Page 1

UNA FOTOGRAFÍA VALE MÁS QUE MIL PALABRAS SU FOTO PUEDE SER PARTE DEL 2013 METRO PHOTO CHALLENGE!

NEW YORK CITY’S #1 FREE DAILY NEWSPAPER

Tuesday, September 3, 2013 www.metro.us | t: MetroNewYork | f: MetroNewYork

El publico descubre que sus periódicos están transformados Noticías de intercambio. Lo hemos sustituido su periódico regular por uno que viene de otra parte del mundo METRO, para demostrar que la fotografía es el verdadero lenguaje universal. Hoy, el concurso de fotografía más grande del mundo, Metro Photo Challenge 2013, abre sus puertas, integrando aplicaciones como Instagram y Facebook. Habla usted el idioma universal? Saque la cámera y muestre nos!

Gana un viaje a Ghana! El ganador mundial del gran premio tendrá una expedición fotográfica a Ghana.

A veces, una potente

FOTOGRAFÍA

puede ser todo lo que necesitas para contar una historia Un activista se defiende de los fuertes chorros de agua en Bolivia. Esta foto fue presentada por Carlos Navas en el Metro Photo Challenge 2012. (Want to find out what’s going on here? Look inside on page 08.)

Comparte tus fotos Este año puedes compartir tus fotos en Instagram. No se te olvide añadir el hashtag #MPC2013.

877.369.7152 | 877.369.7227 x1003 Manhattan

Trying to choose the right career path? Our counselors and faculty will work with you from Day One to find your educational route to success!

NYSCAS

New York School of Career and Applied Studies

a division of TOURO

COLLEGE

Brooklyn

Queens

INFORMATION SESSIONS: Manhattan: Wednesdays, 12 noon-5 pm 27-33 West 23rd Street, Admissions Office

Brooklyn: Wednesdays, 11 am-7 pm 1870 Stillwell Avenue, Admissions Office

www.touro.edu/nyscas

Touro College is an equal opportunity institution


1 NEWS

Top 3

What’s trending on Metro.us

1

‘VIDEO: Feminists parody “Blurred Lines”’

2

‘VIDEO: Fox News host Tucker Carlson falls asleep on live TV’

3

‘VIDEO: 3-year-old mispronounces “bow and arrow”’

Local tweet

“They need to cancel the west Indian day parade for good” @JasonCruzNY, upset about violence at the parade

See more at www.metro.us

www.metro.us Tuesday, September 3, 2013

One-year-old shot dead in Brooklyn Gang fight. Community leaders say the shooter’s brother and the baby’s father had an old “beef.” The shooting death of a 16-month-old baby boy in Brownsville Sunday evening has left a community shaken and prompted community leaders to call for greater efforts to be made to end gun violence in the neighborhood. Police Commissioner Kelly said 1-year-old Antiq Hennis was being pushed in his stroller by his father, Anthony Hennis, when he was shot in the left side of his head as they crossed Livonia Avenue at Bristol Street in Brooklyn around 7:19 p.m. on Sunday. Anthony was bringing Antiq to visit his grandmother, Lenore Steele, 72. Lenore and Anthony’s aunt, Cheryl Steele, described their horror when Anthony came running up the street carrying the stroller and screaming that his little boy had been shot. “All I remember seeing is the bullet and his brains on the side of his head,” Cheryl said. Cheryl said the baby moved once in his stroller before falling still. Police Commissioner Kelly said that emergency medical personnel responded to the scene and rushed the baby to Brookdale Hospital, where he was pronounced dead. Kelly said police found four .45 caliber shell casings on the corner where Antiq was shot, and a fired bullet in front of 360 Bristol St. The stroller had four bullet holes, which appeared to be two entrance holes and two exit holes. Police said Anthony is a known gang member with an extensive arrest history, though he has not served significant time in jail. He would not cooperate with law enforcement, Kelly said, staunchly

NEW YORK

2

Arrested

Man charged in Bronx hit-and-run Leroy Forest, 31, was arrested in connection with a hit-andrun accident that killed a Manhattan woman around 3 a.m. Saturday. Police say he was operating the dark gray SUV that struck and killed Abigail Lino, 24, as she ran across Bruckner Boulevard near Austin Place. She was pronounced dead at the scene. LAURA SHIN Reward

Cops: Woman raped in park A $22,000 reward is being offered for the arrest of the man who allegedly used a Taser on and raped a 69-year-old woman in Forest Park about 4:30 p.m. on Aug. 26. The suspect is described as a white male in his 30s. He is approximately 5-foot-9, has light brown hair and was wearing a black T-shirt and black sweatpants. Anyone with information about this incident is asked to call the NYPD’s Crime Stoppers hot line at 800-577-TIPS.

Antiq’s mother, Cherise Miller, wipes her eyes, right. The baby’s great-aunt Cheryl Steele holds a photo, left. / DANIELLE TCHOLAKIAN Grieving

“[It] is a tragedy for his parents and family, for the entire community and for this entire city. Every child in this city is precious, and every child deserves our protection. ... Today, we are all grieving.” Mayor Michael Bloomberg

refusing to answer any questions. Police said Anthony’s reticence led police to believe he was the shooter’s intended target. Community leaders confirmed that, and that the shooting was gang-related. Community organizer Tony Herbert explained the shooting was a result of an old “beef” between the shooter’s brother and

Anthony. Herbert and others with the National Action Network, a coalition of community groups, said they know who the shooter is and were hoping to bring him into the precinct. Shirley Jones-Baisden, a tenant association vice president in a local public housing complex, said she has known Antiq’s mother, Cherise Miller, since she was just 1 year old herself. She said she was with Miller when she learned of her son’s death. Jones-Baisden and the other community leaders present called on the community to rally around the family. “I’m also asking my community to change,” Jones-Baisden said, weeping. “They gotta do better than this.”

DANIELLE TCHOLAKIAN

danielle.tcholakian@metro.us

Antiq Hennis

A happy baby, always smiling and ready to share Lenore Steele, 72, said she saw her greatgrandson just hours before he was killed, as she was coming home from church around 11 a.m. She said the little boy was all smiles and kisses as usual. He had just learned to walk. “Since he started to walk, oh my god, he was so jolly,” she recalled tearfully. Antiq’s great-aunt, Cheryl Steele, 42, spoke of a baby with “the biggest smile” who loved to eat and was always eager to share.

LAURA SHIN

Hit man

Woman trades stamp collection to have husband killed: NYPD A woman tried to use a stamp collection as payment for killing her husband, but the hit man was really an undercover investigator, the NYPD reported. Cops said Adams gave the investigator a picture of her husband, a stamp collection valued at $60,000 and jewelry when they met in a car in Sheepshead Bay to arrange the hit. DANIELLE TCHOLAKIAN


3 new york Tuesday, September 3, 2013

www.metro.us


NEW YORK

www.metro.us Tuesday, September 3, 2013

4

Quinn: Let ruling be on stop-and-frisk Quoted

“Mayor Bloomberg’s attempt to block the court ruling is simply unacceptable, and insults the hundreds of thousands of young men of color who are needlessly stopped every year.” Christine Quinn City Council Speaker

Councilman Jumaane Williams and Speaker Christine Quinn held a press conference announcing her letter. / WILLIAM ALATRISTE, METRO

Unacceptable. The City Council Speaker slammed Mayor Bloomberg’s attempt to block the federal ruling.

LES MAGIQUES COLLECTION

18K WHITE GOLD 6.0MM LINK WEDDING BAND

$5,790 FEATURES A FLEXIBLE LINK BAND, SIMILAR TO A WATCH STRAP.

TEXT FINA & YOUR EMAIL ADDRESS TO 33233 TO BE THE FIRST TO HEAR ABOUT OUR LATEST NEWS!

City Council Speaker Christine Quinn will file a legal declaration this week supporting a federal court decision ordering reforms to the NYPD’s stop-and-frisk practice. In August, a federal judge called for an independent monitor to oversee stop-and-frisk reforms, citing a “policy of indirect

Analysis

Convenient timing? Stop-and-frisk has been thrust into the forefront of the mayoral election. The Bill de Blasio campaign lashed out at Quinn for filing the letter a week before the primary. The letter was “a desperate attempt to distract attention from racial profiling.” “The court’s decision, along with the inspec-

her eight-year record of standing with Mayor Bloomberg and Ray Kelly as the overuse and abuse of stop-and-frisk exploded,” de Blasio campaign manager Bill Hyers said. Quinn denied that her action was politically motivated, saying the timing was based on the court’s decision and the city’s appeal. ANNA SANDERS

tor general bill I recently passed with my council colleagues, will go a long way

to ending the unconstitutional use of stop-and-frisk in New York City,” Quinn said in a statement about her letter to the court. Arguing the original decision was “rife with errors of law” and might be overturned on appeal, city lawyers asked the judge last week to freeze implementation of the ordered reforms. The city is also appealing the decision. Quinn maintained the city’s request “is a delay ... that would cause irreparable harm to the city and its residents.”

ANNA SANDERS

anna.sanders@metro.us

Electric Zoo cut short after deaths The final day of the Electric Zoo music festival on Randall’s Island was canceled Sunday after two people died from apparent drug overdoses. The city and concert organizers announced on Sunday morning that the event had been canceled “due to serious health risks.” Two concert-goers died, while four others became critically ill and were placed in intensive care during the first two days of the festival, officials said.

Condolences

“[We] send our deepest condolences to the families of the two people who passed away this weekend.” Made Event, Electric Zoo founders

The causes of the deaths had not yet been determined, but they both appear to have involved the

drug MDMA, also known as ecstasy or molly. “The Electric Zoo organizers have worked with city officials to reduce health risks at this event, but in view of these occurrences, the safest course is to cancel the remaining day of the event,” a statement from the mayor’s office read. Jeffrey Russ, 23, from Rochester, and Olivia Rotundo, 20, from Providence were identified as the two fatalities. LAURA SHIN

Electric Zoo concert-goers GETTY IMAGES


www.metro.us

nada, zip, zilch 5 new york Tuesday, September 3, 2013

(What most kids know about preparing for college.)

Without the help of an adult, it may be confusing for students to find their way to college. If you know a student with dreams of a higher education, do your part and help lead the way. Learn how at...

KnowHow2G0.org

800-433-3243


www.metro.us Tuesday, September 3, 2013

NEW YORK

6

Break dancing WE COULD battle champ a BE MORE Brooklyn native CONVENIENT... B-boying. A Brooklynite trounced 15 of the best B-boys in North America at an Aug. 17 competition.

...BUT ONLY IF WE COMMUTED WITH YOU.

B-boying, the original term for break dancing, first blew up in the dance world via the streets of New York City in the 1970s, so it’s appropriate that the crowned winner of the Aug. 17 Red Bull BC One North American Finals was born and raised in Brooklyn.

Miguel Rosario performs at Red Bull BC One North American Finals. / JEREMY DEPUTAT

Miguel Rosario, 24, known as Gravity, earned himself a spot in the world championship in Seoul, South Korea, in November. The Bensonhurst native started break dancing in 2006.

“The break dancing scene in Brooklyn is dope, probably one of the most underground scenes in NYC,” Rosario said. “We have some of the freshest dancers and footwork heads, and I believe we have the rawest scene with the most attitude and aggression.” Rosario got his nickname from his mom. “She told me, ‘Man, when you flip and breakdance, you look like you defy gravity,’” Rosario recalled. “And the name just stuck to me.”

CASSANDRA GARRISON

cassandra.garrison@metro.us

Excellent medical care is just around the corner. Continuum Health Partners puts you close to a great primary care physician. With convenient locations all over the city—many with extended hours on nights and weekends—and simple doc searches online, high quality care is closer than you think.

West Indian-American Day Parade

New Yorkers turned out in droves in Brooklyn for the annual raucous celebration of Caribbean culture Monday. The festivities are often marred by violence, and this year was no exception, though NYPD Commissioner Ray Kelly said there were fewer violent incidents than last year. / MILES DIXON, METRO

Fight

Get started, stat. Go to www.PrimaryCareNYC.org or call 1.866.811.7225.

British soldiers charged with assaulting off-duty cop Six British soldiers were arrested for assaulting and robbing an off-duty cop in Manhattan early the morning of Aug. 30, police said. Iosesof Yazala

Softball

was charged with robbery and assault. Iliakini Raderua, Thomas Shute, Felite Vunisarati, Mosese Kuruala and Joeli Raduva were all charged with assault. A spokesperson for the British Military of Defense told the Daily Record that they were “aware” of the fight. ANNA SANDERS

NYPD bests Shomrim in ball game The NYPD beat the Boro Park Shomrim, 24-9, in the fourth annual Greenfield Classic softball game in Brooklyn last week. DANIELLE TCHOLAKIAN


See more at www.metro.us

Obama and aides confront Congress on Syria strike

President Barack Obama delivers a statement on Syria in the Rose Garden of the White House on Saturday. / GETTY IMAGES

Decision. Polls show the public is largely opposed to U.S. military action. President Barack Obama and his top aides launched a full-scale political offensive over the weekend to persuade a skeptical Congress to approve a military strike against Syria, but faced a struggle to win over lawmakers from both parties and a war-weary American public. Obama made calls to members of the House of Representatives and Senate, underscoring the task confronting the administration before it can go ahead with using force in response to a deadly chemical attack blamed on the Syrian government. Dozens of lawmakers, some in tennis

shirts or shirtsleeves, cut short their vacations and streamed into the corridors of the Capitol building for a Sunday afternoon intelligence briefing on Syria with Obama’s national security team. When they emerged nearly three hours later, there was no immediate sign that the many skeptics in Congress had changed their minds. Many questioned the broad nature of the measure Obama is seeking, suggesting it needed to be narrowed. REUTERS Quoted

“I am very concerned about taking America into another war against a country that hasn’t attacked us.” Representative Janice Hahn A California democrat

Witnesses

Kerry, Hagel to testify at Senate hearing on Syria U.S. Secretary of State John Kerry and Secretary of Defense Chuck Hagel will be witnesses at a Senate Foreign Relations Committee hearing on the authorization of the use of military force in Syria, the committee said.

NEWS

7

Syrian ally

Russian officials want to fly to Washington to sway Syria vote Russian lawmakers want to travel to Washington to urge Congress not to back President Obama’s plan for military strikes on Syria, the speaker of the upper house of parliament told

President Vladimir Putin yesterday. Dismissing U.S. accusations that the Syrian government had killed hundreds of its own people with poison gas as nothing but “talk,” senior legislator Valentina Matviyenko said both chambers were ready to send delegations. Russia is one of the

main allies of Syrian President Bashar al-Assad and has already blocked several Western-led resolutions in the U.N. Security Council to sanction him over his crackdown on the uprising. It was uncertain what sort of reception a Russian delegation would receive in the United States.


NEWS

www.metro.us Tuesday, September 3, 2013

8

This submission was a contender in last year’s Metro Photo Challenge. / YE PYAE

Just what happened with today’s cover? Double take. No, it wasn’t a publishing error. Today’s rather different cover is to bring awareness to this year’s Metro Photo Challenge. Learn how you can enter. If you noticed that today’s cover of Metro was a bit more, well, international than usual, you would be correct. We joined Metros from all of the world — we publish 71 editions in 23 countries — who ran covers today in different languages to bring awareness to this year’s Metro Photo Challenge. We wanted to prove the point that pictures speak a universal language, understood by all (did it work?). The Metro Photo Challenge is the world’s biggest photography competition open to amateurs and professionals alike. For the 2013 Challenge, photographers will “sense” the world through photography, submitting in five categories representing the human senses (sight, hearing, taste, smell and touch), plus an additional “sixth sense,” an open-ended cat-

egory for photographers to interpret in their own creative way. To submit your photos, go to www. metrophotochallenge.com or submit via Instagram using the hashtag #MPC2013. You can use the app’s editing, filters and enhancement — but only in the “sixth sense” category. Starting tomorrow, Metro will publish a daily winner both in print and

Metro Photo Challenge How to enter MPC: •

Go to www.metrophotochallenge. com to upload your submission (there are no limits to how many you can post). You can also upload via Instagram with the hashtag #MPC2013. Remember: The use of filters are only allowed in the “sixth sense” category.

To see what others are submitting, follow @ metrophotochallenge on Instagram.

online at www.metro.us. At the end of the Challenge on Oct. 13, we will pick a U.S. winner to be entered into our international contest. This global grand prize winner will receive a once-in-a-lifetime trip with a social twist. In partnership with Reach for Change, Metro will arrange an eight-day trip to Ghana, West Africa. METRO

Cyber hacked

Pro-Syria hackers put anti-attack message on US Marines site Computer hackers aligned with Syrian President Bashar al-Assad struck an

Internet recruiting site for the U.S. Marine Corps yesterday, urging troops to “refuse your orders” if the United States attacks Syria. The attack appeared to be the work of the Syrian Electronic Army, which also recently targeted the

New York Times’ website and Twitter. The hackers posted a message and images on the website www.marines. com, signing it “delivered by SEA,” a reference to the Syrian Electronic Army. REUTERS


www.metro.us

575 Lexington Avenue, New York City, NY 10022 (between 51st and 52nd Streets)

212-753-5128 www.cameralandny.com œ˜`>ÞʇÊĂ€Âˆ`>Ăž]ĂŠn>Â‡Ăˆ\ÎäÊUĂŠ->ĂŒĂ•Ă€`>Ăž]ʙ>‡x\Îä

TODAY Thru Sept.13th! (OLIDAY(OURSAM PMsAM PMsAM PMsAM PMs#LOSED

SH-50 iHS

SZ-16 iHS

TG-630 iHS

sĂŚĂŚ16.0 Megapixel BSI CMOS Sensor sĂŚĂŚXĂŚ/PTICALĂŚ:OOMĂŚWITH MMĂŚ7IDE !NGLEĂŚLENS sĂŚĂŚ )NCHĂŚ4OUCHĂŚ,#$ sĂŚĂŚPĂŚ&ULLĂŚ($ĂŚ6IDEO

sĂŚĂŚĂŚ-EGAPIXEL sĂŚĂŚXĂŚ/PTICALĂŚ:OOMĂŚWITHĂŚ MMĂŚ7IDE !NGLEĂŚLENS sĂŚĂŚ )NCHĂŚ,#$ sĂŚĂŚ$UALĂŚ)MAGEĂŚ 3TABILIZATION

sÌÌ12 Megapixel BSI CMOS Sensor sÌÌ5x Optical Zoom, 28-140mm Equivalent sÌÌWater/Shock/Freeze-Proof sÌÌ )NCHÌ(IGH 2ESOLUTIONÌ HyperCrystal™ III LCD

Regular Price

$ 299.99

Less Instant Rebate $ 30.00

YOU PAY

Regular Price

$

26999

YOU PAY

$ 229.99

Regular Price

$

19999

Less Instant Rebate $ 30.00

$ 199.99

Less Instant Rebate $ 30.00

YOU PAY

$

16999

TG-830 iHS

XZ-10 iHS

XZ-2 iHS

sĂŚĂŚ16 Megapixel BSI CMOS Sensor sĂŚĂŚ5x Optical Zoom, 28-140mm Equivalent sĂŚĂŚ&ULLĂŚ($ĂŚ1080p Video sĂŚĂŚWater/Shock/Freeze/ Crush-Proof

sĂŚĂŚ12 Megapixel BSI CMOS Sensor sĂŚĂŚ4x Optical Zoom, 26mm Wide-Angle lens sĂŚĂŚ )NCHĂŚ4OUCHĂŚ,#$ sĂŚĂŚĂŚ&ĂŚATĂŚ7IDE !NGLEĂŚANDĂŚ& ATĂŚ4ELEPHOTO

sĂŚĂŚĂŚ-EGAPIXELĂŚ(IGHĂŚ3ENSITIVITYĂŚ "3)ĂŚ#-/3ĂŚ3ENSOR sĂŚĂŚXĂŚ/PTICALĂŚ:OOM ĂŚMMĂŚ%QUIVALENTĂŚ 7IDEĂŚ,ENS sĂŚĂŚ )NCHĂŚ3WIVELĂŚ4OUCHĂŚ,#$ sĂŚPĂŚ&ULLĂŚ($ĂŚ6IDEO

Regular Price

$ 279.99

Less Instant Rebate $ 30.00

YOU PAY

Regular Price

$

24999

YOU PAY

$ 399.99

Regular Price

$

29999

Less Instant Rebate $ 100.00

$ 599.99

Less Instant Rebate $ 100.00

YOU PAY

$

49999

E-PM-2 with 14-42mm Lens

E-PL-5 with 14-42mm Lens

OM-D E-M5 with 12-50mm Lens

sĂŚĂŚĂŚ-EGAPIXELĂŚĂŚ$IGITALĂŚ#AMERA sĂŚĂŚĂŚ )NCHĂŚ4OUCHĂŚ,#$ sĂŚĂŚ,IVEĂŚ'UIDEĂŚ%ASE /F 5SE sĂŚĂŚIĂŚ&ULLĂŚ($ĂŚ6IDEO

sĂŚĂŚĂŚ-EGAPIXELĂŚ$IGITALĂŚ#AMERA sĂŚĂŚFPSĂŚ3%1ĂŚ3HOOTING sĂŚĂŚ )NCHĂŚ4OUCHĂŚ4ILTĂŚ,#$ sĂŚĂŚIĂŚ&ULLĂŚ($ĂŚ6IDEO

sĂŚĂŚĂŚ-EGAPIXELĂŚ,IVE -/3ĂŚ3ENSOR s !XIS)MAGE3TABILIZATION s )NCHĂŚ4OUCHĂŚ4ILTĂŚ,#$ s4RUE0IC6))MAGE0ROCESSOR

Regular Price

$ 499.99

Less Instant Rebate $ 50.00

YOU PAY

Regular Price

$

44999

YOU PAY

$ 599.99

Regular Price

$

54999

Less Instant Rebate $ 50.00

$1299.99

Less Instant Rebate $ 150.00

YOU PAY

$

114999

LENS SPECIALS! 12mm 2.0

17mm 2.8

40-150mm

75mm 1.8

$799.99 - $50 = $749.99

$299.99 - $100 = $199.99

$199.99 - $50 = $149.99

$899.99 - $50 = $849.99

2013 Olympus Imaging America Inc. All rights reserved.

9 new york Tuesday, September 3, 2013

SEPTEMBER SCANNING SPECIALS SAVE ALL MONTH LONG! Have Old 35mm Slides?

s-INIMUMOF 50 Slides

4RANSFERÌTHEMÌTOÌ#$ FORÌ49¢ each

s99¢ each for Lower Quantities

Prices Valid Thru September 30, 2013

EXPERT CAMERA REPAIRS FREE Estimates on All Repairs

Transfer Your Photos to CD Up to 250 Photos to a CD for $39.99

s0LUS$5.99 for CD PASSPORT PHOTOS While-U-Wait

Photos must be unmounted from 4x6 - 8x12 Prices Valid Thru September 30, 2013

WE DEVELOP FILM We Print from Negatives

We print photos from all smart phones and tablets.


NEWS

www.metro.us Tuesday, September 3, 2013

90 mins. to NYC! -- Most Trusted Poconos Builder! Rents are rising, so

10

Stop Renting, Start Owning! Best home selection in the Poconos

Act now and get $5,000 toward Closing Costs! Our prices include EVERYTHING! Including permitting, water and sewer, etc.

The Heritage $283,500 Complete $12,500 DOWN PAYMENT $2,171* per month pays all inincluding principal, interest, taxes and insurance!. insurance!. • 4 bedrooms • 2 1/2 baths • Loft • Dining Rm • Living Rm • Huge Kitchen • 2 car Garage • Central Air & Heat • Jetted Tub • Large Yard • Landscaping • 3,392 Sq. Ft.

American swimmer Diana Nyad swims across the sea near the security team during her fifth attempt at swimming across the Florida Straits. / GETTY IMAGES

Swimmer completes record-breaking Cuba-to-Florida swim Going the distance. Nyad was escorted by five support boats that provided her with food and water. American 64-year-old long-distance swimmer Diana Nyad yesterday became the first person to swim across the Florida Straits from Cuba without a shark cage, succeeding on her fifth attempt at the feat. Transaction

$

The Millburn $194,500 Complete 6,808 DOWN PAYMENT $1,500* per month pays all, inincluding principal, interest taxes and insurance! • 3 or 4 large bedrooms • 2 1/2 baths • Liiving Rm • Dining Rm • Central Air & Heat • Deck • Fireplace • Front Porch • Large Yard • 2,293 Sq. Ft.

1-800-276-4000 Call Toll Free

www.classicqualityhomes.com Hours: Mon. thru Sat. 9am to 5pm * Monthly payments based on FHA 30 yr. fixed interest rate of 4,3% with 4.8% APR with a finance cap of $271,000. Lower rates may apply to qualified buyers. All numbers are estimated. Conventional mtgs. also available

Vodafone, Verizon agree to $130 billion wireless deal Verizon Communications agreed yesterday to pay $130 billion to buy Vodafone out of its U.S. wireless business, signing history’s third largest corporate deal to bring an end to an often fractious 14-year marriage. The two firms said Vodafone would get $58.9 billion in cash, $60.2 billion in Verizon stock and an additional $11 billion from smaller transactions in a deal that is due to close in the first quarter of next year. REUTERS

Nyad came ashore about 53 hours after she set off from Havana, completing the estimated 110-mile journey and setting a record for the longest ocean swim without a shark cage or flippers, according to her crew. She was met by crowds in Key West who surrounded her, snapping photos, when she staggered ashore as they were enjoying sunny beach weather on the annual Labor Day holiday. Helpers were waiting

to give her medical treatment and immediately placed her on a stretcher and hydrated her with an IV, before she was taken to a hospital. Her face looked sunburned except around the eyes, where she had been covered by goggles, and her lips were swollen. REUTERS Years

35

It was her fifth attempt in 35 years to make the crossing.

Snooping. Report: US spied on presidents of Brazil and Mexico The U.S. National Security Agency spied on emails, phone calls and text messages of the presidents of Brazil and Mexico, a Brazilian news program reported, a revelation that could strain Washington’s relations with Latin America’s two biggest nations. The report late Sunday by Globo’s news program “Fantastico” was based on documents that journalist Glenn Greenwald obtained from former NSA contractor Edward Snowden. Greenwald, who lives in Rio de Janeiro, was listed as a co-contributor to the report.

“Fantastico” showed what it said was an NSA slide dated June 2012 displaying passages of written messages sent by Mexican President Enrique Pena Nieto, who was still a candidate at that time. In the messages, Pena Nieto discussed who he was considering naming as his ministers once elected. A separate slide displayed communication patterns between Brazilian President Dilma Rousseff and her top advisers, “Fantastico” said, although no specific written passages were included in the report. REUTERS


www.metro.us

CUNY in the Heights Division of Continuing Education & Workforce Development

Register Today

212-567-7132 Dental Assistant

Certified Phlebotomy Technician

(80 hrs)

This course covers: the history of dentistry, dental assisting, and introduction to the dental office. Clinical aspects of dentistry are also covered: introduction to oral anatomy, dental operatory, dental equipment, how to take x-rays, introduction to tooth structure, primary and permanent teeth, the oral cavity and related structures, proper patient positioning, dental hand-pieces and sterilization. In addition to entry-level employment, this course is ideal for students interested in pursuing a Dental Hygientist program and career. Students that pass with at least 85% can be assigned a 1 – 3 month internship.. Dental Assistant Program Dental Assistant Program

M, M-Th

9/30-1/22/14 6pm-9pm 10/21-11/21/13 9am-1pm

$1,299 $1,299

(Tuition includes all Textbooks, Lab Materials and Insurance)

Dialysis Technician

(50 hrs)

This 50-hour program provides students with the knowledge and skills needed to perform the duties required of a Dialysis Technician. These duties include: operating a kidney dialysis machine, preparing dialyzer reprocessing and delivery systems as well as maintaining and repairing equipment. Furthermore, technicians work with patients during dialysis procedures and monitor and record vital signs as well as administer local anesthetics and drugs as needed. Additionally, they may also be involved in the training of patients for at-home dialysis treatment. Dialysis Technician Dialysis Technician

T, Th 10/1-11/26/13 Sat 10/5-12/14/13

6pm-9pm 1pm-6pm

11 new york Tuesday, September 3, 2013

Certified Nursing Assistant Program

$999 $999

(130 hrs)

Our program is a NYS Dept of Health approved training program for individuals seeking employment as nursing assistants in the medical field. Duties: patient care, taking vital signs, catheter care, assisting with ambulation, range of motion exercises, and moving patients to bed and from bed to wheelchair. The course content, 130hours, include: Anatomy and Physiology (50 hrs), Fundamentals of Patient Care (50 hrs) and Nursing Home Clinical Rotation (30 hours). Upon completion, students will be eligible to take the NYS Certification Exam. Prerequisites: NYS test fee has to be paid in class $115.00. Proof of H.S./GED diploma required. CNA CNA

M-Th 9/30-12/16/13 M-Th 10/21-12/5/13

6pm-9pm 9am-2pm

$995 $995

(80 hrs)

Learn the anatomy and physiology of the venous system as well as phlebotomy practices. Perform blood collection procedures including vacuum collection, syringes, butterfly needles, micro hematocrit collection and live venipuncture. Learn infection prevention and control, quality assurance, and specimen handling, labeling and transport. For this course students must submit health clearance form. Prerequisite: CNA, LPN or coordinator permission. Phlebotomy Technician Phlebotomy Technician

M-Th M-Th

9/30-11/14/13 11/11-12/17/13

6pm-9pm 10am-2pm

$849 $849

Pharmacy Technician Training Certificate Program (100 hrs) The Pharmacy Technician Training Certificate Program comprises of three (3) courses that can be taken individually or together in order to receive a Pharmacy Technician Certificate. Course content includes: pharmacy medical terminology, the history of pharmacy, the pharmacy practice in multiple environments, pharmacy calculations and measurements, reading and interpreting prescriptions and defining drugs by generic and brand names. Through classroom lecture and hands on labs, students will review dosage calculations, drug classifications, the “top 200 drugs”, I.V. flow rates, sterile compounding, dose conversions, aseptic technique, the handling of sterile products, total parental nutrition (TPN), dispensing of prescriptions, inventory control and billing and reimbursement. Students that pass with at least 85% can be assigned a 1 – 3 month internship. Calculations, Measurements, T, Th 10/1-10/31/13 Dosages and Flow Rates (30hrs) Intro to Pharmacology ( 30hrs) T, Th 11/5-12/10/13 General Pharm. Practice/Lab (40hrs) T, Th 12/12-2/11/14

6pm-9pm $299 6pm-9pm $399 6pm-9pm $799

(Tuition includes all Textbooks and Materials)

Calculations, Measurements, M-Fri 10/21-10/30/13 Dosages and Flow Rates (30hrs) Intro. to Pharmacology (30hrs) M-Fri 11/4-11/13/13 General Pharm. Practice/Lab (40hrs) M-Fri 11/18-12/4/13

CUNYin the Heights Division of Continuing Education & Workforce Development

5030 Broadway, NY, NY 10034 cunyintheheights@hostos.cuny.edu www.cunyintheights.com

9am-1pm $299 9am-1pm $399 9am-1pm $799

Register Today 212-567-7132


NEWS

www.metro.us Tuesday, September 3, 2013

Fighters. Afghan Taliban target US army base as attacks mount Taliban fighters attacked part of a U.S. military outpost in the eastern Afghan province of Nangarhar yesterday, officials said, less than a week after targeting a Polish base in a nearby province. Attacks on Afghan security forces and civilians have also mounted this week, killing dozens and adding to fears that the drawdown of foreign troops, most of whom are due to leave the country by the end of next year,

is allowing insurgents to regain lost territory. The attack prompted police to shut part of a highway between the provincial capital and Torkham district near the border with Pakistan, a security source said. The base itself was not penetrated. Three Taliban fighters were killed in the clash, but no others casualties were reported, district governor Isa Khan Zwak said. REUTERS

Afghan attendants and police officials carry coffins of the victims of a clash between Taliban and joint Afghan-foreign troops. / GETTY IMAGES

Singaporean man has 6,000 Barbie dolls Travel. On his last trip to New York, he bought 65 dolls.

The white exterior and spartan grey staircase of Jian Yang’s tidy rowhouse give no hint of the shock that lies within — a pink living room floor and his collection of more than 6,000 Barbie dolls. The 33-year-old Singaporean favors minimalist decor, but the Barbies and 3,000 dolls of other kinds dominate three sides of the main room and spill over to fill nine mirrored cabinets in his dressing room and the shelves of his study. “Incongruous is kind of me,” Yang told Reuters. “When you meet me outside of this, I’m not that kind of guy. I’m not what you expect from a guy that

collects dolls.” Yang has a professional interest in toys and consumer trends as director of strategy at Omicom Media Group. But his Barbie collection began at age 13 when he bought the “Great Shape” model in a turquoise Spandex gym outfit and striped leg warmers. “Before I knew anything about social norms, I was a boy that watched this on TV, liked it and wasn’t allowed to have one,” he said. “As I grew older, got my own allowance, that’s where I started getting the freedom to buy whatever I wanted.” Collection

$392K

The self-described “toy nerd” reckons he has spent at least $392,000 over the last 20 years on his collection.

STOP SUFFERING WITHOUT SURGERY SEDATION AVAILABLE, TOTALLY PAINLESS PROCEDURES Board Certified Pain Management Physicians att HudsonSpine.com H d S i can help. X-Ray and Ultrasound guided same day non-surgical procedures to relieve pain.

U Neck Pain? U Back Pain? U Sciatica? U Herniated Discs? U Knee Arthritis? U Tired of medications? U Physical Therapy & Chiropractors not helping? U Afraid of Surgery?

-̜«Ê-ÕvviÀˆ˜}Ê/œ`>ÞtÊUÊ*i>ÃiÊV> 646-596-7386 Same Day Appointments Available | Most Insurances Accepted “>ˆ\ʘvœJÕ`ܘ-«ˆ˜i°Vœ“ÊUÊ281 Broadway 2nd Floor, NY, NY 10007 near Chambers St

and City Hall 1

2

3

A

C

E

N

R

12

Barbie, launched in 1959, has sold more than 1 billion dolls. / GETTY IMAGES

HURT AT

WORK?

WORKER’S COMPENSATION CONSTRUCTION ACCIDENTS MOTOR VEHICLE ACCIDENTS LAW OFFICES OF HARRIS LAW GROUP, LLP Work Related Injuries Occupational Diseases Construction Accidents Motor Vehicle Accidents Negligence & Liability Accidents Personalized Service to Every Client No Appointment Necessary Represent Uninsured Employers

CALL 212.684.3160 Offices in Queens, Brooklyn, Staten Island, Nassau & Suffolk County

FREE CONSULTATION We speak Spanish, Russian, Chinese, Polish and Bengali


www.metro.us

THINNING HAIR?

HAIR

To control epilepsy you need the best treatment team.

Transplant Made Easy!

At the

NORTHEAST REGIONAL EPILEPSY GROUP, your team members are:

USA Hair Clinics provides the next generation in hair transplant for both men and women. The most advanced FDA approved option for fuller, thicker head of hair.

UĂŠÂ?Â?ĂŠÂ˜iĂ•Ă€ÂœÂ?Âœ}ÂˆĂƒĂŒĂƒĂŠĂœÂˆĂŒÂ…ĂŠĂƒÂŤiVˆ>Â?ĂŒĂžĂŠĂŒĂ€>ˆ˜ˆ˜}ĂŠÂˆÂ˜ĂŠiÂŤÂˆÂ?iÂŤĂƒĂžĂŠ UĂŠ>Â˜ĂžĂŠĂƒiÂ?iVĂŒi`ĂŠ iĂƒĂŒĂŠ ÂœVĂŒÂœĂ€ĂƒĂŠÂœvĂŠ“iĂ€ÂˆV>ĂŠ UĂŠÂœĂ€iĂŠĂŒÂ…>Â˜ĂŠĂŽĂ¤]äääÊiÂŤÂˆÂ?iÂŤĂƒĂžĂŠÂŤ>ĂŒÂˆiÂ˜ĂŒĂƒĂŠĂŒĂ€i>ĂŒi`°

BENEFITS: B

Free Consultation with Hair Specialist

UĂŠĂ•Â˜`Ă€i`ĂƒĂŠÂœvĂŠiÂŤÂˆÂ?iÂŤĂƒĂžĂŠĂƒĂ•Ă€}iĂ€ÂˆiĂƒĂŠĂƒĂ•VViĂƒĂƒvĂ•Â?Â?ÞʍiĂ€vÂœĂ€Â“i`° UĂŠ"˜iĂŠĂŒÂ…iĂŠÂ?>Ă€}iĂƒĂŒĂŠiÂŤÂˆÂ?iÂŤĂƒĂžĂŠÂŤĂ€Âœ}Ă€>Â“ĂƒĂŠÂˆÂ˜ĂŠĂŒÂ…iĂŠ1Â˜ÂˆĂŒi`ĂŠ-ĂŒ>ĂŒiĂƒÂ°

ss,EASTINVASIVEHAIRTRANSPLANTPROCEDURE

UĂŠÂœĂ€iĂŠĂŒÂ…>Â˜ĂŠÂŁxĂŠÂœvwViĂƒĂŠÂˆÂ˜ĂŠĂŽĂŠĂƒĂŒ>ĂŒiĂƒ

ss.OSCALPELINCISION ss.OSUTURESORSTAPLES ss.OWIGS ss.OUNSIGHTLYLINEARSCAR s&ASTESTRECOVERYTIME WORKTHENEXTDAY s-ORENATURALLOOKINGHAIR

“My epilepsy did not respond to treatment for years. Since I switched to my new doctor, a Board CertiďŹ ed specialist in epilepsy, we are on the right track.â€? -Brian

212-661-7486 www.epilepsygroup.com www.epilepsylifelinks.com

www.USAHairClinics.com w .EW9ORK\,OS!NGELES "OSTON\#HICAGO\0HILADELPHIA

ÂœV>ĂŒÂˆÂœÂ˜ĂƒĂŠÂˆÂ˜ĂŠ iĂœĂŠ9ÂœĂ€ÂŽ]ĂŠ iĂœĂŠiĂ€ĂƒiÞÊ>˜`ĂŠ œ˜˜iVĂŒÂˆVĂ•ĂŒ

718-569-6649

Say Goodbye to Painful Varicose Veins! Do you have any of these symptoms?

FREE

1 /2 Hour Massage & Consultation

(some restrictions apply)

With 4 Convenient Locations Call For An Appointment Today!

s6ARICOSE6EINSs3PIDER6EINS s)TCHINGAND"URNING s,EG0AINAND#RAMPS s(EAVINESSAND3WELLING s3KIN$ISCOLORATION s5LCERSAND"LOOD#LOTS You may have a serious medical condition, called Venous insufďŹ ciency.

USA Vein Clinics Will Help! With a non-surgical, minimally invasive and painless ss procedure, that takes only 15 minutes! Covered byy Medicare and most insurance plans up to 100%! 13 new york Tuesday, September 3, 2013

The Best Vein Center (by Home Reporter)

Grand Central: 144 E. 44th St., 6th Fl. New York, NY 10017 (212) 905-0090

Midtown: 22 E. 49th St., 5th Fl. New York, NY 10017 (212) 832-9127

West Side: 57 W. 57th St., Ste. 1012 New York, NY 10019 (212) 906-0140

Call

Wall Street: 39 Broadway, Ste. 610 New York, NY 10006 (212) 514-5868

718.732.0231

www.USAVeinClinics.com 2511 Ocean Avenue, Suite 102, Brooklyn, NY 11229

116-02 QueensBoulevard, Forest Hills, NY 11375

1153 First Avenue, Manhattan, NY 10065


21

ENTERTAINMENT

www.metro.us Tuesday, September 3, 2013

‘Fifty Shades’ movie adaptation casting revealed

CULTURE

Twitter feed We check in with some of Hollywood’s biggest names to see what they’ve been up to — in their own words, in 140 characters or fewer.

Today, Jane Fonda is trying new things and Steve Carell fears his plans are backďŹ ring. @Janefonda: Joined the improv troupe at Upright Citizens Brigade last night. Improv way harder to do than I expected. Fun though @SteveCarell: “Give a Stranger a Smile Dayâ€? results: 23% confused, 34% agitated, 43% annoyed.

Do we still care about “Fifty Shades of Grey�? I feel like the publishing phenomenon has already been cast aside to pop culture’s 99-cent bin. But then again, I’ve doubted the force that is middle-aged suburban women who live vicariously through poorly written fictional characters (see: “Twilight�) for some time. If you find yourself in the die-hard “Fifty Shades� category, you’ll be happy to know that casting for the film adaptation is settled. On Monday, author E.L. James tweeted, “I am delighted to let you know that the lovely Dakota Johnson has agreed to be our Anastasia.� Less than an hour later, James announced that “Sons of Anarchy� star Charlie Hunnam will be the male lead. You’ve seen Johnson in “Ben and Kate� as well “The Social Network.� Hunnam was just recently in “Pacific Rim.�

14

Talking points

Bynes still not on Twitter

Putting the labor back into Labor Day No rest for the famous. James Franco made two huge appearances over the weekend at the Venice International Film Festival, one for his latest directorial eort, “Child of God,â€? on Saturday and Gia Coppola’s “Palo Alto,â€? in which he stars, on Sunday, pictured here. Then, yesterday, he probably saddled up to a bar somewhere to watch the Comedy Central roast of himself, which aired last night but was ďŹ lmed on Aug. 25. And here I thought it was rough sitting in traďŹƒc? GETTY IMAGES

Did Mayer ask Perry to get married?

THE WORD Dorothy Robinson takes on the world of gossip. DOROTHY ROBINSON @dorothyatmetro dorothy.robinson@metro.us

DAKOTA JOHNSON WIREIMAGE

It turns out the mysterious “I love Drakeâ€? message on Amanda Bynes’ Twitter — her ďŹ rst post since being placed under forced psychiatric care earlier this summer — wasn’t actually from her. “Amanda’s Twitter account has been hacked. She is at the UCLA Medical Center with no access to phones or computers,â€? her attorney, Tamar Arminak, tells Radar Online. She is expected to remain in treatment for the foreseeable future.

2

Pippa Middleton and Nico Jackson may plan to marry. / GETTY IMAGES

Is Pippa Middleton engaged?

The British tabloid press is circulating rumors that the bridesmaid with the world-famous badonkadonk, Pippa Middleton, is secretly engaged to her 35-yearold financier boyfriend Nico Jackson. The Daily Mail says

that the fashionable couple, who have only been dating for six months, will announce the news after her 30th birthday festivities this Friday. What will we call the couple? Pippco? Nicpa? Or, my personal favorite — Nicopip?

John Mayer is reportedly so serious about his rekindled romance with Katy Perry that he’s already popped the question — but he didn’t get the answer he wanted, according to Grazia magazine. “John won’t run from Katy again. He knows his bad-boy reputation and what happened with Russell [Brand] hurt Katy, and he’ll do whatever it takes to show he’s the one she should marry,� a source says. But Perry apparently “doesn’t feel ready� to be married again. “John’s proposal really unnerved Katy,� the source says.

SPECIAL INVISALIGN SALE 0% fˆ˜>˜Vˆ˜}ĂŠ>Ăƒ low as fÂ™Â™Ă‰Â“ÂœÂ˜ĂŒÂ… $2500 invisalign express! exp. /0/13

FEEL CONFIDENT IN YOUR SMILE. ASK IF INVISALIGN IS RIGHT FOR YOU ~ THE CLEAR ALTERNATIVE TO BRACES

Invisalign Center Of NY bu!Nboibuubo!Efoubm!Tqb

ÓääÊ>`ÂˆĂƒÂœÂ˜ĂŠĂ›i]ĂŠ-Ă•ÂˆĂŒiÊÓÓä£ÊUĂŠĂ“ÂŁĂ“Â‡Ăˆn·ÓxÎäÊNʓ>˜…>ĂŒĂŒ>˜`iÂ˜ĂŒ>Â?ĂƒÂŤ>°Vœ“

Elite PROVIDER for the last 9 years

11 6

7

8

9

2

3


See more at www.metro.us

BOOKS

15

By the way, this book is 100 percent real Textual satisfaction. “Texts From Bennett” creator Mac Lethal wrote a novel. Two years ago, a Tumblr blog featuring the text messages of a “17-year-old white boy who thinks he’s a Crip, works at Amoco and has a girlfriend named Mercedes” almost broke the Internet. If you don’t know what we’re talking about, we assume you were living under a very large rock in late 2011, because “Texts From Bennett” might be one of the defining Internet memes of our time. The blog turned out to be the creation of Kansas City rapper Mac Lethal, aka David Sheldon, who felt that his wannabegangster cousin Bennett’s lovably crass, inane texts were too good not to share. Now, he has turned the Tumblr into a novel,

Lethal on Bennett

What’s Bennett like in real life? Gentle. Tattooed. Surprisingly supportive in all aspects of life. He’s the type of kid who would rather be happy for your good experience than try to impose his own on you. He has a big heart. ... [He’s] just misled. How is it that Bennett a narrative about Bennett and his mom, Lethal’s Aunt Lillian, living with him for a summer. Lethal checked in from his “Texts From Bennett Tour,” during which he’ll be signing copies of the book and performing live. Did you have any idea this was going to be such an insane phenomenon? I had no idea it would be this huge. The world wasn’t ready for a 17-yearold Crip with the inability to speak coherent English.

If you go

Mac Lethal: Texts From Bennett Tour

didn’t come across the Tumblr right away? People like Bennett don’t have access to the Internet. Bennett goes outside and is social with people. Which is strangely ironic considering all the detractors of the blog just sit around drinking Mountain Dew floats all day, playing “Call of Duty.”

People were weirdly pissed when they found out who you were, and Bennett’s veracity came into question. People get more upset and impassioned about “Texts From Bennett” than they do about me bashing religion or making political statements. ... It’s a wannabe gangster with a stuffed bunny rabbit.

Sept. 6, 6 p.m. (show at 7 p.m.) Tobacco Road 355 W. 41st St. $14 (signing is free) 917-921-4128 www.ticketfly.com

“big titties” because of his newfound fame. Has all this helped or hurt your music career? In 2013, it’s hard to gauge if careers can be helped or hurt. Miley Cyrus is the hottest thing in the world right now, but we can’t say that it’s necessarily helping her. I try not to focus on reputation or keeping track of my blemishes.

How did Bennett react? He just wanted to know if he could get cute girls with

ALEXANDRA CAVALLO

alexandra.cavallo@metro.us

Discover how an MBA can be a real game changer Whether it’s to start your own business, take the next step in your current role or change sectors, an MBA can make it happen. Join us at the QS World MBA Tour to meet with top local and international business schools: University of Pittsburgh, Penn State, Johns Hopkins, Carnegie

Mellon, Temple, UMass – Amherst, Rotman, ASU, INSEAD, IE Business School and many more...

Philadelphia MBA Event

September 17th Pennsylvania Convention Center | Registration from 3:30pm Panels and presentations from 4:00pm | Fair opens 6:30pm *You can attend at any time between 3:30 and 9:00pm

Register now at:

TopMBA.com/metro

“The world wasn’t ready for a 17-year-old Crip with the inability to speak coherent English,” says author Mac Lethal of the book spawned from his Tumblr blog. / PROVIDED


TURN BACK THE CLOCK WITH 50% OFF ANTI-AGING TREATMENTS

just 1 session‌eye brow lift, crows feet or reduce eye bags‌$399 per area

- Fractional for face..

permenant..reduces ďŹ ne lines.. tighten large pores $75

- Thermage for face‌

Anti-Aging, Laser and Slimming Center for men and women

one time treatment‌lifts sagging skin $899

- Gentle Wave‌reduce eye discoloration‌10 treatments $199

Become a Spa Jolie member FREE treatment with membership 50% off anti aging treatments: - Collogen mini facial‌$25 - Anti aging‌7 minute lift‌ temporally reduces lines‌ immediate results‌$25

- Clear and brilliant‌ permanent‌builds collagen, Ă€iĂ›iĂ€ĂƒiĂŠ>˜`ĂŠÂŤĂ€iĂ›iÂ˜ĂŒĂŠ>}ˆ˜}]ĂŠ reduces pigments‌$199 per

$20 Recession Specials Manicure and pedicure Waxing Brazilian, back, chest, full legs, full arms or buttocks area

$50 Spa Specials UĂŠ iiÂŤĂŠÂŤÂœĂ€iĂŠv>Vˆ>Â? UĂŠ{xĂŠÂ“ÂˆÂ˜Ă•ĂŒiʓ>ĂƒĂƒ>}i UĂŠĂŠ-Â?ˆ““ˆ˜}ĂŠLÂœ`ĂžĂŠĂœĂ€>ÂŤĂŠÂˆÂ˜VÂ?Ă•`iĂƒĂŠ mini facial UĂŠĂŠ>ĂƒiÀʅ>ÂˆĂ€ĂŠĂ€iÂ“ÂœĂ›>Â?ĂŠvÂœĂ€ĂŠv>ViĂŠÂœĂ€ĂŠ underarms

Slimming Specials... permanent and painless - Zerona‌lose 3-9 inches in 2 weeks..guaranteed 9 sesssions..$399 - Fat Blaster‌choose any area‌ melt fat....6 sessions $399 Laser Hair Removal...choose any areas...mix and match.. 6 for $399

Full body wax..$59

180 7th Ave South West Village, btwn W 11th St & Perry St

212 229-0399

We will beat all competitors by 10%

ENTERTAINMENT

www.metro.us Tuesday, September 3, 2013

- Thermage for eyes‌ In

Down the rabbit hole

Interview. Rebecca Hall became a “courtroom junkie� while researching “Closed Circuit.’�

Rebecca Hall has made a name jumping between theater and film, often playing reserved, even repressed, but always brainy women in “The Prestige,� “Vicky Cristina Barcelona,� “Please Give� and “The Town.� In the British thriller “Closed Circuit,� she plays a magistrate handling a terrorism case. Researching court proceedings sounds like it has the potential to be quite boring. You’d be surprised. I became a bit of a courtroom junkie. I’m always interested in peoplewatching. And it’s rare that I have something this concrete and a profession that’s entirely new to me to watch.

Quoted

“I’m always interested in people-watching. And it’s rare that I have something this concrete and a profession that’s entirely new to me to watch.� Hall, on researching “Closed Circuit�

Rebecca Hall plays a snooping lawyer in “Closed Circuit.� GETTY IMAGES

Do you tend to immerse yourself in research and Method acting when taking roles? I don’t really believe in the Method, but I believe in a method, and my method is different for every job. It’s probably much more of the Method than I’d care to admit. It’s a combination of things: saturation in the world of the script and finding the daily life of the character. I’ll do weird,

nerdy things like make a playlist or find each character’s own perfume. There are levels of going down the rabbit hole. And there are jobs I’ve gone far, far down and I don’t know how I’m going to get out. You play a lot of inhibited characters. Is it easier to do that than uninhibited characters? No. Emotionally it’s a lot easier to play uninhib-

ited — characters who everything they’re going through they have it on the outside. It’s easier to let go of, in a weird way, because they get their emotions out. Whereas characters where you have to hold that emotion inside, and you don’t have the catharsis of letting it out — those are the ones where I go home, sit in the corner and want to have a little bit of a cry.

MATT PRIGGE

matt.prigge@metro.us

DERMATOLOGY -EDICAL #OSMETIC3URGICAL$ERMATOLOGY

Â?Â?ĂŠ-ÂŽÂˆÂ˜ĂŠ ÂˆĂƒÂœĂ€`iĂ€ĂƒĂŠUĂŠÂ?Â?ĂŠ >ˆÂ?ĂŠ ÂˆĂƒÂœĂ€`iĂ€ĂƒĂŠUĂŠÂ?Â?ĂŠ>ÂˆĂ€ĂŠ ÂˆĂƒÂœĂ€`iĂ€ĂƒĂŠUĂŠÂ?Â?ĂŠ-ÂŽÂˆÂ˜ĂŠĂ€ÂœĂœĂŒÂ…Ăƒ

TAKE A DAY

TO REMEMBER

THE DAY s!CNE s#YSTS s7ARTS s6ITILIGO s(ERPES s2ASHES s%CZEMA s0SORIASIS s(AIR,OSS s3EBORRHEA s!GING3KIN s"IRTHMARKS s6$34$S

s3KIN#ANCER s3KIN'ROWTHS s'ENITAL7ARTS s3KIN!LLERGIES s.AIL$ISORDERS s-OLE2EMOVAL s#HEMICAL0EELS s,EG6EIN2EMOVAL s"ROKEN"LOOD6ESSELS s2ED3POTS s4ORN3PLIT%ARLOBE2EPAIR s#USTOM3KIN#ARE

s3CAR#ORRECTION s3CALP#ONDITIONS s&UNGAL#ONDITIONS s7RINKLE4REATMENT s4UMORS'ROWTHS s7HITE$ARK3POTS s#OMPLEXION0ROBLEMS s,ASER4REATMENTS s2ESTYLANE s(AIR2EMOVAL s"OTOX#OLLAGEN s3KIN2EJUVENATION s#OSMETIC3KIN3URGERY s,ASER0EELS

THAT CHANGED US

FOREVER.

All Insurance Plans, Unions, HMOs, PPOs Medicare & Medicaid Accepted Day, Evening & Weekend Appointments Available

Board Certified / University Affiliated

ÂŁ{xxĂŠ7iĂƒĂŒĂŠĂ›iÂ˜Ă•i]ĂŠ Ă€ÂœÂ˜Ă?]ĂŠ 9棊{ĂˆĂ“ĂŠUĂŠ/iÂ?\ÊÇ£n‡ÓΙ‡£xää Right next to the Post OfďŹ ce and Macys "RONX#O OP#ITY -IDTOWN-ANHATTAN "RONX4HIRD!VE 2100 Bartow Ave., Suite 211, 200 Central Park South, Ste 107 291 E. 149th Street, Bay Plaza Shopping Center Corner of 7th Ave & 59 St. Bet. Cortland & Morris 718.671.1000 212.262.2500 718.742.1000 1.800.545.SKIN (7546)

16

www.adv-derm.com

LEARN MORE AT

91 1 M E M O R I A L . O R G


ENTERTAINMENT

17

PAIN CLINIC

TV watch list

COMEDY

Are you hurting? Waking up with Pain?

‘Tosh.0’ Tosh reveals his newest fashion statement tonight. Please let it be high-waisted jean shorts.

WE CURE PAIN WE MANAGE PAIN WE TREAT PAIN

10 P.M., COMEDY CENTRAL

TRIGGER POINT INJECTIONS METRO CARDS SUPPLIED BY INSURANCE NO MORE PAIN - GAIN CONTROL

REALITY

‘Tickle’ You know that sketch they did on “SNL” a few months back, about all the Bravo spinoffs? This show is like the Discovery Channel version of that. Apparently it’s a spinoff of “Moonshiners” (a show about hicks who make moonshine) featuring a cast member named Tickle who ... makes moonshine? A backwoods hick named Tickle sounds like a great premise for a horror movie, by the way. 10 P.M., DSC

HABLAMOS ESPANÕL!

PODIATRY CLINIC We GET it done! W What will this guy wear next? / IAN WHITE REALITY

‘Catfish: The TV Show’ Tonight, the catfishee is the catfish — mind blown. This episode features a girl who has

been sending Photoshopped pictures of herself to her clueless online boyfriend, to fool him into thinking she looks much better than she actually does. Not cool, missy. 10 P.M., MTV ALEXANDRA CAVALLO

Sense

UÊ / a metro card for transportation UÊ / a nutritional meal UÊ9œÕʓ>ÞʵÕ>ˆvÞÊvœÀʜÀ̅œ«i`ˆVÊvœœÌÜi>À UÊ / a circulation test UÊ / your nails cut UÊ / rid of your foot pain

WE GET IT DONE Blipp for a sensational video here

MOST INSURANCES ACCEPTED SPECIALIZING IN LOWER EXTREMITY CARE: HAMMER TOES DIABETES/ ARTHRITIS HEEL PAIN FLAT FEET

953 SOUTHERN BLVD. LOBBY BRONX 9Ê£ä{x™ÊUÊ/i\ÊÎ{Ç°x™ä°ÓÇäÇ By Subway: Take the 6 train to Hunts Point Ave Take the 2 or 5 train to Simpson Ave By Bus: BX 19

Use the Universal Language. Join the Metro Photo Challenge 2013! Enter your photos in any of the six sense-categories and have the chance to explore West Africa as our photo reporter. Photography: Ck Ng, International Metro Photo Challenge 2012

ÇÓ£Ê1- Ê6 1 Ê ,""9 9Ê££ÓäÈÊUÊ/i\ÊÇ£n°Ó£n°Ènnn metrophotochallenge.com

By Subway: Take the J or M train to Flushing Ave ÞÊ ÕÃ\Ê Ê{ÎÊUÊ ÊxÇ


www.metro.us Tuesday, September 3, 2013

See more at www.metro.us

ENTERTAINMENT

18

‘First Date’ is a comedy for lovers Zachary Levi and Krysta Rodriguez (center) are testing the waters in “First Date,” at the Longacre Theatre. / CHRIS OWYOUNG

MEDICAL ASSISTING Medical Assisting Associate’s Degree, Clinical Medical Assisting Certificate or Medical Office Assisting Certificate

NO GED? NO PROBLEM!

FInancial Aid & Scholarships available for those who qualify

Get your Medical Assisting, Business Management or Paralegal Studies Degree and your high school equivalency diploma at the same time.

CALL TODAY

ENROLL TODAY!

(866) 688-3018 mildred-elley.edu

(866) 210-1579 mildred-elley.edu

GI Bill Approved

GI Bill Approved

Accredited Member, ACICS

Accredited Member, ACICS

25 Broadway, Floor 16 New York, NY

25 Broadway, Floor 16 New York, NY

September is National Preparedness Month. Stop by a National Preparedness Month event today to learn how to prepare for all types of emergencies. Stop by one of the following locations today:

BRONX BROOKLYN MANHATTAN QUEENS STATEN ISLAND

FORDHAM PLAZA BOROUGH HALL W 125TH ST. & ADAM CLAYTON POWELL JR. BLVD.

Theater. Talented actors and good music make this a date to keep. Ever been terrified of a first (especially blind) date? You’re not alone. “First Date” writer Austin Winsberg taps into that fear with wit and whimsy. Lyrics and music by Alan Zachary and Michael Weiner cleverly reinforce the lingering dread that your companion for the evening might just be a serial killer. After a crisp opening number about blind dates, the play focuses on slightly nerdy, mildly uptight finance-type Aaron (Zachary Levi), who’s waiting to encounter hip and happening, commitment-phobic art gallery worker Casey (Krysta Rodriguez). Initially

If you go

‘First Date’ Open run Longacre Theatre 220 W. 48th St. $35-$137 www.telecharge.com

they don’t hit it off. And every time they start to connect, something gets in the way. A case in point: Early on, they discover they grew up in the same general area and run through one Jewish-named acquaintance after another. Then Casey says, “Even though I’m not Jewish” and present action stops. All kinds of costumed relations materialize to convince Aaron that this shiksa is not the girl for him. Reminiscent of the dream sequence from “Fiddler on the Roof,”

it’s hilarious. The same device — freezing the action to have friends and relatives give bad advice — is used with finesse throughout the show. It’s the framework for just about every song, most of which are very funny. And its consistency holds the show together. The music is reliably enjoyable, mostly middleof–the road rock, with an occasional harder or folksier riff. The leads are strong singers and throw themselves full-throttle into their characters. The supporting cast of five — Bryce Ryness, Sara Chase, Kristoffer Cusick, Blake Hammond and Kate Loprest — shows great versatility playing a jumble of wackos with zest and humor.

MICHAEL BRACKEN

michael.bracken@metro.us

… 39 no,really. $0 to join and September is FREE!* 39th anniversary sale. Join now before rates increase Oct.1.

JAMAICA CENTER STATEN ISLAND CHILDREN’S MUSEUM

THROUGHOUT SEPTEMBER TH HRO ROUG UGHO UG HOUT HO U S UT EP PTE T MB BER ER CITIZEN CORPS & READY NEW YORK COMMUNITY FAIRS PREPAREDNESS OUTREACH EVENTS PARTNERS IN PREPAREDNESS WEBINAR SERIES FREE CPR TRAINING EVENTS

Forr more information informatiion Call 311 or vi visit isit NYC NYC.gov gov New York City

MySportsClubs.com * Requires a 1-year membership. Monthly dues are waived from 9.1.13 - 9.30.13. $0 initiation fee. Other fees apply. No cash value. Offer good through 9.8.13.


ENTERTAINMENT

19

‘The Butler’ and the boy band beatdown Box oďŹƒce. The One Direction ďŹ lm didn’t win the holiday weekend.

Top 5 earners

1 2 3 4 5

‘Lee Daniels’ The Butler,’ $20 million

TIRED OF

‘One Direction: This Is Us,’ $17 million

Though it had the edge over most of the weekend, the concert movie “One Direction: This Is Us� wound up losing to “Lee Daniels’ The Butler,� which threw in a last-second boy band beatdown to become the winner of the North American box office for the third week in a row. “The Butler� has raked in sales totaling more than $74 million, $20 million of which came from the fourday Labor Day weekend. “One Direction: This Is Us� grossed not much less, with $17 million over the four days. The film, unexpectedly directed by “Super Size Me� stunt doc-

MASKING

‘We’re the Millers,’ $15.9 million ‘Planes,’ $10.6 million

Forest Whitaker contemplates triumphing over One Direction in “Lee Daniels’ The Butler.�

‘Instructions Not Included,’ $10 million

ANNA MARIE FOX

umentarian Morgan Spurlock, raced to the top on Aug. 30, but saw its grosses drop by Aug. 31. In third and still going strong in its fourth weekend was “We’re the Millers,� starring Jason Sudeikis and Jennifer Aniston as drug smugglers. The biggest shock was the Mexican comedy-

drama “Instructions Not Included� cracking the top five. Directed by and starring television star Eugenio Derbez, it made a strong $10 million, making it the biggest ever opening for a Spanish-language film. Lastly, no one saw “Getaway,� which hit the No. 10 slot with a sad $5.5 million. MATT PRIGGE

THE PROBLEM? If you’re one of the thousands who’ve been prescribed a CPAP mask to stop snoring and treat your sleep apnea, you already know that going untreated is not an option. Ignoring your condition can lead to serious health issues. eOs sleep’s Board Certified physicians offer many different treatment options, some can take as little as 20 minutes.

For the treatment of snoring and sleep apnea

eO sSleep.co m Treatment protocols may differ from patient to patient. After a thorough exam, an eOs specialist will recommend the right solution for your particular condition.

888.460.5733

New York City • Long Island

DERMATOLOGY

PODIATRIST

Â?Â?ĂŠ-ÂŽÂˆÂ˜ĂŠ ÂˆĂƒÂœĂ€`iĂ€ĂƒĂŠUĂŠÂ?Â?ĂŠ >ˆÂ?ĂŠ ÂˆĂƒÂœĂ€`iĂ€ĂƒĂŠUĂŠÂ?Â?ĂŠ>ÂˆĂ€ĂŠ ÂˆĂƒÂœĂ€`iĂ€ĂƒĂŠUĂŠÂ?Â?ĂŠ-ÂŽÂˆÂ˜ĂŠĂ€ÂœĂœĂŒÂ…Ăƒ

The Most Advanced Techniques Used for Bunions and Hammertoes A new approach for treating Tendon Injuries for the Achilles, Tendonitis and Plantar Fasiitis (Heel and Arch Pain)

-EDICAL #OSMETIC3URGICAL$ERMATOLOGY

New Treatment For Heel Pain, Shockwave, PRP as seen on the front page of The New York Times

Platelet Rich Plasma Therapy (PRP)

Take the Foot Health Checkup s!CNE s#YSTS s7ARTS s6ITILIGO s(ERPES s2ASHES s%CZEMA s0SORIASIS s(AIR,OSS s3EBORRHEA s!GING3KIN s"IRTHMARKS s6$34$S

s3KIN#ANCER s3KIN'ROWTHS s'ENITAL7ARTS s3KIN!LLERGIES s.AIL$ISORDERS s-OLE2EMOVAL s#HEMICAL0EELS s,EG6EIN2EMOVAL s"ROKEN"LOOD6ESSELS s2ED3POTS s4ORN3PLIT%ARLOBE2EPAIR s#USTOM3KIN#ARE

s3CAR#ORRECTION s3CALP#ONDITIONS s&UNGAL#ONDITIONS s7RINKLE4REATMENT s4UMORS'ROWTHS s7HITE$ARK3POTS s#OMPLEXION0ROBLEMS s,ASER4REATMENTS s2ESTYLANE s(AIR2EMOVAL s"OTOX#OLLAGEN s3KIN2EJUVENATION s#OSMETIC3KIN3URGERY s,ASER0EELS

All Insurance Plans, Unions, HMOs, PPOs Medicare & Medicaid Accepted Day, Evening & Weekend Appointments Available

Board Certified / University Affiliated

s-YTOENAILSARESTREAKED DISCOLORED THICKENED s4HESIDEOFMYTOENAILSDIGINTOTHESKINANDHURT s)HAVEALARGEBUMPBEHINDMYBIGTOEORLITTLETOE WHICHISALWAYSRED s)GETANEXTREMELYPAINFULhCRAMPvINTHEAREAOFMYTHIRDANDFOURTHTOESWHENWEARINGSHOES s-YTOESARENTSTRAIGHT THEYARECROOKED BENTANDHURT s)HAVEPAINFULCALLUSESONTHEBALLOFMYFOOTWHICHKEEPBUILDINGUP s)HAVECORNSONMYTOESWHICHGETTHICKERNOMATTERWHATSHOESIZE)WEAR s4HEBOTTOMOFMYHEELHURTSALLDAY BUTITSWORSEWHEN)STEPOUTOFBEDINTHEMORNING s)HAVECRAMPSINMYLEGSWHICHALWAYSHAPPENWHEN)WALKTHESAMEDISTANCE s-YANKLESARESWOLLENMOSTOFTHETIME s-YFEETAREALWAYSDRYANDSCALY SOMETIMESTHEYITCH s-YFEETJUSTHURTALLOVERWHEN)STANDORWALKALOT s)HAVENUMBNESS BURNING INFECTION PERSISTENTPAIN SKINRASH OROPENSORES

Feet Hurt? Bunions? Hammertoes? Heel Pain?

.OW&EATURING

(ELPS%RADICATE&UNGAL.AILS ÂŁ{xxĂŠ7iĂƒĂŒĂŠĂ›iÂ˜Ă•i]ĂŠ Ă€ÂœÂ˜Ă?]ĂŠ 9棊{ĂˆĂ“ĂŠUĂŠ/iÂ?\ÊÇ£n‡ÓΙ‡£xää Right next to the Post OfďŹ ce and Macys "RONX#O OP#ITY -IDTOWN-ANHATTAN "RONX4HIRD!VE 2100 Bartow Ave., Suite 211, 200 Central Park South, Ste 107 291 E. 149th Street, Bay Plaza Shopping Center Corner of 7th Ave & 59 St. Bet. Cortland & Morris 718.671.1000 212.262.2500 718.742.1000 1.800.545.SKIN (7546)

www.adv-derm.com

If any of these apply to you, call today. Dr. Paul Drucker, DPM Dr. Martin McGrath, DPM 121 E. 60th St. Suite 3D

162-15 Highland Ave

(Between Lex & Park) New York, NY

(718) 658-9383

(212) 486-7333

Jamaica, NY 11432

Dr. Ernest Levi, DPM Midtown - Grand Central 30 E. 40th St., Suite 401

212-685-5100

0ATIENTISRESPONSIBLEFORCO PAYSDEDUCTIBLEs-OSTINSURANCEPLANSACCEPTED #OMPLETEFAMILYFOOTCAREs,ASERSURGERYAVAILABLE


+

TRAVEL

www.metro.us Tuesday, September 3, 2013

20

PLUS

Flying the friendly skies

The Top 5 airport locations to meet women

Port Royal rooms boast impressive views. Who says summer fun had to end yesterday? / PROVIDED

RYAN MOREY RHM PHOTOGRAPHY

Stealing one last summer vacation

(Based on 2,748 men who got a number)

1 2 3 4 5

Airport bar 33 percent Charge stations 28 percent Taxi cab line 17 percent

Morey’s Piers. We promise, this isn’t anything like that other Jersey Shore.

Airport store 11 percent

Waiting area 9 percent

Source: Misstravel.com

Traditionally, Labor Day (and the start of school) means the end of summer vacations and weekend jaunts to the beach. But as the gorgeous weather con-

tinues to hold out (thanks, global warming!), there’s no reason not to grab the kids or a group of friends for one last getaway. One location that’s easy to visit and especially perfect for families — and conveniently open through Columbus Day — is Morey’s Piers & Beachfront Waterparks in Wildwood, N.J. (www.moreyspiers. com). Just about a two and a half hour drive from NYC,

SPECIALIZING IN SURGERY AND AESTHETICS OF THE FOOT

DOWNTOWN PODIATRY SERVICES ORE

ER

AFT

BEF

BE

AF

FO

TE

RE

R

CORRECTION C ORRECTIO ION ION 1 - 877 - BUNION - 1ĂŠUĂŠ1 - 877 - 286 - 4661 www.DowntownPodiatry.com

MOST INSURANCE PLANS ACCEPTED Downtown 111 John St., Suite 1450

Midtown 315 Madison Ave., Ste. 513

FREE CONSULTATION WITH THIS AD

ALL PHOTOS OF ACTUAL PATIENTS

Cutting Edge Means Less Cutting

this shore spot is not quite like any other resort town or theme park city in the nation. Tracing its boardwalkentertainment origins back to 1969, Morey’s Piers is now the largest waterfront theme park in the Western Hemisphere, with more than 100 rides and attractions spanning about two miles of seascape. Between the piers are seemingly endless ice cream and pizza shops, arcades, souvenirs stands and other such carnivalesque fare. If you don’t have the energy to walk up and down all day, you can catch the Sightseer Tram Car for $3 per ride

(but many tourism booths sell reduced-price day and weekend passes). Although the area is primarily geared toward groups with younglings, adults can also have a good time at one of the many local bars and restaurants. Or, of course, you can just enjoy the beach and people-watching, plus the chance to get away from the hustling humdrum of city life just one more time this summer, basking in Wildwood’s all-too-easy-tobelieve fantasy that sunny days are here to stay.

T. MICHELLE MURPHY

tmichelle.murphy@metro.us

Overnight

Where to stay While visiting, you can also stay at a property owned by Morey’s, such as Port Royal, which offers apartment-like hotel rooms with balconies, views of the beach, mini-kitchens and plenty of space to spread out. Downstairs is a restaurant, a pool and a kiddie pool, a game room and a quieter lounge spot for parents. When you stay at one of the four participating Morey Resorts (starting at $99 per night), you can get a “Stay and Play� package through Sept. 15, which means big savings on unlimited access to Morey’s three piers (Mariner’s Pier, Adventure Pier, Surfside Pier) and two waterparks (Ocean Oasis and Raging Waters).

PASSPORTS & VISAS s0ASSPORT2ENEWALS ORIGINALPHOTOS s!LL6ISAS !LL#ONSULATES s$-6,ICENSE0LATES 2OCKEFELLER0LAZA .9#ONCOURSELEVEL !LICENSEDPRIVATESERVICEBUREAU 0ICK UPANDDELIVERYAVAILABLE

itseasyservices.com

877-33-ITS EASY

253(3%26)#% (OUR3ERVICE!VAILABLE

10% Discount with this Ad


See more at www.metro.us

MR. HARE The dreadlocked designer chats Frank Ocean, getting laid and his vices of choice.

COBBLING A CAREER The old adage, “The shoes make the man,” couldn’t ring more true for Marc Hare. In 2008, the designer lost his job in fashion marketing and went on to create, in his words, “shoes for every moment.” He designs for sybarites and socialites — men with a touch of the playboy about them. Not dissimilar from Hare, really, who has a passion for the sun and surfing. Still, the 42-yearold gets a lot done: Hare has steadily expanded his global footprint from having his shoes stocked on just one website, to global shipping at www.

mrhare.com, to opening his first brick-and-mortar store in September last year in the trendy-meetstrust fund district of Mayfair, London. There are some pretty outlandish men’s shoes out there at the moment, with Jimmy Choo and Christian Louboutin going down a flamboyant route. Would you ever embellish your shoes that way? It’s a different kind of thing to do what I do, but never say never. Those people have been making shoes for a long time and they put things

into their shoes that I don’t even know yet. I’m just blown away by the technical aspects. You once mentioned that you rarely give shoes away to celebrities. Have you changed your attitude about that? Not unless I have absolute respect for them — it’s quite personal. If I’m inspired by what you do and if what you do raises my daily game, then you can have some shoes. Like Tom Hardy — what a genius actor. Any time of day he can have them. Actually, Frank Ocean would be my ultimate person to

GET YOUR CAREER IN SHAPE!

WE OFFER UNIQUE, PROGRAMS IN:

PERSONAL TRAINING & MASSAGE THERAPY • Convenient Manhattan campus (Chelsea) • Flexible day and evening classes • Experienced faculty and staff • Financial aid (for those who qualify)

COME TO OUR OPEN HOUSE

Thursday, August 29th 11:00AM - 6:00PM

151 West 26th Street

1-888-771-4950 A century century of building careers in healthcare.

www.swedishinstitute.edu

Swedish Institute’s programs are registered with and regulated by the New York State Education Department and are accredited by the ACCSC. For important information on program costs, completion and placement rates, median debt incurred, etc., please visit www.swedishinstitute.edu/index.php/programs and click on the program of your interest.

see in my shoes. He has a pair but I’ve just never seen him in them. Women are said to judge a man by his shoes, so will your shoes help get a man laid? It’ll help, but it’s not a done deal. If you’re a dick in my shoes, you’re still a dick. So you’re sitting on the beach: a beer or a spliff? That depends on if it’s legal in that country.

RICHARD PECKETT

richard.peckett@metro.lu

Mr. Hare by the numbers He hasn’t shaved since he was 19 — he’s now 42. •

He’s been growing his hair since he was 17.

He sold 300 pairs in 2008, compared to 7,000 this year.

STYLE

21


PARENTING

www.metro.us Tuesday, September 3, 2013

Recipe. Mango salsa

Ingredients Serves six, ½ cup per serving •

2 large ripe mangoes

•

1 small cucumber

•

2 medium green onions

•

1 medium jalapeĂąo pepper

•

2 medium limes

•

½ tsp salt

•

Pinch of cayenne pepper

Optional •

1 medium bell pepper

•

Âź cup fresh cilantro

Rinse mangoes, cucumber, green onions, jalapeĂąo pepper, limes and bell pepper. Peel mangoes. Cut mango flesh from the pits. Cut cucumber in half lengthwise and remove seeds. If using bell pepper, cut in half lengthwise and remove stems and seeds. Dice mangoes, cucumber and bell pepper. Finely chop green onions. Cut jalapeĂąo pepper in half lengthwise. Remove stems and seeds and dice. If using it, rinse and chop cilantro. Cut limes in half and squeeze juice from each half into a medium bowl. Discard seeds and add mangoes, cucumber, green onions, jalapeĂąo, salt and cayenne pepper to the bowl with juice. If using, add bell pepper and cilantro. Mix well. Cover and refrigerate for at least one hour before serving. From Cooking Matters

Keep the kids in the kitchen Secret ingredient. Little hands can be a big help when it comes to cooking. Many parents’ intuition might be to shoo children out of the kitchen. But the next time your kiddos are underfoot while you’re making dinner, consider tossing them a task. Cooking with kids can be a great way to bond, create healthy habits and make something great for lunch. Sally Sampson, who created ChopChop, a cooking magazine for families, suggests starting small: Let them pick a vegetable at the farmers market to add to a salad, or throw veggies into a blender to create a smoothie. Kids can also create their own salad dressings. One thing she cautions against? Inviting the help for dessert. Cooking works even with the littlest ones. “You

Specializing in

SSENTIAL Skin Care www.essential-skin.com

22

Problem Skin Licensed Professionals Introductory Offers!

Free consultations

Treat yourself to the gift of beautiful skin; We offer results, not promises!

Getting the kiddos involved in the kitchen can be a bonding experience, as well as a way to open them up to diverse foods. / WAVEBREAK MEDIA

can describe what you’re doing,� Sampson adds. “You can have them hand you carrots. No age is too young.� And cooking can be much healthier — and cheaper — than parents might think. Massachusetts program Cooking Matters aims to

help low-income families make delicious, affordable meals. Director Alicia McCabe advises asking children each day whether they ate different colors in the rainbow — for example, if they ate anything green — and making it a daily game. “I think a lot of that

is just getting parents to imagine a slightly different way of doing things,� she says. One last tip: Don’t forget to include them in the cleanup.

ALISON BOWEN

letters@metro.us

DENTAL IMPLANTS SAME DAY TEETH!

Âş Âœ`ÞÊ>ĂƒĂƒ>}iʳÊ>Vˆ>Â?ĂŠf™™ÊUĂŠ ĂžiLĂ€ÂœĂœĂŠĂ‰ĂŠ ĂžiÂ?ˆ˜iÀÊ/ÂˆÂ˜ĂŒÂˆÂ˜}ĂŠfĂ“xĂŠUĂŠ >ÀÊ >˜`iÂ?ˆ˜}ĂŠfxä Diamond Microdermabrasion Only $50 Deep Cleansing Facial Reg $75 $40 for acne scars, sun damage skin, ďŹ ne lines, wrinkles, discoloration, blackheads.

Botinal Wrinkle Treatment Reg $160 $125 formulated with “BotoxŽ - Like� effect without injection. Effectively reduces the appearance of wrinkles and crow’s feet after only one treatment.

Deep cleans and refreshes all skin types.

Brightening Peel Reg $125 $75

ONLY

An antioxidant peel that helps to brighten and lighten discolored skin with highly concentrated L-Vitamin C and L-Retinol. All skin types.

$199

Acne Treatment w/Glycolic Acid Peel Only $45 Body Slimming Wrap or Salt Glow Special $50

For oily and blemish skin with excessive blackheads/ Sea salt scrub to exfoliate and polish or herbal slimming wrap to move toxins and promote inch loss. whiteheads, acne scars and discoloration.

Back/Chest Deep Pore Cleansing $75/$35 Back/Chest Glycolic Peel Only $55/$30 247 E. 50th St. 2fl btw 2-3ave NYC • Trains: E M 6 to Lexington Ave., Tel: 212-588-8866/212-253-9693

Kff[h;WijI_Z[E8%=ODYWh[

XoOkb_oW8ehkY^"9DC s0REVENTATIVE/"'9.SERVICESPAPTEST s4EENlRST'9.CONSULTATION s(06VACCINES FAMILYPLANNING s/FlCEPELVICULTRASOUNDs)5$ANDYEARS s2APID()6TESTINGCOUNSELING 34$SCREEN s-OSTINSURANCESACCEPTED

www.boruchmidwifery.com NEW*** BREAST/OVARIAN CANCER BLOOD TEST IN THE OFFICE (BRCA 1&2) covered by most insurances

1036 Park Ave, Suite 1B (E. 86th st & Park Ave), New York, NY 10028 (Take 4,5 &6 train to 86th st)   s6ISITUSON9ELP:OCDOC

EVERY WOMAN DESERVES TOP QUALITY OB/GYN CARE FROM TEEN YEARS TO GOLDEN AGE OF MENOPAUSE.

Featuring the New Dentium Titanium Implant System

OVERDENTURES $ WITH IMPLANTS .................... 4500 per upper or lower usual & customary fee $7500

per implant

+ Abutment $151 + Crown $1,000 Total Cost Only $1,350

No Hidden Costs! Offer good thru ™/3ä/2013

CALL FOR FREE

www.universaldentalcenter.com CONSULTATION: Come into Our World and Smile 1-800-287-TEETH Midtown Manhattan 212-753-0123 57 W. 57th St. Suite 610 Discounted Parking in NY

Ft. Lee, NJ 201-461-0003 1565 Palisade Ave. Free Parking in NJ

212-753-0123

Oral Surgeon and Periodontist on staff

*Implant, abutment and crown must be completed at our ofďŹ ce to qualify for promotional fees. New patients only.

Additional charges may occur for more complex cases. Ad must be presented for discount.


See more at www.metro.us

PARENTING

23

Ingredients

Recipe. Spicy chicken, tangerine and shiitake stir fry

GETTY IMAGES

In a large skillet, heat the oils over medium-high heat. Add the chicken and cook for 4 to 5 minutes or until lightly browned. Add broccoli, mushrooms, carrots, pepper and onion, and cook an additional 5 minutes, stirring frequently. In a small bowl, combine broth, hoisin sauce, soy

sauce, ginger, garlic and chili flakes. Add to chicken mixture and bring to a boil over medium-high heat. Reduce heat to medium to medium-low and simmer for 4 to 5 minutes or until sauce thickens. Add in tangerines and cilantro, toss lightly and serve over hot brown or jasmine rice. By Cat Cora

1 tbsp vegetable oil

1 tbsp sesame oil

2 pounds boneless, skinless chicken breast, cut into 1/2-inch pieces

1 bunch broccoli, cut

1 package shiitake mushrooms

3 carrots, thinly sliced

1 bell pepper, chopped

1 cup onion, diced

1 cup chicken broth

1/4 cup hoisin sauce

1 tbsp soy sauce

1 tsp ginger, minced

2 cloves garlic, minced

½ tsp crushed chili flakes (optional)

1 cup tangerine (or orange segments)

1 tbsp chopped fresh cilantro

C

Recipe. Black bean hummus

Recipe. Rainbow sandwich

Ingredients

1 cup store-bought, good quality hummus

½ cup cooked black beans

1 small ripe but firm plum tomato seeded and finely chopped

1 clove garlic, finely minced

1 tsp paprika

In a molcajete or bowl, crush the garlic and 2 tablespoons of the chopped cilantro. Add the black beans and mash lightly with a fork. Add the prepared hummus and combine while making sure to incorporate the crushed garlic and cilantro at the bottom of the molcajete or bowl. Add

½ tsp ground cumin

½ tsp of salt

¼ tsp of white pepper

Drizzle of extra-virgin olive oil

3 tablespoons of chopped cilantro

Plantain strips and blue corn chips for serving

the paprika, cumin, salt, and white pepper. Mix well. Carefully fold in all but 1 tablespoon of the chopped tomato. Drizzle the top with olive oil and garnish with remaining cilantro and tomato. Serve with plantain strips and blue corn chips. By Ana Quincoces for IMUSA Scan to Win!

Call 212-779-3493 24/7

YOUR FOOD SCRAPS at GREENMARKET

Book www.SmileArtistNY.com

Wash your hands with soap and water, then gather all your kitchen gear and ingredients and put them on a clean counter. Start with whole-wheat bread and your favorite sliced cheese, then lay on the color. From ChopChop Ingredients

Red: tomatoes, red peppers, radishes

Orange: carrot salad

Yellow: yellow bell peppers, hummus

Green: spinach, lettuce, pesto, fresh herbs, cukes, avocado, sliced green apple

Purple: cabbage slaw

“You too can have a Natural Gorgeous SEXY Smile for as low as $99/month by NEW 3D imaging CAD/CAM Laser @ Relaxing Holistic Park Ave Dental Spa!*

50% off ends 9/15/13 Enter to Win!

Dental Plan: Reduced to only $20 per month! “I had a Quick, Comfortable, Pleasant visit” 1

Express Straight Teeth in 5 months, No Braces!* OR

Drop off household fruit and vegetable scraps at select Greenmarkets citywide.

FAST instant Braces for only $1999 Implants/2 visit Extreme Smile MakeOver Proven Laser * Dentistry

2

BEST Fees & Quality Guaranteed on all procedures as low as $999 3

Save

was 650

Now Only $199 – Exam/Cleaning $49

Visit www.GrowNYC.org/compost or call 212.788.7964 for details, locations, and hours

4

or Natural Strong Dentures as low as $999 5

Discover Natural Veneers as low as $999 6

GrowNYC and DSNY Food Scrap Compost Program A program partnership between the City of New York, the NYC Department of Sanitation, GrowNYC, and community partners.

Whiten all Silver Fillings/ as low as $999 Treatment of pain, Bad Breath/Halitosis, Gummy Smile, Gingivitis. Laser Dentistry, and 500+ other treatments. *Promotions end 9/15/13. Must qualify. Limitations apply. Not all patients qualify for the same treatments.


PARENTING

www.metro.us Tuesday, September 3, 2013

24

Don’t worry about a thing Free your mind. How you can help bright children feel less stressed and anguished.

$1

Plotting out what steps to take next can be a great trait in children. But for many youngsters, this might cross the line into crippling anxiety. Therapist Allison Edwards addresses this in her new book, “Why Smart Kids Worry: And What Parents Can Do to Help.� For kids who excel intellectually, she says, the burden of worry can be overwhelming. Edwards gave Metro some tips for over-anxious children:

Laser Teeth Whitening

(w/Check-up and Cleaning*)

Square breathing

*covered by your PPO Dental Plan

Up to 12 Shades Whiter in just 1 hour Call (212) 537-6923 - Open Weekends and Evenings 30 East 40th 3TsBLOCKFROM'RAND#ENTRAL3TATION

0H  sWWW:OOMFORCOM

Hot ’n horny hookups.

(exp 9/30/2013)

Teaching your child this breathing method is useful in the early stages of anxiety. Breathing re-

LAPTOP OR MOBILE

WE’RE VE VERSATILE ERSATILE

Therapist Allison Edwards suggests that anxiety can come with smarts, but techniques like breathing and naming the fears can help children cope. / FUSE

laxes the body, counting takes their mind off fear, and it’s a simple tool they can take anywhere.

your child to come to you, go to them. Changing the dynamic around your child’s anxiety is most useful for children who are afraid of being alone or overly dependent. Their natural disposition toward independence will have them pushing back but also conquering their fears.

Worry time Setting aside 15 minutes a day for a child to express their worries is useful for children who repeat the same fears or talk incessantly about their anxieties. Worry time gives anxious minds a boundary and awareness while satisfying the child’s need to be heard.

Naming the anxiety Finding a name for your child’s anxiety, like Worry Walter or Scary Sally, helps children who are over-

Brain plate come with fear and feel like something is wrong with them. Putting a name to their fears helps your child gain control and normalizes their anxiety.

Over checking Instead of waiting for

Using a paper plate, outline the areas of your child’s life and then fill in only what is “on their plate� for today, to help children who are overwhelmed by future events and fear of tomorrow. The Brain Plate helps them relax and focus on the present. METRO

MAY WAH VEGETARIAN MARKET

VEGAN

CHICKEN LEGS CHICKEN NUGGETS GINGER CHICKEN FISH FILLET HOT DOGS / CHEESE 213 HESTER STREET

1 month FREE access with the promo code

METRONYC Offer ends Oct 15, 2013 There is no afďŹ liation between the device manufacturer and Squirt.org

6 TRAIN TO CANAL ST BETWEEN CENTRE AND BAXTER


HIGHER EDUCATION

25

Historically black colleges think hard about funding ED DUCATIION GUID DE 20 013 Metro is your source for educational content – schools, testing, paths of study, financing options and more. Don’t miss our remaining Education Guides for 2013: • September 17 • October 15 • November 5 • December 3

FOR ADVERTISING: shari.white@metro.us or 212.457.7824

METRO IS THE MOST READ FREE DAILY NEWSPAPER IN NEW YORK WITH OVER 730,000 DAILY READERS! In his book, Schexnider proposes the idea that historically black schools need to market themselves to other races. / GETTY IMAGES

Business model. Diversifying on campus may be the solution to falling enrollment rates. When Alvin Schexnider took over as chancellor at Winston-Salem State University in 1996, he rubbed more than a few faculty members the wrong way. Schexnider ascended to the chancellor’s office with a vision for radically adapting the historically black college to the changing marketplace of higher education. By 2000 he was gone, five years earlier than he had planned. But Schexnider feels there’s a lesson in this experience for all HBCUs (historically black colleges and universities.) His latest book, “Saving Black Colleges: Leading Change in a Complex Organization,” calls for sobering business-minded alterations to the HBCU model. “I’m not the kind of guy who likes to nibble around the edges. Change doesn’t have to be radical, but it certainly has to be intentional,” says Schexnider. “I didn’t take the time to develop a management team before I made changes, so

FOR ADVERTISING: advertising@metro.us or 212-457-7735

Source: Scarborough R1 2013

By the numbers African-American students that attend a historically black college: •

1974: 18.4%

2001: 12.9%

City Tech’s Green Advanced Manufacturing Collaborative The CareerPATH Program in Manufacturing

EARN COLLEGE CREDITS TOWARDS A DEGREE IN MANUFACTURING

ALL EXPENSES PAID NYC College of Technology (City Tech), CUNY’s designated college of technology, offers stackable, credit-bearing industry-recognized credentials in Mechanical Engineering Technology and Industrial Design Technology. Wrap-around support services and job placement assistance are provided to program participants.

Source: National Center for Education Statistics

ARE YOU ELIGIBLE? when there was a cry, there was no one to take the spear in the chest but me.” Not surprisingly, Schexnider feels these institutions need — first and foremost — a strong president, willing to focus the school’s mission toward greater specialization. He also calls for greater creativity in marketing. Specifically, he believes HBCUs need to market themselves to other races, including whites. “I think it definitely needs to part of the business model. Sometimes there’s a lot of resistance from alumni, but in this new world diversity has to be embraced, not just at majority institutions,” he says. “You can still be a historically black university and embrace diversity. The two aren’t mutually exclusive.”

x 18

years old (preferably 24 or older) School Diploma/GED or college credits x US Citizenship or legally authorized to work in the US x Displaced workers and incumbent workers, veterans, unemployed, underemployed, and prospective college students x Take the CUNY Assessment Test (CAT) x Demonstrate strong math skills x High

CALL TO RESERVE A SEAT IN OUR UPCOMING INFORMATION SESSIONS ON:

September 10th & September 19th, 2013 The CareerPATH Program Advisor 718- 552-1150 gamc@citytech.cuny.edu www.citytech.cuny.edu/bitc/manufacturing New York City College of Technology Business & Industry Training Center Dept. of Mechanical Engineering Technology & Industrial Design

This workforce solution was funded by a grant awarded by the U.S. Department of Labor’s Employment and Training Administration. The solution was created by the grantee and does not necessarily reflect the official position of the U.S. Department of Labor. The Department of Labor makes no guarantees, warranties, or assurances of any kind, express or implied, with respect to such information, including any information on linked sites and including, but not limited to, accuracy of the information or its completeness, timelines, usefulness, adequacy, continued availability, or ownership.

Alvin Schexnider / PROVIDED

BRUCE WALSH

letters @metro.us

The CUNY CareerPATH Program is an equal opportunity employer / program. Auxiliary aids and services are available upon request to individuals with disabilities.

@GAMCCityTech


LETTERS AND GAMES

www.metro.us Tuesday, September 3, 2013

Letters

Horoscope

Virgo | Aug. 23-Sept. 22. Deal with personal responsibilities before they make your life difficult. Ask for help if you need it.

Sagittarius | Nov. 22-Dec. 21. Bravado and control will help you bring about changes, but expect to face scrutiny from an outside source. Be honest.

Pisces | Feb. 19-March 20. Listen carefully to what’s being said. What you offer will exceed what you get in return. Consider working independently.

Gemini | May 22-June 20. You’re in a good cycle for travel. You will meet interesting people and discover something to incorporate into your everyday routine.

Libra | Sept. 23-Oct. 22. A new activity or hobby will result in a relationship that could be seminal. Be confident and share your thoughts, and the world will be your oyster.

Capricorn | Dec. 22-Jan 20. Size up your financial and professional situations. Consider ways to improve and maintain your hardwon achievements.

Aries | March 21-April 20. Take on a challenge that will boost your ego. If you share your feelings, you’ll charm someone.

Cancer | June 21-July 22. Practical improvements on the home front will open up more time. You’ll be drawn to something unusual.

Scorpio | Oct. 23-Nov. 21. Check out your options regarding living arrangements and the places and opportunities that entice you. Change what isn’t working for you.

Aquarius | Jan. 21-Feb 18. Enjoy time spent with someone special. Take part in events that can change your financial situation and lead to contacts. It’s a good time to make a big pitch.

Taurus | April 21-May 21. Consider what everyone else is doing before you make a final decision regarding a career matter. Being cautious will save you from getting into an argument or getting hurt.

Leo | July 23-Aug. 22. Put your energy to good use today instead of wasting time being angry. Focus on positive changes that will enable you to accomplish more. Don’t give in to demands. BERNICE BEDE OSOL

More supply than demand in grad market Re: ‘Graduates pointless without jobs’ (Metro, Aug. 28) What letter writer Joe Alloy fails to allow for is that there is a disproportion between jobs that pay well and people who are properly educated or trained to fill those jobs. The other side of the problem is that employers, also overlooked

Sudoku: Easy and hard Online

8

7

8

4

8

1

9

9 4

2

2

1

7

8

1

7

6

8

5

8

7

9

2

1 3

4

8

6

4 3

1

3 9

1

2 3

5

8 7

6

4

1

9 4

5

26

8

1

4

9 8

3

2 3

7 6

4

6 2

1

1

How to play Fill in the grid so that every row, every column and every 3x3 box contains the digits 1-9. There is no math involved. You solve the puzzle with reasoning and logic.

Read letters at Metro.us

here, have learned over the last five years that higher productivity with fewer employees appears to be working (for them) for the shortterm; this in turn causes more demand for lesser jobs, lowering wages for those who CAN get the jobs while leaving even more people without gainful (if you can call it that) employment. Where I DO agree, although not on who to blame, is that the creation of more jobs is necessary. Fix the roads, fix the infrastructure, boost social services — now THERE IS WORK FOR PEOPLE (are you listening, Congress??) JEREMY NEWMAN, VIA EMAIL

letters@metro.us

In addition to news, features, updates and more, Metro is posting letters to the editor at Metro.us.

Keep them as brief as possible, preferably under 100 words. Metro reserves the right to edit all letters. Please include your name and contact info.

Online You can use your smartphone to discover today’s crossword answers — right now! Download and open the Blippar app on your smartphone and hold the screen over the puzzle — it’s that easy!

ord w s s o Cr

Crossword

Across 1 Punt 5 Dexterity 9 Throw angrily 14 Charles Lamb 15 Castor, to Pollux 16 Bailed out 17 V.I.P. protector 19 Nut holders 20 “Wheel of Fortune” buy (2 wds.) 21 Adams or McClurg 22 Coastal fliers 23 Rank above knight 25 I cannot tell — — 26 Barracks dwellers 27 Gift for Dad (2 wds.) 30 Largest mammal 33 Raises the alarm 34 The Big Apple 36 Pit 37 Where Hawkeye served 38 Goes wrong 39 Belly dance lute 40 Prom rentals 41 Awfully nice 42 Drumming sound (hyph.) 44 Letter after pi 45 Envelope abbr. 46 Reservation 50 Uncertain 52 Young Lennon 53 Billy -- Williams

54 Privilege 55 Fragrant flowers 57 Inner self 58 Sanskrit dialect 59 Camp furnishings 60 Gold or lead 61 Busy as — — 62 Melville opus

Down 1 Shish — 2 Ms. Massey of old films 3 Apple drink 4 Kendall or Starr 5 Recital pieces 6 Expect 7 Foal’s parent 8 Finale 9 Dry goods 10 A Barrymore 11 Lazing about 12 After-tax amounts 13 Mdse. 18 Spirit in a bottle 22 Helen, in Spain 24 Gawk at 25 Buenos— 27 Fortuneteller’s card 28 Concerning (2 wds.) 29 Ceremonial fire 30 Reporter’s question 31 College credit

32 Swit costar 33 Amazon, for one 35 Tex. time zone 37 Poker fund 38 Furry Jedi ally 40 Gridiron pass 41 Was polished 43 Puget Sound port 44 Rock band crew member 46 “Uncle Miltie” 47 Figure of speech 48 Groovy 49 Painter’s undercoat 50 Cooked enough 51 No future — — 52 Import car 54 Buffet standby 55 Academic stat 56 Pvt.’s superior

Weekend’s answer

As the world’s largest global newspaper, Metro has more than 18 million readers in more than 100 major cities in 23 countries. • • Metro New York 120 Broadway, New York, NY 10271 • main 212-457-7790 • to advertise 212-457-7735 • sales fax: 212-952-1505 • National and Executive Sales Director Ed Abrams • U.S. Circulation Director Joseph Lauletta • U.S. Marketing Director Wilf Maunoir • email sales advertising@metro.us • email distribution distribution@ metro.us • Advertisements appearing in Metro are published in good faith. Metro does not endorse and makes no representations about any of the advertising content appearing in its pages. Metro is not responsible for any loss or damages whatsoever resulting from readers using the services of its advertisers. Readers should exercise caution when replying to advertisements, especially those which require any form of payment, and, where necessary, should seek independent legal advice. • Managing Editor, Gossip Editor Dorothy Robinson, dorothy.robinson@metro.us • National News Editor Jill Gadsby, jill.gadsby@metro.us • City Editor Allen Houston, allen.houston@metro.us • Sports Editor Mark Osborne, mark.osborne@metro.us • Features Editor, Music Editor Pat Healy, pat.healy@metro.us • Deputy Features Editor, Home/Style/Food Editor Tina Chadha, tina.chadha@metro.us • Entertainment Editor Alexandra Cavallo, alexandra.cavallo@metro.us • Film/Tech Editor Matt Prigge, matt.prigge@metro.us • Wellbeing/Travel Editor Meredith Engel, meredith.engel@metro.us • Careers/Education/Dating Editor Julia Furlan, julia.furlan@metro.us • Copy Chief Tracie Michelle Murphy, tmichelle.murphy@metro.us


27

SPORTS

Cruz back on practice field week before season starts Banged-up backs

NFL. The Giants wide receiver plans to be 100 percent for the Sept. 8 season opener. Giants wideout Victor Cruz predicted he’d be back in the lineup once the real preparation for the season opener commenced this week, and true to his word, No. 80 was on the field and practicing with his teammates yesterday. Cruz, who hasn’t practiced since mid-August after suffering a heel contusion and was seen in a walking boot and on crutches a day later, went through all the drills. “I actually got the clearance [Monday],” said Cruz. “I went in the training [room] and I was like, ‘How

Questions remain in backfield

Cruz was back on the practice field after missing the final preseason game. / GETTY IMAGES

about a little individual today?’ And they was like, ‘You’re cleared to practice today. Just go out there and if you feel anything just let us now.’ So that’s what we did and that’s what they let me do.” Cruz never wavered

from the belief that his injury was a “short-term speed bump” and said his only trepidation going forward is how his heel will react in the days following practices. “He’s a guy [who] knows the offense very

well, so it won’t take any time, timing-wise, to get back on the same page,” quarterback Eli Manning said.

TONY WILLIAMS

3 SPORTS

The Giants got down to their 53-man roster over the weekend, with a few question marks surrounding the running back position. With Andre Brown out for a month or more, David Wilson will be carrying the majority of the load. “Don’t get confused by my size, I’m a physical guy,” said Wilson. “I’m from the country, so I grew up chopping wood and building houses with my dad. … I’m well put together.”

Watch online

Find video and recap of yesterday’s White Sox-Yankees game at: Metro.us/sports.

TONY WILLIAMS

sports@metro.us

Source: Just 10 percent NOTHING BEATS chance Sanchez ready BEING HERE If Brady Quinn is the answer to the Jets’ quarterback situation, then the question must be an awfully discouraging one. It is inside one week before the Jets open the season against the Buccaneers, and there still is no clarity to their quarterback situation. A source close to the situation tells Metro New York that “there is a 10 percent chance that Mark [Sanchez] will be ready to start this weekend.” Sanchez did not practice with the Jets yesterday as he continues to recover from a shoulder injury suffered two weeks ago. Rookie quarterback

Mark Sanchez / GETTY IMAGES

Geno Smith didn’t say if he’s been told he’ll start Week 1, but the focus is squarely on whether Sanchez is available to play.

“I’m trying. We’re making a good push and we’ll see where I’m at,” Sanchez said. “I just want to take this thing slow, take it the right way and make the right progression without reinjuring it.” The Jets signed former Browns and Chiefs quarterback Brady Quinn yesterday after he was cut by the Seahawks this past weekend. Head coach Rex Ryan diminished talk that the signing of a veteran like Quinn signals that Sanchez will not be available to play this weekend. Quinn’s contract with the Jets becomes guaranteed for the season on Saturday. KRISTIAN DYER

TICKETS AVAILABLE MOST SESSIONS

Holmes nears return

THROUGH SEPTEMBER 9 The Jets might be getting their one true playmaker on the field in time for the Sept. 8 season opener against the Buccaneers. •

Santonio Holmes has gone through a tortur-

ously long rehabilitation process, with today being 11 months to the day since he suffered his Lisfranc injury at the start of the fourth quarter of a Week 4 blowout loss at home to the 49ers.

“I’ve said from Day 1 that I hope he plays because I think Holmes is a difference maker as a player,” Ryan said. “I can tell you that he hopes to play. I guarantee you that he hopes he plays.”

TUES

DAY EVE

• •

WED

THURS

FRI

SAT

 • • • • • • TICKETS AVAILABLE  SOLD OUT

SUN

MON



USOPEN.ORG Ticket availability subject to change. ©2013 USTA. Photo © Getty Images.


SPORTS

www.metro.us Tuesday, September 3, 2013

Federer bounced from Open U.S. Open. The all-time great was knocked out of 2013’s ďŹ nal major by Tommy Robredo. New York fans have never seen Roger Federer and Rafael Nadal play one another in the U.S. Open. And now it’s possible they never will. When the draw came out, the two archrivals seemed destined for their first matchup in Flushing Meadows, a quarterfinal that would have made for an electric atmosphere inside Arthur Ashe Stadium on Wednesday night. But while Nadal was still playing his fourth-round match in Ashe against Philipp Kohlschreiber, Federer shocked the tennis world by losing to Tommy Robredo — a man he had held a 10-0 career record

“I’m trying hard out there, trying to make it work. Sometimes it just doesn’t happen,� Federer said after the loss. / GETTY IMAGES Quoted

“I beat the best guy of all times in a great stadium like this in the U.S. Open in a place where he loves to play.� Tommy Robredo

against — 7-6 (3), 6-3, 6-4, after the match was moved to the cozier Louis Armstrong Stadium from Ashe because rain altered the schedule. Robredo closed out arguably the biggest win of his career with a service winner and a sunken Federer walked off the court, his head down as he waved

Directory

Legal and Professional Services

“I can help you get a fresh start� Howard S. Warner, Attorney Evening and Sat appts available

!BSOLUTE$IVORCE FREE Consultation

starting

at

$

239

Yankees 9, White Sox 1 Phil Hughes haters earned a point in their favor yesterday after his start was cut very short by a rain delay and David Hu stepped in to pitch 5 2/3 innings of one-run ball. Derek Jeter was 2-for-4 with two RBIs. Dylan Axelrod was hammered for Chicago, allowing six runs in 2 1/3 innings.

•

Braves 13, Mets 5 The Braves jumped on Daisuke Matsuzaka early (three innings, six earned runs) and the bullpen often in a rout by Atlanta. Freddie Freeman homered o Matsuzaka in the second inning as part of a ďŹ ve-RBI day, while Paul Maholm got the win.

BANKRUPTCY Not Sure Who to See for Bankruptcy? Want an Attorney Who Will Provide Friendly, Caring, Personal Service at a Low Price? Then Call

*AY3IMONs

OWED OVERTIME? LAW OFFICE OF WILLIAM C. RAND 488 Madison Ave., Suite 1100, New York, N.Y. 10022

Bankruptcy Only, Chapter 7 Specialist, Low Fee, One Set Fee, Installments, Personalized Attention, Free Consultation

The Bankruptcy Whisperer ACCIDENTS & INJURIES

Medical Malpractice Truck/Car/Products/Police Brutality/False Arrest/Brain Injury/Cerebral Palsy/Erbs Palsy/Lead/Cancer/Scars/Burns/Assault & Injury on Premises/Construction Accidents/Surgical Errors/Slips and Falls

WHEN THE CARELESS NEEDLESSLY ENDANGER THE PUBLIC SAFETY CAUSING HARM, YOU MAY BE ENTITLED TO COMPENSATION

212-926-0050 Rawlins Law Firm

No fee unless successful Free Consultation 24/7

Over 60 Years of Experience

DINERMAN BERGAM & DINERMAN

8::@;<EK6 #AR"US4RAINs3LIP4RIPAND&ALLs%LEVATORs2EAL%STATE

80 Broad St., 5th Floor, NY, NY 10004

www.absolutedivorceinc.com

Health & Beauty

â&#x20AC;˘

ALL ACCIDENT CASES HANDLED

+ court fees

212-504-2985

LEGAL PROBLEM? I KNOW HOW TO WIN FOR YOU!

212-286-1425

Free Consultation

Must bring in ad - Expires 9/9/13

The Mets and Yankees both played day baseball in honor of the holiday. Both games were blowouts, but only one was a win for the local team.

sports@metro.us

FIRED?

917-783-0906s$795+ Court Fees

Hablamos EspaĂąol

ADAM ZAGORIA

Joseph B. Maira, Esq., 1229 Ave.Y, Suite 5C, Bklyn. Cell 718-938-3728

BANKRUPTCY

Debt relief agency. We help people ďŹ le for bankruptcy relief under the bankruptcy code.

ed, which is very disappointing, especially on a quicker court.â&#x20AC;? Despite his poor play this year, Federer has long maintained he has no plans to retire anytime soon.

Labor Day baseball

32 Court Street, Suite 805, Brooklyn

To advertise in this directory call Johan Svennerholm at 212.457.7823 or email JOHAN.SVENNERHOLM@METRO.US

Flushing (QNS): 39-01 Main St., Suite 400 Manhattan: 116 West 23rd Street, 5th ďŹ&#x201A;oor

to the fans. â&#x20AC;&#x153;I kind of feel like I beat myself, you know, without taking any credit away from Tommy,â&#x20AC;? Federer said. â&#x20AC;&#x153;Clearly he was making sure he was making many balls. It was up to me to make the difference and I couldnâ&#x20AC;&#x2122;t. â&#x20AC;&#x153;I kind of self-destruct-

28

DIRECTORY

To advertise, call Samantha Miller at 212-457-7831 or email samantha.miller@metro.us

ÂŁxäĂ&#x160; ," 79Ă&#x160; 9 Ă&#x160;UĂ&#x160;­Ă&#x201C;ÂŁĂ&#x201C;ÂŽĂ&#x160;Ă&#x201C;Ă&#x2C6;Ă&#x2021;Â&#x2021;Ă&#x2021;xĂ&#x2021;x &REE#ONSULTATION

ASK FOR MARIA

(ABLAMOS%SPAĂ&#x2014;OL


www.metro.us

DIRECTORY

Medical Research

Get PAID to help ďŹ nd a cure!

To advertise, call Andrea Paz at 212-457-7831 or email andrea.paz@metro.us

Suffering from General Anxiety Disorder (GAD)? If you (or someone you know) have been diagnosed with generalized anxiety disorder (GAD), and is between 18 and 70 years old, you may be eligible to participate in a clinical research study. QualiďŹ ed participants will receive study care, physical exam and laboratory tests andmay be compensated for time and travel.

For more information, please call the Brain Resource Center at:

212-877-0424

GCO 09-0194

Seeking Research Volunteers

Did you recently quit heroin? Interested in a research treatment that could help decrease the craving? Please contact our research staff to learn more about our clinical trial.

212-824-9313 Compensation will be provided for your participation. All Information Kept ConďŹ dential

Participate in local clinical trials at www.ZipTrials.us FREE ONE ON ONE RESEARCH COUNSELING HAVE YOU SUFFERED A

42!5-! DO YOU USE

!,#/(/,OR $25'3 TO #/0% AN OPPORTUNITY TO RECEIVE COMPENSATION

Suffering from terrible anal pain? Does it hurt to go to the bathroom? You may have an anal ďŹ ssure. (Weâ&#x20AC;&#x2122;re completely serious and may be able to help) You may qualify for a research study of an investigational cream. All study related medication and treatment will be provided at no cost. You do not need health insurance to participate. If eligible, you will be compensated for time and travel.

To ďŹ nd out if you qualify, email VEN307@ventrusbio.com call 855-4-PAINAF (855-472-4623) or visit www.clinicalstudysites.com

Have you been diagnosed with osteoarthritis of the knee? Are you tired of taking your pain medication? Manhattan Medical Research is conducting a clinical trial to test the effectiveness of a new treatment for osteoarthritis of the knee. You may qualify to participate in this study if: UĂ&#x160;Ă&#x160;9Â&#x153;Ă&#x2022;Ă&#x160;Â&#x2026;>Ă&#x203A;iĂ&#x160;LiiÂ&#x2DC;Ă&#x160;`Â&#x2C6;>}Â&#x2DC;Â&#x153;Ă&#x192;i`Ă&#x160;Ă&#x153;Â&#x2C6;Ă&#x152;Â&#x2026;Ă&#x160;Â&#x153;Ă&#x192;Ă&#x152;iÂ&#x153;>Ă&#x20AC;Ă&#x152;Â&#x2026;Ă&#x20AC;Â&#x2C6;Ă&#x152;Â&#x2C6;Ă&#x192;Ă&#x160;Â&#x2C6;Â&#x2DC;Ă&#x160; Ă&#x17E;Â&#x153;Ă&#x2022;Ă&#x20AC;Ă&#x160;Â?ivĂ&#x152;Ă&#x160;Â&#x153;Ă&#x20AC;Ă&#x160;Ă&#x20AC;Â&#x2C6;}Â&#x2026;Ă&#x152;Ă&#x160;Â&#x17D;Â&#x2DC;ii UĂ&#x160;9Â&#x153;Ă&#x2022;Ă&#x160;>Ă&#x20AC;iĂ&#x160;{xĂ&#x160;qĂ&#x160;näĂ&#x160;Ă&#x17E;i>Ă&#x20AC;Ă&#x192;Ă&#x160;Â&#x153;Â?` UĂ&#x160;9Â&#x153;Ă&#x2022;Ă&#x160;>Ă&#x20AC;iĂ&#x160;VĂ&#x2022;Ă&#x20AC;Ă&#x20AC;iÂ&#x2DC;Ă&#x152;Â?Ă&#x17E;Ă&#x160;Ă&#x152;>Â&#x17D;Â&#x2C6;Â&#x2DC;}Ă&#x160;ÂŤ>Â&#x2C6;Â&#x2DC;Ă&#x160;Â&#x201C;i`Â&#x2C6;V>Ă&#x152;Â&#x2C6;Â&#x153;Â&#x2DC;Ă&#x160;Ă&#x20AC;i}Ă&#x2022;Â?>Ă&#x20AC;Â?Ă&#x17E; UĂ&#x160;9Â&#x153;Ă&#x2022;Ă&#x160;Â&#x2026;>Ă&#x203A;iĂ&#x160;Â&#x201C;Â&#x153;`iĂ&#x20AC;>Ă&#x152;iĂ&#x160;Ă&#x152;Â&#x153;Ă&#x160;Ă&#x192;iĂ&#x203A;iĂ&#x20AC;iĂ&#x160;ÂŤ>Â&#x2C6;Â&#x2DC;Ă&#x160;Â&#x2C6;Â&#x2DC;Ă&#x160;Ă&#x17E;Â&#x153;Ă&#x2022;Ă&#x20AC;Ă&#x160;Â&#x17D;Â&#x2DC;ii Study related tests and treatment are of no cost to you, and you may be compensated for your participation in the study.Ă&#x160;

For more information, please contact the study coordinator: Michael- at 917-409-3932 or E-mail myang@manhattanmedicalresearch.com

s2%3%!2#(42%!4-%.4345$9!44(%#)49 #/,,%'%/&.%79/2+ s).$)6)$5!,4(%2!093%33)/.3 s3500/24)6%!.$#/.&)$%.4)!,%.6)2/.-%.4

212-650-5177 THE CITY UNIVERSITY OF NEW YORK 138TH & AMSTERDAM

HELP ANOTHER WOMAN GET PREGNANT. BECOME AN EGG DONOR

Women between the ages of 21 and 32 can help make a womanâ&#x20AC;&#x2122;s dream come true. For more information, please call our conďŹ dential toll-free number

1-866 GIVE EGG Or visit our website www.Columbiaeggdonor.Org

EGG DONORS ARE COMPENSATED $8,000

Urinary Incontinence and Overactive Bladder Research Study You may be eligible if you: 29 new york Tuesday, September 3, 2013

s!REMALEORFEMALE ATLEASTYEARSOLD s(AVEBEENDIAGNOSEDBYYOURDOCTORWITHOVERACTIVEBLADDERATLEASTMONTHSAGO s%XPERIENCEURINARYINCONTINENCELEAKINGURINE ANDURINARYFREQUENCY s(AVETRIEDAVAILABLEMEDICATIONSANDHAVENOTBEENHAPPYWITHTHERESULTS s!REWILLINGANDABLETORECORDINFORMATIONREGARDINGBLADDERFUNCTIONINTOA PAPERDIARY

&ORMOREINFORMATIONANDTOSEEIFYOUQUALIFY

PLEASECONTACT

.955ROLOGY!SSOCIATES .EW9ORK .9s  

METRO IS THE FASTEST GROWING NEWSPAPER IN NEW YORK WITH A DAILY READERSHIP INCREASE OF:

15%

+

Source: Scarborough R1 2012 / R1 2013

FOR ADVERTISING OPPORTUNITIES: advertising@metro.us or 212-457-7735


Tuesday, September 3, 2013

TO PLACE AN AD:

866-900-9473

CLASSIFIEDS.METRO.US

NEWYORKCLASSIFIEDS@METRO.US

CLASSIFIED AD DEADLINE: 5PM TWO (2) BUSINESS DAYS BEFORE PUBLICATION IMPORTANT INFORMATION: All classified advertising is subject to the terms and conditions of the applicable Metro Classified rate card and to approval and acceptance at Metro U.S. option. Metro US reserves the right to edit, reject, cancel or reclassify an ad, and reserves the right to convert any classified advertising to alternative formats for use and publication in other Metro U.S. publications. It is the advertiser’s sole responsibility to check each ad the first day it is published. Metro U.S. assumes no responsibility for any reason, for any error or omission in any ad.

Healthcare

Healthcare

General Help Wanted

Programming (Java, .Net, QA) Networking (A+, MCSE, CCNA) Medical Assistant Dental Assistant ESL ...( Free if Qualify ) Financial Aid if qualify, Licensed by NYSED

Nurse Aide (CNA) Patient Care Tech (PCT) EKG & Phlebotomy Pharmacy Tech / CPR

Customer Service

Call: 866-487-5432 Access Careers, Brooklyn

25 Elm Pl, # 201, Brooklyn, New York LOBBY STAFF NEEDED START IMMED. FT/PT ALL SHIFTS NO EXP REQUIRED UP TO $17 P/H BENEFITS INTEVIEWING ASAP CALL: 646.998.5980

Miscellaneous

www. AccessCareers.Edu

Transportation / Travel

General Help Wanted

Wanted TLC Licensed Drivers Wanted TLC licensed drivers 6 days a week Saturdays and national holidays off). -We pay $130 per day, $780 per week in form of check(1099). -Contact Igor at 917 560-0780 from 1 - 8pm.

General Help Wanted

SALES & MARKETING!

Miscellaneous

METRO NEW YORK IS LOOKING TO HIRE THE BEST IN ADVERTISING SALES

Looking for sales representatives with media and online sales experience.

No experience necessary. Training provided. Background & drug test required. Paid Wkly. Up to $750+/wk! 888-493-5456

reserve your space

Training

HELPER/DRIVER WANTED

DEADLINE: two (2) business days prior to publication at noon.

866-900-9473

TV / Film / Musicians Upholstery Custom furniture shop needs a person who is a full springer with knowledge of upholstery. Must be able to communicate in English. Call 212-489-3308

Actors/Models/Dancers/Extras All ages/All types NEEDED!!! For film/TV/ print/comm/catalog/runway. NO EXP NEC. All sizes welcomed! Call (646) 807.7402

General Help Wanted QUEENS FLUSHING AUTO COMPANY Looking for Purchaser. Good Bonus! 347-348-7810

Lobby Attendant/Concierge. FT/PT Morns/Overnights. Benefits+ Union 401k No felonies/pays 13.45$-20.00$ For info call ; 646-841-7799

  A BAR NONE SECURITY  

Doorman/Corporate Officers. FT/PT Morns/Noon/ Overnights. Full Benefits+Union. No felonies/Pays 10.75$-21.45$ #347.331.8689

Tooling Designer Great benefits, including 401k and medical. Salary commensurate with experience. CAD expertise a requirement Knowledge of wire EDM a plus Minimum 5 years experience. Bronx location Fax resume to 718893-2758

Business Opportunity-Owner/ Operator-Open House Deliver newspapers as an Owner/Operator under agreement with our company in Manhattan. Earn up to $1,000+/month. Must have dependable car. Call 646-277-3795 for details

TELMKTRS

F/T EXP ONLY!

MADE YOU LOOK!!!

# CALL NOW # GUARDS NEEDED #

# SECURITY GUARDS/FIRE GUARDS #

Want solutions for all your problems? Mr. K heals the body, stops witches, defeats enemies, and offer powerful protection. Do you have problems with relationships, family, financial, property, court, or immigration cases? Then call Mr.K 646-200-1513

SERIGNE 917-679-1518 Spiritual Reader & Coach bring back loved one, stopped infidelity in Relationship, marriage, fixed Domestic, issues, job, success in business,court case, removed bad luck, witchcraft, black magic. Stop enemy & offer protection. FAST RESULTS africanpsychicnyc.com

Source: Scarborough R1 2013

CONTACT MEDIASALES@METRO.US

Security / Law Enforcement

Psychic

SPIRITUAL READER

The fastest growing newspaper in New York and the #1 free daily in the United States is growing like crazy and we need the best to join our team.

Sales / Marketing

IN PRINT & ONLINE

Now All You Have To Do is Call. Salary + Comm. + Bonus = $8.-$12/Hr. David (212) 563-7500

AMER MED CAREER TRAINING CTR MEDICAL ASSISTANTS MEDICAL LAB TECHNICIAN NURSING ASSISTANTS PHYSICAL THERAPY AIDE (718) 657 1562 OR (718)-739-6768 or 718-526-3626 EZ pymnt plan/Placement Assist avail Lic. by NYS Education Dept.

EXTERMINATION/Termite Certification

SHEIKH SALEEM 917.254.6647

MYSTICAL AFRICAN MEDIUM & SPIRITUALIST SOLVES ALL YOUR ISSUES, LOVE SPECIALIST, REUNITE LOVERS, BUSINESS, JOB, COURT, LUCK, BLACK MAGIC, PROTECTION, IMPOTENCY, IMMIGRATION, ETC. ENGLISH AND FRENCH SPEAKING. QUICK RESULTS www.africanmedium.com

Miscellaneous

REDUCE YOUR CABLE BILL! Cleaning Do You Like Dust Bunnies? We Don’t. Top Quality Residential and Office Cleaning. 5% OFF First Cleaning. (917) 780-7463

Careers

Careers

HIGH SCHOOL DIPLOMA FROM HOME Call 24/7 for free brochure 1-800-264-8330

UNIQUE SPIRITUALIST INDIA PANDIT: SIDDHARTH

www.diplomafromhome.com Benjamin Franklin High School

Miscellaneous

Miscellaneous

FREE PERSONALITY TEST Test the 10 key traits that determine your future success and happiness, and find out how to improve them. (212) 921-1210 Church of Scientology of New York 227 W 46th St.

NOTICE OF FORMATION FORMA ATION T of Talent Talent Meet Rep, LLC Art. of Org. filed with Sec Secy. y. of State State of New YYork ork (SSNY) on 05/16/13. Office loca tion: location: NY County County.. SSNY has been designa ted as an aagent gent upon designated whom process aagainst gainst the LLC may be ser ved. The SSNY shall served. mail a copy of an anyy process aagainst gainst the LLC is to: TTalent alent Meet Rep, PP.O. .O. . Box 319 NY Y, NY NY, 10108. Purpose: an wful act anyy la lawful or activity

of Jamie Mendell LLC. Art. of Org. filed with the Sec y. Secy. of Sta te of New YYork ork (SSNY) State on 07/02/2013, office loca tion: New York York o County, County, location: SSNY designated designated as agent agent of the LLC upon whom process against against it may be ser ved. SSNY shall mail a served. copy of process to: The LLC, 1474 THIRD AVENUE, AVVENUE, #114, NEW YORK, NEW YORK, 10028 Purpose: Any Any lawful lawful business.

SO CALL NOW 877-356-0526

No computer needed!!

NOTICE OF FORMATION FORMA AT TION of KAREN LITZY PHYSICAL THERAPY PLLC. PLLC Art. of Org. Org. filed with the Secy.. of State of New Y York Secy ork (SSNY) on 07/08/2013, office location: New York York County County,, SSNY designated as agent of the LLC upon whom process process against it may be served. SSNY shall mail a copy of pr ocess to: The LLC, 165 process E. 83red. 83red. Apt 3D, New Y ork, NY 10028. Purpose: York, Any lawful business

NOTICE OF FORMATION FORMA ATION T

Get an All-Digital Satellite System installed for FREE and programming starting at $19.99/mo. FREE HD/DVR upgrade for new callers,

6-8 weeks accredited Get a Diploma! Get a Job!

Legal Notices

Palm Reading Expert. Removes Black magic, Voodoo, Obeya, Withchcraft, Butu, Jadoo & all Evils and Gives Protection. Solves problems like Love, Marriage, Business, Job, Money, Kids, Health, Court, Relationship, Divorce, Children Problems, Personal Matters, Negativity and Gives 100 % GURANTEED SOLUTIONS. 107-11 120th, 107th Ave Richmond Hill, NY

NOTICE OF FORMATION NOTICE FORMA ATION T of ANZ Consulting E i Engineering, i PLLC Arts At PLLC. of Org. filed with Secy. Secy. of State Staate of NY (SSNY) on August 2, 2013. Office loca ation: New YYork oork County location: County.. SSNY designated designaated as aagent gent of LLC upon whom process against against it may be ser ved. SSNY shall mail served. process to: PLLC c/o Nass & Roper La w, 14 Penn Penn Law, Plaza, Suite. 2004, New YYork, oork, NY10122 . Purpose: an la wful activity anyy lawful activity..


Tuesday, September 3, 2013

Legal Notices

Miscellaneous

Healthcare, Business, Technology and Graphic Arts. Independence University

NOTICE IS HEREBY GIVEN

that a license, Number 1271136 Liquor, Beer & Wine has been for Liquor, applied for by the undersigned to Liquor, Beer & Wine at retail retail sell Liquor, in a Restaurant/Bar under the ol Law Alcoholic Beverage Contr Control York, o at 311 East 60th St., New York, York o County NY 10022 in New York premises consumption. for on premises Street LLC d/b/a The Jef frey 60th Street Jeffrey

NOTICE IS HEREBY GIVEN that a license, Number 1270628 for Restaurant Wine has been applied for by the undersigned to sell Wine & Beer at retail retail in a Restaurant under the Alcoholic Beverage Control Control Law at 5318 8th Ave., Ave., v Br ooklyn, NY 11220 Brooklyn, for on-pr emises consumption. on-premises New Louxingta Restaurant LTD LTD T

NOTICE IS HEREBY GIVEN that a license, Number 1271260 for On-premise On-premise Liquor has been applied for by the undersigned to sell Liquor, Liquor, Wine & Beer at rretail etail in a Restaurant under the Alcoholic Beverage Control Control Law at 13617 41st A vve., Flushing, Ave., NY 11355 for on-premises on-premises consumption. LCLE Bar Corp.

NOTICE IS HEREBY GIVEN

ONLINE DEGREES Call 877-466-0879

NOTICE TO THE PUBLIC

INDEPENDENCE UNIVERSITY

AFFORDABLE HOME PROGRAM START WITH AS LITTLE AS

$

1,000

Online Degrees Commercial

Wondering what to do with your degree? Start training in Sonography! You could create ultrasound scans used by physicians to make a medical diagnosis. Call now to begin training in Diagnostic Medical Sonography!

Call now to get started!

'//$ä#2%$)4 ä"!$ä#2%$)4 ä./ä#2%$)4

ALL CASES PROCESSED CALL NOW FOR FREE REGISTRATION MANY HOMES ARE FULLY RENOVATED

Rooms ALL MANHATTAN/BRONX

Furnished Rooms for Rent! Cable/Internet Ready! Move in today! All Utilities Inc. Starting just $150/wk! Call us now:(212)368-2685

Affordable Furnished Rooms in Manhattan

Call now, to get your copy! (866) 933-2444 Sanford-Brown Institute

New York, NY Garden, City Licensed by the New York State Education Department Programs vary by campus sanfordbrown.edu

Medical Assistant Surgical Technologist Respiratory Therapist

NEEDED: People to train in Non-invasive

CARDIOVASCULAR TECHNOLOGY!

866-932-7444

Utilities Included Same Day Move In Cable, TV, Internet No Credit Check $125 per week Call 212-862-0457

100â&#x20AC;&#x2122;s Available, All Boroughs

New York, NY â&#x20AC;˘ Garden City, NY Licensed by the New York, State Education Department

sanfordbrown.edu Programs vary by campus

Sanford-Brown understands the needs of working adults. We We offer short-term programs in the healthcare ďŹ eld. Complete in less time than you think.

â&#x20AC;˘ HEALTHCARE ADMINISTRATION â&#x20AC;˘ DENTAL ASSISTANT (MEDICAL BILLING AND CODING) â&#x20AC;˘ PHARMACY TECHNICIAN

888-350-8333

sbmelville.edu

Apartments Pets Wanted

E. Flatbush # 2 Br Unfurnished Apt Call Owner 718-462-1777 Bet. 7pm-9pm

Dog Grooming Special

E A R N Y O U R A S S O C I AT E S D E G R E E, NOT just a certificate! OTHER PROGRAMS:

START TODAY! ST AR RT TODA AY Y! SBI Campus â&#x20AC;&#x201C; an afďŹ liate afďŹ liate OF3ANFORD "ROWN -ELVILLEs-ELVILLE .9 OF 3ANFORD "ROWN -ELVILLEs-ELVILLE .9

â&#x20AC;˘ TRANSFER CREDITS ACCEPTED â&#x20AC;˘ DAY/EVE/WEEKEND COURSES

CALL TODAY!

Tired of your Job?

Private Entry Bath Cooking 1 Person/2 Person $125wk/up room rentals 212-697-3962

$35 Bath/Haircut. 20 lbs and under. Day/Saturday/ Evening (limited offer) American Academy of Pet Grooming. Call for appointment 212-686-3890

Want to pursue a new a career?? Not sure where to start??? With training in Medical Assisting, you too can start a new chapter in your life! Degree program available!

866-942-6444

â&#x20AC;˘ EARN COLLEGE CREDITS â&#x20AC;˘ FLEXIBLE SCHEDULES

1-855-626-3504

OUR ADVISORS WILL HELP EVERY STEP OF THE WAY 254 W 54th Street

Call now to get started! SBI Campus â&#x20AC;&#x201C; an afďŹ liate of Sanford-Brown - Melville Melville, NY

www.mandl.edu

MANDL

SCHOOL

THE COLLEGE OF ALLIED HEALTH

sbmelville.edu

Breeders Business Opportunities

h ADORABLE YORKIE PUPPIES h CALL TRACY 718 236-1515

CAREERS FOR THE 21ST CENTURY! Â&#x2021;3$5$/(*$/ *$/ Â&#x2021;&28575(3257,1*

Never Shave Again! Laser Hair Removal Specials Lip, Chin or Underarms $50 Pamper Yourself Brazilian or Bikini $150 Treatments 2 for $99 ($300 value) Deep Pore Cleansing Facial 60 Minute Aromatherapy Massage Ninaâ&#x20AC;&#x2122;s Day Spa & Laser Center 212.594.9610

h English Bulldog Puppies M/F h MALTESE PUPPIES Adorable Toy & Teacup sizes. Call 718-259-2295

h YORKIE PUPPIES FOR SALE h Toy & Teacup sizes. Call: 718-259-2295

CALL NOW TO REGISTER F O R FA L L S E M E S T E R

Call now to get started!

Apartments

that a license, Number Pending for Wine & Beer has been applied for by the undersigned to sell Wine & Beer at retail retail in a Restaurant under the Alcoholic Beverage Control Control Law at 186 A vve. A, New Y o ork, NY 10009 Ave. York, for on-premises on-premises consumption. 186 A Enterprises, Inc.

# # SHIH-TZU PUPPIES # #

VITAL TAL CAREERS START HERE!

Train in this exciting ďŹ eld and you could help save lives!

(718) 544-1200

NOTICE IS HEREBY GIVEN

sanfordbrown.edu

Get your copy of the Healthcare Career Guide Learn about opportunities, and helpful tips to get you started

3.5% TOTAL DOWNPAYMENT NEEDED

Affordable Home Program LLC NYS. Licensed Real Estate Brokers 116-16 Queens Blvd Suite 202, Forest Hills, NY 11375

866-861-1444

Sanford-Brown Institute New York, NY â&#x20AC;˘ Garden, City Licensed by the New York, State Education Department Programs vary by campus

Want to work in Healthcare?

BROOKLYN,QUEENS,BRONX, WESTCHESTER AND LONG ISLAND

that a license, Number 1272597 for Beer & Wine has been applied for by the undersigned to sell Beer & Wine at rretail etail under the Alcoholic Beverage Control Control Law Law,, at a Arts & Crafts fair/ market located at 29 Norman A venue, v Br ooklyn NY 11222 Avenue, Brooklyn for on-pr emises consumption. on-premises Br ooklyn Bazaar LLC Brooklyn

Call

877-676-1058

Miscellaneous

X-Lg 2 Br $1500 # 3 Br, 1.5 Ba $1700 +

PELHAM PARK AREA

Near #2 Sbwy

SEARCH IT. FIND IT. BUY IT.

(REALTIME WRITING)

Â&#x2021;0(',&$/2)),&( 2)),& ),&( ( Â&#x2021;&/26('&$37,21,1* 63(&,$/,67 67 NEW 1 /2*< 12 PROGRAM Â&#x2021;+($/7+,1)250$7,217(&+12/2*<

NYCI HVWDEOLVKHG

NEW YORK CAREER INSTITUTE

Â&#x2039;;9(5:-,9 *9,+0;: (**,7;,+ Â&#x2039;=( (7796=,+

7KH&ROOHJHRI/HJDO 0HGLFDO3URIHVVLRQV

Now Enrolling for f Fall Term! &ODVVHVVWDUW6HSWWK

7KHUH is still time!

Call Â&#x2021;Â&#x2021;Â&#x2021;ZZZQ\FLHGX \FL HGX 'D\(YHQLQJ 6DWXUGD\&ODVVHVÂ&#x2021;'HJUHH &HUWLÂżFDWH3URJUDPV

3$5.3/$&(1<& &RQYHQLHQWO\/RFDWHGLQ/RZHU0DQKDWWDQ

For Disclosure Information, view Program Details @ nyci.edu


www.metro.us

Are you suffering from

AGONIZING KNEE PAIN? Are you facing the prospect of a knee surgery? AposTherapy is a clinically proven, non-surgical treatment for knee pain, based on a personalized, innovative biomechanical foot-worn device. At AposTherapy, we understand the misery of living with chronic pain and the worrying prospect of undergoing surgery. We have helped many patients to achieve lasting pain relief and to return to do the things they enjoy. The treatment works by bringing your body to optimal alignment, thus reducing the pressure on the painful area in your knee. The device simultaneously retrains and stimulates the muscles while walking, ultimately re-educating the neuromuscular system to adopt a corrected and less painful walking pattern.

Keep doing what you love

Developed by doctors from the fields of orthopedics and sports medicine Non-surgical and drug-free Clinically-proven for lasting pain relief, improvement in mobility and quality of life Highly convenient treatment program that fits easily into your daily routine On-going care for optimal results

855-999-APOS www.apostherapy.com

With practices in US UK Singapore Israel Individual results may vary. This advert is not intended to discourage other treatments or surgical intervention where recommended. Always seek the advice of your physician or other health providers with any questions you may have regarding a medical condition. References: 1. Bar-Ziv Y et al., Arthritis Journal 2013. 2. Elbaz A et al., Clinical Biomechanics 2010. 3. Haim, A,. et al., Journal of Biomechanics 2011.

32 new york Tuesday, September 3, 2013

Call us to learn more or to schedule a FREE NO OBLIGATION ASSESSMENT with one of our specially trained therapists

Over 40,000 patients treated worldwide

20130903_us_new york  
Advertisement