Page 1

THE THRILL OF ‘CHASING MARIA MENOUNOS’ PAGE 26

NEW YORK CITY’S #1 FREE DAILY NEWSPAPER

Tuesday, March 18, 2014 www.metro.us | t: MetroNewYork | f: MetroNewYork

Backing Giddyap. The two main anti-carriage horse organizations in the city are feuding over what will replace the Central Park horses if carriage rides are finally banned. Pulling in the reins. One group says that proposed vintage-style electric cars is a good alternative for tourists, while the other says that the idea is a “risky investment.” PAGE 02

the wrong horse

Carriage horse Blackie and driver Sean Dennehy prepare to set off for a ride through Central Park. / BESS ADLER, METRO

Strypes take a unique ‘Snapshot’ of teen life

Uncovering the Algarve, Portugal’s hidden gem

How much screen time is too much for kids?

Giants sign cornerback out from under Jets

PAGE 25

PAGE 29

PAGE 30

PAGE 36


1

www.metro.us Tuesday, March 18, 2014

NEW YORK

2

NEWS

A horse carriage drives tourists toward Central Park. Electric cars, below, may replace the horses. / BESS ADLER, METRO, NYCLASS

Activists split over what follows horses

Top 3

What’s trending online at Metro.us

1

‘How to sign up for Warren Buffett / Quicken Loans billion dollar NCAA bracket’

2

‘PHOTOS: Looking back at L’Wren Scott, designer and girlfriend of Mick Jagger’

3

‘VIDEO: The Onion spoofs St. Patrick’s Day traditions around the country’

Quoted

“Who do you think got Dinkins to sing? Who do you think got Bloomberg to dance? Who do you think put Rudy in that dress?” Steve Buscemi, helping Mayor Bill de Blasio train for his performance at the Inner Circle Show

Clip-clop. In a rare feud, groups argue over whether electric cars should replace Central Park horses or not.

It’s safe to say that those who want to ban the carriage horse industry in New York City and those who want to save it don’t agree on much. Animal rights groups have cast the industry as cruel and inhumane to horses, while carriage drivers say the animals are well cared for under the umbrella of a highly regulated industry. But the pro-ban movement is split on one key issue. One activist, in a rare instance of agreement with the carriage drivers, says the electric cars Mayor Bill de Blasio touted in his campaign as a horseless alternative are an idea that needs to be put down. The prototype faux-vintage car, commissioned by pro-ban group New Yorkers for Clean, Livable, and Safe Streets for $450,000, is set to arrive in New York in June. NYCLASS is in the process of securing private financing for the rest of the fleet. “No one is losing their livelihood,” said NYCLASS Director Allie Feldman.

Dark horse

‘You can’t pet an electric car’ If the ban does go into effect, the drivers of the city’s 68 carriages will be out of work. The electric car plan would guarantee them jobs — if they entertained the idea of making the switch. Their medallions would transfer over. “Absolutely not,” said driver Sean Dennehy, standing next to his horse Blackie on Central Park South on Sunday. “I own my own

carriage. This is my whole life, you know. You can’t pet an electric car.” Asked on Monday when a bill banning

New industry

“No one is losing their livelihood. The drivers are simply switching from driving a horse carriage to driving the electric horseless carriage car.” Allie Feldman “The drivers are simply switching from driving a horse carriage to driving the electric horseless carriage car.” The carriage drivers, along with Elizabeth Forel of the Coalition to Ban Horse-Drawn Carriages, beg to differ. Of course, their reasons for opposing the cars are different. The drivers are horsemen, and find it galling

that NYCLASS talks about driving a car and driving a horse as if they were interchangeable jobs. For her part, Forel opposes the project because she sees it as expensive and unworkable, and unlikely to expedite the ban her coalition has been working toward. “No one in their right mind would invest big bucks for such a risky investment,” Forel said,

carriage horses might be introduced, the mayor’s office simply restated de Blasio’s commitment to ending the industry. pointing out that cars are not allowed to use the roads of Central Park on the weekend. The city’s Parks Department declined to comment on the issue. A better and cheaper option, Forel said, would be to retrofit existing carriages with motors. Feldman, in turn, said converted carriages would never pass federal highway safety requirements. Forel also took issue with the proposed threeyear phaseout, a time frame she said is three years too long. “One has to also know the mind-set of the drivers to know that you do not phase anything in with

them because to allow them to maintain a foothold is a huge mistake,” she said. Stephen Malone, a second-generation carriage driver and the spokesman for the Horse and Carriage Association of New York, called the proposed retro vehicle a “fantasy car.” “People here are businessmen,” he said. “What they want to do is steal our horses, then they want us to pay $1,700 a month for an untested business.” But according to Feldman, the cars are all but a done deal — and NYCLASS has the edge over Forel’s CBHDC in terms of influence. The group hitched its fortunes to de Blasio’s wagon when it played a key role in funding the super PAC “New York City Is Not For Sale,” which helped sink Christine Quinn in the mayoral election. “There is no ‘doubt’ about the fact that these electric cars will become a reality,” Feldman said. “The carriage horse industry is trying to sow the seeds of doubt because they have no actual arguments for the perpetuation of the unsafe and inhumane use of carriage horses in one of the most congested urban areas in the world.” EMILY JOHNSON @METRONEWYORK letters@metro.us


NEW YORK

3

City Hall

De Blasio hosts paid sick leave hearing Mayor Bill de Blasio championed an expansion of the city’s paid sick leave law during a public hearing Monday. “This is truly a historic day for New York City. This day earns that title,” de Blasio said.

L’Wren Scott and Mick Jagger were a couple. / GETTY IMAGES

L’Wren Scott found dead in Chelsea apartment Style. The fashion maven reportedly committed suicide on Monday. L’Wren Scott, luxury fashion designer and Mick Jagger’s girlfriend, was found dead of a possible suicide in her Manhattan apartment Monday morning, according to police and published reports. The former model, believed to be 49 years old, was reportedly found around 10 a.m. with a scarf around her neck, hanging from a doorknob in her Chelsea home. Investigators don’t suspect foul play and no suicide note was found, according to the Associated Press. She was found after

texting her assistant to come over. The medical examiner will determine the cause of death. In a statement, a spokesperson for Jagger said the Rolling Stones frontman was “completely shocked and devastated” by the news. They first met in 2001. Scott’s designs have been worn by first lady Michelle Obama and celebrities like Nicole Kidman, Oprah Winfrey and Madonna. “This is a horrible and tragic loss,” Madonna said in a statement by her publicist to the AP. “I’m so upset. I loved L’Wren’s work and she was always so generous with me.” ANNA SANDERS @AnnaESanders anna.sanders@metro.us

Visionary

“She was a visionary designer who I very much enjoyed working with, but she was also smart and kind.” Bobbi Brown

Protestor / GETTY IMAGES

“Half a million more people will have paid sick leave when they need it.” The bill, passed by City Council last month, would require businesses with five or more employees to give five days of paid sick off a year. De Blasio said he plans to sign the expansion into law later this week.

Most speakers at the hearing supported the bill. But Khristan Heagle, who said she represents city manages at Rothermel Jacobs & Schess LLP, raised concerns. “The truth is, we have many questions,” she said. When signed, the expansion would go into effect in April. ANNA SANDERS


www.metro.us Tuesday, March 18, 2014

NEW YORK

St. Patrick’s parade marred by boycotts

4

Revelers lined Fifth Avenue on Monday to celebrate the 253rd New York St. Patrick’s Day Parade. Mayor Bill de Blasio declined to take part in this year’s parade and gay rights groups protested along the route over the organizer’s refusal to allow them to march openly. /MILES DIXON, METRO


www.metro.us

Skyline Sightseeing is having a job fair tomorrow!

5 new york Tuesday, March 18, 2014

We provide driven, motivated, and energetic people just like you the means to start their own business. We do this by giving you all of the training, grooming, and supplies you need to get off the ground and running. Our top owners regularly make up to $1200 a week! We also provide a $1000 bonus ON TOP of your commissions after your ďŹ rst 500 tickets sold. We are Skyline Sightseeing, the newest eet of Double Decker Tour Buses. As a partner, you will have the opportunity to sell tickets for the best sightseeing company in New York City.

Wednesday, March 19th, 1pm-5pm The job fair is located at 18 West 25th St at the Chelsea Comfort Inn


www.metro.us Tuesday, March 18, 2014

NEW YORK

6

One of the top-ranked health plans in NYC for almost 10 years.*

The “Kelpies” stand 100 feet high in Central Scotland. Scaled versions are coming to NYC. / BEN WILLIAMS

WHAT’S YOUR PLAN? Choose Quality. Choose Affordability. Choose MetroPlus.

Gigantic horse heads coming to Bryant Park Kelpies. Scottish sculptures will be on exhibit Friday. Two 15-foot-tall steel horses are galloping into Manhattan this weekend. Or, rather, their heads are. Artist Andy Scott will

install scale models of “The Kelpies” overnight Thursday in Bryant Park. They will be on exhibit Friday through April 22. Scott’s original “Kelpies” stand nearly 100 feet high in Scotland and are the largest pair of equine sculptures in the world, costing about $8.3 million to create.

Check them out

By now, you’ve heard all about the Affordable Care Act. Maybe you’re not sure what to do. Call MetroPlus today and we can answer all your questions. We can help you keep the coverage you have now or talk to you about an affordable new plan that’s just right for you. Join one of the top-ranked health plans in NYC for almost 10 years.*

Call 1.855.809.4073 M E T R O P L U S . O R G

*Based on indicators chosen by the New York State Department of Health and published in its publication A Consumer’s Guide to Medicaid Managed Care in NYC 2003-2012.

The sculptures will be on display at Bryant Park: •

March 21 to April 22

In the Bronx

Man dies in shooting A 24-year-old man was found shot to death in the lobby of his South Bronx apartment building Sunday night, police said. Tony Burgess was found unresponsive with a gunshot wound to the head in his Melrose apartment building around 9:20 p.m. No arrests have been made and police said the investigation is ongoing. ANNA SANDERS

The Tartan Day Parade, celebrating Scottish American heritage, is April 5.

They were completed last fall and are to be the centerpiece of a new tourist destination, The Helix, set to open this summer in Central Scotland. The title for the sculptures comes from supernatural water horses in Celtic folklore. A kelpie is believed to haunt Scottish and Irish rivers and lochs, delighting in the drowning of travelers. Let’s hope that doesn’t deter tourists from enjoying the sculptures. ANNA SANDERS @AnnaESanders anna.sanders@metro.us

Taxes. State suspends 8,900 driver licenses New York State suspended almost 9,000 driver licenses belonging to residents who owe more than $10,000 in back taxes — nearly half from New York City. In all, the state froze 8,900 licenses — 4,194 of which came from the five boroughs, bringing

in $56.4 million in state and local tax collections. State records show 1,145 drivers came from Manhattan and 1,146 from Queens. Some 1,078 Brooklyn tax evaders had their licenses cut off, as did 502 Bronxites and 323 Staten Islanders. CHESTER JESUS SORIA


www.metro.us

575 Lexington Avenue, New York City, NY 10022 (between 51st and 52nd Streets)

212-753-5128 www.cameralandny.com œ˜`>ÞʇÊĂ€Âˆ`>Ăž]ĂŠn>Â‡Ăˆ\ÎäÊUĂŠ->ĂŒĂ•Ă€`>Ăž]ʙ>‡x\Îä

We Want Your Used Cameras - Lenses - Flashes - Camcorders 2 Day Buying Event Friday & Saturday March 28th & 29th

Paid On The Spot!! TRADE-IN / TRADE-UP CALL FOR DETAILS SLT-A7

with 28-70mm lens

SLT-A7R Body

s & ULL&RAME-0RESOLUTIONWITH BIT2!7RECORDING s &AST(YBRID!&WITHPHASE DETECTIONFOR$3,2 LIKE speed s $IRECTACCESSINTERFACEFORFAST NATURALSHOOTING s #OMPATIBLEWITH3ONY% MOUNTANDFULLFRAMELENSES s #ONNECTTOSMARTPHONESVIA7I &IšOR.&#

Now thru 3/31/14

$

199999

2014 Olympus Imaging America Inc. All rights reserved.

$

s & ULL&RAME-0RESOLUTIONWITH BIT2!7 RECORDING s &AST)NTELLIGENT!&OPTIMIZEDFORFULL FRAMESENSOR s $IRECTACCESSINTERFACEFORFAST NATURALSHOOTING CONTROL s 3IMPLECONNECTIVITYTOSMARTPHONESVIA7I &IšOR.&# s #OMPATIBLEWITH3ONY% MOUNTANDFULLFRAMELENSES

229999

YOUR SOURCE FOR OLYMPUS Specials 3/16/14- 4/5/14

50%

XZ-10 iHS

SH-50 iHS

XZ-2 iHS

E-PM-2 2-lens Kit

sĂŚĂŚ12 -EGAPIXEL "3)#-/33ENSOR sĂŚĂŚX/PTICAL :OOM MM 7IDE !NGLELENS sĂŚĂŚ )NCHĂŚ4OUCHĂŚ,#$ sĂŚĂŚ&ĂŚATĂŚ7IDE !NGLEĂŚANDĂŚ&ĂŚATĂŚ4ELEPHOTO

sĂŚĂŚ-EGAPIXEL"3) #-/33ENSOR sĂŚĂŚXĂŚ/PTICALĂŚ:OOMĂŚ WITHĂŚMMĂŚ 7IDE !NGLEĂŚLENS sĂŚĂŚ )NCHĂŚ4OUCHĂŚ,#$ sĂŚĂŚPĂŚ&ULLĂŚ($ĂŚ6IDEO

s-EGAPIXEL High Sensitivity "3)#-/3 3ENSOR sX/PTICAL:OOM

MM%QUIVALENT 7IDE,ENS s )NCH3WIVEL4OUCH,#$

with 14-42mm & 40-150mm Lenses

2EGULAR0RICE



,ESS)NSTANT2EBATE 

$

9/50!9

19999

Regular Price

$ 299.99

,ESS)NSTANT2EBATE  

$

9/50!9

24999

2EGULAR0RICE



s-EGAPIXEL$IGITAL#AMERA s )NCH4OUCH,#$ sI&ULL ($6IDEO s,IVE'UIDE %ASE /F 5SE

$

9/50!9

29999

,ESS)NSTANT2EBATE 

Regular Price

$799.99

,ESS)NSTANT2EBATE 

$

9/50!9

39999

E-PL-5 with 14-42mm Lens

OM-D E-M5 with 12-50mm Lens

E-P5 with 17mm 1.8 Lens & VF-4

OM-D E-M1 with 12-40mm Lens

sĂŚĂŚĂŚ-EGAPIXELĂŚ $IGITALĂŚ#AMERA sĂŚĂŚFPSĂŚ3%1ĂŚ3HOOTING sĂŚĂŚ )NCHĂŚ4OUCHĂŚ 4ILTĂŚ,#$ sĂŚĂŚIĂŚ&ULLĂŚ($ĂŚ 6IDEO

sĂŚĂŚĂŚ-EGAPIXELĂŚ,IVE -/3ĂŚ3ENSOR sĂŚĂŚ !XISĂŚ)MAGEĂŚ 3TABILIZATION sĂŚĂŚ )NCHĂŚ4OUCHĂŚ4ILTĂŚ,#$ sĂŚĂŚ4RUE0ICĂŚ6)ĂŚ)MAGEĂŚ 0ROCESSOR

sĂŚĂŚ-0ĂŚ,IVEĂŚ ĂŚ -/3ĂŚ3ENSOR sĂŚĂŚ !XISĂŚ)MAGEĂŚ ĂŚ 3TABILIZATIONĂŚWITHĂŚ ĂŚ )3ĂŚ!UTO sĂŚ"UILT )NĂŚ7I &IĂŚ#ONNECTIVITY

sĂŚ ĂŚ ĂŚ-0ĂŚ,IVEĂŚ -/3)MAGEĂŚ3ENSORĂŚ sĂŚ ĂŚSĂŚMECHANICALĂŚ SHUTTERĂŚANDĂŚFPSĂŚ SEQUENTIALĂŚSHOOTING sĂŚ )ĂŚ N "ODYĂŚ !XISĂŚĂŚ ĂŚ )MAGEĂŚ3TABILIZATION

2EGULAR0RICE



,ESS)NSTANT2EBATE  7 new york Tuesday, March 18, 2014

Save

$

9/50!9

49999

Regular Price

$1299.99

,ESS)NSTANT2EBATE 

9/50!9

$

99999

Regular Price

$1449.99

,ESS)NSTANT2EBATE 

HUGE SAVINGS ON OLYMPUS LENSES EXPERT CAMERA REPAIRS FREE Estimates on All Repairs

PASSPORT PHOTOS While-U-Wait

9/50!9

$

134999

2EGULAR0RICE



,ESS)NSTANT2EBATE 

9/50!9

$

219999

with PEN or OM-D purchase!

WE DEVELOP FILM We Print from Negatives

We print photos from all smart phones and tablets.


See more at www.metro.us

www.metro.us Tuesday, March 18, 2014

Planning could hold key to plane disappearance Investigation. Police have searched the premises of both the captain and co-pilot. Whether by accident or design, whoever reached across the dimly lit cockpit of a Malaysia Airlines jet and clicked off a transponder to make Flight MH370 vanish from controllers’ radars flew into a navigational and technical black hole. By choosing one place and time to vanish into radar darkness with 238 others on board, the person — presumed to be a pilot or a passenger with advanced knowledge — may have acted only after meticulous planning, according to aviation experts. Understanding the sequence that led to the unprecedented plane hunt

widening across two vast tracts of territory north and south of the Equator is key to grasping the motives of what Malaysian authorities suspect was hijacking or sabotage. By signing off from Malaysian airspace at 1:19 a.m. on March 8 with a casual “all right, good night,” rather than the crisp radio drill advocated in pilot training, a person now believed to be the co-pilot gave no hint of anything unusual. Two minutes later, at 1:21 a.m. local time, the transponder — a device identifying jets to ground controllers — was turned off in a move that experts say could reveal a careful sequence. There is so far no indication whether the copilot was at fault or had anything to do with turning off the transponder. Pilots say the usual industry

A man gestures as he stands in front of messages of prayers and well-wishes for passengers of flight MH370. / GETTY IMAGES Quoted

“Every action taken by the person who was piloting the aircraft appears to be a deliberate one. It is almost like a pilot’s checklist.” A senior captain from an Asian carrier with experience flying jets including the Boeing 777

convention is that the pilot not directly responsible for flying the plane talks on the radio. Whoever turned the transponder to “off,” whether or not the move was deliberate, did so at a vulnerable point between two airspace sectors when Malaysian and Vietnamese controllers could easily assume the airplane was each others’ responsibility.

NEWS N

Imposed. Sanctions against 11 Russian, Ukrainian officials President Barack Obama on Monday imposed sanctions on 11 Russian and Ukrainian officials blamed for Russia’s military incursion into Crimea, including two top aides to Russian President Vladimir Putin. The sanctions were the most visible sign of U.S. anger at Russia’s attempt to absorb the Crimea region of southern Ukraine, reflecting the deepest plunge in U.S.-Russian relations since the Cold War.

The sanctions came in an executive order signed by Obama a day after a Crimea referendum on Sunday aimed at allowing Russia to annex the autonomous region, a vote that the U.S. says was illegal and would never be recognized by Washington. Obama warned that continued Russian military intervention in Ukraine would only increase Russia’s isolation and exact a greater toll on its economy. REUTERS

Magnitude 4.4

Earthquake rocks LA area A magnitude 4.4 earthquake struck just outside of Los Angeles on Monday, rattling early morning commuters across a wide swath

of Southern California but causing no damage or injury. The quake struck shortly before 6:30 a.m. and was centered about six miles north-northwest of Westwood, Calif. REUTERS

REUTERS

Primary Care. Walk-in Urgent Care. Specialty Care. Three Convenient West Side Locations Whether you need a primary care doctor, walk-in urgent care or specialty care on the West Side, Beth Israel Medical Group offers comprehensive care by expert physicians at three convenient, state-of-the-art locations.

çAnnual physicals and wellness consults çCare for minor injuries to chronic illnesses çStrep, STD and HIV testing çLab draws at all sites, X-ray at 23rd Street çSpecialty care by appointment çEvening and weekend hours available

52 West 8th Street

8

226 West 14th Street

309 West 23rd Street

For more information, visit www.mountsinai.org/bimgwest


www.metro.us

New Classic Dream Home! $ Only 269,900! Huge Value! True luxury and you can own it! Call us today. Classic, the trusted builder in the Poconos, will show you how to own this home, at terms you can live with! It’s our all new Ashton model and it is available for only $269,900 COMPLETE. The Ashton has every feature you’ve ever dreamed of... Large open foyer, 4 truly spacious bedrooms including the master suite with walk in closet and tray ceiling, 2 1/2 baths, magnificently equipped kitchen, sunken living room complete with fireplace, formal dining room, rear dining deck, central air and heat, spacious 2-car garage and more. A total of 2,866 square feet!

And it can be all yours for just $9,447 down and just $1,920 per month pays all, including principal, interest, taxes and insurance!* Today, only Classic Quality Homes can offer you such outstanding value for the money. Call now and make an appointment at either of our two convenient sales offices with one of our expert home counselors and start moving toward your dream.

ENJOY WINTER FUN!

Live just minutes from Camelback, Blue Mountain, Big Boulder or Shawnee! Enjoy it all -- from a brand-new home of your own!

Homes priced from $199,900 to $499,900 Buy now and get up to $5,000 toward Closing Costs! LOW PROPERTY TAXES! • 90 MINS TO NYC • EXPRESS COMMUTER BUSES (4 per hour)

9 new york Tuesday, March 18, 2014

Call toll free

1-800276-4000 Visit our all-new website:

www.classicqualityhomes.com * Monthly payments based on FHA 30 yr. fixed interest rate of 4.5% with 5% APR with a finance cap of $271,000. Lower rates may apply to qualified buyers. All numbers are estimated. Conventional mtgs. also available.


NEWS

www.metro.us Tuesday, March 18, 2014

  

           

                      

 !  

  ! 

  !

!         !"

Convicted

Sex assault

10

DWI suspected

Jury to consider death penalty for Jodi Arias in September

Charges dropped in rare court-martial of Army general

Owner of NFL’s Indianapolis Colts arrested

An Arizona judge on Monday set a September court date to try again to determine whether convicted murderer Jodi Arias will be put to death for killing her ex-boyfriend nearly six years ago, court officials said. Arias was convicted by a jury in May 2013 of murdering Travis Alexander, whose body was found in the shower of his suburban Phoenix home in June 2008. He had been stabbed multiple times, shot in the face and had his throat slashed. REUTERS

A U.S. Army general at the center of a rare court-martial of a top military leader was cleared of sexual assault charges on Monday, but admitted to mistreating a junior officer during their inappropriate sexual relationship. Brigadier General Jeffrey Sinclair pleaded guilty to several lesser military criminal offenses as part of an agreement with the government that dismissed the most serious allegations against him. The 27-year Army veteran said he knew the female Army captain with whom he had a three-year extramarital affair was enamored by his rank, and he led her on despite knowing he would never divorce his wife. REUTERS

Billionaire James Irsay, the 54-year-old owner of the National Football League’s Indianapolis Colts, was jailed early on Monday on suspicion of drunken driving and possession of a controlled substance, authorities said. Police stopped Irsay on Sunday night for driving at a slow pace, stopping in the roadway and failing to signal a turn. He was arrested after failing several roadside fieldsobriety tests, police in Carmel, Ind., said in a statement. REUTERS

TRAVIS ALEXANDER FACEBOOK

JAMES IRSAY FACEBOOK

“My Apple Bank has FREE ExtraValue Checking — Plus a $100 Bonus with Direct Deposit!�

 

    

           

   !   !"# ! #"$% #

         



       

      

TOTALLY FREE ExtraValue Checking*

$

Get

100

**

wIth Direct Deposit into TOTALLY FREE ExtraValue Checking

y FREE Apple Bank VisaÂŽ Debit Card y FREE Online and Mobile Banking***

Established 1863 ¡ Member FDIC

Visit one of our 76 branches. www.applebank.com y 914-902-2775 *Totally Free ExtraValue Checking account requires $100 minimum opening balance. Direct Deposit $100 bonus offer for new accounts only. **Receipt of $100 bonus is contingent upon establishing Direct Deposit of a recurring payment into the newly established checking account and that Direct Deposit must be veriďŹ ed within 60 days of account opening, prior to crediting the $100 to the account. To qualify for this offer, a recurring payment must be payroll, Federal/state government beneďŹ t, or pension beneďŹ t checks. The $100 will be considered interest earned on your checking account for the year in which it was received and it may be necessary to report this as taxable income for that calendar year. Checking accounts cannot be opened with funds from an existing Apple Bank account. One bonus offer per customer. Employees of Apple Bank and its subsidiaries and their immediate family are not eligible for $100 bonus. ***Data fees may apply from your mobile carrier. Offers may be discontinued by the Bank at any time without prior notice.


See more at www.metro.us Source

Third person dies from SXSW crash in Texas capital

Sony Pictures Entertainment on Monday will announce layoffs throughout its studio operations in the United States and abroad, according to a person familiar with the matter. Among the units that will be hit is the Sony interactive team that supports digital marketing, the source said on condition of anonymity because the information is not yet public. REUTERS

A third person has died as a result of a motorist plowing his car into a crowd of people outside a nightclub last week at the South by Southwest festival in Austin, officials said on Monday. A 26-year-old woman, Sandy Thuy Le, has died. She was one of the five people listed as being in critical condition after the incident last Thursday. Rashad Charjuan Owens, 21, from Killeen, Texas, has been charged with capital murder for the incident. Police said Owens fled from a sobriety checkpoint, smashed through a police barricade and then plowed down people, some of them lined up outside a nightclub, over a span of several city blocks.

Cuts

100M

Under pressure from hedge fund manager Daniel Loeb to improve profitability at its studio, in November Sony hired consultancy Bain & Co to identify more than $100 million in cost cuts through layoffs and other means.

11

GM recalls another 1.5 million vehicles

Drunken driving

Sony Pictures to announce layoffs

NEWS

Last Friday. GM was hit with the first U.S. class action lawsuit related to an ignition problem.

In the XTS, a brake booster pump wiring issue can cause overheating, melting of plastic and a possible engine compartment fire. / GETTY IMAGES Crossovers

1.18M

The automaker said the latest recalls include 1.18 million midsized crossovers to repair an issue that could lead to the nondeployment of side airbags. It said it will repair the wiring harness of seat-mounted side airbags.

REUTERS

Vans

303K

GM is also recalling 303,000 Chevrolet Express and GMC Savana full-size vans to replace plastic material in the passenger instrument panel to meet federal head-impact crash standards for unbelted passengers.

General Motors Co. announced three more recalls on Monday, related to airbag deployment and other issues, and said it would take a $300 million charge primarily to cover the costs related to these actions as well as the previous recall for faulty ignition switches. The No. 1 U.S. automaker, which will take the charge in the first quarter, did not provide a breakdown of how much was related to the ignition-switch recall of more than 1.6 million older-model vehicles that

has hurt the company’s reputation since it was announced last month. GM said on Monday that it is recalling more than 1.5 million newer crossover utility vehicles, luxury sedans and fullsize vans in three separate recalls. While there were reports of engine compartment fires in two dealer-owned Cadillac XTS sedans, the company said it has received no reports of accidents or injuries related to the three new recalls. Affected are some 2008-2009 and all 20102013 Buick Enclave and GMC Acadia crossovers, some 2009 and all 20102013 Chevrolet Traverses and some 2008-2009 and all 2010 Saturn Outlooks. Most of the vehicles were sold in the United States, but some are in Canada and Mexico. REUTERS

ROLL IN READY TO ROCK OUT. Downtown-to-downtown service on the Northeast Regional SM gets you to the heart of the city — and the heart of the music — without the hassles and delays of traffic. So you can get to the show before the band starts up.

AMTRAK.COM

BOOK 14 DAYS IN ADVANCE AND

SAVE 25% OR MORE ON ONE-WAY FARES FROM NEW YORK CITY PHILADELPHIA

$

39

BOSTON

$

49

BALTIMORE

$

49

TRENTON

$

31

WASHINGTON, DC

$

49

RICHMOND

$

68

WILMINGTON

$

45

PROVIDENCE

$

47

This offer is valid for travel on the Northeast Regional train service only. Advance reservations are required a minimum of fourteen (14) days prior to travel. Once purchased, tickets are nonrefundable; exchanges are permitted within the ticket validity period. Blackouts apply on the following dates: 11/25/14–11/26/14, 11/29/14–11/30/14, and 12/19/14–12/21/14. Seating is limited; seats may not be available on all trains at all times. Fares are subject to availability. Up to 2 children ages 2–15 may accompany each adult at half the regular (full) adult rail fare. This offer is valid for Coach seats only; no upgrades permitted. This offer is not combinable with any other discount offer. In addition to the discount restrictions, this offer is also subject to any restrictions, blackouts, and refund rules that apply to the type of fare purchased. Fares, routes, and schedules are subject to change without notice. Once travel has begun, no changes to the itinerary are permitted. Other restrictions may apply. Amtrak and Northeast Regional are registered service marks of the National Railroad Passenger Corporation.


GRAND OPENING Advanced Dermatology Associates of FORDHAM

Medical, Cosmetic & Surgical DERMATOLOGY !LL3KIN$ISORDERSs!LL.AIL$ISORDERSs!LL(AIR$ISORDERSs!LL3KIN'ROWTHS

s!CNE s#YSTS s7ARTS s6ITILIGO s(ERPES s2ASHES s%CZEMA s0SORIASIS s(AIR,OSS s3EBORRHEA s!GING3KIN s"IRTHMARKS s6$34$S

s3KIN#ANCER s3KIN'ROWTHS s'ENITAL7ARTS s3KIN!LLERGIES s.AIL$ISORDERS s-OLE2EMOVAL s#HEMICAL0EELS s,EG6EIN2EMOVAL s"ROKEN"LOOD6ESSELS s2ED3POTS s4ORN3PLIT%ARLOBE2EPAIR s#USTOM3KIN#ARE

s3CAR#ORRECTION s3CALP#ONDITIONS s&UNGAL#ONDITIONS s7RINKLE4REATMENT s4UMORS'ROWTHS s7HITE$ARK3POTS s#OMPLEXION0ROBLEMS s,ASER4REATMENTS s2ESTYLANE s(AIR2EMOVAL s"OTOX#OLLAGEN s3KIN2EJUVENATION s#OSMETIC3KIN3URGERY s,ASER0EELS

!LL)NSURANCE0LANS 5NIONS (-/S 00/S -EDICARE-EDICAID!CCEPTEDs$AY %VENING7EEKEND!PPOINTMENTS!VAILABLE "O A R D #E R T I FI E D  5N IVE R S I T Y !FFI L I A TED

Beatles memorabilia. Early George Harrison guitar leads auction Harrison, who died in 2001 at age 58, played the guitar on 1963 appearances on British TV shows “Ready Steady Go!� and “Thank Your Lucky Stars� months before the group brought Beatlemania to the United States with a series of performances on “The Ed Sullivan Show� in February 1964, launching the British Invasion of rock bands.

An electric guitar played by George Harrison on British television prior to the Beatles’ “invasion� of the United States will go on the auction block along with a rare album cover signed by the Fab Four, Julien’s Auctions said on Monday. Harrison’s black-andwhite 1962 Rickenbacker 425 electric guitar is expected to fetch between $400,000 and $600,000 at an auction on May 16-17 at the Hard Rock Cafe in New York City.

REUTERS

'RAND#ONCOURSE 3UITEs"RONX .9s   "RONX0ARKCHESTERs 1455 West Avenue s Next Post OfďŹ ce & Macy’s s 718-239-1500 "RONX#O OP#ITYs 2100 Bartow Ave, Ste 211 s"AY0LAZA3HOPPING#ENTER s   "RONX4HIRD!VENUEs 291 East 149th Street. s"ET#ORTLAND-ORRISs718-742-1000 -IDTOWN#ENTRAL0ARK3OUTH3TEs#ORNEROFTHAVEANDTHSTs  

www.adv-derm.com 1.800.545.SKIN (7546)

GEORGE HARRISON OF THE BEATLES RECORDS IN THE STUDIO ON A RICKENBACKER ELECTRIC GUITAR IN 1964. / GETTY IMAGES

Scan to Win!

/2 Hour Massage & Consultation 1

(some restrictions apply)

Book www.SmileArtistNY.com

US forces seize tanker carrying oil from Libya rebel port U.S. special forces have seized a tanker that fled with a cargo of oil from a Libyan port controlled by anti-government rebels, halting their attempt to sell crude on the global market. Gunmen demanding regional autonomy and a share of oil wealth had managed to load the ship, which escaped Libya’s navy and triggered a crisis that prompted parliament to sack the prime minister. A U.S. SEAL commando team boarded the tanker Morning Glory from a Naval special warfare rigid inflatable boat as it sat in international waters off Cyprus on Sunday night. REUTERS

Voted: Top Provider in US

For $2001

Express

Call C ll 212-779-8626 212 779 862 24/7

12

Commandos

This Week’s Special 50% off:

Enter to Win!

FREE

NEWS

www.metro.us Tuesday, March 18, 2014

Straight Teeth in 5 months, No Braces!*

Invisalign Express or Braces

for $99/month*

50% off ends 3/31/14

To Get Your Free $100

Gift Card*

1

Call or Text the word SmileCafe To 77286 by this Friday (limited supplies) Dental Plan: Reduced to only

$20/month!*

Implants/2 visit Extreme Smile MakeOver* Proven Laser * Dentistry

2

BEST Fees & Quality Guaranteed on all procedures as low as $999* 3

Save

Now Only $199 – Exam/Cleaning $49* 4

or Natural Strong Dentures as low as $999* 5

Discover Natural Veneers as low as $999* “You too can have a Natural Gorgeous SEXY Smile for as low as $99/month* by NEW 3D imaging CAD/CAM Laser @ Relaxing Holistic Park Ave Dental Spa!*

6

Treatment of pain, Bad Breath/Halitosis, Gummy Smile, Gingivitis. Laser Dentistry, and 500+ other treatments. *Promotions end 3/31/14. Must qualify. Limitations apply. Please visit site & call for details before making a commitment.


NEWS

13

Ancient scourge

Earliest example of cancer found British archaeologists have

Researchers discovered the evidence of tumors that had developed and spread throughout the body in a 3,000-year-old skeleton. REUTERS

found what they say is the world’s oldest complete example of a human being with metastatic cancer and hope it will offer new clues about the disease.

Conquering your cravings. Want a cookie? Try playing Tetris instead Playing a game of Tetris can reduce the strength of food and nicotine cravings, according to a new study. Researchers had used visual games to interrupt cravings before, but only when they had induced those cravings first, she said. For this study, people’s cravings happened — or did not happen — naturally. “We chose Tetris because we wanted a task that would be interesting, demanding and highly visual,� coauthor Jackie Andrade said. She and her team had 119 college-aged, primarily female, students describe

Whip out your phone and resist these like a champ. / GETTY IMAGES

what, if anything, they were craving, and how badly. Then they instructed the students to play Tetris for three minutes. Cravings got weaker over time for everyone. But they weakened faster and to a greater extent among participants who played Tetris. REUTERS

Quoted

“Naturally occurring cravings might be harder to disrupt because they are triggered by internal states like hunger.� Andrade

This building is being constructed through the New Housing Opportunities Program (NHOP) of the New York City Housing Development Corporation and the Mixed Income Program of the New York City Department of Housing Preservation and Development.

Affordable Housing For Rent 125 NEWLY CONSTRUCTED UNITS Crossroad Plaza III, 535 Union Avenue, Mott Haven, Bronx Amenities: 24-on-site resident super,

Transit: 6 to 149th St or BX19 towards E. 149th Street Wales Avenue

on-site parking garage*, laundry room*, party room(s)*

No application fee. No broker’s fee.

PODIATRIST The Most Advanced Techniques Used for Bunions and Hammertoes A new approach for treating Tendon Injuries for the Achilles, Tendonitis and Plantar Fasiitis (Heel and Arch Pain)

(*additional fees apply)

Who Should Individuals or households who meet the income and household size requirements listed Preference for a percentage of units goes to: in the table below may apply. Only qualiďŹ ed applicants will be eligible for apartments. sAPPLICANTSWITHMOBILITYIMPAIRMENTS sAPPLICANTSWITHVISUALORHEARINGIMPAIRMENTS Apply? Applicants who live in New York City receive a general preference for apartments. sRESIDENTSOF"RONXCommunity District 1  sMUNICIPALWORKERS

6IEWTHE!VAILABLE5NITS Unit Size Studio Studio Studio

Monthly Rent* $494 $785 $939

Units Available 1 1 5

z

1 bedroom

$533

5

z z z z

1 bedroom

$844

6

z

1 bedroom

$1,187

31

z

2 bedroom

$648

7

z

2 bedroom

$1,022

11

z

2 bedroom

$1,434

51

z

3 bedroom

$1,175

2

3 bedroom

$1,649

5

z

z

3EE5NIT2EQUIREMENTS Household Size** 1 person 1 person 1 person 1 person 2 people

Annual Household Earning*** $18,618 - $23,520 $28,595 - $35,280 $33,875 - $58,800 $19,989 - $23,520 $19,989 - $26,880

1 person 2 people 1-2 people

$30,652 - $35,280 $30,652 - $40,320 $42,412 - $58,800

2 people 3 people 4 people 2 people 3 people 4 people 1 person(i) 2 people 3-4 people

$24,000 - $26,880 $24,000 - $30,240 $24,000 - $33,560 $36,823 - $40,320 $36,823 - $45,360 $36,823 - $50,340 $50,949 - $67,200 $50,949 - $75,600 $50,949 - $83,900

3 people 4 people 5 people 6 people 2 people(ii) 3-4 people

$42,412 - $45,360 $42,412 - $50,340 $42,412 - $54,420 $42,412 - $58,440 $58,663 - $75,600 $58,663 - $83,900

5-6 people

$58,663 - $97,400

** Household size includes everyone who will live with you, including *** Household earnings includes salary, hourly wages, tips, Social Security, child support, parents and children. Subject to occupancy criteria. and other income for household members. Income guidelines subject to change. (i) Households of 2 or more will be given preference for 2 bedroom units (ii) Households of 3 or more will be given preference for 3 bedroom units How Do You Apply? Apply online or through mail. To apply online, please go to: www.nyc.gov/housingconnect. To request an application by mail, send a self-addressed stamped envelope to: Wavecrest Management Team, LTD., c/o Crossroad Plaza III, 87-14 116th Street, Richmond Hill, NY 11418. Only send one application per development. Don’t submit duplicate applications. Do not apply online and also send in a paper application. Applicants who submit more than one application will be disqualiďŹ ed. When is the Deadline? Applications must be postmarked or submitted online no later than May 16th, 2014. Late applications will not be considered. What Happens After You After the deadline, applications are selected for review through a lottery process. If yours is selected and you appear to qualify, you will be invited to an interview to continue the process Submit an Application? of determining your eligibility. Interviews are usually scheduled from 2 to10 months after the application deadline. You will be asked to bring documents that verify your household size, identity of members of your household, and your household income. * Rent includes gas for cooking.

-AYOR"ILLDE"LASIOs(0$#OMMISSIONER6ICKI"EEN HDC President Gary Rodney

www.nyc.gov/housingconnect

New Treatment For Heel Pain, Shockwave, PRP as seen on the front page of The New York Times

Platelet Rich Plasma Therapy (PRP)

Take the Foot Health Checkup s-YTOENAILSARESTREAKED DISCOLORED THICKENED s4HESIDEOFMYTOENAILSDIGINTOTHESKINANDHURT s)HAVEALARGEBUMPBEHINDMYBIGTOEORLITTLETOE WHICHISALWAYSRED s)GETANEXTREMELYPAINFULhCRAMPvINTHEAREAOFMYTHIRDANDFOURTHTOESWHENWEARINGSHOES s-YTOESARENTSTRAIGHT THEYARECROOKED BENTANDHURT s)HAVEPAINFULCALLUSESONTHEBALLOFMYFOOTWHICHKEEPBUILDINGUP s)HAVECORNSONMYTOESWHICHGETTHICKERNOMATTERWHATSHOESIZE)WEAR s4HEBOTTOMOFMYHEELHURTSALLDAY BUTITSWORSEWHEN)STEPOUTOFBEDINTHEMORNING s)HAVECRAMPSINMYLEGSWHICHALWAYSHAPPENWHEN)WALKTHESAMEDISTANCE s-YANKLESARESWOLLENMOSTOFTHETIME s-YFEETAREALWAYSDRYANDSCALY SOMETIMESTHEYITCH s-YFEETJUSTHURTALLOVERWHEN)STANDORWALKALOT s)HAVENUMBNESS BURNING INFECTION PERSISTENTPAIN SKINRASH OROPENSORES

Feet Hurt? Bunions? Hammertoes? Heel Pain?

Now Featuring

Helps Eradicate Fungal Nails

If any of these apply to you, call today. Dr. Paul Drucker, DPM Dr. Martin McGrath, DPM

Dr. Paul Drucker, DPM Dr. Martin McGrath, DPM

184 East 70th Street, B1 Between Lex and 3rd Ave

121 E. 60th St. Suite 3D (Between Lex & Park) New York, NY

212-772-3500

(212) 486-7333

Dr. Paul Drucker, DPM 162-15 Highland Ave Jamaica, NY 11432

(718) 658-9383

Dr. Ernest Levi, DPM ˆ`ĂŒÂœĂœÂ˜ĂŠÂ‡ĂŠĂ€>˜`ĂŠ iÂ˜ĂŒĂ€>Â?ĂŠUĂŠ30 E. 40th St., Suite 401

212-685-5100 0ATIENTISRESPONSIBLEFORCO PAYSDEDUCTIBLEs-OSTINSURANCEPLANSACCEPTEDs#OMPLETEFAMILYFOOTCAREs,ASERSURGERYAVAILABLE


www.metro.us Tuesday, March 18, 2014

SECOND SHIFT Learn how busy city-dwellers make ends meet. EMILY LAURENCE=

Contact us if you have a story to tell: emily.laurence @metro.us

The stats

Joshua Bradenburg Age: 33 Residence: Astoria, Queens Roommates: None Number of jobs: 3

PERSONAL FINANCE

14

Martial artist by day, bartender by night way.

Overtime. Meet a bartender who could really kick your butt if he wanted to. Briefly describe your jobs. I bartend four nights a week at the Royalton Hotel from 3 p.m. to midnight and teach at a Muay Thai academy six days a week. And on Fridays, I teach voice lessons. Do you enjoy every job? Honestly, I do. It’s a hectic lifestyle, but it’s come together in a manageable

In addition to bartending and teaching Muay Thai, Bradenburg, 33, also teaches voice lessons. /PROVIDED

Are You Shy

PH94B-CL028-1

‰ Do you get anxious in front of others? ‰ Do you feel embarrassed if you have to give a speech or perform at a public function? ‰ Do you avoid meeting new people, going to parties, or dating? ‰ Is it difficult for you to eat, drink, or write while others may be watching you? If your answer is yes to any of these questions, you may be suffering from Social Anxiety Disorder. If you are between 18 and 65 years of age, and feel that these problems interfere with your ability to achieve your goals or to enjoy life fully, you may be eligible for our research study. If you qualify, you will receive studyrelated evaluations with our Board Certified Physician and study medication, at no cost to you. Please call for more information.

(212) 595-5012 Th e Med ica l R e sea rc h Ne two rk , L. L. C. 134 East 93rd Street, New York NY 10128 y www.MedicalResearchNetwork.com

Do you have time to hang out with your friends? I guess theoretically I can on Sunday nights. I’m not free Sunday mornings because I play the guitar and sing at a church. Then, I usually head over to my sister’s to see her, her husbands and kids. To be honest, when I do have free time, I don’t feel like going out to bars or to a club. I just want to order Chinese food, watch a movie and relax. Are you working multiple jobs to make ends meet or to live a certain lifestyle you want to lead? I don’t have a crazy lifestyle. When you work that much, there’s not much of a lifestyle you can have. If I just worked one job, I would just be able to make ends meet. But working more than one job allows me to put some money away for the future, whether it’s to buy an apartment or car or whatever I’ll need so I can actually have more of a life than just going from one day to the next. Are you happy with the way things are or are you working toward cutting down to one job?

“[Working three jobs] is a hectic lifestyle,” says Bradenburg. /PROVIDED

It would be great to just have one job, but I don’t really see that as a possibility for me, at least as far as my life is structured right now. Many, many years down the road maybe I’ll have my own martial arts academy and be able to just have one job, but I feel like it’s always going to be a balance between two or three jobs. Is there anything else

about yourself that you want to share? Usually people who have a very busy work life are very busy in their downtime as well. I do a lot of volunteer work in my spare time. There are so many great organizations out there that don’t need you to commit to a certain numbers of hours every month. Some just want help for one day here or there, or for a single event.


EDUCATION GUIDE

15

Academic Excellence, Flexibility, Accessibility

Earn Your Master of Social Work Degree Online Fordham’s MSW program is ranked #11 by U.S. News and World Report • 24/7 access to classes • Field placements in your geographic area • Part-time clinical program, including advanced standing • Long Island hybrid (campus/online) available • Accredited by the Council on Social Work Education Open to residents of New York, New Jersey, and Connecticut, including metropolitan NYC.

Call 212-636-6600 or visit fordham.edu/gss/online.

What do you think of when you hear the ďŹ gure “a million dollarsâ€?? Some people might imagine a winning lottery ticket, others the grand prize on a TV game show. But what if we were to suggest “a college educationâ€? as something even more likely to translate into money, along with all of its other beneďŹ ts? Well, the United States Bureau of Labor Statistics (BLS) estimates that the difference in median income between someone holding only a high school diploma and someone holding a Bachelor’s degree could translate into more than one million dollars in the course of a working life. Food for thought, we think you’ll agree. The question is, “Where should I go to earn a degree?â€? Our answer? Touro College’s New York School of Career and Applied Studies (NYSCAS). We call NYSCAS “The College

with the Personal Touch,â€? and here’s why: From the moment you arrive at one of our sites, you’ll be treated more like a family member than simply another prospective applicant. Our admissions counselors and academic advisors will work with you one-on-one to show you the best ways to get started with your college education, and our ďŹ nancial aid counselors will help you navigate the process of paying for it. And we won’t stop there! As a NYSCAS student, from the application process through graduation you’ll be guided every step of the way by a faculty and staff dedicated to keeping you on the road to success. There are lots of other beneďŹ ts to being a student at NYSCAS. For example, with 7 sites throughout New York City, each one close to

public transportation, we can make your college experience more convenient. Morning, afternoon, evening — even weekend — classes permit you to work your class schedule around other commitments such as a full-time job or being a full-time parent. It’s very easy to get the ball rolling on a new career and a new pathway in life. Just drop into any of our sites and sit down with one of our admissions counselors. They are eager to answer your questions about careers, majors, programs, application procedures, and anything else that concerns you about being a college student. You can also call us at (877) 3-NYSCAS ext. 1003 and make an appointment at your convenience to get the information you need. Touro College is an equal opportunity institution.

NYSCAS A D iv ision of

TOURO

COLLEGE

College with a personal touch ASSOCIATE’S AND BACHELOR’S DEGREES

‡%XVLQHVV0DQDJHPHQWDQG$GPLQLVWUDWLRQ‡3DUDOHJDO6WXGLHV ‡,QIRUPDWLRQ7HFKQRORJ\‡+XPDQ6HU YLFHV‡%LRORJ\‡6RFLDO6FLHQFHV ‡3V\FKRORJ\‡(GXFDWLRQ‡'LJLWDO0XOWLPHGLD'HVLJQ ‡/LEHUDO$U WVDQG6FLHQFHV‡DQGPRUH INTEGRATED HONORS TRACKS

OTHER PROFESSIONAL OPPORTUNITIES

8QGHUJUDGXDWH2VWHRSDWKLF0HGLFLQH 8QGHUJUDGXDWH3KDUPDF\

‡3UH/DZ‡3UH0HGLFDO‡3UH'HQWDO

INFORMATION SESSIONS: Manhattan: 27-33 West 23rd Street, $GPLVVLRQV2IÂżFH:HGQHVGD\VQRRQSP %URRNO\Q6WLOOZHOO$YHQXH $GPLVVLRQV2IÂżFH:HGQHVGD\VDPSP

MANHATTAN: 212.463.0400

x5500

BROOKLYN: 718.265.6534 x1003 Bensonhurst, Brighton Beach, Flatbush, Kings Highway, Starrett City QUEENS:

718.520.5107 x109

www.touro.edu/nyscas y

N ew Yor k S c h o o l o f C are e r and A p p li e d S tu di e s Touro College is an equal opportunity institution


www.metro.us Tuesday, March 18, 2014

16

EDUCATION GUIDE

2 Washington Street, near Battery Park Accelerated Degree Completion Program • Bachelors Degrees (38 majors) • Alliance Theological Seminary • MA in Mental Health Counseling • MS in Organizational Leadership (finish in as little as 12 months) • MBA (finish in as little as 16 months) • MS in Childhood Education, Childhood Special Education •

New Programs. New Opportunities. New York’s Christian College.

ACCEPTING APPLICATIONS

VISIT US BY USING ANY OF THESE SUBWAY LINES:

For more information call: 877-626-2236 or visit us at: www.nyack.edu Nyack, NY • New York, NY • www.nyack.edu • www.facebook.com/nyackcollege

5

G RE

TE IS

R

Start today on an exciting career.

TO

Enrollment Extended.

DA YS LE FT

Let Mildred Elley guide you on the road to success and increased earning power. Our degree and certificate programs include: t Business Management t Massage Therapy t Medical Assisting t Paralegal Studies Lifetime job placement assistance. Day, evening, weekend & online classes. Financial aid & scholarships for those who qualify.

CALL TODAY! (866) 899-9471 TOLL- FREE

mildred-elley.edu GI Bill Approved

Accredited Member, ACICS For program details and disclosures visit mildred-elley.edu/disclosures

25 Broadway, Floor 16, New York, NY


EDUCATION GUIDE

17

Take advantage of affordable tuition and a competitive degree. Today, the looming cost of a college education is a stressful topic for many families—and BMCC, as part of the City University of New York (CUNY), offers a solution to that dilemma. We provide a high-quality, competitive and remarkably affordable college education. That affordability is assured by the CUNY Safety Net, which includes low tuition, as well as access to an abundance of federal and state aid. Not only that, as a BMCC student, you’ll sustain fewer education loans than other college students in New York and across the country. You’ll graduate with job-ready skills and respected academic credentials, well prepared to begin your career or pursue further degrees. Numbers speak louder than words As a degree-seeking BMCC student and NYC resident, you’ll pay just $1,950 at this time, for tuition and fees—while your peers attending

We want you to gain knowledge and degrees, not debt and uncertainty. private colleges will lay out a staggering $15,500 to $25,000 a semester. In a recent year, over 21,000 BMCC students received more than $102 million in assistance from at least one federal, state or municipal financial aid program, and BMCC provided scholarships for close to $700,000—more awarded than by any other CUNY college. We also disbursed almost $70 million in Pell grants in a recent year, and BMCC ranks in the top 20 colleges—out of 5,000 schools, nationwide—in Pell grant disbursement.

Degrees that set careers in motion Many BMCC graduates are on track to transfer into designated bachelor’s degree programs at CUNY and other 4-year colleges. These include our Criminal Justice, Biotechnology, Forensic Accounting, Health Information Technology, Communication Studies, Bilingual Education, and Mathematics and Science for Secondary Education majors. Likewise, BMCC graduates in Engineering, Science, Mathematics, English, Theatre, Computer Information Systems, Business Management, Media Arts and

Borough of Manhattan Community College

(866) 583-5729

Technology, Human Services, Allied Health and Nursing are well prepared for the third year of a 4-year degree program. In fact, the BMCC value continues, if you transfer to a CUNY 4-year college, where tuition is only about $5,000 a year at this time— dramatically less than private college tuition. We highly value the success of every BMCC student. We want you to gain knowledge and degrees, not debt and uncertainty. Start here, and go anywhere your ambition takes you.

www.bmcc.cuny.edu/metro


www.metro.us Tuesday, March 18, 2014

EDUCATION GUIDE

Stuff every student should know Education. Get through college with a few good tips.

Take notes “Pay attention to anything that’s written on the board. The teacher is not going to put something on the board that doesn’t matter. It’s also important to write down any questions that might come up in a discussion. It could be something you will think about when you’re read-

Myth-busting

The almighty all-nighter

Thornburgh didn’t actually write her book on a typewriter. / PROVIDED

the bathroom all the time, you will not fall asleep. I also find it helpful to break the time down. It can be terrifying to think about writing 12 pages in six hours. You should just think about working 45 minutes straight and then write a page and a half in that time. If you break it down into smaller chunks you’ll feel like it’s more manageable.”

“It’s tempting to think that you can drink six Red Bulls and then write your paper, but that will probably just give you a heart attack. Keep a monitor on your caffeine and drink water instead. It helps you stay awake better, because you’re hydrated — plus, when you have to go to

ing. Write down all dates and formulas. These things are easy to forget, so put them on paper so you have a record of it.”

There’s so much to figure out when you’re in college. We talk to Blair Thornburgh, author of “Stuff Every College Student Should Know,” out March 25, about her best tips for surviving college without spending all your money on textbooks, how to pull an all-nighter and more.

will make it easier. If it’s really bad, you should get help from your residential staff, because that’s why these people are here.”

Getting along

In an interview

“So much of college is social, and a lot of people need to get away from that sometimes. And if you don’t feel like you can go to your room, it’s going to be very stressful. It’s a good idea not to assume that you’re going to be your roommates’ best friend. A lot of people think that because you really want to make friends. Even if you live with someone who was your friend before, you might not get along. It’s really important to talk, so you don’t build up a weird resentment; then you’re more likely to explode. Plan out what you want to say before you bring up an issue — that

“The most important tip is to be courteous and on time [when you’re interviewing.] Recognize [that] a person’s chief job is not normally interviewing people; they have other things to do. So be prepared and make their job easier. Don’t do anything that’s going to make you uneasy. Dress properly and don’t be rude. I wouldn’t come in with a cup of coffee or with my earbuds in. Show that you’re focused on doing this interview. It’s always good to have a couple of questions to ask the interviewer to show that you know what they do and you want to know more about it.”

Funding. You may not think it’s possible to find financial aid, but a little research might reveal unexpected options It can take a bit of digging to find scholarships or grants you’re eligible for, but it’s a small price to pay for the chance to score some free cash. Here’s our guide to not paying full price for that degree.

Scholarships, grants and aid Scholarships, financial aid and grants are three of the most common applicationbased sources of funding available to students. Although all three are monetary awards given to students to help cover education-related expenses, they are disbursed according to different criteria. Scholarships are generally based on merit, financial aid is usually need-

based and grants are most often awarded for a specific project or program. How to apply: Talk to your school’s administrative office to find out what awards may be available to you. After you’ve checked with your school, do research online to find out about awards offered by the government, foundations and corporations. Many schools also host an information session at the beginning of the school year to tell students about financial aid offered available. Equip yourself with a pen and notepad and get there early — those seats fill up fast.

study programs to students who want a chance to gain hands-on work experience before they graduate. How to apply: Start by checking with the financial aid department to make sure you’re eligible for the program and follow their lead. Remember, your workstudy experience is a great opportunity to position yourself for future employment in a given office or department. It’s a chance to show off your skills and build a professional network on campus. Be sure to work hard and make your interest known.

Work-study

Internships or apprenticeships

Many schools offer work-

If you aren’t offered a work-

18

study position, consider applying for an internship or apprenticeship in your chosen field. Though these positions don’t often pay well, the work experience and connections you make are often vital to your career. How to apply: Look for companies or organizations in your area that are connected to your program of study. Contact the manager or human resources department to express your interest in the work they do and ask if they have any need for an extra set of hands in the coming months. TalentEgg.com is a job board and online career resource for college students and recent graduates.

You don’t need to start with a jar full of coins to fund your education. / COLOURBOX

Piggy bank

Money saver “Don’t buy the books new from the campus bookstore — they’re just going to rip you off. The books can be pretty easy to find online if you have the ISBN. Make sure you look around also on foreign sites. Then you can also sell the books when you’re done with them. If it’s a big textbook you’re doing for a huge class and you have a study group, you can split the book. You can also make an arrangement with someone you know is going to take the class next semester.” LASSE EMIL KRISTIANSEN @metronewyork letters@metro.us

Work it

Part-time is the right time If you’re struggling to pay for school, consider taking on a part-time job to help you cover your costs. It can be difficult to balance a job on top of your studies, but it is definitely doable. Stay with it It can feel overwhelming to see your tuition, textbook and living costs add up as you work toward completing a degree, but there is help out there. •

Spend some time doing your research to learn about the funding that’s available — it could be well worth your effort in the end.


EDUCATION GUIDE

19

CUNY Graduate Studies Fair, March 31 Over one million people are employed in the human services sector in fields ranging from child services and elder care to city finance. A master’s degree from The City University of New York (CUNY) prepares you for the many job opportunities available in government, nonprofit organizations other human services institutions.

“The Master of Public Administration (M.P.A.) and Master of Public Health (M.P.H.) offered by CUNY, and our other master’s degree programs, can help you lead in this sector, which is so vital to the life of New York,” says David Birdsell, dean of the Baruch College School of Public Affairs.

Learn more at the Graduate Studies Fair, March 31, at The CUNY Graduate Center. For further information email grad@cuny.edu or visit cuny.edu/grad.

More CUNY Master’s Program Success Stories  Fatima Shama Master of Public Administration School of Public Affairs, Baruch College Vice President, Strategic Development and External Affairs Maimonides Medical Center, Brooklyn

Register TODAY @ cuny.edu/grad

CUNY Graduate Studies Fair Monday, March 31 CUNY Graduate Center 365 Fifth Ave. at 34th Street, Manhattan Outstanding Graduate Programs at 13 Colleges in all Five Boroughs


www.metro.us Tuesday, March 18, 2014

EDUCATION GUIDE

20

Choose from five dynamic & interactive summer programs for motivated students entering the 10th through 12th grades. Distinguished professors lead discussions and offer focused curriculum in PRE-MED, GLOBAL FINANCE, ENTREPRENEURSHIP, SOPHOMORE ENRICHMENT & FINANCIAL ENGINEERING. Summer session begins JULY 7, 2014.

>>

Daily SAT prep

>>

Intensive Learning

>>

Pre-Med

>>

Global Finance Entrepreneurship

>> >> >>

BARUCH.EDU/LEADERSHIP

Sophomore Enrichment Financial Engineering

ONE BERNARD BARUCH WAY, BOX B2-155, NEW YORK, NY 10010

How to become e an n Esthetician in New York?

1

Register and complete a 600hour NY State Licensed Program

2

Upon graduation, apply for the State Board Exam and PASS!

3

Start a new future!

Learn with the FIRST Esthetics School in the USA! Full Time & Part Time classes – Evening, Day, Weekend, etc. ESTHETICS NAIL SPECIALTY WAXING and MORE!

CALL TODAY 212-779-7800 International School for Esthetics, Ski M k Skin C Care & Makeup

261 Fifth Avenue, 24th Fl., New York, NY 10016

I

ACADEMY@BARUCH.CUNY.EDU


EDUCATION GUIDE

21


www.metro.us Tuesday, March 18, 2014

EDUCATION GUIDE

22


3

GOSSIP

Things about Nikki Sixx’s wedding photo

23

THE WORD Dorothy Robinson takes on the world of gossip.

CULTURE

DOROTHY ROBINSON @dorothyatmetro dorothy.robinson@metro.us

ALL PHOTOS GETTY IMAGES

Surprise! Guthrie is married — and pregnant “Today” co-anchor Savannah Guthrie got married this weekend — and broke the news that she is also four months pregnant. She and her new husband Michael Feldman announced the big news to guests at their Arizona wedding on Saturday, but asked their friends and family to keep the news quiet. When Guthrie was back at work on Monday morning (not much of a honeymoon, is it?), “Today” played a clip of their wedding — and the happy pregnancy news. “We are four months pregnant,” Guthrie announced to excited guests in the clip, all of whom erupted to their feet in applause. Back on air, Guthrie shared her happiness with viewers. “I’m so happy to tell the world, because I can’t suck in this gut anymore.”

There are very few weddings in which the groom’s attire upstages the bride’s, but Saturday’s nuptials between Motley Crue’s Nikki Sixx and model Courtney Bingham is an exception to the rule. While Bingham, 28, wore a custom-made gown from her aunt’s California bridal boutique, Sixx sported a dagger necklace and a black bandana. It was, as they say, “a lot of look.” “Just threw my wedding suit on topped with a ton of chrome hearts jewelry & custom leather chucks W/ an old Keith Richards scarf #I’mReady,” he tweeted on Saturday. Readers, I can’t stop staring at him. So many things to address about his wedding photo. Let’s look together, shall we?

1

His hair. So very many questions. Can that

really be his hair? Really? Remember: Sixx is 55. It’s not like most men approaching 60 can rock hair like that. What kind of product do you think he uses? Did he or Bingham spend longer on their wedding ’do? Does he wear the bandana to cover up a receding hairline? Speaking of his best accessory, I love that Sixx is such a romantic as to rock a bandana with a skull and hearts.

2

His other hair. Look very, very closely. Is his goatee lopsided? I want to straighten it out like a crooked painting on the wall. A crooked painting made out of pube-like fabric.

3

His dagger necklace. “Something old, something new, something borrowed and something you can cut your filet mignon with at the reception.”

AMATEUR NIGHT

AT THE APOLLO Sponsored by:

Talking points

Statham needs ‘tough love’ Jason Statham better be careful, as girlfriend Rosie Huntington-Whiteley has reportedly been getting some frank advice from fellow Victoria’s Secret model Miranda Kerr about the state of their relationship, according to Radar Online. “Rosie and Jason have had many ups and downs in their relationship, but the supermodel has begun to lay down the law that if Jason doesn’t start getting serious about getting married, she will leave him. But the ultimatum idea didn’t come from Rosie herself but her close pal and mentor Miranda,” a source says. “After Rosie and Jason have spent four years together, Miranda would like to see her get married. She only

2

wants the best for her friend, so she’s urging her to give Jason some tough love.” And apparently Kerr is more than happy to take credit for what happens next: “Miranda has been bragging to other friends in recent weeks that she is

steering Rosie in the right direction by advising her to leave Jason if he doesn’t propose before the summer,” the source adds.

Twitter feed We check in with some of Hollywood’s biggest names to see what they’ve been up to — in their own words, in 140 characters or fewer.

Today, Mark Duplass is feeling groggy, Tom Daley is globetrotting, Paris Hilton is being nice to herself and Chloe Grace Moretz is in the mood for something lighter. @MarkDuplass: I have been up for 2 hours and I remember maybe 6-7 minutes of it. @TomDaley1994: I’ve missed you twitter and Facebook! Haha...just flown from Beijing to Dubai! @ParisHilton: Just had an amazing 2 hour deep tissue massage. Feeling happy & relaxed. Loves it

JASON STATHAM AND ROSIE HUNTINGTON-WHITELEY

@ChloeGMoretz: flipping through channels then i see “Why Planes Crash” who would Ever watch that?!

BE GOOD OR BE GONE WEDNESDAYS AT 7:30PM 800-745-3000 TICKETMASTER.COM


See more at www.metro.us

www.metro.us Tuesday, March 18, 2014

The comedy “Better Living Through Chemistry” finds Sam Rockwell going off the rails as a mildmannered, henpecked pharmacist who starts getting high on his own supply and getting out of his shell after an encounter with a boozy rich trophy wife (Olivia Wilde). But don’t worry: Rockwell was well-prepared. There’s a particular tone to this kind of comedy. Yeah, it is a pretty particular demographic, isn’t it? I was joking that it was the same arc as “Captain America.” He uses chemicals to become a superhero, and it’s not dissimilar to that — emotionally, anyway. [Laughs] It’s an 80-pound weakling who becomes a strongman, or “Jekyll and Hyde.” You know, I describe the movie as “American Beauty” meets “The Nutty Professor.” You have some very elaborate, if comical, sex scenes with both Olivia Wilde and Michelle Monaghan. Comical is the word, because they’re not, like,

sensual. They’re pretty funny. We were laughing the whole time. It was very silly stuff. You also get quite a range to play with your character as he comes out of his shell. The trickiest part was the beginning, before he takes the drugs. I think that was actually the trickiest to capture, the more introverted version of the guy. I had a few references for that, and the one that comes to mind the most is probably Donald Sutherland in “Ordinary People.” And then I did actually watch both the Jerry Lewis and the Eddie Murphy “Nutty Professor” films, and that was actually very helpful, too. Really? Yeah. I think for the drug stuff I was watching a lot of episodes of “Intervention,” and I think I took a peek at the movie “Dead Ringers” with Jeremy Irons. I might have even watched “Half Nelson” again just to get a little reference. But I really was watching a lot of “Intervention.” You know

FILMS FI I

24

SAM ROCKWELL The actor had unusual prep for the comedy “Better Living Through Chemistry.”

HIGH ON LIFE Practice makes perfect

Is it normal for you to put that much preparation into a role? Yeah, pretty much. It depends on the part. You don’t always have to do that much research. With a lead role, you really have to put in a lot of homework, but different roles have different needs. Like “Matchstick Men,” I didn’t really have any major

Get Discovered

preparation for that. But “Frost/Nixon,” which was also a supporting role, I had to do a lot of research for because we had to improvise about the plumbers and Nixon. And I was the Nixon expert, so I had to know all that s—. I think any preparation just really comes out of the fear of sucking, you know what I mean?

Sam Rockwell plays a pharmacist who gets high on his own supply in “Better Living Through Chemistry.” / GETTY IMAGES

that show, right? The reality show? And I’m not foreign to some drugs, so I knew a little bit about it. But the guys gave me a book that had all these drugs in it and you could

look up what the results would be — the side effects and everything. NED EHRBAR @Nedrick ned.ehrbar@metro.lu

THIS WEEKEND ONLY - MARCH 22ND & 23RD

COMPLIMENTARY ACTING & MODELING WORKSHOP

Barbizon of NYC is searching for new models and actors to be trained for top licensed agents, managers and casting directors! Barbizon Models have graced the covers of all major fashion magazines, appeared in national TV commercials, top teen TV shows, TV Competitions like America’s Next Top Model, American Idol, The Voice, The Face, and major feature films!

TRY IT OUT THIS WEEKEND ONLY Learn how to walk the runway, how to audition for commercials and more!

THE NEW YORKER HOTEL

CALL NOW TO RESERVE YOUR SPOT SPACE IS LIMITED

481 8th Ave (34th St. & 8th Ave)

(212) 239-1110

*under 21 must be accompanied by a parent/guardian

www.BarbizonSuccess.com MO D E L I N G O F M A N H AT TAN

LASIK Deal of the Week $1895 for LASIK Surgery for Both Eyes ($4000 originally)

Expires //201

ORIGINAL PRICE $4,000

DISCOUNT 53%

YOU SAVE $2,105

Call Today for a UÊÊ œ>À`‡ViÀ̈wi`Ê-ÊÃÕÀ}iœ˜ÃÊiÝVÕÈÛiÞÊ`i`ˆV>Ìi`Ê̜ÊÊ 212.759.9617 >ÃiÀÊ6ˆÃˆœ˜Ê œÀÀiV̈œ˜ FREE consultation! UÊxä]äääʳÊ-Ê-ÕÀ}iÀˆiÃÊ«iÀvœÀ“i` UÊ/Àˆ‡ÃÌ>Ìi½Ãʜ˜ÞÊVi˜ÌiÀÊ܈̅Ê{Ê`ˆvviÀi˜Ìʏ>ÃiÀÃÊ̜ÊLiÃÌÊVÕÃ̜“ˆâiÊޜÕÀÊ- www.SeeLasik.com

* Special offer valid with this ad only. The offer is good for Standard Lasik. Additional fee for Custom & Bladeless Lasik. Some restrictions may apply.


MUSIC

25 !VAILABLE-ARCHth - 23RD

FREE PANDORA

BRACE L E T /2"!.', % 7)4(9/520!.$/2!052#(!3% /&/2-/2%

STARS IN STRYPES

All the young dudes: The Strypes are, from left, Josh McClorey, Ross Farrelly, Evan Walsh and Pete O’Hanlon.

Smells like teen spirit. One of the biggest buzzes coming out of SXSW came from a group whose oldest member is 18. In the 1998 Kurt Russell flick, “Soldier,� a group of infants are selected at birth and raised as soldiers. That just may be what’s going on with The Strypes, but instead of using every resource to educate the children in the school of warfare, somebody drilled it into these Irish kids to play the blues. Although the above scenario sounds like one with dystopian consequences, these teenagers cook. They sound like some of the best bands of the 1960s British Invasion, music that one wouldn’t normally think teenagers would have interest in, let alone be able to master. “I suppose we’re all from musical households and our parents all play, so we all had a natural inclination toward music growing up,� says 17-year-old drummer Evan Walsh, who is the most outspoken member of the group when we

Titles and names

Strypes on Stryper When we mention to the band that an y other group of teenagers might call their album, “Snapchat� instead of “Snapshot,� Walsh is quick to snap back. “I think it sounds funny when people make dated references to things,� he says. “I mean, in the

meet them at the SXSW Music Conference. The band’s U.S. debut of “Snapshot,� comes out Tuesday. It’s packed with a dozen stylized and adrenalized tracks, but they’re arguably best experienced live, where 18-year-old guitarist Josh McClorey can let the leads really rip. The band carry themselves with swagger and dress like mods, in sharp blazers ornamented with buttons of their favorite bands on the lapels. Ask Walsh about his Dr. Feelgood button, and it gets the whole band on a roll about the merits of this 1970s pub rock band that most teenagers probably don’t even know about. “Initially we got into these bands through the early Rolling Stones, and

DRINK WATER WITH 3000% MORE ENERGY

FREWEater d Bottle PLE! M A S .296.0214 570

...the ONLY WATER that produces ENERGY!! The KEY to FREE ENERGY that your purchase will fund!

FREE WATER

Dept of Environmental Quality (DEQ): Removing even the smell of pathogens (municipal letters) with our home machine repurifying 100’s of times/gal (not ONCE!!) VIDEO PROOF:

/ PAT HEALY

Add only 20 drops to ordinary low energy water that can’t stop disease!

800 433-9553 | johnellis.com

’80s, people didn’t go, ‘I was looking through my Filofax’ in songs, so why would we go, ‘I was on Twitter’?� Since they seem to know their history so well, we ask their thoughts on the embarrassing Christian metal band with the name so similar to theirs, Stryper: “I’ve seen the name writ-

ten down, but I’ve never been intrigued by it,� says Walsh. McClorey says, either diplomatically or sarcastically, “How can Christian rock be an embarrassing thing?� We inform him of the hair, power ballads and bee-striped leather, and he seems to get it.

found the Yardbirds, Rockpile and Eddie and the Hot Rods,� says Walsh. “They were all white bands who were basically playing cover versions and originals inspired by that sort of stuff. So we got into those bands first and that led us back to people like Chuck Berry, Bo Diddley, Howlin’ Wolf and Muddy Waters. But the band members’ taste isn’t limited to blues. McClorey rattles off a list

of acts he had taken in and planned to take in at SXSW, and they include Damon Albarn, Kanye West, Jay Z and Snoop Dogg. “The blues was always around us, growing up,� says Walsh, “but so was a lot of the new wave and punk stuff too, like Johnny Thunders and The Clash.� PAT HEALY @metrousmusic

pat.healy@metro.us

METRO IS LOOKING TO HIRE THE BEST IN ADVERTISING SALES

The #1 free daily in the United States is growing like crazy and we need the best to join our team. Looking for sales representatives with media and online sales experience. Source: Scarborough R2 2013

CONTACT MEDIASALES@METRO.US

&REESTERLINGSILVER#LASPOR"ANGLE"RACELET53RETAILVALUE  7HILESUPPLIESLAST LIMITONEPERCUSTOMER#HARMSSOLDSEPARATELY 3EESTOREFORDETAILS

MARTINIQUE JEWELERS 750 7th!VEp.EW9ORK .9 "ETWEENth & 50th3TREET MARTINIQUEJEWELS AOLCOM WWWMARTINIQUEJEWELERSCOM JEWELERS IN TIMES !-q0-pDAYSAWEEK SQUARE SINCE 1963 


www.metro.us Tuesday, March 18, 2014

TELEVISION

26

‘Chasing Maria Menounos’ gives fans an ‘Extra’ look TV. The host’s new reality show premieres tonight.

“Chasing Maria Menounos� premieres tonight at 10 on Oxygen. / GETTY IMAGES

“Chasing Maria Menounos� goes inside the mind and heart of the “Extra� host as she attempts to balance her career with family life. The show will chronicle Menounos’ experiences with her boyfriend of 15 years, Keven Undergaro, and traditional Greek immigrant parents, Costas and Litsa, who want her to get married and have children. As she turns 35, her parents’ desire for Menounos to settle down is stronger than ever. Though she respects her family and boyfriend’s opinions, she contemplates whether she can support her parents and the friends who depend on her while building a family with Keven and

still having some fun. “It’s really tough because I feel like more than ever women are in the same kind of boat as me,� Menounos says. “We really don’t know when the right time is and we’re really excited by our careers. We want to prolong it more than ever.� The show also offers a glimpse into the less glamorous aspects of stardom. Menounos notes that one night she may be dressed up for the Oscars, and the next night she’ll be at Chili’s with her family. “There’s the me that works in this business, and then there’s the real me that is outside of that,� Menounos says. “I enjoy the perks of all of this, but there’s a reality to it, too.� Menounos is also excited to show viewers her Greek family. “I think it’s nice to see a traditional Greek family

Quoted

“I’ve known what I’ve wanted to do since I was really young. And I’ve worked really hard to run through every open door and work really hard and make good choices.�

at home,� Menounos says. “I think it’s nice to see someone who made it in this town and stayed in the same relationship they came in with. I don’t think you see that very often.� Menounos’ boyfriend Keven, who will venture into the spotlight for the first time on the show, also says that viewers will enjoy the peek into their life. “I think seeing our family, it’s aspirational,� Undergaro says. “I think a lot of people dream to do better in life. It’s nice to know that you can get there and have better things, but that you can still all be close and you still have the same problems that you had when you were a family back in the neighborhood.� For Menounos, home is a place to relax and get away from her hectic life. “I love being at home with Keven and the dogs and my parents,� she says. “And I love cooking. I love watching movies. I love going to the beach.� She’s just a regular girl — with an “Extra�-ordinary life. MAX PRINZ @metronewyork letters@metro.us

Menounos

G SKINNY & Reduce Cellulite GET PAINLESSLY & PERMANENTLY P Zerona buy 6 for $399 Fat Blaster DBWJMJQP get 6 free lose 3-9 inches NFMUGBUUJHIUFOBOZ in 2 weeks body part $50 Spa Special* t$PMMBHFO"OUJ Aging Facial t5FFUI8IJUFOJOH

t.JDSPEFSNBCSBTJPO t%FFQ1PSF'BDJBM t4MJNNJOH#PEZ 8JUI&YUSBDUJPOT 8SBQX.JOJ'BDJBM

$20 Specials* Choose From: $ t. t.BOJDVSF1FEJDVSF t#BDLPS$IFTU8BY t#

t'VMM-FH8BY t#SB[JMJBO8BY

t(FOUMF8BWF3FEVDFT Eye Discoloration

T ThermageŽ Non-Surgical One Time Treatment TThermageŽ Face – Only $899. Reduce wrinkles and tightens skin in one treatment

TThermageŽ Eyes – Only $399. Lift sagging eyes, reduce crows feet or reduce eye bags

TThermageŽ Body – Only $899. Melt fat and tighten knees, 1/2 arms, stomach, bra area or inner leg

50

$

MBTFSIBJSSFNPWBM choose from lip, chin, cheek, VOEFSBSN IBOETĂśOHFST  GFFUUPFTPSOFDLBSFB

$99

fractional laser reduce acne scars, stretch NBSLT XSJOLMFTĂśOFMJOFT

$199

anti-aging treatment

**"MMTQFDJBMPòFSTFYQJSF "M UI"WF4PVUIt/FX:PSLt   UI <CFUXFFO1FSSZ4U8FTUUI4U> <<C CFUXFF

XXXOZMBTFSOFUt0QFOEBZTBXFFL XXX Free consultation co

clear+brilliant 1SFWFOUTTJHOTPGBHJOH *NQSPWFUPOFBOEUFYUVSF  reduces dark pigmentation and reduction of pores


TELEVISION

27

TV Watch list

REALITY

“A friend recommended USA Vein Clinics. My only regret is that I didn’t do it sooner!”

‘Chrisley Knows Best’ Atlanta multimillionaire Todd Chrisley can be described as a bit brash and outspoken. This “patriarch of perfection” — a father of five — is sure he has the answer to everything. Tonight, daughter Lindsie recovers from breast implant surgery while Chrisley attempts to bond with her husband. As he would say, “been there, done it, got the T-shirt.”

Nataliya L., USA Vein Clinics Patient

Todd Chrisley is definitely the king of his castle. / GETTY IMAGES

10 P.M., USA

DRAMA

‘Supernatural’ Tonight’s episode, “Blade Runners,” features a cameo from none other than Nicole “Snooki” Polizzi — and she’s a long way from the Jersey Shore. Sam and Dean need help finding the First Blade after Crowley falls off the wagon

and injects himself with human blood. What could be worse? Maybe the fact that an untrustworthy demon (is there any other kind?) played by Rebecca Marshall wants to lend a hand. 9 P.M., CW

‘Glee’

with both current and alumni members of New Directions celebrating by reinventing their favorite performances from the series. Quinn, Puck and even the crazy April Rhodes will appear as the gang pays homage to Finn Hudson — the character played by the late Cory Monteith. Every Gleek should have a box of tissues ready for this one.

It’s the 100th episode,

8 P.M., FOX ALEXANDRA KACHAPURIDZE

COMEDY

Besides being unsightly and uncomfortable, varicose veins can be a warning sign of a condition called Venous Insufficiency that claims over half a million lives each year.

Are you HIV+ and not taking HIV medications?

Do you have any of these symptoms?

Varicose Veins Spider Veins Itching and Burning Leg Pain and Cramps Heaviness and Swelling Skin Discoloration Ulcers and Blood Clots Difficulty Walking Long Distances

Researchers at Rockefeller University are testing the safety of a new investigational antibody directed against HIV.

USA Vein Clinics Will help!

You may be eligible if you: ‡ Are HIV positive ‡ Are between the ages of 18-65 ‡ Are not taking HIV medications ‡

Put an end to painful varicose veins and swollen legs! Our non-surgical, painless and minimally invasive procedure only takes 15 minutes! Medicare and most

insurances accepted! Don’t trust your legs to just anyone... USA Vein Clinics are the nations ONLY coast-to-coast vein clinics. Our staff includes Board-Certified Harvard and Stanford-trained Specialists, and we’ve been named ”Best Vein Center” and “Leader in Health Care” five times...Call Today!

Participation involves: ‡ Receiving investigational antibody ‡ Blood work ‡ One over night stay and up to 16 outpatient visits Compensation is provided for participation. To learn more, contact our Recruitment Specialist at 1-800-RUCARES or email us at RUCARES@Rockefeller.edu

(917) 717-5135 Open Saturdays

New York: 1153 First Avenue, Manhattan, NY 10065 2511 Ocean Ave, Ste 102, Brooklyn, NY 11229 2444 86th St, Ste A, Bensonhurst, NY 11214 116-02 Queens Blvd, Forest Hills, NY 11375

New Jersey: 766 Shrewsbury Ave, Ste 300, Tinton Falls, NJ 07724 *i˜˜ÃޏÛ>˜ˆ>ÊUÊ>ÃÃ>V…ÕÃiÌÌÃ


www.metro.us Tuesday, March 18, 2014

BOOKS

‘You Should Have Known’ will change the way you think Books. “Admission” author Jean Hanff Korelitz has a new book about the moments when we should have been paying a little more attention.

Most people pride themselves on knowing when someone is lying. When we hear about former New York Gov. Eliot Spitzer’s outrageous illicit affairs or Bernie Madoff’s massive Ponzi scheme, we look at their smart and stylish wives and think, “She must have known, right? How could she not have?” This “should have known” belief is the idea behind Jean Hanff Korelitz’s latest novel. The book’s protagonist is Grace, a therapist living the life she’s always wanted. Married to a sympathetic pediatric oncologist, she has an intelligent and respectful son and has just written a highly anticipated self-help book cautioning women to hear what men are telling them at the very beginning of a relationship. But when Grace’s husband goes

missing and she finds herself in the middle of a media frenzy, she’s left wondering how she could have missed her own advice. According to Korelitz, you’d be surprised how many smart women have their own “should have known” moment. “The British publisher asked everyone who worked at the publishing company to submit their ‘should have known’ moments, and I got to pick the winner. These women are very, very smart. They’re working for this great publisher, yet they all seem to have some story where you wanted to look at them and think, ‘Really? Really?’” The winner of the aforementioned contest was a woman who went on a first date with a guy who told her that he saw sexuality as free-flowing

TRAINING THAT’S ON-POINT TO HELPING PEOPLE FEEL BETTER ACUPUNCTURE PROGRAM Our unique course of study teaches a complete patient approach to well-being by incorporating traditional East Asian and integrative medicine.

Register Now! 1.888.494.5018 Holistic Nursing Open House

All Program Info Session

Tues., March 18th | 4:00-5:00pm

Thur., March 20th 1:30-3:30pm

Manhattan Campus 110 William Street, 19th Floor Other campus locations in Chicago and San Diego

www.pacificcollege.edu/newstudent Financial Aid for those who qualify. Pacific College of Oriental Medicine’s MSTOM programs are accredited by ACAOM. The college and all its programs are approved by New York State Education Department. All programs, with the exception of the DAOM, are accredited by ACCSC. For important information on program costs, completion and placement rates, median debt incurred, etc., please visit www.pacificcollege.edu/programinformation and click on the program of your interest.

Jean Hanff Korelitz is also the author of “Admission,” which became a film. / MARK CZAJKOWSKI

and not something you can put in a box. “She dated him for years and, of course, he turned out to be gay,” Korelitz muses. Like Korelitz’s other novels — among them

“Admission” — this one is about a smart, independent woman who isn’t entirely likeable. “Every single one of my novels starts with a woman who seems to have her s— to-

28

If you go

Author reading Tonight, 6 The Corner Bookstore 1313 Madison Ave. 212-831-3554

gether but is destroyed by the middle or end of the book,” she says. “If this is an unconscious choice, it’s so unconscious that it might as well be conscious. It’s an overwhelming comparative, almost, to look at these women and basically take them apart and strip them down and see what’s left.” At the end of this novel, the principal character is a much different woman than the one you meet at the beginning of the book. You might also be changed after finishing “You Should Have Known” — a little more discerning, a little more aware and a little less critical of those wives the camera pans to during the next high-profile press conference. EMILY LAURENCE @EmLaurence

emily.laurence@metro.us


See more at www.metro.us

TRAVEL TR R

29

Taking a shine to southern Portugal

+ PLUS Tip

Getting there

The Algarve gets more than 300 days of sun annually. / ALL PHOTOS CHRIS BUDZILOWICZ

Destinations. Long known among Europeans as a year-round holiday locale, the Algarve is finally getting the attention it deserves from the rest of us.

The Algarve is easily accessible from Lisbon airport. From there, you can take the major highways or enjoy a backroad amble along the coast. If you want to sample the city before relaxing on the coast, Martinhal offers an eight-day package beginning at the Four Seasons Hotel Ritz Lisbon and ending in the Algarve. For rates and information, email res@martinhal.com.

Martinhal’s guests enjoy fresh fish pulled daily from the bay.

During the Age of Discovery, a small but mighty Portugal sent out ships to explore Africa, Asia and what was then called the New World (that’s us!). Now it’s time for us to return the favor. Although burdened by the recent economic problems, Portugal hasn’t wavered as a destination for savvy European travelers seeking sun, fresh seafood and a knockout coastline — one of few in the world from which you can see the sun rise and set over the ocean. Lately, the Algarve region on the southern coast is coming into its own. Bordered by miles of protected beaches, the Algarve maintains balmy temperatures year-round — sometimes reaching the 70s in the winter — and averages 300 days of sun annually. Until recently, the Algarve was known mostly to hippie caravaners chasing surf conditions along the coast. And you’ll still find plenty of them there. But you’ll also start to see more families seeking an affordable and unique holiday. And don’t worry — you won’t have to sleep on the beach. Anchoring new development in the Algarve is Martinhal Beach Resort & Hotel (www.martinhal.com), an

MARTINHAL BEACH RESORT & HOTEL WAS DESIGNED TO HIGHLIGHT THE NATURAL LANDSCAPE.

Relax

Magic hour A day on the Algarve ends best by watching the sun set over the ocean. Crowds usually form at Cabo de São Vicente, the southwesternmost point in Portugal. But in the spirit of discovery, we recommend grabbing a bottle of Portuguese wine and finding your own viewing spot in one of the many beach coves on the west coast.

award-winning seaside resort known as much for its sophisticated design as for its family-friendliness. After opening in 2010, Martinhal soon stood out as an affordable luxury destination that still retains hyper-regional charm. In designing the resort, owner Chitra Stern and her husband made it a priority to sustain the natural integrity of the Algarve. “It’s our responsibility to our chil-

dren to do that,” she tells us. Martinhal’s architecture is carefully integrated into the natural landscape, and its restaurants serve only local wine and fish pulled from the bay below. Stern calls it “the freshest fish in the world.” Moreover, Martinhal is one of those rare places where children and adults can enjoy themselves both together and on their own. After having her own children, Stern realized that few vacations truly accommodate every member of the family, so she designed programs at Martinhal that keep kids (from babies to teens) engaged while parents do their own thing. “We try to create moments for everyone in the family,” says Stern. With Martinhal as a base, you can explore the Algarve on trail bikes with a guided tour through small villages and across coastal cliffs. Wind-surfing and scuba-diving lessons are available right in Martinhal’s bay. REBECCA FINKEL @metronewyork letters@metro.us

APPLY NOW

2014 - 2015

K, 1st, & 2nd GRADE STUDENTS CWC Williamsburg

(718) 384-1386

OPEN HOUSE! Jan 30, Feb 13, Mar 6, Mar 20

6:00 - 7:00 pm

Apply online at www.cwc-williamsburg.org At CWC Williamsburg your child will receive: + A free progressive education within a diverse school setting; + Small class size where all students receive individualized attention; + 7ZRFHUWLÀHGWHDFKHUV in every room; + Art, music, dance, and yoga instruction for all students; + $IWHUVFKRROHQULFKPHQW program until 5:45pm; + Pupil transportationSURYLGHGWKURXJKWKH1<&2IÀFHRI Pupil Transportation. Citizens of the World Williamsburg Charter School 424 Leonard Street, 3rd Floor, Brooklyn, NY 11222 Email: enroll.williamsburg@cwc-newyork.org

We are located across the street from McCarren Park, 2 blocks from the G train at Nassau, and 10 minutes from the L train at Lorimer.


www.metro.us Tuesday, March 18, 2014

PARENTING

From screen time to stage time Interview. What do you do after you conquer Facebook, book publishing and parenthood? If you are Randi Zuckerberg, you head to Broadway.

30

Since Randi Zuckerberg left Facebook in 2011, she’s started the media empire Dot Complicated, released a book by that name and, oh yeah, had a baby. Now she’s expanding her philosophy of untangling our wired lives by releasing the children’s book “Dot.” She’s also gearing up for her big Broadway debut in “Rock of Ages.” We catch up with her to talk parenting and managing screen time. What made you want to write a children’s book? I have a son who is almost 3, and everywhere I went — whether it was speaking at a professional business conference or at my son’s preschool — all the parents were talking about screen time. Parents want to make sure their kids are getting enough screen time to be competitive with other kids, but they didn’t want them to have too much. I thought, “Here I am writing a book about how tech has made our lives both so wonderful and complicated for adults, but it really starts much younger.” That’s so true. Even 2-yearolds will try and swipe something like it’s an iPhone. Absolutely! Kids absorb things so easily starting very young. As parents, we can make all these rules until we’re blue in the face,

but I thought if there was a techie young child other kids could relate to going through fun adventures, maybe it would stick. And even though I have a son, I chose to make the main character a girl because I think we could really use more techie girl characters in pop culture, especially for young children. How can parents strike the right balance with screen time? There are a lot of really excellent apps out there that encourage creativity, love for music, love for reading and love for art. They can use tech in ways we could never imagine when we were young, and I think that’s really positive in children’s lives. Where

I start to get [worried] is when tech just replaces the television and becomes a passive medium. You mean sticking a child in front of an iPad to watch a video? Right. But I also live in the real world and understand that it happens sometimes. I’ve had a night where it was just a really long day and I just wanted to have a conversation with my husband, so I gave my son a movie to watch on my iPad. As parents, we already beat ourselves up too much, and tech is an area where you can really cut yourself some slack. EMILY LAURENCE @EmLaurence emily.laurence@metro.us

On Broadway

Rockin’ out in ‘Rock of Ages’

See Randi Zuckerberg in “Rock of Ages” until March 30 at the Helen Hayes Theatre. / PROVIDED

LEXINGTON FOOT, ANKLE & VEIN FREE CONSULTATIONS & FINANCING AVAILABLE TWO LOCATIONS FOR YOUR CONVENIENCE

“If you were to ask me when I was in elementary school what my dream in life was, I would have said that it was my dream to sing on Broadway. … Your dreams come back

to find you sometimes,” says Zuckerberg about her unlikely new role on Broadway’s “Rock of Ages” (she is cast as Regina, a community leader). Zuckerberg says the show’s producers approached her after she gave a talk at TEDxBroad-

way about how Broadway could embrace digital media. “[The producers] thought it would be cool to celebrate their fans using digital and social media. They looked up my TED talk and decided they wanted to invite me to be a part of the show.”

Most e nc Insura ted p Acce

SPECIALIZING IN…

1-888-825-1666 w w w. L e x i n g t o n FAV. c o m NEW YORK: %ASTTH3TREET .EW9ORK .9

NEW JERSEY: 2OSEVILLE!VENUE .EWARK .*

Before

s2ECONSTRUCTIVE&OOTAND!NKLE3URGERY s"UNIONAND(AMMERTOE#ORRECTION s$IABETIC&OOT#ARE s3PORTS)NJURIES s4ENDON2EPAIRs(EEL0AIN After s-ANAGEMENTOF!RTHRITIS s!NKLE2EPLACEMENT3URGERY “After 7 years, I can finally s3PIDER6EINSAND6ARICOSE6EINS wear heels again” - C. Stephen


PARENTING

31

The facts. What you need to know about special needs kids. Raising a child with special needs can feel like a lonely road for parents, but they have plenty of company. The April issue of Parents magazine published the results of an extensive survey of families with specialneeds children as part of a 20-page report, “Life in a Special-Needs World.” The data shows that nearly one in six kids in the U.S. has special needs. The guide aims to answer some of the most frequently asked questions by parents and give them a little peace of mind. Having a conversation with your child about how he or she is different from other kids is a difficult but

necessary task; 73 percent of the parents surveyed have talked with their child about it. But differences aside, 89 percent of parents with special-needs children feel like their child has a good group of friends, an even higher number than the 79 percent of parents of children without special needs. Most (76 percent) also feel that their child’s school is doing an adequate job of addressing his or her needs. These are just a few of the findings, pulled from 500 moms who have children between the ages of 3 and 12. To read the full survey, check out the April issue of Parents magazine, out now. EMILY LAURENCE

Nearly one in six kids has special needs.

/ COLOURBOX

Are your child's immunizations up to date?

Shotsor

Spots

Fun family event

Children’s Film Festival The New York Children’s International Film Festival is currently going on and if you haven’t gotten your tickets yet, you’re going to want to get them before next Saturday, March 22. One of the film festival’s biggest events is taking place: a special 3-D showing of “Walking With Dinosaurs,” which is coming out on DVD and Blue-ray March 25. The mix of liveaction footage

Call your child’s doctor today! “WALKING WITH DINOSAURS” IS ONE OF THE HIGHLIGHTS AT THE FILM FESTIVAL.

and computer animation give a really realistic look. The “Walking With Dinosaurs” showing will take place at the IFC Center Theater, but events are also taking place at Village East Theater, Tribeca Cinemas, DGA Theater and Scholastic so you can choose a location closest to you and see what’s going on. The festival is taking place until the end of the month showing a mix of 3-D movies, animation, musicals and more made from filmmakers around the world. For more info, go to gkids. tv/intheaters. cfm. EMILY LAURENCE

ISTOCKPHOTO

Fidelis Care is working to keep our members and the community healthy. Measles and Chickenpox are just two of the diseases that you can prevent by having your child immunized. Children under the age of 2 don't have all the defenses they need to fight off infection. Immunizations (shots) protect them from dangerous childhood diseases like: • Whooping Cough

• Mumps

• Polio

• Hepatitis

• Diphtheria

• Measles

• Rotavirus

• Flu

• Chickenpox

• Tetanus and more...

Is Your Child Covered? Fidelis Care offers New York State sponsored free or low-cost health insurance coverage for children under 19 through the Child Health Plus program.

1-888-FIDELIS

• fideliscare.org

(1-888-343-3547) | Some children who had employer-based health insurance coverage within the past three months may be subject to a waiting period before they can enroll in Child Health Plus. This will depend on your household income and the reason your children lost employer-based coverage.


15

www.metro.us Tuesday, March 18, 2014

Cry Translator For: iOs Price: $4.99 Weâ&#x20AC;&#x2122;ve all been there. Youâ&#x20AC;&#x2122;re out in public with your baby, and then the wailing starts. Youâ&#x20AC;&#x2122;re willing to do anything to make it stop, including handing over your phone so your kid can play whatever game he or she wants to. Donâ&#x20AC;&#x2122;t panic, keep your phone and

WebMD Baby

2

For: iOs and Android Price: Free Chances are you already turn to WebMD every time your child gets a weird rash or has a cough, but

$1

the WebMD baby app is so much more than a symptom-checker. You can actually use it to manage sleeping and feeding times as well as track growth. Just tell the app your childâ&#x20AC;&#x2122;s age and youâ&#x20AC;&#x2122;ll get new articles about his or

Must-have parenting apps

her peer group each week as well as a new doctorapproved tip each day.

GPS Tracker Pro

Whether youâ&#x20AC;&#x2122;re trying to ďŹ gure out why the heck your baby wonâ&#x20AC;&#x2122;t stop crying or are looking for a digital pediatrician so you can give your real one a break, here are ďŹ ve parenting secret weapons to keep in your back pocket. EMILY LAURENCE

3 4 5

For: Android Price: Free If you have a tween or teen, this app is a must. It tells you where he or she is roaming around the city by tracking his or her cellphone. You can also input boundaries and get notiďŹ cations if your wandering child goes outside of them. That will put an end to those â&#x20AC;&#x153;where were youâ&#x20AC;? questions!

(w/Check-up and Cleaning*) *covered by your PPO Dental Plan

Intuition+: Momâ&#x20AC;&#x2122;s Personal Assistant

Up to 12 Shades Whiter in just 1 hour Call (212) 537-6923 - Open Weekends and Evenings 30 East 40th 3TsBLOCKFROM'RAND#ENTRAL3TATION 0H  sWWW:OOMFORCOM H[S

For: iOs Price: Free Stay on top of your schedule and your kidsâ&#x20AC;&#x2122; schedules with this handy organizer. You can give each family member or type of activity (doctorâ&#x20AC;&#x2122;s appointment, violin lessons, day care) a diďŹ&#x20AC;erent color. There are also places to keep your recipes, shopping lists and other important info.

SitORSquat: Bathroom Finder

You Donâ&#x20AC;&#x2122;t Need Braces To Have a Beautiful Smile. You Need OrthoSnap. STARTING AT $1,500 FINANCING AVAILABLE

UĂ&#x160; Â&#x153;Â&#x2DC;Ă&#x203A;iÂ&#x2DC;Â&#x2C6;iÂ&#x2DC;Ă&#x152; UĂ&#x160; Â&#x153;Â&#x201C;vÂ&#x153;Ă&#x20AC;Ă&#x152;>LÂ?i UĂ&#x160;>Ă&#x20AC;`Â?Ă&#x17E;Ă&#x160; Â&#x153;Ă&#x152;Â&#x2C6;V>LÂ?i

32

download Cry Translator. This app analyzes a babyâ&#x20AC;&#x2122;s cry and tells you what he or she wants, and gives helpful suggestions. And thankfully, it only takes 10 seconds. In a clinical test, babies stopped crying 96 percent of the time after parents took the appâ&#x20AC;&#x2122;s suggestions.

Laser Teeth Whitening

Dr. Irina Feldbein

PARENTING

For: iOS Price: Free You know how kids are: When they have to go, they have to go. Youâ&#x20AC;&#x2122;ll no longer be caught searching for a bathroom thanks to this Charmin-fueled app. It helpfully pulls up a map of all the public bathrooms near you. Weâ&#x20AC;&#x2122;re sure this app has prevented a lot of accidents.

Sumayah Jamal, M.D.- PhD.

", Ă&#x160;

/ ,

UĂ&#x160;vvÂ&#x153;Ă&#x20AC;`>LÂ?i UĂ&#x160;Ă&#x160; Â?i>Ă&#x20AC;Ă&#x160;,iĂ&#x192;Ă&#x2022;Â?Ă&#x152;Ă&#x192;Ă&#x160;Â&#x2C6;Â&#x2DC;Ă&#x160; ,iVÂ&#x153;Ă&#x20AC;`Ă&#x160;/Â&#x2C6;Â&#x201C;i

Free Consultation 7Ă&#x160; Â&#x153;Â&#x201C;ÂŤÂ?iĂ&#x152;iĂ&#x160;/iiĂ&#x152;Â&#x2026;Ă&#x160;-Ă&#x152;Ă&#x20AC;>Â&#x2C6;}Â&#x2026;Ă&#x152;iÂ&#x2DC;Â&#x2C6;Â&#x2DC;}Ă&#x160;7Â&#x2C6;Ă&#x152;Â&#x2026;Â&#x153;Ă&#x2022;Ă&#x152;Ă&#x160; Ă&#x20AC;>ViĂ&#x192; nÂ&#x2122;Ă&#x2021;Ă&#x160;*>Ă&#x20AC;Â&#x17D;Ă&#x160;Ă&#x203A;iÂ&#x2DC;Ă&#x2022;i]Ă&#x160; iĂ&#x153;Ă&#x160;9Â&#x153;Ă&#x20AC;Â&#x17D;]Ă&#x160; 9 ÂŁĂ&#x17D;Ă&#x17D;Ă&#x160;7iĂ&#x192;Ă&#x152;Ă&#x160; Â&#x2DC;`Ă&#x160;Ă&#x203A;iÂ&#x2DC;Ă&#x2022;i]Ă&#x160; Ă&#x20AC;Â&#x153;Â&#x153;Â&#x17D;Â?Ă&#x17E;Â&#x2DC;]Ă&#x160; 9

1-844-OrthoSnap 1-844-678-4676

www.OrthoSnapNY.com

CLINICAL ASSISTANT PROFESSOR OF DERMATOLOGY NYU LANGONE MEDICAL CENTER Laser Surgery, Cosmetic and Medical Dermatology Laser treatments for: U High speed hair removal-safe for all skin types. U Razor bumps. U Acne, depressed acne scarring, enlarged pores. U Leg veins, facial veins, wrinkles. U Sagging skin on face, neck and abdomen. U Brown "age/liver" spots, red complexion, broken blood vessels. U Keloids.

Microdermabrasion and chemical peels for: U Acne, melasma, dark spots, uneven complexion. BOTOX for: U Frown lines, crowâ&#x20AC;&#x2122;s feet, forehead lines, perspiration. Radiesse and Juvederm for: U Laugh lines, lip enhancement, facial volume loss.

Ă&#x17E;Ă&#x160;>ÂŤÂŤÂ&#x153;Â&#x2C6;Â&#x2DC;Ă&#x152;Â&#x201C;iÂ&#x2DC;Ă&#x152;Ă&#x160;Â&#x153;Â&#x2DC;Â?Ă&#x17E;Ă&#x160;UĂ&#x160;(212) 229-0333 166 Fifth Ave. 2nd Flr btw. 21st and 22nd Subways #6, N.R.W.F.V to 23rd St., www.Doctorjamal.com

Read what our many happy patients have to say!

www.kerisderm.com/testimonials Call or make your appointment online at

www.zocdoc.com


LETTERS & GAMES Letters

Horoscope

Pisces | Feb. 19-March 20. You have the chance to correct a past mistake. A defensive or critical attitude will only make matters worse. Make amends.

Gemini | May 22-June 20. An opponent may try to catch you off guard. Maintain a pleasant attitude and don’t be coerced into a confrontation.

Aries | March 21-April 20. You will gain momentum if you stick to your plans and stay alert to new possibilities. Don’t feel compelled to share your ideas.

Cancer | June 21-July 22. Your domestic life will likely face upset. Focus on projects that will boost your confidence. Consider your options before you deal with an emotional dilemma.

Taurus | April 21-May 21. Do your best to help an older friend or relative in need of assistance. Your calmness and kindness will have a lasting effect on those you encounter.

Leo | July 23-Aug. 22. Although you are used to taking action, let someone else set the pace today. He or she may have a different approach to a problem.

Virgo | Aug. 23-Sept. 22. Multitask. Although your schedule may have you on the run, it will prepare you for the challenges ahead. Libra | Sept. 23-Oct. 22. Spend some alone time pursuing activities that make you think. Personal relationships may need an adjustment. Follow up on a creative project. Scorpio|Oct. 23-Nov. 21. A current situation is likely to confuse you. Do some fact-finding before you take action. Don’t feel the urge to gossip or share what you discover.

Sagittarius | Nov. 22Dec. 21. You may enjoy being in the spotlight, but while it may be flattering to have all eyes on you, it could damage a relationship with someone special. Capricorn | Dec. 22-Jan 20. An unusual request is apparent. You will benefit if you keep your emotions in check. Be honest and tactful. Aquarius | Jan. 21-Feb 18. Don’t give in to someone’s demands. It may be difficult, but you will have to maintain your own course of action. BERNICE BEDE OSOL

Sudoku: Easy and hard

8 4

33

9

2

9

2

4

1

3

6

1

4 4

7 2

6

4

9

8 7

9

6

9

5

6

6

4

3

8

9

8

1

7

9 2

2

5

8

4

9

8

5

7

3

9

9 7

6

2

4 5

3

8 1

2 4

6

5

5 2

4

How to play Fill in the grid so that every row, every column and every 3x3 box contains the digits 1-9. There is no math involved. You solve the puzzle with reasoning and logic.

Reagan did help world redecorate without the Iron Curtain

under the Obama administration, which is harassing patriotic Americans who sought to create 501 (C) 3 organizations. The comparison with the kings of Spain and France is erroneous and not applicable. DON SCHWARZ, VIA EMAIL

Re: ‘The people, not Reagan, broke up USSR’ (Metro, March 17) Letter writer Timothy Laren is mistaken in his assertion that Reagan had nothing to do with the breakup of the USSR. As examples, I give you Hungary in 1956 and Czechoslovakia in 1969. The people revolted but were crushed. Reagan increased the U.S. military budget and the oppressed people felt they had a friend in Reagan, and as such were more willing to speak truth to power. This is why people under communist domination were more willing to speak out for freedom — unlike

Ukraine never used WMDs against its own people. Further, it got rid of its WMDs in exchange for a now-broken promise from Russia never to invade. As to his other comments, Reagan ended the policy of appeasing the Soviets and his policies led to their economic weakness. He fully supported the oppressed (“Mr. Gorbachev, tear down this wall!”). JIM FLETCHER, VIA EMAIL

letters@metro.us Keep them as brief as possible, preferably under 100 words. Metro reserves the right to edit all letters. Please include your name and contact info.

Online You can use your smartphone to discover today’s crossword answers — right now! Download and open the Blippar app on your smartphone and hold the screen over the puzzle — it’s that easy!

ord w s s o Cr

Crossword

Across 1 Treaty 5 Stretch fabric 10 Uhura’s crewmate 14 Galaxy unit 15 — and aahed 16 Sin, cos or tan 17 Come down with 18 Brando’s birthplace 19 James -- Jones 20 Gone aloft 22 Justice (2 wds.) 24 Goes limp 25 Serengeti roamers 26 Darth’s daughter 28 Spoil (2 wds.) 32 Gold-rush town 35 Double helix 37 Professor’s goal 38 Scratch out a living 39 Gazing at 41 Lib. section 42 Rich, as farmland 45 — tai (rum drink) 46 Annoying insect 47 Market upswing 48 Not certain 50 Politician Tip — 54 Iowa commune 58 Set off 61 Far from demure 62 An energy source 63 More wise

65 — spumante 66 Secluded 67 Fill with happiness 68 Come across as 69 Author -- Bagnold 70 “Tangled Up in Blue” composer 71 “Voila!” (hyph.)

Down 1 “Humbug!” 2 Video-game pioneer 3 Quibble 4 Sawhorse, e.g. 5 Raucous diver 6 — Kippur 7 Rub the wrong way? 8 Therapy, in short 9 Robin of balladry 10 Crushes (2 wds.) 11 Russian river 12 Turkish money 13 Not attractive 21 WNW opposite 23 Current style 25 Wacky 27 — fixe 29 Forget the roast 30 Survey finding 31 Quick and sure 32 Get closer to 33 Creole veggie

34 Ground corn 36 Purpose 37 Week-ending cheer 40 Makeshift coathanger 43 Burst into flower 44 Singer Loretta — 46 Tumbler, e.g. 49 LAX regulators 51 Maneuvered slowly 52 Austria neighbor 53 Copier setting 55 Between ports (2 wds.) 56 Well-known 57 Feminine side 58 Carnegie or Evans 59 007’s school 60 Ms. Braxton 61 Nest builder 64 JFK info

Yesterday’s answer

As the world’s largest global newspaper, Metro has more than 18 million readers in more than 100 major cities in 23 countries. • • Metro New York 120 Broadway, New York, NY 10271 • main 212-457-7790 • to advertise 212-457-7735 • sales fax: 212-952-1505 • National and Executive Sales Director Ed Abrams • U.S. Circulation Director Joseph Lauletta • U.S. Marketing Director Wilf Maunoir • email sales advertising@metro.us • email distribution distribution@ metro.us • Advertisements appearing in Metro are published in good faith. Metro does not endorse and makes no representations about any of the advertising content appearing in its pages. Metro is not responsible for any loss or damages whatsoever resulting from readers using the services of its advertisers. Readers should exercise caution when replying to advertisements, especially those which require any form of payment, and, where necessary, should seek independent legal advice. • Editor in Chief Dorothy Robinson, dorothy.robinson@metro.us • Managing Editor/ Sports Editor Mark Osborne, mark.osborne@metro.us • National News Editor Jill Gadsby, jill.gadsby@metro.us • City Editor Allen Houston, allen.houston@metro.us • Features Editor, Music Editor Pat Healy, pat.healy@metro.us • Deputy Features Editor, Home/Style/Food Editor Tina Chadha, tina.chadha@metro.us • Entertainment Editor Alexandra Cavallo, alexandra.cavallo@metro.us • Film/Tech Editor Matt Prigge, matt.prigge@metro.us • Wellbeing/Going Out/Travel Editor Meredith Engel, meredith.engel@metro.us • Careers/Education/Dating Editor Julia Furlan, julia.furlan@metro.us • Copy Chief Tracie Michelle Murphy, tmichelle.murphy@metro.us


3 SPORTS

www.metro.us Tuesday, March 18, 2014

SPORTS

34

WELCOME TO #CHOPNATION

No early returns

Ellsbury to miss Sox game It’s just spring training, but it looks like Red Sox fans visiting Tampa Bay won’t get a chance to boo Jacoby Ellsbury in the first Yankees-Red Sox game this year. Ellsbury is dealing with a tight right calf suffered over the weekend. Manager Joe Girardi didn’t rule Ellsbury out entirely, but said “my guess would be no” when asked if he’d play Tuesday.

Watch online

Find video and recap of Monday night’s Nets-Suns game at: Metro.us/sports.

Rutgers fans have embraced social media as a way to draw top recruits to their school as they enter the cutthroat Big Ten next season. / GETTY IMAGES

NCAA. Rutgers fans have started a hashtag to influence recruits — taking one step into a murky realm. Rutgers football can’t compete against the likes of Penn State and Ohio State in terms of prestige, but on Twitter, Scarlet Knights fans are trying to be one step ahead. Jay Poole, a Rutgers graduate who majored in economics, is trying to help the football team by winning on social media. With nearly every recruit on Twitter these days, Poole saw other programs — especially ones in Rutgers’ future home in the Big Ten Conference — were working hard to push their school to possible players. Messages and tweets were sent from other college fanbases “showing love” as these prized teenage athletes call it. So Poole and other fans got fed up and created #CHOPNation. “The movement started in the wake of some of the more-recent recruiting struggles Rutgers has had.

We had just recently lost a 2015 recruit to Penn State after a tumultuous offseason that included plenty of decommits for the 2014 class,” Poole said. “There was a lot of self-reflection happening on the online Rutgers message board at Rivals.com. During that period of self-reflection there was a discussion over Twitter and whether or not we as fans had properly utilized it. In my mind, we never did utilize it to its full potential as there were only a few of us on Twitter, and those few of us

Quoted

“There is very little concern over recruiting violations from a fan’s perspective. This use of Twitter is so prevalent that the NCAA apparently doesn’t want to open [a] Pandora’s Box with it.” Jay Poole, on the NCAA policing fans trying to influence recruits via Twitter

were terribly disorganized. Schools much smaller than ours, such as Appalachian State, had organization on Twitter that allowed them to contact recruits quickly and effectively, something we were incapable of. So

I came up with the idea of using the hashtag of #CHOPNation and then asked for all of our fans’ Twitter handles.” There are now roughly 100 Twitter followers actively using the hashtag,

Pushing the rules Twitter and Facebook interaction with recruits is an area with very little NCAA monitoring as of yet. The rule only outlines “correspondence and telephone calls,” which only vaguely relate to social media. The official NCAA rule book reads as follows: •

General Rule. All in-person, on- and off-campus recruiting contacts with a prospective studentathlete or the prospective student-athlete’s relatives or legal guardians shall be made only by autho-

rized institutional staff members. Such contact, as well as correspondence and telephone calls, by representatives of an institution’s athletics interests is prohibited except as otherwise permitted in this section. Violations of this bylaw involving individuals other than a representative of an institution’s athletics interests shall be considered institutional violations per Constitution 2.8.1; however, such violations shall not affect the prospective studentathlete’s eligibility.

HEAD COACH KYLE FLOOD HAD RUTGERS RANKED THIRD BY RIVALS IN THE AAC IN RECRUITING LAST YEAR. GETTY IMAGES

with more being added each week. They tweet encouragement at the players and let them know the fanbase wants to see them on campus next year. The tag is born of the team’s “Keep chopping” slogan. It has caught on with those hoping to get offers. On the Friday before his unofficial visit to Rutgers in early March, recruit Alex Toplyn tweeted “Looking forward to my Rutgers visit tomorrow! #CHOPNation.” It is a new world, one the NCAA is still coming to grips with. Fans of major programs are just a tweet or a Facebook invite away from having access to players and attempting to lure them to their alma mater. It makes for a plethora of issues the NCAA has to work through. “A fan can follow and reply to a current studentathlete on Twitter, and can tweet generally about a current student-athlete or team,” said Emily James, associate director of Public and Media Relations for the NCAA. “However, fans [and] boosters cannot tweet about a prospective student-athlete.” KRISTIAN DYER @KristianRDyer sports@metro.us


SPORTS

Knicks, Anthony already talking Jackson transition NBA. Carmelo Anthony called the addition of Jackson “more attractive” to free agents — maybe even himself. The worst-kept secret in NBA history will officially be revealed Tuesday when the Knicks announce the hiring of Phil Jackson as the new head of basketball operations. What Jackson will say is still a mystery, but his future roster is already talking about the Pro Basketball Hall of Famer. The Knicks held practice Monday in preparation for a big game against the top-seeded Pacers on Wednesday, but most of the questions were about how Jackson will change

Presumably Jackson and Spike Lee won’t be so chummy if the Knicks don’t improve. / GETTY IMAGES

the club’s future. “As far as knowing what it takes to win, Phil is the best to ever do it,” Carmelo Anthony told reporters after practice. “So for me to be able to have the opportunity and have him by my side, for him

Quoted

“I’m hoping and praying this all works.” Carmelo Anthony On the hiring of Phil Jackson

His Airness speaks

Jordan supports Jackson hiring by Knicks Phil Jackson’s most famous pupil weighed in on the Knicks’ hiring and gave it a positive

JORDAN WON ALL SIX OF HIS TITLES WITH JACKSON AT THE HELM. GETTY IMAGES

review. Bobcats owner Michael Jordan spoke with ESPN, saying Jackson is “great.” “I know he can do it,” said Jordan, “so long as he has the necessary pieces in place.” METRO

to teach me, you know, because I’m still willing to learn the game of basketball.” Anthony also seems to have pulled a 180-degree turn since last week when he said Jackson’s hiring wouldn’t affect his deci-

35

No ticket available

KEVIN GARNETT

sion to leave the team in free agency this offseason. On Monday, he was more willing to adapt to Jackson’s future. “I’m willing to do whatever,” Anthony said. “As long as it’s gonna put me in a position to win, I’m willing to do whatever.” Anthony said the hiring of Jackson makes the Knicks more attractive to free agents — though the team won’t have much in the way of cap space until 2015. “For the big picture, this is definitely more attractive,” Anthony said. Kevin Love, LaMarcus Aldridge, Kyrie Irving and Roy Hibbert are among the stars who are free agents in 2015. MARK OSBORNE @MetroNYSports

mark.osborne@metro.us

GETTY IMAGES

Garnett to remain out rest of week The Nets have ruled out Kevin Garnett for the rest of the week, saying they will re-evaluate him on Saturday. Garnett hasn’t played since Feb. 27 against Denver due to back spasms. Monday night’s game against the Suns was the ninth straight game he’s sat out. The Nets play the Bobcats on Wednesday and Celtics on Friday, both at home. The team is 6-2 in the eight games he had missed going into Monday’s contest with Phoenix. METRO

WINTER SPECIAL $

*

395 Implant

+ post $545 + Crown $695

(Nobel Biocare ONLY $100 add’l) *Implant, post & crown must be completed at our office to qualify for promotional fees

Total complete tooth replacement

SPECIALIZING IN SURGERY AND AESTHETICS OF THE FOOT

$1635

DOWNTOWN PODIATRY SERVICES

Contemporary Dental Implant Centre

E

ER AFT

B

BEF

AFT

OR

ER

E

HAMMERTOE CORRECTION 1 - 877 - BUNION - 1ÊUʣʇÊnÇÇʇÊÓnÈʇÊ{ÈÈ£ www.DowntownPodiatry.com

MOST INSURANCE PLANS ACCEPTED Downtown Midtown 111 John St., Suite 1450

315 Madison Ave., Ste. 513

FREE CONSULTATION WITH THIS AD

ALL PHOTOS OF ACTUAL PATIENTS

Cutting Edge Means Less Cutting

R EFO

Valid from February 14, 2014 thru March 31, 2014

®

CONTEMPORARY DENTAL IMPLANT CENTRE

mention you saw us in Metro

8

Convenient Locations

Speak with your Smile Today!

41st & Mad Ave. Brooklyn, Rego Park Scarsdale, Smithtown Valley Stream Massapequa Park Stratford Ct

CT Scan-3D Views of the Jaw now available at our Madison Ave. location.

FREE CONSULTATION

Must bring in ad at the time of consultation.

Over 2,000 implants placed each year. Now Open in Stratford Connecticut REPLACE MISSING TEETH PERMANENTLY

CALL

212-269-9500 TODAY! WWW. CDImplants.com

Se Habla Español

OPEN 7 DAYS A WEEK


www.metro.us Tuesday, March 18, 2014

Slow and steady

Source: Jets management refuses to budge on high salary demands Despite being linked to multiple major names in free agency this offseason, the Jets havenâ&#x20AC;&#x2122;t whiffed on as many potential targets as one might think, a team executive tells us. Speaking on the condition of anonymity, the team executive reveals to us that while the Jets have engaged in talks with a number of high-profile free agent targets, they â&#x20AC;&#x153;refuse to budge from

their salary cap disciplines.â&#x20AC;? The source said the Jets evaluate a player on the field and will assign a salary range they are comfortable with for negotiations. â&#x20AC;&#x153;[We] will stick to that number, even if it means letting the player walk,â&#x20AC;? the executive said. â&#x20AC;&#x153;It doesnâ&#x20AC;&#x2122;t mean that we missed on all our targets. We didnâ&#x20AC;&#x2122;t. It just means that the targets didnâ&#x20AC;&#x2122;t make sense with what [general manager] John [Idzik] wants to do, and that is build depth and competition on both sides of the ball â&#x20AC;&#x201D; not just a few stars.â&#x20AC;? KRISTIAN DYER

DIRECTORY

Medical Research

To place an ad call Andrea Paz at 212-457-7831 or email andrea.paz@metro.us

SPORTS

Rodgers-Cromartie inks deal to join up with Giants NFL. The corner chose the Giants over the Jets. The New York football rivalry met at the bargaining table and the Giants got their man. Both local teams expressed interest in signing free agent cornerback Dominique RodgersCromartie, but it was the Giants who signed the veteran Monday. â&#x20AC;&#x153;I havenâ&#x20AC;&#x2122;t really found anywhere to just call

home for real,â&#x20AC;? said Rodgers-Cromartie, who has played for three teams in his six NFL seasons. â&#x20AC;&#x153;So if I can just settle down and find a place to be home, I know my best football is ahead of me.â&#x20AC;? He played for the AFC champion Broncos last season. Heâ&#x20AC;&#x2122;s had at least three interceptions in five of his six seasons, including three last year. He also has already played with safety Antrel Rolle in Arizona. The captain pushed for the Giants to sign him on Twitter Monday afternoon. METRO

4RIIALLS #LINICAL4 3EARCH#LINICAL4RIALS -EDICAL.EWS #HECK-EDICAL.EWS NDA#URE (ELP&INDA#URE Check out ourr NEW website:

ZipTrials.us als.us Powered ered by

Do you have

bipolar I disorder?

7DNHWKHÂżUVWVWHS 6HHLI\RXTXDOLI\ &DOOWRGD\IRUPRUH LQIRUPDWLRQ

%05

%HKDYLRUDO0HGLFDO5HVHDUFK

&XUUHQWO\RQWUHDWPHQWIRUELSRODU,GLVRUGHU" ,I\RXDUHEHLQJWUHDWHGIRUELSRODU,GLVRU GHUDQGV\PSWRPVDUHVWDEOHRU\RXIHHO GHSUHVVHG\RXPD\TXDOLI\WRWDNHSDUWLQD FOLQLFDOUHVHDUFKVWXG\ ,IHQUROOHG\RXZLOOUHFHLYH Â&#x2021; ,QYHVWLJDWLRQDOPHGLFLQH Â&#x2021; 6WXG\UHODWHGFDUHIURPDORFDOGRFWRU Â&#x2021; &RPSHQVDWLRQPD\EHDYDLODEOHIRU\RX WLPHDQGWUDYHO 7RTXDOLI\\RXPXVW Â&#x2021; %H\HDUVROG Â&#x2021; 7DNHPHGLFDWLRQIRU%LSRODU,GLVRUGHU



Get CERTIFIED in 3 DAYS

LQIR#EPUVLFRP_ZZZEPUVLFRP

DO YOU SUFFER FROM MIGRAINE HEADACHES?

MonteďŹ ore Medical Center You may be eligible to participate in a research study if you: s !REMALEORFEMALEAGEDYEARSOROVER s (AVEAHISTORYOFEXPERIENCINGATLEAST BUTNOTMORETHAN ACUTEMIGRAINEATTACKSMONTHLYDURINGTHEPREVIOUSYEAR s (AVEAHISTORYOFATLEASTMODERATEMIGRAINEPAININTENSITY IFLEFTUNTREATED

UĂ&#x160;Â&#x2C6;ÂŤÂ&#x153;Ă&#x192;Ă&#x2022;VĂ&#x152;Â&#x2C6;Â&#x153;Â&#x2DC;Ă&#x160;fĂ&#x17D;]xää OR UĂ&#x160; Â&#x153;Ă&#x152;Â&#x153;Ă?Ă&#x2030;Â&#x2C6;Â?Â?iĂ&#x20AC;Ă&#x192;Ă&#x160;fĂ&#x201C;]{ää OR UĂ&#x160;>Ă&#x192;iĂ&#x20AC;Ă&#x160;iĂ&#x192;Ă&#x152;Â&#x2026;iĂ&#x152;Â&#x2C6;VĂ&#x192;Ă&#x160;fÂŁ]nää

You may not participate in this study if you: s !REPREGNANTORBREASTFEEDING s (ADRECENTWITHINMONTHS HEADORNECKTRAUMAEG WHIPLASH s (AVEHEADORNECKPAINSECONDARYTOANORTHOPEDICABNORMALITY s (AVECLUSTERHEADACHES

Contact Information Mark Sollars, Study Coordinator MonteďŹ ore Headache Center Phone: (718) 405-8363 Email: csollars@monteďŹ ore.org

36

www.BHI.edu â&#x201D;&#x201A; (813) 855-4400 â&#x201D;&#x201A; www.3DVaser.com

Rodgers-Cromartie is the cousin of former Jets cornerback Antonio Cromartie. / GETTY IMAGES

Could you be suffering from low testosterone? Are you overweight? Do you have a lack of energy, changes in mood, low sex drive, or E.D? If so, you may be suffering from low testosterone. Physicians are currently looking for qualiďŹ ed men to participate in this clinical research study evaluating an investigational oral medication which may help the body produce its own natural levels of testosterone. In order to participate you must: "EAMALE TOYEARSOLDs(AVEEXPERIENCEDTHESYMPTOMSOFLOWTESTOSTERONEOR (AVEBEENDIAGNOSEDWITHLOWTESTOSTERONE Eligible study participants will receive study related exams, lab tests and study medication at no charge. Compensation for travel expenses may also be available. There will be a chance participants may receive placebo. For more information about this study, please call 917-409-3932


www.metro.us

TO ADVERTISE IN LEGAL & PROFESSIONAL SERVICES

DIVORCE $179 1-800-414-0333 TheDivorceCenter.com

BANKRUPTCY

LEGAL PROBLEM? I KNOW HOW TO WIN FOR YOU!

Not Sure Who to See for Bankruptcy? Want an Attorney Who Will Provide Friendly, Caring, Personal Service at a Low Price? Then Call

*AY3IMONs

Spouse's Signature Not Needed PLEASE CONTACT:

THOMAS FRANKE

212.457.7751 â&#x20AC;˘

THOMAS.FRANKE@METRO.US

Plus Court Fee - Without Children - With This Ad EXPIRES 3/31/2014

Construction Accidents?

Bankruptcy Only, Chapter 7 Specialist, Low Fee, One Set Fee, Installments, Personalized Attention, Free Consultation

The Bankruptcy Whisperer

ABSOLUTE

34!24).' !4 $219

DIVORCE

Call Now: 212-571-9200 &2%%#/.35,4!4)/.s./7)../&%%

!VAILABLEsMILLIONIN#LAIMS7).2!4%

äCOURTäFEES

Hablamos EspaĂąol

ä"ROADä3T äTHä&LOOR ä.9 ä.9ää   ä\äWWWABSOLUTEDIVORCEINCCOM

XXX'JHIU*OKVSZDPNÂ&#x2026;'FJOFS-BWZ 1$"UUPSOFZTBUMBX #SPBEXBZ /:/:

EspaĂąol

32 Court Street, Suite 805, Brooklyn

Joseph B. Maira, Esq., MAIRALAWOFFICE.COM, Cell 718-938-3728

Don't Be Fooled By Imposters

Must bring in ad Expires 3/31/2014.

"UUPSOFZ"EWFSUJTFNFOU

BANKRUPTCY

Over 60 Years of Experience

DINERMAN BERGAM & DINERMAN

917-783-0906 s $795+ Court Fees

8::@;<EK6

Free Consultation â&#x20AC;&#x153;I can help you get a fresh startâ&#x20AC;?

ALL ACCIDENT CASES HANDLED

Convenient evening appointments in Manhattan

#AR"US4RAINs3LIP4RIPAND&ALLs%LEVATORs2EAL%STATE

Flushing (QNS): 136-17 39th Ave., 3rd Fl, Flushing Manhattan: 116 West 23rd Street, 5th ďŹ&#x201A;oor

Howard S. Warner, Attorney

Debt relief agency. We help people ďŹ le for bankruptcy relief under the bankruptcy code. Evening and Sat appts available

ÂŁxäĂ&#x160; ," 79Ă&#x160; 9 Ă&#x160;UĂ&#x160;­Ă&#x201C;ÂŁĂ&#x201C;ÂŽĂ&#x160;Ă&#x201C;Ă&#x2C6;Ă&#x2021;Â&#x2021;Ă&#x2021;xĂ&#x2021;x ASK FOR MARIA

&REE#ONSULTATION

(ABLAMOS%SPAĂ&#x2014;OL

Spa & Massage Directory To place an ad call Mark Bonanni at 212.457.7754 or email MARK.BONANNI@METRO.US

Grand Opening!

$15 off

with this ad 212-243-1300 206 W 23rd St. (2F) Manhattan, NY 10011 open 9am-1am, 7 days a week

Tuesday, March 18, 2014

TO PLACE AN AD:

866-900-9473

EVERY WEEK, METRO REACHES 128,000 MORE ADULTS IN NEW YORK THAN AMNY

[Integrated Newspaper Audience - Metro: 1,509,438, amNY: 1,380,877] FOR ADVERTISING: advertising@metro.us or 212-457-7735

CLASSIFIEDS.METRO.US

CLASSIFIED AD DEADLINE: 5PM TWO (2) BUSINESS DAYS BEFORE PUBLICATION IMPORTANT INFORMATION: All classiďŹ ed advertising is subject to the terms and conditions of the applicable Metro ClassiďŹ ed rate card and to approval and acceptance at Metro U.S. option. Metro US reserves the right to edit, reject, cancel or reclassify an ad, and reserves the right to convert any classiďŹ ed advertising to alternative formats for use and publication in other Metro U.S. publications. It is the advertiserâ&#x20AC;&#x2122;s sole responsibility to check each ad the ďŹ rst day it is published. Metro U.S. assumes no responsibility for any reason, for any error or omission in any ad.

Miscellaneous

REDUCE YOUR CABLE BILL! Get an All-Digital Satellite System installed for FREE and programming starting at $19.99/mo. FREE HD/DVR upgrade for new callers,

SO CALL NOW 877-356-0526 SEARCH IT. FIND IT. BUY IT. 37 new york Tuesday, March 18, 2014

Careers

HIGH SCHOOL DIPLOMA FROM HOME 6-8 weeks accredited Get a Diploma! Get a Job!

No computer needed!! Call 24/7 for free brochure 1-800-264-8330

www.diplomafromhome.com Benjamin Franklin High School

TO PLACE AN AD CALL 866-900-9473

Psychic

KEKUTA AFRICAN PSYCHIC 646.577.7595 Can help you with Love & Relationships pbs, Reunite lovers, marriage, job,business, court Cases,evil,sickness, depression,bad luck, Black Magic, enemies,impotency, protection & more, Call now for a better tomorrow...

SHEIKH SALEEM 917.254.6647 MYSTICAL AFRICAN MEDIUM & SPIRITUALIST SOLVES ALL YOUR ISSUES, LOVE SPECIALIST, REUNITE LOVERS, BUSINESS, JOB, COURT, LUCK, BLACK MAGIC, PROTECTION, IMPOTENCY, IMMIGRATION, ETC. ENGLISH AND FRENCH SPEAKING. QUICK RESULTS www.africanmedium.com

Psychic

International Clairvoyant & Spiritual Healer MR. MADDY 917.754.8216 Problem with love life, Marriage, Relationship Bad luck, business, stress, Court cases, black magic, Career, Sexual Depression Etc. PRIVATE AND CONFIDENTIAL 100% GUARANTEED. DONâ&#x20AC;&#x2122;T SUFFER IN SILENCE

PROFESSOR SHEIKH IBRAHIM SPIRITUAL HEALER AND CLAIRVOYANT SPECIALIZE IN RELATIONSHIP, MARRIAGE & LOVED ONES, BREAK BLACK MAGIC, BAD LUCK, SUCCESS IN BUSINESS, JOB, EXAMS, DIVORCE, COURT CASES, IMMIGRATION, ETC SEEK HELP FROM MR IBRAHIM QUICK RESULTS GUARANTEED CALL NOW 212-316-0567 OR 646-659-7457

Psychic

Indian Astrologer Pandit: YOGANANDA

PERFECT GUIDENCE... ASSURED RESULTS. An Expert Astrologer tells Past, Present, & Future. Provide Solutions for issues like Love, Health, Depression, Job, Family, court, etc. 100% Removal of Black Magic, Jadoo, Vodoo, Evil Spirits, & Bad Luck by special Poojas & Worships. DONT WAIT, CALL TODAY GUARANTEED SOLUTIONS 104-12 115TH STREET Richmond Hill NY, 11419

You want a solution for all your problems? Mr Q, heâ&#x20AC;&#x2122;s a man of god. He can clear negatively, spiritual cleaning, stops witches, defeats your enemies, and offers powerful protection. Do you have problems with your relationships, family, property, court cases? Give me a call . Appt only. Mr. Qaadir 718-213-9945

Source: Scarborough 2013 R2

NEWYORKCLASSIFIEDS@METRO.US

IN PRINT & ONLINE

Psychic

WORLD RENOWNED SPIRITUALIST ASTROLOGER PANDIT: RAM SHANKAR

He can Clear Negativity. Future Life Events. Solves Impossible problems. Helps Bring back Loved ones. Family Problems, Health, Sexual, Depression, Drinking, Marriage, Evil Influences etc. NOBODY CAN BREAK MY WORK. GIVES UNBREAKABLE & UNACCESSIBLE PROTECTION. QUICK RESULTS GUARANTEED, BY APPOINTMENT ONLY 118-09 Liberty Ave. Richmond Hill, NY 11419 Inside AVON Beauty Supply, Private Office.

Psychic

International Clairvoyant & Spiritual Healer MR. MADDY 917.754.8216 Problem with love life, marriage, Relationship, bad luck,Business, stress, Court cases, black magic, Career, Sexual Depression etc. PRIVATE AND CONFIDENTIAL 100% GUARANTEED. DONT SUFFER IN SILENCE

SERIGNE 917-679-1518 Spiritual Reader & Coach bring back loved one, stopped infidelity in Relationship, marriage, fixed Domestic, issues, job,success in business, court case, removed bad luck, witchcraft, black magic. Stop enemy & offer protection. FAST RESULTS www.spiritualrestore.com

TO PLACE AN AD CALL 866-900-9473 OR VISIT US AT


Tuesday, March 18, 2014

TO PLACE AN AD:

866-900-9473

NEWYORKCLASSIFIEDS@METRO.US

CLASSIFIEDS.METRO.US

CLASSIFIED AD DEADLINE: 5PM TWO (2) BUSINESS DAYS BEFORE PUBLICATION Careers

Careers

Careers

BEST TRAINING BEST PRICE MEDICAL ASSISTANT

Psychic

Mr SHAMAN SPIRITUAL HEALER CALL NOW (347) 4745886 Natural born Psychic and spiritual healer

ÍťDÄ&#x17E;Ä&#x161;Ĺ?Ä?Ä&#x201A;ĹŻĆ?Ć?Ĺ?Ć?Ć&#x161;Ä&#x201A;ĹśĆ&#x161; Íť<'dÄ&#x17E;Ä?Ĺ&#x161;ĹśĹ?Ä?Ĺ?Ä&#x201A;Ĺś ÍťWĹ&#x161;ĹŻÄ&#x17E;Ä?Ĺ˝Ć&#x161;ŽžÇ&#x2021;dÄ&#x17E;Ä?Ĺ&#x161; ÍťDÄ&#x17E;Ä&#x161;Ĺ?Ä?Ä&#x201A;ĹŻĹ?ĹŻĹŻĹ?ĹśĹ? ÍťWĹ&#x161;Ä&#x201A;Ć&#x152;ĹľÄ&#x201A;Ä?Ç&#x2021;dÄ&#x17E;Ä?Ĺ&#x161;

....... CALL ....... $399 ....... $399 ....... $399 ....... $899

for a Low Price

COMPUTER TECH

ÍťWdÄ&#x17E;Ä?Ĺ&#x161;ĹśĹ?Ä?Ĺ?Ä&#x201A;ĹśÎ&#x20AC;нΠ............. $399 ÍťEÄ&#x17E;Ć&#x161;Ç Ĺ˝Ć&#x152;ĹŹĹ?ĹśĹ?ŽŜÄ?Ä&#x17E;Ć&#x2030;Ć&#x161;Ć?Î&#x20AC;EнΠ.. $399 ÍťEÄ&#x17E;Ć&#x161;Ç Ĺ˝Ć&#x152;ĹŹ^Ä&#x17E;Ä?ĆľĆ&#x152;Ĺ?Ć&#x161;Ç&#x2021;Î&#x20AC;^нΠ....... $399 Natural born Psychic and spiritual healer Are you suffering for love? are you tired of calling and never get a call back from that special person you love? is your love one ignoring you or neglecting you? Stop suffering call me now -------347 474 5886 ------CLIENT TESTIMONIALS: -Robert From Long Island: I own a restaurant and was having very serious money problems, i went to several psychics and they all told me that some body was doing black magic voodoo on my to ruin me, but nobody helped me, Mr Shaman saw me and he told me to stop paying money to psychic, he told me that there was not voodoo on me and that I was fine, the real problem in my business was an employee stealing money from me, thanks Mr Shaman For your help. -My husband was cheating on me and when i confronted him, he left me and run to the other woman, he humiliated me posting pictures with her and our kids on the internet, he rejected me for months, Mr Shaman Brought him back in less than 5 days, thanks Mr Shaman. Judith from Brooklyn. -My name is Sandra, I"m Italian and I came to see Mr shaman all the way from long island because the sales in my business where dropping dramatically, Mr Shaman saw that my exmother in law was doing witchcraft on me as revenge for leaving her son, who was an abusive man, thanks to Mr Shaman we where able to stop her, and my business is better than ever. -Hello My daughter was in a very bad relationship this man made her a drug addict, he used to hit her in the face, but she refused to leave him, I went to Mr Shaman with my wife, he help us and my daughter left this guy after only 2 days. ---------------------------------I HELP WITH Luck and money problems clean black magic spells get protection from enemies Court and legal problems REMOVE EVIL SPELLS from homes, business or persons ----Guaranteed Results-----**CALL NOW 347 474 5886 ** www.amazonianshaman.com Consultations in Manhattan and New Jersey

Ç Ç Ç Í&#x2DC;Ä&#x201A;Ä?Ä&#x17E;Ä?Ä&#x201A;Ć&#x152;Ä&#x17E;Ä&#x17E;Ć&#x152;Í&#x2DC;Ä&#x17E;Ä&#x161;Ćľ

ZÄ&#x17E;Ĺ?Ĺ?Ć?Ć&#x161;Ć&#x152;Ä&#x201A;Ć&#x;ŽŜĨÄ&#x17E;Ä&#x17E;Î&#x2DC;Ä?ŽŽŏÄ?Ĺ&#x161;Ä&#x201A;Ć&#x152;Ĺ?Ä&#x17E;Ć?Ä&#x201A;Ć&#x152;Ä&#x17E;ŜŽĆ&#x161;Ĺ?ĹśÄ?ĹŻĆľÄ&#x161;Ä&#x17E;Ä&#x161;

MANHATTAN

QUEENS

718-575-3223

ACE INSTITUTE OF TECHNOLOGY

Interested in the

Justice System?

PEST CONTROL/TERMITE LIC. 6/9 DAYS NY STATE APPROVED CERTIFICATION & RE-CERTIFICATION IN 7A/7F/8/3A/7C & JOB ASSISTANCE pestmanagementsciences@y ahoo.com CALL 24 HOURS. 1-800-220-5494 OR 718-205-0557

Â&#x2021;3$5$/(*$/ *$/ Â&#x2021;0(',&$/2)),&( 2)),& ) ( Â&#x2021;&/26('&$37,21,1* 63(&,$/,67 6 67 NEW 12 1 2/2* 2*< *< PROGRAM Â&#x2021;+($/7+,1)250$7,217(&+12/2*< (REALTIME WRITING)

NYCI HVWDEOLVKHG

NEW YORK CAREER INSTITUTE

Â&#x2039;;9(5:-,9 *9,+0;: (**,7;,+ Â&#x2039;=( (7796=,+

7KH&ROOHJHRI/HJDO 0HGLFDO3URIHVVLRQV

All Manhattan/Bronx

&ODVV 6WDUWV 0D\ WK

(QUROOLQJIRU1H[W7HUP

Call Â&#x2021;Â&#x2021;Â&#x2021;ZZZQ\FLHGX L G

Furnished Rooms For Rent! Cable/Internet Ready! Move In Today! All utilities Inc. Starting Just $125/wk. Call Us Now:(212)368-2685

'D\(YHQLQJ 6DWXUGD\&ODVVHVÂ&#x2021;'HJUHH &HUWLÂżFDWH3URJUDPV

3$5.3/$&(1<& &RQYHQLHQWO\/RFDWHGLQ/RZHU0DQKDWWDQ

For Disclosure Information, view Program Details @ nyci.edu

Rooms for Rent

General Help Wanted

Just not sure where you fit in?

TELMKTRS

Consider LEGAL STUDIES at Briarcliffe College where you will learn over 20 different ďŹ elds of law! Day and Evening Classes Available

866.991.5777 www.briarcliffe.edu

Bethpage | Patchogue

Career Education 566742â&#x20AC;&#x201C;10/13. Find employment rates, ďŹ nancial obligations and other disclosures at www.briarcliffe.edu/disclosures. Briarcliffe College cannot guarantee employment or salary. While many of our degree programs are designed to prepare graduates to pursue continued bachelor, graduate or doctorate-level education, the University cannot guarantee that students will be granted admission to any programs.

VITAL TAL CAREERS START HERE!

Medical Assistant Surgical Technologist Respiratory Therapist E A R N Y O U R A S S O C I AT E S D E G R E E, NOT just a certificate!

Call and receive a Career Guide brought to you by Sanford-Brown and Careerbuilder! Read about: -Job Searching in a Recession -5 Ways to Get Better Pay -Want Job Security? Work on your education and more! Call now, to get your copy! 877-871-6444 Sanford-Brown Institute .EW9ORK .9s'ARDEN #ITY Licensed by the New York State Education Department Programs vary by campus sanfordbrown.edu

Training

Â&#x2021;&28575(3257,1*

Want to make a change in your life? Interested in healthcare? We offer hands-on training in a variety of healthcare ďŹ elds. Classes starting soon! START TODAY! 888-806-6333 SBI Campus â&#x20AC;&#x201C; an afďŹ liate of Sanford-Brown - Melville Melville, NY sbmelville.edu Tired of your Job? Want to pursue a new a career?? Not sure where to start??? With training in Medical Assisting, you too can start a new chapter in your life! Degree program available! Call now to get started! 877-839-5444 SBI Campus â&#x20AC;&#x201C; an afďŹ liate of Sanford-Brown - Melville Melville, NY sbmelville.edu

OTHER PROGRAMS:

F/T EXP ONLY!

CALL TODAY! OUR ADVISORS WILL HELP EVERY STEP OF THE WAY 254 W 54th Street

www.mandl.edu

HHA/CNA training Assist slow learner? Long time out of school? Placement Assistance. Call#718-349-8003

â&#x20AC;˘ EARN COLLEGE CREDITS â&#x20AC;˘ FLEXIBLE SCHEDULES

1-855-626-3504

MANDL

SCHOOL

THE COLLEGE OF ALLIED HEALTH

TO PLACE AN AD CALL 866-900-9473 OR VISIT US AT

Healthcare

Call Now & Move in Today Need valid ID & 2 Paystubs/ Need Help renting? CALL US. BigHugApts.com 718-565-5023/ Hablo Espanol

MADE YOU LOOK!!!

Now All You Have To Do is Call. Salary + Comm. + Bonus = $8.-$12/Hr. David (212) 563-7500

Business Opportunity-Owner/ Operator-Open House

JOBS We Train & Place!

Deliver newspapers as an Owner/Operator under agreement with our company in Manhattan. Earn up to $1,000+/month. Must have dependable car. Call 646-277-3795 for details

New Media Production (Audio & Video)

INCREASE YOUR EARNING POWER!

On Queens Blvd Next to E/F Train Q10 Bus 8002 Kew Gardens Rd, Kew Gardens, NY

0#4s((!s-EDICAL!SST%+'0(,%0HARM4ECH

#.!&2%%4RAININGIFELIGIBLE &REE4RAINING536ETS 3OLAR4ECHETC

#ALL   STUDENT VISAS @ LOW COST

General Help Wanted Ticket Agents Start Today! Paid Daily Work/Hrly,loc.30% comm 218 W37 5th floor, NY, NY 10018 212-664-0300

Fast growing company is expanding in the NY, NJ area. Looking someone Interested in earning full time income on a part time basis. Text "Lifetime Results" to "55469"

Activist Jobs! Many Job Openings Factories, Restaurants, Deli Sales, Cashiers, Domestics and more

(718) 478-5690 Fee

Campaign to: -Keep Birth Control Affordable -Defend a Womanâ&#x20AC;&#x2122;s Right to Choose Protect Reproductive Rights $12-$16/hr FT/PT/Career Call Janet at (212) 219-1502

â&#x20AC;˘ HEALTHCARE ADMINISTRATION â&#x20AC;˘ DENTAL ASSISTANT (MEDICAL BILLING AND CODING) â&#x20AC;˘ PHARMACY TECHNICIAN â&#x20AC;˘ TRANSFER CREDITS ACCEPTED â&#x20AC;˘ DAY/EVE/WEEKEND COURSES

TO PLACE AN AD CALL 866-900-9473

777!##%3315%%.3#/Comp. Networking(A+,MCSE,CCNA) Comp. Programming (C++,.Net,QA) Medical Assistant ESL ( Free.. If you Qualify)

Ashmatt Employment Agency

NEEDED: People to train in Non-invasive CARDIOVASCULAR TECHNOLOGY! Train in this exciting ďŹ eld and you could help save lives! Call now to get started! 877-817-5444 .EW9ORK .9s'ARDEN#ITY .9 Licensed by the New York State Education Department Programs vary by campus sanfordbrown.edu

Careers

CAREERS FOR THE 21ST CENTURY!!

FINANCIAL AID AVAILABLE &Ĺ˝Ć&#x152;^Ä&#x17E;ĹŻÄ&#x17E;Ä?Ć&#x161;WĆ&#x152;Ĺ˝Ĺ?Ć&#x152;Ä&#x201A;ĹľĆ?/ĨYƾůĹ?ÄŽÄ&#x17E;Ä&#x161;

212-695-9700

Careers

IN PRINT & ONLINE

DRIVERS Premier Paratransit is seeking Drivers with NYS CDL Class C with Passenger Endorsement COME IN FOR APPLICATION

940 Remsen Ave, Brooklyn (bet Av D/Foster Av) Â&#x153;Â&#x2DC;Â&#x2021;Ă&#x20AC;Â&#x2C6;Ă&#x160;n>Â&#x201C;Â&#x2021;Ă&#x2021;ÂŤÂ&#x201C;Ă&#x160;UĂ&#x160;->Ă&#x152;Ă&#x2030;-Ă&#x2022;Â&#x2DC;Ă&#x160;n>Â&#x201C;Â&#x2021;{ÂŤÂ&#x201C;

Nurse Aide ( CNA ) EKG & Phlebotomy Patient Care tech (PCT) Dental Assistant Pharmay Tech. ( PhT) MS Office / CPR

Call: 866-487-5432 Access Careers, Brooklyn www.AccessCareers.Edu Close to 2, 3, A, C, G, R, Q, N, E, F, Train at Hoyt St Financial Aid if qualify

Licensed by NYSED

Ultrasound Med Assistant 2-! Pharmacy Tech 04#" Dialysis Technician Nursing Assistant (CNA) .......................................$699 EKG & Phlebotomy Combo....................................$699 Patient Care Technician (CPCT)............................$699 Medical Billing (CBCS)......................................... $699 Med Off Administration (CMAA) .......................... $999 Pharmacy Technician (PTCB) .............................. $999 CPR (By American Heart Association Valid 2yrs) ..$80

Financial Aid Available If You Qualify

ACCREDITED INSTITUTE

NEW YORK MEDICAL CAREER TRAINING CENTER 500 8th Ave. NYs  s#LOSETO0ENN3TATION0ORT!UTH 36-09 Flushing Main St. s  s#ORNEROF-AIN3TREET.ORTHERN"LVD

WWWNYMEDTRAININGCOM


Tuesday, March 18, 2014

Legal Notices

Home

Home

NOTICE TO THE PUBLIC Rooms Affordable Furnished Rooms in Manhattan

AFFORDABLE HOME PROGRAM

Legal Notices

Utilities Included Same Day Move In Cable, TV, Internet No Credit Check $125 per week Call 212-862-0457

1,000

'//$ä#2%$)4 ä"!$ä#2%$)4 ä./ä#2%$)4

2738 BRUCKNER ASSOCIATES, Defendants. To the above named defendants:

CALL NOW FOR FREE REGISTRATION MANY HOMES ARE FULLY RENOVATED

BROOKLYN, QUEENS, BRONX, WESTCHESTER AND LONG ISLAND 3.5% TOTAL DOWNPAYMENT NEEDED Private Entry Bath Cooking 1 Person/2 Person $125wk/up room rentals 212-697-3962

Affordable Home Program LLC NYS. Licensed Real Estate Brokers 116-16 Queens Blvd Suite 202, Forest Hills, NY 11375

1866-988-HOME (4663)

PUBLISHERS NOTE All real estate advertising herein is subject to the Federal Fair Housing Act of 1968 and state and local fair housing laws. The Fair Housing Act makes its i l l egal to advertise any preference, limitations or discrimination on the basis of race, color, religion, sex, handicap, familial status, or national origin or an intention to make any such preference, limitation or discrimination. State or local laws may make unlawful advertising that discriminates on the basis of age, marital status, or sexual orientation. Metro US will not knowingly accept any advertising for real estate which violates the law. The law requires that all dwellings advertised are available on an equal opportunity basis. If you have any questions regarding housing discrimination, call the Long Island Housing Services at 1(800) 660-6920 in Long Island or the Anti-Discrimination Center at (212) 346-7600 in New call HUD toll-free at (800) 669-9777 or the New York City Commission on Human Rights at (212) 306-7500

Multi-family

Ozone Park $390.000 2 Family house 3/3 fully finish basement. Call 718-300-7057 Maybell hablamos espanol.

TO PLACE AN AD CALL 866-900-9473 OR VISIT US AT

AFFORDABLE 1ST HOMES III *Licensed Real Estate Broker

Attention Renters: Tax Refund Time Is Here 28 32 Homeowners needed by March 12th!

SStart Sta t with as little as

$1,500

STOP PAYING RENT Register in person at our office:

1-2 Family Homes in Brooklyn, Bronx, and Queens Good credit/bad credit G All cases processed

143-13 Hillside Ave., Jamaica NY 11435 By Train: Take the “F” Train to Sutphin Blvd By Car: Take Van Wyck to Hillside Ave

718-291-1800 START NOW!!

SEARCH IT. FIND IT. BUY IT. Legal Notices NOTICE IS HEREBY GIVEN

NOTICE IS HEREBY GIVEN

that a License, Number 1276790 for Restaurant Wine has been applied for by the undersigned to sell Beer & Wine at retail in a Japanese Restaurant under the Alcoholic Beverage Control Law at: 85 Kenmare St., Front A New York, NY 10012 for On-premise consumption. Mikaku Inc.

that a license, Number 1276867 for Beer & Wine has been applied for by the undersigned to sell Beer & Wine at retail in a Restaurant under the Alcoholic Beverage Control Law at 161 Nassau Ave., Brooklyn, NY 11222. For onpremise consumption. Nassau Kyoto Japanese Sushi Inc.

X

The basis of venue is situs of property known as 2738 Bruckner Blvd., Bronx, New York.

YOU ARE HEREBY SUMMONED to answer the complaint in this action and to serve a copy of your answer, or, if the complaint is not served with this summons, to serve a notice of appearance, on the plaintiff’s attorneys within 20 days after the service of this summons, exclusive of the day of service (or within 30 days after the service is complete if this summons is not personally delivered to you within the State of New York); and in case of your failure to appear or answer, judgment will be taken against you by default for the relief demanded in the complaint. Dated: October 24, 2013

ALL CASES PROCESSED 100’s Available, All Boroughs

Legal Notices

SUPREME COURT OF THE STATE OF NEW YORK COUNTY OF BRONX KS# 12338 X Index No. 306503/13 CROSSWAY CHRISTIAN CENTER, ASSEMBLIES OF GOD, SUMMONS Plaintiff, Plaintiff designates Bronx -againstCounty as the Place of Trial

START WITH AS LITTLE AS

$

Legal Notices

Defendants Address: 2738 BRUCKNER ASSOCIATES, c/o LEVINE, THALL AND PLOTKIN 1740 BROADWAY, NEW YORK, NY

SUPREME COURT OF THE STATE OF NEW YORK COUNTY OF BRONX CROSSWAY CHRISTIAN CENTER, ASSEMBLIES OF GOD, -Plaintiff -against2738 BRUCKNER ASSOCIATES, -Defendant(s)

KEVIN A. STEVENS, P.C. Attorney for Plaintiff 98 Lafayette Avenue Suffern, NY 10901 845-357-9144

KS # 12338 Index No. COMPLAINT

Plaintiff, by its attorney Kevin A. Stevens, PC, complaining of defendant(s) hereby alleges and states as follows: 1. This action is brought pursuant to N.Y. Real Property Actions and Proceedings Law Article 15 to compel the determination of claims to real property described in this complaint. 2. Plaintiff is a New York Religious Corporation duly organized and existing, with a principal place of business in the State of New York, County of BRONX. 3. Upon information and belief, defendant is or was a partnership organized under the laws of, and headquartered in, the State of New Jersey. Defendant is referred to as a New Jersey Partnership by deed dated May 17th, 1990, recorded June 15th, 1990, in Reel 990, Page 93. (See discussion in paragraph 7 below) 4. That the transactions complained of, to the extent not otherwise specified, all occurred within the State of New York, County of BRONX. 5. Plaintiff at all relevant times was and now is owner in fee simple of the following described property, located and situated in the City of New York, County of Bronx, and State of New York: Parcel “B” of land designated on the Tax Map of the City of New York, for the Borough of the Bronx, as Lots 7 in Block 5537 of Section 18, as said Map was on the 4th day of February, 1952; said property being known and designated as 2738 Bruckner Blvd., Bronx, NY and conveyed by deed dated May 17th 1990, and recorded June 15th, 1990. (See Deed attached as Exhibit “A”) Prior to plaintiffs ownership of this lot, the same was owned by plaintiff’s denominational parent. 6. Plaintiff also has at all relevant times owned and possessed of a House of Worship (“House of Worship Parcel”) in fee simple on lots 1 and 3 in Block 5537 of Section 18, as said Map was on the 4th day of February, 1952; said property being known and designated as 2726 and 2730 Bruckner Blvd., Bronx, New York, conveyed from New York District of The Assemblies of Gob by deed dated April 4th, 2000, recorded March 16, 2001 in Reel at Page 1542. (See Deed attached as Exhibit “B”) 7. Defendant previously obtained record title to the following described property, located and situated in the City of New York, County of Bronx, and State of New York: Parcel “A” of land designated on the Tax Map of the City of New York, for the Borough of the Bronx, as Lot 7 in Block 5537 of Section 18, as said Map was on the 4th day of February, 1952; said property being known and designated as 2738 Bruckner Blvd., Bronx, NY and conveyed by deed dated July 13th, 1983, and recorded March 7th, 1988 (herein after the “Premises”). (See Title Report and Deed attached as Exhibit “C”) 8. Plaintiff has acquired title to the above referenced Premises by virtue of adverse possession pursuant to RPAPL sections 501 & 512. 9. Plaintiff has used and occupied the Premises openly, notoriously, continuously, and exclusively, for a period of time extending well beyond the ten (10) year statutory requirement set forth in CPLR Section 212. 10. For over twenty (20) years the Premises has been used as egress in case of a fire or other emergency access for the rear portion of the building on parcel “B”, granting access to Bruckner Blvd. 11.Since 1998 the church has maintained a storage shed on the Premises for the storage of equipment associated with maintenance and landscaping. 12. For over ten (10) years the Premises has been used for regular church construction projects and clean up. Commercial dumpsters were placed on the Premises for project cleanups each time. 13. In 2003 the Premises was used for heavy equipment storage when the church was going through renovations. 14. Since 2006 the Premises has been used as an access point for wireless antenna heavy machinery to work on cell towers. 15. Since 2010 the Premises has been used as a children’s play area during Sunday worship programs. 16. Plaintiffs occupation of the Premises has been under a claim of right. As stated and shown above, Plaintiff’s occupation has been continuous, exclusive and adverse to any other rights and claims, including that of defendant. Defendant has not set foot on the Premises at all, nor contacted plaintiff in regard to the plaintiffs occupation at all. Defendant has made no use of the Premises whatsoever, including one abandoned billboard located on parcel “A”, for years. Defendant has abandoned the Premises and has not occupied, possessed or used the Premises for in excess of ten years, during which Plaintiff has openly and notoriously occupied the Premises. 17. By virtue of the filed deed (Exhibit “C”), defendants claim or may claim to have, or it appears by the public records that they may claim, some estate or interest in the above-described Premises, which belongs to plaintiff, and of which a description is given in paragraph 7 above or that the defendants claim or my claim to have, or it appears by the public records that they may claim some estate or interest in a part of the real property, the exact nature, extent, and quality of which claims, except as here specified, are unknown to plaintiff 18. Plaintiff alleges that all claims of defendant to the Premises are invalid and have been abandoned, and are of no force or effect and that all such claims have been wholly and effectually extinguished, cutoff, and barred by the acts and occurrences of a continuing nature that have continued for a period exceeding that required by statute for the vesting of title through the medium of adverse possession, and that plaintiff has seized and possessed of the Premises free of, and wholly discharged from, any and every claim, demand, or encumbrance on behalf of defendant. 19. All the defendants are known, and none are infants, mentally retarded, mentally ill, or alcohol or drug abusers. 20. Any judgment granted herein will not affect any person or persons not in being or ascertained at the commencement of this action, who by any contingency contained in a devise or grant or otherwise, could afterward become entitled to a beneficial estate or interest in the aforesaid Premises. In addition, every person in being who would have been entitled to such estate or interest, if such event had happened immediately before the commencement of the action is named as a party to this action. WHEREFORE, plaintiff demands judgment as follows: A) that it be adjudged and finally determined that plaintiff is the lawful owner and are vested with an absolute and unencumbered title in fee to the Premises described in this complaint in paragraph 7 (and in Exhibit “C”); B) that the sole and complete possession of the Premises described in paragraph 7 of this complaint be awarded to the plaintiff, and that the plaintiff remains in possession of the Premises; C) that defendants and all persons claiming under them or under any of them be forever barred from all claim to an estate or interest in the Premises described in paragraph 7; D) that plaintiff recover costs, disbursements, and allowances against any and all defendants answering this action; E) that plaintiff have such other and further relief as to the Court may deem just, equitable, and proper.

Dated: October 24, 2013

KEVIN A. STEVENS Attorney for Plaintiff 98 Lafayette Avenue Suffern, NY 10901 845-357-9144


VISIT ADORAMA TODAY AT 42

W 18TH STREET, NYC BETWEEN 5

TH

AND 6TH AVENUES

www.metro.us

STORE HOURS Sun 9:30am-5pm M-Th 9am-8pm Fri 9am-2pm Sat Closed

IN-STORE EXCLUSIVE

Introducing the

MORE EVERYTHING PLAN More data for the same price*

Apple® iMac® 21.5” 1080p LED All-In-One Desktop Computer

WRT54GL Wireless-G Broadband Router

# ACME086LLA

# LKWRT54GL

1,19900

$

$

Apple, the Apple logo, and iMac are trademarks of Apple Inc., registered in the U.S. and other countries.

4999

Coolpix S3600 Digital Camera Bundle INCLUDES FREE ACCESSORIES * Select plans only. See a sales associate for details.

# INKCPS3600LB

17766

INCLUDES

$

Lumix DMC-GX7 Digital Single Lens Mirrorless Camera Body

W

IN-STORE # IPCDMCGX7 SPECIAL PRICING! $ 00

998

12-35mm F/2.8 Lumix G X Vario Aspherical Power OIS Lens

PowerShot ELPH 330 HS Digital Camera Bundle

# IPC1235

# ICAE330HSBA

1,10499

14005

$

$

PIXMA MG3520 Wireless Inkjet Photo All-in-One Printer # ICAMG3520B

Z523 40W 2.1 Speaker System

8.5x11” Sample Pack of Signature Worthy Papers

# LOGZ523

# IESS045234

$

8695

6400

$

After $10 Rebate

1999

$

20 OFF Must Present Coupon At Checkout

Expires March 28, 2014 *Some restrictions apply

SHOP

RENT

42 W 18TH ST NYC | 212.741.0063 | ADORAMA.COM Same Day Delivery

PRINT

Expert Spotlight

FREE PC Tune-Up

LEARN

See, Touch and Demo

SELL

40 new york Tuesday, March 18, 2014

A Purchase Of $200 Or More*

COUPON CODE “metroNY031814”

$

20140318_us_new york  
Read more
Read more
Similar to
Popular now
Just for you