Issuu on Google+

GADIS ASAL BEL AWAN JADI KORBAN TRAFICKING BELAWAN ○

8

BACA DI HAL ○

MAYAT KULI BONGKAR MUAT MENGAPUNG DI KOL AM KOLAM ○

Memulai KERJA KERAS memang sangat BERAT. Tapi KALAU sudah TERBIASA bekerja keras, semua PEKERJAAN akan menjadi MUDAH. (*) DAHLAN ISKAN

9

BACA DI HAL ○

Edisi 249 „ TTahun ahun VI

MINGGU, 15 September 2013

GEREBEK RUMAH BANDAR NARKOBA DI SIMPANG GAMBUS LIMAPULUH

BNN Sita 1 Kg Sabu dan Ratusan Pil Ekstasi LIMAPULUH-Suasana sepi di Desa Simpang Gambus, Kecamatan Limapuluh Batubara, Sabtu (14/9) sekira pukul 10.00 WIB, mendadak heboh. Pasalnya, personil Badan Narkotika Nasional (BNN) bersenjata lengkap, menggerebek rumah Dora (28), yang disebut-sebut bandar narkoba di daerah itu.

Data dihimpun METRO ASAHAN di lokasi, personil BNN sudah melakukan pengintaian selama dua bulan terhadap rumah DR yang kerap dijadikan sebagai lokasi transaksi narkoba. Saat dilakukan penggerebekan, Dora tidak berhasil ditemukan di dalam rumah. Delapan personil yang melakukan tugas, hanya menemukan barang bukti dari dalam rumah masingmasing 1 kilogram sabu-sabu, ratusan pil ekstasi, timbangan, bong, dan mobil

lancer milik Dora pun turut disita dan dibawa ke Poldasu. Terlihat, delapan personil ketika keluar dari dalam rumah milik Dora disaksikan ratusan warga, membawa kantongan dan goni diduga berisi seluruh barang bukti yang disita. Ketika personil hendak meninggalkan lokasi, sempat terjadi perdebatan dengan Kepala Desa Simpang Gambus Idris Dile. Idris, sempat keberatan jika mobil

Lancer yang ada di depan rumah Dora ikut disita sebagai barang bukti. Namun, setelah personil Polsek Limapuluh tiba di lokasi, perdebatan bisa ditenangkan, dan mobil Lancer tetap ikut disita dan dibawa personil BNN. Kepala Desa Simpang Gambus Idris Dile ketika dikonfirmasi, mengaku sebelum dilakuka penggerebekan di rumah Dora, delapan pria bersenjata

‹ ‹ Baca BNN ...Hal 2

1 November, Inalum Jadi Milik Indonesia

„ Fauzi dan Ramadhan bersalaman saling memaafkan atas isu memelihara tuyul.

DITUDUH PELIHARA TUYUL

Along-along Nyaris Dibakar Massa AEKKUASAN-Rahmad (40), warga Desa Desa Afdedling I Kebun Socfindo Kecamatan Aek Kuasan, nyaris dimassakan warga. Pasalnya, pria yang bekerja sebagai along-along (pedagang keliling,red) dituduh memelihara tuyul. Informasi dihimpun ME-

TRO ASAHAN, peristiwa itu berawal ketika Suarno ((23) kesurupan diduga dimasuki roh halus, Selasa (9/9) lalu. Melihat Suarno kesurupan, warga menyarankan keluarga memanggil paranormal.

‹ ‹ Baca Along ...Hal 5

Demokrat Tanjungbalai

JAKARTA–Tim perunding Indonesia dan konsorsium Nippon Asahan Aluminium (NAA), hingga kini belum juga mencapai kesepakatan terkait besaran nilai kompensasi yang harus dibayarkan Indonesia sebagai pengganti saham NAA yang mencapai 58 persen pada PT Inalum. Padahal kontrak kerjasama antara Indonesia dengan Jepang sudah harus berakhir 31 Oktober 2013 mendatang. “Sampai hari ini pembicaraan masih seperti kemarin. Belum ada kesepakatan berapa nilai buku dari total seluruh aset Inalum yang ada. Hanya bedanya, kini kita sudah sama-sama mengerti situasi masing-masing,” ujar Direktur Jenderal (Dirjen) Kerjasama

Dahlan Tokoh yang Mumpuni TANJUNGBALAI-Langkah Menteri BUMN Dahlan Iskan untuk ikut maju dalam konvensi calon presiden Partai Demokrat disambut gembira oleh kalangan petinggi partai berlambang mercy itu di Kota Tanjungbalai. Mereka berpendapat, dengan segala reputasinya selama ini, Dahlan Iskan adalah salah satu tokoh Indonesia

‹ ‹ Baca Dahlan ...Hal 2

„ Ridwan Ritonga

‹ ‹ Baca 1 November ...Hal 2

FOTO:SUSILAWADY

„ Petugas sedang melakukan pemeriksaan terhadap kendaraan roda empat saat digelar sweeping di kawasana Makam Pahlawan Kisaran.

Polres Asahan Sweeping Jalinsum Medan-Rantauprapat Pasca Perampokan Toko Mas Suranta FOTO: PRA EVASI HALOHO

„ Ida saat berada di Mapolres Sianta saat membuat laporan pengaduan, Sabtu (14/9).

Dihamili, Janda Polisikan Oknum Honorer Disdik SIANTAR-Berharap perlindungan malah jadi bencana. Begitulah yang dihadapi janda beranak satu, sebut saja Ida (24). Percaya janji manis pacarnya yang akan menikahinya, dia rela melakukan hubungan layaknya suami istri tanpa ikatan pernikahan. Tapi saat meminta pertanggungjawaban kepada keluarga oknum honorer di Dinas Pendidikan (Disdik) Siantar itu, dia diabaikan meski sedang berbadan dua. Merasa tidak ada respon, korban akhirnya melaporkan perbuatan kekasihnya itu ke polisi, Sabtu (14/9). Menurut ibu kandung korban, A br S (56) pihaknya terpaksa

‹ ‹ Baca Dihamili ...Hal 2

KISARAN-Pasca terjadinya aksi perampokan toko emas oleh 6 pria bersenjata api di Medan, pihak Polres Asahan langsung melakukan sweeping di Jalin-

sum Medan-Rantauprapat, Jumat (13/ 9) sekitar pukul 21.00 WIB. Kapolres Asahan AKBP Budi Suherman didamping Kasat Reskrim AKP Hendra Eko Triyulianto kepada METRO ASAHAN mengatakan, kegiatan yang dilakukan merupakan giat rutin yang ditingkatkan guna mengatisipasi tindak kejahatan, terlebih pasca terjadinya peristiwa perampokan toko emas di Medan. Budi juga menerangkan, pada siang

hari pihaknya juga melakukan razia kendaraan untuk menekan angka kecelakaan. “Pada malam hari, selain tim gabungan, giat rutin juga dilaksanakan dengan sasaran kendaraan roda dua dan empat,” katanya. Sementara, pemilik Toko Mas Suranta Edi Suranta ketika di Polresta Medan, mengaku kecewa atas kinerja pihak

‹ ‹ Baca Polres ...Hal 2

Dedikasi Radja Murnisal Nasution di Tengah Keterbatasan Fisik

Meski Kaki Diamputasi, Akan Melatih sampai Mati Bagi pencinta olahraga renang, nama Radja Murnisal Nasution sudah tidak asing. Dia adalah pencetak perenang andal Indonesia. Tapi, diabetes telah mengamputasi kaki kanannya. Hebatnya, dia tetap aktif membina atlet renang. NARENDRA PRASETYA, Jakarta

FOTO: HENDRA EKA/JAWA POS

„ Radja Murnisal Nasution

“AYO, lebih cepat lagi renangnya, yang tidak bisa cepat harus bersiap-siap menerima hukuman lari keliling kolam renang 20 kali.” Suara yang bernada perintah itu seakan membelah keheningan kolam renang di kompleks Gelora Bung Karno (GBK), Senayan, Jakarta, Senin pagi (9/

9). Itulah suara lantang Radja Murnisal Nasution dari atas kursi roda di pinggir kolam renang. Hingga kini belum ada pelatih renang Indonesia sehebat dia dalam mencetak para juara. Di antaranya, para perenang Trah Nasution. Mulai Elfira Rosa Nasution, Elsa Manora Nasution, Maya Masita Nasution, hingga Kevin Rose Nasution dan Muhammad Akbar Nasution. Selain putra-putrinya sendiri, banyak lagi perenang kaliber nasional yang lahir dari tangan dingin pria kelahiran Medan, 64 tahun silam, tersebut.

‹ ‹ Baca Meski ...Hal 5

FOTO;DHEV FRETES BAKKARA

„ Para peserta lomba renang sepanjang 120 Kilometer mengelilingi pulau Samosir tiba di garis finish disambut para penonton, Jumat (13/9)

Refleksi Festival Danau Toba 2013

Jalan Masih Panjang PARAPAT- Bicara soal keindahan alam dengan seluruh lanskap dan kekayaan budaya masyarakat sekitar Danau Toba, nyaris diakui semua orang. Sungguh kawasan yang terberkati. Rasa takjub akan keindahan itulah alasan mengapa Da-

nau Toba ‘pernah’ jadi primadona. Tapi situasi saat ini tampak sangat ironis. Saat ini kehidupan masyarakat di kawasan Danau Toba seolah tak bernya-

‹ ‹ Baca Jalan ...Hal 2


6

MINGGU

15 September 2013

Dokter RSU Djsamen Kosong Pasien Jampersal Operasi di RS Tentara SIANTAR- Irawati (23), warga Jalan Rakutta Sembiring, Kelurahan Pondok Sayur, Siantar Martoba, terpaksa harus melahirkan anak pertamanya di RS Tentara, Kamis (12/9) pukul 04.30 WIB. Dia berniat bersalin di RSU Djasamen Saragih dengan menggunakan Jampersal, karena keterbatasan ekonomi. Akan tetapi, saat itu perawat yang berjaga mengatakan tidak ada dokter yang menangani hingga pukul 09.00 WIB.

Informasi dihimpun dari pasien, pagi itu sekira pukul 03.30 WIB, dia sudah merasakan anak pertamanya akan lahir. Namun, keluarganya membawanya ke seorang bidan untuk membantu proses kelahiran. Namun, karena anaknya sudah keadaan sungsang (posisi bayi tidak pada tempatnya, sehingga sulit lahir normal), dia diharuskan menjalani operasi. Selanjutnya bidan Boru Purba tersebut menyarankan Irawati mendatangi RSU Djasamen

Polres Asahan Sweeping Jalinsum Medan-Rantauprapat Sambungan Halaman 1 kepolisian. Pasalnya, kepolisian melepaskan Gani, pria yang berada di toko ketika terjadi aksi perampokan. Menurut Edi Suranta, Gani diduga kuat terlibat peraampokan itu. Sebab, dari rekaman CCTV yang kini diamankan pihak kepolisian, terlihat Gani tidak duduk saat para perampok menggasak toko emasnya. “Si Gani itu dari rekaman CCTV yang lainnya, tunduk ke bawah tapi dia berdiri aja,” ujar Edi. Bukan hanya itu, saat para perampok berada di dalam toko, terlihat Gani sempat keluar dari dalam kemudian masuk kembali. “Dalam rekaman itu, sempat Gani keluar padahal perampok itu masih di dalam. Habis itu, masuk lagi,” jelas Edi. Dan paling disesalkan Edi, saat para pelaku hendak meninggalkan toko, Gani sempat menjabat tangan salah seorang pelaku. “Habis itu, sempat lagi dalam rekaman itu si Gani

bersentuhan tangan dengan pelaku. Kenapa dipulangkan, makanya sudah lemas saya. Cuma bisa pasrah,” kesal Edi. Kasat Reskrim Polresta Medan Kompol Celvijn Simanjuntak, ketika dikonfirmasi, membenarkan Gani sudah dipulangkan karena tidak cukup bukti untuk dilakukan penahanan atas keterlibatan perampokan itu. Dia menyebutkan, pihaknya telah membentuk tiga tim untuk mengungkap aksi perampokan yang berhasil membawa kabur 15 kilogram emas senilai Rp7 miliar itu. Dua Kreta Dicuri Terpisah, sepedamotor Yamaha Vega R BK 3222 QY milik Hajrin Fauzan (27), warga jalan Imam Bonjol Kisaran dan sepedamotor Yamaha Vixon BK 2598 IJ milik Berlin Hasibuan (40), warga Jalan Kartini Kisaran, diembat pencuri. Sepedamotor Hajrin dan Berlin, hilang saat diparkir di depan rumah mereka, Rabu (11/9) sekira pukul 03.00 WIB. Dan keduanya sudah membuat laporan ke Polres Asahan.(sus)

Dahlan Tokoh yang Mumpuni Sambungan Halaman 1 yang mumpuni dan diyakini mampu untuk memimpin negara ini.”Kami sangat mendukung dan menyambut baik dengan keikutsertaan dari Pak Dahlan dalam konvensi calon presiden. Tentu saja, Pak Dahlan tokoh yang sangat berkompeten. Namun demikian, secara organisasi, kita juga sangat mendukung sepenuhnya terhadap seluruh tokoh yang ikut dalam konvensi tersebut. Karena apapun itu nantinya hasil dari konvensi, itu adalah hasil terbaik dari organisasi,” kata Ketua DPC Partai Demokrat Kota Tanjungbalai, H Ridwan Ritonga Amd, belum lama ini. Hal senada juga diungkapkan Asfi Kelana, Ketua Assosiasi Pengusaha Kilang Minyak Makan (APKMM) Kota TanjungbalaiAsahan saat ditemui ditempat terpisah. Katanya, dengan segala reputasinya selama ini, Dahlan Iskan sudah layak untuk menjadi orang nomor satu di negeri ini. “Saya support kepada Pak Dahlan yang telah ikut konvensi

capres Demokrat. Pasalnya, saya tidak ragu dengan kapasitas yang dimiliki pleh Pak Dahlan, namun kita perlu juga mengetahui visinya untuk Indonesia. Tentu saja yang kami ketahui sosok seperti Pak Dahlan Iskan memiliki reputasi yang sangat baik secara nasional,” ungkap Asfi Kelana yang juga mantan fungsionaris DPC Partai Demokrat Kota Tanjungbalai ini. Kendati mengapresiasi dan menyambut baik, kedua kader Partai Demokrat ini menegaskan, bahwa saat ini masih terlalu dini bagi jajaran partai di daerah untuk memberikan dukungan penuh kepada salah satu dari peserta konvensi capres. Alasannya, karena sebelas orang yang kini sudah diumumkan sebagai peserta konvensi calon presiden dari Demokrat juga adalah tokohtokoh yang dengan reputasi baik. “Bagi kita, siapapun yang terpilih nanti, misalnya Pak Dahlan, tentu kita akan mendukung sepenuhnya karena memang dialah yang terbaik secara keseluruhan,” katanya. (ck-5/smg)

METRO ASAHAN Anggota SPS No.: 438/2003/02/A/2007

Penerbit : PT. Siantar Media Pers (Metro Siantar, Metro Tapanuli, Metro Asahan, Metro Tabagsel ) Chairman : Komisaris Utama : Komisaris : Direktur Utama : Direktur : Pengasuh Pemimpin Umum/Penjab/GM : Wakil PU/Pimpinan Perusahaan : Pimred Metro Siantar : Plt.Pimred Metro Tapanuli : Pimred Metro Tabagsel : Pimred Metro Asahan : Wakil Pimpinan Metro Asahan: Tim Ombudsman :

Rida K Liamsi Makmur Kasim Khadafi Marganas Nainggolan Maranatha Tobing Marganas Nainggolan Maranatha Tobing Pandapotan MT Siallagan Daniel Simanjuntak Muhiddin Hasibuan Eva Wahyuni Darwin Purba Vincent Wijaya

Saragih agar dilakukan operasi. Setelah mendengar pernyataan bidan, pihak keluarga sepakat membawa Ira operasi cesar di RSU Djasamen Saragih ditemani dua orang pegawai bidan tersebut. Setibanya di RS Djasamen, pegawai bidan Boru Purba tersebut melakukan perbincangan dengan perawat

yang bertugas. Setelah beberapa menit berbincang, kedua pegawai tersebut mengatakan bahwa saat itu tidak ada dokter yang menangani hingga pukul 09.00WIB. Pihak keluarga tidak ingin mengambil resiko dan langsung membawa Ira ke RS Tentara untuk menjalani operasi cesar. Setengah jam setibanya di RS Tentara, dr Fitri langsung melakukan operasi cesar untuk

kelahiran putri pertama dari pasangan Ira dan Putra. Ira mengatakan, dia menjalani oeprasi dengan lancar tidak ada kendala yang berarti. Operasi tersebut berjalan hingga memakan waktu satu jam. “Memang kata bidan itu, kami bisa mengurus Jampersal. Bahkan fotocopi KTP kami sudah diminta untuk mengurusnya. Makanya kami langsung ke RS Djasamen,” katanya.

Dia juga mengatakan, untuk biaya operasi dia belum punya jalan keluar. Karena tidak ada persiapan untuk biaya persalinan. Selama ini, suaminya hanya bekerja sebagai montir di salah satu bengkel sepedamotor. “Kalau kabar-kabarnya biayanya sampai Rp6 juta, Bang. Makanya ini masih bingung carinya,” katanya. Sementara, Humas RSU Djasamen Saragih dr Andy Rangkuti, mengaku belum

mengetahui kejadian tersebut. Dia mengakui seharusnya saat itu ada dokter yang berjaga untuk mengantisipasi hal yang seperti ini. “Saya belum dapat kabar mengenai hal itu. Saya harus cek dulu kebenarannya,” katanya saat diihubungi METRO memalui selularnya. dr Rangkuti juga mengatakan, masih mengecek siapa dokter yang jaga saat itu. (lud)

BNN Sita 1 Kg Sabu dan Ratusan Pil Ekstasi Sambungan Halaman 1 laras panjang, mendatanginya sekira pukul 09.15 WIB. Kedelapan pria memakai rompi bertulis NARKOTIKA POLICE, setelah menunjukkan surat tugas, langsung dibawanya ke rumah Dora.

“Kalau personil BNN Cuma 5 orang, 3 orang lagi personil polisi,” katanya. Ditambahkan Idrin, ketika personil melakukan penggerebekan, dia ikut menyaksikan dengan warga sekitar. Dan dia juga sempat menanyakan, apa saja yang ditemukan para pesonil

dari dalam rumah. “Aku tanya apa saya yang didapat, ternyata benar di rumah itu mereka (personil) menemukan bungkusan plastik di dalam kantong plastik lain yang lebih besar berisi sabu-sabu dan pil ekstasi,” ujarnya. Terpisah, Kapolsek Limapuluh

AKP M Ritonga, membenarkan adanya penggerebekan rumah warga diduga bandar narkoba. Dan saat penggerebekan itu, pihaknya juga turut berada di lokasi untuk mengamankan situasi, karena warga banyak berdatangan ingin menyaksikan penggerebekan itu.

“Benar ada penggerebekan, kita kirim personil juga ke sana mengamankan situasi. Para personil dari Medan itu, sudah melakukan koordinasi terlebih dahulu dengan Kepala Desa kemudian diteruskan kepada pihak kita,” kata Ritonga singkat. (ck-4)

Dihamili, Janda Polisikan Oknum Honorer Disdik Sambungan Halaman 1 menempuh jalur hukum karena perbuatan JA yang menghamili putrinya, namun lepas tanggung jawab. Hal itu terungkap ketika ia mendengar langsung dari pengakuan putrinya itu bahwa JA sudah kabur setelah menyampaikan bahwa putrinya sudah hamil. Padahal sebelumnya, JA engan gagahnya mengaku akan segera menikahi putrinya bila kelak keluarga menyetujui hubungan asmara dengan putinya. “Tapi itulah, si JA ini kerja di Dinas Pendidikan, tapi tidak mencerminkan dari sifatnya,” kata A br S kesal. Sedangkan Ida yang merupakan warga Kecamatan Marihat, ketika dikonfirmasi usai melapor mengatakan, kekasihnya itu kabur entah ke mana setelah dirinya

memberitahu telah hamil. Hal itu ia sampaikan, Senin (9/9) usai mendatangi tukang urut di Sibatu-batu, Siantar Sitalasari. Dia ke sana karena sebelumnya mengalami mual-mual yang dikiranya hanya masuk angin. Namun saat tubuhnya diurut, tukang urut memberitahu kalau dia sudah mengandung bayi yang besarnya sudah mencapai telapak tangan. Meski kurang yakin, Selasa (10/ 9) siang dia bertemu dengan JA kekasihnya seraya memberitahu kalau dirinya sedang hamil. Karena kurang yakin, keduanya sepakat memeriksa kandungan dengan mendatangi seorang bidan di Kelurahan Tomuan, Siantar Timur. Hasilnya positif dan usai kandungan beranjak tiga bulan. “Tapi sakitnya Bang, si JA pacarku ini malah meminta untuk menggugurkan

kandunganku ini. Jelas aku tolak karena itu dosa besar, setelah dosa yang kami perbuat,” kata Ida berlinang air mata. Dia menambahkan, selain penolakan keras menggugurkan kandungannya itu, dia juga mengingatkan janji yang pernah diucapkan pacarnya yang akan bertanggungjawab bila dia hamil setelah melakukan hubungan layaknya suami istri. Sebab, sebelumnya JA berjanji akan memperjuangkan hubungan mereka sekalipun keluarga calon ayah dari bayi yang dikandungnya itu menolak. Tapi janji tinggal janji. JA hilang bak ditelan bumi setelah korban menolak menggugurkan kandungannya. Beberapa kali HP JA dihubungi, tetap tidak aktif. Sedangkan usaha korban terus dilakukan dengan mendatangi

Bapa Uda pacarnya yang merupakan mantan DPRD Kota Siantar. namun usaha tersebut tetap saja sia-sia, karena yang ditemui tetap ‘buang badan’ dan mengaku tidak peduli dengan apa yang dilakukan pelaku. “Pacarku ini Bang sudah yatim piatu dan keluarnya, ya Pak A yang pernah anggota dewan Siantar itu,” kata Ida. Tak ada pilihan, keluarga korbanpun sepakat melaporkan JA ke Polres Siantar dengan harapan pelaku bisa diamankan hingga bersedia bertanggungjawab atas perbuatannya. Dia mengisahkan awal perkenalannya dengan pelaku, di warung tuak milik orangtua korban. Saat itu, JA menganu jatuh hati padanya persisnya setahun lalu sekitar awal November. Bahkan saat menjalin hubungan, keduanyapun merayakan dengan jalan-jalan

Tenda Biru di Ajibata. Karena percaya setelah JA serius mengungkapkan akan menikahinya, lantas hubungan terlarang itupun terjadi. Korban sendiri sudah memiliki anak dari mantan suaminya marga Manurung yang sudah meninggalkannya karena selingkuh dengan wanita lain sekitar tahun 2010 lalu. Terkait laporan itu, Kasubag Humas Polres Siantar AKP Efendi Tarigan mengatakan laporan korban sudah diterima. Namun untuk sementara, masih masuk dalam pengaduan masyarakat. Sebab, korban dan pelaku sudah sama-sama dewasa dan hubungan itu dianggap pilihan sendiri. “Mereka sudah dewasa, terkecuali si wanitanya masih di bawah umur, kita akan langsung tindaklanjuti,” kata Efendi. (dho/ck3)

tuyul. Tuduhan Paijan, membuat kehebohan di Desa Afdeling I, sehingga warga datang ke rumah Rahmad. Ketika itu, warga yang emosi hendak memassakan Rahmad dan hendak membakar rumahnya. Beruntung, situasi bisa dikendalikan Lukman (45) Kepala Desa Afdeling I. Lukman sendiri, terpaksa memanggil Kapolsek Pulau Raja AKP H Torang Arifin Rangkut, Camat Aek Kuasan Suherman Siregar, Danramil, KUA, dan Ketua MUI Aek Kuasan. Ketika dilakukan dialog dengan warga di kantor kepala desa, Kapolsek Pulu Raja AKP

H.Torang Arifin Rangkuti, meminta masyarakat agar tidak terpancing dengan isu yang belum pasti, apalagi hendak main hakim sendiri. Dia mengimbau, agar masyarakat tidak mudah percaya terhadap hal-hal gaib. Bahkan, Rangkuti sempat menegur Sulam agar tidak meniru hal-hal negative dari sinetron. Kepala Desa Afdeling I Kebun Socfindo Lukman, ketika dihubungi METRO, Sabtu (14/9) membenarkan adanya peristiwa itu. Dia menyebutkan, beberapa tahun terakhir di desanya memang kerap terdengar isu bahwa ada orang yang menuntut

ilmu pesugihan. “Memang sudah sering ada isu ada warga memelihara pesugihan, mungkin kejadian kemarin buntut dari isu itu. Tapi, sebenarnya itu tidak perlu terjadi. Karena harusnya masyarakat jangan mudah terpancing dengan isu itu,” kata Lukman. Disebutkan Lukman, perbuatan masyarakat yang hendak memassakan Rahmad dapat dihindari. Karena, pihaknya bersama Uspika Aek Kuasan dan tokoh agama cepat melakukan antisipasi. Dia mengungkapkan, Rahmad selama ini dikenal sebagai iman di masjid, dan giat bekerja

sehingga saat ini berhasil membangun rumah dan memiliki ternak. “Rahmad itu tipe giat bekerja, jadi wajar dia berhasil, jadi tak perlu dicurigai memelihara roh halus,” pungkas Lukman. Ditambahkannya, setelah dilakukan musyawarah akhirnya didapatkan kesepakatan antara masyarakat dan Rahmad demikian juga dengan keluarga Paijan, untuk tidak memperpanjang masalah itu. “Mereka (Paijan dan Rahmad), masih memiliki hubungan saudara, jadi sudah damai dan sudah maaf-maafan,” ujar Lukman. (sof)

Along-along Nyaris Dibakar Massa

Sambungan Halaman 1 Mendapat saran dari warga, keluarga Suarno memanggil Sulam (45) karyawan PT. Socfindo, yang juga dikenal warga sebagai paranormal. Ketika dilakukan ritual di rumah Suarno, Sulam kemudian menanyai roh halus yang masuk di dalam tubuh Suarno. Warga terkejut, ketika Suarno yang kesurupan mengaku bernama Rahmad. Paijan, orangtua Suarno mendengar perbicangan saat ritual itu, langsung menemui Rahmad di rumahnya. Paijan, menuduh Rahmad memelihar

Jalan Masih Panjang Sambungan Halaman 1 wa. Seluruh sektor kehidupan, sebagai efek berantai (multiplier effect) pariwisata, lesu seperti tak ada prospek. Padahal, era tahun 1980 hingga 1990-an, Danau Toba pernah mencapai puncak kejayaannya. Kini, semua seolah

sirna. Apakah masa-masa kejayaan itu akan kembali? Sepertinya, jalan masih sangat panjang. Sejak resesi dunia menghempas tahun 1997, berbagai program telah dilakukan untuk memulihkan sektor pariwisata di kawasan Danau Toba, termasuk menggelar Pesta Danau Toba setiap tahun, yang pada tahun 2013 ini diubah namanya menjadi Festival Danau Toba (FDT). Tapi upaya itu belum membuahkan hasil. Sekilas merunut, tahun 1980 hingga1990-an, daerah wisata Parapat, Kabupaten Simalungun, masih menjadi tujuan wisata paling favorit. Ia seperti magnet, wisatawan lokal maupun wisatawan mancanegara, masih berduyun-duyun mendatangi kota itu, pun jadi tempat transit menuju Samosir melalui dermaga Tigaraja atau Ajibata. Di era kini, jumlah wisatawan mestinya meningkat. Tapi tidak. Energi dan pesona Danau Toba justru terlihat pudar, seolah tak mampu lagi memanggil orang untuk datang. Saidin Situmorang (51), salah seorang saksi kejayaan pariwisata tahun 1980-an, mengatakan, ketika itu Parapat adalah tempat masyarakat menaruh harapan untuk memeroleh kehidupan

Departemen Redaksi METRO ASAHAN Dewan Redaksi Group : Marganas Nainggolan (Ketua), Maranatha Tobing, Pandapotan MT Siallagan, Muhiddin Hasibuan, Eva Wahyuni, Daniel Simanjuntak, Leo Sihotang, Nasa Putramaylanda, Hermanto Sipayung, Nurjannah. Redaktur Pelaksana: Hermanto Sipayung, Redaktur: Edwin Garingging, Edi Saragih, Pholmer Saragih, Jhon Damanik, Plidewatna, nasa Putramaylanda, Pala Silaban,Hezbi Rangkuty. Asisten Redaktur : Imelda Purba Kordinator Liputan: Syafruddin Yusuf, Reporter:Susilowady, Mariadi (Kisaran), Putra (Aek Kanopan),Anniko Rambe, Rizki Whardana (R Prapat), Mahra Harahap (Kota Pinang), Ishak Lubis (Tj Balai), Syawaluddin Tanjung (Pamingke), Siswanto, Bima Pasaribu (Batubara) METRO SIANTAR Redaktur Pelaksana: Leonardus Sihotang, Yappy Chandro Purba Kordinator Liputan: Tonggo Sibarani, Reporter: Imelda Purba, Pra Evasi Haloho, Billy Andra Nasution, Eko Hendriawan, Dhev Fretes Bakkara (fotografher), Rano Kambo Hutasoit, Darwis Damanik, Sawaluddin, Soetomo Samsu (Jakarta), Irwansyah (TanahJawa), Hardono Purba (Silau Kahean), Sendi Warto Purba (Saribudolok), Taman Haloho (Parapat) Sekretaris Redaksi: Yanti Nurhapni, Staf Redaksi : Ita Butar-butar METRO TAPANULI Pjs Redaktur Pelaksana: -, Kordinator Liputan:Ridwan Butar-butar, Ass.Korlip : Marihot Simomora Reporter: Freddy Tobing, Milson Silalahi, Aris Barasa, Juris Tanjung, Samuel Sitompul, Masril Rambe (koresponden Barus), Horden Silalahi(Humbahas), Bernard Lumbangaol (Taput), Hengki Tobing (Taput), Jantro Naibaho, Juandi Sihombing,

yang lebih baik melalui sektor pariwisata. Sebab, pada era itu wisatawan mancanegara setiap hari selalu lalu-lalang di Kota Parapat untuk menikmati indahnya Danau Toba. “Semua orang tau, tahun 1980an banyak sekali wisatawan yang datang ke Parapat. Sehingga sektor ekonomi di sini cukup baik,” ujar pria yang dulunya menjabat Manager Bonansa Holiday Travel, saat membuka pembicaraan dengan METRO, kemarin (11/9). Pria asal Ambarita, Samosir, ini menceritakan, tahun 1986, ia membuka warung kelontong di Parapat. Pada masa itu, walau infrastruktur masih buruk, wisatawan masih banyak berdatangan. “Perhotelan dan kios-kios penjual souvenir, warung makanan dan minuman, sangat laris. Sehingga perekonomian masyarakat lokal bertumbuh,” katanya. Setelah membuka usaha kelontong, tak begitu lama, dia kemudian dipercaya membuka Bonansa Holiday Travel di Kota Parapat dan berkantor pusat di Jakarta dan memiliki cabang di Medan. Saidin Situmorang tahu betul bagaiamana dinamika parawisata di Parapat. Sebab,

selain melayani wisata lokal, Bonansa Holiday Travel juga menjadi kepercayaan wisatawan mancanegara untuk menyediakan tiket termasuk penginapan dan hotel. “Saat itu, masih kami satu-satunya usaha travel di Parapat. Sehingga jaringan airline kami di mancanegara pun banyak. Seperti Malaysia, Singapura dan negara lain. Tahu apa Bonansa itu?” tanya Saidin. “Bonansa itu singkatan dari Bona Ni Pinasa. Jadi kalau dipanjangkan namanya Boan Ni Pinasa Holiday Travel. Dan nama PT-nya PT Monang Sianipar Abadai System. Monang Sianipar itu ayahnya Vicky Sianipar yang musisi Batak itu. Jadi, ayahnya-lah yang punya travel ini,” kata pria tamatan SMA Pembangunan Samosir ini. Memasuki tahun 1990-an, Kota Parapat makin hidup dan tetap menjadi pilihan bagi turis untuk berlibur. Ketika itu, di Parapat sudah berdiri tiga unit bank, yakni Bank BNI, BRI dan Bank Sejahtera Umum. Keberadaan bank-bank itu menunjukkan ekonomi Kota Parapat cukup baik pada masa itu. Bahkan, jasa money changer ketika itu menjadi lahan bisnis yang menjanjikan. Saat ini, kioskios money changer ini seolah

Hermanto Turnip (Tobasa) METRO TABAGSEL Redaktur Pelaksana: Nurjannah, Pjs Kordinator Liputan: Ikror Amin Lubis, Reporter: Parlindungan Pohan (Sidimpuan/Tapsel), Amran Pohan (Tapsel), Amran Pikal Siregar, (Palas), M Ridwan Lubis (Madina), Oryza Pasaribu, Parningotan Aritonang. Dep. Perwajahan, Pracetak & Artistik Kadep Pracetak & Artistik: Ahmad Yasir, Kabag: Amiruddin Staf Pracetak:Salomo SH Malau, Jamaluddin Sinaga, Hedry Handoko, Jefree Putra, Andri Manullang, Handoko, Nazaruddin, Saddam Boythree Purba Mounting: Samuel Sihotang (Koordinator), Hotland Doloksaribu, Amran Nainggolan, Nico HS, Kabag Teknisi, Maintenance & IT: Irwan Nainggolan, Online: Juanda Panjaitan DIVISI USAHA Departemen Umum/Adm/Keuangan Manager Adm/Keu/Umum: Dumaria, Kabag Accounting: Restioni Padang Departemen Sirkulasi / Pemasaran Manager Pemasaran: Jaberlison Saragih, Koordinator Pemasaran:Simson Winata Hutabarat Adm Pemasaran : Indarny Aritonang, Piutang Koran: Ester Ade Gultom, Staf Pengembangan: Jhon Tua Purba, Dedi Kurniawan, Kordinator Ekspedisi: Ardi Departemen Iklan Manager Iklan: Jamot S, Kabag Iklan : Holden Simanjuntak, Kord Iklan: Bambang Satria, Kord Adm. Iklan group: Hariyani Kartini, Piutang Iklan: Tio Maria, Annisa (Medan) Staf Desain:Reliston Purba, Togap Sinaga. Perwakilan Metro Tapanuli

lenyap. Namun krisis moneter melanda. Ditambah situasi keamanan Indonesia memasuki era reformasi dan aksi-aksi teror bom, membuat situasi berubah buruk. Beberapa negara mengeluarkan kebijakan yang melarang warganya berwisata ke Indonesia. Sejak itu kondisi perekonomian masyarakat di Parapat terombang ambing. Pelaku usaha hanya tinggal mengharapkan wisatawan lokal. Bahkan sejak itu, bank yang ada di Parapat tutup, karena tak mampu mengelola keuangannya. Hanya BRI yang tetap bertahan. Lalu saat ini, berdiri lagi Bank Sumut. Efek moneter itu juga berimbas pada tutupnya usaha Bonansa Holiday Travel dan terpaksa memberhentikan karyawannya. Setelah kondisi Indonesia mulai aman dan krisis moneter berangsur pulih, volume wisatawan mancanegara tak kunjung meningkat. Angka pengunjung dari luar negeri ke Danau Toba sangat jauh berkurang hingga saat ini. Berbagai kegiatan dilakukan pemerintah dan pelaku wisata di sekitar Danau Toba untuk mengembalikan kejayaan di masa lalu. Tapi, sepertinya, jalan masih sangat panjang. (pra/leo)

Kepala Perwakilan : Ridwan Butar-butar Koordinator Keuangan: Eriska Muham, Staf Piutang Koran/Iklan: Arfah Sari Hasibuan, Koord. Pengembangan: Zulfiandi, Staf Pengembangan : Jack Simbolon (Taput), Tamy Sianturi (Tobasa) Perwakilan Metro Tabagsel Ka Perwakilan/Ka Biro Usaha: Edi Panjaitan, Kabag Pengembangan: Ahmad Suhaimi Lubis, Koordinator Keuangan: Kristina Hutabarat Perwakilan Metro Asahan Wakil Pimpinan Perusahaan: Darwin Purba, Kabag Pengembangan: Marshall Leo Siagian, Staf Pengembangan: Jemelister Sitorus, Koord.Keuangan: Revina Sihombing Kuasa Hukum: Binaris Situmorang SH TARIF IKLAN : Hitam/Putih (B/W) Umum/Display Rp. 7.500/mm kolom, Iklan Keluarga Ucapan Selamat Rp. 3.500/mm kolom, Iklan Warna (Full Colour) Rp. 15.000/mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp2.000 (dalam kota). Rekening a/n : PT Siantar Media Pers Bank Mandiri Cab Pematangsiantar AC:1070003101831. Alamat Redaksi /Iklan/ Pemasaran Medan : Graha Pena Medan Jl Sisingamangaraja KM 8,5 No.134 Medan-Amplas. Telp (061) 7881661 (Hunting) Fax (061) 7881733 Alamat Redaksi /Iklan/ Pemasaran: Jl Sangnawaluh No.24 Komp Mega Land Siantar Telp:(0622) 7553511, Fax (0622) 7553501 Siantar. e-mail : metrosiantar@yahoo.com. Perwakilan Jakarta: Jln Raya Kebayoran Lama17 Jakarta Selatan Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl SM Raja KM 8,5 No.134 Medan. Telp (061) 7881661 (Hunting) Fax (061) 7881733

DALAM PELIPUTAN, WARTAWAN METRO ASAHAN SELALU DIBEKALI IDENTITAS DIRI DAN TIDAK DIBENARKAN MEMINTA SERTA MENERIMA APAPUN DARI NARASUMBER BILA ADA YANG MERASA DIRUGIKAN OLEH WARTAWAN METRO ASAHAN, DIMINTA UNTUK MELAPOR KE PIHAK BERWAJIB ATAU HUBUNGI (0623) 698050090


MINGGU

15 September 2013

„ Sultan Asahan ke 10 Sultan Muhammad Husyin Syah.

„ Sultan Asahan Sultan Muhammad Rahmad Shah II.

„ Orang asing berburu buaya di sungai di wilayah Batubara.

„ Istana Kesultanan Asahan

„ Orang Besar dan Anggota Balai Kerapatan Kesultanan Asahan yang sudah mulai kehilangan Kuasa.

PROMO IKLAN JITU JITU 2013 2013 Pasang Iklan Baris, GRATIS berlangganan koran 1 bulan

Hanya ulan b Rp 60.000,-/

kirim langsung data anda ke: www.iklanpms@yahoo.com

A LLTT O L E L A N G H O N D A SUPRA X 125 NEW R Th 10-12: lelang 1 ANlelang utk umum hrg 4 jtan tempat: halaman rumah, Jl.jend.A.Yani (dpn makam pahlawan) R.Prapat. Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang) BEAT TH 11- 12 : Lelang 1 An-lelang Utk Umum-hrg 4jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan)R.Prapat. Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang) AB.VARIO TECHNO TH 12: Lelang 1 Anlelang Utk Umum-hrg 5jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan)-R.Prapat. Hub : 081263238391, 085285380613, 087807037277 (Alto Lelang) SCOOPY TH 11-12 : Lelang 1 An-lelang Utk Umum-hrg 5jtan--tempat: Halaman Rumah, Jl.jend.a. Yani(dpn Makam Pahlawan)R.Prapat . Hub: 081263238391, 085285380613, 087807037277 (Alto Lelang) AB. REVO/BLADE TH 08-11 : Lelang 1 Anlelang Utk Umum-hrg 3jtan--tempat: Halaman Rumah, Jl. Jend.A.Yani (dpn Makam Pahlawan)-R.Prapat. Hub: 081263238391, 085285380613, 087807037277 (Alto Lelang)

YAMAHA BYSON TH11-12: lelang 1 an-lelang utk umum-hrg 10 jtan. tempat di Halaman rumah, Jl.Jend. A.Yani (dpn makam pahlawan) Rantauprapat. Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (alto lelang) XEON--TH 11-12 : Lelang 1 An-lelang Utk Umum-hrg 3jtan. tempat di Halaman Rumah, Jl. Jend. A. Yani (dpn Makam Pahlawan) R.Prapat. Hub: 0812 6323 8391, 0852 85380613, 087807037277 (Alto Lelang) MIO SOUL TH 09-12: Lelang 1 An-lelang Utk Umum-hrg 3jtan-di Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan) R.Prapat. Hub: 081263238391, 085285380613, 087807037277 (Alto Lelang) JUPITER MX NEW TH 11-12 : Lelang 1 Anlelang Utk Umum-hrg 5jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan) R.Prapat. Hub: 0812 6323 8391,0852 8538 0613 (Alto Lelang) MIO TH 09-12 : Lelang 1 An-lelang Utk Umumhrg 2jtan--tempat: Halaman Rumah, Jl.Jend.A.Yani (dpn Makam Pahlawan) R.Prapat. Hub :0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang) JUPITER Z NEW TH 10-12 : Lelang 1 Anlelang Utk Umum-hrg 4jtan--tempat: Halaman Rumah, Jl. Jend. A.Yani (dpn Makam Pahlawan) R.Prapat. Hub : 0812 6323 8391, 0852 8538 0613 (Alto Lelang) VEGA ZR TH 09-12 : Lelang 1 An-lelang Utk Umum-hrg 2jtan--tempat: Halaman Rumah, Jl. Jend. A. Yani (dpn Makam Pahlawan) R.Prapat Hub: 0812 6323 8391, 0852 8538 0613, 0878 0703 7277 (Alto Lelang)

SUZUKI TITAN TH 10: Lelang 1 An-lelang Utk Umumhrg 2jtan--tempat: Halaman Rumah, Jl.Jend.A. Yani(dpn Makam Pahlawan)-R. Prapat. Hub : 081263238391, 085285380613, 087807037277 (Alto Lelang)

MOBIL & MOTOR

DAIHATSU BARU : Ready stock semua type dgn Dp. 20Jtan (Xenia) Dp. 22Jtan (Terios) Dp. 13Jtan (Pick Up/Minibus) Pesan sekarang juga, data dijemput dan proses leasing dibantu. Sariaman Marpaung, HP. 0852 7023 1310, Pin BB 297B2A40. NEW NISSAN: Grand Livina, Juke, X-Trail. Navara, Murano. Ready Stock, cash/credit. Hub: Mili 0852 7033 7739

HONDA 100% BARU

NAGA MAS MOTOR: Services - Ganti Oli Spare Parts - Accessoris. Jl. Teuku Umar Ujung, Tj.Balai. Hub: AKIET - 0852 7668 8988

- All NEW CRV - NEW JAZZ - NEW BRIO - NEW FREED READY STOCK – CASH / CREDIT; DP ringan + hadiah + discount; Proses Cepat + data dijemput. Hub : ALDY – 0853 7131 6440; CAB. RANTAU PRAPAT

DIJUAL: Bahan & Peralatan Chrom yang masih berjalan diberikan pelatihan & alamat Suplier bahan baku, Peminat serius Hub:0617870503 (Jam Kerja)

Promo Akhir Tahun • Daihatsu Paket Ringan • Gran Max Pick Up Dp. 11Jtan angs 2Jtan • Xenia Dp. 27Jtan angs 3Jtan • Terios Dp. 24Jtan angs 4Jtan Proses cepat, pasti oke+hadiah menarik Rudi Astra, 0813 9611 6389

TOKO PRABOT HJ. MARIAM jual berbagai prabot rumah tangga, lemari, kursi, tempat tidur, terbaru dan lengkap. Furniture harga Famili, barang istimewa dan memuaskan. Simpang gallon Jl. Access Road INALUM, Kuala tanjung, HP: 0823 6986 5100

DAIHATSU 100% BARU

“TOKO TUNAS BARU”. Menjual kursi, lemari dan semua jenis barang-barang perabot rumah tangga lainnya,di jual dgn harga yg murah & terjangkau. Jl. Besar Simpang Dolok, Lima Puluh, B.Bara, Serta menyediakan tempat Rekreasi pemandian “ Kolam Lima Putri “ Untuk keluarga anda, Jl.Besar Air Hitam Simpang Dolok. Hub: Bapak Agam HP 0812 6474 707

ASTRA DAIHATSU

• Pick Up Dp. 25% angsuran 2 Jtan • Xenia Dp. 25% angsuran 3 Jtan • Terios Dp. 25% angsuran 3 Jtan • Luxio Dp. 25% angsuran 3 Jtan • Sirion Dp. 25% angsuran 3 Jtan Hub: ZUL CAPELLA, 0823 6253 2633

YAMAHA HORAS MOTOR, Jual sepeda motor Yamaha, cash& credit terbaru, dapatkan Helm LOVENZO Cuma-cuma dengan pembelian new zupiter Z1 (kesempatan terbatas). Dialer Telp:0622-31883. Jl. Jend. Sudirman Kota Indrapura, B.Bara. DIJUAL MOBIL: Mitsubishi triton Tahun 2008, Warna Abu Perak, Double Cabin, Kondisi sangat Terawat, BK panjang, Plat Medan, Ban Radial 90%, AC, Tape. Hub. HP 0812 6947 2280; 0823 6546 6007 SUZUKI BARU TERMURAH • Carry Pick Up Dp. 13 Jtan Angs 2,6Jtan • Mega Carry Dp. 20 Jtan Angs 2,8Jtan • APV Arena Dp. 25 Jtan Angs 4Jtan • Ertiga Dp. 30 Jtan Angs 3,9Jtan Banjir Hadiah, Proses cepat & Luar Kota Hub: Darwin Siagian 0852 9717 5955

MITSUBISHI SUPER HEMAT Ready stock : - Colt diesel - L300 pu & T120ss - Fuso - L200 Triton - Pajero Sport - Outlander - Mirage DP RENDAH – ANGSURAN TERJANGKAU, BUNGA MULAI 0% Hub : ARIE – 0813 6207 1094; 0853 7216 1877 PROMO AWAL TAHUN CAPELLA Daihatsu Rantau Prapat Xenia Dp25% Angs. 2jt An Terios Dp25% Angs. 3jt An Pick Up Dp25% Angs. 2jt An Grand Max Mini Bus Dp25% Angs. 2jt An Proses cepat data siap di jemput Hub: syahrinal siregar HP 0812 6547 1399 TOYOTA BARU: Wujudkan mobil impian anda bersama kami. Ready Stock ; New Avanza, Veloz, New Rush, New Innova, New Fortuner VNTurbo, Etios, New Yaris. Cash & Kredit, Data dijemput, Proses Cepat. Penawaran terbaik. Hub : RICKY MANIK - HP. 0812 6598 7888 0812 6505 3191 (Sales Executive TOYOTA) Pilihan CERDAS Pasti TOYOTA...!!

LELANG 250 MOTOR & 15 UNIT MOBlL Harga Limit 2 Jt S/D 7 Jtan Th 08-12. Lelang Satuan, Terbuka Untuk Umum, Berbagai Merek & Tipe, Cek Fisik Tgl 13 S/D 17 Desember 2012. Lelang 18 Desember 2012 Pukul 13 ; 00 Tempat: Dpn Makam Pahlawan,Jl.Jend.A.Yani-Rantau Prapat. Hub: 0812 6323 8391, 0852 8538 0613, O878 0703 7177 (alto Lelang)

PROMO AGUSTUS BULAN MERDEKA CAPELLA DAIHATSU KISARAN • Xenia Airbag • Terios • Sirion • PickUp • Luxio DP Terjangkau + Angsuran Ringan, Proses Cepat, Data Siap Dijemput Dan Hadiah Menarik Menanti. Hub : RIDHO F | HP 0853 6119 8590 PIN BB: 25A8CD65

-Ertiga DP. 25Jt-an Ang. 5Jt-an -APV Arena DP. 19Jt-an Ang. 3Jt-an -Carry PickUp DP. 18Jt-an Ang. 2Jt-an -Mega Carry DP. 19Jt-an Ang. 3Jt-an -Swift ST DP. 36Jt-an Ang. 4Jt-an -Splash DP. 46Jt-an Ang. 3,6Jt-an Syarat Ringan&Proses Cepat. Hub: PT. Trans Sumatera Agung, Jl. SM. Raja KM. 7,3 Medan HP: 0812 6037 9028

PT CAPELLA MEDAN KISARAN BOOM. DISCOUNT -Xenia Air Bag. - Luxio -Pick Up - Sirion -Terios. - Ayla Proses Cepat, Data siap dijemput dan hadiah menarik menanti Hub: Satria | HP 0852 6129 8787 | Pin BB21BC1EDB

100% DIALER RESMI SUZUKI MOBIL:

PT CAPELLA MEDAN CAB KISARAN Pick Up Angsuran 2 Jutaan Xenia Air Bag Angsuran 3 Jutaan Terios AB Angsuran 3 Jutaan Luxio Angsuran 3 Jutaan DP Rendah Angsuran Terjangkau Discount Bersaing Hub Arman 0813 7071 7172 BB 24CF0B8D

AIR MINUM KESEHATAN & KEBUGARAN” Air super alkali pertama di Indonesia”.Membantu proses penyembuhan berbagai macam penyakit:kolestrol,asam urat,susah BAB, asma, diabetes, panas dalam, hipertensi, maag, sakit kepala, sakit otot, sendi,dsb. An. Bapak Kodimin HP 0813 6113 2128 “RAGHIB JAYA ALUMINIUM” Aluminium, Contraktor, Partition, Swing door/Rolling Door, Serta Menyediakan Barang Seperti : Pintu Kamar Mandi, Tenda/Awning, Lemari Kaca, Rak Piring, Steling, Raill Gorden, Tangga, Jemuran Baju & Segala Jenis Kaca. Alamat: Jl. Merdeka No. 165-166 Batubara, Hubungi : DICKY BUDIANTO, HP : 0812 655 3575 - 0812 6536 6166. “UD MANDIRI”: Jual segala Sparepart sepeda motor & menerima boring, pasang botol,siting klep, pasang sokar, jual accessories & sepeda anak-anak, menjual secara Grosir & eceran. Access Road Kuala Tanjung, Hub: UDIN - 0813 7024 4402. UD. JANNAH: Menjual alat2 pancing, Kantor, Olahraga, Sekolah, Komputer, dan Perlengkapan Sholat, HARGA GROSIR. Jl. Lintas Medan-Kisaran, Simpang Kebun Kopi, B.Bara. HP: 0852 7680 942 CV PARNA JAYA MOTORS: Jual beli mobil baru dan bekas, melayani tukar tambah Cash & Kredit, menerima leasing BPKB Mobil, Toyota, Mitsubishi, Suzuki, Honda, Daihatsu, Isuzu, Desa tanah rendah, Indrapura. Telp. 0622 646378 MARI SALON SANGGUL: Menerima murid untuk belajar Salon Dengan biaya sekolah bisa dicicil. Alamat : Pasar Gelugur Rantau Prapat, Lantai II Blok B No.43 dekat musholla. Hub : 0813 9758 8003 (Emy) “CAHAYA PRABOT” cash & credit, berbagai macam prabot, rak tv, meja makan, sofa, springbed, meja belajar, elektronik, kulkas, mesin cuci, TV, LCD, DVD, kompor gas, dll. Kunjungi: Jl. Access road inalum, desa pakam raya no.20 (depan pajak sore). (0622) 31326/3327. “DINDA Keyboard” Entertainment Musik Melayu Modern, & TOKO D.J 2 Elektronik, Cash & Credit segala jenis elektronik. Hub: Iwan (0811 6282 272 – 0852 7599 9772), di Simpang Tiga Pahang, Talawi, B.Bara

Toko B atik NUR’ ALFI: J u a l b a t i k pekalongan berbagai jenis, pakaian sempit (pas-pasan), Couple, baju anak2, Blus, kemeja, dll. Murah dan terjangkau. Jl. A. Yani/ Psr Mereng Simp. 4 Talawi, B. Bara. Hub: Rosini - 0812 6002 9388 PERCETAKAN & ADVERTISING BIMA: Terima segala jenis cetakan partai besar & kecil, undangan, sablon, stempel, MMT, baliho, Neonbox, baju kaos, kop surat, dll. (Hub: HABIB SYAH: 0852 7074 7585). Jl. Jend. Sudirman No. 288 Indrapura B. Bara “BOMBAY SPORT”: Jual alat2 Olahraga sport, sepatu futsal/bola, kaos, baju , sandal, tas , asesori sport, dll. Barang bagus-Harga Memuaskan. HUB: M Yusuf, SE - HP: 0813 7635 8395 - 0812 9436 3434. Jl. Jend. Sudirman, Indrapura (depan UGD) TOKO CANTIKA COLLECTION :Jual jilbab, busana muslim, pakaian pria & wanita, serta perlengkapan baby, accesoris jilbab, mukenah,dll. Jl. Merdeka No.03 Depan kantor PLN Tanjung Tiram & Jl. Rakyat No. 40 (Depan Pajak Tanjung Tiram) B.Bara. Hub:Jonni Hendra, SPd. - 0823 6269 4535 ”PIONER GYFSUM”: Menerima pemasangan design, Plafon gyfsum rumah dan Perkantoran dgn tenaga yg berpengalaman.serta menjual sgala macam keperluan gyfsum. Hubungi: 087818917066 (Bpk Anwar); 0853 5910 8633 (Ibu Ida), Jl. A. Yani / Psr. Mereng Simp. 4 Talawi - Batu Bara. DIKA GORDYN Menerima Segala Jenis Tempahan Gordyn, Kebaya, Seragam; menerima Bordir. Terima Anak Kustum (Wanita). Hub: Ibu Indah 0821 6432 2396, di Jl. Kopertis Lingkungan 7 Indrapura B.Bara. HENDY GETs Stiker & Aksessories: Penjualan & Pema-sangan Variasi Mobil dan sepeda motor. Jl. Jend. Sudirman, Indrapura (Samping Lap. Sepakbola); HP: 0813 7644 4177; Telp. 0622 - 646 144. "CV. ANUGRAH JAYA" Kontraktor, Lepelansir, Biro Jasa, Dagang umum, Pertanian, Sedia&Jual barang-barang serta peralatan bangunan,dll. Jl. Merdeka Pasar Mereng Desa Suka Maju Kec. Tanjung Tiram,Batubara. hub:Ibu Ani-0853 6067 1005 UD. ABANG ADIK: Menerima Tempahan Kosen, Pintu, Jendela dan Menjual segala ukuran jenis Kayu. Jl. Dr. Hamka (RSU) R.Prapat. Hub: 0813 6159 0689 ANDREAN GYPSUM: Profesional dalam pemasangan Plafon Gypsum, Accessories Gypsum, atap baja ringan, stainless stell & desainer. Dapat juga pertamanan, poid balkon, kanopy, dll. Jl. Diponegoro No.212/283 KISARAN. Telp: (0623)-43611; HP: 0812 6399 062. Pimpinan Baginda Muslim Harahap (Asien) GROSIR ULOS BATAK DONGANTA, Jual Berbagai Jenis Ulos Batak, partai besar dan kecil. Hub: RAMSES TAMBUNAN, HP: 0812 6875 1155 - 0877 6864 2302. Jl. Perintis Kemerdekaan No.165 Blok 8, Lima Puluh, B.Bara USAHA TANPA MODAL: Pertama di kisaran AMWAY sebagai bisnis yang bisa dibanggakan, rencana untuk sebuah hasil yg lebih baik. Tersedia Nutrilite Vitamin, artistry Cosmetic, Farpum bermacam macam, pengkilat Sepeda Motor, odol, sabun dan lain lain. KISARAN Hub: 0813 6113 2128 LKP “UNI SMART COM” Kursus Komputer Mahir program Office 2007, Desain Grafis (Ps CS4, CorelDRAW X4), Teknisi Komputer dan Jaringan, MYOB Acc V.17, (Belajar sampai Mahir) Hub: 0877 4930 6155. Jl. Lintas Sumatera KM.137, Bangun Sari, B.Bara. TERIMA: Pasang Jaringan/Lan/Hotspot Untuk Warnet/Game Online/Kantor Perakitan, Instal, Billing, Proteksi,Antivirus,Service Computer dan Printer. Hub:0853 7329 2283 UD ISKANDAR Jual barang & alat-alat bangunan, kontraktor, levelansir. Harga standar & terjangkau, dll. Jl. Masjid Lama No. 41 Talawi B.Bara. Hub. Hj Ani - 0852 7508 7880 UD IRFAN JAYA Panglong Jual segala jenis papan(papan Boat/Sampan) & alat-alat bangunan, Menerima tempahan, Khususnya ukuran panjang dari ukuran standartnya. Dusun II Jl. Merdeka Tanjung Tiram B.Bara. Hub: Bpk Irfan, HP : 0812 6456 2615

Untuk Pemasangan Iklan Hub: 1. Leo Siagian 2. Dini 4. Porno

: 0823 6980 5009 0877 4471 8592 : 0813 6237 1211 : 0813 9776 2062

K I S A R A N

5. Budi (R.Prapat) 6. Agus Tanjung (Aek kanopan) 7. Vino (Tanjung Balai)

ISTANA AYU: Menjual : Alat - alat musik Keyboard dan Sound System, Aneka Tas, Koper, Pakaian, Handphone Baru Dan bekas, juga Terima Servis HP & Leptop HP 0813 7517 3300. Alamat : Jl. Jend. Sudirman No. 120 RANTAU PRAPAT. MAGIC ENERGY ION BOTOL: Menghasilkan energy air dalam 1 detik. Kaya Oksigen, bermolekul kecil mudah diserap tubuh. Tubuh lebih Fit & Konsentrasi, melancarkan peredaran darah & Detoks, cegah penuaan Dini. Cegah Penyakit Jantung, Liver, Pankreas, ginjal, usus serta kanker. Tersedia 3 ukuran ( 500 ml, 700 ml, 1000 ml ) di KISARAN. Hub. 0813 6113 2128 THE PLANET PARFUM: Menyediakan bermacammacam merk Parfum Import non alkohol dan alkohol : 212 MAN, AIG BLUE EMOCION, JESIKA PARKER, DANHIL BLUE, PARIS HILTON, JILO STIL, BURBERI WOMAN, 212 SEXY, BULGARIA AQUA. Klinik Happy Man Alamat: Jln Sudirman Km 2,5Simpang Panca Karsa Tanjung Balai Dony HP 0821 7353 3524. CASH & KREDIT PERUMAHAN MUTIARA REGENCY KISARAN Bulan promosi selama persediaan masih ada, Tersedia type 48 & 60. Harga terjangkau. Fasilitas : Listrik, Sumur Bor, PLN Prabayar, Batu Block, Satpam. Siap HUNI. Hub: Bpk. Kodimin – 0813 6113 2128. BERGEGASLAH LKP “CANTIK MANIS“ belajar tata rias rambut pengantin, kecantikan kulit-rambut, menjadikan tenaga kerja terampil, siap pakai wirausaha dan trend model professional, hub 0812 6374 0598, Jl. Besar Perdagangan, Lima Puluh Kota B.Bara.

APOTIK KARYA: Jual berbagai obat dan Lengkap, Harga terjangkau. Terima pasien & konsultasi kesehatan. Jalinsum Desa Tj. Gading, Simp. Kuala Tanjung, Indrapura, B.Bara. Telp: 0622-632751

"Balai Pengobatan ELLY” Izin No : 800/3244/ DINKES SOS/2008, Penanggung Jawab: Dr HIDAYAT MKes. Sedia berbagai Jenis obat, dan mengobati penyakit untuk kesehatan anda & keluarga, bersedia datang ke rumah anda untuk panggilan pengobatan di rumah; waktu 24 Jam. Empat Negri, Kec. Lima Puluh, Kab. Batu Bara. Hub: IBU ELLY-0852 7668 2236

"ACCUBEKAM" Praktek Bekam & Herbal. Insya Allah & BI'IZMILLAH. Menyembuhkan penyakit seperti • Darah tinggi • Kolestrol • jantung • reumatik • sakit kepala • Wasir • Batuk • Vertigo • Sembelit • Migrain • INsomnia • kebas kebas • sakit mata • sakit gigi • asam urat • Lambung DLL. Hub: Bpk. DJAKFAR. HP 0823 6779 8889 APOTIK MENTARI: Menjual alat-alat kesehatan, seperti kursi roda, timbangan badan, kotak P3k, Nebulizer Comp air, Obat – obat berkulitas/terdaftar, harga terjangkau, memberikan pelayanan yang memuaskan & menerima resep dokter. Alamat : Jl. KH Ahmad Dahlan No. 23 Rantau Prapat Tlp. 0624 22597 “KLINIK HERBAL” Ahli Penyakit Kronis tnp Operasi/Injeksi +GURAH+ Penyakit yang sdh Terbukti SEMBUH, & Mengobati brbagai penyakit lainnya. Buka Praktek Jam: 08.0020.00WIB. Hari libur/besar tetap Buka. Jl. Jend. Sudirman No. 28/ JALINSUM, Indrapura. HP 0812 6327 9810 - 0853 7066 9348 GRIYA LAURICH: Griya Laurich spa & salon : Perawatan Rambut, wajah, tubuh. Paket promo lulur bali + creambath / totok wajah Rp.100.000, Dan perawatan lainnya disc 30%. khusus wanita, (Free Wi-Fi). Jl. Kota Pinang No. 2 Rantau Prapat HP 0852 6165 2226 DIVA SALON DAN SPA perawatan rambut, wajah dan tubuh. Promo Ramadhan terapi telinga Rp 25.000 Facial emas: Rp 80.000 Java maserge + lulur: Rp 100.000 Jln. Lintas Sumatera Desa Binjai Baru, Kec Talawi Kab. Batubara 0852 7508 4444 BINTANG PANGKAS: Khusus pangkas pria.Rapi, indah, bersih, trendy & memuaskan. Mode masa kini. Hub: Rahmad, 0878 1892 0095. Samping Pertamina, Parepare, Indrapura, Batubara “AA” Fashion: jual berbagai jenis pakaian muslim,wanita, pria, anak2, & dewasa, berbagai merek dan ternama, & terbaru. Melayani eceran & grosir. Jl. Jend. Sudirman, Indrapura, Kab. B.Bara. HP: 0813 6154 2640 MAJESTYK: Sedia bermacam jenis roti dan Bolu: Bika Ambon, Lapis Legit, Kue MP, Bolu Gulung, Roti Tawar, Donat dan dll. Terima pesanan untuk acara Rapat, Arisan & Ultah. Hub: 0622-646300 ; Jl. Jend. Sudirman No. 75 INDRAPURA, Kab. B.Bara ANDA MAU BUKA WARNET ??? Kami menyediakan jasa layanan pembelian, service, maintenance, upgrade, instalasi, setting jaringan, Lan, microtik squid dan jual beli komputer Baru/second. hub : Queengaming - 0813 9759 6596. Jl. Imam Bonjol No. 126 Rantau Prapat

KURSUS BEKAM : Cuma 1 pertemuan langsung dapat alat bekam + buku. Biaya Rp 150.000,- Bisa langsung buka praktek sendiri Hub: Fadhil 0821 6532 8344 Tanjungbalai

: 0852 9779 9501 : 0813 7630 5720 : 0812 6539 6060

TOKO ELEKTRIK BICYCLE: Dengan harga terjangkau (suku cadang terjamin lengkap). Alamat Tanah Merah Kec. Air Putih Batu Bara HP 0852 6137 7280 TELAH DI BUKA RM. KHAS BATAK, BORU ARITONANG: Di pusat kota Rantau Prapat. JL. Siringo – ringo (Dpn. RM. Soto Medan) Menyediakan : Saksang, Naniarsik, Tanggo2, Panggang, Natinombur, B1 & B2, Lengkap dan bersedia Antar Pesanan. Segera Hub : 0821 6464 2075 – 0821 6850 2663 “WARUNG MPOK ATIK” Menyediakan masakan : nasi Goreng, soto, mie goreng/ tiaw, aneka ikan bakar, dan menyediakan aneka juice . Jl. ACCES ROAD INALUM, Simp Durian. Hub: Ibu Atik- 0852 6546 3152. RUMAH MAKAN CAHAYA MINANG: Sedia masakan Khas Padang Pariaman, terkenal lezat, sedia ayam bakar, minuman, kopi susu, teh susu & Juice, terima pesanan nasi kotak. Jl. Jend. Sudirman No. 72 INDRAPURA Rumah No.404. Hub : 0813 7655 6793 SALMA D’CAFÉ Sedia sarapan pagi,serba 7000-hidangan istimewa. Nasi/Mie goreing, bakso/pangsit/siomai, Batagor, bandrek, aneka juice. Terima nasi kotak dan rantangan. Hub: Ibu salma , 0812 6349 7777 Jl. Kula Tanjung Kebun Kopi Indrapura, B.bara. “WARUNG BAMBU AYAM PENYET” menjual : Ayam Penyet, Tom Yam, Ifu Mie/ Mie Telur, Bebek Goreng, Cah kangkung, cap cai, sop Buah & aneka juice. Jl. Access Road Kuala Tanjung. Hub: Kak Lina - 0853 6058 1512 BROKOLI CERIA: sajian spaghetti sehat. Menyediakan sajian: Mie Ayam, Mie Ketela, Mie Wortel, Mie buah, Martabak sayur, Aneka Juice, Kopi Luwak, Softdrink. Harga Terjangkau. Jl. Jalinsum KM 99.5 Sei Suka, Batubara. HP 0812 6217 910 RUMAH MAKAN BERSAMA: Menyajikan berbagai masakan, Nasi Goreng, Mie Goreng, Soto. Aneka minuman, Aneka juice, teh manis, kopi susu, ginseng. SERBA EKONOMIS. Simp.Kuala Tanjung, Indrapura, B.Bara. RM FAMILI MINANG: Khas Minang tersedia rendang daging sapi, kambing, ayam, cincang, ikan panggang, harga Rp.7000. Hub: Ibu Nisa - 0853 5835 6505, di Simp. Sumodang Jl. Kuala Tanjung (Inalum), Sei Suka, B.Bara. RM Nasi SOTO: Sedia kare sapi, soto, sop, ayam goring sambal balado, gulai asam, gulai lemak, dll. Hub: Bpk Junaidi 0852 7074 7147, di Brohol Simp. Kenangan, Kuala Tanjung, B Bara “RM DENAI MINANG” Jual masakan khas padang, dengan menu istimewa: Nasi serba Rp8000, rendang, gulai pari, daging sapi, ikan mas, khas masakan rendang padang, menerima pesanan nasi kotak. Hub: Ibu AS , HP : 0817 4798 835. Jalinsum Lima Puluh B.Bara BAKSO PAKDE: Sajian Bakso, Mie Ayam, Nasi/Mie Goreng, Minuman : Jus Tomat, Jus Mangga, Jus Wartel, Jus Timun, Jus Pokat, Jus Jeruk. Hub: 0813 7645 3399–0823 6432 11480819 9041 4222. Simpang Kuala Tanjung (INALUM) BT/BS BIMA KISARAN: Membimbing siswa/ i kelas IV,V,VI SD. VII,VIII, IX SMP. X, XI, XII SMA. Untuk sukses UASBN, UN, SBMPTN, STAN. Alamat Jl. SM Raja No. 321 Telp. 0623 - 42920 Kisaran. (Ingat Bima Ingat Belajar) PT MELDA JAYA: Jl. Suprapto Tanjungbalai Melayani Masyarakat Penumpang Ferry KM MV Milinium 2 KM MV Marine Hawk KM MV Boing Skiking.Tujuan Perak/Port Klang Malaysia, Tanjungbalai. Berangkat setiap. Setiap Senin - Rabu - Jumat dari Tanjungbalai & Sabtu- Selasa-Kamis Ke Perak. Pimpinan Hasnan Mrp.Dir Sofyan Mrp.INCOME PASTI: Perhari dapat 6 Juta selama 300 hari!. Hub: PT. IHS Telp. 021-41000607 Telp. 021-41000684atau SMS "BERMINAT" HP. 082360597944 (www.forinvester.com) DIBUTUHKAN: Wanita gadis/janda untuk disalurkan menjadi baby sitter, kakak asuh & perawat orang tua, gaji 1Jt s/d 1,5Jt. Hub: Yayasan Sepa Husada Jl. Notes No. 65 HP. 0852 6114 3441, 0812 1952 9316 WARUNG ROTI JALA H.TENGKU IKLAS: Makanan Khas Melayu menyediakan: Roti Jala, Tan Pong (setiap hari jum'at). Spesial Jus Tape Pulut Hitam, Nasi Soto, Pecal Ulek Tahu goreng Saus Kacang dan Aneka Jus. Terima pesanan : pesta, ultah, arisan, dll. HP : 0821 6295 9248 - 0813 9758 7519


C MINGGU

15 September 2013

METROTABAGSEL ASAHAN METRO

Pangeran Katak

4 A

Pada suatu waktu, hidup seorang raja yang mempunyai beberapa anak gadis yang cantik, tetapi wajah yang sangat cantik dan selalu terlihat bercahaya. Ia bernama Mary. Di dekat istana raja terdapat hutan yang luas serta lebat dan di bawah satu pohon limau yang sudah tua ada sebuah sumur. Suatu hari yang panas, Putri Mary pergi bermain menuju hutan dan duduk di tepi pancuran yang airnya sangat dingin. Ketika sudah bosan sang Putri mengambil sebuah bola emas kemudian melemparkannya tinggitinggi lalu ia tangkap kembali. Bermain lempar bola adalah mainan kegemarannya. Namun, suatu ketika bola emas sang putri tidak bisa ditangkapnya. Bola itu kemudian jatuh ke tanah dan menggelinding ke arah telaga, mata sang putri terus melihat arah bola emasnya, bola telaga itu pun tak terlihat. Sang Putri pun mulai menangis. Semakin lama tangisannya makin keras. Ketika ia masih menangis, terdengar suara seseorang berbicara padanya,”Apa yang membuatmu bersedih tuan putri? Tangisan tuan Putri sangat membuat saya terharu… Sang Putri melihat ke sekeliling mencari darimana arah suara tersebut, ia hanya melihat seekor katak besar dengan muka yang jelek di permukaan air. “Oh… apakah engkau yang tadi berbicara katak? Aku menangis karena bola emasku jatuh ke dalam telaga”. “Berhentilah menangis”, kata sang katak. Aku bisa membantumu mengambil bola emasmu, tapi apakah yang akan kau berikan padaku nanti?”, lanjut sang katak. “Apapun yang kau minta akan ku berikan, perhiasan dan mutiaraku, bahkan aku akan berikan mahkota emas yang aku pakai ini”, kata sang putri. Sang katak menjawab, “aku tidak mau perhiasan, mutiara bahkan mahkota emasmu, tapi aku ingin kau mau menjadi teman pasanganku dan mendampingimu makan, minum dan menemanimu tidur. Jika kau berjanji memenuhi semua keinginanku, aku akan mengambilkan bola emasmu kembali”, kata sang katak. “Baik, aku janji akan memenuhi semua keinginanmu jika kau berhasil membawa bola emasku kembali.” Sang putri berpikir, bagaimana mungkin seekor katak yang bisa berbicara dapat hidup di darat dalam waktu yang lama. Ia hanya bisa bermain di air bersama katak lainnya

sambil bernyanyi. Setelah sang putri berjanji, sang katak segera menyelam ke dalam telaga dan dalam waktu singkat ia kembali ke permukaan sambil membawa bola emas di mulutnya kemudian melemparkannya ke tanah. Sang Putri merasa sangat senang karena bola emasnya ia dapatkan kembali. Sang Putri menangkap bola emasnya dan kemudian berlari pulang. “Tunggu… tunggu,” kata sang katak. “Bawa aku bersamamu, aku tidak dapat berlari secepat dirimu”. Tapi percuma saja sang katak berteriak memanggil sang putri, ia tetap berlari meninggalkan sang katak. Sang katak merasa sangat sedih dan kembal ke telaga kembali. Keesokan harinya, ketika sang Putri sedang duduk bersama ayahnya sambil makan siang, terdengar suara lompatan ditangga marmer. Sesampainya di tangga paling atas, terdengar ketukan pintu dan tangisan,”Putri, putri… bukakan pintu untukku”. Sang putri bergegas menuju pintu. Tapi ketika ia membuka pintu, ternyata di hadapannya sudah ada sang katak. Karena kaget ia

segera menutup pintu keras-keras. Ia kembali duduk di meja makan dan kelihatan ketakutan. Sang Raja yang melihat anaknya ketakutan bertanya pada putrinya,”Apa yang engkau takutkan putriku? Apakah ada raksasa yang akan membawamu pergi? “Bukan ayah, bukan seorang raksasa tapi seekor katak yang menjijikkan”, kata sang putri. “Apa yang ia inginkan dari?” tanya sang raja pada putrinya. Kemudian sang putri bercerita kembali kejadian yang menimpanya kemarin. “Aku tidak pernah berpikir ia akan datang ke istana ini..”, kata sang Putri. Tidak berapa lama, terdengar ketukan di pintu lagi. “Putri…, putri, bukakan pintu untukku. Apakah kau lupa dengan ucapan mu di telaga kemarin?” Akhirnya sang Raja berkata pada putrinya,”apa saja yang telah engkau janjikan haruslah ditepati. Ayo, bukakan pintu untuknya”. Dengan langkah yang berat, sang putri bungsu membuka pintu, lalu sang katak segera masuk dang mengikuti sang putri sampai ke meja makan. “Angkat aku dan biarkan duduk di sebelahmu”, kata sang katak. Atas perintah

Raja, pengawal menyiapkan piring untuk katak di samping Putri Mary. Sang katak segera menyantap makanan di piring itu dengan menjulurkan lidahnya yang panjang. “Wah, benar-benar tidak punya aturan. Melihatnya saja membuat perasaanku tidak enak,” kata Putri Mary. Sang Putri bergegas lari ke kamarnya. Kini ia merasa lega bisa melepaskan diri dari sang katak. Namun, tiba-tiba, ketika hendakmembaringkan diri di tempat tidur…. “Kwoook!” ternyata sang katak sudah berada di atas tempat tidurnya. “Cukup katak! Meskipun aku sudah mengucapkan janji, tapi ini sudah keterlaluan!” Putri Mary sangat marah, lalu ia melemparkan katak itu ke lantai. Bruuk! Ajaib, tiba-tiba asap keluar dari tubuh

katak. Dari dalam asap muncul seorang pangeran yang gagah. “Terima kasih Putri Mary… kau telah menyelamatkanku dari sihir seorang penyihir yang jahat. Karena kau telah melemparku, sihirnya lenyap dan aku kembali ke wujud semula.” Kata sang pangeran. “Maafkan aku karena telah mengingkari janji,” kata sang putri dengan penuh sesal. “Aku juga minta maaf. Aku sengaja membuatmu marah agar kau melemparkanku,” sahut sang Pangeran. Waktu berlalu begitu cepat. Akhirnya sang Pangeran dan Putri Mary mengikat janji setia dengan menikah dan merekapun hidup bahagia. Pesan moral : Jangan pernah mempermainkan sebuah janji dan pikirkanlah dahulu janji-janji yang akan kita buat.

Lagu Daerah

Soleram Lagu Daerah Provinsi Riau Soleram Soleram Soleram Anak yang manis Anak manis janganlah dicium sayang Kalau dicium merah lah pipinya Satu dua Tiga dan empat Lima enam Tujuh delapan Kalau tuan dapat kawan baru sayang Kawan lama ditinggalkan jangan

Tahukah Kamu

Bagaimana Proses Hujan di bumi PROSES penguapan air dari tumbuh-tumbuhan itu dinamakan => transpirasi. Kemudian uap-uap air tersebut akan mengalami proses kondensasi atau pemadatan yang akhirnya menjadi awan. Awan-awan itu akan bergerak ke tempat yang berbeda dengan bantuan hembusan angin baik secara vertikal maupun horizontal. Gerakan angin vertikal ke atas menyebabkan awan bergumpal. Gerakan angin tersebut

menyebabkan gumpalan awan semakin membesar dan saling bertindih-tindih. Akhirnya gumpalan awan berhasil mencapai atmosfir yang bersuhu lebih dingin. Di sinilah butiran-butiran air dan es mulai terbentuk. Lama-kelamaan angin tidak dapat lagi menopang beratnya awan dan akhirnya awan yang sudah berisi air ini mengalami presipitasi atau proses jatuhnya hujan air, hujan es dan sebagainya ke bumi.

C


6

MINGGU

15 September 2013

METRO ASAHAN

MARRIED..?! OH, NO...! Cerpen Karya Michelia Ceska Menikah...?! oh,No...! Tidak adakah kalimat lain yang bisa ku dengar di rumah ini? Ayah, ibu, dan keluarga besarku selalu mempertanyakannya. Usiaku masih 25 tahun. Kenapa kalian memandangku seperti gadis tua yang tak laku? Lama-lama aku pobhia dengan kata ‘menikah’.

N

amaku Vora. Usiaku 25 tahun. Aku masih singel, tentunya. Aku lebih suka menyendiri. Bukan berarti aku pendiam. Aku termasuk tipe gadis yangenergik.Taksedikittemanpria di kantor yang mendekatiku. Jadi jangan pernah bilang kalo aku ini ‘gadis tua yang tak laku’. Aku tidak pernah merespon perhatian yang diberikan oleh teman pria di kantorku. Karna kupikirtidaketisjikamenjalincinta masih dalam kantor yang sama, akan mengganggu kinerja dalam bekerja.Akhirnyamerekamundur teratur. Untunglah sikap mereka tidakberubahpadaku.Masihtetap hangat. Tau kah kalian aku sangat membenci yang namanya pertemuan keluarga.Kumpulbarengbersama sanak keluarga jauh, ngerumpi, ketawa-ketiwi, dan dan membicarakan hal yang tidak penting. Aku benci jika mereka menanyakan mana pacarmu Vor? Kenapa belum punya pacar? Kapan kamu NIKAH biar bisa nyusul si A, si B? memangnya menikah itu seperti lomba lari, pake susul-susulan. Ujung-ujungnya tante Nania akan berceloteh: “ Masa’ kamu kalah sama si C yang masih SMP? Dia aja sudah punya pacar, masa kamu belom?”. Semua pandangan langsung tertuju kepadaku, tawa terdengar menggema di ruangan itu. Aku merasa tiba-tiba tubuhku mengecil. Oh Pliss deh tanteku yang cerewet... jangan bahas-bahas itu di depan mereka, pekikku dalamhati.Tuhanselamatakuuu.... Aku kembali ke kamarku dengan wajah tertunduk lesu. Ku kunci rapat-rapat pintu. Ku hempaskan tubuhku ke kasurku yang empuk. Aku menutup kepalaku erat-erat. Dadaku bergemuruh, aku tak tau perasaan apa yang menyentuh dinding hatiku. Malu,tentu. Gengsi, pasti. Marah, semuanya bercampur aduk. Yang lebih mengoyak harga diriku adalah mereka membandingkan aku dengan keponakanku yang masih SMP. Mataku mulai panas. Per-

tahananku jebol, air itu deras mengalir tak bisa terbendung lagi. Malam itu, Aku menangis sejadijadinya. Bukan menangisi statusku yang singel. Tapi sikap keluargaku yang menjudgeku sebagai ‘gadis tua yang tak laku’. Paginya, ketika aku memasuki kantor, beberapa rekan kerjaku menatap dengan pandangan bertanya-tanya, dan sebagian lagi cuek karena sibuk dengan pekerjaannya. Pagi ini aku memang beda dari biasanya. Aku menggunakan kacamata hitam. Aku menyembunyikan sembab akibat menangis semalam. Kalau tidak memakaikacamata,bisa-bisaseluruh staff kantor tau kalau mataku sembab. Mereka pasti akan menertawaiku. Kerin langsung menghampiri mejaku. “Lagi sakit mata ya Non?” tanyanya sambil mesam-mesem. Aku pura-pura sibuk membereskan beberapa berkas yang sedikit berantakan di mejaku serta menghidupkan komputerku. Aku tau dia hanya berusaha meledekku. Kerin adalah sahabatku. Ia mengenalku dengan baik. Di SMA kami selalu sekelas. Hanya bedanya ia lebih beruntung. Setelah menamatkan studinya, Adam, lelaki yang sudah menjadi kekasih Kerin selama 8 tahun itu langsung melamarnya. Kerin mencoba melihat mataku dari balik kacamata hitamyangkupakai.Kalaudarijauh mungkin tidak akan kentara kalau mataku sembab, efek dari peristiwa tadi malam. Tapi kalau di perhatikan dari dekat pasti akan ketahuan juga. Tawanya langsung meledak. Beberapa pasang mata langsung menoleh ke arah kami. Hushstt.... aku memberi isyarat pada Kerin untuk mengecilkan suaranya. Kerin langsung menutup mulutnya dengan kedua tangannya. Ia pasti tidak sadar bahwa tertawanya itu mengundang perhatian staff lain. “Keluargamumenyuruhmuuntukcepat-cepatmenikahlagiya...?” tanyanya dengan volume suara yang lebih rendah dari sebelum-

nya. Maklum, di kantor memang ada aturan dilarang untuk mendiskusikan hal-hal yang tidak penting kecuali masalah pekerjaan. Aku hanya mangangguk lemah. Hari ini aku benar-benar tidak ingin melakukan apapun. Ouhh ... “Kamu sih pilih-pilih!” celetuknya. Segera ku jitak kepalanya. Ouch.. ia meringis kesakitan. “ iya maaf aku salah ngomong!” ujarnya sambil mengelus-elus bagian kepalanya yang kujitak. “ Temennya lagi kesusahan bukannya di bantuin malah dikatakatain.” Gerutuku Kerin tertawa cekikikan. “ Suruh siapagaknikah-nikah!”kerinmenjulurkan lidahnya seraya berlari ke mejanya. Sikap Kerin menyebalkanhariini.Apagunanyamenikah kalau sikapnya masih tidak seperti itu? Sungguh kekanak-kanakan. Kufokuskan lagi perhatianku pada layar komputerku. Hari itu telah tiba. Ruangan itu tampak indah bernuansa putih, disekelilingnya dihiasiolehmawarputihyangcantik. Aku mengenakan gaun putih nan elegan. Terdapat hiasan bunga mawar dan batu berlian di bagian dada. Gaun itu membalut tubuhku dengan indah. Aku terlihat seperti puteri dalam cerita Barbie. Mama dan Papa tampak tertawa bahagia. Begitu juga dengan keluarga besarku, terutama tanteku yang cerewet itu. Siapa lagi kalo bukan tante Nania. Ia tampak sibuk menyambut tamu undangan. Senyumnya sumringah. Beberapa keponakan ku tampak main kejar-kejaran. Beberapa rekan kerjaku juga tampak hadir di sana. Kerin dan suaminya juga hadir memberiku

ucapan selamat. Tuhan, hari ini benar-benar yang aku tunggu. Semuanya tampak berbahagia. Tak ada raut kesedihan di wajah orang-orang yang kusayangi. jika ada mesin penghenti waktu, aku ingin selamanya ada di waktu ini. Tanpa terasa air mataku meleleh. Aku benar-benar bahagia. “ Vora. bangunlah sayang! “ suara itu terdengar berat dan bergetar. Wanita separo baya itu menggenggam tangan gadis yang terbaring di ranjang dengan selang infus yang tertancap di tangannya. Air matanya tak berhenti mengalir. Beberapa mesin ‘penyangga’ hidup gadis itu tampak hidup dan menunjukkan ritme-ritme kehidupan. “Mama selalu mendoakan yang terbaik untukmu, sayang. Kami tidak akan memaksakan kehendakkamilagi.TapiMamaminta kamu bangun.” Tangisnya semakin menjadi, hatinya mencelos melihat anaknya yang terbaring tanpa tahu kapan ia akan bangun dari komanya. Dibelakangnya berdiri suaminya yang berusaha menguatkannya. Memeluknya dengan hangat, mencoba menenangkannya. Gadis yang terbaring di ranjang pesakitan itu memang Vora. Vora yang merasa dirinya workerholicsampai-sampaiialupa untuk memikirkan urusan asmaranya. Gadis yang terlihat kuat diluar, namun penuh kerapuhan. ‘Si gadis tua yang tak laku’ menurut pemikirannya. Bukan pemikiran Tantenya ataupun keluarganya. Flashback “Tidak Ma!” teriak Vora. “Tapi sayang, rencana pernikahan ini sudah Mama dan Papa rencanakan sudah lama. Kami sengajatidakmemberitahumukarna kami pikir kamu terlalu asyik dengan pekerjaanmu sekarang, sehinggahampirtidakpernahmelirik lelaki manapun. Yang kamu perhatikan hanyalah berkas-berkas perusahaanmusaja.“paparMama Vora. “Vora tidak mau dijodohkan Ma,Pa!” “ Dia lelaki baik Vora. Anaknya temennya Papa dan Mama. Namanya Narendra Pradiptyo. Apakah kamu tidak mau bertemu de-

ngan dia dulu? Baru kamu putuskan, mau dilanjutkan atau tidak.” Kata Papa lebih bijaksana. “Tidak-Pa. Vora tetap tidak mau. Mendengar namanya saja Vora sudah bisa membayangkan bagaimana orangnya. Pasti Jelek, culun, dan Bau! Dan kemanamana membawa blangkon dan tongkat.” Mendengar perkataan Vora, Mama dan Papa tertawa cekikikan. Hal ini membuat Vora semakin sebal. “ Kalo Mama dan Papa masih tetap pada keputusan kalian untuk menjodohkan Vora dengan lakilaki itu, lebih baik Vora pergi selama-lamanya dari rumah ini!“ ancam Vora. Sebenarnya ada rasa penyesalan di dalam hatinya ketika mengeluarkan kata-kata bernada ancaman itu pada kedua orangtuanya. Tapi egonya lebih besar dan mengalahkan akal sehatnya. Mama dan papa hanya tersenyum menanggapi ancaman Vora. Mereka tau ucapan Vora barusan hanyalah gertakan untuk mencapai apa yang diinginkannya. Vora kesal melihat gelagat orang tuanya yang biasa-biasa saja itu. Karna tidak mendapatkan respon dari orangtuanya, Vora akhirnya nekat untuk melaksanakan ancamannya itu. Segera Vora mengambil kunci mobil dan meraih jaketnya. Dengan emosi ia menjalankan mobilnya dengan kecepatan tinggi meninggalkan halaman rumahnya. mama dan papanya hanya geleng-geleng kepala menyaksikan tingkah kekanakan anak semata wayangnya itu. Mereka yakin, setelah emosinya reda, Vora pasti akan kembali lagi kerumah. Sama seperti kejadian beberapa tahun yang lalu. Vora ngambek mintadibelikantiketnontongroup asal holiwood “One Direction”, tapi mereka tidak menurutinya. Alhasil, Vora kabur dari rumah. Sehariansopirnyamencariketempat-tempat yang pernah dikunjunginya, tapi tidak ditemukan. Rupanya ia menginap di rumah Kerin. Keesokan harinya, Vora kembali ke rumah dan meminta maaf atas sikapnya yang kekanakkanakan. Kejadian itu terulang kembali. Kali ini Vora hilang kendali, dan pergi meninggalkan rumah karna egonya yang tinggi. Nasib seseorang tidak ada yang tahu. Kali ini kejadiannya berbeda seratus delapan puluh derajat. Ucapan vora benar-benar terbukti. Kecelakaan mobil itu membuatnya koma selama dua minggu. Luka dibagian luar memang tidak parah. Hanya lecet ringan. Benturan keras dikepalanya yang membuatnya tak sadarkan diri. Operasi sudah dilakukan, dokter yang menangani Vora juga sudah melakukan usahanya yang terbaik. Kecelakaan itu tidak hanya mencelakai Vora, pengemudi lain juga tidak jauh beda dengan Vora.

Hanya saja, Vora lebih beruntung. Jiwanya masih diberikan nafas oleh Tuhan. Meskipun raganya tak lagi memiliki kekuatan. Lelaki itu tak tertolong. Baru beberapa jam setelah operasi, ia menghembuskan nafas terakhirnya. Flashback end Aku menatap pada kilauan benda asing itu. Semakin dekat cahayanya mengilang, digantikan sosok lelaki yang tidak aku kenal. Iamemakaibajuserbaputih,serasi dengan gaun yang aku pakai saat ini. Ia begitu tampan. Ia seperti pangeran dari negeri dongeng. Kakiku lemah dibuatnya. Ia berjalan mendekatiku sambil mengulurkan tangannya padaku. Senyumnya begitu manis. Apakah diamempelaipriayangditurunkan Tuhan padaku? Aku tersenyum serayamenyambutulurantangannya. Untunglah aku menolak perjodohan konyol itu, dan menemukan pangeran sebenarnya, pikirku. Ia mengajakku berdansa tanpa musik. Hanya ketukan se-

patu kami yang terdengar. Perasaan bahagia menyeruak dari dasar hatiku. Apakah seperti iniyangnamanyajatuhcinta?Yang kurasakan hanya bahagia. Tidak ada yang lain. Tuhan kenapa baru sekarang kau anugerahkan rasa ini kepadaku? Kalau aku tau rasanya seperti ini, aku tidak akan menyianyiakannya. Aku begitu senang berada bersamanya. Pangeranku. “Siapa namamu?” bisiknya padaku. “ Ivorane Prayoga” jawabku seraya tersipu malu-malu” Nama kamu? “ NARENDRA PRADIPTYO” “.....” Mataku terbelalak mendengar ia menyebutkan namanya..aku tidak bisa mengucapkan satu katapun. Lidahku kelu. Aku masih tidak percaya dengan apa yang kulihat. Benarkah lelaki itu Narendra?Lelakipilihanorangtuaku? Tiba-tiba pandanganku buram. Aku terkulai lemah. THEEND Cerpen diambil dari http:// www.lokerseni.web.id/

UNTUKMU Oleh Frisca Nanda Pagi telah tiba Saat aku akan melangkah Memulai semuanya dari awal Mencari apa yang telah terjadi Disaat mulai tergoyang Aku tidak dapat lagi menahan Dari kejauhan mata sudah melihatnya Mencoba berdiri dan mengikhlaskan semuanya Berat....berat Untuk mengangkat sesuatu yang telah kubawa,dan Membawa sesuatu itu keluar dari ruangan itu Meghentikan langkahku Aku tahu ini semua berat Meninggalkan yang tlah lama bersama Dimana ada kasih yang tulus Tidak mungkin aku dapatkan lagi Mengusap air mata paling menyakitkan bagiku Mengapa aku harus mengusap air mata ini Tak sanggup harus pergi Kupeluk kau dengan rasa sayangku Andai waktu ini dapat berputar kembali Aku ingin mencoba berhenti disitu Menghabiskan waktu bersama Bercanda,menangis, dan pelukan Tidak ada hal yang paling bahagia ketika berkumpul bersama Ketika rasa persaudara muncul dalam ruangan itu membuatku berat meninggalkan semuanya membuat semuanya menyakitkan bagiku Semakin kumengerti hidup ini tak lengkap tanpamu Aku berpura-pura dengan semua ini Karena ku tak ingin melihatmu terluka,tak ingin...dan tak ingin Aku sayang kalian... Tidak peduli seburuk apa temanmu itu Sejelek dan secantik apa dia Bila semuanya akan seperti ini Aku tidak dapat mengatakannya


6

MINGGU

15 September 2013

Obama Tegaskan Siap Serang Suriah WASHINGTON- Presiden Amerika Serikat Barack Obama telah menyampaikan kesediaannya untuk memberikan kesempatan bagi upaya diplomasi dalam menyelesaikan krisis Suriah. Namun Obama juga mengingatkan, opsi militer masih tetap ada. Saat ini Menteri Luar Negeri (Menlu) AS John Kerry dan Menlu Rusia Sergei Lavrov tengah mengadakan pertemuan menyusul usulan Rusia soal penyerahan senjata kimia rezim Presiden Bashar al-Assad. Pertemuan itu untuk menuntaskan kesepakatan soal penghancuran senjata kimia rezim Assad. “Kita perlu melihat tindakan-tindakan konkret yang menunjukkan bahwa Assad serius soal menyerahkan senjata kimianya,” kata Obama dalam pidato mingguannya seperti dilansir kantor berita AFP, Sabtu (14/9). “Dan karena rencana ini muncul hanya bersama ancaman kredibel aksi militer AS, kita akan tetap mempertahankan posisi militer kita di wilayah itu untuk terus menekan rezim Assad,” imbuh Obama. Sebelumnya, Presiden Assad telah menyampaikan konfirmasinya atas kesediaan rezimnya untuk melaksanakan usulan Rusia, sekutu dekatnya. Pemerintah Rusia mengusulkan penyerahan senjata kimia rezim Suriah tersebut sebagai cara untuk menghindarkan aksi militer AS. Namun Assad menegaskan, kesediaan rezimnya mengikuti usulan Rusia itu bukan karena adanya ancaman serangan militer AS. “Suriah menyerahkan senjata-senjata kimia dalam pengawasan internasional adalah karena Rusia,” tutur Assad. “Ancaman-ancaman AS tidak mempengaruhi keputusan itu,” tandas pemimpin Suriah itu.(int)

2 Tentara Tewas Kena Ledakan Bom

BANGKOK- Sebuah bom pinggir jalan menewaskan dua tentara di Thailand selatan hari ini. Ledakan bom ini menambah panjang daftar serangan mematikan di wilayah konfllik tersebut. Ledakan bom itu juga menyebabkan empat tentara lainnya luka-luka. Insiden ini terjadi di provinsi Pattani. “Seorang sersan berumur 21 tahun dan seorang kopral berumur 27 tahun tewas,” kata Mayor Polisi Somjet Thongpan kepada kantor berita AFP, Sabtu (14/9). “Salah seorang dari mereka tewas di tempat dan seorang lagi meninggal di rumah sakit,” imbuhnya. Para tentara itu menjadi korban ketika bom tersebut meledak dan mengenai truk militer yang mereka naiki. Dalam sepekan terakhir, belasan personel keamanan Thai telah tewas di wilayah Thailand selatan. Wilayah tersebut telah dilanda konflik sejak tahun 2004 silam. Kekerasan separatis yang dilakukan para gerilyawan muslim di wilayah tersebut telah menewaskan lebih dari 5.700 orang sejak tahun 2004. Sebelumnya, pada Kamis (12/9), lima polisi tewas dalam serangan para gerilyawan di wilayah tersebut. Sementara dua tentara tewas dalam serangan di sebuah sekolah.(int)

Polisi Harus Introspeksi JAKARTA-Penembakan terhadap anggota kepolisian menjadi marak akhir-akhir ini. Disinyalir, rasa tak suka terhadap institusi Polri menjadi alasan serentetan aksi penembakan itu. “Terhadap kelompok-kelompok di daerah-daerah konflik, polisi sering bekerja over (keterlaluan) di luar batas kemanusiaan,” kata pengamat kepolisian Bambang Widodo Umar menjelaskan sebab kenapa polisi tidak disukai sebagian kelompok masyarakat. Bambang berbicara usai diskusi di Warung

Daun, Cikini, Jakarta Pusat, Sabtu (14/9). Menyikapi hal itu, Kadiv Humas Mabes Polri Irjen Ronny F Sompe menyatakan polisi akan introspeksi diri setelah serentetan aksi penembakan yang mengarah ke korpsnya. “Polisi tentu tidak resisten terhadap evaluasi dan teguran. Polisi harus mem-

perbaiki diri dan kultur pelayanan. Akan kami tindak lanjuti,” ucap Ronny. Namun demikian, Polri menyatakan akan tetap bekerja profesional. Karena sudah ada ketetapan prosedur yang mengatur cara kerja polisi, termasuk caracara menangkap kelompok-kelompok yang diduga meresahkan masyarakat. “Tentu Polri berupaya profesional dalam melakukan tugas. Namun juga harus tetap profesional memperhatikan prosedurprosedur yang ada,” ujar Ronny. Serentetan kasus penembakan hingga

penembakan yang menewaskan Aipda Sukardi di depan KPK, Jakarta Selatan, diakui memang ditujukan khusus untuk institusi kepolisian. Namun tidak untuk kasus terakhir di Cimanggis, Depok. “Empat kasus sebelumnya (sebelum penembakan di Cimanggis), memang Polri menjadi target. Kita upayakan mengungkap dan menangkap tersangka. Kalau kasus di Cimanggis, kebetulan korbannya anggota Polri, ini kasus pencurian kendaraan bermotor. Kita akan melihat motif kejadian ini,” tutur Ronny.(int)

Hatta Bisa Jadi Cawapres Jokowi atau Prabowo JAKARTA- PAN membuka kemungkinan evaluasi pencapresan Ketua Umumnya, Hatta Radjasa. Jika tidak menjadi capres, Hatta bisa menjadi Cawapres dari Prabowo atau Joko Widodo. “Hatta sama Prabowo saja bisa (apalagi Hatta dengan Jokowi),” ucap Teguh Juwarno saat ditanya soal kemungkinan langkah politik PAN di 2014, Sabtu (14/9). PAN membuka kemungkinan menjadikan Hatta sebagai cawapres jika target raihan suara lebih dari 10 persen di Pemilu Legislatif 2014 tidak tercapai. “Ya seperti yang dikatakan Pak Amien Rais, kalau Pileg kita tak mencapai target, maka kita harus melakukan evaluasi untuk kemudian apa

„ Hatta Radjasa

Sambungan Metro Asahan

peran yang paling tepat yang harus kita ambil. Tapi tetap harus jadi pemimpin nasional,” tutur Teguh saat ditanyai kemungkinan Hatta menjadi cawapres. Jika harus berkoalisi setelah Pileg nanti, maka PAN bersedia untuk berkoalisi dengan PDIP atau Gerindra. Teguh menyatakan partainya telah menjalin komunikasi politik dengan PDIP dan Gerindra, begitu juga dengan partai yang berbasis sama dengan PAN. “Komunikasi kita dengan Gerindra dan PDIP bagus. Termasuk partai-partai menengah berbasis Islam. Dan Pak Hatta tokoh yang paling luar biasa dalam komunikasi politik,” kata Teguh.(int)

Meski Kaki Diamputasi, Akan Melatih sampai Mati 1 November, Inalum Sambungan Halaman 1 Misalnya, Desak Nyoman Rina, Sherly Yunita, dan Dwiki Anugerah. Mereka dibina Radja di klub yang didirikannya pada 1996, Pari Sakti. Meski kakinya harus diamputasi, Radja tidak mau berhenti untuk terus membina para perenang belia. Dia ingin terus menciptakan para perenang nomor satu. “Saya merasa masih punya utang. Karena itu, saya harus tetap melatih dalam kondisi apa pun. Apa jadinya anakanak itu kalau saya tidak melatih,” ujar Radja saat ditemui Jawa Pos di tempat latihan. Besarnya dedikasi itulah yang membuat Radja tidak menghiraukan kondisinya. Bahkan, pasca dirawat dua pekan di sebuah rumah sakit di Bandung pada Januari lalu, dia ingin langsung pergi ke kolam renang. Bagi dia, waktu yang luang terlalu sayang jika tidak dilewatkan dengan melatih anak-anak asuhnya. Penyakit yang diderita Radja hingga membuat kaki kanannya diamputasi itu sebenarnya bukan penyakit baru. Penyakit tersebut dideritanya sejak 2008. Tepatnya sebelum Pekan Olahraga Nasional (PON) di Kalimantan Timur. Kadar gulanya ketika itu mencapai 380 mg/dL.

Penyakit tersebut semakin parah ketika PON 2012 di Riau. Saat itu Radja bertindak sebagai juri hakim, kukunya secara tidak sengaja terpotong hingga terluka. Luka itulah yang tidak sembuh-sembuh. Dasar keras kepala, Radja tidak pernah mengkhawatirkan lukanya yang makin parah tersebut. Dia merawatnya sendiri sekalipun akhirnya sampai membusuk. Dalam kondisi seperti itu, dia tetap bersikeras tidak mau dibawa ke rumah sakit. Petaka pun datang ketika akhir 2012, tepatnya saat menemani anak didiknya berlaga di Kejuaraan Renang Antar Perkumpulan Seluruh Indonesia (KRAPSI) di Bandung. Meski kondisinya drop dan harus duduk di kursi roda, Radja tetap memaksakan datang ke arena lomba. Dia ingin menyaksikan salah seorang anak didiknya, Dwiki Anugerah, meraih emas di kelompok usia (KU) III. Sejam berada di lokasi kejuaraan, Radja lalu kembali ke hotel karena kondisi tubuhnya melemah. Nah, sehabis peristiwa itulah, kondisi Radja terus memburuk. Terutama luka di kaki kanannya yang membusuk. Karena itu, setelah dia diperiksa dokter, tak ada jalan lain kecuali mengamputasinya agar penyakit tidak menyebar ke bagian tubuh lainnya. Dari

mata kaki ke bawah. Amputasi itulah yang kemudian mengubah hidup Radja dari yang semula selalu berusaha melakukan segala hal sendiri menjadi sering bergantung pada orang lain. Baik saat melatih maupun dalam aktivitas keseharian. Meski demikian, tidak ada sedikit pun niat dalam dirinya untuk mengurangi porsi kegiatan melatihnya ketika sakit seperti saat ini. “Saya tetap melatih, tidak ada yang berbeda dengan frekuensi latihan. Senin sampai Sabtu, pagi dan sore hari,” ungkapnya. Pagi dia melatih mulai pukul 04.45 WIB hingga 06.00 WIB, sedangkan sore mulai pukul 16.00 WIB hingga 18.30 WIB. Radja tidak sendiri dalam melatih para perenang muda. Anak-anaknya, Akbar dan Kevin, ikut melatih dan mengelola klub. “Saya tetap harus melatih untuk menjaga kualitas pola latihan di klub,” ujarnya. Jika sebelumnya memegang perenang kelas utama, setelah kakinya diamputasi, Radja menangani para perenang di grup III atau yang berusia di bawah 10 tahun. Kelas utama dipegang Akbar. “Dulu saya bisa menguasai semua lintasan, tapi sekarang saya hanya bisa fokus di grup III,” tuturnya. Satu hal kini menjadi hambatan Radja dalam melatih. Yakni, dia tidak bisa

memberikan contoh kepada anak-anak binaannya. Padahal, ketika belum duduk di kursi roda, Radja tidak hanya memberikan materi secara teori, melainkan juga praktik di dalam kolam renang. “Sekarang dengan suara saja sudah cukup. Saya harap anak-anak bisa mengerti dengan kondisi saya,” imbuhnya. Satu ciri khas yang masih tetap ada pada diri Radja adalah gaya melatihnya yang keras dan disiplin. Menurut dia, gaya yang galak itu harus tetap dipertahankan agar anak-anak tidak seenaknya berlatih. “Tapi, sejak sakit ini, Bapak bisa lebih sabar. Karena Bapak tidak mau stres juga. Lagian, yang dilatih anak-anak kecil. Bisa-bisa nangis kalau dikerasi terus-terusan,” kata Ike Kusuma, istri Radja. Sang istri yang juga ikut membantu dalam melatih anak-anak menyebutkan, para perenang Pari Sakti seolah mendapat kekuatan ganda begitu didampingi Radja. Motivasi mereka seakan berlipat ganda. Itulah yang membuat Radja sekalipun dalam kondisi sakit dan di atas kursi roda tetap berusaha untuk menemani anak asuhnya, baik saat latihan ataupun kejuaraan. Bahkan, bulan lalu dia menyempatkan diri untuk datang ke Balikpapan hanya

untuk menonton anak didiknya berlaga di sebuah kejuaraan terbuka. Belum lagi kejuaraan-kejuaraan lokal di Jakarta dan sekitarnya yang biasanya dilangsungkan dua pekan sekali, Radja tidak pernah absen dari pinggir kolam. “Anak-anak jadi lain semangatnya kalau tidak ada beliau (Radja, Red),” imbuhnya. Radja optimistis masih bisa melahirkan para perenang andal untuk stok nasional. Menurut dia, hampir 75 persen anak didiknya punya peluang berprestasi di level nasional. “Hanya, mereka masih muda, masih cukup panjang jalannya untuk menuju ke sana,” paparnya. Usia yang semakin tua dan kondisi fisik yang tidak lagi prima ternyata bukan hambatan bagi Radja untuk terus mengabdikan diri di kolam renang. Bagi dia, melatih sudah seperti panggilan hati, dan dia bertekad tidak akan melepaskan profesi itu sekalipun anak-anaknya sudah siap menerima tongkat estafet tersebut. Atlet renang dan polo air pada era 1980-an itu belum punya keinginan untuk pensiun melatih. “Kapan saya berhenti melatih” Saya akan berhenti jika sudah tidak bisa apa-apa lagi. Mungkin sampai Tuhan memanggil saya,” jelasnya. (*/ c10/ari)

Jadi Milik Indonesia

Sambungan Halaman 1 Industri Internasional Kementerian Perindustrian, Agus Tjahyono. Menurut Agus, adanya saling memahami kondisi masing-masing ini, merupakan terobosan baru. Karena dengan demikian, pembicaraan dapat lebih mudah dilakukan. Dan diharapkan dalam waktu dekat dapat dicapai kesepakatan bersama. “Dalam dua minggu ini tim Jepang ada di sini. Secara marathon kita terus melakukan perundingan. Setiap hari, bahkan itu dari jam 8 pagi sampai 18.00 WIB. Ini kita lakukan karena sama-sama menyadari betapa pentingnya perundingan ini dilakukan untuk mencapai kesepakatan,” ujarnya. Sayangnya meski mengaku pertemuan rutin dilakukan, Agus yang juga merupakan salah seorang tim perunding Indonesia ini, belum dapat memastikan apakah pada pertemuan kali ini kesepakatan akan dapat dicapai. Ia hanya menyatakan, kemungkinan kalau pun nantinya kesepakatan belum tercapai hingga berakhirnya batas waktu, Inalum tetap akan menjadi milik Indonesia sebagaimana kontrak yang ditandatangani tahun 1978 lalu. Alasannya sederhana, karena pada hakikatnya permasalahan hanya terkait selisih nilai buku. Di mana seperti yang sebelumnya pernah dikemukakan Sekretaris Jenderal Kemenperin, Ansari

Bukhari, Jepang mengusulkan nilai buku sebesar US$650 juta. Sementara Indonesia mengacu pada hasil audit Badan Pengawasan Keuangan dan Pembangunan (BPKP), yang nilainya berada di bawah angka tersebut. Selisihnya berkisar US$150 jutaUS$200 juta. “Jadi hanya masalah perbedaan sudut pandang. Misalnya kesepakaatan belum tercapai, maka selisih perbedaan angka akan kita masukkan pada escrow account. Sederhananya begini, kita contohkan mereka mengatakan nilainya 10, sementara kita mengatakan 5. Nah selisihnya kan berarti ada 5. Itu yang disimpan pada sebuah rekening bersama atau pihak ketiga yang telah disepakati,” katanya. Dengan adanya opsi ini, maka proses pengambilalihan Inalum pada 31 Oktober mendatang menurut Agus menjadi tidak akan terganggu. “Jadi intinya perbedaan tidak akan merusak hubungan kedua negara. Tapi memang adanya selisih angka tersebut membuat kita susah. Kalau kita (tim perunding Indonesia) mengalah dan mengikuti kemauan Jepang, nanti banyak pihak yang memertanyakannya. Kenapa harus mengalah? Kita juga yang akan repot. Makanya sampai saat ini kita masih terus melakukan upaya-upaya perundingan sesuai dengan mekanisme yang ada,” ujarnya. (gir/jpnn)


MINGGU 15 SEPTEMBER 2013

Hotel di Parapat Terancam Gulung Tikar Sambungan halaman 8 bisnis perhotelan di Parapat sudah tidak menjanjikan lagi. Pria lulusan sarjana Sospol dari Universitas Hasanuddin Makassar ini sedikit menceritakan pengalamannya selama mengelola hotel yang penuh tantangan dan harus benar-benar mampu memanajemen dengan baik. Dia mengatakan, hotel yang dikelolanya itu memiliki 63 kamar dengan berbagai fasilitas, mulai kelas ekonomi dan VVIP, yang juga lengkap dengan bungalow serta suasana pantai pasirnya. “Setiaphari,rata-ratakamaryang berisi cuma 10-15 kamar. Namun kalauharilibur,bisalebih,”katanya. Meski begitu, pihaknya masih bisa bertahan membuka hotel setiap hari dan tetap dapat menghidupi karyawannya yang berjumlah 55 orang. Tapi untuk mendapatkan laba yang besar, rasanya cukup sulit. Itu karena wisatawan yang semakin menurun. “Di sini sudah banyak hotel yang hanya buka pada malam minggu saja dan saat-saat liburan saja. Karena kalau dibuka setiap hari, tidak ada untungnya. Sebab tamu tidak ada yang datang. Bahkan hotel berbintang empat sekalipun pernah hanya 2 sampai 5 kamar yang terisi. Ada juga rekan pengusaha hotel meminta kepada saya agar menerima karyawanya. Karena ia sudah tidak sanggup lagi menggaji,” terangnya. Seorang pegawai Inna Hotel kepada METRO, mengatakan hal yang sama. Menurutnya, jumlah kamar yang terisi pada hari biasa hanya 5 sampai 10 kamar. Padahal jumlah kamar di Inna Hotel yang sudah berbintang empat ini ada 97 kamar. Terkadang kamar bisa penuh hanya pada saat liburan saja. “Hari ini memang ada 20 kamar yang berisi, tapi itu rombongan dari pihak kebun. Kalau hari biasa, tidak sampai sebanyak itu,” ujar wanita yang sedang berdiri di resepsionis, dengan pakaian adat Simalungun. Kembali ke Agus Salim, pria kelahiran 16 Agustus 1971 di Parepare, Sulawesi, ini mengakui, jumlah wisatawan yang terus merosot itu tidak terlepas dari pembangunan infrastruktur yang sangat minim di Kota Parapat. Termasuk juga hiburan kebudayaan dan wisata kuliner yang tidak terdesain dengan baik. “Kemarin kami bersama masyarakat mengadakan acara Horas Parapat Fiesta yang anggarannya dari masyarakat sendiri. Ketika itu banyak pertunjukan budaya-budaya local, sehingga dapat menghibur pengunjung. Termasuk dengan membuat live musik di lapangan terbuka. Itulah yang dilaksanakan masyarakat di sini. Tapi itu tidak cukup, karena keterbatasan masyarakat untuk mengeluarkan biaya acara itu sangat tidak memungkinkan,” terangnya. Ditambahkan pria berpangkat

Mayor Angkatan Laut ini, ia sengaja ditempatkan oleh pimpinannya untuk mengelola Hotel Wisata Bahari yang merupakan aset dari kesatuan angkatan laut, yang sebelumnya difungsikan sebagai margas TNI AL. Namun sejak 1997, Hotel Wisata Bahari tidak lagi sebagai markas, namun sebagai hotel untuk komersil yang masih di bawah pengelolaan TNI AL. Setelah ditempatkan sejak 1 Mei 2012 lalu, Agus Salim sudah banyak mempelajari karakter masyarakat lokasi, serta industri pariwisata Danau Toba. Dia melihat banyak sektor perekonomian yang stagnan. Baik sektor perdagangan, perhotelan, transportasi yang tidak dapat lagi berharap banyak atas industri pariwisata. “Banyak hal yang sebenarnya bisa digali di Danau Toba. Seperti pembuatan areal wisata kuliner, pagelaran budaya yang terjadwal dengan rapi, serta wahanawahana wisata yang baru. Seperti mengelola perbukitan untuk pemandangan dengan fasilitas bermain dan sebagainya. Sehingga itu bisa menarik wisatawan luar,” terangnya yang saat itu mengenakan kemeja batik yang sama dengan pakaian karyawannya. Pembangunan infrastruktur dari pemerintah, menurutnya adalah hal yang harus dilakukan untuk memberikan imej yang baik bagi wisatawan. Sebab dengan pembangunan yang baik, para wisatawan akan berpikir bahwa pemerintah sangat perduli dengan keberadaan Kota Parapat sebagai lokasi wisata. Berbicara karakter masyarakat lokal, menurutnya sangat mencintai kenyamanan dan keamanan. Buktinya sangat jarang sekali ada tindakan pelanggaran hukum yang dialami oleh pengunjung, baik itu pencurian ataupun lainnya. “Bahkan saya melihat masyarakat di sini sangat mencintai kedamaian dan keberagaman. Saya sendiri orang Bugis lho, tapi mereka menyambut saya di sini dengan bersahabat. Jadi apapun tudingan orang luar tentang masyarkat lokal di sini, saya tidak percaya itu. Karena saya sudah di sini dan melihat serta merasakan langsung,” katanya. Lebih lanjut Agus mengatakan, soal bentuk pelayanan yang belum maksimal dari masyarakat, tentunya butuh waktu untuk memperbaikidenganmemberikan pemahaman sadar pariwisata. “Kebersihan masih tetap harus ditingkatkan. Sebab kebersihan merupakan hal yang sangat penting untuk dipelihara. Diharapkan juga dari sektor pendidikan, agar siswa mulai TK hingga SMA, diberi muatan local dan dibuat pelajaran tentang sadar wisata. Dengan demikian, para generasi akan lebih memahamibagaimanasebenarnya pelayanan yang maksimal bagi tamu,” terangnya. (pra)

Saling Mengejek, Dua Kelompok Pemuda Bentrok Sambungan halaman 8 kan akan pecah. Namun kita sangat mengharapkan kejadian ini tak terulang lagi,” kata Alando Simorangkir (45) warga Nagori Nusa Indah. Menurut dia, kejadian itu bermula ketika Erman mendatangi sekelompok pemuda di Simpang Siboro persisnya di persimpangan yang membelah empat nagori, yakni Nagori Sitalasai, Busa Indah, Indah Lestari dan Laras II. Tapi naas, Erman malah jadi sasaran pengeroyokan hingga akhirnya bentrok pecah. Ini sudah berbentuk dendam, karena kejadian-kejadian sebelumnya juga dipicu masalah spele hingga diduga ada yang sengaja memprovokasi bentrokan itu. Masih kata Alando yang juga Ketua Golkar kecamatan ini, bentrok baru mereda ketika lima petugas Polsek Bangun tiba di lokasi hingga melepaskan tembakan peringatan. Beberapa pemuda yang terlibat bentrok langsung berhamburan melarikan diri saat sejumlah petugas berupaya mengejar para pelaku yang terlibat bentrok. Akan tetapi, petugas belum menahan seorangpun yang terlibat bentrok serta pelaku yang diyakini menganiaya serta mengeroyok Erman. Bahkan Kapolsek Bangun AKP B Simarmata juga hadir melerai pertikaian antar pemuda itu. “Kita masih mengembang-

kan penyelidikan dan sudah menerima laporan terkait penganiayaan itu,” kata AKP B Simarmata saat dikonfirmasi, Sabtu (14/9). Pihaknya juga berupaya menghindari korban berjatuhan hingga sempat melakukan pengejaran terhadap pelaku yang diyakini terlibat bentrok. Saat itu juga, langsung dihadirkan pangulu nagori setempat, guna mengantisipasi bentrok susulan. *Erman Membaik Erman yang ditemui di ruang perawatan RS Vita Insani dengan pintu kamar 263, masih terkulai lemas dengan kondisi kepala diperban setelah mendapat 10 jahitan. Selain itu lebam membiru masih terlihat padaleher, lengan, punggung dan dada. Begitupun menurut keluarga korban, kondisi Erman sudah membaik. Sedangkan Erman mengaku, kepalanya pecah akibat dipukul menggunakan broti keras dan panjang oleh sekelompok pemuda. Bahkan kedatangannya ke Jalan Makadame untuk menyelesaikan persoalan yang terjadi di Sionggan. Namun tiba-tiba, beberapa orang langsung menyerangnya. “Lebih sepuluh orang yang menyerang aku, tapi sekuat tenaga aku melawan dan menghindar dan sempat berlari meski kepalaku sudah mengeluarkan darah,” kata Erman. Terkait itu, melalui abangnya, penganiayaan itu sudah di-

(FOTO : Ishak Lubis/METRO ASAHAN)

„ Irma Sari, gadis asal Secanang Belawan, yang mengaku jadi korban Traficking di Malaysia, berdiskusi dengan polisi, di Mapolres Tanjungbalai.

Gadis Asal Belawan jadi Korban Traficking Sambungan halaman 8 membawa serta seorang pria asal Malaysia, yang oleh Irna Sari, disebut sebagai orang yang menjualnya. Mantan Pelayan Restoran Sementara itu, ditemui di halaman belakangan Mapolres Tanjungbalai, Irma kepada METRO ASAHAN mengaku, berangkat ke Malaysia, awal Agustus lalu bersama 2 orang rekanya, masing-masing Wenty, dan Esra. Kepergian mereka ke Malaysia, sambung Irma, adalah atas tawaran rekan mereka,

Z br S. “Kami ditawari kerja di Malaysia, di restoran. Gajinya besar. Waktu itu, perjanjiannya, paspos kami, dan ongkos ditanggung semua, tapi, potong gaji setelah bekerja nantinya,” kata Irma. Di Malaysia, ketiganya pun, aku Irma dipekerjakan di sebuah restoran yang china, yang menyuguhkan menu-menu chinesse food . Berbeda dengan 2 rekannya, Irma mengaku tidak kerasan, dan meminta dipulangkan. Namun, oleh Apek, pria Malaysia yang belakangan diketahui sebagai rekan Z br S Irma Sari tidak diizinkan pulang. “Belakangan,

saya diantar ke sebuah tempat, mirip penginapan,” kata Irma sendu. Di tempat baru ini, sebut Irma, dia dipaksa melayani pria hidung belang, yang merupakan tamu tempat tersebut. Bahkan, Irma mengklaim, hanya beberapa hari di tempat itu, setidaknya sudah ada 10 pria yang tidur dengannya. “Kadang-kadanng, kalau lagi senggang, si Apek pun harus aku layani,”cetusnya. Sementara itu, Apek Warga Malaysia yang memiliki nama china Tan Tsiu Kien alias Apek Sani (69), di ruang Kanit Idik Mapolres Tanjungbalai membantah

pernyataan yang menyudutkan dirinya, yang dilontarkan Irma. “Tidak benar saya menjual wanita itu. Ketemunya juga ketepatan satu kapal,” katanya. Apek juga menegaskan, di Malaysia, dia bekerja sebagai biro jasa, yang memfasilitasi penyaluran, dan penempatan calon tenaga kerja asal Indonesia di negeri itu. “Saya ini ketepatan mau ke Medan, menemui rekan bisnis saya. Tenaga kerja yang dia kirim ke saya mengulah, bikin rugi usaha,” tutur Apek, yang ternyata cukup mahir bahasa Indonesia ini. (Ilu)

P-APBD 2013 Belum Dibahas Sambungan halaman 8 buruk kepada pelaksanaan kegiatan belanja publik. “Oleh karena itu, kita minta kepada Walikota Tanjung Balai agar segera menyampaikannya ke DPRD untuk dibahas bersama,” ujar Hakim Tjoa Kien Lie. Menurut Hakim Tjoa Kien Lie, belum

disampaikannya hingga saat ini draf RPAPBD 2013 tersebut, erat kaitannya dengan belum terbitnya Laporan Hasil Pemeriksaan (LHP) BPK-RI terhadap laporan keuangan APBD 2012 Kota Tanjungbalai. Akan tetapi, terhadap LHP-BPK tersebut, seharusnya Pemko Tanjungbalai dapat dikonsultasikansehinggapenyampaiandraf RP-APBD2013tetapdapatdilaksanakan.

”Jika Pemko beritikad baik untuk melanjutkan program pembangunan Kota TanjungBalai,seharusnyapermasalahanLHPBPK tersebut dapat dikonsultasikan dengan BPK untuk mencari jalan keluarnya dan dilakukan secara transparan. Sehingga, pelaksanaanprogrampembangunandiKota TanjungBalaitidakmenjaditerhambat,”tegas HakimTjoaKienLie.

Sementara itu, Sekretaris Daerah Kota (Sekdako) Tanjungbalai, Ir H Erwin Syahrul Pane,MMyangdihubungimelaluisellularnya mengaku, hingga saat ini Pemko belum menerima LHP-BPK atas Laporan keuangan Tahun 2012. ”Belum kita terima,” singkat Ir H Erwin Syahrul Pane,MM menjawab METRO ASAHAN. (Ck-5)

Kinerja DPRD Lamban Sambungan halaman 8 membutuhkan lahirnya Perda tentang pemberian bantuan hukum tersebut. Alasannya, karena di era yang sudah serba modern sekarang ini, masyarakat sering menjadi korban dari penerapan hukum akibat ketidak tahuan dan ketidak mampuan secara ekonomi untuk menanggulangi biayai konsultasi hukum maupun biaya pengacara pada

saat di persidangan khususnya untuk kasus perdata. ”Oleh karena itu, kita minta DPRD agar dapat merampungkan pembahasan Ranperda tersebut. Dengan disahkannya Perda tentang bantuan hukum tersebut, maka mulai tahun mendatang, Pemko Tanjungbalai sudah dapat mengalokasikan anggaran untuk penerapan Perda tersebut,” tegas Musa Setiawan SH.

Ketua Komisi A DPRD Kota Tanjung Balai, H Ridwan Amd yang dihubungi METRO ASAHAN di tempat terpisah mengaku, pembahasan Ranperda tentang pemberian bantuan hukum tersebut dipercayakan kepada Komisi A. Dan saat ini, pembahasannya sudah hampir rampung, tinggal menunggu rapat paripurna DPRD untuk disampaikan kepada pimpinan DPRD.

”Benar, yang membahas Ranperda tersebut adalah Komisi A yang ditunjuk melalui rapat paripurna DPRD. Dan saat ini, Komisi A sudah selesai membahasnya, tinggal menunggu pelaksanaan rapat paripurna saja untuk penyampaian hasilnya kepada pimpinan DPRD. Mudah-mudahan hari Senin ini, sudah ada jawaban dari pimpinan DPRD untuk jadwal pelaksanaan rapat paripurnanya,” ujar H Ridwan Amd.(CK-5)

DPT Kota Tanjungblai Diprotes Sambungan halaman 8 lah adanya penetapan DPT pihaknya melakukan penelusuran terhadap namanama pemilih yang tercatat dalam DPT tersebut. Ternyata, dari hasil penelusuran tersebut, di temukan sejumlah nama-

nama pemilih pemula yang tidak cukup umur pada hari H pelaksanaan Pemilu Legislatif 2014 mendatang. Terhadap hasil temuannya itu, Husni Rusli berjanji, akan segera melaporkannya secara resmi kepada KPU, Panitia Pengawas (Panwas) dan instansi terkait lainnya.

Alasannya, masuknya nama-nama pemilih pemula yang tidak cukup umur tersebut, diduga bertujuan untuk memenangkan calon-calon legislatif dari partai politik yang saat ini berkuasa di Kota Tanjungbalai. Seperti diketahui dengan informasi dari KPU beberapa waktu lalu, jumlah pemilih

yang tercatat dalam DPT Kota Tanjungbalai pada Pemilu Legislatif Tahun 2014 mendatang adalah 109.740 orang, yang terdiri dari 55.025 orang perempuan, dan 54.715 laki-laki, dan akan memberikan hak suaranya di 354 TPS.(CK-5)

Jalan Lintas Perdagangan-Indrapura Rusak Sambungan halaman 8 terdapat lubang yang cukup dalam dan hampir memenjuhi badan jalan. ini mengganggu, dan merugikan

sekali,”ujarnya. Sementara Jumri (45), warga Dusun I, Desa Tanjung Muda, Kecamatan Air Putih, Kabupaten Batubara, mengatakan, kondisi jalan itu semakin hari se-

makin parah. Menurutnya setiap harinya jalan yang rusak parah tersebut sering dilalui mobil truk yang over tonase. “Semakin parah saja jalan ini, sudah

hampir satu tahun rusaknya namun hingga saat ini jalan itu dibiarakan saja. Setiap hari, puluhan truk yang over tonase melintas, sehingga jalan ini rusak parah,”katanya.(Mag-09) (FOTO : Siswanto/METRO ASAHAN)

„ Truk melintas dari jalan penghubung antara Kabupaten Simalungun, dengan Kabupaten Batubara yang mengalami kerusakan parah sejak beberapa tahun terakhir.


MINGGU 14 SEPTEMBER 2013

Edisi 250 „ Tahun VI

Gadis asal Belawan jadi Korban Traficking BACA Gadis

Hal 8

TANJUNGBALAI-Irma Sari (24), gadis asal Sicanang Belawan, mengaku menjadi korban perdagangan manusia di Malaysia, sesaat setelah tiba di tanah air, melalui Pelabuhan Teluk Nibung Tanjungbalai, dari Port Klang, Malaysia dengan menumpang KM MV Jet Star, Sabtu (14/9). Persoalan ini muncul, setelah Irma Sari, ditemani Ariana (35), warga Batu 20, Perumahan Belawan Permai menemui

pihak kepolisian, di pos KPPP Teluk Nibung. Kepada polisi, Ariana(35) yang mendampingi Irma mengatakan, bahwa wanita itu mengaku telah menjadi korban perdangan manusia di Malaysia. “Dia mengaku dijual seorang pria Malaysia ke tempat hiburan semacam kafe. Dia minta perlindungan ke saya. Makanya, saua bawa melapor polisi saja,” ujar Ariana, lantas

mengatakan, Irma juga sempat mengarahkan telunjuk ke seorang pria paruh baya, sesama penumpang kapal asal Malaysia tersebut, dan menyebutnya sebagai orang yang menjualnya. Setelah melapor ke Pos Polisi KP2 Teluk Nibung, oleh Aiptu Riduan Nasution, kepala Pos Polisi, Ariana, dan Irma Sari diarahkan untuk mengadu ke Polres. Selain itu, mereka juga

(FOTO : Araffotografie.wordpres/INT)

MENYEBERANG-Seorang nelayan, dengan menggunakan sampan mesin tempel, menyeberangi Sungai Asahan, yang memisahkan wilayah Kabupaten Asahan, dengan Kota Tanjungbalai. Terletak di muara dua sungai besar, yakni Sungai Asahan, dan Sungai Silau, membuat Tanjungbalai ternasuk dalam golongan Kota strategis.

Pembahasan Ranperda Bantuan Hukum Belum Tuntas

Kinerja DPRD LAMBAN TANJUNGBALAI-DPRD Kota Tanjungbalai didesak segara merampungkan pembahasan rancangan peraturan daerah (Ranperda) pemberian bantuan hukum kepada masyarakat yang kurang mampu. Hal itu diungkapkan Musa Setiawan,SH, Direktur Lembaga Bantuan Hukum (LBH) TRISILA, Sabtu (14/9). “Berdasarkan hasil audensi kita dengan Sekdako barubaru ini, diakui bahwa Pemko telah menyampaikan Ranper-

da tentang pemberian bantuan hukum kepada masyarakat kurang mampu ke DPRD untuk dibahas dan disahkan. Akan tetapi, hingga saat ini DPRD Kota Tanjung Balai belum memperlihatkan tandatanda telah rampungnya pembahasan ranperda bantuan hukum tersebut,” ujar Musa Setiawan SH. Menurut Musa Setiawan SH, masyarakat saat ini sangat „) Baca Kinerja.....Hal 7

P-APBD 2013 Belum Dibahas TANJUNGBALAI -Menjelang pertengan bulan September 2013, Pemerintah Kota Tanjungbalai ternyata belum menyampaikan draf Rancangan Perubahan APBD 2013 ke DPRD untuk dibahas. Hal itu diungkapkan Hakim Tjoa Kien Lie, Sekretaris Fraksi PDI Perjuangan DPRD Tanjungbalai, Sabtu (14/9). ”Harusnya Pemko sudah menyampaikan draf Rancangan Perubahan APBD 2013 ke DPRD un-

tuk segera dibahas. Akan tetapi, hingga saat ini belum ada,” katanya. Hakim mengatakan, pihaknya khawatir, jika tidak segera disampaikan, DPRD tidak akan sempat lagi untuk melakukan pembahasan terhadap RP-APBD tersebut yang akan berdampak „) Baca P-APBD.....Hal 7

Saling Mengejek, Dua Kelompok Pemuda Bentrok

Hotel di Parapat Terancam Gulung Tikar Ada yang Buka Hanya saat Liburan PARAPAT- Bisnis perhotelan di sepanjang pinggiran Danau Toba tidak secerah dan semakmur era 90-an. Hal itu seiring terus menurunnya jumlah pengunjung objek wisata danau terbesar di Indonesia itu. Jangankan mengharapkan untung, untuk membayar gaji karyawan

saja, pengelola hotel sudah cengap-cengap. Namun, tentu saja itu tak dialami oleh semua hotel yang ada di sana. Seperti yang diceritakan oleh Agus Salim, Manajer Hotel Wisata Bahari, Kamis (12/9) lalu. Dia menuturkan, „) Baca Hotel .....Hal 7

(FOTO: Fandho Girsang)

„ Erman saat menjaani perawatan di RS Vita insania. Sabtu (14/9) .

Jadwal Keberangkatan STASIUN TANJUNGBALAI KA Putri Deli Berangkat (Tanjung)

Tiba (Medan)

I. 06.50 WIB

11.17 WIB

KA Putri Deli Berangkat (Tanjung)

II. 12.50 WIB

Tiba (Medan)

17.27 WIB

KA Putri Deli Berangkat (Tanjung)

Tiba (Medan)

III. 17.50 WIB

22.15 WIB

Sumber: Stasiun Kereta Api Tanjungbalai

Wak Alang: P-APBD belum dibahas jugo. Apa masalah? Wak Ongah: Agaknyo, masalah ‘tarif ’ nan bolum sasuai, he he.(***)

SIMALUNGUN- Gara-gara saling ejek saat minum tuak, dua kelompok warga di Perumnas Batu VI, Kecamatan Siantar, Simalungung terlibat bentrok. Seorang di antaranya harus dilarikan ke rumah sakit karena mengalami luka di kepala. Selain itu, Pos Polisi dan beberapa rumah warga sempat jadi sasaran lemparan batu dari dua kubu yang bentrok. Peristiwa yang sempat menghebohkan warga Perumanas Batu VI itu terjadi, Jumat (13/9) malam hingga Sabtu (14/9) dihi hari kemarin. Seperti informasi yang dihimpun dari lokasi kejadian, bentrok antar warga itu dipicu saling ejek saat minum tuak di Nagori Sionggang, Kecamatan Siantar. Bahkan sempat terjadi perang mulut hingga pertengkaran berlanjut ke Perumanas Batu VI, persisnya di Jalan Makadame Raya, Nagori Nusa Harapan, Kecamatan Siantar. Saat itu, seorang pemuda yang terlibat pertengkaran di warung tuak Sionggang, mendatangi beberapa pemuda yang sedang nongkrong tak jauh dari Pos Polisi Perumas Batu VI. Kedatangan pemuda itu justru menimbulkan malapetaka. Sekolmpok pemuda secara membabi buta langsung menganiaya secara keroyokan.

Beberapa di antaranya bahkan menggunakan broti menghajar pria yang belakangan diketahui bernama Endy Erman Syahputra (32) itu. Bersamaan itu, teman korban langsung memanggil rekannya yang lain. Karena sudah sama-sama banyak teman, bentrokpun pecah ketika sekelompok teman Erman dari Nagori Nusa Harapan, berupaya menyelamatkan Erman. Begitupun sekelompok warga dari Nagori Sitalasari, tetap memberi perlawanan dengan melempari batu ke arah kelompok warga Nusa Harapan. Lebih dua jam saling baku hantam hingga saling lempar batu. Beberapa petugas yang sedang piket di Pos Polisi bahkan tidak mampu berbuat banyak. Sementara Erman yang mengalami pecah kepala, langsung dilarikan ke RS. Vita Insani Siantar. Namun bentrok masih tetap berlanjut. Bentrok yang sudah terjadi tiga kali selama tujuh bulan terakhir juga sempat merembes ke Nagori Lestari Jaya. “Perkelahian ini sudah pernah terjadi dan ini bukan kali pertama. Sudah dua kali bentrok terjadi. Jika tidak cepat ditanggapi, bentrok susulan bah„) Baca Saling.....Hal 7 „) Baca Saling.....Hal 7

DPT Kota Tanjungblai Diprotes TANJUNGBALAI-Daftar Pemilih Tetap (DPT) Kota Tanjungbalai yang disusun oleh KPUD diprotes. Garagaranya, ada indikasi kelalaian, dan rekayasa data penduduk, yang diduga dilakukan pihak penyelenggara pemilu. “Kita menemukan ada beberapa nama pemilih yang tercatat dalam DPT, umurnya belum genap 17 tahun pada hari H pelaksanaan Pemilu

Legislatif 2014 mendatang. Untuk itu, kita minta kepada KPU Kota Tanjungbalai agar meninjau kembali DPT tersebut untuk kebaikan bersama,” ujar Husni Rusli, Ketua Dewan Penasehat LSM Forum Generasi Muda Indonesia Kota Tanjungbalai kepada METRO ASAHAN, Sabtu (14/ 9) malam. Menurut Husni Rusli, sete„) Baca DPT.....Hal 7

Jalan Lintas PerdaganganIndrapura Rusak BATUBARA-Ruas jalan penghubung Kota Perdagangan di Simalungun, dengan Kota Indrapura Batubara saat ini kondisisnya rusak parah. Jalan yang berstatus jalan provinsi tersebut, kondisinya cukup memprihatinkan, dan mirip dengan kubangan kerbau. Ruas jalan tersebut berada di antara Desa Tanjung Muda Kecamatan Air Putih, Batubara, dengan Desa Sugaran Bayu, Kecamatan Bandar, Kabupaten Simalungun. Hampir di sepanjang jalan,

lobang dengan diameter besar menganga, dan menjadi kolam kecil, yang tentunya sangat mengganggu pengguna jalan.. Siran (38) warga Limapuluh, seoramg supir truk yang ketepatan melintas mengatakan, kerusakan jalan tersebut sudah sangat mengganggu, dan sudah merugikan seluruh pihak yang menggunakan jalan tersebut dari sisi ekonomisnya. “Hampir di sepanjang jalan „) Baca Jalan.....Hal 7


MINGGU

15 SEPTEMBER 2013

Mayat Kuli Bongkar Muat Mengapung di Kolam Sambungan Halaman ...9

mayat tidak dikenal, maka mereka menelepon saya dan saya langsung melapor ke Pos Pos Pol Pangkatan,” jelas Kepala Desa Kampung Padang, Ali, Sabtu (14/ 9). Kapolpos Pangkatan Aiptu Taufik Siregar ketika dikonfirmasi membenarkan adanya penemuan mayat di areal kolam tempat pembuatan batu bata itu. Di

sekitar jenazah, juga ditemukan satu unit sepedamotor Supra X 125 berwarna hitam BK 6696 ZB yang diduga milik korban. Kata Taufik, berdasarkan pengakuan keluarga korban, Wisnu Simalango pergi meninggalkan rumah Kamis (12/9), sekitar pukul 12.00 WIB. Saat itu korban mengaku ingin berkunjung ke rumah familynya di Desa Tanjung Harapan. Namun korban yang pergi berkunjung itu tidak pu-

lang-pulang ke rumah hingga ditemukan tewas mengapung di kolam pembuatan batu bata itu. “Itu berdasarkan pengakuan keluarga korban yang datang ke kamar jenazah RSUD Rantauprapat, “ kata Taufik Sedangkan penyebab kematian korban hingga kini belum bisa dipastikan, karena tidak ada tanda-tanda kekerasan maupun penyakit yang diderita korban dan motifnya masih dalam pe-

nyelidikan. Namun dari kantong celana korban ditemukan lem kambing, sehingga kuat dugaan korban tergelincir ke kolam yang kedalamannya 3 Meter, setelah mengkonsumsi lem tersebut. “Penyebab kematian korban belum diketahui dan masih dalam penyelidikan, namun dugaan sementara korban tergelincir ke kolam setelah mengkonsumsi lem kambing, “ tambah Taufik. (nik)

Baru Isu Sudah Kalap Sambungan Halaman ...9

tukang becak Marlis yang tinggal di Lorong Belaras Tembilahan Kota, Kecamatan Tembilahan (Riau). Semua informasi yang masuk ditelan mentah-mentah, tanpa diselidiki dan diklarifikasi dulu. Padahal gara-gara pemikirannya yang pendek, keluarga hancur dan “karier” dia sebagai tukang becak harus berakhir, lantaran harus mendekam di sel penjara. Keluarga Marlis sebenarnya pasangan yang sedang berbahagia. Sebab setelah setahun berumahtangga,istrinyamenunjukkan hasilnya sebagai ibu rumahtangga

sejati. Maksudnya, berkat kerja siang malam, Wida kini sedang hamil 7 bulan. Berarti 2 bulan 10 hari lagi dia akan disebut sebagai bapak. Marlis pun pernah berkhayal, agar nanti anaknya harus jadi orang pandai, sehingga tidak perlu jadi tukang becak macam dirinya. Akan tetapi rupanya Tuhan berkehendak lain. Di kala Marlis sedang senang-senangnya bakal jadi ayah, ada orang iseng yang merusak kebahagiannya. Di kala dia sedang mengenjot becak, tibatiba ketemu tetangga. Maksudnya guyon, tapi Marlis menerima serius. “Kasihan amat kamu Marlis.

Kerjasampaibantingtulangbegitu, padahal istrimu hamil tidak dengan kamu……!” ujar teman sambil berlalu. Hati siapa yang tak tercekat bila tak bisa mencermati kata-kata itu? Dan sesuai dengan kadar pemikiran tukang becak, Marlis langsung menduga bahwa istrinya telah selingkuh. Jika hamil bukan denga dirinya, apa namanya kalau bukan selingkuh? Termakan oleh kabar itu, dia mendadak pulang dengan kemarahan yang meledak-ledak. AlampikiranMarlisyangsempit, menganggap bahwa Wida istrinya memang bermain selingkuh. Sebagaimanakatatetangga,istrinya

hamildenganoranglain.Ah,kurang ajarbenarWidaini.Dikalasuamidi luar capek menggenjot becak, di rumah istrinya digenjot lelaki lain. Masya Allah……. Yang terjadi selanjutnya sungguh tragis. Tanpa bertanya ini itu, setibanya di rumah langsung saja Marlis menghujamkan pisau dapur ke perut dan leher istrinya. Cuma tiga kali, tapi langsung wasalam. Sementara istrinya dimakamkan, Marlis menjalani pemeriksaan. Dia menyesal tujuh turunan saat tahu maksud kata “hamiltidakdengankamu”adalah hamil tak mungkin berdua-dua. Nasi sudah menjadi bubur. (int)

Pencuri Ditangkap di Hadapan Istri dan Anak Sambungan Halaman ...9

sekitar pukul, 03.30 WIB. Tertangkapnya Mahdan Munthe atas pengembangan pemeriksaan dari Aminuddin alias Tohir (27) warga Kuala Bangka Kecamatan Kualuh Hilir,Laburayang diringkusdiDesa Sidua-dua Kecamatan Kualuh Selatan, Selasa (3/9) lalu. Tohir di tangkap atas kasus curanmor. Atas pengembangan dari kasus Tohir tersebut diketahui bahwa Tohir pernah melakukan keja-

hatan mencuri tas berisikan uang dan perhiasan pada 4 Juli bersama Mahdan Munthe. Saat itu Korban bernama Hekbon (45) warga Sibaja Bengkalis Riau, mengendarai mobil Xenia dariBengkalis menujuMedandan tiba di Area SPBU Mangga. Saat itu korban bersama keluarga sedang istirahat, dan sebagian keluarganya berada di dalam Musholla SPBU, sedangkan istri Hekbon dan anaknya berada di dalam mobil Xenia warna Silver.

Lalu Tohir dan Mahdan beraksi dan berhasil mengambil satu tas warna hitam yang berisikan uang kontan Rp5 juta dan perhiasan kalung dan cicin emas, Handphone merek Nokia yang ada di dalam tas yang tumpangi keluarga Hekbon. Berdasarkan pengaduan korban, polisi melakukan pengejaran dan berhasil menangkap kedua tersangka. Kapolsek Aek Natas AKP TH Perangin-Angin dan Kanit

Reskrim IPDA M Pasaribu mengatakan, penangkapan terhadap Mahdan saat Mahdan sedang duduk santai bersama istri dan anaknya. Lalu Mahdan diboyong ke kantorpolisiuntukdimintaiketerangan dan pertanggungjawabannya. Selain membawa Mahdan, petugas juga memboyong sepedamotor Supra X 125 tanpa plat sebagai barang bukti yang dipergunakan tersangka untuk mencuri. (nik)

DUDA SODOMI REMAJA PUTUS SEKOLAH

Pelaku: Banyak yang Sudah Saya Gitukan SIDIMPUAN- “Banyak yang gitukan sudah saya (sodomi,red). Tapi, enggak ada yang sampai melapor,” aku S (51), warga Jalan Ketapang, Gang Mawar, Kelurahan Sibolga Hilir, Kota Sibolga, tersangka pencabulan terhadap DSN (16). Menurut S, sudah sering melakukan hal tersebut dengan anak-anak di bawah umur di Kota Sibolga. Hal itu dilakukan duda ini, karena waktu remaja, pernah menjadi korban sodomi juga. Saat ditemui METRO, Sabtu (14/9), di ruangan Sat Reskrim Polres Kota Psp, S bercerita tentang kehidupannya dan mengapa sampai bisa berbuat seperti itu. S, pria yang sudah berusia lebih dari setengah abad ini, mengaku hidup dari pekerjaannya sebagai pelukis. Dan, pekerjaannya itu sudah dilakoninya selama puluhan tahun. “Hidup saya hanya dari melukis. Semua orang di Sibolga tahu dengan saya. biasanya saya mendapat panggilan untuk melukis ke sekolah-sekolah. Dari situlah saya hidup dan membiayai diri,” ujar pria yang mengaku pernah berumah

tangga namun ditinggal oleh sang istri. Semenjak ditinggal istrinya sekitar 10 tahun lalu, sambung S, ia mulai punya rasa tertarik terhadap sesama jenis (homo). Dan katanya, ia juga mempunyai masa lalu yang suram. “Dulu sewaktu saya merantau ke Jakarta, saya juga pernah digituin. Dan, itu sering saya dapatkan. Mungkin dari situ saya jadi merasa tertarik terhadap laki-laki. Enggak tahu kenapa, kalau saya lihat ada anak-anak yang masih polos dan penurut saya jadi sayang sama dia. Makanya saya enggak nyangka kalau anak itu (korban, red) tega melaporkansayakepolisi.Padahal dia bilang kalau dia juga sayang samasaya,”ujarSsambilmengaku menyesali perbuatannya itu. S menambahkan, ia baru tiga hari berada di Psp. Sebelumnya ia berada di daerah Sitinjak Angkola Barat, Tapsel. Di sana, S juga melukis sebuah sekolah. Setelah pekerjaannya di Sitinjak selesai, ia mendapat pekerjaan baru untuk melukis SD di Psp. “Baru 3 hari saya disini, sebelumnya saya baru siap melukis di Sitinjak. Habis dari situ saya mendapat job di SD dekat Kampung

Darek. Saya juga tinggal di rumah yang berada di sekitar sekolah. Kalau untuk upah, setiap selesai melukis biasanya saya dapat Rp300 ribu sampai dengan Rp 500 ribu. Dan itulah yang saya pergunakan untuk kebutuhan seharihari,” tukasnya. S juga menceritakan mulanya ia mengenal korban, Selasa (10/9), ketika sedang berjalan-jalan di sekitar Jalan Alboin Hutabarat Kota Psp, kemudian ia menegur korban dan menanyakan apa pekerjaannya. Ternyatakorbanpunmenjawab kalau ia sudah tidak sekolah lagi dan tidak mempunyai pekerjaan. Kemudian, ia menawarkan kepada korban untuk ikut kerja dengannya. Dan korban pun menyetujuinya. Selanjutnya pelaku membawakorbankesekolahyang dimaksud. Di sana ia menjelaskan kepada korban, bahwa pekerjaanya sebagai pelukis dan korban nantinya hanya bekerja membantu-bantunya. “Saya lihat anak itu baik, rajin, tidak merokok. Makanya saya sayang sama dia. Saya belikan sandal, baju, saya kasih makan dan beri uang. Tega kali dia sampai memenjarakan saya seperti ini,” ucap S sedih. (mag 01)

Banyak Desa Tak Bisa Pertanggung Jawabkan ADD Sambungan Halaman ...9

sebesar 70 persen diperuntukan bagi pemberdayaan masyarakat dan pembangunan infrastruktur serta peningkatan ekonomi kerakyatan, dan 30 persen belanja aparatur dan biaya operasional pemerintahan desa. “Namun kebanyakan pemerintah desa tidak bisa memperlihatkan bukti penggunaan secara lengkap pada surat pertanggung jawaban mereka,” katanya. Menurutnya sesuai pasal 23 Permendagri Nomor 37 tahun 2007 tentang pedoman pengelolaan keuangan desa menyatakan, setiap pertanggung jawaban ADD terintegrasi dengan pertanggung jawaban anggaran pendapatan dan belanja desa. Namun dari konteks tersebut sesuai kajian mereka minimnya sumber daya

manusia (SDM) yang ada pada pemerintah desa tersebut merupakan pemicu utama pengelolaan keuangan tersebut. Sehingga sangat dibutuhkan adanya bentuk pelatihan pengelolaan keuangan yang dapat mengisi kekosongan SDM pada aparatur Desa. Di samping itu, dalam penyaluranADDtahun2012,pemerintah telah menetapkan kategori desa dalam pembagian ADD tersebut, seperti desa yang berlokasi di sekitar perkebunan mendapat ADD Rp36 juta, desa non perkebunan bisa mencapai Rp56 juta, dan desa tertinggal/pantai mencapai Rp79 juta lebih. Adanya kategori desa penerima ADDmemangmenimbulkandilema tersendiri, contohnya desa perkebunan setelah dikeluarkan dari pengeluaran operasional pe-

merintahan desa dan bantuan modal usaha kelompok masyarakat(Pokmas)biayaLKMD,biaya Tim Pengerak PKK, biaya Posyandu, biaya kegatan Keagamaan dan pembinaan generasi muda serta biaya raskin ADD-nya hanya bisa tersisa sekitar Rp 4 jutaan untuk pembenahan infrastruktur. “Jadi akibat adanya pemisahan kategori itu beberapa desa Perkebunanyangsecaraotomatismemperolehanggaranminimtidakbisa melaksanakan pembangunan secara maksimal,” sebutnya. Dia menyarankan agar PemerintahdapatmemberikanFormula tersendiri dalam program penyaluran dana ADD tersebut untuk mendongkrak pertumbuhan ekonomi, sosial dan pembangunan disuatu Desa agar program penyaluran dana ADD ini tidak mubajir ataupun sia-sia.(riz)

Hari ini Akhir Massa Tanggapan Masyarakat Sambungan Halaman ...9

Labuhanbatu. Ketua Tim Seleksi KPU Labuhanbatu Ihsan Rambe melalui Sekretaris Rony Afrizal mengatakan, mereka mengharapkan adanya tanggapan dan masukan dari masyarakat agar pihaknya dapatmengetahuirekamjejakpara calon tersebut untuk melangkah ke proses seleksi selanjutnya. “Kepada masyarakat diharapkan partisipasinya dalam rekrutmen ini,” terang Rony. Tanggapan tersebut kata dia, sangat diperlukan guna melihat

integritas, independensi, dan moralitas calon komisioner KPU Labuhanbatu. Sebab hal itu sangat dibutuhkan untuk dapat menelurkanpenyelenggarapemiluyang berkualitas. Menurutnya tanggapan masyarakat telah mereka buka sejak 12 september lalu, dan akanberakhirhariini.Diamenambahkan dari tanggapan tertulis yang dilayangkan masyarakat tersebut dapat disampaikan melalui sekretariat Tim Seleksi ataupun langsung kepada anggota Tim seleksi KPU Labuhanbatu. Sebelumnya Tim Seleksi telah mengumumkan 20 orang calon

anggota KPU Labuhanbatu yang lolos dalam seleksi test tertulis, kesehatan, dan psikologi pada Kamis (12/9) lalu. Adapaun 20 nama-nama tersebut yakni Mulkan Drajat MA, Fit Aidil Indra ST, Sutini SPd, Siti Nurmala Nasution SE, Idham SPd, HM Sofyan MA, Abdul Haris Hasibuan, Darlis Satrya Nasution SS MM, Andi Pati Dana, Makmur SE, Irwansyah SH MH, Tengku Azhar Taufik SAg, Abdul Jalil Ritonga SPd, H Syam Hasri SH, Fadli Amri Hasibuan, Hj Ira Wirtati SAg MPd, Ghazali Harahap, Ilham Maulana SE, Wahyudi SSos, dan T Musliminsyah. (riz)

Mantan Kadis Pasar Bantah... Sambungan Halaman ...9

Dijelaskanya, selama ini DP Ginting terkenal dekat dengan mantan Kepala Dinas Pasar dan sering kali datang bertemu dengan mantan Kepala Dinas Pasar Edi Gani Ginting . “Walaupun si DP Ginting bukan lah pegawai di dinas pasar, namun semua urusan di dinas pasar selalu dia yang tangani. Sebab, dia merupakan orang dekat mantan kepaladinaspasar,”terangnyasambil meminta namanya agar diraha-

siakan. Dia juga menambahkan, selain copy kuitansi atas nama Suyanto, juga terdapat beberapa nama copykuitansiyangjugatelahberedar. “Selain copy kuitansi atas nama Suyanto, saya juga pernah melihat beberapa nama lainnya. Kalau saya tidak salah si DP ginting itu sebagai kordinator calo mengumpulkan orang yang ingin masuk kerja di dinas pasar. Dan uang itu sebagian akan disetorkan kepada kepala dinas. “Biasanya, 50 persen dari jumlah uang itu akan disetor

kepada kepala dinas” tambahnya. Sementara itu, mantan Kepala Dinas Pasar Edi Gani Ginting saat dikonfirmasi membantah secara tegas ada menerima dana dari DP Ginting. Bahkan Edi mengaku tidak mengenal DP ginting. “Saya secara tegas tidak kenal dengan dia. Jadi, saya minta jika anda jumpa dengannya tolong katakan jangan bicara sembarangan. Dan saya minta, jika ada yang merasa korban dan merasa keberatan agar membiat laporan kepolisi,” katanya. (CR-2).

Labusel Minim... Sambungan Halaman ...9

katanya. Dalam hal ini, menurut Doni, pemerintah daerah harus bisa menarik investor untuk membangun pusat pembelanjaan serba lengkap dalam menjual alat-alat elektronik. Hal senada, juga disampaikan Hanum (21), salah seorang pegawai medis di Labusel. Menurutnya, kalau dilihat pusat pembelanjaandiLabuselmemangsangat minim sekali. Apalagi persediaan bahan ataupun bakal baju sangat terbatas.

Seperti halnya pakai yang menggunakan bahan kain tenun, kain songket dan katon morry, doby, piscos, sutra super, sutra timbul, sutra alat tenun mesin dan batik pakai pegawai perkantoran . Hanum menambahkan, “ kalau dilihat dari bahan-bahan pakaian tersebut sangat jarang sekali ditemukan dijual di pusat pembelanjaan di pertokoan perkotaan di Labusel. “Jadi tak heran, kalau orang Labusel sendiri ketika ingin mencari bahan dan corak ataupun jenismerekpakaiharuskeluardaerah terlebih dahulu untuk menda-

patkan barang tersebut. Karena sangat jarang sekali dijual bahan seperti itu,” tambahnya. Menurutnya, agar warga tidak merasa kesulitan dalam memenuhi kebutuhan belanja sudah selayak pusat pembelanjaan terbesar dibangun dengan fasiltas misalkan tersedia seperti satu lorongruanganspesialmenjualkhusus alat eletronik, bahan dan jenis merek pakaian, alat dapur dan bahan bakunya, alat bangunan serta peralatan, makan dan roti, minyak wangi, sabun dan lainlainnya mengakhiri, “jelasnya. (Mhr).

Warga Sibuk Melengkapi Persyaratan Sambungan Halaman ...9

Seperti dimulai dari kantor camat untuk mengurus KTP, kantor disnaker mengurus kartu kuning dan Polres Labuhanbatu mengurus surat keterangan catatan kepolisian (SKCK). “Ialah, rencananyakan surat yang diurusi ini untuk dipergunakan dalam memenuhi persyaratan melamar mengikuti ujian

CPNS tahun ini,” katanya Selain itu, dikatakan Deliana taman D3 Akademi Keperawatan ini, Senin (16/9) masih ada lagi kegiatan dalam urusan mau melegalisir ijazah. Hal serupa juga disampaikan Akmal Pasaribu (23) warga Torgamba. Menurutnya lebih kurang dua jam dirinya terpaksa harus menunggu surat SKCK dan surat kesehatan. Walaupun harus mon-

dar-mandir antar kecamatan yaitu Kotapinang dan Torgamba demi mempersiapkan kelengkapan surat lamaran dalam mengikuti CPNS tahun ini namun dirinya tetap bertekad melengkapi berbagai persyaratanagarbisamelamarjadi CPNS. “Enggak apa-apa, biarlah menunggu asalkan urusan cepat selesai demi harapan untuk menjadi PNS,” ujarnya. (Mhr)


MINGGU, 15 SEPTEMBER 2013

Mayat Kuli Bongkar Muat Mengapung di Kolam PANGKATAN-Wisnu Simalango alias Wisnu (16), warga Dusun Bulu Tolang Desa Sei Siarti Kecamatan Panai Tengah Kabupaten Labuhanbatu ditemukan tewas mengapung di kolam pembuatan batu bata di Dusun Sidodadi, Desa Kampung Padang, Kecamatan Pangkatan, Kabupaten Labuhanbatu, Sabtu (14/9) sekitar pukul 06.00 WIB.

B

elum tahu pasti penyebab kematian korban. Namun kuat dugaan, ABG yang seharinya bekerja sebagai kuli bongkar muat di Pabrik Kelapa Sawit (PKS) PT Cisadane Negeri lama tersebut tewas akibat mengkonsumsilemkambingyang ditemukan di saku celananya.

Informasi diperoleh, jenazah Wisnu pertama kali ditemukan oleh pemilik kolam pembuatan batu bata, Jumi’in, yang hendak melakukan aktifitasnya. Namun saat tiba di kolam, Jumi’in mencium bau busuk. Lalu Jumi’in mencari tahu asal aroma tidak sedap tersebut.

Setelah beberapa lama mencari tahu, akhirnya Jumi’in menemukan sumber bau tersebut ternyata dari sosok mayat pria yang tidak dikenalnya mengapung di kolam. “Mayat ditemukan pemilik kolam batu bata pagi tadi. Karenakan

Mantan Kadis Pasar Bantah Terima Uang Pendaftaran Honorer RANTAU-Mantan Kadis Pasar Edi Gani Ginting disebut-sebut menerima dana penerimaan pegawai honorer di Dinas Pasar dan Kebersihan Labuhanbatu Rp7 juta per orang. Namun Edi membantah tudingan tersebut. Menurutnya ia tidak ada menerima dana dari pendaftaran honorer.

“Kalau saya tidak salah mantan Kepala Dinas Pasar Edi Gani Ginting ada menerima dana untuk pegangkatan tenaga honorer,” ungkap salah satu pegawai Didinas Pasar berinisial AS, Sabtu(14/9)diPasarGelugur Rantauprapat. „) Baca Mantan....Hal 10

„) Baca Mayat ....Hal 10

Banyak Desa Tak Bisa Pertanggung Jawabkan ADD RANTAURPAPAT– Hingga kini masih banyak kepala desa yang belum bisa mempertanggung jawabkan penggunaan anggaran Alokasi Dana Desa (ADD) khususnya tahun 2012. Dari sejumlah kajian hal itu dipicu, akibat penggunaan dana tersebut yang dinilai tidak tepat sasaran. Patrisno L, aktivis LSM di Rantauprapat, Sabtu (14/9) mengatakan, sesuai aturan porsi penggunaan ADD telah ditentukan „) Baca Banyak....Hal 10

SELEKSI ANGGOTA KPU LABUHANBATU

„ Kapolsek Aek Natas AKP Thomas Perangin-angin dan Kanit Reskrim IPDA M Pasaribu menginterogasi Mahdan Munthe (tengah) pencuri sepedamotor Supra X 125.

Pencuri Ditangkap di Hadapan Istri dan Anak AEK NATAS – Pelaku pencurian Rp8,5 juta di Stasiun Pengisian Bahan Bakar Umum (SPBU) Mahdan Munthe (27), Sabtu (14/9) diringkus petugas

Polsek Aek Natas di hadapan istri dan anaknya. Mahdan ditangkap di kediamannya di Kongsi Enam, Desa Terang Bulan, Kecamatan Aek Natas,

Labuhanbatu Utara. Informasi dikepolisian dari Kapolsek Aek Natas AKP TH Perangin-Angin dan Kanit Reskrim IPDA M Pasaribu,

Mahdanmelakukanpencurian di SPBU 14. 214.246 Mangga Desa Terang Bulan 4 Juli lalu „) Baca Pencuri ...Hal 10

Baru Isu Sudah Kalap Agaknya tukang becak itu memang lebih berkarya lewat tenaga daripada pikiran. Buktinya Marlis, 28 (bukan nama sebenarnya) dari Tembilahan (Riau) ini. Dengan kabar istrinya selingkuh, tanpa pikir panjang langsung saja main tusuk. Padahal Wida, 24 (bukan nama sebenarnya), istrinya sedang hamil 7 bulan. Tak ayal lagi ibu beserta janinnya langsung wasalam. Tukang becak adalah profesi yang dijalani karena keterpaksaan. Gara-gara pendidikan minim, masuk jalur kerja formal menjadi susah. Pasar yang masih bisa menerima hanyalah hal-hal yang bermodalkan tenaga bukan pi-

kiran. Nah, karena pendidikan yang minim pula, dia tak bisa menyelesaikan setiap masalah yang timbul secara bijak dan cerdas. Ini setidaknya terjadi pada „) Baca Baru....Hal 10

Hari ini Akhir Massa Tanggapan Masyarakat RANTAU–Jadwal masukan dan tanggapan masyarakat terhadap 20 orang yang dinyatakan lulus tahapan seleksi Calon Anggota KPU Labuhanbatu yakni Minggu (15/ 9). Diharapkan masyarakat turut proaktif memberikan masukan kepada tim seleksi terkait rekam jejak para calon anggota KPU

„ Para pencari kerja saat mengurus SKCK di Polsek Kota Pinang.

JELANG PENERIMAAN CPNS

Warga Sibuk Melengkapi Persyaratan KOTAPINANG - Menjelang penerimaan Calon Pegawai Negeri Sipil (CPNS) 2013, sejumlah warga di Kotapinang Labuhanbatu Selatan (Labusel) sudah mulai sibuk mempersiapkan berkas untuk memenuhi persyaratan menjadi pelamar CPNS. Deliana (21) warga Kotapinang, Sabtu(14/9) mengatakan, menjelang adanya penerimaan CPNS tahun ini, dirinya sudah berungkali memasuki ke kantor

kepolisian dan pemerintahan untuk mengurus kelengkapan berkas-berkas melamar CPNS.

„) Baca Hari ....Hal 10

„ Suasana di inti kota Kotapinang yang minim sarana perbelanjaan.

Labusel Minim Pusat Pembelanjaan KOTAPINANG - Pusat pembelanjaan di Kabupaten Labuhanbatu Selatan sangat minim. Hal ini terlihat masih banyaknya warga yang harus membeli alat elektronik, alat perkantoran keluar daerah. Doni (24) seorang mahasiswa disalah satu perguruan tinggi di Kota Medan, warga Kotapinang, Sabtu(14/9) mengatakan, dalam memenuhi kebutuhan alat elektronikperkantoranberupamesin

foto copy, CCTV, mesin Fax, mesin projector dan lemari besi menyimpanberkasdocumentia terpaksa membelinya dari kota lain. Sangat jarang sekali ketika kita temui dipusat pembelanjaan di perkotaan pada setiap pertokoan dilima kecamatan Labusel.Bahkansamasekalibisa dikatakan tidak ada yang menjual perlengkapan itu di sini,” „) Baca Labusel ....Hal 10


METRO ASAHAN

11

MINGGU, 15 September 2013

Olahraga, Jauhkan Wanita dari Kanker Menyikapi Keterlambatan Tumbuh Kembang Balita FASE tumbuh kembang anak usia 0-5 tahun perlu mendapat perhatian dari para orangtua. Pada masa golden age inilah, anak-anakmengembangkankemampuan motorik kasar, motorik halus, berbahasa dan kecerdasannya. Sebaiknya, tak ada satu pun tahapan tumbuh kembang balita yang terlewati, agar bisa terhindar dari berbagai kesulitan saat anak berusia di atas lima tahun. Kalau fase ini terlewati, orangtua perlu mewaspadai namun bukan berarti khawatir berlebihan apalagi cemas dan panik. Pentingbagiorangtuauntukmemahami risiko keterlambatan tumbuh kembang anak, sekaligus juga memahami bagaimana cara menyikapinya dengan tepat. Dengan begitu, anak bisa tertangani dengan baik kalau pun mengalami keterlambatan.Orangtuajugalebihmampu mengambil tindakan terbaik untuk si kecil, dan tidak terpedaya mitos. Risiko “Orangtuaharuswaspadadengantandatandaketerlambatantumbuhkembanganak. Semua anak harus melewati milestone tumbuh kembang, jangan sampai ada fase yang terlewati,” ungkap dokter anak dari Brawijaya Women and Children Hospital, dr Attila Dewanti, SpA(K) Neurologi, di Jakarta, beberapa waktu lalu. Menurutnya, orangtua juga sebaiknya tidak mengabaikan tanda-tanda keterlambatantumbuhkembang.Misalnya, anakusiaenambulansudahmampududuk namun belum bisa tengkurap. Hal ini sebaiknya tidak dibiarkan karena jika fase tengkurapterlewati,anakberisikomengalami kesulitan ke depannya. “Kalautigatahunbelumbisamemegang pensil, bawa ke dokter, karena bisa jadi ada yang salah dengan motorik halus, ada kelainan saraf. Ini bisa dikenali dengan observasi. Biasanya observasi dilakukan 30menithinggasatujamuntukmengetahui apakah ada tanda-tanda keterlambatan tumbuh kembang dan risikonya,” jelas dr Attila sekaligus memberi contoh lain keterlambatantumbuhkembanganakbalita. Setiap anak unik, tak perlu panik Orangtuayangmendapatiketerlambatan tumbuh kembang pada anak, sebaiknya tidakmembandingkankondisianakdengan anaklainnya.Orangtuajugasebaiknyatidak panikmenyikapimasalahtumbuhkembang pada anak, karena setiap anak unik. Psikolog dari klinik tumbuh kembang Rainbow Clinic, Rika Ermasari, SPsi, Ct, CHt mengatakan orangtua perlu berpikir rasional menyikapi keterlambatan tumbuh kembang anak. “Anak tidak ada yang sama. Konsultasi ke dokter tetap perlu jika anak mengalami keterlambatan tumbuh kembang, namun janganterlalukhawatir.Tapijanganjugaterlalu telat melakukan pemeriksaan,” tuturnya. Selainmengatasikekhawatiran,orangtua

juga perlu tahu kapan harus mulai memeriksakan anak yang mengalami keterlambatan tumbuh kembang. Menurut Rika, setiap anak mengalami dampak berbeda dari keterlambatan tumbuh kembang di masa golden age ini. “Orangtua bisa mengandalkan instingnya,bisatahukapansebaiknyamulai memeriksakan anak. Asal jangan terlalu lama, karena semakin lama keterlambatan ini dibiarkan, akan semakin sulit memperbaikidampakyangditimbulkannya. Kalau kesulitan ditangani di masa golden age, akan lebih mudah memperbaikinya,” saran Rika. Menurut Rika, keterlambatan tumbuh kembang punya dampak berbeda pada setiap anak. Umumnya, anak cenderung mengalami kesulitan sosial emosi, seperti tidak bisa berinteraksi, kurang tanggap, sulit bicara, juga kesulitan mengikuti instruksi. Jika keterlambatan tumbuh kembang dibiarkan,dampakjangkapanjangnyaanak menjadi anti sosial. Mitos Orangtua baru pada umumnya merasa panikketikaanakmengalamiketerlambatan tumbuh kembang. Tak sedikit juga yang akhirnya membiarkan karena terpedaya mitos. Penyiar radio dan MC, Amy Zein, mengalamihalini.PutrapertamanyaAbiputra Prasetyo (4), mengalami keterlambatan bicara. Amy mengenali tanda-tanda keterlambatan bicara putranya dari kebiasaan makan. “Kalau makan, Abi mengunyah seadanya. Otot itu yang memengaruhi kemampuan Abi bicara,” ungkapnya. Hinggaputranyaberusia2,5tahun,Amy mendapatikemampuanbicaraputranyatak juga berkembang. “Perkembangan bicara Abi lebih lambat dibanding teman-teman sepantarannya. Tapi banyak yang bilang anak laki-laki bicaranya memang lebih lambat. Jadi saya sempat agak cuek,” ungkapnyakepadaKompasHealthmelalui pesan singkat. Meski telah mengenali tanda keterlambatan bicara pada putranya,Amy taklantasmemeriksakananaknyakedokter. Iamengakuterpedayamitosmengenaianak laki-laki yang lebih lambat berbicara. “Pada usia 2,5 tahun Abi masih bicara seperti bayi, ya sudah akhirnya saya langsung ke dokter dan psikolog,” katanya. Ia menambahkan, “Harusnya bisa lebih cepatmemeriksakankedokterkalauibunya tidak termakan mitos.” Amy juga percaya, orangtua punya insting tinggi yang akan mendorongnya kapanwaktutepatmemeriksakananakyang mengalami keterlambatan tumbuh kembang. Ia pun menyarankan agar orangtuasegeramencaribantuanprofesional begitu menemukan tanda tidak wajar pada tumbuh kembang anak. (int)

OLAHRAGA ternyata tak sekedar menjadikan tubuh lebih bugar. Bagi wanita, olahraga dapat menjadi benteng ampuh terhadap serangan kanker rahim. Riset di Inggris membuktikan, olahraga selama 38 menit sehari ditambah menjaga pola makan, dapat membantu mencegah 44 persen kasus kanker rahim. Studi terbaru ini dilakukan para ahli dari Imperial College London. Para peneliti meninjau berbagai studi sejak 2007 tentang kanker rahim dan

hubungannya dengan diet, olahraga, dan berat badan. Hasilnya, 44 persen kanker rahim di Inggris dapat dicegah dengan cara penjagaan berat badan dan rajin olahraga. Para ilmuwan percaya, ada hubungan antara kanker dan lemak tubuh. Di antaranya, lemak melepaskan hormon yang meningkatkan risiko tumbuhnya kanker. Rutin

olahraga menjaga kadar hormon tidak berlebih dan meningkatkan daya tahan tubuh. Olahraga juga menjaga sistem pencernaan tetap sehat. Laporan dari World Cancer Research Fund’s Continuous Update Project (CUP) menyatakan, setidaknya 3.700 kasus kanker dapat dicegah setiap tahunnya dengan berolahraga. Sayangnya menurut laporan itu, hanya 56 persen wanita di Inggris yang bergerak aktif setidaknya selama 30 menit setiap hari, 5 kali dalam seminggu. Selain itu, hanya 39

persen yang memiliki berat badan berkategori sehat. Tidak ada jalan lain, para wanita harus rajin olahraga untuk menghindari risiko kanker rahim. “Kami menyarankan untuk rutin olahraga 30 menit setiap hari dan tetap langsing, namun jangan sampai underweight,” kata Direktur Eksekutif World Cancer Research Fund (WCRF), Karen Sadler. Kanker rahim merupakan penyakit yang paling banyak dialami wanita berusia lebih dari 60 tahun. Jenis yang paling umum adalah kanker endometrial. (int)

Ujilah Pacar Sebelum Menyesal UJILAH cinta. Kalau tidak, Anda hanya mendapatkan “cinta palsu”. Bayangkan, calon staf yang melamar kerja saja sekarang ini diuji macammacam. Bukan hanya ujian kepandaian, melainkan juga uji kesehatan hingga psikotes. Nah, jika demikian ketat seleksi jadi staf di sebuah lembaga, apalagi saat menerima “lamaran cinta” seorang pria atau wanita. Kita patut mengujinya dengan saksama. Kini sudah mulai ada alat tes pranikah, baik untuk menguji kepribadian maupun kesehatan mental. Alangkah baiknya sebelum melanjutkan hubungan ke arah yang lebih serius, setiap orang perlu menguji (cinta) calonnya. Menguji cinta Berikut ini ada cerita menarik tentang bagaimana seorang putri raja menguji cinta tiga pangeran yang melamarnya. Alkisah, seorang raja perkasa dan terkenal bijak didatangi tiga raja tetangga. Masing-masing raja menawarkan putra mereka agar boleh mempersunting putri sang raja. Tentu Sang Raja tidak mudah memutuskan. Akhirnya, dia memanggil si putri dan meminta dia memutuskan yang terbaik untuk dirinya.

Berkat bimbingan penasihat raja, si putri raja membuat satu kontes sederhana, tetapi dampaknya sungguh besar. Si putri raja meminta setiap pangeran tadi masuk ke sebuah ruangan besar bercat putih bersih. Mereka diminta menghadap satu sisi tembok. Putri raja mengajukan satu permintaan yang sulit diterima

menjelang dua meter dari tembok dia berhenti. Dia pilih mengundurkan diri dari kontes ini. Dia merasa si putri raja ini aneh. Beda dengan pangeran ketiga. Sejak awal dia sudah kenal baik bahwa raja itu terkenal bijak, si putri raja namanya harum sebagai putri yang berbudi luhur. Dia

yakni, ”Jika pangeran benarbenar mencintai saya, mohon berlari kencang dan tabrakkan diri pangeran ke tembok di depan sana.” Pangeran pertama langsung menyerah. Membayangkan dia akan benjol dan geger otak, dia mundur dengan teratur. Pangeran kedua lebih berani. Dia segera ancangancang dan berlari sekencangkencangnya. Namun,

berpikir, “Pasti ini hanya suatu jebakan, tidak mungkin dia akan membinasakan kami. Itu bisa membuat perang....” Dia segera ambil ancangancang dan berlari kencang hingga menabrak tembok tadi. Badannya jeblos ke dalam ruangan sebelah. Ternyata tembok itu hanyalah terdiri dari karton tebal yang mirip tembok bata. Sang putri raja akhirnya berkenan menerima cinta

pangeran ketiga karena cintanya telah teruji. Cinta palsu? Meski umumnya orang menikah bilang karena cinta, tetapi sebenarnya ada beberapa alasan yang lebih kuat mendorong orang menikah. Alasan itu pada dasarnya bukanlah cinta. Berikut ini beberapa contoh: Orang (terpaksa) menikah karena kadung sudah ada hubungan intim atau hamil. Sebagian lain karena status sosial dan desakan orangtua. Lainnya karena merasa takut apa kata orang banyak kalau mereka tidak jadi nikah karena sudah lama pacaran? Meskipun pacarnya punya kecenderungan kasar dan gemar memukul, dia tetap memaksakan diri menikah. Ada pula yang menikah karena motif ekonomi, berharap calon pasangannya bisa menjamin masa depannya. Meski dia tahu orang itu lebih pantas menjadi ayah atau ibunya, tetap saja dia ngotot menikah. Sebagian lain karena dijodohkan orangtua. Sebagian lainnya “jatuh cinta” karena sering-sering ketemu, ya akhirnya suka juga. Yang lebih serius, menikah karena berharap pasangannya bisa menjadi pengganti ayah atau ibunya. Jika alasan di atas menjadi motif Anda (akan)

menikah, sebaiknya ditunda. Kenali dengan baik Teman, cinta itu tidak buta. Setiap orang yang mau menikah haruslah mengenali, mencermati, dan memahami benar orang yang akan Anda nikahi seumur hidup. Amati sifat, karakter, fisik, kesehatan, intelektual, hobi, latar belakang keluarga, dan sebagainya. Pastikan lebih banyak kesepadanan daripada perbedaannya. Pastikan Anda yakin bisa fit atau tepat dengan calon pasangan Anda. Sama seperti kisah putri raja di atas, sangat baik Anda menguji kualitas pribadi dan cinta pasangan Anda. Tidak cukup melakukan tes kesehatan. Ujilah kepribadian pasangan Anda dan kualitas hubungan Anda selama berpacaran. Caranya, temui dan dengarkanlah pendapat penasihat perkawinan. Sangat baik jika sebelumnya Anda berdua mengikuti tes pranikah, alat bantu yang membuat kalian lebih saling mengenal secara obyektif. Meski harus mengeluarkan uang dan waktu yang tidak sedikit, hasil tes itu akan menjadi bekal kalian untuk saling mengenal sebelum memutuskan jadi menikah atau tidak. (int)

Sudah Rajin Menyikat Gigi, Mengapa Masih Berlubang? RUTIN menyikat gigi merupakan langkah awal untuk memiliki gigi yang bersih dan sehat. Meski begitu cukup banyak orang yang mengalami gigi berlubang walau sudah rajin sikat gigi. Gigi berlubang merupakan

penyebab utama sakit gigi pada anak-anak atau orang dewasa. Penyebabnya adalah pertumbuhan bakteri dalam mulut serta kebiasaan mengonsumsi makanan manis. “Meski sudah rajin sikat gigi

tapi kalau waktunya tidak tepat sama saja. Waktu yang disarankan untuk menyikat gigi adalah pagi hari setelah sarapan dan malam sebelum tidur. Kebanyakan orang Indonesia menyikat gigi saat mandi,” kata drg.Ratu Mirah Afifah, GCClinDent, Profesional Marketing Manager Oral Care PT.Unilever Indonesia.

Selain waktu yang tidak tepat, cara menyikat gigi yang salah juga bisa membuat bakteri dalam mulut tidak bisa dibersihkan dengan maksimal. “Kebiasaan makan makanan manis dan lengket juga harus dikurangi,” kata drg.Ratu Mirah dalam acara konferensi pers pembukaan program Bulan Kesehatan Gigi Nasional di Makassar,

Sulawesi Selatan. Makanan seperti gula-gula, kacang bersalut gula, roti, atau cokelat, dapat menempel pada gigi. Jika Anda mengonsumsinya, usahakan untuk segera menyikat gigi dalam waktu 20 menit setelah makan, atau minimal berkumur-kumur dengan air. Pembentukan asam oleh bakteri penyebab gigi berlubang sangat aktif pada waktu 20 menit setelah makan. Bakteri di mulut mengubah sebagian gula dan karbohidrat yang dimakan menjadi asam. Bakteri dan asam yang dibentuknya menjadi endapan lengket yang disebut plak gigi. Bakteri dalam plak akan mengurangi mineral gigi sehingga gigi menjadi mudah berlubang. Gigi berlubang masih dapat dirawat dengan penambalan. Dengan berkembangnya perawatan gigi dan kemajuan ilmu kedokteran gigi membuat banyak orang bisa mempertahankan giginya, meski kondisi lubang gigi cukup parah. (int)


OTOMOTIF

12

MINGGU

15 September 2013

METRO ASAHAN

SAMPAI AKHIR TAHUN

Pasokan Toyota Agya Habis JAKARTA- Bagi Anda yang berminat membeli mobil murah dan ramah lingkungan (LCGC), Astra Toyota Agya nampaknya perlu lebih bersabar. Pasalnya, pasokan 15.000 unit sampai akhir tahun dipastikan ludes terjual. “Kami berencana meminta tambahan pasokan dari pabrikan untuk tahun ini. Kalau permintaan bagus, sepertinya bisa ditambah,” ujar Widyawati Soedigdo, GM Corporate Planning and Public Relation PT Toyota Astra Motor (TAM), di sela-

sela test drive Astra Toyota Agya di Bandung (13/9). Dijelaskan, sejak peluncuran pekan lalu, Toyota Indonesia mengaku sudah berhasil menjual 17.557 unit. Jumlah ini diperoleh dari surat pemesanan kendaraan (SPK) yang masuk sejak tahun lalu sebanyak 10.000 unit dan 1.574 unit dalam sejam pada hari peluncuran di Gelora Bung Karno, Jakarta Selatan, Senin (9/9). “Sekitar 7.000 tambahan pesanan baru disumbang Jakarta saja, sedangkan yang 10.000 unit dari tahun lalu itu mencakup nasional,” beber Widyawati. Dari total pesanan yang masuk, komposisi Agya tipe G mendominasi sampai 55 persen, TRD 35 persen, sisanya varian E (15 persen). Sebelumnya, Sudirman Maman Rusdi, Presiden Direktur PT Astra Daihatsu Motor (ADM), selaku produsen mengatakan bahwa kapasitas produksi Ayla

dan Agya hanya 30.000 unit dibagi dua (15.000 unit masing-masing). Artinya, suplai Agya sampai akhir tahun sudah habis terpesan! Pakai BBM Ron 92 Sesuai dengan peraturan pemerintah di program Low Cost and Green Car (LCGC) kalau mobil murah itu diharuskan untuk menggunakan bahan bakar minyak (BBM) dengan ron 92. Maka, Toyota pun menghimbau kepada pengguna mobil murahnya untuk selalu menggunakan BBM dengan ron 92. Hal itu diungkapkan langsung oleh General Manager Corporate Planning and Public Relation PT Toyota-Astra Motor (TAM) Widyawati di sela-sela acara media test drive Agya di Bandung, Jawa Barat. “Kami tetap menghimbau kepada pengguna mobil murah

kami untuk menggunakan bahan bakar dengan ron 92,” kata Widya kepada wartawan. Sebenarnya, lanjut Widya tak hanya untuk konsumen mobil murahnya saja yang dianjurkan untuk menggunakan BBM ron 92 tetapi untuk semua konsumen Toyota. “Bukan hanya mobil murah saja, tapi kami juga tetap menghimbau kepada seluruh konsumen kami agar selalu menggunakan Ron 92,” katanya lagi. Ditambahkannya, mobil menggunakan bahan bakar minimal ron 92 itu akan membantu juga kepada kualitas mesin dan akselerasi mobil menjadi jauh lebih baik. Perbedaan Spesifikasi Program mobil murah ramah lingkungan mulai bergulir. Namanya saat ini ganti sebutan menjadi kendaraan bermotor roda empat hemat energi dan harga terjangkau (KBH2). Toyota dan Daihatsu menjadi produsen pertama yang mengawali karier di segmen mobil murah dengan meluncurkan Agya dan Ayla. Ayla lebih menggoda dengan harga Rp75 juta-Rp114 juta. Agya bermain di rentang Rp100 jutaRp122 juta. Berselang dua hari, Honda juga meresmikan produk mereka, Brio Satya, untuk membuat kompetisi makin seru. Bermodalkan 3 varian, Satya dijual dengan harga Rp106 jutaRp117 juta. Berbeda dengan kedua kompetitornya, mobil paling murah yang pernah dijual Honda di era modern ini hanya punya versi transmisi manual. Kendati demikian, Satya memberikan nilai lebih dengan kapasitas mesin lebih besar, yakni 1,2 liter. (int)

Perbedaan Spesifikasi Spesifikasi Dimensi (mm) Panjang Lebar Tinggi Jarak sumbu roda Radius putar (m) Berat (kg) Mesin Tipe

Kapasitas (cc) Tenaga (PS/rpm) Torsi (Nm/rpm) Transmisi Ban

Honda Brio Satya

3.610 1.680 1.485 2.345 4,5 930

1.2L, 4 silinder, SOHC, i-VTEC, 16 katup 1.198 88/6.000 109/4.500 manual 175/65 R14

Toyota Agya/Daihatsu Ayla

3.580 1.600 1.510 2.450 4,4 745

1.0L, 3-silinder, DOHC, 12 katup 989 65/6.000 85/3.600 manual dan otomatis 175/65-R14

KAWASAKI ZX-14 R EDISI SPESIAL

Pakai Suspensi Ohlins TOKYOKawasaki menggelontorkan banyak penyegaran untuk jajaran moge beberapa hari terakhi. Setelah Ninja 1000, giliran hyperbike ZX-14R dikenalkan dengan edisi khusus. Jadi spesial karena kini ada dua warna dan suspensi baru. Jika varian standar pakai Showa, edisi spesial memercayakannya ke Öhlins. Warna juga hadir lebih segar. Kalau varian ”biasa” diberi kelir kombinasi hijau keemasan dan hitam, orange candy dan hitam, serta kemerahan, maka untuk edisi spesial ditambah dua warna. Antara lain hijau dengan hitam atau putih, dan yang paling dimintai,

Skutik Berdecit, Nih Penyebabnya! putih-hitam dengan grafis api dan pelek warna emas. Suspensi belakang TTX merupakan kerjasama Öhlins dan Kawasaki. Menggunakan konstruksi twin-tube, mengurangi berat dan membuat semakin kompak. Dikatakan, suspensi ini punya sil dengan tekanan lebih rendah untuk mengurangi kerugian gesek. Dengan begitu,

stabilitas di belakang dan peredaman getaran diklaim lebih baik. Kompresi dan pantulan balik suspensi bisa diatur. Garpu depan juga bisa disetel dengan perlakuan yang sama. Tak hanya itu, edisi spesial juga mendapat jok yang lebih nge-grip memegangi pantat pengendara dengan cincin hitam di sekelilingnya. Takometer dan spidometer dikelilingi

Honda Civic Tourer

Meluncur Tahun Depan

dengan lingkaran hitam, menggantikan versi regular yang dipoles stainless steel. Konsumen Eropa akan mendapat knalpot Akrapovic, layar panal cembung, dan beberapa ubahan. Belum ada pengumuman soal harga. (kc/int) FRANKFURT- Ajang Frankfurt Motor Show 2013 juga menjadi saksi kehadiran model terbaru dari Civic Tourer. Honda Civic Tourer adalah model station wagon yang dikembangkan di Eropa untuk pasar mobil dunia. Mobil keluarga kebanggaan Honda ini mengedepankan desain aerodinamis di kelasnya. Sebagai mobil keluarga, kendaraan asal Jepang yang banyak mengusung teknologi terdepan tersebut memiliki kapasitas bagasi 624 liter.Dan jika jok belakangnya dilipat, volume bagasi membesar menjadi 1.668 liter. Honda akan menyematkan mesin 2 pilihan mesin yaitu i-DTEC 1.6 liter iDTEC turbodiesel yang menyemburkan tenaga 118 hp dan mesin bensin 1.8 liter i-VTEC dengan pilihan transmisi manual atau otomatis. Honda Civic Tourer tersebut akan mengusung teknologi Adaptive Damper System (ADS) pertama, sehingga dengan teknologi ini Civic Tourer lebih stabil. Honda mengumumkan Civic 5 pintu ini akan dijual pada 2014. (dc/int)

JAKARTA- Di jalanan, sering kita dengar skutik berdecit (berasal dari CVT), terutama saat berakselerasi. Suara decit putus-putus mirip komponen bergesek tanpa pelumas. Jika laju mulai kencang, decit kadang hilang. Kadang juga disertai suara kasar bersumber dari tempat yang sama. Nah , jika terjadi pada skutik Anda, waspadalah! Ini tanda-tanda, harus segera diperiksa dan diservis. Dicky Hermawan, Service Advisor Yamaha DDS, menjelaskan, beberapa hal yang menyebabkan suara decit tersebut, terutama ketika pemutar gas mulai digeber di awal. 1. Bisa jadi clutch housing (mangkuk ganda atau rumah kopling) dan clutch carrier (kampas ganda) bergesek atau bergerak tidak normal. Penyebab, adanya rembesan gemuk dari puli sekunder (kedua). Kata Dicky, cek o-ring (karet berbentuk gelang untuk mencegah kebocoran) dan seal. Biasanya sudah aus. ”Kalau masih dan ada kebocoran, biasanya sisasisa gemuk dari pabrik. Ini tidak masalah! Bersihkan saja! Kalau sudah lama, ganti o-ring dan seal-nya,” papar Dicky.

2. Di mangkuk dan kampas ganda terdapat kotoran, pasir atau berkarat. Penyebab, macam-macam, antara lain filter CVT rusak atau penutupnya dicopot alias ada bagian terbuka. Dijelaskan kotak CVT tidak boleh kena kotoran atau terbuka. Untuk pendinginan, pabrik sudah mengatur sirkulasi udara agar ruang tetap dingin. ”Kan banyak tuh , yang ditambahi selang menjulurjulur atau dibuka bagian atasnya. Katanya agar lebih dingin dan ’narik’, atau biar tambah nyentrik. Ada pengaruhnya sih, tapi tidak banyak. Justru lebih banyak negatifnya, kotoran mudah masuk dan merusak. Terutama kalau hujan,” jelas Dicky. 3. Untuk menghilangkan decit, Dicky menyarankan untuk dilihat dulu komponenya. Jika bisa dibersihkan, cukup membuang kotoran atau menghilangkan karat. Tapi jika sudah parah, wajib diganti, terutama kampas ganda. 4. Kalau penyebabnya bukan kotoran, jarak mangkuk harus disetel agar kampas tidak terlalu renggang. Suara berdecit bukan karena V-belt. (kc/int)


13

MINGGU

15 September 2013

Abbey Clancy

Menari Seksi STRIKER Stoke City, Peter Crouch, cemburu melihat istrinya yang seksi, Abbey Clancy, ikut program acara “Strictly Come Dancing”. Di acara tersebut, Clancy menari dengan seksi bersama pria muda bernama Aljaz Skorjanec. Clancy merupakan salah satu bintang yang terpilih mengikuti program acara menari “Strictly Come Dancing” ke11. Model lingerie itu bersaing dengan sejumlah selebriti lainnya, seperti penyanyi Sophie Ellis-Bextor dan aktris Fiona Fullerton. Keputusan Clancy untuk ikut program “Strictly Come Dancing” membuat sang suami, Peter Crouch, cemburu. Striker timnas Inggris itu tidak senang Clancy menari seksi bersama pria lain. “Crouch benar-benar cemburu. Tapi, saya juga tidak akan membiarkan dia ikut acara ini. Wanita-wanita di sini jauh lebih seksi daripada saya,” ujar Clancy seperti dilansir Daily Star. Clancy menganggap duetnya di “Strictly Come Dancing”, Aljaz Skorjanec, sangat tampan. Model 27 tahun itu pun terlihat tidak bisa jauh dari Skorjanec. “Ya Tuhan, dia sangat tampan. Dia yang paling tampan di acara ini,” ucap Clancy. Pantas saja jika Crouch cemburu. (int)

Tim Karateka Indonesia Jalani Delapan Uji Coba Pengurus Besar (PB) Federasi Olahraga Karate-do Indonesia (FORKI) serius dalam mempersiapkan atletnya menuju SEA Games XXVII. Delapan uji coba sudah dipersiapkan untuk 28 atlet pelatnas. Hal itu disampaikan Ketua umum PB FORKI, Hendardji Soepandji ketika ditemui di hall B Glora Bung Karno, Senayan, belum lama ini. Ia mengatakan dalam rangka persiapan menghadapi SEA Games nanti, pihaknya

sudah menyiapkan delapan uji coba, yang tujuannya untuk meningkatkan kualitas para atlet. Delapan uji coba itu antara lain, 2nd SEAKF Karate Championships 2013, di Pampaga, Filipina, 17-21 April 2013, Karate WKF Premier League 2013 di Jakarta, Juni, Finnish Open 2013 digelar di Finlandia pada 31 Agustus hingga 1 September. Sementara lima lainnya, baru akan dijalani dalam tiga bulan kedepan. Lima agenda itu adalah Islamic Solidarity Games, di Palembang, 22 September- 1 Oktober 2013, AKF Champion Cup 2013 di Kazakhstan, awal Oktober, turnamen

Italy Open, di Italy, akhir Oktober, dan 8th World Cadet & Junior karate, di Spanyol, awal November, serta 2th AKF Senior & 13th AKF junior Championship, awal Desember. “Dengan delapan uji coba yang sudah dipersiapkan ini, saya harap atlet bisa jauh lebih baik pada SEA Games nanti,” kata Hendardji. Dibanding cabang olahraga lain, tim karateka Indonesia memang menjadi salah satu cabor yang paling banyak mencicipi uji coba baik luar dan dalam luar negeri. Tak heran ketika kejuaraan dilakoni, hasil yang dapat atlet juga sejalan dengan target yang diberikan PB. (int)

Saul ‘Canelo’ Alvarez China Masters Super Series

Dua Ganda Campuran ke Semifinal DUA pasangan ganda campuran Indonesia, Riky Widianto/ Puspita Richi Dili dan Markis Kido/ Pia Zebadiah melangkah ke semifinal China Masters 2013, usai mengalahkan lawan-lawannya pada babak perempatfinal. Sedangkan perjalanan Lukhi Apri Nugroho/ Annisa Saufika harus terhenti karena kalah dari wakil Korea. Pada pertandingan yang dihelat di Changzhou, China, Jumat (13/9), Riky/Puspita menang atas pasangan pasangan Indonesia lainnya, Praveen Jordan/ Vita Marissa. Sempat kalah 8-21 pada game pertama, Riky/Puspita bangkit pada dua game berikutnya hingga akhirnya meraih kemenangan 21-14 22-20.

Andy Murray

Sumbang Kemenangan untuk Inggris ANDY Murray mempersembahkan kemenangan pertama untuk Inggris saat menghadapi Kroasia pada laga play-off Grup Dunia, Davis Cup, di Stadion Stella Maris, Umag, Kroasia, Jumat (13/9). Murray mengalahkan Borna Coric, 6-3, 6-0, 6-3. Sebelum laga ini, Murray bahkan belum pernah sekali pun melihat Coric bertanding. Petenis 16 tahun tersebut barusajameraihgelarjuaradiUSOpen untuk kategori yunior. Dalam event yang sama, Murray tersingkir di perempat final, kalah dari Stanislas Wawrinka. Sayangnya, kemenangan Murray ini tidakdiikutiDanielEvans.BertemuIvan Dodig, dia langsung kalah 3-6, 2-6, 3-6. Hasil ini mengubah kedudukan kedua negara menjadi imbang 1-1. (int)

Sementara itu, Kido/Pia mengamankan satu tiket semifinal usai menundukkan pasangan Korea, Baek Choel Sin/ Ye Na Jang. Tak menemukan kesulitan berarti pada game pertama, yaitu menang 21-15, Kido/Pia mendapat perlawanan ketat pada game kedua. Namun, pasangan adik-kakak itu mampu tampil fokus hingga akhirnya menang 21-19. Sedangkan pada pertandingan perempatfinal lainnya, Lukhi/ Annisa gagal melenggang ke semifinal lantaran ditaklukkan pasangan Korea, Yeon Seong Yoo/ Hye Won Eom. Lukhi/Annisa tak mampu menunjukkan permainan terbaiknya pada laga tersebut, sehingga takluk lewat dua game

langsung 12-21 9-21. Pada semifinal nanti, Riky/ Puspita akan menghadapi Seong Yoo/Won Eom, sedangkan Kido/Pia akan berhadapan dengan pasangan China, Nan Zhang/Yunlei Zhao. Dengan hasil tersebut, peluang untuk berlangsungnya All-Indonesian Final cukup terbuka, meski dipastikan tak akan mudah. Sementara itu, pada nomornomor lainnya, Indonesia tak menyisakan wakil di semifinal, setelah pasangan ganda putri Nitya Krishinda Maheswari/ Greysia Polii takluk dari unggulan pertama asal China, Xiaoli Wang/ Yang (F) Yu. Nitya/Greysia kalah lewat pertarungan dua set, 16-21 11-21. (int)

Siap Kalahkan Mayweather Jr SAUL ‘Canelo’ Alvarez menyatakan siap mencetak sejarah baru di dunia tinju dalam pertarungan kontra penguasa kelas welter WBC, Floyd Mayweather Jr, akhir pekan ini di Las Vegas. Ia siap menguasai kelas WBC ini. Kedua petinju ini memang memiliki rekor yang cukup baik dengan samasama belum menelan kekalahan. Mayweather Jr meraih kemenangan terus dalam 44 pertarungannya, sedangkan Canelo 42 kali menang dengan 30 di antaranya menang KO. Canelo pun mengaku siap untuk menjalani pertarungan ini dengan meraih hasil kemenangan yang mengesankan. Tak hanya itu, ia juga mengklaim dirinya telah kuat dalam hal mental. “Pertarungan ini bisa mengubah sejarah, ketika saya memenangkan pertarungan ini akan menjadi kemenangan mengesankan. Inilah yang memotivasi saya,” kata Canelo, seperti dikutip The Mirror. “Saya tidak khawatir terkait kesempatan ini. Dalam karier saya, saya

selalu bisa fokus dengan baik meskipun dalam beberapa perkelahian yang sangat sulit. Saya seorang petinju yang selalu sangat kuat secara mental dan sangat dingin dalam pikiran.” “Sebagai seorang petinju, Anda ingin menghadapi yang terbaik dan pada saat

ini dalam waktu ini, Floyd Mayweather dianggap yang terbaik. Dan satu-satunya cara Anda menjadi yang terbaik adalah dengan mengalahkan yang terbaik, jadi saya melihat ke depan untuk itu,” paparnya. (int)

Casey Stoner

Berencana Akhiri Balapan V8 Supercar MEDIA Australia melaporkan bahwa mantan pebalap MotoGP, Casey Stoner, akan mengakhiri balapan V8 Supercarnya, pada akhir musim nanti. Setelah pensiun dari MotoGP akhir musim lalu,

saat masih berusia 27 tahun, Stoner berganti haluan dengan turun pada balapan roda empat, V8, di kampung halamannya. Juara dunia MotoGP dua kali tersebut

dikabarkan sudah membuat keputusan untuk berhenti secara penuh dari kompetisi, musim depan. Stoner saat ini berada di urutan 18 seri Dunlop Development, di mana dia membalap dengan Triple Eight Holden. Stoner tahun ini dijadwalkan empat kali menjalani sesi uji coba bersama Honda, untuk membantu mengembangkan motor yang akan dipakai musim depan. Dua uji coba sudah dilakukan di Sirkuit Twin Ring Motegi, Jepang. Sayangnya, pada uji coba kedua, Stoner tak sempat turun ke lintasan karena cuaca yang buruk. Sejak menyetujui untuk terlibat dengan Honda dalam program uji coba mereka, rumor pun berkembang bahwa ayah satu putri tersebut akan kembali ke MotoGP. Tetapi, sejauh ini Stoner belum punya rencana untuk kembali. (int)


16

14

MINGGU 15 September 2013

MANCHESTER- Manchester United meraih kemenangan kedua mereka musim ini setelah menaklukkan Crystal Palace dua gol tanpa balas. Gol-gol dibuat Robin van Persie dan Wayne Rooney.

P

ada laga pekan keempat Liga Inggris yang dihelat di Old Trafford, Sabtu (14/ 9) malam WIB, dua gol MU dihasilkan lewat set piece. Satu gol Van Persie lewat titik putih di babak pertama yang dilanjutkan free kick Rooney di 10 menit akhir pertandingan. Palace harus tuntaskan laga dengan 10

SUSUNAN PEMAIN MAN UTD: De Gea; Fabio, Ferdinand, Vidic, Evra; Valencia, Carrick, Anderson (Fellaini 61'), Young (Januzaj 67'); Rooney,Van Persie (Hernandez 78') C RYSTAL PALACE: Speroni, Mariappa, Campana (Guedioura 57'), Digkacoi, Puncheon, Jedinak, Gayle (Jerome 62'), Gabbidon, Moxey, Delaney, Chamakh (Kebe 75')

AGENDA METRO

Senin, 16 September 2013 (dini hari WIB)

Bundesliga

Ligue 1

Minggu, 15 September 2013

Minggu, 15 September 2013

Minggu, 15 September 2013

Premier League

Fiorentina v Cagliari

Parma v AS Roma

Hoffeinheim v Monchengladbach

AS Monaco v Lorient

Minggu, 15 September 2013

(TVRI pukul 17.30 WIB)

(beIN Sport 1 pukul 01.45 WIB)

(beIN Sport 2 pukul 20.30 WIB)

(BChannel pukul 19.00 WIB)

Southampton v West Ham

Lazio v Chievo

Sampdoria v Genoa

Braunschweig v Nuernberg

Senin, 16 September 2013

(SCTV pukul 22.00 WIB)

(TVRI pukul 20.00 WIB)

(TVRI pukul 01.45 WIB)

(Telkom Vision pukul 22.30 WIB)

Lyon v Rennes (BChannel pukul 02.00 WIB)

Serie A

Zaccheroni Tak Merasa Jadi Kandidat Pelatih Italia TOKYO - Alberto Zaccheroni menanggapi rumor yang menghubung-hubungkannya dengan kursi pelatih tim nasional Italia. Dia tak merasa menjadi kandidat pengganti Cesare Prandelli. Italia dilaporkan akan mengalami pergantian pelatih usai perhelatan Piala Dunia 2014. Kontrak Prandelli akan habis saat itu dan sejauh ini belum ada pembicaraan soal perpanjangan kontrak. Kalau Prandelli benar-benar meninggalkan Gli Azzurri, sejumlah nama sudah digadang-gadang jadi suksesornya. Beberapa di antaranya adalah Zaccheroni, Antonio Conte, dan Roberto Mancini. Zaccheroni, yang kini berstatus pelatih timnas Jepang, tak mau berpikir terlalu jauh. Bag-

inya, yang paling penting saat ini adalah pekerjaannya di Jepang. Lagipula, dia tak merasa jadi calon pelatih Italia. ”Bagaimana rasanya dihubung-hubungkan dengan bench Italia? Biarkan saya menyelesaikan Piala Dunia bersama Jepang karena cuma itulah yang saya pikirkan sekarang,” ucap Zaccheroni kepada TMW. ”Rumor selalu beterbangan, tapi lebih baik bicara soal halhal yang konkret. Hari ini saya adalah pelatih Jepang,” tegasnya. ”Saya tak merasa seperti seorang kandidat karena sekarang saya fokus pada apa yang perlu saya lakukan, yakni ambil bagian di Piala Dunia,” kata mantan pelatih Udinese dan AC Milan ini. (dc/int)

orang setelah Kagisho Digkacoi dikartu merah.The Eagles harus turun ke posisi 17 dengan tiga poin dari empat laganya. Sementara The Red Devils naik ke posisi kedua dengan tujuh poin dengan jumlah laga sama. Jalannya Pertandingan Di menit ke-4 MU mendapat peluang pertama lewat tembakan keras Michael Carrick tapi bola masih menyasar tepat di pelukan kiper lawan. Setelahnya laga berjalan dengan tempo datar dan MU relatif kesulitan menembus ketatnya

pertahanan tim tamu. Peluang terbaik MU ada di menit 37 ketika Robin van Persie mendapat bola di kotak penalti. Sambil dibayangi pemain lawan, ia melepaskan sepakan setengah voli dari kaki kanannya, tapi bola malah menghantam mistar. Begitu juga peluang Palace di menit 41 masih tak kunjung menghasilkan. Gayle yang lolos dari penjagaan Rio Ferdinand, kemudian mencuri bola dan tinggal berhadapan dengan David De Gea, Gayle malah mengarahkan bola ke sisi kiri gawang. MU mendapat hadiah penalti semenit sebelum turun minum usai Digkacoi menjatuhkan Ashley Young yang tengah dalam posisi on goal. Wasit tak ragu-ragu mengacungkan kartu merah untuk Dikgacoi. Van Persie yang maju sebagai eksekutor dengan mudah mengecoh Julian Speroni dan membawa MU memimpin 1-0 hingga turun minum. Tiga menit selepas jeda MU punya peluang lagi dan kali ini Speroni mampu mengagalkan sepakan Young dari jarak dekat. Peman baru Marouane Fellaini masuk sebagai pemain pengganti di menit 61 dan enam menit setelahnya bikin satu shot on goal tapi bola hasil tembakannya bisa dihadang Speroni. Rooney menggandakan keunggulan MU di menit 80 dan kembali gol hadir dari situasi bola mati. Sepakan bebas Rooney dari jarak 25 yard berhasil membuat bola melewati pagar hidup dan bersarang di pojok kanan bawah gawang Palace. Skor 2-0 bertahan hingga laga usai.

Casillas Akan Kembali

ˆ di Laga Lawan Galatasaray MADRID - Iker Casillas menarik napas lega. Carlo Ancelotti memastikan bahwa kiper senior Real Madrid itu akan tampil melawan Galatasaray di laga pembuka Liga Champions tengah pekan depan. Pertandingan pertama babak penyisihan Grup B tersebut akan digelar di Turk Telekom Arena, Istanbul

Messi Layak Dibanderol 100 Juta Euro BUENOS AIRES— Mantan pemain Barcelona, Juan Antonio Pizzi, yakin pemain sepak bola yang layak ditebus seharga 100 juta euro hanyalah Lionel Messi. Menurut pelatih San Lorenzo ini, Messi boleh dibilang salah satu pemain terbaik sepanjang sejarah sepak bola. ”Messi-lah yang layak dihargai 100 juta euro. Statistiknya tak tertandingi. Saya rasa tak akan ada yang bisa memecahkan rekornya, baik jangka pendek maupun jangka panjang. Berbicara soal Messi berarti bicara soal salah satu, atau bahkan pemain terbaik dunia,” kata pemain yang mem-

perkuat Barcelona pada pertengahan tahun 1990-an tersebut. Selama memperkuat Barcelona sejak 2004, Messi sudah tampil sebanyak 383 kali di semua ajang dan menyumbang 318 gol, serta enam gelar La Liga, dua gelar Liga Champions, dan serangkaian trofi lain. Ia juga mengumpulkan empat gelar pemain terbaik dunia. Adapun gelar pemain termahal dunia saat ini bukan dipegang oleh Messi, melainkan Gareth Bale. Pemain Wales ini ditebus Real Madrid dari Tottenham Hotspur dengan banderol Rp 1,4 triliun. (dc/int)

pada Selasa (17/9). Casillas sudah delapan bulan tidak menjaga gawang Madrid sejak cedera tangan pada awal tahun ini. Setelah pulih, Casillas kehilangan tempatnya oleh Diego Lopez yang direkrut dari Sevilla dan memang tampil impresif. Pergantian manajer klub dari Jose Mourinho — yang berseteru dengan Casillas — kepada Ancelotti rupanya pun tidak lantas mengembalikan statusnya sebagai kiper nomor satu di klub. Kendatipun Casillas masih dipercaya sebagai kiper utama timnas Spanyol. Media-media Spanyol mulai mempertanyakan keputusan Ancelotti karena terus membangkucadangkan Casillas. Kini, sang manajer sudah memberikan jawabannya. ”Iker akan bermain pada hari Selasa di Liga Champions, jadi Anda semua sekarang bisa tenang,” kata Ancelotti kepadaMarca. Menilik sedikitnya waktu bermain Casillas, beragam rumor yang terkait masa depan kapten Madrid dan Spanyol pun mulai berhembus. Kabarnya, Casillas diminati klub-klub top Eropa seperti Arsenal, Manchester City ataupun Borussia Dortmund. (dc/int)


MINGGU

15 September 2013

Gara-gara Tempe ‘Labil Ekonomi’ Arzetti Bilbina

Mogoknya industri tempe dan tahu selama tiga hari awal pekan ini, ternyata membawa pengaruh pada masyarakat. Hal ini pun juga berlaku pada kalangan selebriti, semisal Arzetti Bilbina. Peragawati dan model ini mengaku kebingungan, pasalnya tempe merupakan makanan pengganti daging karena nilai gizi yang sangat tinggi.

Arzetti Bilbina HOROSKOP HARI INI VIRGO (23 Agustus- 22 September) Karier: Banyak kemajuan pesat yang akan Anda alami! Keuangan: Bersabarlah menyambut rezeki besar yang menggembirakan. Kesehatan: Pertahankan kondisi fit saat ini. Asmara: Hindari konflik, cari solusi yang lebih bijaksana.

Libra

(23 September - 22 Oktober)

. Karier: Statis. Namun bersiaplah menerima kabar baik. Keuangan: Jangan lupa menyisihkan sedikit uang untuk keperluan mendadak. Kesehatan: Kembangkan hobi untuk menghilangkan stres. Asmara: Jangan kecil hati dulu, semua itu pasti ada hikmahnya.

Scorpio

(23 Oktober – 22 November)

Pekerjaan: Bakal membuka awal baru Keuangan: Ada kekecewaan sedikit Kesehatan: Periksa rutin kesehatan payudara Anda. Asmara: Feeling Anda ternyata benar, lho.

Sagitarius

( 23 November - 20 Desember)

Karier: Anda terasa lebih lancar dalam waktu dekat. Keuangan: Cukup baik, hanya jangan sampai kelewat boros. Kesehatan: Usahakan jaga pola makan yang benar, hindari makanan berkolesterol tinggi. Asmara: Hubungan Anda dan si dia tambah mesra dan berbunga-bunga.

Capricorn

(21 Desember -19 Januari)

Karier: Setiap langkah yang Anda tempuh saat ini, meski kecil, tapi sangat bermakna dan prospeknya cerah. Keuangan: Ada rezeki yang tak terduga. Kesehatan: Usahakan jangan terlalu lelah karena kondisi tubuh mudah terserang flu. Asmara: Kesetiaan si dia sedang diuji, padahal kadangkadang Anda merasa sangat yakin, dialah yang cocok untuk Anda.

Aquarius

(20 Januari - 18 Februari)

Karier: Sedang merasakan proses belajar tempat Anda bekerja, pertahankan semangat Anda. Keuangan: Jangan khawatir pemasukan sangat lumayan kok. Kesehatan: Karena Anda kurang istirahat maka daya tahan tubuh Anda mudah terserang batuk dan pilek. Asmara: Terasa semakin dekat dan tambah romantis.

Pisces

19 Februari - 20 Maret

Karier: Sangat beruntung karena saat ini Anda mempunyai karier yang sangat prospektif. Keuangan: Akan banyak pendapatan ekstra yang akan memenuhi dompet Anda. Kesehatan: Kondisi tubuh sangat prima saat ini. Asmara: Hubungan yang lancar walau ada sedikit konflik kecil di antara Anda dan pasangan.

Aries

(21 Maret - 20 April)

Karier: Ada yang mengancam keamanan Anda? Jangan takut, hal ini tidak akan berpengaruh pada Anda kembali. Keuangan: Kondisi kocek sedang paspasan, jadi jangan terlalu boros. Kesehatan: Baik-baik saja alias tidak banyak masalah. Asmara: Sejak kehadirannya, hidup Anda terasa lebih cerah.

Taurus

(21 April - 20 Mei)

Karier: Lancar, tidak banyak masalah. Keuangan: Hemat pangkal kaya, pengeluaran Anda harus mulai dicatat. Kesehatan: Kurangi tidur terlalu larut, bisabisa Anda terserang darah rendah/anemia. Asmara: Banyak mengalah demi kebaikan tidak selalu jadi orang yang kalah.

Gemini

(21 Juni- 20 Juli)

Karier: Kenyataan saat ini benar-benar di luar dugaan Anda. Tak disangka-sangka secepat itu Anda mendapat promosi jabatan. Keuangan: Pendapatan Anda sangat baik. kesehatan: Sedang terganggu flu. Asmara: Hati-hati, ada cinta baru yang bisa merebut perhatian Anda.

Leo

Arzetti didaulat menjadi pembawa acara Sambut Idul Adha: Bango Ungkap Rahasia Kelezatan Sajian Kambing Ala Legenda

Maia Estianty:

Aku Minta Maaf

Wulan Guritno

Tegas Soal Jam Malam Di film, Wulan Guritno bisa berakting sebagai ibu yang selalu menuruti keinginan anak. Di kehidupan nyata, Wulan termasuk ibu yang tegas terhadap anak. Terutama kepada Shaloom, putri sulungnya yang kini mulai beranjak remaja. Saat weekend, dia mengizinkan gadis 15 tahun itu bermain hingga malam. Namun, putrinya tersebut tidak boleh pulang di atas pukul 11 malam. “Kalau weekend dia boleh main. Tapi, jam 11 malam harus sudah di rumah,’’ katanya. Dia berusaha mengerti kebutuhan anak. Soal pergaulan misalnya. Hingga kini, ibu tiga anak itu membebaskan putrinya bergaul. ’’Saya pengin anak saya bergaul dengan siapa saja. Biar nggak minder,’’ lanjutnya. Bukan tidak mungkin, anak sulungnya itu mulai merasakan ketertarikan dengan lawan jenis. ’’Pacaran sih belum. Dia ber-

teman sama teman laki-laki. Ya wajar lah. Yang penting fondasi anak kuat,’’ terang Wulan. Sejatinya, lanjut dia, kalau sebagai orang tua dekat dengan anak, segala sesuatunya bisa dibicarakan. Misalnya, soal konser. Shaloom pernah menanyakan kepada Wulan mengapa dirinya belum boleh menonton konser. Sebisa mungkin, dia memberikan penjelasan yang rasional. Dia juga membekali Shaloom dengan pengetahuan yang luas. Kalau sudah begitu, anak akan memiliki prinsip dan karakter sendiri. Tahu mana yang baik dan tidak. Wulan merasa harus bisa menjadi teman untuk anakanaknya. Jadi, anak merasa nyaman bercerita dengan orang tua. ’’Ya meski hati saya sedang gimana, gitu ya. Terus, dia pengin curhat, reaksi saya harus selektif,’’ ujarnya. (jan/ c4/any)

Maia Estianty begitu terpukul dengan musibah yang menimpa anak bungsunya, AQJ alias Dul. Namun, di sisi lain, sebagai orangtua ia juga merasa bersalah lantaran kecelakaan anaknya mengakibatkan orang lain meninggal dunia. Maia pun mengungkapkan kata maaf, untuk keluarga korban yang meninggal atau pun luka-luka. “Aku minta maaf, kepada korban yang meninggal maupun yang mengalami luka-luka dengan apa yang terjadi dengan musibah ini. Semoga semuanya akan baik-baik saja,” ujar Maia kepada media. Sebagai ibu, Maia tak mau ada hal buruk yang terjadi pada putra bungsunya. Ia meminta agar masyarakat mau mendoakan kesembuhan Dul dan korban lainnya. “Saya juga minta doa buat anak saya, mudah-mudahan cepat selesai masalahnya, Dul cepat sembuh dan korban di rumah sakit juga sembuh,” ucapnya. Tak hanya keluarga Dul yang berduka, 14 korban lainnya pun diharapkan tabah menghadapi musibah ini. “Mudah-mudahan kita diberi ketabahan. Semoga dikasih jalan yang terbaik,” lanjut Maia. (int)

Nikita Mirzani

Nyaman di Apartemen Apartemen jadi pilihan Nikita Mirzani sebagai tempat tinggal sementara, sambil menunggu pembangunan rumahnya selesai. Ibu satu anak itu lebih memilih apartemen karena memiliki keamanan yang bagus. “Karena apartemen privasi terjaga, keamanan bagus,” ujarnya saat dijumpai di kediamannya, Apartemen Permata Hijau Residence, Kebayoran Lama, Jakarta Selatan. Nikita Mirzani merasa nyaman tinggal di apartemen. Nikita Mirzani merasa nyaman tinggal di apartemen. Demikian, lokasi apartemen menjadi pertimbangan Nikita dalam memilih hunian bers a m a sang anak.

“Tetapi tergantung lokasi juga. Kenapa di sini? Deket sekolahan anak, deket mall juga,” katanya lalu tersenyum. Selain itu, di apartemen Nikita bisa mendapatkan ketenangan dan privasi yang terjaga tatkala lelah menjalani aktivitas. “Di sini nyaman. Nggak bising, nggak kepo orang-orangnya,” pungkasnya. (int)

(21 Mei - 20 Juni)

Karier: Semakin membaik. Anda pantas diacungi jempol oleh atasan Anda. Keuangan: Belum terlalu membaik, tapi selalu ada saja proyek baru yang mendatangkan uang bagi Anda. Kesehatan: Tidak bermasalah bahkan saat ini Anda senang tampil prima. Asmara: Tampaknya Anda harus memilih yang mana yang lebih mengerti Anda dari dua orang yang menyukai Anda.

Cancer

“Sempat bingung waktu ada demo gak jualan tempe. Untungnya di pasar dekat rumah masih ada,” katanya

Kuliner di Oasis Restauran, Raden Saleh, Jakarta Pusat. Setelah selesai ia menjelaskan bahwa tempe adalah salah satu makanan yang disukai keluarganya. “Tempe itu murah dan sehat. Kami suka,” ucapnya lagi. Bahkan gara-gara kehilangan tempe selama tiga hari lalu, ibu tiga anak ini mengaku menjadi labil. “Iya, gara-gara tempe, jadi labil ekonomi,” ujarnya kemudian tertawa. (int)

(21 Juli-21 Agustus)

Karier: Kejadian yang menyedihkan membuat Anda pusing tujuh keliling, tapi semuanya akan berakhir dengan hasil yang baik. Keuangan: Tidak terlalu banyak, tetapi masih lumayan. Kesehatan: Jangan khawatir, Anda sehat-sehat saja. Asmara: Agak membosankan, tapi masih bisa berjalan lancar.

Chika Jessika

Senang Dijodohkan Tak butuh waktu lama bagi Chika Jessika untuk melupakan masa lalunya dengan Ade Govinda. Buktinya, Chika mengaku tengah dekat dengan seorang pria. Perkenalan dengan pria tersebut karena dijodohkan teman-temannya. Jessica pun mengaku senang. “Kayaknya enggak laku banget, tapi aku senang sih. Mereka yang merekomenda-

sikan juga, cowok-cowok yang hubungannya baik. Jarang nih yang nawarin dagangannya oke. Lumayan lah,” katanya di Studio Hanggar, Pancoran, Jakarta Selatan. Kejadian masa lalu yang pahit pun bukan halangan bagi Chika untuk kembali menjalin asmara. Ia bahkan tak segan menyebut kriteria pria idaman. “Yang bisa menghormatisasikan, bisa seimbang, pencapaian labil ekonominya yang…., aku sih suka yang humoris, yang bisa beradaptasi dengan lingkungan aku,” ujarnya tersenyum. (int)


15 September 2013

BIKERS se Indonesia, selamat datang di Kota Pematangsiantar. Welcome to Birmingham Small Arms (BSA) Land. Hari ini, BSA Owners Motorcycles Siantar (BOMS) akan mengajak kita semua larut dalam kemeriahan Hari Ulang Tahun (HUT) yang ke-7. Are you ready? Cekidot… akan berlanjut dengan berbagai perlombaan. Mulai kontes motor klasik, slow race, festival band, bahkan pertandingan tradisional pun, juga akan diadakan, seperti, tarik tambang. “Dan, acara kita akhiri dengan penyerahan hadiah kepada semua pemenang lomba,” sebut Rizal. Rizal menambahkan, panitia berusaha menjadi tuan rumah yang baik dengan mengemas acara secara apik hingga menyediakan berbagai fasilitas. Di antaranya; penginapan selama dua hari, mulai Sabtu (14/9) hingga Minggu (15/9) bagi peserta dari luar pulau dan luar provinsi. Makan siang untuk masing-masing klub saat acara berlangsung. Dihadiahi souvenir BOMS untuk masingmasing klub yang telah terdaftar. Tak hanya itu, klubklub yang telah terdaftar juga akan menerima piagam BOMS. “Hari ini (kemarin) sudah banyak yang mendarat di

PERAYAAN HUT BOMS yang dihelat di Lapangan Universitas Simalungun (USI), Jalan Sisingamangaraja, akan dimulai sekitar pukul 10.20 WIB, yang ditandai dengan pembukaan; menghidupkan mesin BSA oleh Walikota Pematangsiantar Hulman Sitorus didampingi Presiden BOMS Erizal Ginting. Selanjutnya, acara dirangkai dengan konvoi mengambil rute Jalan Sisingamangaraja, belok Jalan Ahmad Yani; simpang Rambung Merah, menuju Jalan Sutomo, melintas dari Jalan Diponegoro, tembus Jalan Gereja hingga simpang dua, dan kembali ke USI. “Kita sengaja tidak melintas dari Lapangan Adam Malik. Sebab, dalam waktu bersamaan ada acara keagamaan di sana. Kita tidak ingin bunyi deru ribuan mesin kendaraan mengganggu jalannya acara Jubileum. Kita (panitia) tetap menjunjung tinggi toleransi beragama,” kata Erizal Ginting.

Menurut Rizal –sapaan akrabnya- setelah konvoi, ada laporan dari ketua panitia, lalu acara dilanjutkan dengan penyampaian kata sambutan dari Walikota, Kapolres Pematangsiantar, Ketua Umum Motor Antik Club Indonesia (MACI) Pusat, Himpunan Motor Tua (HMT) Bali, Ikatan Motor Besar Indonesia (IMBI) Sumut. “Dan, kata sambutan terakhir dari saya,” lanjut Rizal. Usai penyampaian kata sambutan, lanjut Rizal, para bikers dan undangan yang hadir akan dihibur dan dijamu makan siang. Selesai menikmati santap siang, acara seremonial HUT ke-7 BOMS dimulai. Yakni; pelantikan chapter BOMS Tebing Tinggi/ 001, Medan/002 dan Tangerang/003. Kemudian, pembagian sembilan bahan pokok (sembako) untuk brother BSA secara simbolis. Lalu, ditutup dengan doa. Eits, meski sudah berdoa, bukan berarti acara usai. Sebab, kegembiraan masih

Siantar. Tamu pertama sekaligus tamu utama Anniversary 7th BOM’S dari keluarga besar HMT Bali (Brada Atta Gautama, Restu Gautama). Disusul MACI Bandung (Oscar Manik dkk) dan ditutup tamu yang tak kalah penting, Ketua Umum MACI Pusat (bapak H Joko). Dan, siapa lagi menyusul?” tanya Rizal mengakhiri. Oia, rangkaian pesta bikers se-Indonesia di Anniversary 7th BOM’S dijadwalkan dihadiri ribuan bikers dari 109 klub Motor yang tersebar di seluruh nusantara. Kedatangan mereka bakal disambut spanduk BOMS yang berisi kalimat; Terserah Mau Peduli atau Tidak. Kami Tetap Selamatkan Becak BSA sebagai Cagar Budaya Kota Pematangsiantar. Hmmm, bikers se-Indonesia saja peduli dengan becak. Bagaimana dengan kita? Terakhir, Selamat Ulang Tahun BOMS. Semoga becak Siantar lestari di hati, di jiwa, dan raga. Horasss…. (ann)


15 minggu 09 2013 metro asahan