Page 1




KAMIS, 22 Agustus 2013




Edisi 219 „ Tahun V

Dimangsa Buaya, Ibu 4 Anak Dimakamkan Tanpa Tangan & Kaki Orang yang HEBAT tidak dihasilkan melalui kemudahan, kesenangan dan kenyamanan, mereka DIBENTUK melalui kesukaran, TANTANGAN dan air mata. (*)

Dahlan Iskan

Dugaan Korupsi Lahan Rusunawa Rp5,3 M

Wali Kota Sibolga Diperiksa Kejatisu MEDAN- Setelah tidak menghadiri panggilan penyidik Kejaksaan Tinggi (Kejati) Sumut pada Senin (29/7) lalu, akhirnya Wali Kota Sibolga Syarfi Hutauruk memenuhi panggilan, Rabu (21/8). Dia diperiksa selama dua jam untuk menjawab 15 pertanyaan. Syarfi sendiri diperiksa sebagai saksi dalam perkara dugaan mark-up belanja modal Pemko Sibolga Tahun Anggaran 2012 untuk pengadaan Rusunawa sebagai sarana perumahan dan perkantoran seluas 7.171 meter persegi, senilai Rp5,3 miliar. Kasi Penkum Kejati Sumut Chandra ‹ ‹ Baca Wali

MADINA- Hotmauli Hospita (39), warga Desa Sikarakara 4, Kecamatan Natal, Kabupaten Mandailing Natal (Madina), ditemukan tewas tanpa tangan kanan dan kedua kakinya, Rabu (21/8) sekira pukul 10.30 WIB. Ibu empat anak ini, diduga tewas dimangsa buaya di Sungai Kunkun, pada Selasa (20/8) sekira pukul 17.00 WIB.

MENURUT Sekretaris Desa Sikarakara 4 Hendra Lubis, kepada METRO, Rabu (21/8), korban ditemukan dengan kondisi menggenaskan sekitar 300 meter dari tempat mencuci kain ‹ ‹ Baca Dimangsa

...Hal 6

Calhaj Diimbau Patuhi Anjuran Petugas Medis SIDIMPUAN- Menurut hasil pemeriksaan sementara yang dilakukan Dinas Kesehatan Kota Padangsidimpuan terhadap 380 calon jamaah haji (calhaj), didapat sebanyak 15 persen atau sekitar 60 calon jamaah haji beresiko tinggi terkena

penyakit. Kepala Dinas Kesehatan Kota Psp drg Doria Hafni Lubi, kepada METRO Rabu (21/8), menjelaskan, pihak sudah melakukan pemeriksaan di tingkat Puskesmas kepada 380 calon jamaah haji untuk wilayah Kota Psp. ‹ ‹ Baca Calhaj

Diimbau ...Hal 6


„ Korban Hotmauli Hospita yang tewas dimangsa buaya, di Sungai Kunkun, Selasa (20/8) sore.


2 Kritis, 8 Luka-Luka Tujuh Anak Selamat

KISARAN-Peristiwa tabrakan terjadi antara Bus KUPJ Tour jurusan Medan-Rantuprapat nomor pintu 88 BK 7897 DN, kontra Truk Colt Diesel BK 9426 CR di Jalinsum Medan-

Kota ...Hal 6

Rantuprapat, persis di depan Hotel Megasari Kisaran, Rabu (21/8) sekira pukul 12.15. Akibat kejadian itu, dua pen‹ ‹ Baca 2

Kritis,...Hal 7

(FOTO: )

„ Kondisi Colt Diesel yang ringsek pasca tabrakan dengan KUPJ Tour, kemarin siang.

Napi Labuhan Ruku Tiba di Salambue

Kalapas Minta Pengamanan Polisi dan Tentara SIDIMPUAN- Sebanyak 50 napi pindahan dari Lapas Labuhan Ruku Batubara tiba di Salambue Kota Psp, Selasa (20/8) sekitar pukul 22.45 WIB. Selang beberapa jam, atau Selasa (20/8) dini hari sekitar pukul 00.30 WIB, lima napi asal Tanjung Gusta, Medan juga tiba di tempat itu. Amatan METRO, Selasa (21/ 8) sekitar pukul 22.45 WIB, satu mobil Patwal memasuki Komplek Lapas Salambue mengiringi laju dua mobil yang

MENANTU Presiden Republik Indonesia, Siti Ruby Aliya Radjasa menunjukkan kepeduliannya terhadap pemberantasan buta aksara di Indonesia. Aliya menjadi pembicara dalam kuliah umum komunitas membaca di Hotel Mercure, Ancol, Jakarta Utara. Indonesia tak sendiri mengadakan acara yang diselenggarakan atas kerja sama antara Dirjen Pendidikan dan Kebudayaan dan UNESCO ini. Aliya mengungkapkan bahwa tak kurang dari 18 negara diundang untuk ‹ ‹ Baca Dimangsa

...Hal 7


„ Para napi asal Lapas Kelas II A Labuhan Ruku, Batubara tiba di Lapas Kelas II B Salambue, Psp, saat diturunkan dari mobil tahanan Polres Padangsidimpuan, Selasa malam (20/8).

berada dibelakangnya. Dua mobil yang berada dibelakang tersebut diketahui membawa para narapidana asal Labuhan Ruku. Satu mobil Dalmas berisi 25 napi dan satu mobil lagi yang bertuliskan ‘Tahanan Polres Padangsidimpuan’ membawa 25 napi didampingi beberapa Personil Polres Psp. Setibanya di Salambue, Kabag Ops Polres Kota Kompol Edi Sitepu yang memimpin rombongan pemindahan para ‹ ‹ Baca Kalapas

...Hal 6

Mengunjungi Lapas Anak Salambue, Kota Padangsidimpuan (2)

Omak Kena Stroke, Mau Nangis Rasanya Tiga Bulan Gak Dijenguk… ORYZA PASARIBU, Sidimpuan

“Saat itu aku hanya bisa berlari, karena kulihat mereka (polisi) seperti mengamuk mengejar kami. Ada yang dipukuli dengan senjata. Ada juga yang ditunjangi. Aku terus berlari,” ujar Huala sedih sambil meneteskan airmata, mengingat kejadian itu. ‹ ‹ Baca Omak


...Hal 7

„ Suasana LP Salambue saat malam hari diambil dari luar lapas, Selasa (20/8).

Totalitas PADA ZAMAN dulu, di sebuah negara, hiduplah seorang pria yang dipanggil Leyangtsi. Ia mempunyai seorang istri yang sangat bijaksana dan cerdas. Mereka hidup harmonis karena saling mencintai satu sama lain. Suatu hari, Leyangtsi dalam perjalanan pulang dari bekerja, menemukan sebongkah emas. Baginya, itu adalah harta yang sangat berharga. Karenanya, saking senang, ia pun segera berlari menuju rumah untuk memberitahukan penemuan itu pada istrinya. Ternyata, sampai di rumah, ia justru mendapat “sambutan” yang berbeda. Istrinya berkata, “Laki-laki sejati bahkan tidak akan pernah meminum air curian. Jadi bagaimana bisa kamu membawa emas yang bukan milikmu?” Mendengar ucapan itu, Leyangtsi pun terbuka kesadarannya. Ia segera mengembalikan emas itu ke tempat di mana ia menemukannya. ‹ ‹ Baca

Totalitas...Hal 7







Penjara Konsep Pemenjaraan

PENJARA kita mirip barisan gunung api yang saling berjejaring. Lapas-lapas berletupan seakan beriringan. Seperti diberitakan kemarin, Lapas Labuhan Ruku, Batu Bara, dilanda amuk napi (18/8). Sebelumnya, Lapas Tulungagung (3/8) juga demikian. Lebih dahsyat, kejadian di Lapas Tanjung Gusta, Medan, dilanda amuk yang menyebabkan sipir tewas (11/7). Tak lama kemudian di Lapas Batam juga ada pemberontakan napi (17/7). Lapas Sekayu, Musi Banyuasin, juga diamuk napi karena kesal dirazia (3/2). Lapas Ngawi juga diberontaki napi (20/3). Dan, masih banyak lagi kisah pemberontakan para napi dan tahanan. Tanpa kerusuhan pun, negara sangat berat mengurus para napi dan tahanan. Meski mereka orang bermasalah, negara terpaksa mengongkosi hidupnya. Ada di antara para napi yang harus diberi ransum seumur hidup (Padahal, orang baik-baik yangberadadiluarpenjarapunharuscari makansendiri). Pemenjaraan ini memunculkan banyak dilema.Kalaudiberibilikyangcukup,kokdianggap mengenakkan napi/tahanan. Kalau bilik tahanan tak cukup, mereka semua berdesakan (kondisi semua penjara). Kalau tempat penahanan dibuat bersih dan bagus, dianggap memanjakan orang bersalah.Tapi,kalaufasilitastakdicukupi,dianggap tak manusiawi. Kalau penjara dibuat tenang dan penuh hiburan, dianggap terlalu lunak. Kalau situasipenjarabanyakfaktorstres,dianggapkejam. Serba repot. Dan, ketika kerepotan itu berjalan, uang rakyat untuk mengurus mereka kian membebani. Sampai kapan dan berapa banyak kita harus membangunpenjara untuk menampung semua pelaku kriminal? Kenapauangrakyatyangtriliunanrupiahuntuk

mengurus orang bermasalah itu tak dialihkan untuk menyantuni orang baik-baik? Layak direnungkan. Apakah pemenjaraan memang satu-satunya konsep pemidanaan yang harus tetap dominan di masa depan? Tidakkah kita bisa keluar dari ”penjara konsep pemenjaraan” dan mencari pemidanaan yang lebih menjerakan sekaligusefisien?Bukankahsudahsangattuakritik bahwa penjara adalah ”universitas kejahatan?” Bahkan, untuk hukuman mati, yang potensial mengurangi kesesakan penjara, kenapa tak diterapkan sebagai pembalasan kepada banyak kejahatan pembunuhan? Kita tengok negara sekitar. Di Malaysia, selain penjara dan pidana mati, corporal punishment (hukumanbadani)dengancambukditerapkan.Ini hukuman cambuk betulan, tak seperti cambuk simbolis dalam pidana lokal Aceh. Negara mini Singapura juga menerapkan hukum cambuk. Bahkan,keteguhanlegendarisnegarainidikenang ketikatetapmencambukMichaelFay,pemudaAS, pada 1994. Protes pemerintah AS tak digubris, si pemuda tetap dicambuk empat kali karena melakukanvandalismedinegerisebersihUGDitu. Kini mulai disuarakan pidana kerja paksa. Kenapa tidak? Juga disuarakan pidana perampasan harta bagi perampok (termasuk pencuri uang rakyat). Kenapa tidak? Menjadi miskin pasti lebih berat bagi perampok atau koruptor yang terbiasa foya-foya. Kalau ini ditambahi dengan pidana korporal (cambuk, misalnya)pastiakanlebihmenjerakandanefisien. Setelahituaksesmendapatlayananfasilitaspublik para penjahat ini dibatasi sampai beberapa waktu tertentu, sebagai bagian sanksi pidana. Intinya, harus diperbanyak alternatif jenis hukuman. Agar penjara tak sesak. Agar negara tak menghabiskan dana mengurusi orang tak berguna.(*)

“KPK akan memeriksa Mantan Ketua Umum Partai Demokrat Anas Urbaningrum minggu depan. Saat ini, tengah mengurus surat panggilannya,”

Juru Bicara KPK Johan Budi

“Jangan menguji ketakutan kepada kami. Menegakan hukum itu berdasarkan bukti-bukti dan kelengkapan berkas perkara itu sendiri. Jadi bukan takut,”

Ketua KPK Abraham Samad

Apa Kata Mereka Calon Panglima TNI Jenderal Moeldoko

“Kesejahteraan prajurit jauh dari harapan, minimnya dukungan remunerasi dan fasilitas primer seperti rumah sakit militer dan perumahan prajurit. Kekurangan itu yang dapat menghambat profesionalisme prajurit,”

MARKETING CALEG Jika cara-cara mengenalkan diri kepada masyarakat masih sekadar menggunakan pola lama, niscaya caleg (calon legislatif) sekarang ini akan lebih sulit memenangi kontestasi. OLEH:DRS RIKANSON JUTAMARDI PURBA, AK DIREKTUR GOP@S MEDIA GROUP (GMG) TIDAK lama lagi, akan keluar Peraturan Komisi Pemilihan Umum (PKPU) yang membatasi penggunaan spanduk dan balihoolehcalegsecara individual. Jika berkelompok per dapil (daerah pemilihan) per partai, rencananya penggunaan spanduk dan baliho masih diizinkan, dengan catatan sudah sepengetahuan dan dalam koordinasi partai. Meski ada pro-kontra, agaknya PKPU ini segera diwujudkan. Yang pro melihat bahwa regulasi seperti ini akan mengurangi kesemrawutan pemasangan spanduk dan baliho di jalanjalan, sedangkan yang kontra (semisal Jeirry Sumampow, koordinator TEPI) beranggapan, beleid semacam ini akan mengurangi media bagi caleg untuk mengenalkan diri kepada masyarakat. Apa pun ceritanya, kebijakan ini akan mengubah cara caleg mengenalkan dirinya. Sebenarnya tidak sekadar mengenalkan, melainkan me-marketing-i (memasarkan) diri. Karena setelah popularitas masih ada soal elektabilitas, maka – maaf saja – caleg harus memasarkan dirinya supaya laku (dipilih), tak cukup hanya sekadar terkenal. Dalam konteks ini, kita tidak menggunakan terminologi “menjual” (sales), karena berbaubau money politics (politik uang), melainkan “memasarkan”. Apa bedanya? Sales adalah ujung dari aktivitas marketing dalam rangka pemenuhan kebutuhan sehingga bersifat transaksional (jual-beli), sedangkan marketing itu sendiri lebih bermakna penciptaan kebutuhan. Yang dibutuhkan masyarakat adalah anggota legislatif (DPRD) yang memenuhi paling tidak tiga hal. Pertama, seorang anggota DPRD yang dapat mewakili masyarakat menyusun dan menetapkan – bersama eksekutif – anggaran yang pro-rakyat. Anggaran (APBD) seyogianya menyejahterakan masyarakat dengan berkeadilan. Kedua, anggota DPRD yang – bersama

eksekutif – dapat menyusun legislasi (peraturan, Perda) yang bukan sekadar Perda rutin yang retributif (pemajakan) demi pemenuhan PAD (Pendapatan Asli Daerah) semata, melainkan yang juga memberikan insentif (perangsang, pendorong) bagi pertumbuhan ekonomi, penciptaan lapangan kerja, peningkatan kualitas pendidikan, tersedianya jaminan sosial dan kesehatan, tersedianya infrastruktur yang memadai, dll. Ketiga, anggota DPRD yang dapat mengawasi eksekutif dalam menjalankan pemerintahan, sehingga terwujud good governance (transparan, akuntabel, efektif, efisien, dan bebas KKN) sebagai prasyarat penciptaan masyarakat yang sejahtera dan berkeadilan. Jadi, sebenarnya masyarakat tidak butuh uang lima puluh ribu atau seratus ribu rupiah dalam pileg yang akan datang. “Apalah arti lima puluh ribu rupiah untuk lima tahun? Bukankah itu hanya berarti sepuluh ribu rupiah atau dua bungkus rokok Saliti (153) setahun?” gugat masyarakat. Masyarakat sudah semakin pintar. Mereka sudah semakin sering menyatakan, yang mereka butuhkan adalah tokoh semacam Jokowi (Joko Widodo). Gubernur DKI Jaya yang dalam banyak survei calon presiden senantiasa menduduki posisi teratas itu, tak mengandalkan money politics, melainkan keberadaannya yang sederhana, merakyat, berintegritas, dan tahu apa yang (hendak) dilakukannya, itulah yang dapat memenuhi dahaga kebutuhan masyarakat sekarang. Ada rekan saya seorang caleg Kabupaten Simalungun yang jelas-jelas sudah menyiapkan uang dalam jumlah besar untuk pileg (pemilihan legislatif) 2014 ini. Katanya didampingi istrinya, “Kami sudah menyiapkan uang lima ratus juta rupiah. Kalaupun saya tidak berhasil duduk (jadi anggota DPRD), kami tidak akan kenapa-kenapa, karena uang itu kami peroleh dari masyarakat juga melalui usaha/ bisnis yang kami jalankan selama ini.” Saya memahami kesiapan rekan tersebut untuk membiayai kerja politiknya (cost of politics), bukan untuk money politics. Dua istilah ini memang beda-beda tipis. Kalau untuk money politics (beli suara), sayang sekali uang sebesar itu dihamburkan. Pertanyaannya: apakah

dengan menghamburkan uang sebesar itu rekan saya sudah pasti duduk? Pertanyaan sebaliknya: apakah kalau tidak punya uang sebesar itu tidak bakalan duduk? Pada periode sebelum ini (2004 dan 2009) di Kabupaten Simalungun, ada caleg yang menyatakan telah menghabiskan enam ratus juta rupiah, tapi toh tak duduk juga. Sebaliknya, ada yang punya uang pas-pasan (sekadar menutupi cost of politics), tapi bisa menang. Di mana letak perbedaannya? Dari popularitas ke elektabilitas Terlepas sudah punya modal awal atau belum, tentu upaya pertama adalah bagaimana agar caleg (lebih) dikenal masyarakat. Inilah yang perlu di-marketing-i lewat spanduk/baliho berkelompok, poster, flier, kartu nama, perkunjungan-perkunjungan, dll. dengan cara yang cerdas. Seorang caleg harus membuat dirinya berbeda daripada caleg lain. Dengan kata lain, harus melakukan diferensiasi (pembedaan). Ilustrasinya begini: ketika Anda melihat a purple cow (seekor lembu berwarna terong) di antara sekawanan lembu putih di dekat perkebunan sawit, maka mata Anda akan lebih tertarik pada lembu berwarna terong itu. Kedua, tentu modal kemampuan. Caleg harus punya modal kompetensi yakni dapat menyalurkan dan mengartikulasikan aspirasi masyarakat di DPRD kelak. Bagaimanalah menjadi anggota Dewan yang Terhormat jika tidak dapat menjalankan tiga tupoksi (tugas pokok dan fungsi) seorang legislator: budgeting, legislasi, dan kontrol/pengawasan? Bagaimanalah kalau selama ini tidak punya kemampuan mengajukan gagasan serta sekaligus melakukan lobi dan taktik/strategi untuk mengegolkan gagasannya itu? Bagaimanalah kalau tidak punya jaringan? Ini yang perlu diasah terus-menerus, mumpung masih ada waktu lebih daripada setengah tahun lagi. Ketiga, modal finansial untuk menutupi sekadar ongkos politik. Karena apa pun butuh ongkos, bahkan sekadar menyetor (martulak) komoditas (katakanlah kopi atau coklat) kepada tauke atau ke pekan harus juga pakai angkutan, minimal becak. Tentu untuk menjadi anggota DPRD tidak perlu miliaran, melainkan cukup dalam jumlah yang pas. (*)



22 Agustus 2013

Diming-imingi Uang dan Hp Siswi SMA Hamil 3 Bulan SIANTAR- Dengan kondisi berbadan dua, Bunga (16), nama samaran, ditemani orangtuanya mengadu ke Polres Siantar, Selasa (20/8) sekira pukul 22.00 WIB. Wanita yang masih duduk di bangku SMA ini mengaku dihamili oleh JS (49), seorang pria beristri yang sebentar lagi akan memiliki cucu. Kepada polisi, orangtua Bunga, warga Kecamatan Siantar Utara, mengaku baru dua hari ini mengetahui kehamilan anaknya. Hal itu ketahuan ketika melihat perubahan bentuk tubuh anaknya yang tidak seperti biasa. Saat ditanya, beberapa kali Bunga mencoba mengelak, namun akhirnya dia bercerita. Kepada ibunya, Bunga mengakui dirinya sedang mengandung tiga bulan. Parahnya lagi, calon ayah dari janin yang dikandungnya itu adalah seorang pria yang masih ada ikatan keluarga dengan Bunga yang sudah berumur 49 tahun. Sontak orangtua Bunga emosi dan langsung membawa putrinya itu ke rumah pelaku di Kecamatan Siantar, Kabupaten Simalungun. Saat itu nyaris terjadi perkelahian fisik saat pelaku mengaku bersedia menikahi Bunga. Padahal pelaku tak lama lagi akan memiliki cucu dari anak pertamanya. Beruntung warga cepat melerai pertengkaran

dan menyarankan agar keluarga Bunga menempuh jalur hukum. Selama proses pengaduan, JS mencoba membujuk orangtua Bunga untuk bersedia berdamai. Namun kasus itu tetap saja bergulir dan laporannya sudah diterima. Sementara Bunga mengaku sudah lebih lima kali ditiduri oleh JS. Berawal saat dirinya diming-imingi uang dan Hp oleh pria beranak lima ini, pada pertengahan April lalu. Melalui komunikasi yang lancar lewat SMS, akhirnya JS mengajak Bunga jalan-jalan dan berhasil membawa Bunga ke hotel kelas melati di Jalan Pdt Wismar Saragih, Siantar Utara. JS beralasan hendak memberi sesuatu dan membicarakan hal yang penting menyangkut sekolah korban. Namun di dalam kamar hotel melati itu, Bunga dipaksa membuka baju meski awalnya menolak. Namun karena iming-iming uang dan Hp, korban pasrah ditiduri. Hal serupa kembali terjadi di akhir bulan April hingga Mei. Usai melampiaskan nafsunya, Bunga mengaku diberi uang, Hp dan pakaian. Sementara Kasubag Humas AKP Efendi Tarigan membenarkan laporan itu dan kasusnya sedang ditangani Unit Perlindungan Perempuan dan Anak (PPA). (dho)

4 Tahun Tak Dilayani Istri Anak Tiri Dicabuli TEBING TINGGI- Abdul (60), suami kedua Nur (41), berhasil diringkus polisi atas laporan pencabulan yang dilakukannya terhadap anak tirinya, Kembang (15), nama samaran. Abdul diringkus personel Polres Tebingtinggi, Selasa (21/8) malam di rumahnya, di Kelurahan T Marulak, Kecamatan Rambutan, Tebingtinggi.

Foto Asnawi

„ Abdul, yang sudah tiga kali mencabuli anak tirinya saat diperiksa di Polres Tebing Tinggi.

Kuli Bangunan Diringkus Lagi Nyabu

Nyolong Kreta Setelah Kalah Main Judi MEDAN- Rudi (34), warga Denai, Kecamatan Medan Denai, dipukuli warga karena tertangkap tangan mencuri sepedamotor Satria FU BK 2730 ABP milik Erik (21), warga Jalan Benteng Hilir, Kecamatan Medan Tembung, Rabu (21/8) sekira pukul 05.00 WIB. Berdasarkan keterangan dihimpun, sebelum kejadian, pelaku dan temannya yang diketahui bernama Nazri (30) warga Perbaungan, usai bermain judi kartu bersama warga sekitar. Diduga kalah berjudi membuat keduanya gelap mata dan mencuri sepedamotor milik korban yang tengah terparkir tak jauh dari lokasi bermain judi yang berdekatan dengan rumah korban. Dengan merusak kunci kontak dengan menggunakan kunci T, kedua pelaku berhasil membawa kabur sepedamotor korban. Namun, sepedamotor korban kehabisan minyak yang membuat kedua pelaku harus mendorongnya. Saat mendorong, teman korban curiga melihat sepedamotor korban yang dibawa orang tak dikenal dan langsung memberita-

hukannya kepada korban. Korban yang terkejut lantas mengejar kedua pelaku dan ditangkap hanya berjarak 400 meter dari lokasi sepedamotor dicuri. Rudi pun babak belur dihajar warga, sementara nazri berhasil kabur. Tak lama petugas kepolisian yang mendapat laporan tersebut langsung turun ke lokasi untuk mengamankan pelaku beserta barang bukti sepedamotor korban dan kunci T. Sementara, pelaku saat ditanyai mengaku kalau usai bermain judi dan mengaku hanya diajak kawannya. “Aku diajak kawanku itu, duduk-duduk di rumah kawannya sekalian cari-cari kerjaan. Kami baru siap main judi. Aku gak tau Bang dia (Nazri) dapat kreta dari mana. Aku cuma diajaknya,” kilah pria berbadan besar yang mengaku bekerja sebagai juru parkir ini. Kanit Reskrim Polsek Percut Sei Tuan AKP Faidir Chaniago ketika dikonfirmasi membenarkan telah diamankannya seorang pelaku curanmor. (Bay)

Foto Fandho

„ Charles Pialang, tersangka kepemilikan narkoba, usai menjalani pemeriksaan di Mapolres Siantar. SIANTAR- Charles Piliang (45) ditangkap personel Sat Narkoba Polres Siantar saat mengonsumsi sabu-sabu di rumahnya di Jalan Tanah Jawa samping Gang Sewu, Kelurahan Melayu, Siantar Utara, Rabu (21/8). Menurut keterangan Kasat Narkoba AKP Bambang melalui Kasubag Humas AKP Efendi Tarigan, polisi mendapatkan informasi adanya peredaran narkoba di lokasi tersebut dari masyarakat. Lalu polisi melakukan peng-

intaian di sekitar kediaman kuli bangunan ini. Saat itu, beberapa orang terlihat keluar masuk, namun petugas tidak langsung mengambil tindakan hingga benar-benar mendapat kepastian. Dengan melakukan pengintaian selama satu malam penuh, usaha petugas berbuah hasil. Saat itu tersangka kembali ke rumahnya mengendarai sepedamotor, Rabu (21/ 8) sekitar pukul 05.00 WIB dini hari. Saat itu tersangka sedang mengonsumsi narkoba, se-

lanjutnya dilakukan penggerebekan. Akhirnya tersangka yang mengalami cacat di kaki ini didapati sedang mengonsumsi sabu-sabu dengan alat berupa bong, mancis dan timah alumunium foil. Semula tersangka membantah menyimpan barang haram itu. Namun ketika polisi menggeledah kamar tempatnya menikmati kristal putih itu, didapati dua paket kecil sabu-sabu yang dikemas dalam plastik klip. Bapak dua anak ini tak bisa berkelit lagi dan akhirnya mengaku kepada polisi bahwa dua paket sabu-sabu itu baru saja dibelinya dari seseorang yang tinggal di Kecamatan Siantar Barat seharga Rp130 ribu per paket. Namun ketika polisi mengembangkan informasi dari Charles, pria yang diduga penjual sabu-sabu itu sudah kabur. Dalam pemeriksaan, tersangka mengatakan, dirinya bukanlah seorang bandar, melainkan hanya sebagai pemakai saja. “Baru sebulan aku make Pak dan itu untuk menambah staminaku aja,” kata tersangka. Perbuatan tersangka dijerat pasal 112 Undang-undang Nomor 35 Tahun 2009. “Penyelidikan masih kita kembangkan dangan proses yang panjang,” kata Efendi. (dho)

Aksi ayah tiri ini terungkap karena Kembang yang masih duduk di bangku SMP terlihat murung saat pelajaran olahraga. Saat itu guru yang melihat korban tidak seperti biasanya memanggil korban dan menanyakan keadaannya. Saat itu korban langsung menangis, lalu guru tersebut membawa Kembang kepada guru Pembimbing. Saat itulah cerita kebejatan ayah tiri itu terungkap. lalu guru BP melaporkan hal ini kepada kepala sekolah dan kemudian pihak sekolah menghubungi ibu korban hingga laporan disampaikan ke Polres Tebing Tinggi, Selasa (20/8) sekitar pukul 12.00 WIB. Kepada polisi, korban mengaku sudah tiga kali disetubuhi oleh Abdul, terakhir tanggal 13 Agustus 2013 sekira pukul 24.00 WIB di dalam kamar korban ketika ibunya tertidur. Dari pengakuan korban, setiap ayahnya ingin melakukan huKembangn intim itu, korban diancam dengan pisau sambil mengatakan akan membunuh ibunya, sehingga korban ketakutan dan si ayah bebas mencabuli korban. Sementara, tersangka yang berhasil diamankan mengaku sama sekali tak tahu kalau ternyata istri dan anak tirinya telah melaporkan perbuatannya ke polisi. “Aku heran kenapa dilaporkan sama istri dan anak tiriku. Padahal aku tak pernah menidurinya, cuma kupegangpegang saja pan***nya Pak,” ujar tersangka. Katanya, perbuatan itu ia

lakukan setiap kali Kembang (15) sudah tidur di kamar, lalu dia masuk diam-diam agar tak ketahuan istrinya yang tertidur pulas di kamar sebelah. “Karena Kembang tidurnya suka terlentang, nafsuku jadi muncul. Tapi aku tak ada menimpa tubuhnya Pak, hanya kupegang-pegang saja pan***nya,” kilah tersangka. “Pertama kali kugitukan, memang Kembang menjerit, tapi begitu kusuruh diam, dia pun diam Pak. Yang kedua dan ketiga kalinya pun dia diam juga. Pas kugosok-gosok, aku sambil onani,” ujar Abdul. Ditanya mengapa dia tega memperlakukan anak tirinya seperti itu, Abdul mengaku karena bernafsu dengan kemolekan tubuh Kembang. Selain itu, sambungnya, 4 tahun lamanya dia tak berhubungan badan dengan istrinya (ibu kandung Kembang) yang juga menjadi pemicu dia mencabuli Kembang. “Jujur pak, aku sudah 4 tahun nggak berhubungan dengan istriku, padahal hasrat untuk itu ada, tapi tenagaku yang sudah lemah. Karena kulihat Kembang semakin besar, tiba-tiba muncul niat menggitukan Kembang, tapi cuma pegang-pegang saja,” ujar Abdul. Kasubbag Humas Polres Tebingtinggi AKP Ngemat Surbakti saat dikonfirmasi mengaku menjerat tersangka Abdul dengan pasal 82 UU RI No. 23 Tahun 2002 tentang perlindungan anak dengan ancaman hukuman maksimal 10 tahun penjara.(awi)

Pria Beristri Pukuli Selingkuhan

Korban Tak Sudi Berdamai SIANTAR- Pasca kasus penganiayaan pria beristri terhadap selingkuhannya ditangani polisi hingga akhirnya ARS (36) ditahan, keluarga korban dan pelaku sudah bertemu dan membicarakan perdamaian. Namun korban Ulina br Sinaga (20) mengaku tetap bertahan dan menolak tawaran damai dari ARS, yang juga seorang oknum PNS Pemko Siantar. Kepada METRO, Rabu (21/ 8), Ulina mengaku tetap bertahan pada prinsipnya semula. Alasannya, penderitaan yang dialaminya cukup menyakitkan selama setahun ini. Mulai dari mengetahui ARS sudah berkeluarga, suka memukul, pemabuk, bahkan beberapa kali mengancam kalau hendak putus hubungan serta melarangnya bekerja. Namun Ulina juga mengaku, awalnya dia memang sangat menyayangi ARS. Katanya, rasa sayang itu bukan karena ARS adalah seorang PNS, melainkan perhatian ARS yang membuatnya luluh. Namun, atas kekerasan yang dialaminya, Ulina akhirnya memutuskan melapor ke polisi sekaligus mengakhiri hubungannya dengan pria beristri yang sudah memiliki 3 anak tersebut. “Kalaulah aku dikatakan simpanan, pastinya aku berge-

„ Ulina br Sinaga limang uang. Tapi, untuk makan aja aku terancam,” kata Ulina seraya menegaskan dirinya takkan pernah kembali ataupun mengganggu keluarga ARS lagi. Hingga Rabu (21/8), keluarga ARS tampak tetap saja menghubungi keluarganya untuk menerima permohonan maaf agar ARS terbebas dari jeratan pidana. Sedangkan Kanit Reskrim Polsek Siantar Martoba Ipda M Karo-karo mengatakan, pihaknya masih tetap menahan ARS atas laporan Ulina. “Soal perdamaian, itu urusan keluarga masing-masing,” katanya. (dho)


KAMIS 22 Agustus 2013

Pindahkan Pria Berbobot 610 Kg, Aparat Saudi Pakai Alat Berat SEORANG pria Arab Saudi yang memiliki bobot 610 kilogram terpaksa diterbangkan ke rumah sakit, setelah tak bisa meninggalkan kamarnya selama dua setengah tahun. Khalid Mohsin Shaeri (20), diterbangkan dari kediamannya di kota Jazan di wilayah selatan Arab Saudi menuju ke sebuah rumah sakit di ibu kota Riyadh, atas perintah Raja Abdullah. Rencana penyelamatan Khalid ini tertunda selama enam bulan hingga sebuah tempat tidur khusus untuk Khalid selesai dibuat dan didatangkan dari Amerika Serikat. Kementerian Kesehatan Arab Saudi bekerja sama dengan aparat keamanan dan palang merah Arab Saudi mengorganisasi evakuasi Khalid. Petugas bahkan harus menghancurkan sebagian kediamannya sehingga pria itu bisa dipindahkan dari kamarnya di lantai dua ke lantai dasar. Di luar rumah, sudah disiapkan forklift untuk mengangkut Khalid ke dalam ambulans untuk dibawa ke pesawat terbang yang sudah disiapkan di bandara setempat. Khalid yang beratnya sama dengan dua bayi gajah atau delapan kali berat rata-rata manusia dikabarkan memiliki seorang saudara perempuan dan laki-laki yang juga kelebihan bobot tubuh. Namun, kedua saudaranya itu masih mampu berjalan. Sejumlah media Arab Saudi mengatakan, Kementerian Kesehatan negeri itu sudah pernah “berurusan” dengan masalah kelebihan berat badan seperti ini, termasuk dua orang bersaudara seberat 298 kilogram dan 349 kilogram. Menteri Kesehatan Arab Saudi Dr Abdullah alRabeeah mengatakan, perintah Raja Abdullah untuk mengevakuasi Khalid adalah sebuah perintah kemanusiaan. (Gn/Kcm/Int)


DIPERIKSA KPK: Pejabat Pelaksana Tugas Kernel Oil Pte Ltd di Indonesia Simon Gunawan Tanjaya meninggalkan Gedung KPK dengan menggunakan baju tahanan usai menjalani pemeriksaan di Jakarta, Rabu (14/8). KPK menahan tiga tersangka yakni Ketua SKK Migas Rudi Rubiandini, Devi Ardi serta Pejabat Kernel Oil Pte Ltd Simon Gunawan Tanjaya yang telah ditetapkan sebagai tersangka usai menjalani pemeriksaan setelah tertangkap dalam operasi tangkap tangan oleh penyidik KPK dengan menyita barang bukti uang 690 ribu dolar AS, 127 dolar Singapura dan sebuah motor antik BMW dengan nopol B 3946 FT terkait dugaan suap oleh perusahaan trader minyak asing.


KPK Yakin Rudi Terima Uang Pihak Lain JAKARTA- KPK mengamankan uang total USD 1,2 juta dan SGD 187 ribu terkait kasus suap di SKK Migas. KPK meyakini uang sebanyak itu tidak hanya diterima Rudi dari satu pihak saja.

India Terapkan Diet Untuk Gajah PEMERINTAH Negara Bagian Tamil Nadu, India, kini menghadapi tugas “maha-berat”. Tugas itu adalah melangsingkan kembali gajahgajah kuil yang mengalami obesitas. Di banyak tempat di India, sebagian kuil memelihara gajah untuk kepentingan keagamaan, seperti sebagai bagian dari upacara atau perayaan tertentu. Namun masalahnya, gajahgajah kuil ini karena jarang bergerak dan terus diberi makan sebagian besar menderita obesitas. Seperti dikutip BBC, para pengurus kuil kini menyusun program diet untuk gajah-gajah mereka berdasarkan saran dokter hewan. ”Gajah betina Parvathi yang berusia 15 tahun kini memiliki bobot 500 kg, dan kami berusaha untuk menurunkan berat badannya,” kata Kepala Pengurus Kuil Madurai Meenakshi Amman. Gajah lain di Kuil Kallazagar, Madhuravalli, memiliki bobot 700 kg atau jauh lebih berat dari bobot seharusnya bagi seekor gajah berusia 48 tahun.Menurut para dokter hewan, kondisi dipelihara dan obesitas merupakan dua faktor yang saling terkait. Di dalam hutan, gajah bisa memakan 200 makanan berbeda termasuk buah-buahan, bunga, akar-akaran dan cabang-cabang pohon. Namun, ketika dipelihara, makanan mereka kurang variatif.Para pakar juga mengatakan gajah di alam liar tidak pernah bersentuhan dengan makanan manusia, seperti nasi, jawawut, garam, dan gula. Olahraga Selain mengatur pola makan para gajah gemuk ini, para dokter hewan juga menyarankan agar hewan-hewan besar ini diberi porsi kegiatan fisik.Di alam liar, gajah akan terus berkelana, naik turun bukit, melintasi sungai dan berjalan di berbagai medan. Selain itu, mereka juga harus berkompetisi dengan hewan lain dalam urusan mencari makan. ”Saat dipelihara, gajah makan secara rutin. Ditambah kurangnya kegiatan fisik, hewan itu akan menderita obesitas,” kata seorang dokter hewan. Akan tetapi, para pengurus kuil membantahgajah-gajahmerekakurang“olahraga”.Mereka mengklaim selalu membawa hewan-hewan besar itu berjalan-jalan setidaknya 5 km setiap hari.Namun, penelitian menunjukkan bahwa di alam liar gajah harus menjelajah setidaknya 250 km persegi untuk mendapatkan makanan paling sedikit seberat 250 kg. Para pengelola kuil mengatakan, mereka sudah menciptakan lingkungan yang hampir mirim dengan alam liar khusus untuk para gajah. Namun, langkah ini dikecam para aktivis pencinta hewan.Solusi terbaik, kata dr Singh, beberapa kuil membeli sebidang tanah bersamasama dengan kondisi yang alamiah dilengkapi persediaan makanan dan air secukupnya. Di tempat itulah para gajah bisa berjalan-jalan, bermain, dan berinteraksi dengan sesama gajah layaknya di alam liar. “Mereka baru dibawa ke kuil saat akan diikutkan dalam upacara atau perayaan keagamaan,” tandas Singh.(Bbc/Kcm/ Int)

”KPK meyakini uang di luar USD 400 ribu dan USD 90 ribu bukan dari Simon. Uang itu diyakini berasal dari pihak lain,” ujar juru bicara KPK, Johan Budi di kantornya, Jl HR Rasuna Said, Jakarta Selatan, Rabu (21/8). Menurut Johan saat ini KPK terus melakukan pengembangan terhadap kasus ini. Pengembangan diarahkan ke sisi pemberi dan penerima suap. Mengenai siapa pihak lain pemberi suap yang dimaksud, Johan belum bisa memberi keterangan. ”Itu yang sedang kita dalami, apakah pihak lain itu perusahaan atau individu,” jelas Johan. Sebelumnya pihak Simon mengakui telah memberi uang sejumlah USD 700 ribu ke Deviardi. Uang itu untuk memuluskan ekspansi Kernel Oil ke SKK Migas. Tapi belakangan pihak Simon merubah keterangan dengan mengklaim uang itu milik Ardi yang dititipkan ke Widodo Ratanachaitong, direktur Kernel Oil Singapura.

KPK pun kemungkinan besar akan segera memeriksa Widodo. Dia dianggap banyak tahu tentang alur uang dalam kasus suap ini. ”Kemungkinan memeriks Widodo sebagai saksi sangat terbuka sekali,” imbuh Johan. Jujur Wakil Ketua Komisi Pemberantasan Korupsi (KPK) Bambang Widjojanto meminta Komisaris PT Kernel Oil Private Limited (KOPL) Simon G Tanjaya untuk jujur dalam pemeriksaan. Bambang mengatakan, KPK memiliki bukti yang kuat, termasuk bukti transfer terkait uang yang diduga sebagai suap dari Simon. ”Simon pada akhirnya harus mengakui bahwa kami tidak hanya mengejar pernyataan dari keterangan Simon. Kita punya bukti lain, bukti transfer, dan lainnya. Saya tidak bisa sebutkan bukti-bukti itu semua, tapi ada,” kata Bambang di Jakarta, Rabu (21/8). Sebelumnya, Simon mengaku tak mengenal Kepala SKK Migas Rudi Rubiandini. Namun

kemudian, Simon melalui kuasa hukumnya Junimart Girsang mengaku menyerahkan uang sebesar 700.000 dollar AS kepada pelatih golf Rudi, yakni Deviardi alias Ardi. Uang itu diberikan kepada Ardi karena Simon menganggap Ardi sebagai Sekretaris SKK Migas. Simon mengaku tak tahu bahwa uang itu kemudian diberikan Ardi kepada Rudi. Menurutnya, PT Kernel Oil ingin berekspansi ke kegiatan hulu minyak dan gas karena selama ini hanya bergelut dalam bisnis solar. PT Kernel juga belum pernah mengikuti tender di SKK Migas. Bambang mengatakan, saat ini, KPK pun fokus untuk menelusuri hasil penggeledahan di SKK Migas, kantor Kernel Oil, maupun kantor ESDM. ”Sekarang fokus KPK memberikan perhatian untuk mengkaji hasil-hasil penggeledahan. Lakukan pemblokiran untuk melindungi asetaset, kekayaan, dan kemungkinan kerugian negara itu,” terang Bambang. Dalam kasus ini, KPK menetapkan Rudi sebagai tersangka atas dugaan menerima suap dari petinggi PT KOPL Simon terkait kegiatan hulu minyak dan gas. Selain Rudi dan Simon, KPK juga menetapkan Deviardi sebagai

tersangka. Sama halnya dengan Rudi, Deviardi diduga menerima uang dari Simon. Beberapa hari lalu, Deviardi dan Rudi tertangkap tangan penyidik KPK di kediaman Rudi dengan barang bukti uang senilai 400.000 dollar AS, 90.000 dollar AS dan 127.000 dollar Singapura, serta motor berkapasitas mesin besar bermerek BMW. Tim penyidik juga menyita uang tunai 200.000 dollar AS dari kediaman Ardi. Terkait penyidikan kasus ini, KPK telah menggeledah ruang kerja Sekjen Kementerian ESDM Waryono Karyo. Dari penggeledahan tersebut, KPK menyita uang 200.000 dollar AS yang dibungkus dalam tas hitam. Selain menggeledah ruangan Sekjen ESDM, KPK menggeledah kantor SKK Migas sejak Rabu (14/8/2013) malam, hingga Kamis (15/8) sore. Dari penggeledahan tersebut, KPK menyita sejumlah uang dan emas di ruangan Rudi. Nilai uang yang ditemukan sekitar 60.000 dollar Singapura, 2.000 dollar AS, dan kepingan emas seberat 180 gram. KPK juga menyita uang dalam deposit box yang berada di Bank Mandiri, Jakarta, senilai total 350.000 dollar AS. (Dtc/Kcm/Int)

Perburuan Aset Century bak Kejar Angin Surga


„ Presiden SBY, dan Wapres Boediono dalam sebuah kesempatan. Menyikapi jatuhnya nilai tukar Rupiah, presiden memastikan tidak akan ada PHK massal.

Rupiah Rontok, Presiden Janji Tak Ada PHK JAKARTA- Membaiknya ekonomi Amerika Serikat (AS) bukannya menjadi berkah bagi ekonomi Indonesia. Indonesia malah tertekan, lantaran dana investor asing yang dulu masuk mulai keluar lagi. Hal tersebut tercermin dari kondisi Rupiah yang semakin melemah. Selain itu, pasar saham Indonesia mulai terkoreksi tajam. Pasalnya, membaiknya ekonomi AS membuat Bank Sentral AS menghentikan stimulus pembelian obligasinya, padahal stimulus tersebut adalah salah satu pendorong kenaikan saham-saham. Menanggapi ekonomi global yang belum stabil ini, Presiden Susilo

Bambang Yudhoyono (SBY) mengungkapkan memang saat ini dunia usaha tengah mendapat tekanan. Meski demikian, dia mengatakan bahwa pemerintah akan melakukan tindakan agar tidak terjadi pemutusan hubungan kerja (PHK). ”Kita juga akan mengamankan para pekerja. Oleh karena itu, kita akan melakukan sesuatu, melakukan kerja sama dengan dunia pengusaha, dan jangan sampai sekali lagi terjadi PHK,” kata SBY di kantornya, Jalan Medan Merdeka, Jakarta, Rabu (21/ 8). Menurutnya, jika terjadi PHK akan sulit bagi rakyat untuk mencukupi sehari-harinya. “Itulah kebijakan

yang akan kami jalankan. Setelah pertemuan yang saya pimpin ini, dan sejak tiga hari lalu, dan akan dirumuskan beberapa hari ke depan untuk menjaga stabilitas keuangan kita,” jelas dia. Presiden SBY menjelaskan, untuk menjaga pertumbuhan agar tidak menurun secara tajam, maka dua hal yang mencegah terjadinya inflasi tersebut yang dikehendaki. ”Maka paket akan segera disiapkan dalam dua hari ini, dan Jumat akan saya rumuskan untuk paket tindakan pemerintah mengatasi masalah ini, dan akan diumumkan oleh menteri teknis untuk merumuskan ini,” tuturnya. (Okz/Int)

JAKARTA- Tim Pengawas kasus Bank Century diminta untuk segera memanggil Menteri Hukum dan HAM Amir Syamsuddin. Pemanggilan tersebut perlu dilakukan untuk meminta laporan perkembangan tim pemburu aset Bank Century yang dipimpin Amir. ”Harus panggil Menkumham supaya tahu sejauh mana perkembangan aset Century. Ini kan yang penting uang balik dulu. Sekarang enggak ada yang kembali. Kayak angin surga saja,” ujar anggota Timwas Century Fahri Hamzah di Kompleks Parlemen, Jakarta, Rabu (21/8). Pada Rabu ini, Timwas Century melakukan rapat internal untuk menjadwalkan sejumlah pemanggilan pihak terkait kasus itu. Wakil Ketua DPR Priyo Budi Santoso yang memimpin rapat itu menuturkan, pemanggilan Menhuk dan HAM menjadi salah satu kesepakatan dalam rapat tersebut. ”Minggu depan, kami memanggil Menkumham sebagai ketua tim pemburu aset didampingi menterimenteri lain. (Mereka diminta) untuk menyampaikan hasil aset yang bisa diselamatkan di beberapa negara,” ujar Priyo. Selain Menhuk dan HAM, Timwas Century juga akan memanggil Komisi Pemberantasan Korupsi (KPK) dan Badan Pemeriksa Keuangan (BPK). Priyo mengaku ada usulan untuk pemanggilan terhadap mantan

DeputiGubernurSeniorBankIndonesia Miranda Gultom, mantan Deputi Gubernur BI Budi Mulya, dan mantan Menteri Keuangan Sri Mulyani. ”Tapi nama-namaituakhirnyakamisepakat untuk tidak memanggil karena kami fokus pada fungsi pengawasan saja,” imbuh Priyo. Aset Century Sebelumnya, Amir menyampaikan perkembangan kinerja tim pemburu aset Century. Amir yang melakukan kunjungan kerja ke Inggris dan Jersey pada 28 Juli-4 Agustus itu menyisipkan salah satu agendanya membahas soal aset Century di Pulau Jersey. Amir sudah menyampaikan permintaan bantuan timbal balik, atau mutual legal assistance (MLA), terkait pembekuan aset Bank Century. Pulau Jersey merupakan sebuah pulau yang terletak di selat Inggris, dan merupakan wilayah hukum di bawah Kerajaan Inggris yang memiliki pemerintahan sendiri. Di pulau tersebut ada kegiatan lembaga keuangan dari seluruh dunia. Menurut Amir, otoritas hukum Jersey bersedia memberikan komitmen terhadap permintaan Indonesia karena mereka ingin menjaga kredibilitas dan standar pelayanan. Aset Bank Century di Jersey diduga mencapai 40 juta dollar AS. Namun, Amir menuturkan aset yang berhasil terdeteksi mencapai 16 juta dollar AS atau sekitar Rp 160 miliar. (Kcm/Int)


22 Agustus 2013


Semua Habis, Hanya Baju yang Dipakai Tinggal


RATA DENGAN TANAH- Rumah dua nelayan di Gang Sentosa Dusun IX, Desa Sukajaya, Kecamatan Tanjung Tiram, rata dengan tanah karena terbakar saat ditinggal pergi melaut , Rabu (21/8).

TANJUNGTIRAM-Dua rumah milik nelayan masing-masing Kimen (28) dan Syarifudin (38), warga Gang Sentosa Dusun IX, Desa Sukajaya Kecamatan Tanjung Tiram, terbakar saat kondisi rumah itu kosong ditinggal pergi bekerja, Rabu (21/8) sekira pukul 12.00 WIB. Data dihimpun METRO ASAHAN, peristiwa itu terjadi saat kondisi rumah dua nelayan yang sedang pergi melaut itu kosong. Pasalnya, Aini (26) istri Kimen sedang merantau di Malaysia. Sementara, Yani (35) istri Syarifudin siang itu pergi mencari kayu di belakang rumah. Kebakaran itu, kali pertama diketahui warga sekitar yang melihat kepulan asap dari salah satu rumah. Tidak berapa lama, api mulai tampak membesar membakar rumah. Kejadian itu, langsung membuat warga heboh dan berusaha memadamkan api dengan peralatan seadanya. Api bisa dipadamkan, setelah satu unit mobil Pemadam Kebakaran milik Pemkab Batubara tiba dilokasi, dan api sudah meratakan bangunan rumah nelayan itu. Yani (35) ketika ditanyai, men-

gaku siang itu dia pergi dari rumah pergi mencari kayu di hutan bakau yang berjarang 1 kilomter dari rumahnya. saat pergi dari rumah, dia menyebutkan tidak ada memasak atau pun menyalakan perapian. “Aku tak tahu Bang, saat kejadian aku sedang cari kayu bersama adikku Khairiyah. Kami pergi dari rumah sekira pukul 10.00 WIB. Sementara,suamikusudahsejakpagi pergi melaut,” katanya. Diungkapkan Yani, saat dia dan adiknyaasyikmencarikayu.Adiknya mendengar seperti ada suara rumput yang terbakar. Mendengarucapanadiknya,dia kemudian mengecek sekitar lokasi pencarian kayu, dan melihat dari kejauhan rumahnya terbakar. Dituturkannya, melihat rumahnya terbakar. Dia langsung keluar dari hutan bakau, dan berlari ke arah rumah sembari meminta tolong kepada warga. “Kaluasalapi,akutaktahu.Karena, aku asyik mencari kayu. Aku panik saat itu, karena anakku kutinggal di rumah. Ternyata, anakku saat kutinggal dibawa kakeknya ke Desa Bongak,” sebut Yani. Diugkapkan Yani, tidak ada harta benda yang bisa diselamatkan dari rumahnya, termasuk pakaian

warga yang dicucinya. “Akukan juga mencuci kain warga. Semuanya sudah habis, hanya baju yang dipakai tinggal,” lirih Yani. Syarifuddin (38) ketika ditanyai, mengetahui rumahnya terbakar, begitu menepi pulang melaut. “Saya tak tahu, aku baru pulang melaut. Pas di Pajak Kerang, aku sempat melihat api membubung dariarahtempattinggalku.Melihat itu, aku menghubungi kerabatku. Dan benar, kerabatku menyampaikanrumahkuterbakar,’katanya. Syarifudinmenambahkan,kejadian itu membuat dia terpaksa mengungsi dan sementara tinggal di rumah adinya Riyah (33). Dia berharap, Pemkab Batubara dapat memberikan bantuan kepada mereka. Rosni (50) tetangga kedua korban mengatakan, tidak tahu bagaiamana kebakaran terjadi. Sebab, sebelum diketahui api membesar, diaberadadidalamrumahsedang makan siang. “Pas makan, aku dengar suara minta tolong ada kebakaran. Baru akukeluardaridalamrumah,melihat situasi,” ujarnya. Dia menambahkan, tetangganya Kimen belum mengetahui rumahnya terbakar, karena belum pulang melaut. Sementara, Aini istri Kimen merantau ke Malaysia, dan anak mereka Nadia (7) dan Zahra(4),tinggaldirumahneneknya di daerah Pangkalan. Kapolsek Labuhan Ruku AKP Handri Matondang SH, ketika dikonfirmasi wartawan, mengaku belummengetahuiadarumahterbakar. Sebab, dia sedang berada di Limapuluh mengikuti rapat. “Aku belumtahu,karenabelumadawargamelapor.Cobatanyaanggotaku, saya lagi rapat di Limapuluh,” katanyamelaluitelepon. (mag-09)

Dimangsa Buaya, Ibu 4 Anak... Sambungan Halaman 1

Hendra menambahkan, korban sudah berada di rumah duka untuk mengikuti acara keagamaan dan akan langsung dimakamkan. “Rencananya setelah mengikuti acara adat, langsung dimakamkan,” ucap Hendra. Sudah Dua Korban Dalam dua tahun terakhir, sudah ada dua warga Desa Sikarakara 4, yang tewas dimakan buaya. Sebelumnya, Juni tahun 2012. Namun sampai sekarang belum ada tindakan dari Pemkab Madina. “Sudah ada dua korban, dan keduanya perempuan. Kejadian pertama sekitar bulan Juni tahun lalu,” kata Hendra Lubis, kepada METRO, Rabu (21/8). Harapan warga, sambung Hendra, pemerintah bisa membantu mereka untuk melakukan penangkapan buaya pemangsa manusia itu. Sebab, jika dibiarkan begitu saja kemungkinan

di Sungai Kunkun. Tubuh istri dari Julius (44) itu ditemukan tidak utuh lagi. Tangan kanan dan kedua kaki korban hilang sementara organ tubuh bagian perutnya juga sudah tidak utuh. “Korban saat itu mencuci kain di pinggir sungai Kunkun tak jauh dari rumah tempat tinggal mereka. Tiba-tiba datang seekor buaya menerkam korban dan langsung membawa korban ke sungai. Ada warga yang melihat langsung kejadian itu. Lalu melaporkan ke kampung. Setelah mendapat laporan, kami langsung melakukan pencarian hingga malam. Namun, korban baru bisa ditemukan tadi (kemarin) siang sekira pukul 10.30 WIB kondisi menggenaskan dan organ tubuhnya tidak utuh lagi,” beber Hendra.

METRO TABAGSEL Koran Kebanggaan Orang Tabagsel

Anggota SPS No.: 438/2003/02/A/2007 Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel ) Chairman Komisaris Utama Komisaris Direktur Utama Direktur PengasuhPemimpin Umum/Penjab/GM Wakil PU/Pimpinan Perusahaan Pimred Metro Siantar Plt.Pimred Metro Tapanuli Pimred Metro Tabagsel Pimred Metro Asahan Wakil Pimpinan Metro ASahan Tim Ombudsman

: : : : : : : : : : : : :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Maranatha Tobing Marganas Nainggolan Maranatha Tobing Pandapotan MT Siallagan Daniel Simanjuntak Muhiddin Hasibuan Eva Wahyuni Darwin Purba Vincent Wijaya

korban akan bertambah. “Harapan kami, pemerintah dan aparat terkait bisa membantu warga menangkap buaya pemangsa itu. Kami berencana akan melakukan upaya penangkapan. Kami tidak ingin korban bertambah lagi,” kata Henra. Salah seorang warga Desa Kunkun, Haris, menambahkan, warga memang sering melihat buaya di sungai Kunkun. Namun, warga setempat tidak pernah diganggu. “Sungai Kunkun memang dihuni puluhan ekor buaya, tetapi warga tidak pernah diganggu. Dan, baru dua tahun ini buaya itu memangsa warga. Menurut nenek moyang kami, mereka tidak akan mengganggu warga jika memang tidak ada melakukan kesalahan. Itu menurut cerita nenek moyang kami,” pungkas Haris. (wan)

Kalapas Minta Pengamanan Polisi dan Tentara Sambungan Halaman 1 napi bersama sekitar 18 personil Polres Psp langsung menjumpai KPLP Kelas II B Salambue Marahatoguan. Selanjutnya, napi pindahan yang terbagi dalam dua mobil mulai diturunkan satu per satu, sambil didata dan difoto. “Kami berangkat dari sana (Labuhan Ruku) sekitar pukul setengah dua siang. Di dalam perjalananmenujuPsptidakkendalasama sekali. Semuanya berjalan dengan aman dan terkendali. Semua napi juga sangat kooperatif,” ujar Kompol Edi Sitepu. Menurut salah seorang petugas yang juga ikut dalam proses pemindahan para napi tersebut, semula para napi menolak dibawa dengan menggunakan pengawalan dari pihak kepolisian. Mereka meminta dibawa menggunakan pengawalan dari pihak TNI. Selanjutnya, untuk memudahkan proses pemindahan, pihak TNI yang menjemput para tahanan dari dalam lapas dibawa keluar. Lalu dimasukkan ke dalam mobil pemindahanyangtidaklainadalah mobil milik Polri. “Untuk mengelabuinya, terpaksa pihak TNI yang menjemput mereka ke dalam, seolah-olah pihak TNI yang akan mengawal mereka. Lalu dimasukkan ke dalam mobil yang tidak diketahui mereka. Setelah itu, baru dibawa dengan pengawalan kami,” ujar petugas yang tidak mau disebutkan namanya tersebut. “Ya saya kurang tahu juga, mengapa mereka menolak dibawa dengan menggunakan pengawalan polisi, yang pasti didalam perjalanan hingga sampai ke mari semua berjalan dengan aman dan lancar,” sambungnya. Sementara itu, Kalapas Kelas II BSalambueMSutanmelaluiKPLP Marahtoguan menjelaskan, total penghuni lapas sampai Selasa (20/ 8) sudah mencapai 558 orang, sebelumnya hanya berjumlah 503 orang. “Jadisampaisatinitotalpenghuni Lapas Salambue sudah mencapai 558 orang, sebelumnya juga sudahmencapai503orang,ditambah napi pindahan dari Tanjung Gusta dan napi pindahan dari La-

buhan Ruku,” tuturnya. Marahatoguan menambahkan, untuk masalah pengamanan pihaknya sudah berupaya untuk meminta penambahan pengamanan dengan memohon kepada pihak yang terkait seperti Polres Kota, Polres Tapsel dan Pihak Kodim0212KotaPsp,namunbaru dari pihak Kodim 0212 yang bersedia memberikan bantuan pengamanan dengan menempatkan anggotanya sebanyak dua orang untuk mewanti-wanti terjadinya hal-hal yang tidak diinginkan. “Ditanya tentang pengamanan, kalau dari pihak kami petugasnya masih seperti yang biasa, makanya kami memohon kepada pihak yang terkait, untuk dapat membantu dalam hal mengawasi dan juga turut menjaga untuk menghindari terjadinya hal-hal yang tidak diinginkan,” tukas pria bertubuh tinggi tersebut. 22 Napi Labuhan Ruku Tiba diLapasPanyabungan Sebanyak22 Narapidanapindahan dari LP Labuhan Ruku BatubaratibadiLPKelasIIBPanyabungan Kabupaten Mandailing Natal (Madina)padaRabu(21/8)dinihari sekira pukul 03.30 WIB. Para napi itu dibawa dengan kendaraan truk Dalmas Polres Madina dan dikawal sejumlah polisi. DemikiandisampaikanKalapas Kelas IIB Panyabungan Arief RahmankepadaMETRO,Rabu(21/8). Arief mengatakan jumlah napi yang dipindahkan dari LP Labuhan ruku sebanyak 22 orang dari berbagai kasus. “Jumlahnya 22 orang bukan 50 orang, tiba di Panyabungan sekira pukul 03.30 WIB. Kebanyakan kasusnarkoba,adajugakasushuman traficking dan kasus lainnya. Kami sedang melakukan pendataan karena berkas mereka turut terbakar saat terjadi kerusuhan,” ungkap Arief. Disebutkan, jumlah napi di LP Panyabungan saat ini menjadi 317 orang, karena sudah mendapat penambahan 27 orang. “Jumlah warga binaan kita awalnya 290 orang, kemarin bertambah 5 orang dari LP Tanjung Gusta Medan, lalu bertambah 22 orang dari LP Labuhan Ruku,” tambahnya. Pantauan METRO di LP Kelas IIBPanyabungan,aparatTNI/Polri

disiagakan di sekitar lokasi lapas, baik di dalam lokasi tahanan maupun di luar lapas. Dan sampai saat ini belum ada kendala pada bagian pengamanan. Mestinya Dipindahkan ke Nias Pemindahan sekitar 500 napi Lembaga Pemasyarakatan (Lapas) Kelas II A Labuhanruku, Batubara, ke ke 13 Lapas/Rutan di Sumut, mendapat sorotan dari Indonesia Police Watch (IPW). Ketua Presidium IPW Neta S Pane menilai, langkah pemindahan itu menunjukkan manajemen di jajaran Direktorat Jenderal Pemasyarakatan (PAS) dan jajarannya di daerah, masih amburadul. Menurut Neta, Ditjen PAS hanya cari enaknya saja, yakni memindahkan napi ke rutan-rutan yang berada di kota-kota besar di Sumut yang sudah jelas over kapasitas, tanpa mempertimbangkan potensi rusuh akibat bertemunya napi limpahan dari LP Tanjungusta dengan napi dari LP Labuhanruku. Padahal, potensi rusuh di lapaslapas yang dijadikan lokasi pemindahan bisa dihindari. Yakni, menurutNeta,dipindahkansajake lapas-lapas yang ada di Kepulauan Nias. “Jangan hanya dipindahkan ke kota-kota besar saja. Mestinya pindahkan ke Nias. Kalau di sana belum ada lapas, ya bangun dong. Tempatkan napi di wilayahwilayah terpencil. Bisa juga di Tapsel atau perbatasan Madina,” ujar Neta S Pane kepada koran ini di Jakarta, kemarin (21/8). Terpisah,JubirDitjenPAS,Akbar Hadi Prabowo, mengatakan, langkah pemindahan yang dilakukan saat ini merupakan upaya langkah cepat dalam rangka evakuasi. “Kalau ke Nias, itu jauh, sementara kita perlu waktu cepat. Lagipula setahu saya di Nias tak ada lapas,” kata Akbar kepada koran ini. Sementara kalau pun harus dibangun lapas di Nias, hal itu membutuhkan waktu. “Sedangkan kita harus gerak cepat,” imbuhnya. Seperti diketahui, sedikitnya tiga lapas dan satu rutan di Sumut memiliki ‘status’ rawan rusuh. Kekhawatiran itu muncul lantaran Lapas KelasIIBTebingtinggi,LapasKelas

II A Pematangsiantar, Lapas Kelas II B Siborong-borong, dan Rutan Kelas II B Sidikalang yang mengalamioverkapasitaskembalimendapat limpahan napi asal Labuhanruku. Sebelumnya, pada Juli lalu, napi asal Lapas Kelas I A Tanjunggusta yang lebih dulu melakukan pembakaran dan kerusuhan sudahdipindahkankeempatlokasi tersebut. Kembali ke Neta. Menurut aktivis yang juga ‘anak Medan’ ini, sebenarnya pemicu utama rusuh di lapas karena perlakuan diskriminatif yang ditunjukkan para petugas lapas. Selama ini, kata Neta, napi-napi berkantong tebal bisa memilih untuk ditempatkan di lapas-lapas yang ada di perkotaan. Fasilitasnyapunberlimpah.Berbedadengan napi kere, yang dibuang di lapaslapas non perkotaan, dengan fasilitasminim. “Napi tak punya uang, untuk mendapatkan air saja susah. Sementara napi berkantong tebal, air melimpah ruah. Ini menimbulkan kesenjangan, yang memicu emosi dan terjadilah kerusuhan,” kritik Neta. Karenanya, Neta menantang jajaran Ditjen PAS dan Kanwilkanwil, untuk berani melakukan perombakanbesar-besaran.“Napi berkantong tebal juga harus disebardilapas-lapasterpencil,”ujarnya. Untukpengamanan,Netamenyarankan, pihak Ditjen PAS juga harus menjalin kerjasama dengan aparat kepolisian secara berjenjang, mulai Polsek dan Polres. “Sehingga polisi punya kewenangan untuk melakukan patroli di lapas-lapas. Ketika ada kerawanan, bisa langsung diantisipasi,” kata Neta. Jika pihak kepolisian merasa kewalahan saat menghadapi napi, barulah kepolisian minta bantuan TNI. Jangan sampai, kata Neta, pengamanan oleh TNI atas permintaan napi, bukan atas permintaan polisi. “Napi itu orang yang sudah melakukan kejahatan dan sedang dihukum. Jangan permintaan-permintaan mereka dituruti. Jangan petugas lapas diatur-atur napi,” pungkasnya. (mag 01/wan/sam)

Calhaj Diimbau Patuhi Anjuran Petugas Medis Sambungan Halaman 1 Selanjutnya dilakukan pemeriksaan kembali untuk tingkat kota yang dipusatkan di Puskesmas Pijorkoling Kota Psp mulai Rabu (21/ 8) hingga Sabtu (24/8) mendatang. Untukhasilpemeriksaansementara, pihaknya mencatat ada sebanyak 60 calon jamaah haji yang

beresiko tinggi atau dengan kata lain mempunyai catatan penyakit yang cukup menggangu dalam pelaksanaan ibadah haji nantinya. “Jadiberesikotinggiitudimaksud memilikipenyakityangrentan,seperti hipertensi, gula darah dan penyakit lainnya yang diketahui dapat menggangu dalam pelaksanaan ibadah haji,” ujar Doria Hafni.

Doria juga menambahkan, hal itu dapat dicegah jika para calon jamaahdapatmenjalankansemua anjuran yang diberikan petugas medis yang memeriksanya. Dan, pemeriksaan tersebut bukan sampai di situ saja. Sebab setelah pemeriksaantingkatkotaselesai,para jamaah akn kembali diperiksa di tingkat provinsi sebelum ke-

berangkatan. “Jadi mulai sekarang coba patuhi apa yang menjadi anjuran para petugas medis, sebab jika tidak, dan ketika di tingkat provinsi diperiksa, maka calon jamaah yang diketahui memilik penyakit yang beresikotinggibisaterancamgagal menjalankan ibadah haji,” tegasnya. (mag01)

Wali Kota Sibolga Diperiksa Kejatisu Sambungan Halaman 1 Purnama membenarkan pemeriksaan terhadap Syarfi di ruang Pidsus (Pidana Khusus) Kejati Sumut. Dalam pemeriksaan itu, penyidik mencecarnya dengan 15 pertanyaan berkaitan pencairan anggaran untuk pembangunan pengadaan Rusunawa yang terletak di Jalan Merpati Sibolga Selatan tersebut. Yang diduga terjadi markupharganilaipembelianlahandari warga pemilik tanah, sehingga merugikan keuangan negara. “Dia diperiksa dengan kapasitas sebagai saksi. Untuk perkara di Sibolga, hanya Wali Kota yang dijadwalkan menjalani pemeriksaan hari ini. Dia datang sendiri pagipagi sekali. Mulai diperiksa dari pukul 08.15 WIB hingga 10.15 WIB. Memang hanya sebentar, karena penyidik hanya melontarkan sedikitnya 15 pertanyaan. Pada saat anggaran untuk pembangunan Rusunawa itu dicairkan, dia diduga menyetujui pencairannya. Jadi kita menanyakan mengenai posisi kegiatan pada saat itu,” ujar Chandra, Rabu (21/8) kepada SumutPos(GrupMETROTABAGSEL).

Departemen Redaksi METRO TABAGSEL Dewan Redaksi Group : Marganas Nainggolan (Ketua), Maranatha Tobing, Muhiddin Hasibuan, Pandapotan MT Siallagan, Eva Wahyuni, Daniel Simanjuntak, Leo Sihotang, Chandro Purba, Hermanto Sipayung, Nurjannah. Redaktur Pelaksana: Nurjannah, Redaktur: Pholmer Saragih, Jhon Damanik, Plidewatna, Nasa Putra Maylanda, Syafruddin Yusuf, Pala Silaban Hezbi Rangkuty, Edi Saragih Asisnten Redaktur: Imelda Purba Pjs Kordinator Liputan: Ikror Amin Lubis, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina), Oryza Pasaribu, Parningotan Aritonang. METRO SIANTAR Redaktur Pelaksana: Leonardus Sihotang, Yappy Chandro Purba Kordinator Liputan: Tonggo Sibarani, Reporter: Pra Evasi Haloho, Billy Andra Nasution, Eko Hendriawan, Dhev Fretes Bakkara (fotografher), Rano Kambo Hutasoit, Darwis Damanik, Sawaluddin, Soetomo Samsu (Jakarta), Irwansyah (TanahJawa), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok), Taman Haloho (Parapat) Sekretaris Redaksi: Yanti Nurhapni, Staf Redaksi : Ita Butar-butar METRO TAPANULI Pjs Redaktur Pelaksana:-, Kordinator Liputan: Ridwan Butar-butar, Ass.Korlip : Marihot Simamora Reporter: Freddy Tobing, Milson Silalahi, Aris Barasa, Juris Tanjung, Samuel Sitompul, Masril Rambe (koresponden Barus), Horden Silalahi(Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput), Jantro Naibaho, Juandi Sihombing, Hermanto Turnip (Tobasa)

Saat ditanyakan mengenai informasi yang beredar bahwa Syarfi sempat pingsan ketika menjalani pemeriksaan, Chandra membantahnya. “Mana pula pingsan. Informasi dari mana itu. Kalau pingsan, gak mungkin lah pemeriksaan dilanjutkan. Sehatsehat aja kok dia tadi,” ungkap Chandra. Mengenai materi pemeriksaan itu, Chandra enggan menjelaskannya. Saat disinggung apakah Syarfi akan ditetapkan sebagai tersangka dalam perkara itu, mengingat kegiatan pembangunan Rusunawa tersebut tak terlepas dari perannya sebagai Wali Kota, Chandra mengatakan masih menunggu hasil pemeriksaan dari penyidik. Dia menyatakan, bila pemeriksaan terhadap Syarfi diperlukan lagi, maka penyidik akan menjadwalkan pemeriksaannya kembali. “Oh, kalau itu belum taulah. Inikan masih pemeriksaan dia sebagai saksi. Mengenai penetapan tersangka, tunggu saja apa hasil dari penyidik. Tapi kalau memang dibutuhkan, akan dijadwal ulang kembali pemerik-

saan dia,” terangnya. Dalam perkara itu, penyidik belum menetapkan seorang pun tersangka. Penyidik juga telah memeriksa Muhammad Sugeng selaku Sekretaris Daerah (Sekda) Pemko Sibolga, Ir Basar Sibarani selaku Asisten I Pemko Sibolga yang juga wakil ketua tim penilai harga tanah, Ir Tumbur Harahap selaku Kepala Dinas Kebersihan Penataan Ruang dan Pertamanan yang juga anggota tim penilai harga tanah. Kemudian Sahban Tambunan selaku Lurah Aek Manis Sibolga Selatan yang juga anggota tim penilai harga tanah, Thamrin Hutagalung selaku Kadis PU Sibolga, Sahat Simatupang selaku Camat Sibolga Selatan, Zubir selaku Bendahara Pengeluaran pada Dinas PPKAD Kota Sibolga, Sori Tua selaku mantan Kadis PPKAD Kota Sibolga, Irfan Nasution selaku Ka Orkum Pemko Sibolga, Juanuar Siregar selaku Plt Kadispenda dan Juli List selaku pihak swasta yang juga pemilik tanah. Diberitakan sebelumnya, penyidik Kejati Sumut menemukan indikasi kerugian negara sebesar Rp5,3 miliar dalam kasus

METRO ASAHAN Redaktur Pelaksana: Hermanto Sipayung, Kordinator Liputan: Edwin Garingging, Reporter:, Susilowady (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai), Syawaluddin Tanjung (Pamingke), Siswanto, Bima Pasaribu (Batubara). Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo Seven Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Handoko, Nazaruddin Ikhsan, Saddam Boythree Purba Mounting: Samuel Sihotang (Koordinator), Hotland Doloksaribu, Amran Nainggolan, Nico HS, Kabag Teknisi, Maintenance & IT: Irwan Nainggolan, Staf Operasional Website: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlison Saragih, Koordinator Pemasaran:Simson Winata Hutabarat Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Pengembangan: Jhon Tua Purba, Dedi Kurniawan, Kordinator Ekspedisi: Ardi Departemen Iklan Manager Iklan: Jamot S, Kabag Iklan : Holden Simanjuntak, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan : Tio Maria, Annisa (Medan) Staf Desaign:Reliston Purba, Togap Sinaga. Perwakilan Metro Tapanuli

pengadaan lahan Rusunawa ini. Kemudiam, status perkara ini naik ke tingkat penyidikan berdasarkan surat perintah penyidikan (P-8) nomor Print-22/N.2.1/ Fd.1/05/2013 tanggal 14 Mei 2013, dalam perkara tipikor mark up belanja modal pada pengadaan tanah sarana perumahan dan perkantoran seluas kurang lebih 7.171 M2 di Jalan Merpati, Jalan Mojopahit, Kelurahan Aek Manis, Kecamatan Sibolga Selatan pada Pemko Sibolga TA 2012 sebesar Rp5,312 miliar. Diduga terjadi semacam mark-up harga nilai pembelian lahan dari warga pemilik tanah sehingga merugikan keuangan negara. Tanah untuk Rusunawa itu terletak di Jalan Merpati Sibolga Selatan. Untuk pengadaan tanahnya sudah ada ketentuan yang baru tahun 2012, namun belum ada peraturan pelaksanaanya. Awalnya tanah itu dibeli dengan harga Rp1,5 miliar kemudian berikutnya Rp5,3 miliar sehingga total Rp6,8 miliar dari APBD 2012. Kasus ini juga sudah pernah digelar pada Jampidsus Kejagung. (far/des)

Kepala Perwakilan : Ridwan Butar-butar Koordinator Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari Hasibuan, Koordinator Pengembangan: Zulfiandi, Staf Pengembangan: Jack Simbolon (Taput),Tamy Sianturi (Tobasa) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Kabag Pengembangan: Ahmad Suhaimi Lubis, Koordinator Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Wakil Pimpinan Perusahaan: Darwin Purba, Kabag Pengembangan: Marshall Leo Siagian, Staf Pengembangan: Jemelister Sitorus, Koord.Keuangan: Revina Sihombing Kuasa Hukum: Binaris Situmorang SH Tarif Iklan : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733


22 Agustus 2013

Kecewa Terhadap Kepala Desa

Tanpa Plang Proyek Sambungan Halaman 8

menuju kantor BP2KP Tapsel di Sipirok. Selain mempermudah akses menuju tempat kerja bagi para abdi negara yang bertugas di kantor milik pemerintah itu, jalan itu juga sangat bermanfaat bagi kelancaran sarana jalan bagi pelajar di MTsN Sipirok dan juga warga sekitar. Namun beberapa warga yang melintas merasa heran dengan aktivitas pembangunan yang sedang berlangsung. Pasalnya sekalipun aktivitas pembuatan parit dan bahan material untuk perbaikan jalan telah berada di lokasi, tetapi tidak ditemui plang proyek yang menerangkan nama proyek, jumlah anggaran, pelaksanaan dan sebagainya. Abdul Jalil (63) adalah salah seorang warga yang merasa heran dengan aktivitas kerja di lokasi karena tidak adanya plang yang menerangkan nama pekerjaan, sumber dana, jumlah dana

dan lainnya. “Sebagai warga kita sangat senang dengan upaya pembangunan yang dilakukan pemerintah. Akan tetapi kita juga ingin mengetahui nama kegiatan, sumber dana, jumlah dana dan masa pelaksanaan dan pelaksana sendiri. Karena kita ingin pekerjaan itu mendatangkan manfaat sesuai dengan tujuannya,” terangnya. Sebagi warga, dirinya juga berharap agar pelaksana proyek mengutamakan mutu pembangunan agar dapat bertahan dan bermafaat lebih lama bagi warga. Amatan METRO Rabu (21/8) di ruas jalan tersebut, aktivitas perbaikan saluran air telah dimulai oleh pekerja, meterial berupa batu, kerikil dan pasir juga telah tersedia di lokasi, namun dari pangkal hingga ujung lokasi pekerjaan, tidak ditemukan plank proyek yang memberikan ifomasi singkat tentang aktivitas di lokasi itu. (ran)

Pererat Silaturahmi dengan Pendamping Pedagang Sambungan Halaman 8

Pendamping persatuan pedagang itu antara lain, Ikatan Cendikiawan Muslim Indonesia (ICMI), Pekerja Sosial (Peksos) Kota Psp dan Korps Alumni Himpunan Mahawasiswa Islam (KAHMI). Menurut Ketua Persatuan Pedagang Makanan dan Minuman Tugu Salak Syamsuddin Nasution, Rabu (21/8), persatuan pedagang Tugu Salak ini tidak terpisahkan dengan para pendamping. Sebab para pendamping ini telah memberikan jasa yang sangat kuat untuk ketetapan para pedagang berjualan di lokasi. Salah satu bentuk kepedulian dari para pendamping ialah, saat pedagang ingin digusur beberapa waktu lalu, para pendamping tetap mempertahankan pedagang agar tetap bisa berjualan di Tugu Salak dengan syarat harus memenuhi aturan-aturan yang telah disepakati. “Halal bihalal ini dilakukan tidak lain untuk mempererat hubungan silaturrahmi antara sesama pedagang dengan para pendamping pedagang. Kita sudah termasuk dalam satu keluarga kecil. Walau sedikit, tapi jika kebersamaan ini akan terus berlangsung, maka akan kokoh selamanya. Dengan terbentuknya Persatuan Pedagang Makanan dan Minuman Tugu Salak ini, kita sudah mulai merasakan keindahan akan kebersamaan antara sesama pedagang serta kekompakan dalam berdagang,” jelasnya. Selanjutnya, mereka juga selalu menyelenggaraka rapat bulanan dan tahunan dengan maksud untuk menyusun agenda serta kestabilan para pedagang. Hal ini terlaksana atas kerjasama antara para pendamping dengan pedagang. “Kita akan tetap menjaga kebersamaan dan kekompakan dalam mempertahankan kebersihan dan kenyamanan Tugu Salak. Melalui rapat yang

diadakan setiap bulan dan tahunan, para pedagang bisa saling tukar pikiran akan kendala di lapangan dalam berjualan dan menjaga kebersihan Tugu Salak. Kami sangat berterimakasih kepada para pendamping yang telah bersedia mempertahankan pedagang makanan dan minuman Tugu Salak,” pungkasnya. Amatan METRO, pada acara halal bihalal ini, pedagang makanan dan minuman Tugu Salak terlihat sangat akrab dengan para pendamping. Pendamping yang hadir dalam acara ini yaitu Ketua Peksos Baun Aritonang, Sekretaris ICMI Muktar Helmi Nasution, Sekretaris KAHMI Pertamayul Asmara Pane. Turut hadir Ketua KPA Forester Tabagsel Andika Daulay dan Al Ustad Irfan Harahap. Sementara itu Ketua Peksos Baun Aritonang bersama Sekretaris KAHMI Pertamayul Asmara Pane mengatakan, mereka akan tetap mempertahankan pedagang makanan dan minuman Tugu Salak sampai para pedagang tersebut mempunyai izin resmi. Sehingga dapat menghasilkan Penghasilan Asli Daerah (PAD) bagi Kota Psp, karena keramaian di Tugu Salak tidak akan lengkap tanpa pedagang. “Kita tetap akan mengusahakan pembuatan izin para pedagang dalam berjualan di Tugu Salak tersebut. Sehingga para pedagang merasakan kenyamanan dan ketentraman. Namun sebelum izin tersebut diperoleh, Persatuan Pedagang Makanan dan Minuman Tugu Salak harus mematuhi ketentuan-ketentuan yang telah disepakati seperti menjaga kebersiahan Tugu Salak, kekompakan para pedagang dan lainnya. Melalui Persatuan Pedagang Makanan dan Minuman Tugus Salak ini, mudah-mudahan para pedagang dapat menjaga kekompakan dan kebersamaan antara sesama pedagang serta melaksanakan peraturanperaturan yang telah disepakati bersama,” pungkasnya. (mag-02)

Sambungan Halaman 8

dan Pemkab yang diduga telah berpihak kepada PT AR tersebut, seolaholah Pemkab Tapsel tidak mempedulikan lagi keselamatan generasi berikutnya. Sebab jika pemasangan pipa tidak berlangsung lagi, maka keselamatan dan kesejahteraan generasi berikutnya akan terancam. Dengan demikian, PT AR akan merasa tenang dan tidak merasakan kendala lagi terhadap masyarakat. Karena kepala desa di Muara Batangtoru telah bersedia menandatangani dan tidak ada lagi pema-

sangan pipa pada isi perubahan nota kesepahaman. “Saya sangat kecewa terhadap Pemkab Tapsel yang diduga telah dihasut oleh PT AR. Karena melalui Pemkab, makanya kepala desa di Muara Batangtoru bersedia menandatangani perubahan nota kesepahaman yang diberikan PT AR. Diduga PT AR akan memberikan pembangunan di daerah Kecamatan Batangtoru sebagai ganti dari pemasangan pipa tersebut,” ujarnya. Dia menganalisa, Pemkab Tapsel tidak mampu lagi memberikan pembangunan di wilayah Muara Batantoru,

sehingga PT AR harus turun memberikan bantuan untuk pembangunan. Pasalnya, Pemkab bersedia menerima dengan baik tentang perubahan nota kesepahaman ini. Jika Pemkab mempedulikan keselamatan masyarakat untuk generasi yang akan datang, maka tentunya Pemkab akan terus memperjuangkan nota kesepahaman antara masyarakat dengan PT AR yang telah dibuat pada 22 September 2012 atau nota kesepahaman pertama. “Kepala desa di Kecamatan Muara Batangtoru tidak mempunyai daya, jika atasannya sendiri tidak mampu mempertahankan mereka. Kesadaran akan

mencintai lingkungan dan sesama makhluk akan mulai hilang di antara kita. Saya sangat menyesalkan Pemkab Tapsel dan kepala desa yang tidak berpihak lagi kepada masyarakat,” jelasnya. Saat METRO menghubungi Manajer PT AR Stevi Thomas, dia mengatakan bahwa untuk saat ini PT AR belum bisa memberikan infonya, karena masih belum rampung. “Mengenai hal itu sedang kami rampungkan. Kalau sudah saatnya, nanti kita bagikan infonya kepada temanteman wartawan,” ungkapnya melalui SMS. (mag-02)

Hasilkan Bibit Unggul... Sambungan Halaman 8

Nasution SP mengatakan, petani sawah di kota Psp sudah banyak yang menerapkan sistem tanam jajar legowo. “Hal ini tidak terlepas dari keberhasilan beberapa petani yang menerapkan sistem ini dan telah dapat meningkatkan hasil produksi pertaniannya,” ungkapnya. Dikatakannya, sistem tanam jajar legowo yang diterapkan saat ini adalah 4:1 dan sistem ini telah terbukti menghasilkan gabah sebanyak 9,3 ton per hektare pada panen petani di Desa Purwodadi, Psp Batunadua, beberapa waktu yang lalu. “Saat ini sistem yang sama kita terapkan di Kelurahan Sabungan Jae ini pada lahan seluas 3 hektar,” ungkapnya di sela-sela melakukan penanaman bibit padi varietas mikongga di lokasi. Sementara Kabid SDM Indra Saputra Harahap SP dan Kabid Tehnis Ir Abi Sofyan menjelaskan, hingga saat ini program tanam jajar legowo di Kota Psp telah diterapkan di Desa Gunung Hasahatan, Desa Purwodadi, Desa Pudun Jae Kecamatan Batu Nadua, Desa Pijor Koling dan Desa Manunggang Kecamata Psp Tenggara. Selain itu di Kelurahan Lembah Lubuk Manik, Suharang Karang dan Kelurahan Sabungan Jae Kecamatan Psp Hutaimbaru. “Penanaman varietas mikongga saat ini dilakukan pada lahan Kelompok Wanita Tani (KWT) Rim Satahi Sabungan Jae yang di ketuai Masrida,”

terang keduanya. Lebih jauh mereka menjelaskan, manfaat yang didapatkan dari sistem tanam jajar legowo itu sangat banyak, di antaranya memperbaiki kualitas gabah dengan semakin banyaknya tanaman pinggir, mengurangi serangan penyakit atau tingkat serangan hama, mempermudah dan menghemat perawatan, baik itu pemupukan maupun penyemprotan pestisida, serta memudahkan tanam ulang setelah selesai masa panen. “Lebih dari pada itu, tentunya meningkatkan pendapatan atau kesejahteraan petani,” jelas keduanya. Sedangkan KUPT PPL Kecamatan Psp Hutaimbaru Asnah Aminah mengatakan, para petani padi di Psp, khususnya di Kecamatan Psp Hutaimbaru, sudah mampu menerapkan sistem teknologi yang disampaikan petugas Penyuluh Pertanian Lapangan (PPL). Hal ini dibuktikan dengan tingginya hasil panen yang didapat para petani sawah setelah mengikuti program-program yang diterapkan Badan Ketahan Pangan Kota Psp melalui para penyuluh pertanian lapangan, khususnya terhadap kelompok tani. “Pemilihan varietas mikongga di lahan Kelompok Wanita Tani ini adalah untuk penyediaan bibit unggul yang nantinya akan disebar luaskan kepada kelompok tani atau pada petani lainnya di wilayah ini. Sehingga para petani mudah mendapatkan bibit pada saat musim tanam tiba,” ujarnya. (ran)


„ Wali Kota Psp Andar Amin Harahap dan Ketua DPRD Aswar Syamsi Lubis, usai menerima opini WDP dari BPK RI Perwakilan Sumut di Medan, Senin (19/8).

Pemko Psp Raih Predikat WDP dari BPK Sambungan Halaman 8

Predikat WDP ini menggambarkan laporan keuangan Pemko Psp TA 2012 itu cukup baik, kendati masih perlu pembenahan supaya ke depan dapat meraih predikat opini tertinggi yakni Wajar Tanpa Pengecualian (WTP). Kepada METRO, Rabu (21/8) Wali Kota Psp Andar Amin Harahap melalui Inspektorat Ikhpan Lubis SSos didampingi Kabag Humas dan Arsip Setda Kota Psp Saiful Bahri mengatakan, Opini BPK dengan perdikat WDP ini telah diserahkan oleh Kepala Perwakilan Badan Pemeriksa Keuangan (BPK) RI Perwakilan Provinsi Sumatera Utara Muktini didampingi Kepala Sub Auditor BPK RI Perwakilan Sumut Aris Laksono SE, Kabag Hukum dan Humas Mikael PH Togatorop kepada walikota didam-

pingi Ketua DPRD, Senin (19/8) lalu. “Predikat WDP atas LHP Laporan Keuangan Pemko Padangsidimpuan oleh BPK RI Perwakilan Sumut ini merupakan tahun ke empat diraih Pemko, sejak pertama kali diraih pada 2009 silam. Mudah-mudahan pada tahun-tahun mendatang predikat kita naik menjadi WTP,” tutur Ikhpan didampingi Saiful Bahri. Ikhpan menambahkan, beberapa hal yang perlu mendapat pembenahan serius supaya meraih predikat opini WTP pada tahun mendatang antara lain, masalah pengadministrasian aset Pemko. “Pemko akan berupaya serius membenahi administrasi aset daerah ini sehingga tidak ada lagi ganjalan untuk meraih predikat tertinggi WTP,” tukasnya. (mag01)

Hasilkan 8,1 Ton per Hektare Sambungan Halaman 8

Rabu (21/8). Dengan lahan kurang lebih 2 hektare serta memiliki 6 varietas unggul, yaitu mekongga, Inpari 3, 10, 14, 15 dan 16, panen tersebut menghasilkan 8,1 ton per hektare. Dengan sistem pendampingan SLPTT (Sekolah Lapang Pengelolaan Tanaman Terpadu) padi, sangat mendukung pencapaian surplus 10 juta ton beras tahun 2014 melalui kerjasama Badan Litbang Pertanian BPTP Sumut dengan Pememerintah Kabupaten Tapsel. Salah seorang tokoh masyarakat Raja Gele mengatakan, sangat berterima kasih dengan pembinaan yang dilakukan selama ini, dan dengan sistem pertanian padi seperti ini mereka

mengaku merasakan manfaat yang cukup besar diantaranya hama agak berkurang. “Sedangkan kendala untuk petani saat ini adalah banyaknya lahan yang beralih fungsi menjadi lahan tanaman keras,” ujarnya. Kepala BPTP Sumut DR Ir Ali Jamil Harahap dalam sambutannya, mengajak seluruh petani memanfaatkan tekhnologi untuk meningkatkan hasil pertanian. “Mari kita manfaatkan teknologi pertanian dalam upaya meningkatkan produktivitas hasil pertanian. Namun demikian, mengingat yang ditanam adalah padi sawah, tidak terlepas dari ketersediaan air. Keuntungan yang diperoleh dengan sistim legowo antara lain, lebih banyak tanaman yang di-

pakai di pinggir, jumlah rumpun lebih banyak, populasi lebih banyak dan mempermudah merawat atau memelihara tanaman,” terangnya. Lebih jauh Jamil menyarankan, agar petani selalu menggunakan varietas baru dengan lebel putih dan menyarankan agar menanam infari 3. “Kekompakan itu juga penting,” ujarnya. Bupati Tapsel yang diwakili sekretaris Daerah Ir Aswin Efendi Siregar MM dalam sambutannya mengatakan, agar benih unggul yang ada dapat dikembangkan demi kesejahteraan petani ke depan. “Terutama jenis infari tiga. Kekompakan dan kebersamaan juga sangat penting dan selalu berkoordinasi dengan PPL dan bila memungkinkan Batang Angkola ini jadi contoh di

Tapanuli Selatan,” terangnya. Anggota DPRD Tapsel Ali Mujur yang juga salah seorang formulator pertanian mengatakan, apabila bidang pertanian digeluti dengan serius tidak kalah hasilnya dengan jenis tanaman lain. Untuk itu Ali menyarankan agar dalam mengusahakan pertaniannya tepat waktu, tepat sasaran, tepat cara, dosis dan tepat harga. Turut hadir dalam panen perdana tersebut, selain sekdakab Ir Aswin Efendi Siregar MM, Kepala BPTP Propsu DR Ir Ali Jamil Harahap, anggota DPRD Tapsel Asgul Dalimunte, Hj Hasni Delaila Harahap, Ali Imran Hasibuan, Ali Mujur, para SKPD terkait seperti kepala BP2KP Bismark Siregar, camat Batang Angkola dan masyarakat setempat. (ran)

SAMBUNGAN METRO TABAGSEL Peduli Pemberantasan Buta Aksara


Sambungan Halaman 1 Begitulah, sang istri selalu mendampingi Leyangtsi dengan saling mengingatkan satu sama lain. Hingga suatu ketika, Leyangtsi pergi untuk belajar pada seorang guru, yang membuatnyaberpisahdengansang istriuntukbeberapalama.Padasuatu hari,setelahmerekaberpisahcukup lama, Leyangtsi datang ke rumah. Saat itu, istrinya sedang menenun kain. Melihat kedatangan yang tibatiba,sangistribertanyadengannada khawatir, apa yang membuatnya kembali sebelum waktunya. Leyangtsi menjawab, dirinya sangat sedihberpisahlamadenganistrinya, dan ia sangat merindukannya. Namun,sangistriternyatabereaksi kurang sesuai yang diharapkan. Bahkan, tanpa diduga, sang istri mengambil gunting dan langsung memotongkaintenunanyanghampirdiselesaikannya.“Akutahukamu memang mencintaiku, begitu juga sebaliknya. Tapi, seperti halnya kain ini,takakanmenjadikainyangindah jikaakutakmenyelesaikannya.Kalau hanya separuh saja, ini tak akan laku dijual atau tak akan bisa dipakai. Begitu juga denganmu. Saat kamu hanya menjalani setengahnya, ilmumu tak akan pernah cukup!” seru sang istri. Leyangtsi pun sadar, ada kepentinganyanglebihbesardaripadasekadar memenuhi rasa kangen pada istrinya. Maka, ia pun berjanji, baru akankembalisetelahmenyelesaikan masa belajar dan mencetak prestasi yang mengagumkan. Kisahtadimencerminkanbahwa pekerjaan apa pun yang kita mulai, harus kita tuntaskan, selesaikan dengan sebaik-baiknya. Maka jika kitahanyasetengah-setengahdalam berusaha tapi mengharapkan hasil palingmaksimal,tidakmungkinkita dapatkan! (int)

Sambungan Halaman 1 membicarakan soal pemberantasan buta aksara ini. Aliya Radjasa menunjukkan kepedulian untuk buta aksara. Aliya Radjasa menunjukkan kepedulian untuk buta aksara.

“UNESCO ini juga mengundang 18 negara di antaranya dari Asia, Afrika dan Australia untuk mengadakan forum untuk membicarakan hal ini. Nah di forum ini akan ada panel yang akan presentasi dari delegasi-delegasi negara masing-

masing dalam mengentaskan masalah buta aksara. Hasilnya nanti berupa butir-butir yang akan diserahkan ke dirjen di UNESCO,” ungkap Aliya yang ditemui usai acara. Sebanyak 18 negara turut serta dalam acara ini.Sebanyak 18 ne-

gara turut serta dalam acara ini. Keikutsertaan Aliya dalam acara seperti ini bukan hal baru bagi anak dari Hatta Radjasa yang merupakan Menteri Koordinator Bidang Perekonomian Republik Indonesia itu. Aliya sebelumnya turut aktif dalam Yayasan

Tunggadewi dan Satoe Indonesia yang juga bertujuan memberantas buta aksara. Dengandiadakannyaacarainidi Indonesia,Aliyaberharapnantinya Indonesiabakalmenjadiacuannegara lain sebagai negara yang peduli soal pemberantasan buta

2 Kritis, 8 Luka-Luka Tujuh Anak Selamat Sambungan Halaman 1 umpangKUPJ Tourkritis,delapan luka-lukalangsundilarikankeRSUD HAMS Kisaran. sementara, 7 penumpang anak-anak selamat tanpa mengalami luka apapun. Informasi dihimpun METRO ASAHAN (Grup METRO TABAGSEL) di lokasi kejadian dari beberapa warga, sebelum peristiwa terlihat Bus KUPJ Tour yang dikemudikan ImranNainggolan(36),melintasdari arah Rantauprapat menuju Medan.

Beberapa ratus meter dari lokasi kejadian, Bus KUPJ Tour sempat berhenti menaikkan penumpang. Selanjutnya, kembali melanjutkan perjalanan dengan kecepatan sedang. Tiba-tiba, bus yang dikemudikan Imran terlihat kehilang kendali dan mengambil jalan sedikit ke kanan, sehingga menabrak truk pembawa material bangunan yang dikemudikan Sutikno(44), yang melintas dari arah berlawanan. Warga yang melihat kejadian itu,

langsung berdatangan memberi pertolongan kepada para penumpang bus dan truk yang langsung dibawa ke RUSD HAMS Kisaran. Imran ketka ditemui saat menjalani perawatan, mengaku arus lalulintassaatitusedanglengang.Tibatiba, kemudi kendaraannya tidak bisa dikendalikan, sehingga laju bus tidak terkedali dan menabrak truk. “Itulah, aku pun tidak tahu mengapa bisa kehilangan kendali. Padahal, kecepatanku sedang hanya 60 KM per jam,” katanya sembari mer-

ingis kesakitan dan meminta agar peristiwa itu disampaikan kepada tokenya.“Tolonginformasikansama tokeku, kalau keluarga jangan dulu,” kata Imran. Pengakuan sama disampaikan Sutikno, dia menuturkan lalulintas lengang. Dia mengaku terkejut, ketika melihat bus dari arah berlawanankehilangankendalidanlangsung menabrak truk yang kemudikannya. “Bawamaterialbangunanmauke Pekanbaru. Saat tu, nggak sempat

banting setir, karena mendadak,” katanya. Pantuan METRO ASAHAN, para penumpangBusKUPJTourdirawat paramedis RSUD HAMS Kisaran mengalami luka-luka di tangan dan kaki. Dua penumpang terlihat kriris di ruang UGD. Terlihat juga, Imran dan Sutikno mengalami luka jahitan dan patah tulang pada kaki nya bersama dan sedangkan Sutikno. Sementara, 7 anak-anak penumpang bus yang selamat, duduk di teras rumah sakit

aksara.Denganbegitu,namaIndonesia akan harum di muka Internasional. “Jadi tujuan yang diinginkan, Indonesia jadi acuan dari negaranegara sekitar terutama yang diundang di acara ini. Kalau jadi acuan berarti kita mencontohkan yang baik kan. Buat mereka, jadi kita maju negara lain juga maju,” harapnya. (int) menungguorangtuanyayangmasih dirawat. Gasya salah seorang penumpang anak-anak, mengaku dia serta dua adiknya Ariya Sandika dan Mirja selamat dari peristiwa itu karena duduk di belakang bus bersama ayahya Endang Wahyudi. “Aku dan adikku selamat. Kami baru saja naik di Simpang Palang, beberapa puluh meter dari tempat naik, tiba-tiba terjadi kecelakaan. Padahal, bus tidak kencang Bang,” katanya. (sus/ck3)

Omak Kena Stroke, Mau Nangis Rasanya Tiga Bulan Gak Dijenguk… Sambungan Halaman 1 AKHIRNYA Huala ditangkap dan dibawa ke RSUD Kota Padangsidimpuan untuk diobati luka tembak yang mengenai betis kiri dan menembus pahanya itu. Sedihnya lagi, setelah kondisi Huala membaik, Tapsel pun menetapka Huala bersama para korban lainnya menjadi tersangka. Katanya, itu sesuai hasil penyelidikan dan pemeriksaan polisi. Dan, jadilah Huala tahanan satu-satunya yang masih berstatus anak-anak pada saat kejadian itu. Kemudian hakim memutuskan vonis enam bulan

penjara untuknya atas perbuatan yang menurutnya sama sekali tidak pernah diperbuatnya itu. “Vonisku 6 bulan bang. Sampai sekarang aku sudah menjalani hukuman selama 5 bulan,” ucap Huala. Selanjutnya, Huala menceritakan bagaimana ia menjalani kehidupannya. Seumur hidupnya, baru kali ini ia merasakan bagaimana kehidupan di dalam lapas tersebut. “Enggak pernah aku ingin masuk ke dalam sini Bang. Tapi entah kenapa hukum dan keadilan itu tidak ada. Mungkin karena saya orang susah dan tidak punya apa-apa makanya dengan

mudah bisa masuk ke mari,” keluhnya. Di dalam lapas, sambung Huala, ia ditempatkan bersama napi anak lainnya. Huala mengaku, kehidupan di dalam lapas sangat keras. Siapa yang kuat dia yang berkuasa. Walaupun umurnya tergolong masih anakanak, tak jarang ia juga bergabung dengan penghuni yang usianya terpaut jauh darinya. “Cukup kejam di dalam sini Bang. Biarpun saya digabung dengan yang statusnya anakanak, sering juga kami kumpul sama yang lebih tua. Kalau di sini itu, siapa yang kuat dia yang jadi bosnya,” ungkap Huala.

Lalu yang membuat hati Huala sedih, adalah saat mengetahui ibunya sedang sakit stroke. Dan, sudah hampir tiga bulan Huala tidak pernah dikunjungi keluarga. Ia teringat, biasanya ketika ibu sakit, meskipun sang Ayah masih ada, ia selalu membantu ekonomi keluarganya dengan mencari kayu di kebun dan menjualnya. Uang hasil penjualan kayu itu dibuatnya untuk menghidupi kehidupan mereka sehari-hari. Tapi kini, semua itu hanya tinggal kenangan saja. Kini, hanya bapaknya saja yang sanggup bekerja untuk membiayai kehidupan mereka.

“Sudah hampir 3 bulan omak sakit. Katanya kena stroke, mungkin karena itu belum ada yang datang melihatku sampai sekarang. Sedihlah Bang, apalagi melihat kawan-kawan saat saudaranya menjenguk. Mau nangis rasanya, tapi mau bagaimana lagi, ya... beginilah,” tuturnya. Hingga kemarin, Huala sudah menjalani hukuman kurang lebih selama 5 bulan, sedangkan vonis yang diberikannya adalah selama 6 bulan. Masih ada waktu sebulan lagi untuk Huala menjalani kehidupannya di dalam Lapas Salambue. Ia berharap, jika bebas nanti, ingin langsung bertemu dengan kedua

orangtuanya. Huala juga berniat memperbaiki kehidupannnya dan keluarga untuk menjadi lebih baik lagi. Biarlah apa yang sudah dialami dan dirasakannya menjadi pengalaman yang paling berharga dalam hidupnya. Semoga kelak tidak dirasakannya kembali. “Jadi cukup ini yang pertama dan terakhir Bang, enggak mau aku lagi masuk ke mari. Mudahmudahan bulan depan aku sudaah bisa berkumpul bersama keluargaku kembali,” harapnya. (bersambung)



22 Agusuts 2013



„ Kepala Badan Ketahan Pangan Kota Psp HM Soleh Nasution SP dan Kabid SDM Indra Gunawan Harahap, melakukan penanaman perdana padi jenis mikongga dengan sistem jajar legowo 4:1.


Hasilkan Bibit Unggul Varietas Mikongga SIDIMPUAN- Badan Ketahan Pangan Padangsidimpuan melakukan penanaman perdana padi sistem jajar legowo 4:1 variteas mikongga, Selasa

(20/8) di lahan pertanian warga Kelurahan Sabungan Jae, Psp Hutaimbaru. Pemilihan varietas ini bertujuan untuk mendapatkan bibit unggul pada

TAPSEL- Ketua Komisi III DPRD Tapsel H Mahmud Lubis mengaku kecewa terhadap kepala desa di Kecamatan Muara Batangtoru yang menandatangani perubahan nota kesepahaman yang diberikan PT AR (Agincourt Resources). Padahal, perusahaan tambang emas itu belum menyelesaikan pemasangan pipa yang tercantum pada nota kesepahaman tertanggal 22 September 2012.


emikian disampaikan H Mahmud Lubis, Rabu (21/8). Dia menambahkan, walau belum ada persetujuan dari masyarakat atau rapat desa, Kepala Desa di Kecamatan Batangtoru sudah menandatangani perubahan nota kesepahaman. Hal ini terjadi disebabkan

karena PT AR diduga telah menghasut Pemkab Tapsel untuk membujuk kepala desa di Muara Batangtoru agar bersedia menandatangani perubahan nota kesepahaman yang diberikan. Selanjutnya, sikap kepala desa

„) Baca Kecewa....Hal 7


Pererat Silaturahmi dengan Pendamping Pedagang

turunannya. Kepala Badan Ketahanan Pangan (Ketapang) HM Soleh

„) Baca Hasilkan....Hal 7


„ Seorang warga sedang berjalan di lokasi pembangunan jalan menuju kantor BP2KP Tapsel di Sipirok yang tidak memasang plang.

SIDIMPUAN- Persatuan Pedagang Makanan dan Minuman Tugu Salak mengadakan Halal Bihalal di Tugu Salak Kota Psp, Rabu (21/8). Tujuannya untuk memper-

erat hubungan silaturrahmi antara sesama pedagang dan pendamping persatuan pedagang.

„) Baca Pererat....Hal 7


Tanpa Plang Proyek SIPIROK- Pengerjaan pembangunan jalan menuju Kantor BP2KP Tapsel di kawasan Sipirok tanpa plang. Beberapa warga pun mengaku heran, meski aktivitas pembuatan parit dan bahan material untuk perbaikan jalan sudah berada di lokasi. Diketahui sebelumnya, pemerintah Kabupaten Tapsel bela-

kangan terus mengupayakan peningkatan pelayanan masyarakat melalui berbagai aspek pembangunan. Salah satunya pembangunan infrastruktur jalan. Untuk anggaran 2013, salah satu ruas jalan yang mendapat perhatian pembangunan adalah jalan

„) Baca Tanpa....Hal 7


„ Persatuan Pedagang Makanan dan Minuman Tugu Salak, foto bersama dengan para pendamping, yaitu ICMI, Peksos, dan KAHMI, usai halal bihalal.

Pemko Psp Raih Predikat WDP dari BPK SIDIMPUAN- Pemko Psp meraih predikat Wajar Dengan Pengecualian (WDP) yang diberikan BPK RI Perwakilan Provinsi Sumatera Utara terkait Laporan

Hasil Pemeriksaan (LHP) atas laporan keuangan Pemko Psp Tahun Anggaran (TA) 2012.

„) Baca Pemko....Hal 7

Panen Perdana Padi Jenis VUB di Batang Angkola

Hasilkan 8,1 Ton per Hektare TAPSEL- Pemerintah Kabupaten Tapsel menggelar panen perdana padi jenis Varietas Unggul Baru (VUB) di Saba Bobaran,

Kelurahan Pintu Padang II, Kecamatan Batang Angkola, Tapsel,

„) Baca Hasilkan....Hal 7

KAMIS 22 Agustus 2013

Bachrum-Riskon Resmi Bupati & Wabup Terpilih BARIS Diharap Wujudkan Provinsi Sumatera Tenggara

PALUTA-KPU Paluta secara resmi menetapkan pasangan Drs H Bachrum Harahap-H Riskon Hasibuan SE ini menjadi Bupati dan Wakil Bupati Paluta terpilih periode 2013-2018 dalam rapat pleno KPU di Aula Hotel Mitra, Rabu (21/8).

„ Bachrum Harahap

Rapat pleno dipimpin Ketua KPU M Ali Ansor Siregar dihadiri seluruh anggota KPU yaitu Ongkusyah Harahap, Nasir Harahap, Muhammad Aman Siregar, Drs Safri Siregar menetapkan Bachrum HarahapRiskon Hasibuan sebagai Bupati dan Wakil Bupati Paluta terpilih Kabupaten Paluta pa-

‹ ‹ Baca Bachrum ...Hal 10


„ Pelaksanaan rapat pleno rekapitulasi hasil penghitungan suara, penetapan dan pengumuman pasangan calon terpilih hasil pilkada Bupati dan Wakil Bupati Paluta, Rabu (21/8) di Aula Hotel Mitra, Gunung Tua.

SAMPAI yang Terbaik untuk Pimpin Palas PALAS-Parsadaan Marga Lubis (PML) Kabupaten Palas siap mendukung dan memenangkan pasangan DR H Sarmadan Hasibuan SH MM-H Paisal (SAMPAI) dengan no-

mor urut 1 pada Pemilukada Palas 11 September mendatang. PML yang bertempat di Jalan Gunung Tua Sibuhuan Julu tersebut juga siap menyo-

„ Riskon Hasibuan

sialisasikan kepada seluruh kader dan masyarakat Palas untuk bersama-sama memenangkan SAMPAI. Demikian disampaikan Ketua PML Kabupaten Palas Mu-

‹ ‹ Baca Baris ...Hal 10

Pembangunan Desa Ladang Ganja Dimulai

nawar Kholil Lubis didampingi Sekretaris Iddam Lubis kepada METRO, Rabu (21/8). Dikatakannya, alasan utama

‹ ‹ Baca SAMPAI ...Hal 10

PALUTA-Relawan Bachrum-Riskon Ok (BRO) mengucapkan rasa syukur atas ditetapkannya pasangan incumbent BARIS oleh KPU Kabupaten Padang Lawas Utara (Paluta) sebagai bupati dan wakil bupati terpilih.

„ Munawar Kholil Lubis

Ditemukan 29 Ribu DPT Bermasalah

MADINA-Pembangunan fasilitas umum sejumlah desa di sekitar To Sihite atau dikenal dengan ladang ganja di Kecamatan Panyabungan Timur Kabupaten Mandailing Natal (Madina) dari bantuan community development PT Perta-

mina akan dimulai. Proses pembangunannya akan melibatkan masyarakat setempat. Demikian disampaikan Kepala Badan Narkotika Nasional

‹ ‹ Baca Pembangunan ...Hal 10

Tiga Pasangan Cabup Taput Datangi Kantor KPU

TARUTUNG-Tiga pasangan calon bupati dan wakil Bupati (cabup dan cawabup) Taput, menemukan sekitar 29.545 DPT (Daftar Pemilih Tetap) bermasalah. Tiga pasangan itu masing-masing, pasangan nomor urut 1 Sanggam Hutagalung-Sahat Sinaga (Sahata),

nomor urut 3 Bangkit SilabanDavid PPH Hutabarat (Badia) dan pasangan nomor urut 6 Banjir Simajuntak-Maruhum Situmeang (Banjirma). Penemuan itu berdasarkan penelitian masing-masing tim

‹ ‹ Baca Ditemukan ...Hal 10

NGO Soroti Keterlibatan PNS KALANGAN aktifis organisasi non pemerintah atau NGO (Non Government Organization) Terhadap Pilkada Jujur menyoroti adanya keterlibatan para pejabat dan kalangan pegawai negeri sipil (PNS) secara aktif maupun

pasif untuk memenangkan pasangan tertentu terutama ‘incumbent’ pada pemilukada yang akan dilaksanakan hampir serentak di tujuh kabupaten di Sumut pada September dan Oktober 2013 mendatang. Padahal menurut para

aktifis itu, aturan main tentang larangan keterlibatan PNS dan para pejabat negara itu telah diatur antara lain di UU No 32 Tahun 2004 Tentang Pemilu, UU No 43 Tahun 1999 tentang


„ Jalan Surapati yang masih beralaskan batu yang selalu menimbulkan debu tebal yang mengakibatkan jarak pandang sehingga pengendara harus berhati-hati, Rabu (21/8).

Hati-hati Melintas di Jalan Surapati PALAS-Sejak lama kondisi Jalan Surapati tepatnya simpang empat menuju Banjar Raja Hapung Pasar Sibuhuan sangat memprihatinkan. Pasalnya jalan di pusat kota tersebut rusak dan belum kun-

jung diperbaiki. Sehingga kepada setiap warga yang melintas diharapkan lebih berhatihati. Sofyan Lubis warga Sibu-

‹ ‹ Baca Hati-hati ...Hal 10

‹ ‹ Baca NGO ...Hal 10


Siapkan “Serangan Udara” BANDUNG-Calon presiden Republik Indonesia sekaligus Ketua Umum Partai Hati Nurani Rakyat (Hanura) Jenderal TNI (Purn) Wiranto menyatakan bahwa “serangan udara” adalah salah satu senjata yang tak kalah penting untuk mengantarkannya ke Istana Negara bersama calon wakil presiden Hary

‹ ‹ Baca Siapkan ...Hal 10


„ Timsel saat menyampaikan keterangan pers usai menutup pendaftaran calon anggota KPU Taput.

35 PPelamar elamar Berebut 5 Kursi Komisioner KPU TTaput aput

„ Calon presiden dan wakil presiden yang diusung Partai Hanura Wiranto (kiri) dan Hary Tanoesoedibjo saat acara deklarasi capres-cawapres dari Partai Hanura di Jakarta.

TAPUT-Sebanyak 35 orang yang berasal dari berbagai profesi dan pekerjaan akan mengikuti seleksi untuk merebut 5 kursi komisioner Komisi Pemilihan Umum (KPU) Taput masa periode 2013 -2018.

Sebelumnya tim seleksi calon anggota KPU Taput telah membuka pendaftaran penerimaan calon anggota KPU di kantornya yang terletak di Ja-

‹ ‹ Baca 35 Pelamar ...Hal 10


22 Agustus 2013

Pembangunan Desa Ladang Ganja Dimulai Sambungan Halaman 9 (BNN) Kabupaten Madina, AKBP Eddy Mashuri SH MH kepada wartawan, Rabu (21/8). Dikatakan Eddy, dalam tahun ini diupayakan proses pembangunan fasilitas umum di beberapa desa sekitar tor Sihite akan dilaksanakan, dalam rangka pengalihan lahan ganja ke tanaman holtikultura dan sayuran. “Jika tidak ada kendala tahun ini akan dimulai proses pembangunannya. Ini berkat bantuan dana Community Development dari PT Pertamina, sebagai masyarakat Madina kita selayaknya bersyukur atas bantuan dana ini,” ucap Eddy. Dan dalam proses pembangunannya, sambung Eddy. Masyarakat setempat bagi yang mau bekerja akan diikutsertakan. “Bagi warga yang mau bekerja, nanti bisa dilibatkan,” tambahnya. Dijelaskan Eddy, Pertamina berencana mewujudkan pembangunan fasilitas umum melalui dana Corporate Sosial Responsibility (CSR) dari perusahaan di bawah Kementerian BUMN itu. Rencana bantuan yang akan diberikan berupa pembangunan jalan setapak, MCK, mushalla, sarana pendukung pendidikan, puskesmas dan bangunan lain yang dibutuhkan masyarakat. “Bantuan yang akan disalurkan Pertamina berdasarkan skala prioritas. Artinya, apa kebutuhan prioritas masyarakat, maka itu yang didahulukan, dan pihak Pertamina sendiri sebelumnya sudah melakukan survey ke beberapa desa dalam beberapa

bulan belakangan ini. Bahkan salah seorang Deputi PT Pertamina pusat, Wahyu sudah pernah datang bertemu langsung dengan warga Panyabungan Timur. Ini merupakan anugerah bagi masyarakat Madina. Semoga dengan adanya bantuan pembangunan dari dana CSR PT Pertamina masyarakat lebih sejahtera, karena selama ini keluhan masyarakatbahwahasilbumidariPanyabungan Timur harganya sangat jauh berbeda dibandingkan daerah lain di Madina. Itu disebabkan fasilitas infrastruktur yang tidak mendukung,” jelasnya. BNN dalam hal ini, kata Eddy, akan membantu pengalihan lahan ganja, seperti memberikan bibit tanaman holtikultura berupa sayur mayur, buah-buahan dan sebagainya untuk ditanam di areal ladang ganja yang ditemukan selama ini. Karena kebutuhan sayur dan buah di Madina sendiri masih banyak didatangkan dari luar daerah,” tambahnya. Eddy berharap, seluruh elemen masyarakat, khususnya kepada Pemerintah Kabupaten Madina mendukung program yang akan direalisasikan BNN tersebut. BNN akan terus berupaya mencari alternatif development dengan mendekati perusahaan-perusahaan besar di nusantara agar bisa membantu mensejahterakan masyarakat Panyabungan Timur yang jauh tertinggal dibandingkan dengan desa lainnya. Sebab masyarakat masih sulit untuk memeroleh pendidikan dan layanan kesehatan. (wan)

Hati-hati Melintas di Jalan Surapati Sambungan Halaman 9 huan kepada METRO, Rabu (21/ 8) yang sering melintasi jalan tersebut merasa terganggu dengan kondisi jalan yang masih bebatuan. Hal ini juga diperparah ketika cuaca terik akan menimbulkan debu tebal, sehingga dikhawatirkan mengakibatkan penyakit. Sedangkan ketika cuaca hujan jalan akan berubah menjadi becek yang sangat menyulitkan pengendara untuk melintas. “Jadi bukan hal luar biasa jika jalan ini sering memicu kemacetan disini karena pengendara juga harus pelan-pelan ketika lewat, belum lagi kenderaan yang parkir dikiri dan kanan jalan menambhak sumpek jalan ini,” ungkap Sofyan. Hal senada juga disebutkan B Hasibuan salah satu parbecak yang sering mangkal di jalan tersebut mengatakan, kemacetan

juga diakibatkan truk translit barang ke toko-toko sekitar, sehingga jalan semakin sempit dan berabu. Dan terkadang para pemilik toko disepanjang jalan rusak dan penuh debu tersebut harus rela menyiram jalan setiap kali. Sebab debu tebal itu sangat mengganggu pada dagangan juga jarak pandang yang terbatas. “Sedangkan pengendara sepeda motor terpaksa harus menutup hidung dan mulut, dan kalau perlu pakai masker karena debu tebal yang ditimbulkan, oleh sebab itu pengendara harus berhati-hati ketika melintasi jalan Surapati ini,” ujarnya. Amatan METRO, Rabu (21/8) kondisi jalan sekitar Seratus Meter mulai dari simpang empat Pasar Sibuhuan masih beralaskan batu kerikil. Debu tebal senantiasa menghiasi jalan ini baik siang dan malam. (tan)

35 PPelamar elamar Berebut 5 Kursi Komisioner KPU TTaput aput Sambungan Halaman 9 lan Balige, Tarutung, sejak Kamis (15/8) dan ditutup Rabu (21/8). Sekretaris Timsel (tim seleksi) KPU Taput Delima Silalahi dan dua anggota Hulman Sihombing serta Samsul Pandiangan, Rabu (21/8) mengatakan, sejak pihaknya membuka pendaftaran, sebanyak 67 orang telah mengambil formulir pendaftaran ke kantor timsel. Namun hingga hari terakhir tepatnya pukul 16.00 WIB, tercatat hanya 35 orang pelamar yang mengembalikan berkasnya. “Yang memasukkan berkas lamaran pendafataran calon anggota KPU Taput tercatat sebanyak 35 orang. Kita akan melakukan seleksi administrasi untuk kemudian akan mengumumkan nama-namanya,” ujarnya. Diterangkan Delima, dari buku pendaftaran ditemukan sejumlah nama-nama yang berasal dari berbagai profesi maupun pekerjaan. Di antara DIBUTUHKAN: Wanita gadis/janda untuk disalurkan menjadi baby sitter, kakak asuh & perawat orang tua, gaji 1Jt s/d 1,5Jt. Hub: Yayasan Sepa Husada Jl. Notes No. 65 HP. 0852 6114 3441, 0812 1952 9316

yang memasukkan berkas pendafataran tersebut, katanya, ada 4 anggota KPU Taput saat ini yang mencalonkan kembali. “Ada pelamar yang berprofesi sebagai guru, dosen, pengacara, wartawan dan juga dari wiraswasta. Kita akan melakukan seleksi administrasi kepada 35 pelamar, melakukan tes kesehatan, tes psikologis dan tes tertulis serta wawancara.Untuk kemudian menetapkan siapa yang masuk 10 besar dan akan kita kirim ke KPU Sumut. Oleh KPU Sumut akan melakukan uji kelayakan dan kepatutan hingga akhirnya memilih lima besar yang akan ditetapan menjadi lima komisioner KPU Taput periode 2013 -2018,” paparnya. Pantauan METRO, di hari terakhir pendafataran, kantor timsel disesaki oleh puluhan pelamar yang ingin memasukkan berkasnya. Bahkan terlihat juga beberapa pelamar yang harus putar haluan karena tidak diterima oleh timsel dengan alasan sudah melewati batas waktu. Dimana timsel sudah mengumumkan penutupan pendaftaran pada Rabu (21/8) pukul 16.00 WIB.(Cr-02/cr-01/nasa)

Bachrum-Riskon Resmi Bupati & Wabup Terpilih Sambungan Halaman 9 da Pemilukada tanggal 14 Agustus 2013 dengan perolehan suara sah sebanyak 78.106 atau setara dengan 64,03 persen dari jumlah suara sah pemilukada Tahun 2013 sebanyak 121.990. Masih menurut keputusan KPU, perolehan suara pasangan calon incumbent nomor urut 4 ini telah memeroleh suara lebih dari 30 persen dari jumlah suara sah. Dan perolehan suaranya terbesar diantara pasangan calon lainnya. Pasangan ini selanjutnya ditetapkan sebagai pasangan bupati dan wakil bupati terpilih.

Sementara perolehan suara yang diraih 4 pasangan calon bupati dan wakil bupati lainnya, pasangan Syah-Unggul meraih 28.321 suara atau sekitar 23,22 persen, pasangan Sutan-Zul meraih 10.570 suara atau sekitar 8,66 persen, pasangan RADAR meraih 3.062 suara atau sekitar 2,51 persen dan terakhir pasangan independent RAMAH meraih 1.931 suara atau sekitar 1,58 persen. Ketua KPU M Ali Ansor Siregar dalam sambutannya mengatakan, dengan penetapan KPU Paluta terhadap hasil pilkada ini, maka Kabupaten Paluta telah

memiliki pemimpin baru. “Banyak hal yang patut kita apresiasi dari warga, terutama partisipasi warga dalam memberikan hak suaranya. Penetapan KPU terhadap Bupati dan Wakil Bupati terpilih Kabupaten Paluta semoga dapat diterima semua pihak,” ujarnya. Ketua Pokja Ongkusyah Harahap mengatakan, angka partisipasi pemilih di Kabupaten Paluta mencapai 83 persen dengan suara sah 121.990 atau sekitar 97,69 persen dan suara tidak sah 2.900 atau sekitar 2,32 persen. Hadir dalam kesempatan

BARIS Diharap Wujudkan Provinsi Sumatera Tenggara Sambungan Halaman 9 Namun dibalik itu semua ada harapan besar yang dibebankan di pundak pasangan ini, terkhusus tokoh pemekaran Paluta yakni Bupati Paluta Drs Bachrum Harahap untuk terus mewujudkan mimpi dan asa dan berupaya melakukan gebrakan agar Provinsi Sumatera Tenggara terbentuk. Pengurus relawan BRO, Asmar Ismail Siregar, Doli Siregar SH, Pahrur Roji Harahap, Yusuf Siregar, Andi Siregar, BP Pohan, HS Hasibuan dan lainnya mengucap rasa syukur sesaat setelah KPU Paluta menetapkan BARIS sebagai pasangan bupati dan wakil bupati terpilih. “Sebenarnya hal yang wajar dalam kemenangan pasangan BARIS di pilkada ini. Bukan apaapa, namun karena masyarakat

Paluta masih menaruh dan memberikan kepercayaan kepada pasangan BARIS untuk terus melanjutkan pembangunan di Paluta ini, baik infrastruktur, kesehatan, pendidikan, ekonomis, sosial budaya, keagamaan dan lainnya,” tutur mereka, Rabu (21/8). Bahcrum Harahap merupakan satu tokoh senior perpolitikan di Tabagsel saat ini dan sudah kenyang asam garam dunia perpolitikan dan memiliki pengaruh yang luas. Ini dibuktikannya saat menjadi salah satu pelopor pemekaran Tapsel lama saat menjabat sebagai Ketua DPRD Tapsel dua periode. Dengan latar belakang tersebut, ayahanda Walikota Psp Andar Amin Harahap ini juga merupakan salah satu penggerak dan pencetus pembentukan

Provinsi Sumatera Tenggara yang meliputi wilayah Tapsel lama. “Kita ingin terus maju dan berkembang. Makanya kita juga menaruh harapan besar khususnya sebagai tokoh senior di Tabagsel yang kita yakin mampu bersama dengan daerah lainnya untuk bergerak terus mengupayakan pembentukan Provinsi Sumatera Tenggara. Apalagi ini terus didengungkan Bachrum Harahap dalam setiap kesempatan kepada masyarakat. Dengan kembali terpilihnya Bachrum Harahap sebagai Bupati Paluta besar harapan kita ini semua bakal segera dan bisa terwujud secepatnya. Kepada seluruh masyarakat Paluta kami haturkan ucapan terima kasih yang tak terhingga. Mari bergandeng tangan bersama kita bangun Paluta yang kita cintai ini,” harap mereka. (phn)

tersebut Kapolres Tapsel AKBP Abdul Rijal Engahu SIK MSi, Kajari Psp, perwakilan Dandim dan Danyon, Ketua Desk Pilkada Paluta yang juga Plt Sekda Paluta Drs Hailullah Harahap MM, saksi dari tim BARIS, 4 saksi pasangan calon lainnya tidak hadir, Panwas Paluta dan kecamatan, PPK dari 9 kecamatan. Rapat pleno KPU yang mendapat penjagaan dari personil Polres Tapsel dan Polsek

Padang Bolak berjalan dengan aman, lancar dan kondusif. Terkait ketidakhadiran para saksi dari 4 pasangan calon lainnya, Ongkusyah Harahap menegaskan hal tersebut tidak masalah rapat pleno itu sah dan pihaknya menunggu selama 3 hari kerja untuk sanggahan. Dimana hari ini juga hasil rekapitulasi suara rapat pleno itu langsung dibawa ke Provsu. (phn)

SAMPAI yang Terbaik untuk Pimpin Palas Sambungan Halaman 9 PML menjatuhkan pilihan tepat terhadap pasangan SAMPAI bermula saat kedatangan kandidat ke hadapan pengurus PML guna bersilaturrahmi. Saat bersamaan para pengurus PML melalui ketua mempertanyakan hasrat dan niat kuat kandidat maju di Pilkada Palas. Melihat ketulusan hati Sarmadan yang penuh komitmen nyata untuk membangun Kabupaten Palas kedepan, maka segenap PML siap mendukung dan memenangkan pasangan ganteng ini. “Dasar kami mendukung SAMPAI dilihat dari niat dan komitmen yang nyata Sarmadan untuk membangun Palas yang lebih baik. Meski dari 6 kandidat semuanya baik, tapi menurut kami Sarmadan lah yang terbaik dari yang terbaik untuk memimpin Palas,” ucap Ketua yang akrab disapa Kholil ini. Selain itu, PML menjatuhkan hati memilih SAMPAI

dikarenakan Sarmadan merupakan baik di pendidikan dan berpengalaman. Dimana hal ini dinilai akan menunjang kepemimpinan Palas dimasa yang akan datang untuk menjadi kabupaten yang maju. Dengan kata lain secara umum akan meningkatkan taraf dunia pendidikan Palas yang berimbas pada peningkatan SDM. “Kami berharap agar kondisi Palas tidak terulang kembali seperti yang sudah lewat yang jauh dari harapan masyarakat,” imbuhnya. PML menaruh harapan besar kepada Sarmadan yang juga keluarga besar PML dari istri yang juga pengurus PML Kabupaten Palas saat ini, untuk dapat membawa perubahan yang lebih baik. Pencerdasan terhadap masyarakat dan bukan pembodohan. Dan sejak dibentuknya PML Palas pada tahun 2005 hingga kini telah mempunyai keanggotaan sebanyak 7.000-an massa yang tersebar di seluruh Kecamatan Palas. (tan)

Ditemukan 29 Ribu DPT Bermasalah Sambungan Halaman 9 pemenangan yang bertugas mencermati DPT Pilkada Taput 2013. Atas temuam tersebut, ketiga pasangan calon ini kemudian menyampaikan salinan DPT yang bermasalah tersebut ke kantor Komisi Pemilihan Umum (KPU) Taput, sebagai bentuk keberatan dan protes mereka atas DPT tersebut. Mereka meminta KPU untuk segera merevisi dan membenahi DPT yang bermasalah tersebut. “Berdasarakan hasil penelitian

kami di lapangan, ditemukan sebanyak 29.545 orang pemilih yang terdaftar dalan DPT Pilkada Taput tidak memiliki nomor induk pemilih dan nomor induk kependudukan (NIK). Bahkan orang yang sudah tujuh tahun meninggal pun masih tercatat di dalam DPT,” kata Ketua Tim Pemenangan Pasangan Banjirma, Tota Situmeang, Rabu (21/8). Tota juga mengaku salinan temuan itu sudah disampaikan ke KPU Taput untuk diperbaiki. “Berdasarkan peraturan KPU nomor 12 tahun 2010 tentang pedoman tata cara pemutakhiran

data dan daftar pemilih, penyelenggara pemilu harus berpedoman kepada asas mandiri, jujur, adil, kepastian hukum, tertib, akuntabilitas, efesiensi dan efektifitas. Berdasarkan peraturan KPU nomor 12 itu seharusnya DPT sudah lebih terinci dan valid,” ucapnya. Untuk itu kata Tota, KPU Taput diminta untuk memperbaiki DPT Pilkada Taput 2013. “Kami minta KPU untuk memperbaiki DPT Pilkada Taput ini, sebab kita khawatir DPT yang bermasalah ini nantinya akan menghasilkan masalah dan

konflik bahkan bisa disalahgunakan. Kalau DPT bermasalah, sengketa pilkada besar peluangnya terjadi,” terangnya. Menanggapi temuan ketiga pasangan Cabup Taput tersebut, pihak KPU Taput mengaku akan melakukan verifikasi ulang. “Memang benar ada tiga pasangan Cabup Taput menyampaikan 29 ribu lebih salinan DPT ke kita. Menurut mereka bermasalah. Untuk memperbaikinya kami akan melakukan pemuktahiran ulang, dan masalah ini pun sudah kami bahas dengan para pasangan

calon,” ucapnya. Untuk diketahui, jumlah DPT pada Pilkada Taput pada 10 Oktober 2013 mendatang tercatat sebanyak 200.782 pemilih. Pemilih yang ditetapkan itu tersebar di 15 kecamatan dengan jumlah TPS (Tempat Pemungutan Suara) sebanyak 627. Pemilih terdiri atas 97.709 laki-laki dan 103.073 perempuan. Jumlah ini mengalami penurunan sebesar 17.445 dari 218.227 pemilih yang tercatat sebelumnya di Daftar Penduduk Potensial Pemilih Pemilu (DP4). (cr-01/nasa)

NGO Soroti Keterlibatan PNS Sambungan Halaman 9 Perubahan Atas UU No 8 Tahun 1974 tentang Pokok-Pokok Kepegawaian dan Peraturan Pemerintah (PP) No 53 Tahun 2010 tentang Disiplin PNS. Demikian disampaikan para aktifis tersebut, yang terdiri dari Direktur Eksekutif Elsaka (Lembaga Studi dan Advokasi Kebijakan) Effendi Panjaitan SE, Humala Tanjung SE Ak, dan David Pernando Nababan dari Somppur (Solidaritas Masyarakat Peduli Pilkada Jujur). Juga ada Ketua Forum Peduli Pilkada Bersih (FPPB) Tapanuli Utara Jan Sahan Pasaribu didampingi Sekretaris Amir Hutabarat, dan Bendahara Maju Marbun kepada wartawan di Medan, kemarin (21/8). “Menyikapi hal ini, seluruh PNS termasuk TNI dan Polri diingatkan untuk tidak terlibat kegiatan pemenangan pemilukada, apalagi ikut dalam tim sukses, karena sesuai UU Pemilu dan peraturan kepegawaian, yang bersangkutan akan mendapat sanksi atau hukuman berupa penundaan dan penurunan pangkat, pencopotan jabatan hingga

pemberhentian dari PNS,” kata Effendi Panjaitan, terkait adanya fenomena keterlibatan kalangan PNS dan para pejabat daerah di tujuh kabupaten Sumut yang akan melaksanakan pemilukada, termasuk Taput dan Dairi. Menurut Effendi Panjaitan dan Humala Tanjung, keterlibatan PNS dan kepala daerah langsung maupun tidak langsung, terbukti berperan besar dalam kemenangan calon tertentu di sejumlah pemilukada di Indonesia termasuk di Sumatera Utara. “Menjelang pemilukada di tujuh kabupaten di Sumut yang hampir serentak digelar bulan September dan Oktober mendatang yaitu Langkat, Deli Serdang, Dairi, Tapanuli Utara, Padang Lawas, Kabupaten Batubara, dan Padang Lawas Utara, fenomena itu juga makin kentara terlihat terutama di Taput dan Kabupaten Dairi,” tandas Humala. FPPB, timpal Maju Marbun, mengamati langsung adanya keterlibatan kepala daerah menyosialisasikan calon tertentu yang maju pada pemilukada di Taput baik melalui pajangan baliho dan menggalang PNS. “Yang paling kentara, satu calon diperkenalkan di acara-

acara pemerintahan yang dihadiri masyarakat. Itu sudah jelas penggunaan uang negara untuk pemenangan calon tertentu. Hampir seluruh masyarakat juga tahu kendaraan dinas pemerintahan pun ramai berderet untuk kegiatan sosialisasi calon tertentu walaupun plat merahnya diganti jadi plat hitam. Itu sudah kita rekam dan didata. Hal itu juga sudah kita laporkan ke Panwaslu kemarin supaya bertindak,” jelas Marbun. Somppur juga melihat pelibatan aparatur pemda melalui “gerakan bawah tanah” seperti itu juga terjadi di Kabupaten Dairi yang sering memanfaatkan acara-acara Pemkab untuk sosialisasi. Menurut Panjaitan, dalam PP No 53 Tahun 2010 tentang Disiplin PNS jelas dipaparkan bentuk keterlibatan atau dukungan aparatur pemerintah dan PNS yang dilarang itu meliputi terlibat dalam kegiatan kampanye, menggunakan fasilitas pemerintahan dan jabatan, membuat keputusan dan/atau tindakan yang menguntungkan atau merugikan salah satu pasangan calon selama masa kampanye, mengadakan kegiatan yang

mengarah kepada keberpihakan terhadap pasangan calon yang menjadi peserta pemilukada baik sebelum, selama dan sesudah masa kampanye meliputi perte-

muan, ajakan, himbauan, seruan atau pemberian barang kepada PNS dalam lingkungan kerjanya, anggota keluarga dan masyarakat. (cr-01/sor/pmg)

Siapkan “Serangan Udara” Sambungan Halaman 9 Tanoesudibjo. Serangan udara yang dimaksud Wiranto dan Hari Tanoe (Win-HT) adalah kampanye melalui sejumlah media massa, seperti media online, radio, cetak, dan televisi, mengingat HT adalah bos media MNC Group. “Wajah kita yang serius nanti itu. Ini namanya ‘serangan udara’. Kita bersyukur cawapres kita punya pesawat udara yang bisa dimanfaatkan untuk ‘mengebom’,” kata Wiranto dalam sambutannya di depan ratusan kader Partai Hanura di Hotel Horison, Jalan Pelajar Pejuang, Bandung, Jawa Barat, Rabu (21/8). Hal itu pun, kata Wiranto, sangat menguntungkan para caleg yang maju dari Partai Hanura. “Saya kira banyak hal yang diuntungkan menjadi caleg dari Partai Hanura,” katanya. Sementara itu, HT mengatakan, dirinya yang ditunjuk sebagai Ketua

Badan Pemenangan Pemilu (Bapilu) Hanura akan menyediakan semaksimal mungkin sarana kampanye dalam bentuk tiga media. “Saya ingin sampaikan tiga, yaitu MNC, Global, dan RCTI, audiensnya lebih dari 40 persen, bahkan pada acara-acara tertentu bisa mencapai 50-60 persen atau lebih. Jika programnya bagus, misalnya seperti ketika itu pertandingan di SEA Games antara Indonesia vesus Malaysia bisa mencapai 93 persen atau lebih. Tentu ini menjadi modal yang sangat besar,” katanya. Menurutnya, iklan pasangan Win-HT akan besar-besaran menjelang Pilpres 2014 nanti. Tentu saja, kata HT, iklan di televisi yang paling dominan, selebihnya iklan di media online, cetak, radio, dan ada juga sarana lainnya seperti billboard. Menurutnya, pemberitaan di media online juga penting, mengingat pembacanya adalah kawula muda. (kps/int)


Pernahkah Anda merasa terbatasi karena sikap mertua yang terlalu over protektif? Tentu ini membuat Anda merasa jengkel. Anda dan pasangan yang masih tinggal satu atap bersama mertua, membuat sebagian kecil pasangan tidak nyaman dengan sikap mertua yang protektif. MEMANG hidup satu atap bersama mertua, kita harus bisa mengikuti aturan yang ada di rumah tersebut. Namun bagaimana menghadapi mertua yang terlalu protektif. Berikut beberapa saran umum agar menjaga hubungan Anda dengan mertua yang protektif: 1. Menuruti segala aturan rumah yang berlaku, sebagai orang yang masih

menumpang hidup bersama mertua Anda tidak memiliki wewenang besar. Lain hal jika Anda yang memiliki rumah sendiri. 2. Jangan terlau ikut campur dengan masalah keluarga yang tengah melanda, ini untuk menghindari kesalah pahaman Anda dengan mertua. 3. Jadikan sikap ke protektifannya sebagai pembelajaran bagi Anda.

4. Jika memang sebuah tindakan Anda yang menurut Anda baik, dan ditentang oleh mertua. Anda bisa menjelaskan dan memberikan pemahaman, agar tidak terjadi kesalah pahaman. 5. Bila ada sebuah omongan yang ingin Anda bicarakan kepada mertua, sebaiknya jangan langsung berbicara ajak pasangan untuk membicarakan hal yang ingin disampaikan. Karena biasanya

mertua lebih mengerti dengan apa yang dibicarakan oleh anak kandungnya sendiri. Menjalin hubungan harmonis dengan mertua kunci suksesnya ialah mengikuti aturan yang berlaku. Karena biasanya sebelum Anda dan pasangan memutuskan untuk menikah, sudah berkomitmen untuk menerima segala kekurangan dari pasangan serta keluarganya. (int)

Ajarkan Anak Menabung Sejak Dini Menabung sejak usia dini memberi manfaat yang positif pada anak. Baik untuk hari ini maupun di kemudian hari. Kenapa mengajak anak untuk menabung menjadi penting? Menurut psikolog Ratih Ibrahim, mengajarkan anak menabung sejak usia dini bermanfaat untuk pembentukan karakternya. Secara luas, masyarakat dunia berubah dengan cepat dan dinamis, karena itu kita butuh sumber daya yang berkompeten. Dengan menabung, berarti kita memfasilitasi perkembangan seluruh aspek

kecerdasan anak. “Saat menabung, anak mulai mengenal angka, belajar menahan diri, dan memahami mana

yang jadi prioritas,” ujar psikolog yang juga pendiri Personal Growth ini, saat talkshow bersama CIMB Niaga di SME Tower, Jakarta, kemarin. Banyak yang beranggapan tidak baik untuk mengenalkan uang pada anak, karena anak dikhawatirkan akan menjadi konsumtif atau mata duitan. Namun, kata Ratih, mengenalkan anak sejak dini pada uang justru mengajak mereka menghargai uang. Selain itu mereka juga sekaligus belajar berhitung dari nominalnya. Pengenalan uang bisa dilakukan pada saat anak berusia satu sampai tiga tahun. Lalu menanamkan perilaku menabung dengan menggunakan celengan, untuk uang koin dan uang kertas. Baru pada usia enam tahun atau ketika mereka menjejak bangku SD, tahap menabung boleh berlanjut pada pengelolaan uang. “Dalam prosesnya, menabung itu yang penting adalah konsisten, tidak hanya pada waktu tertentu saja,” tambah dia. Sependapat dengan Ratih, perencana keuangan Prita Hapsari Ghozie menuturkan banyak hal positif yang diperoleh anak dengan menabung. Dari salah satu studi yang pernah dilakukan di AS, diketahui bahwa anak yang dulu di masa kecilnya diajari menabung akan menjadi pribadi yang lebih baik di saat dew-

asa, terutama dalam pengelolaan finansialnya. “Sebagai langkah awal, dimulai dari orangtua, karena anak akan mengikuti apa yang diajarkan orangtuanya,” kata Prita. Cara mudah mengajarkan anak untuk menabung, adalah dengan memberi mereka target dan perbandingan. Misalkan ingin membeli sesuatu atau mainan, maka mereka menabung dalam jangka waktu tertentu. Lalu, mengenali sebuah mainan itu mahal, dengan memberi perbandingan satu boneka bisa jadi sama dengan sepuluh burger. “Ada banyak nilai positif yang bisa diperoleh anak saat mereka menabung,” tambah dia. Sukiwan dari CIMB Niaga menuturkan saat ini ada layanan khusus yang memfasilitasi keinginan anak untuk menabung dengan tabungan CIMB Junior. Untuk mereka yang di bawah 18 tahun bisa memiliki buku tabungan atau rekening sendiri meski tanpa Kartu Tanda Penduduk, tapi menggunakan akte kelahiran. Kepemilikan buku tabungan ini juga memberi manfaat sama seperti tabungan orang dewasa, seperti insentif, serta berbagai potongan harga di beberapa merchant. (int)

Ibu Hamil Rajin Olahraga Bikin Jantung Bayi Sehat

SIAPA bilang ibu hamil tidak boleh olahraga? Justru ibu hamil umumnya rentan terhadap kelelahan sehingga disarankan untuk melakukan banyak gerakan melalui olahraga. Laporan sebuah studi pun menunjukkan bahwa olahraga dapat meningkatkan mood ibu hamil dan membantu mengurangi tingkat kelelahan. Sebuah studi yang diterbitkan dalam jurnal Psychology and Health mengungkapkan, beberapa ibu hamil yang belum pernah melakukan olahraga disarankan untuk melakukan program latihan selama empat minggu. Ternyata, terjadi peningkatan signifikan dalam suasana hati mereka selama program latihan. Penelitian yang dilakukan oleh Anca Gaston dan Harry Prapavessis dari University of Western Ontario ini juga menemukan adanya pengurangan tingkat kelelahan pada mereka. Kelainan mood pascapersalinan, seperti depresi postnatal, memang kerap terjadi. Namun, tingkat depresi, kecemasan, dan kelelahan sebenarnya lebih tinggi selama kehamilan ketimbang setelah melahirkan. Anak-anak dari ibu yang mengalami depresi selama kehamilan memiliki tingkat kortisol (hormon stres) lebih tinggi saat lahir dan masa remaja, merusak kemampuan kognitif dan risiko gangguan perkembangan dan mental yang lebih besar. Kelelahan selama kehamilan juga sering

dikaitkan dengan meningkatnya risiko persalinan secara caesar, gangguan tidur, dan pengaruh negatif pada kesehatan fisik dan mental. Latihan rutin selama kehamilan diharapkan dapat memperbaiki kesehatan fisik dan psikologis ibu hamil. Riset pada tahun 2010 menunjukkan, bayi yang lahir dari ibu yang rajin berlatih aerobik selama kehamilan ternyata memiliki jantung yang lebih sehat. Disebutkan, bayi-bayi tersebut memiliki detak jantung yang lebih rendah. Para peneliti meyakini bahwa latihan selama kehamilan memberi manfaat pada anak hingga dewasa, seperti menurunkan risiko penyakit jantung, stroke, diabetes, dan hipertensi. Apa yang menyebabkannya demikian? Jantung ternyata sebenarnya merupakan otot, yang menjadi lebih kuat jika dikondisikan demikian. Jika otot jantung

lebih kuat, detak jantung juga menurun sehingga tidak perlu berupaya terlalu keras untuk memompa darah. “Program latihan teratur selama kehamilan bisa menjadi intervensi paling awal untuk memperbaiki kesehatan kardiovaskular,” ungkap dr Linda May dari Kansas University, yang menggelar studi tersebut. Karena adanya kesalahpahaman selama ini mengenai keamanan olahraga selama kehamilan, para peneliti bertekad terus mengedukasi kaum perem-

puan, keluarga, dan praktisi kesehatan mengenai pedoman, manfaat, dan hambatan yang terkait dengan olahraga selama kehamilan. (kps/int)

Ramuan Natural Penghilang Bau Badan

MEMILIKI badan yang wangi akan menambah kepercayaan diri saat tampil di hadapan orang lain. Bau badan yang tidak sedap akan membuat pergerakan anda menjadi tidak bebas dan tidak nyaman. Banyak orang yang akhirnya memilih untuk menyendiri karena tidak ingin bau badannya yang buruk

tercium orang lain. Masalah bau badan ini memang menjadi sangat serius saat anda tidak bisa berinteraksi dengan nyaman dengan orang lain. Ketiak

biasanya menjadi sumber bau badan karena produksi keringat yang berlebih. Banyak orangyang mencari cara untuk mengurangi dan menghilangkan bau yang tidka sedap pada ketiaknya. Banyak cara baik yang natural maupun modern yang dipercaya mampu mengurangi bau badan. Menggunakan ramuan yang alami akan bisa memberikan hasil yang lebih aman. Berikut ini adalah beberapa jenis bahan ramuan yang baik untuk mengurangi dan menghilangkan bau badan. • Daun kemangi Mengkonsumsi daun kemangi mentah secara langsung akan sangat membantu para wanita yang sedang haid mengatasi masalah bau badannya. Anda akan bisa meras lebih nyaman saat haid dengan bau badan yang tidak menyengat.

Daun yang mengandung antiseptic ini juga akan membuat nafsu makan menjadi meningkat. • Jeruk purut Ramuan dengan bahan dasar jeruk purut ini akan lebih berkhasiat saat dicampurkan dengan sebatang kencur yang dihaluskan. Ramuan yang dicampur dengan air secukupnya ini dapat diminum sehingga bau badan yang tidak sedap akan bisa berkurang dan bahkan hilang. • Jeruk nipis Berbeda dengan ramuan jeruk purut, ramuan dari jeruk nipis ini tidak untuk diminum. Ramuan dari campuran air perasan jeruk nipis dengan kapur sirih ini harus dioleskan di area ketiak sehingga bau badan yang dihasilkan di ketiak akan berkurang. • Jahe Cukup dengan diseduh dan menjadi wedang jahe, ramuan alami ini dapat diminum untuk mengurangi bau badan anda. Kesegaran dri jahe akan membuat bau tidak sedap yang ada pada tubuh anda akan berkurang dan menjadikan bau badan anda menjadi lebih baik. • Ketimun Menggosokkan sari ketimun ke area ketiak sehabis mandi akan membantu mengurangi jumlah keringat yang membuat bau badan menjadi tidak sedap. Dengan melakukan hal ini secara rutin setiap hari, anda akan bisa mendapatkan keperercyaan diri dengan bau badan yang lebih segar. • Cengkeh Anda harus merendam daun cengkeh hingga mengembang dan meminum airnya. Air cengkeh yang beraroma sedap ini akan bisa membantu mengurangi bau badan. Untuk variasi yang berbeda, tambahan gula merah pad air rebusan cengkeh ini dapat memberikan kehangatan untuk anda saat hujan turun. Semua bahan-bahan dan cara mempergunakannya ini akan sangat berguna untuk anda yang ingin menjadikan tubuh anda lebih nyaman dengan bau yang sedap. Anda akan memiliki kepercayaan diri yang lebih baik dengan bau badan yang lebih sedap. (int)



22 Agustus 2013


(23 September - 22 Oktober)

Pekerjaan: Mewujudkan keinginan Anda, tidak bisa langsung cepat dalam waktu singkat sehari atau dua hari Keuangan: Jiwa sosialmu sudah mulai kembali lembur, batasilah Kesehatan: Kurangi kebiasaan minum alkohol


(23 Agustus-22 September)

Pekerjaan: Tetaplah pada pendirian Anda semula, jangan terpengaruh oleh kabar angin yang tidak jelas. Keuangan: Hasilnya cukup memuaskan, jangan lupa menabung ya. Kesehatan: Tidak ada pilihan lain kecuali stop merokok Asmara: Anda merasa kurang diperhatikan oleh si dia.


(23 Oktober – 22 November)

Pekerjaan: Andaikan pikiran Anda luas, jangan terlalu gampang mengambil kesimpulan mengenai sesuatu Keuangan: Jangan sampai Anda menyesal. Pikir baik- baik sebelum membeli barang itu


( 23 November - 20 Desember)

Pekerjaan: Anda harus konsentrasi bila ingin cepat selesai. Keuangan: Agak kacau. Anda inginnya marah melulu Kesehatan: Kesehatan jantung perlu dijaga Asmara: Tampaknya yang menjadi incaran Anda mulai membalas perhatian.


(21 Desember -19 Januari)

Pekerjaan: Jika Anda mau menyampaikan sesuatu, tidak perlu minta tolong. Lebih baik Anda sendiri yang bicara. Keuangan: Hilangkan semua gengsi. Anda sendiri yang bisa rugi


(20 Januari - 18 Februari)

Pekerjaan: Dedikasi Anda pada pekerjaan baik sekali, karena suasana hati Anda lagi asyik hari ini Keuangan: Amati peluang-peluang yang kira-kira bisa menguntungkan Kesehatan: Memforsir olahraga tidak baik bagi jantung Anda


19 Februari - 20 Maret

Pekerjaan: Tetapkan tujuan Anda. Jangan selalu berubah pikiran atau mengubah rencana. Keuangan: Bila semua sesuai anggaran, semuanya bakal oke. Kesehatan: Tidak ada masalah


(21 Maret - 20 April)

Pekerjaan: Anda bisa mengalahkan saingan. Jadi tidak usah kuatir. Keuangan: Tagihan mulai berdatangan. Jangan lupa untuk membayar. Kesehatan: Gatal-gatal Asmara: Dia menjadi sumber kekuatan dan memberi rasa bahagia.


(21 April - 20 Mei)

Pekerjaan: Terlalu perfeksionis akan bikin Anda jadi stres. Wajar-wajar sajalah Keuangan: Ada pemasukan, tapi juga ada pengeluaran Kesehatan: Perbaiki pola makanan Anda Asmara: Ada orang mengincar si dia.

(21 Mei - 20 Juni)

Gemini Pekerjaan: Sebaiknya Anda bikin evaluasi apa yang sudah Anda bikin Keuangan: Anda masih kurang puas dengan penghasilan Anda. Kesehatan: Kurangi kebiasaan tidur lewat tengah malam Asmara: Anda sepertinya tidak berdaya menghadapi dia.


(21 Juni- 20 Juli)

Atiqah Hasiholan dan Rio Dewanto akan menikah Sabtu (24/8). Namun, lokasi prosesi sakral itu dihelat masih dirahasiakan. Eits, ada sedikit bocoran. Pasangan bintang film itu akan menggelar pernikahan mereka di pinggir pantai.


al itu diungkapkan oleh perancang baju pengantin Atiqah, Anne Avantie, Rabu (21/8). “Jadi, nanti Atiqah dan Rio akan jalan-jalan ke pinggir pantai, memang disesuaikan dengan konsep pernikahan mereka,” terang Anne. Lebih jauh, perancang kebaya itu mengungkapkan bahwa proses pernikahan Atiqah dan Rio akan dihelat dalam satu hari, dari akad hingga resepsi. “Dari akad langsung ke resepsi nanti,” jelasnya lagi. Namun, Anne tidak tahu berapa banyak tamu yang akan hadir. Pada Rabu (14/8) lalu, Rio ditemani oleh calon ibu mertuanya, Ratna Sarumpaet mengunjungi Gubernur DKI Jakarta, Jokowi untuk mengantarkan undangan pernikahan. Sabtu 24 Agustus akan menjadi hari yang tidak bisa dilupakan oleh Atiqah Hasiholan dan Rio Dewanto. Hal itu dikarenakan keduanya

yang akan melangsungkan acara pernikahan di suatu tempat yang masih dirahasiakan. Ibunda Atiqah Hasiholan, Ratna Sarumpaet mengungkapkan mengapa tanggal tersebut dipilih untuk menggelar acara pernikahan buah hatinya. “Tunangannya sudah setengah tahunan ini ya. Tapi semua tanggal itu baik,” ucap Ratna saat dihubungi melalui sambungan telepon, Rabu (21/8). Tak hanya itu, lebih lanjut ia mengatakan bahwa Atiqah dan Rio memang ingin melangsungkan pernikahan usai Hari Raya Idul

Fitri yang memang sudah tidak hujan. “Ya pasti semakin siap kan tanggal 24 besok menikahnya jadi sudah siap sekali,” katanya lagi. Namun sayang Ratna enggan menjelaskan bagaimana pernikahan itu akan berlangsung. “Besok (hari ini) ada jumpa persnya jadi besok bisa ditanyakan sama mereka langsung,” elak Ratna.(int)

Nuri Maulida

Buka Butik Fashion Muslim Nuri Maulida kini sedang fokus ke pekerjaan barunya dengan membuka bisnis butik bersama adik dan orangtuanya. Ketika bulan Ramadan kemarin bisnisnya mendapatkan omzet yang tinggi. Bahkan, ia menyebut bulan Ramadan adalah musim panen bagi bisnis Hijab dan baju Muslimah. “Ramadan memang panennya karena kebutuhan baju baru untuk lebaran. Kalau sekarang sama, cuma orang lebih mencari yang kebutuhan sehari-hari. Alhamdulillah usaha masih lancar di bidang ini,” ungkap Nuri Maulida saat ditemui di kawasan Epincentrum, Jakarta Selatan, Rabu (21/8/).

Nuri fokus di dunia bisnis lantaran ia mengetahui bahwa dirinya butuh pekerjaan sampingan selain di dunia hiburan. Ia sadar bahwa regenerasi yang cepat di industri hiburan akan membuat seseorang susah untuk bertahan.(int)

Pekerjaan: Yang penting Anda konsentrasi saja pada urusan Anda sendiri. Keuangan: Anda dapat menikmati hasil jerih payah sendiri. Kesehatan: Asam lambung meningkat Asmara: Kalau Anda menuruti emosi, bisa-bisa hubungan kalian menjadi panas.


(21 Juli-21 Agustus)

Pekerjaan: Kalo benar sudah menjadi niat dan fokus, pasti urusan cepat beres Keuangan: Tergantung Anda, mau royal atau irit Kesehatan: cek kesehatan paru-paru Anda Asmara: Selalu salah terima. Positive thinking, dong.

Ibunda Ngebet Punya Cucu dari Vicky Shu Hingga kini, penyanyi Vicky Shu masih terlihat ‘sendiri’. Pelantun ‘Mari Bercinta’ itu mengaku dirinya memang belum menemukan pria yang tepat untuk dijadikan sebagai pasangan. Padahal, Vicky mengaku, sang ibu sudah sering bertanya kapan dirinya menikah. Tak hanya itu, ibunda juga tak sabar bisa menimang cucu dari Vicky. “Mama udah sering nanyain kapan nikah. Lebih pengen punya cucu juga sih sebenarnya,” ujarnya, Selasa (20/8). Dara 23 tahun ini mengungkapkan, memiliki pasangan memang menjadi hal yang inginkan saat ini. Bicara soal pria idaman, perempuan berambut panjang ini pun tak neko-neko. Ia hanya berharap bisa memiliki kekasih yang mendukung karier yang ia jalani. “Inginnya yang sesuai, bisa support sama karier akulah ke depannya,” paparnya. (int)

Maudy Ayunda

Sering Stres Masa-masa sekolah tentu adalah masa-masa indah bagi semua orang. Begitupun dengan Maudy Ayunda yang selalu terkenang dengan masa berseragam putih abu-abu. Namun, ternyata Maudy sering mengalami tekanan saat sekolah. “Kalau masa SMA itu masa puber, dan pasti aku stres banyak tugas, dan banyak jerawat,” kata Maudy di Kota Kasablanka, Jakarta Selatan. Jerawat membuat tak nyaman pemeran film PERAHU KERTAS ini. Karena sebagai wanita dirinya sangat mempedulikan penampilannya. “Jerawat itu bikin down banget. Jaman SMA itu ya pasti, banyak aktivitas dan akhirnya keluar jerawat. Kalau datang jerawat pasti jadi gak nyaman,” lanjutnya. “Karena pas jaman SMA merasakan adanya panahpanah asmara. Buat cewek juga sangat mementingkan penampilan,” tukasnya. (int)

Jerawat itu bikin down banget. Jaman SMA itu ya pasti, banyak aktivitas dan akhirnya keluar jerawat. Kalau datang jerawat pasti jadi gak nyaman. ”


22 Agustus 2013

Seorang wanita bernama Asha Mandela dinobatkan oleh Guinness World Record menjadi wanita dengan rambut gimbal terpanjang di dunia.

„ Bilik asmara yang dibangun pemerintah Swis.


Pemerintah Bangun Bilik Asmara Sekilas, bangunan semipermanen berdinding kayu ini mirip saung peristirahatan bagi pendaki gunung. Namun melihat poster yang terpasang dan piranti pelengkapnya, jelas ini bukan bilik biasa. Pemerintah kota Zurich, Swiss, sengaja membuat bilikbilik itu untuk memudahkan pekerja seks komersial bertransaksi dengan pelanggannya. Disebut sebagai drive in sex boxes, bilik ini akan resmi digunakan mulai 26 Agustus. Saat ini, yang siap digunakan sebanyak sembilan bilik, yang terletak di bekas zona industri di bagian barat kota. Pengemudi harus mengikuti rute yang ditandai dengan jelas dimana 40 PSK siap menawarkan jasanya. Begitu selesai memilih PSK dan harga disepakati, mereka akan berkendara ke salah satu bilik itu. Terbuka di salah satu sisinya, bilik ini dilengkapi dengan alarm yang bisa diaktifkan jika sang PSK merasa terancam keamanannya oleh sang klien. Untuk saat ini, bilik ini hanya disediakan untuk pengemudi mobil - pejalan kaki dan mereka yang berkendara dengan sepeda motor tidak diper-

bolehkan - dan akan beroperasi dari sore sampai pukul 05.00 setiap hari. Menurut pejabat setempat, bilik asmara adalah salah satu dari beberapa tindakan yang dimaksudkan untuk mengurangi praktik pelacuran di daerah perumahan dan di pusat kota. Selama ini, banyak PSK yang menjajakan jasanya di sepanjang bantaran sungai Sihlquai. Dengan adanya bilik asmara, mereka yang kedapatan bertransaksi di luar tiga lokasi yang disepakati akan dikenai denda hingga 450 franc atau setara Rp5,2 juta. ”Kami ingin mengatur prostitusi karena sampai sekarang yang berlaku adalah hukum rimba,” kata Michael Herzig, dari Departemen Kesejahteraan Sosial Zurich. Proyek senilai 1,4 juta franc (setara Rp16,3 miliar) disetujui melalui referendum. Prostitusi adalah profesi legal di Swiss, dimana pekerja seks harus membayar pajak sebesar lima franc (setara Rp58 ribu) setiap malam saat mereka bekerja. (int)

„ Asha Mandela

Wanita berusia 50 tahun ini memiliki rambut sepanjang 5,7 meter yang telah ia rawat sejak usianya masih 25 tahun. ”Saya pertama kali mulai memanjangkan rambut ini sejak usia saya masih 25 tahun. Jika rambut ini dipotong sama saja seperti mengambil nyawaku,” ujar Asha, seperti dikutip Huffington Post, Rabu (21/8). Asha harus mencuci rambut gimbalnya itu seminggu sekali dengan menggunakan 6 botol sampo serta dibutuhkan dua hari untuk men-

geringkannya. Rambut gimbalnya ini memiliki berat 11,3 kilogram jika dalam keadaan basah. ”Para dokter tampak khawatir pada tulang belakang saya, karena rambut panjang saya ini sangat berat,” ujar Asha. ”Rambut saya tidak berakibat buruk pada percintaan saya. Saya pikir hal itu menambah sedikit bumbu di atas,” tambahnya. Seorang juru bicara Guinness World Records mengatakan bahwa Asha dinobatkan menjadi wanita yang memiliki rambut gimbal terpanjang di dunia ini pada 2009 silam dan sampai sekarang belum ada yang memecahkan rekornya. (int)


Membunuh Dua Anaknya Seorang wanita di Afrika Selatan ditangkap polisi karena merencanakan pembunuhan kedua anaknya. Wanita berusia 50 tahun ini menyewa pembunuh bayaran untuk menghabisi nyawa kedua anaknya. Seperti dilansir AFP, Rabu (21/8), rencana pembunuhan ini dilakukan demi mendapat uang asuransi anaknya. Wanita yang tidak disebut namanya ini merekrut seorang kerabatnya untuk membunuh kedua anaknya. Untuk melaksanakan tugas ini, si pembunuh bayaran dibayar sebesar US$ 2.400. Namun menjelang pelaksanaannya, si pembunuh bayaran tersebut malah melapor ke polisi. ”Motif percobaan pembunuhan ini karena pelaku ingin mengklaim uang asuransi

yang dia keluarkan untuk anak-anaknya,” demikian keterangan polisi setempat. Tidak disebutkan lebih lanjut usia kedua anak pelaku. Namun disebutkan bahwa wanita ini menjanjikan tiga pekerjaan tambahan jika si pembunuh bayaran berhasil menghabisi nyawa kedua putranya. Dari tangan wanita ini, polisi menyita dokumen asuransi dan empat kartu identitas. Wanita ini dijerat dakwaan konspirasi percobaan pembunuhan dan akan mulai disidangkan pada Kamis (22/8). (int)


Untuk Dapatkan Celana Dalam Wanita Polisi Brisbane tengah mencari seorang pria yang membayar 100 dollar Australia, lebih dari Rp1 juta, untuk mendapatkan celana dalam para perempuan. Lelaki ini dilaporkan mendekati perempuan-perempuan di kawasan pusat bisnis dan menawarkan 100 dollar jika mereka mau memberikan celana dalamnya. Polisi mulai menerima laporan dari para perempuan sejak Juni 2013, termasuk di antara pelapor adalah remaja pe-

rempuan berusia 16 tahun. Dikutip dari Brisbane Times, Selasa (20/8), pria ini menyasar para perempuan di kawasan Queen Street Mall. Lokasi ini merupakan pusat belanja terkenal dan berada di dekat kampus Queensland University of Technology di Garden Poins. Foto lelaki tersebut sudah diedarkan ke seluruh kota oleh kepolisian setempat. Polisi mendapatkan gambar lelaki itu dari kamera CCTV di kawasan tersebut. (int)

Uang Kompensasi Dibayar dengan Segunung Koin

„ Badak dan jerapah, hewan yang banyak hidup di Afrika.

Hewan Stres, Ingin Bunuh Diri Konflik Mesir saat ini rupanya tidak hanya membuat rakyat tertekan tapi binatangbinatang di Negeri Sungai Nil itu juga bisa kena stres. Sejumlah jerapah, badak, gajah, dan kijang di kebun binatang di Mesir dilaporkan dalam kondisi stres, seperti dilansir stasiun televisi Al Arabiya, Rabu (21/8). Menurut laporan surat kabar al-Masry al-Youm pekan ini hewan-hewan di kebun binatang itu bahkan mencoba bunuh diri untuk mengakhiri penderitaan mereka. Ahli hewan di kebun binatang di Ibukota Kairo mengatakan hewan-hewan itu diyakini mempunyai pikiran untuk mengakhiri masa hidupnya. Sejumlah unjuk rasa yang menyebabkan bentrokan bisa terdengar sampai ke kebun bi-

natang di Giza, termasuk letusan senjata. Ahli hewan itu juga mengatakan bintang punya kemampuan untuk mendengar suara lebih tajam, termasuk beruang. Binatang-binatang itu mencoba membenturkan kepala mereka ke dinding dan pagar kandang yang mengelilingi mereka untuk melukai diri sendiri. Tidak hanya itu, rasa ketakutan yang mencekam bisa membuat hewan-hewan itu menangis. Awal bulan ini polisi Mesir membubarkan unjuk rasa Ikhwanul Muslimin di dekat kebun binatang. Dalam satu kesempatan stasiun televisi melaporkan sejumlah pengunjuk rasa masuk ke kebun binatang di dekat kawasan Nahda sambil menembakkan senjata. (int)

Pasangan suami-istri asal Kota Kunming, China kebingungan saat menerima kompensasi dari restoran yang dituntutnya. Pasalnya, restoran itu membayar kompensasi dalam bentuk ratusan ribu koin. Seperti dilansir Yahoo News, Rabu (21/8), kasus tersebut dimulai ketika Wu Qian dan suaminya makan di sebuah restoran. Sang suami dipukuli pelayan restoran setelah memprotes kondisi makanan yang tidak bersih. Pasangan itu lalu menuntut restoran tersebut ke pengadilan atas tuduhan penganiayaan. Dalam putusannya, pengadilan memerintahkan pihak restoran membayar kompensasi sebesar 68 ribu Yuan yang setara dengan Rp118,5 juta (Rp1.743 per 1 Yuan). Pemilik restoran sepertinya tidak terima dengan keputusan tersebut. Dia mengirim sebagian uang kompensasi dalam bentuk uang receh. Dia mengirim setidaknya delapan

„ Koin yang dibayarkan oleh restoran sebagai uang kompensasi. karung koin dengan berat lebih dari 400 kilogram (kg). Wu pun harus mondar-

mandir mencari bank yang mau menghitung dan menyimpan koin receh tersebut. Bank Per-

dagangan dan Industri China adalah satu-satunya bank yang mau melayani perempuan itu.

Mereka mengerahkan 18 pekerja hanya untuk menghitung tumpukan koin itu. (int)

social media dan dilarang mengunjungi empat kabupaten setempat. Selain itu, Clemmons juga harus menjalani evaluasi kesehatan mental selama 30 hari. Evaluasi alkohol

dan obat-obatan juga terpaksa dijalaninya. Clemmons bisa bebas dengan jaminan sebanyak US$ 20 ribu dan akan dibebaskan Selasa 20 Agustus 2013 waktu setempat. (int)


Mahasiswa Dibui 6 Bulan Dunia maya memang beda dengan dunia nyata. Apalagi dalam sosial media yang mudah menyebar (viral). Semua unggahan bisa langsung disebarkan oleh orang lain dan menjadi obrolan publik. Tak terkecuali juga aparat keamanan. Inilah yang menimpa Caleb Jamaal Clemmons. Mahasiswa umur 20 tahun itu ditangkap polisi hanya dalam waktu tiga jam usai mengunggah statusnya di blog sosial Dalam postingan-nya, mahasiswa psikologi itu menulis; “Halo nama saya Irenigg dan saya berencana untuk menembaki Georgia selatan. Apakah saya ditangkap.” Hasilnya, dia ditangkap. Namun, polisi tak menemukan adanya senjata dan bukti jika dia mau betul-betul menyerang. Akan tetapi, dia tetap ditangkap. Menurut hakim John Turner, laku Clemmons merupakan ancaman terorisme. Ancaman ini dituangkan

dalam undang-undang pidana negara setempat kode bagian 16-11-17. Menurut pengacara Clemmons, Jack Williamson, tindakan kliennya masuk kriteria ‘ancaman teroris’ walau tak diikuti aksi. Untuk sebuah ancaman saja, bisa dijerat penjara hingga 10 tahun. Menurut hakim John Turner, Clemmons dibui 6 bulan dengan masa percobaan 5 tahun. Selama masa percobaan, dia dilarang memakai

14 14


22 Agustus 2013

PENGORBANAN RICKY Berbuah Emas Pertama Indonesia Keberhasilan atlet renang Ricky Anggawijaya membuat sejarah meraih medali emas Asian Youth Games merupakan buah strategi dan kerja keras atlet dan tim.

„ Ricky Anggawijaya

RICKY meraih medali emas Asian Youth Games II Nanjing di nomor 100 meter gaya punggung dengan catatan waktu 58.42 detik dan mengalahkan atlet Taiwan dan Korea. Menurut pelatih nasional Albert C. Sutanto yang ikut ke Nanjing, tim pelatih melihat peluang Ricky untuk merebut medali di nomor 200 meter gaya punggung menjadi terbuka setelah ia berhasil lolos ke final, Senin (19/8). “Masalahnya, Ricky juga akan

turun di beberapa nomor pada hari final 200 meter gaya punggung yaitu Selasa (20/8),” ungkap Albert pada Ricky memang diturunkan di nomor 200 meter gaya bebas dan 4x100 meter gaya bebas. Karena itulah tim pelatih yang terdiri dari Albert C. Sutanto, Hartadi Nurtjojo, Priyo Pawoko dan Nijaruddin menginstruksikan Ricky agar tidak terlalu ngotot dan menyimpan ten-

SEA Games,

gaya bebas. “Sementara di kolam, kami berusaha memperbaiki kekurangan Ricky dengan waktu yang sempit itu. Tim pelatih melihat kekurangan Ricky di penyisihan dan semifinal adalah selalu mengendur di 15 meter terakhir,” kata Albert. “Karena itulah kami mengoreksi Ricky untuk star dan finish yang efektif. Untungnya, mental anak ini memang kuat dan ia mampu menjalankan semua itu dan hasilnya berbuah medali emas,” ungkapnya. Pengorbanan Ricky sebenarnya sudah dilakukan sebelum berlangsungnya Asian Youth

dengan catatan waktu 58.42 detik. Ia mengatasi atlet Taiwan, yang Chunjyao yang merebut medali perak dengan catatan waktu 58.83 detik serta atlet Korea Wong Younjun yang kebagian perunggu dengan catatan waktu 58.90 detik. Ini merupakan medali emas pertama kontingen Indonesia di ajang Asian Youth Games II 2013 ini. Sebelumnya Indonesia telah merebut medali perunggu yang juga dipersembahkan cabang renang melalui atlet Monalisa Arieswaty di nomor 200 meter gaya kupukupu. (int)

Buru Kemenangan Pertama MESKI sudah memenangi lebih dari 30 balapan sepanjang kariernya di Formula 1, Fernando Alonso belum pernah sekalipun menjadi juara di Belgia. Alonso pun mengincar kemenangan pertamanya di Sirkuit SpaFrancorchamps.


Musim 2012 lalu misalnya, harapan Alonso mengakhiri kutukan Spa langsung kandas di lap pertama setelah ditabrak Romain Grosjean. Gara-gara insiden tersebut, Grosjean dihukum larangan membalap di seri berikutnya. Kini, seiring dengan dimulai kembali kompetisi Formula 1 setelah libur hampir satu bulan, juara dunia 2005 dan 2006 itu berharap peruntungannya

Stefan Bradl

Brno Selalu Istimewa Akhir pekan GP Indianapolis sudah berlalu, kini Stefan Bradl ingin menyongsong seri Brno dengan pikiran yang lebih baik. Usai mengalami kekecewaan di Indy, Bradl ingin meraih kepercayaan dirinya lagi di trek yang dianggap spesial untuknya itu. Penghuni jok LCR Honda itu padahal sempat tampil gemilang di Laguna Seca. Tak ada yang menyangka, Bradl sanggup memijak podium dua. Akan tetapi di seri berikutnya – masih di negara yang sama (Amerika Serikat), Bradl malah terpaksa finis di tempat ketujuh.“Saya meninggalkan Indianapolis den-

gan sedikit kekecewaan karena kecepatan saya sudah konsisten selama sesi latihan. Hanya saja, saya sempat terajatuh di sesi terakhir dan oleh karenanya, kehilangan kepercayaan diri selama race,” ujar Bradl. “Setelah meraih posisi kedua (runner-up) di Laguna Seca, jelas saya mengharapkan hasil yang lebih ketimbang hanya finis ketujuh,” imbuhnya, sebagaimana disadur FIM-Live, Rabu (21/ 8). Satu hal yang digarisbawahi rider asal Jerman itu, kecepatannya sudah bisa diperlihatkan secara konsisten. Menyongsong

Brno, Bradl ingin mood-nya kembali menanjak, apalagi mengingat pembalap kelahiran Augsburg 23 tahun silam itu punya momen manis berupa kemenangan pertamanya pada kelas 125cc 2008 silam. “Tapi yang perlu diingat, saya sudah menunjukkan kecepatan saya secara stabil dan senang rasanya bisa kembali ke Eropa. Brno trek yang menyenangkan buat saya karena saya memenangkan seri pertama saya di sana 2008 lalu dan trek ini selalu spesial. Layout sirkuitnya menarik dan saya senang membalap di sana,” pungkas Bradl. (int)

Jelang US Open 2013

Federer Belum Habis

SEPANJANG awal tahun hingga menjelang US Open, indeks prestasi Roger Federer menurun drastis. Akibatnya, peringkatnya di ATP pun terjun bebas ke urutan ketujuh. Tak pelak, petenis kawakan asal Swiss itu pun tak dianggap sebagai unggulan yang difavoritkan juara. Publik lebih melihat kepada tiga petenis elite lainnya macam Novak Djokovic, Andy Murray

dan Rafael Nadal yang mulai bangkit. Namun mantan jawara Wimbledon 12 tahun silam, Goran Ivaniševic mengingatkan bahwa belum saatnya menghapus nama Federer dari daftar calon juara. “Anda bisa saja mengharapkan tiga pemain itu (Djokovic, Nadal atau Murray untuk juara) tapi masih ada Roger Federer. Semua orang ingin mengatakan

dia sudah habis, tapi saya takkan bilang begitu,” terang Ivaniševic, sebagaimana dikutip DailyMail, Rabu (21/8). “Di lapangan (Flushing Meadows) itu, bola bisa mengalir lebih cepat dan dia sempat menyulitkan Nadal pekan lalu (di Cincinnati). Jika dia punya pikiran positif, dia mampu tampil hebat dan bahkan memenangkannya,” imbuhnya. “Favorit di sana memang Djokovic buat saya, tapi dua tahun lalu ketika Djokovic memenangkannya, Roger sempat mendapat match-point saat melawannya di semi final. Oleh karena itu, saya percaya dia bisa melakukannya,” sambung Ivanisevic. Khusus untuk Murray yang sedianya juara bertahan tahun lalu, malah belum masih “hitungan” Ivanisevic untuk jadi favorit utama karena dianggap belum menemukan konsistensi permainan terbaiknya. “Andy Murray belum mampu konsisten dalam permainanya. Dia bermain buruk di Montreal dan Cincinnati. Apalagi keadaannya akan berbeda ketika Anda bertindak sebagai juara bertahan. Semua orang ingin mengalahkan Anda,” ujar pria asal Kroasia berusia 41 tahun itu. (int)

Maria Sharapova

Kembali ke Ayahnya

„ Gita Wirjawan

Games II di Nanjing. Ricky yang sebenarnya lolos ke nomor perairan terbuka Kejuaraan Dunia Renang di Barcelona, Juli lalu diminta tidak berangkat agar bisa berkonsentrasi di ajang AYG ini. Nyatanya ia membuktikan hal ini. Emas Pertama Indonesia Cabang renang mempersembahkan medali emas pertama Indonesia di ajang Asian Youth Games II Nanjing lewat Ricky Anggawijaya di nomor 100 meter gaya punggung, Selasa (20/8). Dalam lomba yang berlangsung di Nanjing Natatorium, Ricky merebut medali emas

Fernando Alonso


KETUA Umum PBSI Gita Wirjawan mengemukakan SEA Games 2013 di Myanmar pada November mendatang sebagai target berikut yang harus direngkuh. Untuk itu, para pemain harus mulai bersiap sejak sekarang. Euforia keberhasilan ganda putra Muhammad Ahsan/Hendra Gunawan dan ganda campuran Tontowi Ahmad/Liliyana Natsir yang menjadi juara pada World Championship 2013 di Guangzhou, China masih terasa di tubuh PBSI hingga sekarang. Gita Wirjawan menyatakan sukses tersebut menjadi modal yang teramat bagus untuk meraih lima emas di Myanmar. Pada 2011 lalu saat menjadi tuan rumah di Jakarta, Indonesia berhasil menyabet empat emas di nomor perseorangan yakni melalui Simon Santoso, Ahsan/Bona Septano, Nitya Maheswari/Anneke Agustine, serta Tontowi/ Liliyana dan keluar sebagai juara di nomor beregu dengan mengalahkan Thailand di final. “Kami punya empat milestones di 2013 ini. Pertama adalah All England yang hasilnya satu gelar,” kata Gita Wirjawan seperti dikutip Badminton Indonesia. “Kemudian Piala Sudirman di mana kami terhenti di perempatfinal tetapi kalah terhormat dari China. Lalu Kejuaraan Dunia dengan dua gelar. Satu lagi adalah SEA Games yang akan berlangsung November nanti di Myanmar,” terang Gita. “Semoga kami dapat meraih hasil yang membanggakan,” harap Gita. (int)

aga di nomor 200 meter gaya bebas. Karena 200 meter gaya bebas diperlombakan sebelum final 200 meter gaya punggung. “Kami juga memutuskan menarik Ricky dari tim estafet 4x100 meter dan menggantikannya dengan Kenny Lisanputera yang berada di posisi cadangan,” lanjut Albert. Dengan keputusan ini, bisa ditebak Ricky gagal lolos ke final nomor 200 meter gaya bebas. Sementara di nomor estafet 4x100 meter, Indonesia juga gagal lolos ke final karena catatan waktu Kenny Lisanputera memang masih di bawah Ricky Anggawijaya untuk nomor 100 meter

Setelah memecat Jimmy Connors, Maria Sharapova akan kembali bekerja sama dengan sang ayah, Yuri Sharapov, sebagai pelatih. Event pertama mereka adalah US Open, yang akan berlangsung mulai Senin (26/8). Ayah dan anak ini dulu sudah pernah bekerja bersama. Beberapa tahun lalu Yuri memutuskan untuk mundur sejenak dari dunia tenis demi melakukan hal lainnya.

Sharapova sebelumnya dilatih Thomas Hoegstedt sekitar dua tahun hingga Wimbledon,

Juni lalu. Kekalahan di babak awal Wimbledon jadi pertimbangan Sharapova memutus-

kan kerja sama. Setelah itu, petenis Rusia ini memilih Connors sebagai pelatih. Tetapi, kerja sama mereka hanya bertahan sebulan. Sharapova memecat Connors hanya setelah satu pertandingan, menyusul kekalahannya di babak kedua Cincinnati. Sharapova baru sekali bertanding di turnamen lapangan keras sebelum memulai persaingan di US Open. (int)

yang selalu sial di Belgia bisa berubah. “Saya berusaha dengan cukup baik ketika finis kedua pada 2005 lalu. Juga sewaktu saya masih membalap di Formula 3000,” kata pembalap 32 tahun tersebut seperti dikutip Crash. “Sejauh ini, saya tak pernah punya kesempatan untuk benar-benar bertarung memperebutkan kemenangan

di Spa. Seringnya justru harus berhenti di tengah lomba,” aku Alonso. “Bisa jadi karena nasib sial, problem teknis, atau kesalahan saya sendiri. Jadi, alangkah hebatnya bila saya berhasil memenangi balapan di sini pada tahun ini,” cetus Alonso yang masih tertahan di posisi tiga klasemen dengan 133 poin atau tertinggal 39 poin dari Sebastian Vettel. (int)


KAMIS 22 Agustus 2013

Start Berat MU Tak Cemaskan Evans

MANCHESTER- Target Manchester City musim ini bukan sekadar kembali menjuarai Liga Primer Inggris. The Citizens juga ingin melakukan hal tersebut dengan cara yang mengesankan.


etelah musim lalu kalah bersaing dengan Manchester United, City akan mencoba merebut kembali trofi Premier League dari tangan tetangganya itu. Untuk mewujudkan ambisinya, mereka telah banyak berbenah. Manuel Pellegrini ditunjuk sebagai nakhoda baru untuk memimpin armada City. Untuk memperkuat skuatnya, City

juga telah mendatangkan Stevan Jovetic, Fernandinho, Alvaro Negredo, dan Jesus Navas. Dengan modal seperti itu, City mampu membuat start bagus di Premier League musim ini. Mereka menggasak Newcastle United 4-0 pada pekan pertama. Tapi, musim masih sangat panjang. City bertekad untuk terus mempertahankan performa bagus dan permainan atraktif

mereka demi merebut titel. “Kami menginginkan titel itu kembali dan kami akan mencoba mendapatkannya lagi musim ini dengan sepakbola atraktif,” ujar bek City, Pablo Zabaleta, di Mirror. “Penampilan kami melawan Newcastle fantastis. Semangat tim bagus dan ini adalah cara main yang kami inginkan.” “Kalau Anda melihat tim-tim Pellegrini sebelumnya, mereka selalu bermain begitu. Mereka sangat agresif, selalu mencoba untuk ‘membunuh’ bola, masuk ke celah dan, di atas semua, bermain untuk menang.”

“Dia menciptakan tim-tim yang agresif dan menyerang, yang bermain dengan tempo bagus dan intensitas tinggi. Kami melakukannya ketika melawan Newcastle.” “Kami sudah bekerja sangat baik di pramusim. Komunikasinya dengan para pemain bagus dan dia mengungkapkan ide-idenya dengan sangat jelas.” “Kami tahu cara main yang kami inginkan. Tentu saja ini baru pertandingan pertama, tapi kami mencetak beberapa gol, tidak kebobolan, dan sekarang kami akan bersiap menghadapi Cardiff.” (dc/int)

Timnas U-19 Akan Jajal Uni Emirat Arab JAKARTA- Timnas Indonesia U-19 akan bertolak ke Kuala Lumpur, Malaysia, guna menjajal tim Uni Emirat Arab U19 dalam laga uji coba di Stadion Shah Alam. Laga ini merupakan persiapan sebelum Piala AFF bulan September mendatang. “Hari ini mereka berangkat. Mereka membawa 20 pemain. Nantinya mereka akan balik ke pemusatan

latihan lagi nanti tanggal 23 Agustus,” ujar Sekretaris Badan Tim Nasional (BTN) Sefdin Syaefuddin, Rabu (21/ 8). Skuad ‘Garuda Muda’ bakal melakoni Piala AFF U-19 di Surabaya, tanggal 9-22 September mendatang. Kejuaraan ini diikuti 12 negara yang akan dibagi ke dalam dua grup pada babak penyisihan. (dc/int)

Pemain yang Dibawa untuk Melawan UEA: 1. Ravi Murdianto (GK) 2. Rully Desrian (GK) 3. Febly Gushendra (Centerback) 4. Putu Gede Juni Antara (Centerback/Fullback) 5. Hansamu Yama Pranata (Centerback) 6. Rudolof Yanto Basna (Centerback) 7. Muhammad Fatchu Rochman (Fullback) 8. Dimas Sumantri (Fullback) 9. Mahdi Fahri Albaar (Fullback) 10. Muhammad Hargianto (Midfielder) 11. Al Qomar Tehupelasury (Midfielder) 12. Zulfiandi (Midfielder) 13. Paulo Oktavianus Sitanggang (Midfielder) 14. Evan Dimas Darmono (Midfielder) 15. Hendra Sandi Gunawan (Midfielder) 16. Maldini (Left Winger) 17. Septian David Maulana (Right Winger/Striker) 18. Muchlis Hadi Ning Syaifulloh (Left Winger/Striker) 19. Angga Febriyanto Putra (Striker) 20. Muhammad Dimas Drajad (Striker)

Liverpool Pinjam Cissokho dari Valencia LIVERPOOL- Liverpool resmi mendapatkan satu pemain baru lagi. Dia adalah Aly Cissokho yang didatangkan dengan status pinjaman dari Valencia. Kepastian tersebut langsung diumumkan oleh Liverpool melalui situs resmi mereka. Bek kiri berusia 25 tahun tersebut akan menghabiskan musim 2013/2014 bersama Liverpool. “Pemain berusia 25 tahun itu lolos tes medis, sebelum akhirnya menandatangani kontrak yang membuatnya akan meng-

habiskan musim 2013/14 dengan The Reds,” demikian bunyi pernyataan Liverpool. Cissokho menjadi pemain kelima yang didatangkan Brendan Rodgers musim ini. Sebelumnya, dia sudah mendatangkan Iago Aspas, Luis Alberto, Simon Mignolet, dan Kolo Toure. Cissokho didatangkan Valencia dari Olympique Lyon pada Agustus 2012. Dia bermain sebanyak 25 kali di La Liga musim lalu dan menyumbang 2 gol. (dc/int)

„ Aly Cissokho

Benitez Kembali Diuji Bologna

„ Rafael Benitez JAKARTA- Tiga tahun lalu Rafael Benitez melakoni debutnya di Seri A dengan melawan Bologna. Akhir pekan ini kembali Rossoblu akan menguji racikan Benitez bersama tim barunya, Napoli.

ti Gonzalo Higuain, Pepe Reina, Jose Callejon, Raul Albio, dan Dries Mertens. Dengan masih bertahannya Marek Hamsik serta Juan Zuniga, Napoli punya kans besar merebut Scudetto. Apalagi di sisa bursa transfer ini Napoli masih berencana mendatangkan pemain baru di posisi pertahanan seperti Martin Skrtel, Davide Astori, atau Javier Mascherano. Namun, sebelum itu skuat baru Napoli yang bertabur bintang akan mendapat ujian Bologna di San Naples, Senin (26/ 8) dinihari. Lawan yang musim lalu bikin “luka” untuk Napoli di Desember 2012. Setelah menang 3-2 di Seri A pada 16 Desember, tiga hari setelahnya Napoli yang juara bertahan Coppa Italia disingkirkan

“Mungkin bukan hal yang buruk langsung mendapatkan partai-partai berat,” kata Evans kepada Inside United. “Kami sudah menunggu sepanjang musim panas untuk kembali bertanding, jadi kenapa tidak langsung bermain di laga yang sulit?,” lanjut bek internasional Irlandia Utara ini. “Dalam kompetisi apapun Anda selalu menginginkan sebuah start yang bagus dan di Premier League tidak ada bedanya. Rentetan kemenangan di awal akan selalu membantu Anda tapi yang lebih penting adalah bagaimana Anda finis di akhir musim.” (dc/int)

Tiket Piala Dunia 2014 Mulai Dijual SAO PAULO- Tiket untuk pertandingan-pertandingan Piala Dunia 2014 mulai dijual secara online. Dalam waktu singkat, jumlah pembeli sudah melewati kuota yang ditetapkan FIFA. Per Selasa (20/8) waktu setempat, tiket Piala Dunia 2014 mulai dijual secara online. Meski tiket yang dijual baru untuk 16 pertandingan, dari total 64 laga yang akan digelar sepanjang turnamen, jumlah peminatnya sudah sangat tinggi. Dikutip dari Reuters, jumlah peminat laga pembukaan dan final sudah melebihi jumlah kursi yang tersedia di empat kategori harga yang berbeda. Hal tersebut membuat suporter yang sudah melakukan pemesanan harus menunggu nasib baik karena FIFA akan mengundi siapa-siapa saja yang bakal dapat tiket tersebut. Tiket lain yang juga diserbu

pada hari pertama penjualan adalah kategori termurah, yang diperuntukan khusus bagi warga negara Brasil. Penjualan tiket Piala Dunia

2014 secara online mulai dibuka sekitar pukul 17.00 WIB, Selasa kemarin. Sesaat setelah dibuka, FIFA mengklaim langsung mun-

cul ‘antrian virtual’ di situs resmi penjualan lantaran tingginya jumlah peminat. Sejauh ini negara dengan jumlah pemesan tiket terbesar adalah Brasil, Argentina, Amerika Serikat, Australia dan Inggris. Pada gelombang pertama ini dilepas sebanyak 81.821 tiket. Setiap pembeli diperbolehkan memesan empat tiket sekaligus untuk tujuh pertandingan berbeda. FIFA sebelumnya mengharapkan permintaan tiket akan setinggi saat Piala Dunia 2006, di mana saat itu untuk setiap lembar tiket ‘diperebutkan’ oleh tujuh orang. Ketika itu setidaknya 3,3 juta orang datang ke stadion menyaksikan pertandingan-pertandingan Piala Dunia di Jerman. Sementara tiga tahun lalu di Afrika Selatan, total tiket yang terjual sepanjang turnamen berjumlah sekitar dua juta lembar. (dc/int)

Inter Rekrut Saphir Taider dari Bologna MILAN- Menjelang bergulirnya Serie A 2013/2014, Inter Milan menambah amunisinya. Nerazzurri resmi merekrut pemain tengah internasional Aljazair Saphir Taider dari Bologna. Dilaporkan Sky Sports, Taider dan Inter telah menyepakati kontrak selama empat tahun dengan nilai sebesar 5,5 juta euro (Rp78,8 miliar) usai lulus tes medis yang dilakukan Selasa (20/8). “Aku sangat senang dan aku ingin berterima kasih kepada Bologna dan Inter karena telah memberiku kesempatan ini. Aku senang, Inter adalah sebuah klub hebat yang sudah memenangi segalanya,” ucap Taider. Pesepakbola berusia 21 tahun ini akan dapat bergabung dengan rekan-rekan barunya di

Inter dalam satu atau dua hari ke depan. Lahir dan besar di Prancis, Taider mengawali kariernya bersama Grenoble selama set-

ahun pada 2010 sebelum digaet Bologna. Selama dua musim berkostum Rossoblu, Taider tampil sebanyak 48 kali dengan sumbangan tiga gol. (dc/int)

„ Saphir Taider

Cabaye Dikabarkan Tertarik Gabung Arsenal

‘Debut’ di Seri A Inter jadi tim Italia pertama yang ditangani Benitez dan pada 30 Agustus lalu Benitez melakoni debutnya di kompetisi dengan melawat ke kandang Bologna. Inter tampil kurang mengigit dan harus puas dengan skor imbang tanpa gol. Setelahnya seperti diketahui bahwa Benitez hanya bertahan selama enam bulan di Inter sebelum dipecat oleh Massimo Moratti. Kini Benitez pun mencoba lagi peruntungannya dengan kembali berkarier di Italia dengan menangani runner-up Seri A musim lalu, Napoli, yang musim ini punya ambisi bersaing dengan Juventus memperebutkan titel juara. Kehilangan Edinson Cavani langsung ditebus dengan sejumlah pembelian top seper-

MANCHESTER- Manchester United langsung dihadapkan dengan jadwal berat di awal musim Premier League. Bek tengah MU Jonny Evans justru merasa senang dengan situasi demikian. Setelah di laga pembuka memperoleh kemenangan meyakinkan dengan mengalahkan Swansea City 4-1 di Liberty Stadium, MU akan menghadapi Chelsea di akhir pekan nanti. Selanjutnya, ‘Setan Merah’ akan bertandang ke Liverpool pada awal September sebelum bersua rival sekotanya Manchester City (22/9) yang didahului dengan menjamu Crystal Palace sepekan sebelumnya. Dengan laga-laga yang berat itu, MU berisiko kehilangan poin sehingga berpotensi tertinggal dari rival-rivalnya. Meski begitu, Evans menilai ada sisi positif dari situasi ini.

Bologna. Inilah yang harus diwaspadai Benitez jika tak mau debutnya berakhir tanpa tiga angka lagi. Meski Napoli punya skuat yang lebih baik dari Bologna, tapi kualitas Alberto Gilardino, Alessandro Diamanti atau pemain barunya, Rolando Bianchi, bisa memberikan kejutan untuk Il Partenopei di partai pembuka kali ini. Padahal Napoli dan Benitez juga masih mencari bentuk terbaik skuat itu setelah melalui sesi pramusim lalu. Dari enam laga, Napoli menang empat kali, satu imbang dan satu kalah. Soccerbase mencatat Bologna lebih unggul jumlah kemenangan dalam total 20 pertemuan di seluruh kompetisi dengan Napoli dengan sembilan berbanding delapan. Tiga laga lain berakhir imbang. (dc/int)

LONDON- Ketertarikan Arsenal terhadap Yohan Cabaye dikabarkan mendapatkan sambutan bagus dari si pemain. Namun, Newcastle United tidak akan semudah itu melepasnya. Sky Sports menyebut bahwa prospek bermain di Liga Champions bersama Arsenal telah menggoda Cabaye. Kendati demikian, masalah ada pada negosiasi kedua klub. Seperti diberitakan sebelumnya, Arsenal membuka penawaran dengan angka 10 juta poundsterling. Sedangkan Newcastle meminta 20 juta pounds untuk gelandang berusia 27 tahun itu. Permintaan Newcastle pun bisa dipahami mengingat Cabaye berstatus sebagai pemain penting buat mereka dan masih punya sisa kontrak tiga tahun lagi. Cabaye tidak dimainkan

„ Yohan Cabaye

ketika Newcastle menghadapi Manchester City hari Senin lalu. Dia tidak juga berada di bangku cadangan. Kabar yang beredar menyebut bahwa Manajer Alan Pardew mengistirahatkannya untuk memberinya kesempatan berpikir. “Kami sudah mempersiapkan si pemain selama tiga hari, lalu pikirannya terganggu akibat adanya tawaran dari Arsenal tak lama sebelum laga dimulai,” ujar Pardew. Manajer berusia 52 tahun itu pun menyebut bahwa Arsenal tidak mengormati timnya dengan memberikan penawaran sebelum pertandingan dimulai. Cabaye tidak main dan akhirnya The Magpies —yang juga bermain dengan 10 orang setelah Steven Taylor dikartu merah— kalah 0-4 pada pertandingan tersebut. (dc/ int)


KAMIS 22 Agustus 2013


1 1




Manchester United

1 1




3 3

Aston Villa

1 1












West Ham




























Tottenham Hotspur 1



















Rayo Vallecano






3 3

Atlético Madrid







Real Sociedad








1 1





Athletic Club








1 1





Real Madrid

1 1






1 1





Celta de Vigo

1 0











Bayer Leverkusen 2






Bayern München







Mainz 05







Werder Bremen







Hertha BSC




























Hannover 96







SUSUNAN PEMAIN: PSV (4-2-3-1): Zoet; Brenet, Bruma, Rekik, Willems; Schaars (Oscar Hiljemark ’89), Maher; Park (Florian Jozefzoon ’68), Wijnaldum, Depay; Matavz (Locadia ’75). AC MILAN (4-3-3): Abbiati; Abate, Mexes, Zapata, Emanuelson; Montolivo, De Jong (Andrea Poli ’78), Muntari; Boateng (L. Niang ’84), Balotelli, El Shaarawy.

PELATIH AC Milan, Massimilano Allegri, menilai peluang timnya dan PSV Eindhoven untuk lolos ke babak kualifikasi Liga Champions masih sama besar.


ilan meraih hasil imbang 1-1 ketika bertandang ke markas PSV di Philip Stadium, Rabu (21/8) dinihari dalam laga play-off Liga Champions. Dengan hasil itu, I Rossoneri memiliki keunggulan agresivitas gol tandang dan tugas mereka hanya tinggal menahan imbang PSV tanpa gol di San Siro jika ingin lolos. Allegri beranggapan, hasil seri tanpa gol tidak cukup untuk meloloskan Milan. PSV sudah pasti akan berupaya mati-matian untuk bisa membalas keunggulan gol tandang yang dimiliki Milan sehingga dia berharap agar anak-anak asuhnya tetap bisa fokus untuk menghadapi leg kedua nanti. Milan baru akan menjamu PSV di San

Siro pada 28 Agustus 2013. “Jika kami menang, terutama dengan keunggulan dua poin, maka tugas lebih mudah akan kita emban di leg kedua. Kami sekarang akan fokus untuk menghadapi Verona terlebih dulu, baru ke PSV,” ungkap pria berusia 46 tahun itu seperti dilansir Sky Sports Italia.Sebenarnya Milan unggul terlebih dahulu melalui tandukan Stephan El Shaarawy pada menit ke-15. Namun, striker PSV asal Slovenia, Tim Matavs, mampu menyamakan kedudukan di paruh kedua dan membuat skor akhir menjadi imbang. “Peluang untuk lolos bagi kedua klub terbuka di leg kedua. Sangat disayangkan banyak peluang yang

didapat tapi tak bisa dikonversi menjadi gol. Akhirnya pertandingan menjadi imbang,” jelas Allegri. Akhiri Paceklik Gol Striker muda AC Milan, Stephan El Shaarway, mengaku puas bisa mengakhiri paceklik golnya. Shaarawy memang belum mencetak gol lagi untuk I Rossoneri sejak Februari 2013 lalu. Ini terasa semakin manis ketika gol tersebut dia persembahkan untuk Milan di laga play-off Liga Champions melawan PSV Eindhoven. The Little Pharaoh mencetak gol melalui sundulannya ketika laga baru berjalan 15 menit. Umpan silang Ignazio Abate disambutnya dengan tandukan keras yang menghujam gawang PSV. Ini juga menjadi gol pertama Shaarawy dengan kepalanya. “Ini adalah gol pertama saya sejak laga derby pada February 2013 lalu. Dan juga merupakan gol pertama dengan sundulan,” kata Shaarawy usai pertandingan seperti

dilansir Football Italia. Sayangnya, gol Shaarawy mampu disamakan striker PSV, Tim Matavz, di babak kedua. “PSV melakukan start yang baik, tapi kami mampu unggul lebih dulu dengan dua hingga tiga peluang emas. Pada akhirnya mereka mampu menyamakan kedudukan. Penampilan yang baik dan hasil yang penting,” ungkap pemain berusia 20 tahun itu. “Hasil seri ini normal karena kami punya masalah di kebugaran fisik tapi kami tetap fokus dan punya intensitas permainan yang baik. Yang utama adalah tugas kami hanya tinggal menahan imbang mereka tanpa gol di kandang agar bisa menang,” dia menambahkan. Mudah Kalahkan Milan Sementara dari kubu seberang, mempunyai penilaian yang berbeda pula. Seperti yang diutarakan Adam Maher. Menurutnya, bagi PSV, mengalahkan AC Milan adalah hal yang mudah. Ia juga tetap

menjaga optimisme lolos ke Liga Champions 2013/2014. Tidak berniat mengecilkan kekuatan raksasa Italia yang sekaligus langganan Liga Champions ini, namun bagi Adam Maher, jika rekan-rekannya tampil layaknya leg pertama, maka peluang lolos masih sangat terbuka. “Pertandingan ini merupakan sebuah bentuk kepercayaan yang nyata,” buka Maher kepada Goal International. “Kita bisa mengalahkan Milan di San Siro jika kita meniru kinerja kami dari leg pertama. Kami yakin bahwa kami bisa mendapatkan hasil yang positif dan bisa bahkan memenangkan pertandingan,” tambahnya. Perihal hasil seri tersebut, Adam Maher juga memberi sedikit komentar. Optimisme Maher ini bakal diuji ketika PSV membesuk AC Milan di leg kedua yang rencananya akan digelar pada 28 Agustus nanti. (dc/ int)

22 kamis 08 2013 metro tabagsel  
22 kamis 08 2013 metro tabagsel  