memang bukan tim yang defensif seperti Stoke. Tapi, merekatahucarabertahandengan baik. Mereka baru kebobolan dua gol dan sudah mencetak sembilan gol dalam tiga laga terakhir. Jika ditambah laga Piala Liga Inggris, maka The Gunners sudah menciptakan 15 gol dalam empat pertandingan terakhir. SteveBould,mantanbektimasal London Utara itu dan kini jadi asisten baru Arsene Wenger, dianggap jadi orang yang paling berjasa dalam memperkuat pertahanan Ar-

senal. “Kami bekerja keras melatih cara kami bertahan dan Anda bisa melihat itu dari tiga clean sheet yang kami dapat,” kata Thomas Vermaelen. Di sisi lain, keliatan Cazorla sebagaisalahsatuamunisiliniserang terbilang mantap. Ia, dan juga Aaron Ramsey, beberapa kali melepaskan passing ciamik dalam laga melawan City. Beberapa umpan terobosan pun mampu menembus barisan bek yang digalang Vincent Kompany. Sial bagi mereka, beberapa kali penyelesaian akhinya tidak se-ciamik operan itu sendiri. Di Emirates Stadium, Chelsea justru memiliki catatan yang lebih bagusdibandingArsenal.Darilima pertemuan terakhir kedua tim di Emirates Stadium di semua kompetisi, Arsenal hanya mampu meraih satu kemenangan, menelan tiga kekalahan dan sekali imbang. (int)

Kehidupan para bintang lapangan hijau selalu menarik untuk disimak. Bukan hanya aksi dan penampilan merekadidalamlapangan,kisahcinta mereka pun selalu menarik untuk diperbincangkan. Berikut daftar 10 teratas(partI)pasanganpesepakbolaselebrititersohordiplanetbumisaatini. Gerard Pique & Shakira Bek handal Barcelona dan kekasihnya Shakira menempati posisi pertama pasangan pesepakbola selebriti terpopuler. Mungkin terdapat kesenjangan usia di antara kedua sejoli ini. Namun tampaknya buah cinta yang kini berada dalam rahim Shakira mampu menepis bahwa perbedaan usia bukanlah sebuah masalah. PiquebertemuShakirapadamusim semi tahun 2010, sebelum perhelatan akbar Piala Dunia Afrika Selatan lalu. Selama periode yang sama itu, Shakira pun tengah mempersiapkan single resmi turnamen tersebut yang berjudul Waka Waka (This Time for Africa). Dan hanya membutuhkan waktu semusim, kedua pasangan ini pun dikabarkan resmi berkencan. David Bechkam & Victoria Adams Si Tampan Beckham bertemu dengan Victoria pada 1997 silam. Saat itu Beckham menjadi salah satu pesepakbola idola para kaum hawa. Sementara Posh (julukan Victoria), tengah berada pada masa keemasaannya, sebab Spice Girls, grup vokal yang digawanginya bersama Emma Bunton,GeriHalliwell,MelB,danMel C tengah merajai blantika musik dunia. Hanya dalam waktu tiga bulan, keduanya memutuskan untuk menjalin hubungan asmara. Kehadiran Victoria membawa perubahan bagi kehidupan mantan bintang Old Trafford itu, seperti gaya busana dan tatanan rambut Beckham yang berubah total. Pasangan ini akhirnya mengikat janji suci pada 1999 di Irlandia. Dari pernikahannya tersebut, Beckham dan Victoria dianugerahi empat

„ Pasangan PesepakbolaGerald Pique dan Shakira

Liverpoolmelajukebabakempat PialaLigaInggrissetelahmenangtipis 2-1atasWestBromwichAlbion.Nuri Sahinjadipahlawankemenangan‘Si Merah’lewatduagolnya. Bertandang ke The Hawthorns, markas West Bromwich, Kamis (27/9) dinihari, The Reds sempat ketinggalan 0-1 ketika pertandingan baru masuk menit ke tiga setelah Sebastien Gabriel Tamas bikin gol. Liverpool berhasil menyamakan skor setelah Nuri Sahin mencetakgol,yangjugagolperdananya

bersama klub itu, di menit ke-18. Tendangan spekulasinya dari luar kotak penalti tak mampu ditepis Ben Foster. Youssouf Mulumbu hampir membuatWestBromwichkembali unggul di menit ke 42 jika saja tendangannya tak diblok oleh Jamie Carragher. Skor 1-1 bertahan hingga babak pertama usai. Kemenangan Liverpool akhirnya dipastikan setelah Sahin mencetak gol keduanya di menit ke-82 setelah bekerja sama dengan Oussama Assaidi. (int)

SUSUNAN PEMAIN: LIVERPOOL: Jones, Robinson, Coates, Carragher, Wisdom, Henderson, Sahin, Downing, Pacheco (Suso 81'), Assaidi, Yesil (James Sinclair 81'). WEST BROMWICH ALBION: Foster; Jones, Tamas, Olsson, Ridgewell; Thorne, Mulumbu; Fortune (Yassine El Ghanassy 87'), Dorrans, Rosenberg; Lukaku (Shane Long 70').

orang anak, yaitu: Brooklyn, Romeo, Cruz, dan si mungil Harper Seven. Namun, keharmonisan rumah tangga mereka bukan tanpa cobaan, berkali-kali hubungan keduanya diterpa badai perselingkuhan. Meski akhirnya hingga kini keduanya tetap bersama. Francesco Totti & Ilary Blasi Seorang ikon Roma yang melegenda, bukan hanya karena kehebatannyadilapangan,melainkanjuga dengan kesetiaannya dengan sang istri, Ilary Blasi. Keduanya kemudian mendapat julukan ‘Posh & Becks-nya Italia. Pasangan ini menikah pada 2005 lalu.Darihasilpernikahannyamereka kemudian dikarunia dua orang anak, yaitu Cristian yang lahir pada bulan November, dan Chanel dua tahun berselang. Sebagai bukti cintanya kepada dua buah hatinya, Totti mengisap jempol kala melakukan selebrasi usai mencetak gol. Rafael van der Vaart & Sylvie Meis Keharmonisan pasangan ini kerap dibanding-bandingkan dengan pasangan Beckham dan Victoria. Sylvie yang merupakan seorang model dan presenterkenamaanBelandaitutelah mendampingi Van Der Vaart selama

sembilan tahun dan dikaruniai seorang putra, Damian. Manis tak selalu menghampiri rumah tangga keduanya, pada 2008 lalu, Sylvie divonis mengidap kanker payudara. Vonis tersebutternyatajugamempengaruhi performa Van der Vaart di lapangan, hingga Real Madrid (klub yang dibelanya saat itu) menjualnya ke Tottenham Hotspur. Hingga saat ini, keduanya masih tetap bersama, tak mengherankan apabila publik Belanda menilai pasangan ini memiliki cinta abadi. Bahkan pernikahan keduanya disiarkan secara langsung di seluruh penjuru Negeri Kincir Angin itu. Wayne Rooney & Coleen McLoughlin Striker andalan Manchester United yang baru kembali dari cedera ini menempati posisi ke lima pasangan pesepakbola selebriti terpopuler selanjutnya. Rooney menikahi Coleen yang berprofesi sebagai seorang aktris dan model pada 2008 di sebuah jet pribadi. Isu perselingkuhan bukanlah hal barubagiColeen,namunmeskidemikianiatetapsetiamendampingistriker 26 tahun itu. Pernikahan mereka kian manis dengan kehadiran sosok Kai Rooney di antara keduanya. (int)

Cassano:SaatnyaInterMenang MILAN- Hingga Liga Italia memasuki giornata 5, Inter Milan belum pernah membukukan kemenangan di kandang sendiri. Menjamu Fiorentina akhir pekan nanti, Antonio Cassano berharap timnya bisa memetik tiga poin. Sejauh ini, sudah lima laga dimainkanInterdiGiuseppeMeazza disemuakompetisi.Tapi,duahasil imbang dan tiga kekalahan yang didapat oleh Nerazzurri. DiSeriA,duapertandingankandang Inter berakhir dengan kekalahan. Pasukan Andrea Stramaccioni itu juga tercatat baru mencetak satu gol di Meazza di ajang Seri A. Faktu itulah yang membuat Cassanobersemangatmenghadapilagagiornata6kontraFiorentina, Senin (1/10) dinihari mendatang. Dia ingin La Beneamata menambah pundi-pundi golnya serta membukukan kemenangan. “Sekarang kami akan berpikir tentang mencetak beberapa gol di kandang. Kesempatan sudah datang tapi sayangnya kami belum mewujudkannya,” ujar Cassano seperti dikutip Football Italia. “Ini tidak mudah karena semua

„ Cassano datang ke San Siro untuk bertahan, tapi kami akan melakukannya dan dihariMinggukamiakanmemainkan laga yang hebat melawan La Viola,” kata eks pemain AC Milan itu. (int)


JUMAT 28 September 2012


Team Chelsea Man United Everton West Brom Arsenal

M 5 5 5 5 5

M 4 4 3 3 2

S 1 0 1 1 3

K 0 1 1 1 0

SG 9-2 12-6 9-5 7-4 9-2


Nilai 13 12 10 10 9




TOP SCORER Gol 5 4 4

Nama R van Persie D Ba J Defoe

Klub Manchester United Newcastle United Tottenham Hotspur

SPANISH LA LIGA No 1 2 3 4 5

Team Barcelona Atlético Madrid Mallorca Málaga Sevilla

M 5 5 5 5 5

M 5 4 3 3 3

S 0 1 2 2 2

K 0 0 0 0 0

SG 14-3 15-7 7-3 6-2 6-2

Nilai 15 13 11 11 11

TOP SCORER Gol 7 6 4

Nama R Falcao L Messi T Hemed

Klub Atlético Madrid Barcelona Mallorca

ITALIAN SERIE A No 1 2 3 4 5

Team Juventus Napoli Sampdoria Internazionale Lazio

M 5 5 5 5 5

M 4 4 3 3 3

S 1 1 2 0 0

K 0 0 0 2 2

SG 11-2 11-2 8-5 8-5 7-5

Nilai 13 13 10 9 9

Manchester United mendapatkan lawan yang tidak ringan, Newcastle United, pada babak ke tiga Piala Liga Inggris. Namun akhirnya Red Devils pun menang dengan skor 2-1 atas The Magpies. Hal itu disambut gembira oleh bos MU, Sir Alex Ferguson.


„ Alex Ferguson

Indonesia 5-0 Brunei Darussalam TOP SCORER Gol 5 4 3

Nama E Cavani S Jovetic A Cassano

BUNDESLIGA No 1 2 3 4 5

Team München Frankfurt Hannover 96 Schalke 04 Düsseldorf

Pelepas Dahaga

Klub Napoli Fiorentina Internazionale

M 5 5 5 5 5

JERMAN M 5 4 3 3 2

S 0 1 1 1 3

K 0 0 1 1 0

SG 17-2 14-7 14-8 10-5 4-0

TOP SCORER Gol 5 4 3

Nama M Mandžukiæ T Müller S Aigner

Klub Bayern München Bayern München Eintracht Frankfurt

TOP SCORER Gol 2 2 2

Nama Mkhitaryan Lionel Messi Rafael Bastos

Klub Shakhtar Donetsk Barcelona CFR 1907 Cluj

Nilai 15 13 10 10 9

Indonesia mendapat kemenangan dalam laga uji coba melawan Brunei Darussalam di Stadion Hassanal Bolkiah, Rabu (26/9). Hat-trick Irfan Bachdim mewarnai kemenangantelaklimagoltanpabalasIndonesiaatas Brunei. Bermain tanpa lima pilar (Titus Bonai, Okto Maniani, Valentino, Yoshua Pahabol, dan Cornelis Geddy) pasukan “Merah Putih” tampil lumayan spartan. Beberapa kali Irfan dan kawan-kawan mengancam gawang Brunei. Memasuki menit ke-25, Indonesia mendapatkan hadiah penalti. Irfan yang menjadi algojo, tak menyia-nyiakan kesempatan dan membuka skor pertandingan. Suntingan Irfan melecut semangat rekan-rekannya. Jelang berakhirnya babak pertama, Indonesia kembali menggandakan kemenangan. Kali ini, tendangan jarak jauh Vendry Mofu sukses menggetarkan jala Brunei untuk kedua kalinya. Tim “Garuda” kian menggila pada paruh kedua. Enam menit selepas jeda, Irfan kembali mencetakgolkeduabagidirinyadanmengubah kedudukan menjadi 3-0 untuk Indonesia. Pasukan Nil Maizar semakin di atas angin. Buktinya, pada menit ke-63, Indonesia makin melejit. Gelandang serang mungil, Hendra Adi Bayauw, mampu menceploskan bola ke jala Brunei dengan memaksimalkan umpan M Rahmat. Sudah unggul empat gol tanpa balas tak memuaskan Indonesia. Pesta gol tim “Merah Putih” ditutup trigol Irfan pada menit ke-72. Laga pun berakhir dengan kemenangan Indonesia lima gol tanpa balas melawan Brunei. Kemenanganinimenjadipelepasdahagatim

„ Irfan Bachdim nasional Indonesia. Itu kemenangan pertama sejak tim “Merah Putih” mengalahkan Mauritania pada Turnamen Al-Nakbah di Palestina, Mei silam. Setelah meladeni Mauritania, Indonesia menjalani delapan laga, termasuk melawan BruneiDarussalam.Daridelapanpertandingan itu, tim “Garuda Pancasila” meraih satu kemenangan, tiga kali imbang, dan empat kekalahan. Total, sepanjang tahun ini, timnas Indonesia telah menjalani 15 laga, baik partai resmi maupun uji coba. Tiga kemenangan didapat timnas dari seluruh pertandingan itu. (int)

U memainkan beberapa pemain mudanya saat menjamu Newcastle diOldTrafford,Kamis(27/9)dinihari WIB. Meski begitu, mereka tetap menang 2-1 berkat gol-gol Anderson dan Tom Cleverley. “Saya sangat senang,” aku Ferguson di situs resmi klub. “Pertama-tama, mengingat ini adalah pertemuan antarklub Premier League dan Newcastle mungkin lebih kuat daripada kami secara fisik, kami menampilkan sepakbola

yang fantastis. Kami terus memainkan permainan kami dan gigih dengan itu dan juga memiliki ketenangan dalam bermain,” jelasnya. Menurut Fergie, ia sangat senang dan selalu berpikir layak menang. “Newcastle adalah tim yang sangat bertenaga,jadibagusbisamelewatimereka,”kata pria asal Skotlandia ini. MUakankembalimenghadapilawanberat di babak ke empat. The Red Devils akan melawan Tottenham Hotspur. (int)

Perjalanan Setan Merah Setelah kalah dari Everton di pekan pertama, Manchester United melaju dengan empat kemenangan beruntun. Bisakah rekor tersebut berlanjut kala menghadapi Tottenham Hotspur pada Sabtu (29/9)? MU kalah 0-1 dari Everton pada pekan pertama, namun langsung bangkit di pekan berikutnya. Menghadapi Fulham, ‘Setan Merah’ menang 3-2 dalam laga yang diwarnai oleh gol debut Robin van Persie. Eks bomber Arsenal itu kemudian jadi bintang di pekan berikutnya, ketika dia mencetak hat-trick ke gawang Southampton dan MU, lagi-lagi, menang dengan skor 3-2. Di dua laga selanjutnya, MU menang 4-0 atas Wigan Athletic dan 2-1 atas Liverpool. Dua kemenangan itu masih ditambah dengan kemenangan di Liga Champions (1-0 atas Galatasaray) dan Piala Liga Inggris (2-1 atas Newcastle United). Seperti yang diperlihatkan dalam laga melawan Southampton, The Red Devils kerap menang, meski performa mereka tidak impresif. Sabtu (29/9), MU akan menghadapi Tottenham Hotspur di Old Trafford. Sang calon lawanpunyacatatanduakemenangandalam dua laga terakhir. Jermain Defoe juga mulai tajam lagi. Striker internasional Inggris itu sudah mencetak tiga gol dalam dua pertandingan terakhir di Premier League. Spurs punya kans untuk menyulitkan. Namun,MUpunyarekorbaguskalamenghadapi Spurs di Old Trafford. Dalam empat pertemuan terakhir di liga, MU selalu meraih kemenangan. Catatan terbaik Spurs di Theatre of Dreams dalam pertandingan liga tujuhtahunterakhiradalahmenahanimbang

„ Anderson 1-1 pada musim 2005/2006. Hanya saja, akhir pekan ini MU tidak akan diperkuat oleh Nemanja Vidic. Kapten asal Serbia itu dipastikan absen selama dua bulan karena mengalami cedera lutut. Kemungkinan, Sir Alex Ferguson akan kembali mengandalkan Rio Ferdinand dan Jonny Evans di sebagai duet bek tengah. Sementara Wayne Rooney yang cedera ketika melawan Fulham sudah bisa dimainkan lagi. Rooney turun sebagai starter dalam lagamelawanNewcastle,meskitidakbermain selama 90 menit. (int)



Read more
Read more
Similar to
Popular now
Just for you