Page 1

IF YOU THOUGHT NEWMAN WAS AN EVIL CHARACTER ...

Family Adventure

THIS SUNDAY

PAGE 20

$5

OFF

JUST WAIT ’TIL YOU SEE WHAT WAYNE KNIGHT IS DOING ON “EXES.”

A PRINCESS + PIRATE

WITH CODE METRO

All Inclusive Sunday Cruise - Puppet Show - Magician - Live Music

- Cruise Around The Statue of Liberty - Bagged Lunch

- Arts & Crafts - Face Painting June 23, July 14, July 21, July 28 + more!

NEW YORK CITY’S #1 FREE DAILY NEWSPAPER

Wednesday, June 19, 2013 www.metro.us | t: MetroNewYork | f: MetroNewYork

Hi Katy, Divorce? K Thx. -RB PAGE 14

Ice Cube talks Kings of the Mic PAGE 16

212-987-9200 www.KiddieCruise.com Like Us on Facebook

Follow Us on Twitter

Hurricane zones paint a stormy pic Updated findings. The hurricane evacuation zones released yesterday cover 600,000 more New Yorkers. Where do you fall? According to the city, 37 percent of residents now live in emergency evacuation zones. Safety barrier. Updates to the city’s plan could help cut down on damage caused by natural disasters. PAGE 02

Make your salad even healthier PAGE 28

Pop some tags: Refine thrift finds PAGE 22

Under surveillance PAGE 03

A new bombshell lawsuit by several legal groups that was filed yesterday hopes to put an end to the NYPD’s Muslim surveillance program. / GETTY IMAGES


1 NEWS

Top 3

Trending online at Metro.us

1

No, no, no! Twoarmed vibrator banned in U.S. in patent row

2

VIDEO: Watch BMX pro perform breathtaking bike tricks

3

VIDEO: Man rages at Wendy’s employees for putting cheese on his hamburger

See more at www.metro.us

www.metro.us Wednesday, June 19, 2013

NEW YORK

2

New photos released in Times Square bombing Renewed effort. The FBI and NYPD are seeking new leads in the case. The FBI and the NYPD yesterday announced a reward of up to $65,000 for information leading to the identification, arrest and conviction of a suspect or suspects involved in the unsolved 2008 bombing of an Army recruiting station in Times Square. New video surveillance footage of the suspect or suspects and new photos were also released by the FBI. “Someone, somewhere, knows something about a bomber who’s still on the run,” FBI Assistant Director-in-Charge George Venizelos said. The FBI believes the person or people responsible for this bombing may also have been behind two other bombings in New York City: one in 2005 at the British consulate and another in 2007 at the Mexican consulate. The FBI and the NYPD will be using the hashtag #BikeBomber to release information about the attacks and solicit information via Twitter. The surveillance video and photos are being displayed on digital billboards throughout the northeast, including in Times Square. The bombing occurred

The FBI and NYPD released new photos from the bombing, including the suspect’s bike and bomb shrapnel. / COURTESY OF FBI New information

Public’s assistance

The FBI believes that the person responsible for the bombing might have worked with others. •

The bombing occurred in the early morning hours of March 6, 2008.

One of the photos shows part of the explosive device used in the attack.

The ammunition used in

the device was typical of that used in warfare in Iraq and Afghanistan. •

The suspect’s bike was reportedly found in a dumpster near Madison Avenue and 38th Street.

The FBI and the NYPD will be using the hashtag #BikeBomber to solicit information about the incident.

“Today we’re asking for the public’s assistance in finding those responsible and encouraging the public to look closely at these photos and video.” George Venizelos

in the early morning hours of March 6, 2008. The consulate bombings that the FBI suspects could be related also occurred in the early morning hours, between 3 a.m. and 4 a.m.; those bombs were also set by a person on a bicycle. According to the FBI, the suspect rode a blue Ross bicycle and got off his bike at West 43rd Street and Seventh Avenue. The suspect then apparently placed a bomb at the Army recruiting station, lit a fuse, and fled on the bicycle south on Broadway. The bike was reportedly found in a dumpster near Madison Avenue and 38th Street. The suspect was last seen wearing a gray sweatshirt and pants of an unknown color, the FBI said. The height, weight, age, sex and race of the suspect are still unknown. While the suspect appears to have been working alone, the FBI said that it’s possible there were as many as five other people working as lookouts or as a surveillance team in Times Square at the time that the bombing occurred. Authorities are urging anyone with information to call the FBI at 212-3841000. Callers can remain anonymous.

DANIELLE TCHOLAKIAN

danielle.tcholakian@metro.us

Quoted

“The surveillance program has prevented me from fulfilling my duty as an imam. I cannot believe this has happened in the country that I know and love.”

City releases hurricane evac maps

Imam Hamid Hassan Raza

MAYOR’S OFFICE

Final updates to New York City’s hurricane evacuation zones were announced by the city yesterday. The new maps now include 600,000 residents who weren’t covered under the old zoning system. The updated zone system now places a full 37 percent of New Yorkers in an emergency evacuation zone. It also swaps out the old alphabetical

zoning system in favored of a numbered system. “The new zones incorporate the best-available data and will help the City to more effectively communicate to those most at risk, depending on the characteristics of a particular storm,” said Deputy Mayor Cas Holloway. To support the recent zoning updates, the city has also upgraded its

Hurricane Evacuation Zone Finder to support mobile phones, which will help residents find their evacuation zone using GPS technology. Updates to the evacuation plan could prevent future damage from storms like superstorm Sandy, which left 42 New Yorkers dead and millions of dollars in damage, the city said. BREANNA BISHOP


NEW YORK

3

New study

Brooklyn has most traffic deaths in city Brooklyn has the highest rate of traffic deaths in the city, and an alarming number of motorists drive faster than the speed limit in the borough, a study shows. According to the new report by the advocacy

group Transportation Alternatives, a total of 79 Brooklyn residents were killed in traffic crashes in 2011, and 23,000 others were injured. Queens followed with 67 fatalities in 2011, the Bronx had 65, Manhattan had 45 and Staten Island only had 12 fatalities. The group tracked the speed of drivers in Bay

Brooklyn traffic / GETTY IMAGES

Ridge, Canarsie, Greenpoint and Midwood, and found that a full 88 percent of surveyed motorists drove at unlawful speeds. According to the group, speeding is the leading cause of fatal crashes and kills more New Yorkers than drunk drivers and drivers on cell phones combined. LAURA SHIN

A child attends a rally yesterday at City Hall to announce the lawsuit against the city. / GETTY IMAGES

Groups to sue over Muslim surveillance Spying. The groups say that the NYPD Muslim surveillance program is illegal. The American Civil Liberties Union, the New York Civil Liberties Union and other legal organizations filed a lawsuit against the city on Tuesday on behalf of New Yorkers who say they were targeted by the NYPD’s Muslim surveillance program. Attorneys bringing the lawsuit say the program is unconstitutional. They are moving for the records of the plaintiffs to be wiped clean. One of the plaintiffs is a 20-year-old college sophomore, Asad Dandia, who co-founded a student

group called Muslims Giving Back. The group was infiltrated by an FBI informant, according to the NYCLU. Another plaintiff is the spiritual leader at a Brooklyn mosque, Masjid Al-Ansar, which has reportedly been under surveillance by the NYPD since 2008. Imam Hamid Hassan Raza said he has been visited on several occasions without reason. City attorney Celeste Koeleveld defended the Muslim surveillance program, citing the Boston Marathon bombing as evidence of “the critical importance of ‘on-theground’ research.”

Skip the idle chit-chat.

DANIELLE TCHOLAKIAN

danielle.tcholakian@metro.us

Under surveillance Attorneys want the Muslim surveillance program shut down. •

They are also moving for the plaintiffs’ records to

be wiped clean. •

The suit names Mayor Bloomberg and Police Commissioner Ray Kelly as defendants.

No more waiting for your meetings to start. Get down to business fast with join.me.


NEW YORK

www.metro.us Wednesday, June 19, 2013

4

Solar chargers for cell phones debut in NYC After Sandy. The outlets will give the public a place to charge their dying phones. New York City unveiled the first of 25 free solar charging stations for mobile phones yesterday, installed in response to superstorm Sandy, which wiped out power and forced residents to walk miles to charge their phones. The Street Charge stations are Mayor Michael Bloomberg’s latest answer to flaws in infrastructure exposed by the storm that ripped into the East Coast in October 2012 and left about 900,000 New York City residents without power. Located throughout the

The solar phone chargers are a result of superstorm Sandy. / HAND OUT Charger locations

The chargers are located in Union Square, Fort Greene Park and on Governors Island, with more coming in the near future.

city’s five boroughs, the charging stations are part of a public-private partnership with AT&T. Powered by solar panels, they will work day or night. Six ports in each station will allow the public to charge phones, tablets and other devices even if the city’s power is out. In the first days after

the storm, some of the city’s residents walked miles to charge their electronic devices. Street Charge units were put to work this week in Union Square in Manhattan, Fort Greene Park in Brooklyn and on Governors Island, with more opening by the end of the summer, the city said. AT&T is paying for the 25 stations, with the city bearing no cost, Marissa Shorenstein, president of AT&T’s New York office said. Sandy brought a record 14-foot storm surge to lower Manhattan and inflicted an estimated $19 billion in damages on the city. The storm, which claimed more than 130 lives in the United States and Canada, left more than 8 million homes and businesses along the East Coast in the dark. REUTERS

DERMATOLOGY -EDICAL #OSMETIC3URGICAL$ERMATOLOGY Â?Â?ĂŠ-ÂŽÂˆÂ˜ĂŠ ÂˆĂƒÂœĂ€`iĂ€ĂƒĂŠUĂŠÂ?Â?ĂŠ >ˆÂ?ĂŠ ÂˆĂƒÂœĂ€`iĂ€ĂƒĂŠUĂŠÂ?Â?ĂŠ>ÂˆĂ€ĂŠ ÂˆĂƒÂœĂ€`iĂ€ĂƒĂŠUĂŠÂ?Â?ĂŠ-ÂŽÂˆÂ˜ĂŠĂ€ÂœĂœĂŒÂ…Ăƒ

s!CNE s#YSTS s7ARTS s6ITILIGO s(ERPES s2ASHES s%CZEMA s0SORIASIS s(AIR,OSS s3EBORRHEA s!GING3KIN s"IRTHMARKS s6$34$S

s3KIN#ANCER s3KIN'ROWTHS s'ENITAL7ARTS s3KIN!LLERGIES s.AIL$ISORDERS s-OLE2EMOVAL s#HEMICAL0EELS s,EG6EIN2EMOVAL s"ROKEN"LOOD6ESSELS s2ED3POTS s4ORN3PLIT%ARLOBE2EPAIR s#USTOM3KIN#ARE

s3CAR#ORRECTION s3CALP#ONDITIONS s&UNGAL#ONDITIONS s7RINKLE4REATMENT s4UMORS'ROWTHS s7HITE$ARK3POTS s#OMPLEXION0ROBLEMS s,ASER4REATMENTS s2ESTYLANE s(AIR2EMOVAL s"OTOX#OLLAGEN s3KIN2EJUVENATION s#OSMETIC3KIN3URGERY s,ASER0EELS

All Insurance Plans, Unions, HMOs, PPOs Medicare & Medicaid Accepted Day, Evening & Weekend Appointments Available

Board Certified / University Affiliated

"RONX#O OP#ITY 2100 Bartow Ave., Suite 211, Bay Plaza Shopping Center 718.671.1000

1.800.545.SKIN (7546)

1455 West Avenue, Bronx, NY 10462 Tel: 718-239-1500 Right next to the Post OfďŹ ce and Macys -IDTOWN-ANHATTAN "RONX4HIRD!VE 200 Central Park South, Ste 107 291 E. 149th Street, Corner of 7th Ave & 59 St. Bet. Cortland & Morris 212.262.2500 718.742.1000

www.adv-derm.com


See more at www.metro.us

LIRR train derailment causes delays

Mistreated dogs The dogs appeared malnourished and had scars and signs of trauma, animal care officers said. •

Alexander is being charged with 22 counts of animal fighting.

If convicted, he could face up to seven years in prison.

25 dog kennels, devices to strengthen the dogs’ jaws, syringes, two dog treadmills and a “breaking stick” to be used to break a dog’s grip on an animal or other object. Additionally, Alexander’s garage had allegedly been converted to a dogfighting arena. Hynes said a handgun and ammunition were also found at the house.

5

Transportation

Animal cruelty. Man indicted for allegedly training dogs to fight Brooklyn District Attorney Charles Hynes announced the indictment of a man accused of training pit bulls to fight. Leslie Alexander, 39, of Brooklyn, faces more than two dozen charges in connection with dogfighting. Hynes slammed animal fighting as “a barbaric and inhumane practice.” He noted that breeding and training animals for fighting is a felony under New York state law and can bring a sentence of up to four years in prison and a $25,000 fine. NYPD officers were granted a warrant to search Alexander’s home for guns and drugs, but when they executed the search on May 24, they reportedly found seven pit bulls and equipment used to train dogs for dogfighting, including

NEW YORK

It’s a snap for artist who uses Legos “Swimmer,” a sculpture by Nathan Sawaya, went on display in the “Art of the Brick” show at Discovery Times Square on June 18. Sawaya created the pieces from Lego bricks. The exhibition features more than 100 works that were built out of millions of the toy pieces. / GETTY IMAGES

DANIELLE TCHOLAKIAN

Thank you bike courier ripping over the Brooklyn Bridge at 40 MPH. Thank you barista who has our coffee ready before we walk in the door. Thank you handbags going in and out of style faster than we can hold them.

THANK YOU INDY CAR CABBIES RACING DOWN THE FDR. Thank you storefronts compulsively changing their doors. Thank you “it” dogs, “in” bars, and neighborhoods “du jour.” Keeping up with you, the fastest city on the planet, has made us the fastest internet in New York.

America’s fastest* Internet. Inspired by New York. With FiOS QuantumSM, you get the speed you need to support multiple devices and users at once.

Call 1.888.896.2511 or visit verizon.com/nyfast to get Internet at the speed of New York *Reprinted from www.pcmag.com with permission. ©2012 Ziff Davis, Inc. All Rights Reserved. FiOS available in select areas. ©2013 Verizon.

An eastbound Long Island Rail Road train carrying nearly 1,000 passengers derailed in the East River Tunnel on Monday, delaying trains during the Monday evening and Tuesday morning rush hours. A total of 35 out of 144 morning trains were canceled or diverted Tuesday, according to the MTA. Two cars of a 10-car Hempsteadbound train derailed shortly after 6 p.m. on Monday as it left Penn Station and entered the tunnel. No one was injured, and most passengers were led onto a rescue train. The derailed train was removed early Tuesday morning. The cause of the derailment is under investigation. LAURA SHIN


Celebrate… your Independence. FRONT ROW Seats to The Macy’s July 4th Fireworks® with

Best Value:

Pier Party! ONLY

99

$

NEW YORK

www.metro.us Wednesday, June 19, 2013

6

Indictment in Village hate crime killing

Cold drinks, hot grills with classic all American cook-out food, and live DJ’s “Doors open” at 7 pm for a sunset party setting Every attendee will get a ticket for a future

Circle Line Liberty Cruise*

Book Now: NYCFireworks.com · 877-759-1857

West 42nd Street and Hudson River, NYC

Your casual, fun night on the water…

Circle Line | $95 Your classic Manhattan dinner cruise…

World Yacht | $350 *Restrictions apply. Cannot be used before the Fourth of July or on a Fireworks Cruise.

Mourners gather at the spot in Greenwich Village where Mark Carson was killed. A shrine was built in his honor. / GETTY IMAGES

Anti-gay shooting. Elliot Morales was charged with murder as a hate crime for killing Mark Carson. The Manhattan District Attorney’s office announced yesterday an indictment in the fatal shooting of 32-year-old Mark Carson in Greenwich Village last month. Police reported that Carson was shot by a suspect who made anti-gay comments to him. The fatal shooting was the most violent of several alleged hate crimes last month. “This young man’s tragic death serves as a reminder of the discrimination that many of our family members, coworkers and friends still face,” said Manhattan District Attorney Cy Vance. The alleged shooter, Elliot Morales, is charged with one count of murder in the second degree as a hate crime, five counts of criminal possession of a weapon and two counts of

menacing, including one count of menacing a police officer. According to Vance, statements made on the record in court describing the May 17 incident indicate that after being chastised by a restaurant worker for urinating outside the restaurant, Morales confronted employees, barking antigay comments, displaying a gun and threatening to shoot patrons. Morales allegedly left the establishment and ran into Carson walking with another male, and made further anti-gay comments. He eventually shot Carson point-blank in the head, according to police. Vance said an NYPD officer tracked Morales down.

Tearing at the fabric

“By instilling fear, hate crimes tear at the very fabric of our communities.” Cy Vance

When confronted, Morales pointed his gun at the officer. When Morales fumbled, the officer wrested the gun away. Morales faces a possible sentence of 25 years to life in prison for the most severe of the charges against him.

DANIELLE TCHOLAKIAN

danielle.tcholakian@metro.us

High-profile case Manhattan District Attorney Cy Vance charged Elliot Morales with murder in the second degree as a hate crime.

In addition, he was charged with five counts of criminal possession of a weapon and two counts of menacing.

Vance encourages those who experience or witness hate crimes to call his office at (212) 335-3100.

Morales allegedly shot Mark Carson in the face after making anti-gay comments.


See more at www.metro.us

NEW YORK

7

Former New York City Mayor Ed Koch died earlier this year. / GETTY IMAGES

Koch’s grave has the wrong date of birth Cemetery. The former mayor’s tombstone lists him as being born in 1942.

Final resting place Mayor Ed Koch’s tombstone has him listed as born almost 20 years after his real birthdate. •

The tombstone of former New York City Mayor Ed Koch, who died earlier this year, is engraved with the wrong birth year. Koch was born on Dec. 12, 1924, but the birthdate on his tombstone reads “December 12, 1942.” The mistake is ironic since Koch was known for having planned the details of his burial years before his death, including what would be written on his tombstone. The former mayor, who is buried in Trinity Church Cemetery in Washington Heights, bought the plot because he said that he wanted to stay in Manhattan forever. He also chose to have inscribed a quote by journalist Daniel Pearl, who

The former mayor was born in 1924, but the gravestone says 1942.

Koch / GETTY IMAGES

was killed by al-Qaeda terrorists in 2002: “My father is Jewish; my mother is Jewish; I am Jewish.” The date was not engraved when Koch was buried, NBC News reports. It was engraved earlier this month, and the mistake was due to an “inadvertent error,” Tommy Flynn of Flynn

Koch is buried in Trinity Church Cemetery in Washington Heights.

The company that made the tombstone said that it will correct the mistake.

Funeral and Cremation Memorial Services told NBC. “I have to make it right. I will correct it,” he said. “As Ed Koch used to say, ‘It’s always important to correct the record,’” said Koch’s former chief of staff Diane Coffey about the error. Koch died of congestive heart failure on Feb. 1. He was mayor from 1978 to 1989, through a difficult time in the city’s history. Koch was known for his trademark phrase, “How’m I Doing?”

LAURA SHIN

letters@metro.us


See more at www.metro.us

www.metro.us Wednesday, June 19, 2013

US poll. Airlines improve performance but still get low marks Consumers are more satisfied with airlines in recent years, but the industry still gets relatively low marks — mainly due to the onboard experience, according to a new customer poll. The American Consumer Satisfaction Index — which surveys some 70,000 U.S. customers annually on more than 40 industries, ranging from apparel and hospitals to banks and insurance —

found only television and Internet service providers ranked lower. It found that full-service and fastfood restaurants, hotels and shipping companies provided consumers with a better experience. But ACSI said airlines were making progress, with a ranking of 69 on a 100-point scale — up two points from 67 last year — for their best mark in nearly two decades. REUTERS

Certain aspects of air travel were rated better than others. / GETTY IMAGES

NSA: Programs have halted more than 50 acts of terrorism Classified. The NSA is protecting residents from terrorist attacks on American soil. General Keith Alexander, the director of the U.S. National Security Agency, said yesterday the NSA’s data-gathering programs had prevented potential terrorist attacks more than 50 times since Sept. 11, 2001. “In recent years these programs, together with other intelligence, have protected the U.S. and our allies from terrorist threats across the globe to include helping prevent ... potential terrorist events over 50 times since 9/11,” he said in tes-

“ I used to

wear the

MASK.” “I wanted to stop my snoring, but the CPAP mask was so uncomfortable and it didn’t help my love life. I had to find another answer. So I went to eOs Sleep. They examined me and offered me a few different treatment options. I chose a quick 20-minute in office treatment. I was surprised that it was so easy.” – an eOs patient To find out more, call

888-460-5733.

General Keith Alexander testifies before the House Select Intelligence Committee yesterday in Washington, D.C. / GETTY IMAGES

timony to the U.S. House of Representatives intelligence committee. Alexander said the intelligence agencies would give documents about those cases to

the committee for its review in a classified setting today, and that he would discuss two thwarted plots during his testimony yesterday.

NEWS

8

Snowden to Iceland?

Leaker makes an informal approach seeking asylum Iceland has received an informal approach from an intermediary who says Edward Snowden wants to seek asylum there. Snowden made headlines after leaking details of a government surveillance program to two newspapers. In a column in Icelandic daily Frettabladid, WikiLeaks spokesman Kristinn Hrafnsson wrote that a middleman had approached him on behalf of Snowden. “On June 12, I received a message from Edward Snowden where he asked me to notify the Icelandic government that he wanted to seek asylum in Iceland,” Hrafnsson, who is also an investigative journalist in Iceland, told Reuters. REUTERS

REUTERS

Say Goodbye to Painful Varicose Veins! Do you have any of these symptoms? s6ARICOSE6EINSs3PIDER6EINS s)TCHINGAND"URNING s,EG0AINAND#RAMPS s(EAVINESSAND3WELLING s3KIN$ISCOLORATION s5LCERSAND"LOOD#LOTS You may have a serious medical condition, called Venous insufficiency.

USA Vein Clinics Will Help! With a non-surgical, minimally invasive and painless ss procedure, that takes only 15 minutes! Covered byy Medicare and most insurance plans up to 100%!

The Best Vein Center (by Home Reporter)

The nation’s foremost medical practice for the treatment of snoring and sleep apnea

Call

w w w.e O s S l e e p .co m

www.USAVeinClinics.com

Treatment protocols may differ from patient to patient. After a thorough exam, an eOs specialist will recommend the right solution for your particular condition.

New York City • Long Island - 888.460.5733

718.732.0231

2511 Ocean Avenue, Suite 102, Brooklyn, NY 11229

116-02 QueensBoulevard, Forest Hills, NY 11375

1153 First Avenue, Manhattan, NY 10065


NEWS

Rookie teachers woefully unprepared, report says Classroom. But the study did not typically evaluate the quality of teaching within the training program. The U.S. teacher training system is badly broken, turning out rookie educators who have little handson experience running classrooms and are quickly overwhelmed by the job, according to a report released yesterday by the National Council on Teacher Quality. The review found “an industry of mediocrity,” with the vast majority of programs earning fewer than three stars on a fourstar rating scale — and many earning no stars at all. The council, a bipartisan research and advocacy

group, spent eight years developing the methodology, fighting in court to gain access to data and analyzing the information before issuing the report. It contains detailed analysis of 608 colleges and universities with teacher training programs and partial data on 522 others. Those 1,130 institutions collectively turn out more than 170,000 novice teachers annually, about 80 percent of the new teachers entering classrooms each year. Most of the rest come from nontraditional training programs that are not necessarily affiliated with colleges, such as Teach for America. Freshly minted teachers “don’t know how to teach reading, don’t know how to master a classroom, don’t know how to use data,” said Kate Walsh, the council’s president. “The results were dismal.” REUTERS

Slimmest smartphone unveiled The Obama administration has proposed federal funding for training programs for teachers. / GETTY IMAGES

And we can help. Our Managed Long-Term Care plan provides people with Medicaid with the services they need to live at home. At no cost.

h e a l t h p l u s. a m e r i g r o u p. c o m / m l t c free,

Chains

20

The Food and Drug Administration is expected to require chains with 20 locations or more to make similar disclosures nationwide by the end of the year.

customizing their drinks,” said Lisa Passe, a Starbucks spokeswoman. She added that the coffee company’s pastries will also come with a calorie count. REUTERS

Smart and thin

We k n ow w h a t yo u ’ r e go i n g t h r o u g h .

toll

Nutrition. Starbucks to post calorie labels in stores nationwide Starbucks will display calorie counts for coffees and snacks at all its U.S. locations starting Tuesday, ahead of a federal requirement that large food chains disclose nutrition information. The company said yesterday that the labels were meant to encourage health-conscious consumers to further customize orders by opting for sugarfree syrups or nonfat milk over more calorie-heavy alternatives. “People are already

Being there for Mom once a we e k i s g r e a t . B u t s h e n e e d s h e l p eve r y d ay.

1-800-950-7679

9

8AM-6PM

China’s Huawei unveiled its flagship smartphone, the Ascend P6, at its first

stand-alone launch event, underlining its ambitions to compete with Apple and Samsung. The company says the phone, under a quarter of an inch thick, is the world’s slimmest. REUTERS


See more at www.metro.us

www.metro.us Wednesday, June 19, 2013

One sexy patent case

US patent case climaxes with win for vibrator maker Couples in the United States looking to spice up their sex lives will have to do without certain adult toys after a U.S. trade panel ruled on Monday that some companies are violating a patent held by a Canadian company for a two-armed vibrator. The U.S. International Trade Commission found that vibrator maker Lelo Inc. as well as distributors and a retailer infringe on Standard Innovation Corp.’s patent for a two-armed vibrator that couples can use during intercourse. Standard Innovation, which is based in Ottawa, Ontario, and is privately held, filed an infringement complaint against

Lelo and a long list of other companies in early 2012, accusing them of infringing on Standard’s patent for the adult toys, designed to be worn while a couple has sex. On its website Standard Innovation describes the We-Vibe family of vibrators as “a global sensation.” The commission’s ruling overturns a preliminary ruling by an ITC judge, who found in January that the patent holder did not have enough commercial activity in the United States to have standing to prevail at the ITC. The full commission disagreed. It banned the sale of vibrators made by Lelo Inc. and distributed or sold by Nalpac Enterprises Ltd., Williams Trading Co., Honey’s Place Inc. and Lover’s Lane & Co.

NEWS

10

Jolie stunt double sues News Corp over hacking Phone hacks. She claims the interference from the tabloids caused her to lose voice messages. A stunt double for Oscarwinning actress Angelina Jolie has sued News Corp. over allegations its British newspapers hacked her phone, the first lawsuit in the United States against the company since a hacking scandal broke out two years ago. The lawsuit filed on June 13 by professional stunt double, Eunice Huthart, said reporters from News Corp.’s tabloids The Sun and the defunct News of the World hacked her mobile phone while she

REUTERS

was working for Jolie on location in Los Angeles. A spokesman for News Corp. declined to comment on the lawsuit. Huthart’s lawsuit said the hacking occurred in 2004 and 2005 while she was in the United States and Britain and resulted in lost voice messages that she never received. The missing voicemails provided information later used in news reports, according to the court document in U.S. District Court in California. Huthart is seeking unspecified damages. The allegations include stories that ran in the tabloids about Jolie’s budding relationship with actor Brad Pitt — when only a tight circle of people had knowledge of it — while they were filming “Mr. & Mrs. Smith.” REUTERS

Scandal

Jolie uses stunt doubles during tricky scenes. / GETTY IMAGES •

This is how rumors get started

The vibrator is designed to make sure multiple parties have a good time. / GETTY IMAGES

The lawsuit said that the tabloids intercepted messages left by Jolie regarding her movie career. It cited a News of the World article with the headline “Pitt Stop for Jolie” that began “Hollywood babe Angelina Jolie has threatened to quit the movies for good.”

The phone hacking scandal sent shockwaves through the British establishment, forced the closure of the Sunday tabloid News of the World, prompted a huge police inquiry and led to the arrest of more than 60 people. But until the Huthart

INTERN IN ISRAEL AND MAKE CONNECTIONS, NOT COPIES. REAL EXPERIENCE FROM AN INTERNSHIP IN ISRAEL Spending 5 to 10 months kick-starting their career with world-class innovators who won’t send them out for coffee, our interns are a real part of the action. Here at Masa Israel Journey, we don’t just help find the best internships, we also offer funding to help get there. Go to www.MasaIsrael.org/Intern to see how we can help find and fund the perfect internship.

START HERE. GO FURTHER.

lawsuit, the scandal has been contained in Britain. •

News Corp. is preparing to split its publishing assets, which includes its British newspapers, the Wall Street Journal and book publisher HarperCollins, from its cable networks and movie studio on June 28.


NEWS

US to hold peace talks with Afghan Taliban in Doha Time. News of talks comes as the U.S. and its allies try to meet a 2014 deadline for an end to combat in Afghanistan. The United States will meet the Taliban this week for talks aimed at achieving peace in Afghanistan, where U.S.-led forces and insurgents have fought a bloody and costly war for the past 12 years, U.S. officials said yesterday. The Taliban opened an office in Doha, the Qatari capital, yesterday to help restart talks. It said it wanted a political solution that would bring about a just government and end foreign occupa-

Legislation

House won’t consider immigration bill unless GOP backs it

the road.” U.S. officials say they hope the meeting will open the way for the firstever official peace talks between the government of Afghan President Hamid Karzai and the Taliban, which has waged a 12-year campaign to oust him and foreign troops. The Taliban have until now said they would not countenance talks with the government, which they consider a stooge of the United States and other Western states in the NATO coalition fighting in Afghanistan.

tion of Afghanistan. A senior U.S. official said the talks would start in Doha tomorrow, but President Barack Obama cautioned against expectations of quick progress, saying the peace process would not be easy or quick. U.S. officials said the process could take many years and be subject to reversals. “This is an important first step toward reconciliation, although it’s a very early step,” Obama said after a G8 meeting in Enniskillen, Northern Ireland. “We anticipate there will be a lot of bumps in

REUTERS

Gay marriage support high

Quoted

“This is an important first step toward reconciliation, although it’s a very early step.”

11

Most adults in developed countries favor gay marriage or some type of legal recognition for same-sex couples and think they should be able to adopt children, according to an international poll released yesterday. REUTERS / GETTY IMAGES

The House of Representatives will not consider immigration legislation that does not have the support of most Republicans, Speaker John Boehner said yesterday, casting doubt on prospects for reform as the Senate prepares to vote on a bill giving millions of illegal immigrants a chance to become citizens. “I don’t see any way of bringing an immigration bill to the floor that doesn’t have a majority support of Republicans,” Boehner told reporters. The House is controlled by Republicans, and Boehner determines what legislation gets voted on. The Senate is controlled by Democrats. REUTERS

Obama, after a G8 meeting in Enniskillen, Northern Ireland

GRAND OPENING

HIGH SCHOOL DIPLOMA

313 First Avenue | New York | NY 10003 CORNER OF 18th & 1st Ave tel: (212) 228-7900 fax: (212) 228-7700

NOT ENOUGH? Mildred Elley can help!

email: naturesfirst313@gmail.com www.skpharmacy.com

Financial Aid & Scholarships available for those who qualify. Advanced Paralegal Studies Business Management Massage Therapy

Medical Assisting Nurse Aide Training (CNA) Practical Nursing (LPN)

CALL TODAY!

ENROLLMENT ENDS SOON Accredited Member, ACICS

GI Bill Approved

(866) 231-0912 | mildred-elley.edu

-̜ÀiÊœÕÀÃ\Êœ˜‡Àˆ\ʙ>“ʇÊn«“ÊUÊ->Ì\ʙ>“ʇÊÈ«“ÊUÊ-՘\Ê£ä>“ʇÊx«“ *…>À“>VÞÊœÕÀÃ\Êœ˜‡Àˆ\ʙ>“ʇÊÇ«“ÊUÊ->Ì\Ê£ä>“ʇÊx«“Ê ÞÊœÕÀÃ\Êœ˜ 

Best prices in town for OTC and RX products!

FAST ACCURATE SERVICE!

FREE

delivery & Pick up

your prescription ready while you wait it usually within 10 minutes

We have a bilingual staff, fluent in Spanish, Russian & Tagalog

20% OFF 10% OFF

OPEN HOUSE Mildred Elley Campus Thur, June 20 | 10am - 4pm 25 Broadway, Floor 16 Career and college exploration From start to finish

CALL TODAY TO RSVP (888) 419-5635 mildred-elley.edu

GI Bill Approved Accredited Member, ACICS

MASSAGE THERAPY Day, Evening & Weekend Classes Available ˒Located in Manhattan’s Financial District

ENROLL NOW (888) 500-0953 mildred-elley.edu GI Bill Approved Accredited Member, ACICS

THE PURCHASE FOR SENIOR CITIZENS

With this coupon only. Limited time offer Expires Sept. 30, 2013 Coupons can’t be combined

UP TO $15 OFF

20% DISCOUNT

NOT VALID MEDICARE / MEDICAID

For all hospital, medical and office employees on over the counter products

With this coupon only. Limited time offer Expires Sept. 30, 2013 Coupons can’t be combined

With this coupon only. Limited one time offer Expires Sept. 30, 2013 Coupons can’t be combined

Bringing Good Old Fashioned Customer Service Back! 25 Broadway, Floor 16 | New York, NY

25 Broadway, Floor 16 | New York, NY

ORGANIC PRODUCTS

WE ACCEPT ALL MAJOR INSURANCES

NUTRITIONIST / VITAMIN SPECIALIST ON STAFF

COPIES 5¢ EACH

FREE DELIVERY & PICK UP

SCHOOL SUPPLIES

FOR ANY OTC SURGICAL SUPPLIES DIABETIC SUPPLIES PRODUCT Dear Community,

With this coupon only. Limited time offer Expires Sept. 30, 2013 Coupons can’t be combined

COPAYS ON FIRST PRESCRIPTIONS FOR NEW PRESCRIPTION CUSTOMERS ONLY

PRODUCT DEMONSTRATION PLEASE INQUIRE PARIS WITHIN

Thank you for welcoming us into the neighborhood. We are thrilled to be a part of a collaborative effort to promote optimal healthcare to our patients. Our approach ranges from natural & holistic advice to prescription therapy, all of which our Doctors of Pharmacy are fully skilled to take care of. We are proud to say that our hours fully reflect the needs of our guests; keeping our doors open to you late into the evening, 7 days a week. Whether you’re stopping by for a consultation or a conversation don’t give it a second thought. Stop by Nature’s, First!!!


See more at www.metro.us

www.metro.us Wednesday, June 19, 2013

Pork-infused ammo

Magic bullet against terror? Security services can now stop listening to our calls, as a simple solution to Islamist terror has been discovered in the form of pork bullets. Idaho-based company Jihawg Ammo is producing ammunition coated with piginfused paint, believing that fear of contact with the “unclean” animal will discourage terrorists. Keith, a spokesman at Jihawg, told us more. How did you come up with this? The idea started after hearing about plans for a mosque at Ground Zero, which we thought were inappropriate. We kept coming back to it over time and talking to people in the military, who said that on days when there were swine in the area, there were no attacks by terrorists. We put two and two

together and realized it’s a natural deterrent, a peaceful answer that saves the jihadists and the victims.

12

Assange anniversary: one year in the embassy Time saved. Confinement has been put to good use, said acting WikiLeaks chief Kristinn Hrafnsson.

What’s the recipe? It’s traditional ballistic paint, but it took a year to figure out how to infuse it with pork. I can’t share exactly how we do it — trade secret — but it’s a compound of bone, meal and flesh. What reactions have you been getting? Web traffic has gone crazy, and we’re selling 15,000 units a day. WalMart thought they were cute, but we’re mainly selling to locals — they like that it goes against political correctness. Are you worried about causing race hate? We can talk about radical Islam without being negative about Islam itself. Two of our group dropped out because they were worried, but if we’re attacked, that proves our point. MWN

NEWS

WikiLeaks founder Julian Assange addresses the press and his supporters from the balcony of the Ecuadorian Embassy in London on Aug. 19, 2012. / GETTY IMAGES Quoted

“The time he saves not traveling is devoted to work, and he gets a lot done.” Kristinn Hrafnsson, Acting WikiLeaks chief

Inside the gold-framed double doors, the Ecuadorian Embassy of London is a modest apartment with white-painted walls and simple furniture. Not the most fitting residence for a world-famous hero, or villain. But since June 19, 2012, WikiLeaks boss Julian Assange has gone from pioneer to captive, forced into hiding to avoid extradition to Sweden, where charges on sexual assault await him. The Australian will be arrested if he steps outside the building, so the jet-set lifestyle has been

replaced by a single room and his laptop. DVD box sets of “The Twilight Zone” and “The West Wing” keep him company, and an ultraviolet lamp replaces daylight. Assange lives nocturnally, according to reports, working until dawn supported by heavy doses of caffeine. The 41-year-old has not been forgotten, from the crowds outside his window shouting “freedom fighter” to his generous hosts, who have granted him asylum and allowed him to cramp their workplace. Further, celebrity guests from Lady Gaga to Oliver Stone have visited, with British filmmaker Ken Loach donating a treadmill on which the captive runs miles each day.

KIERON MONKS

kieron.monks@metro.lu


NEWS

13

Protesters fill the streets in Brazil Dissent. It is the latest in a wave of demonstrations the country has seen in two decades. As many as 200,000 demonstrators marched through the streets of Brazil’s biggest cities on Monday in a swelling wave of protest tapping into widespread anger at poor public services, police violence and government corruption. The marches, organized mostly through snowballing social media campaigns, blocked streets and halted traffic in more than a half-dozen cities, including Sao Paulo, Rio de Janeiro, Belo Horizonte and Brasilia, where demonstrators climbed onto the roof of Brazil’s Congress building and then stormed it. Monday’s demonstrations were the latest in a flurry of protests in the past two weeks that have added to growing unease

Quoted

“For many years the government has been feeding corruption. People are demonstrating against the system.” Saleswoman and protester Graciela Caçador

Thousands demonstrate in the streets of Rio de Janeiro, Brazil, on Monday against the increase in the public transportation fare and the cost of staging international soccer tournaments. / GETTY IMAGES

A car burns during Monday’s protest in Brazil. / GETTY IMAGES Scan to Win!

Call 212-779-3493 24/7 Book www.SmileArtistNY.com

over Brazil’s sluggish economy, high inflation and a spurt in violent crime. While most of the protests unfolded as a festive display of dissent, some demonstrators in Rio threw rocks at police, set fire to a parked car and vandalized the state assembly building. Vandals also destroyed property in Porto Alegre. The epicenter of Monday’s march shifted from

Sao Paulo, where some 65,000 people took to the streets late in the afternoon, to Rio. There, as protesters gathered throughout the evening, crowds ballooned to 100,000 people, local police said. At least 20,000 more gathered in Belo Horizonte. The protests have gathered pace as Brazil is hosting the Confederation’s Cup, a dry run for next year’s World Cup soccer championship. The government hopes these events, along with the 2016 Summer Olympics, will showcase Brazil as an emerging power on the global stage. Contrasting the billions in taxpayer money spent on new stadiums with the shoddy state of Brazil’s public services, protesters are using the Confedera-

“You too can have a Natural Gorgeous SEXY Smile for as low as $99/month by NEW 3D imaging CAD/CAM Laser @ Relaxing Holistic Park Ave Dental Spa!*

50% off ends 6/30/13 Enter to Win!

Dental Plan: Reduced to only $20 per month! “I had a Quick, Comfortable, Pleasant visit” 1

Express

COME VISIT US AT OUR NEW HOME 2 Washington Street, near Batttery Park

Accelerated Degree Completion Program • Bachelors Degrees (38 majors) • Alliance Theological Seminary • MA in Counseling or Marriage & Family • MS in Organizational Leadership •

Straight Teeth in 5 months, No Braces!* OR

FAST instant Braces for only $1999 Implants/2 visit Extreme Smile MakeOver Proven Laser * Dentistry

2

BEST Fees & Quality Guaranteed on all procedures as low as $999 3

Save

tion’s Cup as a counterpoint to amplify their concerns. The tournament got off to shaky start when police clashed with demonstrators outside stadiums at the opening matches in Brasilia and Rio. “For many years the government has been feeding corruption. People are demonstrating against the system,” said Graciela Caçador, a 28-year-old saleswoman protesting in Sao Paulo. “They spent billions of dollars building stadiums and nothing on education and health.” More protests are being organized for the coming days. It is unclear what specific response from authorities would lead the loose collection of organizers across Brazil to consider stopping them. REUTERS

was 650

Now Only $199 – Exam/Cleaning $49

(finish in as little as 12 months) MBA (finish in as little as 16 months)

MS in Childhood Education, Childhood Special Education

4

New Programs. New Opportunities. New York’s Christian College.

or Natural Strong Dentures as low as $999 5

JOIN US AT OUR OPEN HOUSE Thursday, June 20th at 6:00pm 2 Washington St, New York NY 10004

Discover Natural Veneers as low as $999 6

Whiten all Silver Fillings/ as low as $999 Treatment of pain, Bad Breath/Halitosis, Gummy Smile, Gingivitis. Laser Dentistry, and 500+ other treatments. *Promotions end 6/30/13. Must qualify. Limitations apply. Not all patients qualify for the same treatments.

For more information call: 877-626-2236 or visit us at: www.nyack.edu Nyack, NY • New York, NY www.nyack.edu www.facebook.com/nyackcollege


2

GOSSIP

www.metro.us Wednesday, June 19, 2013

14

CULTURE Twitter feed We check in with some of Hollywood’s biggest names to see what they’ve been up to — in their own words, in 140 characters or fewer.

Today, Elizabeth Banks isn’t thrilled about summer, Amanda Bynes is having some work done, Samantha Ronson is frustrated with her social network and Anna Kendrick is already thinking about Halloween. @ElizabethBanks: We all hate swimsuit shopping, right? @AmandaBynes: I’m in between nose surgeries! My eyes are black and blue because my nose is broken! I can’t wait for my nose to be done! I’ll share pics! @samantharonson: If u don’t want me to know about your party please send me an invite via Facebook. @AnnaKendrick47: Halloween 2008. Donkey ears + boxing gloves = Donkey Punch. People thought I was an angry Plushie. #NoRegrets

Dear Brad: Please cut your hair. Love, Women everywhere Brad Pitt (or is that a member of The Allman Brothers?) attended the New York premiere of his new movie “World War Z” on Monday night in New York City. I think I speak for women (and mothers) everywhere when I plead: Brad, please do something with that hair of yours. You have such a pretty face!

Scott Disick is Patrick Bateman With his product-coated hair, steely gaze, love of high fashion and dead soul, Scott Disick has channeled a distinct Patrick Bateman vibe for years. Now, fellow Kardashian baby daddy Kanye West is capitalizing on this eerie resemblance in a new promo for “Yeezus.” Disick portrays the Bret Easton Ellis character in the famous “American Psycho” scene where Bateman listens to Huey Lewis with a friend — with bloody consequences. The West promo is not a great homage. Check it out for yourself on www. metro.us. I think you’ll agree that if we knew exactly what Disick’s day job was, we would tell him not to quit it.

1

Brand divorced via text Pretty sure this is a marriage don’t: Russell Brand apparently divorced wife Katy Perry via text message. “He’s a very smart man, a magical man, and I was in love with him when I married him. Let’s just say I haven’t heard from him since he texted me saying he was divorcing me Dec. 31, 2011,” the singer revealed in a new interview with Vogue. And as for her rebound with John Mayer? “It’s over, I was madly in love with him. I still am madly in love with him,” she told the mag. “Beautiful mind, tortured soul. I do have to figure out why I am attracted to these broken birds.” Maybe it’s because they are hot and famous? Just a guess.

2

THE WORD Dorothy Robinson takes on the world of gossip. DOROTHY ROBINSON @dorothyatmetro dorothy.robinson@metro.us

3

Munn’s eyelash problem

In 2012, Olivia Munn announced about suffering from trichotillomania, an anxiety disorder in which the sufferer pulls out his or her own hair. And according to a new interview with Marie Claire, she is still trying to overcome it. When asked what she’s working on, she replied, “Trying to overcome my social anxiety. ... It’s manifested in trichotillomania, a disorder that gives me the urge to pull out my eyelashes.” The actress is also working on another disorder, which is probably more familiar to most of us. “I struggle with wanting to work out,” she says. “I hike, surf and dance, but I think I’m going to start doing Pilates — though I’m not happy about it.”

Chastain doesn’t need arm candy When it comes to her personal life, Jessica Chastain is looking to keep things under wraps — for now, at least. “Sometimes when someone [in the press] asks me about my dating status, I get really quiet about that because I want to protect it,” the “Zero Dark Thirty” star tells E! News. “Seeing all these interviews with actors talking about loves of their lives and then they break up in a year and you’re thinking, ‘What if something happens and they end up being a total jerk?’ Then you forever have these pictures of you standing on the red carpets together.” Right! But that helps when I write about their divorce (see the Brand and Perry item, left).

4


ENTERTAINMENT

1

LA Film Festival fun

2

The funny gang

1

“Crystal Fairyâ€? co-stars Michael Cera and Gaby Homan shared a laugh with director Sebastian Silva at film’s premiere on Friday. ‘Station’ star

2

3

4

5 6

Tired of traditional weight loss methods failing? *OINäOURäMEDICALLYäSUPERVISEDäWEIGHTäLOSSäPROGRAMS APPROXIMATELY 90% SUCCESS RATE

$

100 OFF

FOR THE FIRST 20 PATIENTS FOR THIS WEEK ONLY "%&/2% sä#OMPLETEäINITIALäMEDICALäEVALUATIONäANDäBLOODäWORK sää(#'ä(UMANä#HORIONICä'ONADOTROPIN äMEDICALLYä MONITOREDäPRESCRIPTION sä(#'äTOäASSUREäSAFEääHEALTHYäWEIGHTäLOSS sä/NE ON ONEäWITHäAä-EDICALä7EIGHTä,OSSä#OUNSELOR

!&4%2

CALL TODAY FOR YOUR FREE CONSULTATION #ONVENIENTLYä,OCATEDäATä ä"ROADWAY ä%ASTä"UILDINGäTHä&L

(212) 227-3363 INFO NYTHCCOM

15

Actor Michael B. Jordan was interviewed at the premiere of “Fruitvale Stationâ€? on Monday. Kid stu

3

Co-stars Kid Cudi and

McKenna Grace hit up the “Goodbye World� red carpet on Saturday. The great Grenier

4

Actor Adrian Grenier also worked the red carpet of “Goodbye World.� Model behavior

5

Supermodel Alessandra Ambrosio arrived at the “My Little Pony Equestria Girls� premiere at Regal Cinemas L.A. Live on Saturday. Oscar power

6

Academy Awardwinning actors Octavia Spencer and Forest Whitaker also appeared at the “Fruitvale Station� premiere on Monday. GETTY IMAGES


ENTERTAINMENT

www.metro.us Wednesday, June 19, 2013

16

Ice Cube: Still as cool as ever Hip-hop legends. Ice Cube tells us about his career and keeping it real. Ice Cube has parlayed a hardcore rap career into an entertainment empire that spans movies, television and product endorsements. But the former N.W.A. member and solo artist known for groundbreaking albums such as “AmeriKKKa’s Most Wanted” and “Death Certificate” has no plans to switch up his politically charged style. While mainstream rap drowns in escapist tales of cars, clubs and fancy cribs, he says fans can expect “vintage Ice Cube” on his forthcoming album, “Everythang’s Corrupt.” “Everything that you’ve ever gotten from me, I deliver on this record,” he says. “My style is straight street knowledge. I don’t really cater to what’s going on in hiphop or what’s going on in the industry, so to speak. I just dial in on Ice Cube fans and try to keep them satisfied, and everybody else gotta get in where they fit in. I don’t want to have to worry about no program director here or no A&R there. That makes it a drag. And being independent, I can just go in the studio and do what I

If you go

Rap royalty

Kings of the Mic tour with Ice Cube, LL Cool J, Public Enemy and De La Soul Tomorrow, 6:30 p.m. Roseland Ballroom 239 W. 52nd St. $60-$70, 212-777-6800 www.livenation.com

Ice Cube says Chuck D is like a brother to him. GETTY IMAGES

Ice Cube chills in the spotlight. / CHRIS MCKAY, WIREIMAGE

feel.” While he wraps up his 10th album, the actor, writer, producer and director is in talks with distributor New Line Cinema to close out the “Fri-

day” franchise with final installment “Last Friday.” “We’re trying to get it done,” he says. “New Line has really been neutered by Time Warner, so they can’t do as many mov-

ies as they usually do per year. So it’s just a fight to get ‘Last Friday’ on their schedule. They only got three or four movies to do a year, and urban comedy is probably low on the to-

tem pole.” Cube — born O’Shea Jackson — is also working on a feature film about Compton collective N.W.A. that will reunite him with “Friday” director F. Gary Gray. He says the movie could hit theaters by mid-2014, and the cast may include his son O’Shea Jr., a budding rapper who goes by the moniker OMG (Oh My Goodness). “I want my son OMG to play me. He looks like me and he can act, so he can do it,” Cube says. “I just had to meet with [Gray] and Dr. Dre to work on the script and keep getting it tighter and tighter, so we’re in the process of casting the movie now, so it’s full steam ahead. This N.W.A. movie, it’s still my dream. That’s what I’ve been dying to make.”

LAUREN CARTER

letters@metro.us

Chuck D still on point, Ice Cube says Ice Cube isn’t shy about revealing that his favorite rapper is a tourmate, Public Enemy’s Chuck D. “It’s like being on tour with your big brother,” Cube says. “He’s just one of those dudes who — pound for pound, lyric for lyric — has done the most out of any emcee, because he ain’t just rapping no bulls—. ... It’s something real. And even when rapping about bulls— is popular, I mean, he still stick to what he do. That’s great. For artists like myself, and him being one of my peers and me really looking up to Chuck, it’s good that he sticks to the script.”

NEW APPROACH. NEW PROGRAMMING. NEW ATTITUDE.

9

ONLY

$

OF HU JU FE RR NE R E Y! 30 ND TH S !

.99 PER MONTH*

PLUS, RECEIVE A

FREE BALLY SPORT KIT

**

FOR JOINING BEFORE

JUNE 11TH!

FREE 3 DAY GUEST PASS

MONTH-TO-MONTH.

EXPIRES 6/30/2013

NO LONG-TERM CONTRACT.

To activate, must be at least 18 years of age, sign guest register and take club tour and receive presentation. Must be resident or employee of local area where redeemed with valid ID. Limit 1 pass redemption per person in any 6-month period. Cannot be sold, reproduced or redeemed for cash. Membership is valid at club activated for 3 consecutive days from activation date. Additional charges for some classes.

*$0 Enrollment Fee, 1st and last monthly payment of $9.99 and $29 card fee due at time of joining. Offer ends 6/30/13. A prorated usage fee through 1st scheduled payment date may be added. Recurring Credit Card (RCC)/Electronic Funds Transfer (EFT) transactions only. Additional charges for some programming. Offer subject to change or termination without notice. Visit club for full details. **Offer good with any new membership at time of joining by 6/11/13, while supplies last.

ballyfitness.com/sport


ENTERTAINMENT

17

Transplants transforming

Friday June 21

Transplants are, from left, Aston, Barker and Armstrong. / ESTEVAN ORIOLE

Interview. Transplants singer Rob Aston on the glue that binds this all-star power trio. With the members constantly working on a multitude of projects, it’s no wonder that it took so long for Transplants to release new material. To say that drummer Travis Barker, guitarist Tim Armstrong and singer Rob Aston have kept themselves busy since disbanding in 2006 is an understatement. After eight years, the trio is back with a new album, “In a Warzone,” which still blends punk rock with hip-hop, like on previous releases, but this time the focus is more on punk, says Aston. “We’ve all grown up listening to different types of music, but punk rock has always been the backbone for all of us,” he says. “I personally think that’s the best type of music we make together.” To someone who has never listened to you before, how would you describe Transplants? If you listen to either our first or second album, it’s a little harder to describe because there’s so much going on. There are punk rock elements, hip-hop elements, dub elements … all kinds of stuff going on. But I always tell people that we’re a punk rock band. We do what we want, and

You recognize Armstrong from Rancid and Barker from Blink-182.

that’s punk rock. Were scheduling conflicts between the three of you the main reason why it took so long to make this album? We took a break after Warped Tour in 2005, but I guess we worked on the new album for about three years before we turned it in. Obviously it wasn’t three years straight, because everyone’s busy with other projects. So we recorded when we could, and we didn’t want to rush this album or turn If you go

Rancid With Transplants Thursday and Friday Terminal 5, 610 W. 56th St., Between 11th and 12th Avenues $28, 212-260-4700 www.livenation.com

in something half-a—ed. When you’re gone for a long time, you can’t come back with just anything. We had to give it our best, and that’s what we did. I think it’s our best work by far. Are there any guest vocalists on the new album worth mentioning? This time around we only put a few guests on the album. We have Paul Wall on one song, and Bun B and Equipto on another. But that’s it, just three rappers. It’s kind of funny that this is a punk rock album, but the guests we have are rappers. But that’s true to Transplants form. We’ve always put people on our albums that you normally wouldn’t think would be on an album like ours.

JOHN PLICHTER

letters@metro.us

Over 1000 free concerts in parks & streets citywide see them all at makemusicny.org


ENTERTAINMENT

www.metro.us Wednesday, June 19, 2013

18

“Northern Light� is a visually stunning documentary about low-income families in Michigan. / BAMCINEMAFEST, TETHERBALL

Of an independent mind High Quality Spanish classes $99 5 wk. Courses âœ˝ All levels âœ˝ Starting this week

Free online placement test! www.easyespanol.org 646-233-4235ĂŠU 555 8th Avenue, NY (btw 37th & 38th)

Series. The BAMcinemafest turns 5, oering gems from the American indie scene and elsewhere.

‘Ain’t Them Bodies Saints’ A lot of pomp for precious little, David Lowery’s Sundance fave lathers up a Terrence Malick-y storm for a tale that always feels too slender. Casey Affleck is an outlaw who busts from jail to reunite with his beloved wife (Rooney Mara) and their child. The film has been compared to a folk song, but even three-minute ditties have more meat on ’em.

OD GOES; O W Y L L O H RE TISTS COME WHE N E D F O E U tor AG THE IVYNLAPE-ON smile from the inven Get your S

Snap-On Smile

is excellent for:

UĂŠÂˆĂƒĂƒÂˆÂ˜}ĂŠĂŒiiĂŒÂ… Â… ĂŠÂœĂ€ĂŠĂƒĂŒĂ€>ˆ˜i`ĂŠĂŒiiĂŒ ÂŤÂ?>Â˜ĂŒĂƒ UĂŠ>ÂŤĂƒ]ĂŠVĂ€ÂœÂœÂŽi` vÂœĂ€ĂŠLĂ€Âˆ`}iĂƒĂŠÂœĂ€ĂŠÂˆÂ“ ĂƒĂŠ ĂŒi ĂŠÂ˜ÂœĂŒĂŠV>˜`ˆ`> Ă€i ĂŠ> Â…Âœ ĂŒĂŠĂŒÂ…iĂŠiĂ?ÂŤiÂ˜ĂƒiĂŠ Ăœ ÂœĂ• iĂŠ ÂˆĂŒÂ… ÂœĂƒ UĂŠ/Â… œœ`ĂŠĂƒÂ“ÂˆÂ?iĂŠĂœ Â?ĂžĂœ ÂœÂ?  >ĂŠ iĂŠ ĂŠÂ?ˆŽ Â?` ÂœĂ• `Ă•Ă€iĂƒ UĂŠĂŠÂ˜ĂžÂœÂ˜iĂŠĂœÂ…ÂœĂŠĂœ iĂŠ`iÂ˜ĂŒ>Â?ĂŠÂŤĂ€ÂœVi ÂŤÂ?iĂ?ĂŠ>˜`ĂŠÂˆÂ˜Ă›>ĂƒÂˆĂ› œ“ ĂŠV Âœv Ă€ĂŒĂŠ iÂ˜ĂŒĂ•Ă€iĂŠ>˜` vÂœ Â?ĂŠ` œ“ ĂŒÂˆ> >˜`ĂŠ`ÂˆĂƒV Â“ÂœĂ›>LÂ?iĂŠÂŤ>Ă€ Ă€i `ĂŠ ˜i ˆœ ĂƒÂ… v> >ĂƒĂŠ>Â˜ĂŠÂœÂ?`‡ UĂŠĂŠÂ˜ĂžÂœÂ˜iĂŠĂœÂ…ÂœĂŠÂ… LÂ?iĂŠ>Â?ĂŒiĂ€Â˜>ĂŒÂˆĂ›i Â?]ĂŠÂ“ÂœĂ€iĂŠVœ“vÂœĂ€ĂŒ> ˆvĂ• Ă•ĂŒ i> ĂŠL ĂŠ> ĂŒĂƒ >˜ Ăœ

in... ÂŤÂ?>Â˜ĂŒĂƒĂŠ Â?ĂƒÂœĂŠ 8* ,/ĂŒÂˆVĂƒĂŠUĂŠ iÂ˜ĂŒ>Â?ĂŠÂ?“ ˜ Âœ ` Âœ ` ˜ UĂŠ ÞÊ ĂŒÂˆĂƒĂŒĂ€ UĂŠi˜iĂ€>Â?ĂŠ i˜ UĂŠÂ˜Ă›ÂˆĂƒ>Â?ˆ}˜ ĂƒĂŠ ĂŒÂˆV ˜ UĂŠ*iĂ€ÂˆÂœ`Âœ

IONt $250) T A T L U S N E CO (valued a

FRieEw of Your Hollywood Smile

and Prev

CCEPTED SURANCES!

-OST)N

!CCEPTEDs

ING &LEX3PEND

AY SUITE

#ENTERs"ROADW

)NTHEHEARTOF,INCOLN

M

ANHATTANDENTALARTSCO

M SMILE sWWW

Now in its fifth year, the BAMcinemafest focuses on American independents — both upcoming heavies with big names and obscurities that languish without distributors. A few outside voices still get in, from the likes of Uganda and Pakistan, and that’s a good thing.

‘Drinking Buddies’ Joe Swanberg sells out, sort of; the filmmaker prone to deliberately sloppy camera work gets an actual cinematographer, as well as a name cast. Olivia Wilde plays a brewery worker in love with her engaged bestie (Jake Johnson). Swanberg has done illicit love before, but the film retains his better qualities. ‘I Used to Be Darker’ Matthew Porterfield follows his stunner “Putty Hill� with another survey of people struggling to ignore personal tragedy (here, it’s divorce). Less experimental than “Putty,� it goes deeper into the void of lives violently uprooted, both in youth and, even scarier, middle age. ‘It Felt Like Love’ Straight out of deep south

Andrew Bujalski’s “Computer Chess� plays BAMcinemafest. BAMCINEMAFEST, KINO LORBER

‘Computer Chess’ A decade ago, Andrew Bujalski’s microbudgeted “Funny Ha Ha� helped create the so-called “mumblecore� movement. His fourth is a new kind of film, too, and if others copycat it, cinema will be weirder for it. Genuinely, thrillIf you go

BAMcinemafest Through June 28 BAM Rose Cinemas 30 Lafayette Ave. www.bam.org/ bamcinemafest

Brooklyn, Eliza Hittman’s debut concerns the teenage anxieties of a young loner who spends the summer trying to fit in with neighborhood hooligans. Sexual inexperience leads to near-tragedy, but what’s affecting is how she, and the film, are always in an uneasy middle ground

ingly rich and strange, it’s a bizarre study of disconnection at a titular competition in the ’70s or ’80s (like much in the film, it’s never clear which), shot with video cameras created in 1969. That’s only the tip of the weirdness iceberg. Expect roaming cats, jarring editing and much, much more. — on the precipice of disaster, but never falling over. ‘Northern Light’ Though concerned with rural life in wintry economic times, Nick Bentgen’s documentary captures all of life, not just the bad stuff. It’s one beautiful image after another, showing its Michigan subjects trying to win at various competitions. Ups and downs are captured, but the impression that comes off is people just keepin’ on keepin’ on.

MATT PRIGGE

matt.prigge@metro.us


ENTERTAINMENT

19

TERENCE STAMP The acting legend talks about his new ďŹ lm, “UnďŹ nished Song,â€? as well as “Man of Steel.â€?

KNEEL BEFORE ZOD NICK WALL

British actor Terence Stamp has just about perfected cranky, from playing General Zod in “Superman 2� to his roles in “The Adventures of Priscilla, Queen of the Desert� or “The Limey.� In his latest, “Unfinished Song,� he puts all that practice to good use playing the misanthropic but devoted husband of the sunny and cheerful terminally ill Marion (Vanessa Redgrave). How easy does it make your job when Vanessa Redgrave is playing your

wife? It’s not easy, it’s just a great blessing, really. A lot of people have remarked that the fact that we’re this couple who’ve been together for 30 years is just kind of a given. It’s not spoken about, you know? Also, having you and Christopher Eccleston play father and son is inspired casting. When he was cast, my question to the director was, “How’s his voice?� — meaning, “What’s his dialect?� Because in

music that I like. So when he rucked up on the set, he had my voice down pat.

That’s funny because that was what I had to lose. I thought, “I’m never going to be able to play Hamlet, I’m never going to be able to play Macbeth talking like that.� I’m always amazed by the workings of the universe. It’s like a wheel, isn’t it? Everything turns round.

In an interview last year, director Terence Davies complained about how young English actors are all trying to sound like they’re from South London nowadays.

What do you think of “Man of Steel,� wherein Michael Shannon takes over for your villainous character, General Zod? I’m kind of sad. But to be honest with you, I think

Quoted

“I’m kind of sad. But to be honest with you, I think Dick Donner’s Superman movies were the benchmark, really.� Stamp, on his thoughts about the new “Man of Steel�

England your dialect is a kind of class system. It’s really how you speak. Apparently what he did was he downloaded both of my “Desert Island Discs� episodes and he listened to my voice — which is so astute. Because it’s not me performing, it’s me being myself talking about the

Dick Donner’s Superman movies were the benchmark, really. I mean, every kind of comic-book movie of that genre took from those first two Superman movies, you know? So I would be very surprised if it was as funny and as sophisticated. But then, the youth of today is not interested in that. I think if Donner’s movie came out now, it wouldn’t be as charming as it was then.

NED EHRBAR

ned.ehrbar@metro.lu

Special Pricing on Laser Hair and Tattoo Removal, BotoxÂŽ and JuvedermÂŽ 20 Years of Experience

Call for Details VISIT BBLDOC.COM To See Our Amazing Before and After Pictures of Brazilian Butt Lifts. For your comfort and safety all procedures at our facilities are performed “awake� under under local anesthesia. Accredited surgical facility & hospital available if needed.

State of the art non-surgical treatment for foot and heel pain Minimal invasive procedures for corrections of bunions and hammertoes New Cutting Weekend and evening appointments available Edge Laser for Toe Nail Most insurance plans honored Fungus! Free consultation ONLY $500 Non-injection therapy for heel pain Expires 6/30/13

s"OTOXÂŽs*UVEDERMÂŽ s2ESTYLANEs2ADIESSE

1

2

3 A B # 4

5

6 N R

Redeem with ad

/FlCESOF$R*EFFREY2OSENBLATT $0-s$R,ARRY#OHEN $0-

We specialize in curves and buttocks enhancements

New York Laser Lipo

Surgical & Non- Surgical Cosmetic Enhancement for Men & Women

(212) 695-1999

(718) 745-7172

7ESTTH3Ts3TE .9#

TH3Ts"+,. .9

WWWNYBEAUTYSURGEONCOMs3%(!",!%30!./,

Financing Options Available

Insurance not accepted

225 Broadway, Suite 1420 New York, NY 10007 212-385-3800 (Financial District)

'RAND#ENTRAL -IDTOWN 7EST3T TH&, New York, NY 10036 212-391-1279

*AY3T ND&, Brooklyn, NY 11201 718-875-9251 (Metrotech)

,ONG)SLAND,OCATION 543 Hempstead TRK West Hempstead, NY 11552 516-292-0023

#ONVENIENT,OWER-ANHATTAN"ROOKLYN,OCATIONS


See more at www.metro.us

www.metro.us Wednesday, June 19, 2013

TV watch list

SCIENCE

‘Through the Wormhole with Morgan Freeman’ This is a science documentary series narrated by the Greatest Voice of Our Time, Morgan Freeman. Tonight, he soothes us into submission with that voice while he talks about aliens. 10 P.M., SCI

REALITY

‘Couples Therapy’ In this episode of the only show about washed-up “celebrities” that is depressing enough to rival “Celebrity Rehab” (or “The Surreal Life”), Flavor Flav’s incredibly messed-up love life is examined. 10 P.M., VH1 ALEXANDRA CAVALLO

Slim on Down at Spa Jolie Slimming & Laser Center In just 2 weeks you can reduce cellulite and rid fat cells painlessly and permanently. Immediate results guaranteed with: Fat Blaster: Cavitation Ultrasonic. As seen on Dr. OZ. Immediate results. ody part) 6 Treatments $399 or 10 Treatments $599 (per body Zerona: Lose 3-9 inches permanently and painlessly in just 2 weeks with full-body inch loss. s. Buy 6 for $399, Get 3 FREE

Slimming Treatments: Slimming body wrap with mini facial: Reduce water retention.. $55 $555 ea. or pkg. of 4 for $159 Exercise at Spa Jolie: Our machines do all the work and you get all the results. 1 Month UNLIMITED $49 or Buy 2 forr $15

Interview. Wayne Knight discusses doing sitcoms and being more versatile than his “Seinfeld” image (he hopes).

What’s it like returning to sitcoms? Basically, the nature of the job is equivalent to stealing. Once you’ve learned how to pilfer, you remember how to do it, it’s highly profitable and it takes little effort. The great thing that TV Land does is, it hires veterans. Everybody knows what they’re doing. You just feel relaxed.

Rid Unwanted Hair: Full Body Laser $299 Lip or Chin $49 Back, Chest, Brazilian, Legs, or Arms ms $89 each Wax Specials: Back, Chest, Arms, Legs, or Bikini $18 each Full Body Wax $59s"RAZILIAN7AX$25 Spa Specials: Spa Manicure with Spa Pedicure $25 UV Gel Manicure $22 s4EETH7HITENING  MINUTE-ASSAGE UTE-A Body Wrap, or Microdermabrasion $49 each

FREE Consultation We will beat competitor’s coupons by 10%

180 7th Ave South West Village, btwn W 11th St & Perry St

212 229-0399 Expires 6/30/13

Q&A

You started as a serious stage actor. I came to New York at 23 and was on Broadway for this play “Gemini,” which was a comedy. I honed my chops over three years of doing that play. What was fascinating to me was learning how an audience works. You just learn these things about comic timing. And that grandfathers as you go, from one job to another job. In the era of YouTube, you can find a 1975 colonoscopy of yours. You have no idea what’s out there.

TV LAND

You’ve said one thing you like about your “Exes” character is that he’s a bit opaque, and you can play him in different ways. This season, we get to see a bit more variance. We peel away revelations about what his marriage was like. There’s depth to him that doesn’t show all the time. There’s broadness at times. There’s cynicism. It depends on the plot.

Loose Dentures? Missing Teeth Chew Better! Get Implants Free Implant Consultation www.newcenturysmile.com

Skin tightening laser: Tighten that sagging skin with our enhanced lasers. 6 Treatments for $399 Laser Specials: Acne scar and stretch mark reduction with Fractional ctional Laser $69

20

Hello, Newman Wayne Knight’s legacy is secure, thanks to two major contributions to 1990s culture: Newman on “Seinfeld” and greedy Dennis Nedry in “Jurassic Park.” Knight is back with sitcom work on TV Land’s “The Exes,” starting its third season tonight at 10:30 p.m. But like many longtime workhorses, there’s more to him, including films, other shows and Broadway. For instance, did you know he was on a 1980s sketch comedy show with Emma Thompson?

This man could narrate a milk carton. / SCIENCE CHANNEL

ENTERTAINMENT

(View Our Implant Video) • • • • •

Tighten Ex is ting Dentures Replace Dentures with Fixed Teeth R egrow B o ne Eliminate Gum Disease O ver 2 5 y r s Ex p er i ence

A l l D e n t a l S e r v i c e s Ava i l a b l e Most Insurances Accepted F I N A N C I N G AVA I LA B LE

(212) 752-2212 New Century Smile George Manthas, DDS Howard B. Marshall, DDS 250 E. 58th St, NYC NY 10022

Do you consciously try to avoid some of the darker tones of Newman or Dennis Nedry? That’s more in the public’s eye than mine. I don’t know if I’m as versatile as I’d like to pretend. [Laughs] The thing is, if you play two iconic characters who are evil guys, if you do it well, then that’s what people want to see you do. I spent 10 years trying to change that, but after awhile you just go, “Oh, whatever.” Some of your earlier shows, including the 1985 British-American sketch comedy “Assaulted Nuts,” with you and Emma Thompson, are now online.

You were also on Broadway in the play “Art,” which was written by Yasmina Reza, who wrote “God of Carnage.” “Art” was perhaps my favorite experience onstage. It was very challenging. The script was coming from the French through the British to America. It’s almost like you’re translating an alien script. I had a big scene where I had to find a way to break down every night emotionally. The great thing about the play is, it’s 90 minutes, without an act break. Her plays are incredibly great acting exercises. They’re just trampolines that you can bounce on as high as you can go.

MATT PRIGGE

matt.prigge@metro.us


21

+ PLUS Priciest

$20.9M The most expensive property to hit the market this week is a duplex at 50 Central Park West. This co-op has four bedrooms and 90 feet of frontage along the park. It’s listed by Stribling for $20.9M.

LIVE AT ARVERNE APARTMENTS AND BENEFIT FROM THE NEWLY RESTORED ROCKAWAY BEACH THIS SUMMER WITH YOUR FAMILY, AND RECEIVE A $300 GIFT CARD* UPON SIGNING A 1 YEAR LEASE FOR A THREE BEDROOM APARTMENT.

$145K

Major renovations are well underway at the complex. Residents enjoy newly renovated apartments, modern laundry facilities, energy efficient appliances, and on-site daycare. New retail includes a Stop and Shop, and a brand new YMCA. *Offer valid until July 15 and contingent upon signing a 12mo lease for a 3-bedroom unit.

For leasing information, please contact us at 888-635-6948 or email at info@arverneapartments.com

Cheapest

The cheapest unit this week is a two-bed co-op at 505 West 148th Street. A “stone’s throw away from the A, D, B and C” trains, this prewar unit is listed by Exit Realty Landmark for $145,500, and is subject to income restrictions.

ARVERNE APARTMENTS

*

IN QUEENS

Streeteasy.com is a New York-based real estate information portal that aggregates the most comprehensive set of sale and rental listings along with other useful info.


HOME

www.metro.us Wednesday, June 19, 2013

DIY furniture makeover Decor. Transform a set of chairs or desk into a work of art.

Before you toss that handme-down dresser, Barb Blair suggests you try giving it a paint job. In her new book, “Furniture Makeover,” the artsy designer and founder of Knack Studios arms aspiring DIY-ers with knowledge, courage and easy-to-

Tips

Knobby needs “For changing out knobs, which I always feel is a must, hit up the sales section at Anthropologie where you can find great ones for $2 and $3,” says Blair. “Hobby Lobby and World Market are other good sources.”

follow instructions. “One of the biggest things I hear from people is, ‘I’m so afraid to do that to this piece,’” says Blair. “That’s what I tried to dispel with the book. I wanted to take away the fear of painting furniture. It takes some time, yes ... but it’s not rocket science.” Here, she shows us how to spruce up curb-side mirrors.

Some handy tips

Use a medium sanding sponge to sand down whatever piece you want to paint, whether it’s a dresser, stool or desk. “I prefer sanding sponges over paper because they’re easier to hold,” says Blair.

Hit up the Oops paint section at SherwinWilliams or Home Depot for cheap options. “They always have a section where they mixed the wrong color of paint or the customer didn’t like the color once it was mixed and so a gallon of paint is around $5. Some of my best colors come from the Oops pile.”

“I am pretty particular about my paintbrush,” confesses Blair. She uses Purdy nylon brushes for latex paint. “They’re really soft and they make a huge difference.”

TINA CHADHA

tina.chadha@metro.us

Q&A

Why should people reimagine an old piece of furniture?

So many people come to me and say, “I’ve had my grandpa’s or grandma’s [furniture] in storage for 10 years.” And then they see my book and say, “Oh, that’s the exact same piece I’ve had in

my attic.” And if it’s your grandpa’s piece and it’s sitting in your attic, you’re not enjoying it. If you bring it down and DIY it and stick it in your foyer or bedroom and love it, by all means do it.”

22

And if you’re doing a big job, Blair says to roll the flat surfaces with a foam roller. “It’s absolutely seamless and smooth.”

Beauty is in the details

“If I’m doing a desk or chest of drawers, I love to line them with a fun paper that coordinates with the paint and the knob. It’s nice when you open your drawers and see a pretty pattern. Details are just something I pay a lot of attention to.”

Project: Mirror, mirror on the wall

ARVERNE APARTMENTS

From “Furniture Makeovers” by Barb Blair

Studios to 5 bedroom apartments from $702

Mustard Mirror

IN QUEENS

3 BEDROOM SPRING INCENTIVE

Removed the wooden attachment frame and wood-filled the side holes

Applied milk paint with a Nylox paintbrush

Sanded to remove all loose flakes

Applied a clear wax finish

STUDIO 1 BEDROOM 2 BEDROOM 3 BEDROOM 4 BEDROOM 5 BEDROOM

RENTS*

MINIMUM INCOME REQUIRED

$702 – $848* $872 – $1,054* $1,039 – $1,255* $1,237 – $1,494* $1,329 – $1,606* $1,459 – $1,763*

$28,080 $34,880 $41,560 $49,480 $53,160 $58,360

*Adjusted based on 30% of gross household income, per program guidelines

** Offer valid until July 1 and contingent upon signing a 12mo lease for a 3-bedroom unit

888-635-6948 • info@ArverneApartments.com Leasing office on site: 9am-9pm 57-17 Shore Front Parkway, Arverne, NY 11692 (cross streets: Beach 59th St, Beach 56th Pl)

THE MIRRORS AFTER

Gray Mirror

Limited Time Offer: $300 Gift Card** APARTMENT SIZE • Steps from the beach and A train • Renovated apartments • Modern laundry facilities • Energy efficient appliances • Commercial shopping • 24-hr security • On-site daycare

Removed the long attachment pieces from the back of the mirror so that the mirror would have a nice straight line on the bottom

Lightly sanded

Applied gray latex paint with a Nylox paintbrush

Wood-filled the holes

Sanded and distressed

Applied brown wax finish

Applied Knack custom green paint in latex. (This is a color that I mixed, and have named it Esme Green after the first piece I used it on.)

Green mirror

THE MIRRORS BEFORE

Lightly sanded and finished the surface in a brown wax Turquoise Mirror

Wood-filled the side holes and applied turquoise latex paint with a Nylox brush

Sanded and finished the surface with brown wax

Attached hardware for hanging


www.metro.us

ADVERTISEMENT

NEW LUXURY RENTALS AND INCOMPARABLE AMENITIES ATTRACT RENTERS TO THE BEACON IN JERSEY CITY unique collection of new luxury rental residences and incomparable amenities have helped establish The Beacon in Jersey City as the community of choice for scores of new renters. At this private, gated community, residents enjoy 50,000 square feet of amenities including an indoor pool, Grotto lounge, yoga studio, 24/7 fitness center, lounge screening room, children’s playroom, poker room and a billiards hall. Additional services include valet parking and courtesy shuttle transportation to the Grove St. and Exchange Place PATH/Ferry Stations.

A

The Beacon also offers plenty of open green space including a 2-acre park with children’s playground, a dog run, and a nearly-completed parking garage that will feature a 45,000 square-foot landscaped rooftop park with spectacular views. The Beacon’s stylish rental residences are situated in historic restored buildings that boast modern finishes and appointments to create exceptional living spaces – many with panoramic views of the Manhattan skyline and Liberty State Park. Studio, one- and two-bedroom residences range from 592 to 1,310 square feet of living space at net effective monthly rents starting from $1,705, with immediate occupancy available. The ultra modern residences feature 14-foot lofted ceilings, oak plank flooring, and Gourmet Chef’s Kitchens with granite countertops, GE® Energy Star® stainless steel appliances and garbage disposals. Each residence also offers central heating and air conditioning, individual washers and dryers, and smart card key access. For more information on The Beacon,

call (877) 640-4945, or visit The Beacon’s website at thebeaconjc.com. The community’s Leasing Center is located at 20 Beacon Way, Jersey City, NJ 07304.

FOLLOW YOUR

DESIRE

Luxury Apartments Starting From $1,705*

23 new york Wednesday, June 19, 2013

*2 Months Free

Pool • Gym • Spa • Views • Full Service Building

TheBeaconJC.com |

866.928.0638


Stop Renting and Start Owning!

www.metro.us

Poconos Pennsylvania Builder -- 90 mins. from NYC!

All our new homes include up to 4 bedrooms, 2½ baths, garage, living room, dining room, complete appliance package, Central Air and Heat, landscaping, and a host of features. including permitting, driveway and well -- all included in the purchase price!

THE ALL NEW MILLBURN

THE ALL NEW COUNTRY HOME

194,500

$

NOW

NOW

2,393 SQ. FT. • COVERED FRONT PORCH $

$6,808 DOWN PAYMENT

1,500* per month pays all including principal, interest, taxes and insurance!

199,900

$

2,681 SQ. FT. • LARGE OPEN FOYER $

$7,000 DOWN PAYMENT

1,545* per month pays all including principal, interest, taxes and insurance!

ALSO AVAILABLE --

THE ALL NEW HERITAGE

Previously Owned Homes

now

In addition to its world-famous line of new homes, some at left, Classic Quality homes is proud to announce an entirely new offering of previously owned homes, priced from an amazing $99,000. These are quality offerings, all completely reconditioned and fully warranteed by Classic, the Pocono’s most trusted builder. These beautiful homes, in some of the area’s most desirable communities, can be purchased for as little as $3,400 down and as low as $1,500 per month. Call us now for complete details on these reconditioned resale homes as well as Classic’s all new line.

283,500

$

3,422 SQ. FT. • CLASSIC STONE TOWER $

$12,500 DOWN PAYMENT

2,171* per month pays all including principal, interest, taxes and insurance!

NOW FROM

99,000

$

WHEN AVAILABLE

Buy a new home now -- Get up to $5,000 toward Closing Costs! LOW PROPERTY TAXES! EXPRESS COMMUTER BUSES (4 per hour) 90 mins to NYC!

1-800276-4000 Visit our all-new website:

www.classicqualityhomes.com

Member Better Business BureauNE and Central PA

* Monthly payments based on FHA 30 yr. fixed interest rate of 3.75% with 4.252% APR with a finance cap of $271,000. Lower rates may apply to qualified buyers. All numbers are estimated. Conventional mtgs. also available.

24 new york Wednesday, June 19, 2013

Call toll free


HOME

25

Builders’ confidence a good sign for the market Real estate. The housing recovery is gaining traction.

Builders aren’t just conďŹ dent that their homes are level. They’re conďŹ dent in the market. / WAVEBREAK MEDIA

Confidence among U.S. homebuilders surged this month, staging its biggest gain since 2002 in one of the strongest signs yet that the housing recovery is gaining traction. A majority of homebuilders say conditions for new construction are favorable, rather than poor, for the first time since the housing crisis began seven years ago, according to a closely watched index released on Monday. Executives in the homebuilding industry say a steady rise in home prices, tighter inventories of properties up for sale and a slowing trend in foreclosures have helped

PARKCHESTER SPACIOUS LIVING ¡ AFFORDABLE RENT

the housing market regain its stride over the past year. Even so, the big jump in confidence registered this month by the National Association of Home Builders/Wells Fargo Housing Market index was surprisingly robust. Pete Flint, chief executive of online real estate company Trulia, said conditions were just right for confidence to blossom, with supply of available homes still trailing a rising tide of buying sentiment. “We are in the early days of a real estate market recovery,� he said. “The supply of homes for sale

is still relatively small because sellers are reluctant to list in a rising market. They want to sell at the top.� And there’s good reason for further bullishness, said Stan Humphries, chief economist from Zillow, an online real estate company, because annualized new home sales aren’t even back to their historical average. “At this point, I suspect many of the constraints preventing builders from building faster are logistical and land-related versus concerns about future demand,� he said.

Quoted

“The supply of homes for sale is still relatively small because sellers are reluctant to list in a rising market. They want to sell at the top.� Peter Flint Chief executive of online real estate company Trulia

Flagging a more robust outlook for profits, the stronger-than-expected data buoyed homebuilder shares. But investors were mostly focused on whether the Federal Reserve would reinforce its commitment to supporting the economic recovery at its meeting yesterday and today. The market wants clues from the Fed on when it would start cutting back on its $85 billion in bond purchases every month. Those purchases have stimulated the economy and kept mortgage rates near record lows in recent years. While a recent spike in market rates has raised concerns about the headwinds that might affect the recovery, home loans remain cheap by historical standards, a trend that bodes well for the market. REUTERS

**** PUBLIC NOTICE ****

AFFORDABLE

1ST HOMES *Licensed Real Estate Broker ATTENTION: ALL TENANTS AND FIRST TIME HOME BUYERS!!! LIMITED TIME OFFER TO OWN A HOUSE FOR ONLY: UÊf£]nÇxÊ/"Ê-/,/Ê/ Ê*," --Ê UÊ "Ê "- Ê "-/-Ê UÊ"7‡8 Ê,/ Ê",/ Ê phot pph pho hhoto by Ron Ron G Gla laassma m n

ELEGANT NEW KITCHENS ¡ GRANITE COUNTERTOPS NEW APPLIANCES ¡ STAINLESS STEEL FINISHES 1 & 2 BR RENTAL APARTMENTS START AT $1100 PER MONTH* UĂŠ 9½-]ĂŠ-/, 1 -]ĂŠ** ½-]ĂŠ-1* ,, /-]ĂŠLÂ?ÂˆÂ˜ÂŽĂŠ/ ->˜`ĂŠ1 ĂŠ", ĂŠĂŠ" ‡-/ ĂŠUĂŠĂ“{ĂŠ,ĂŠ,"6 ĂŠ- 1,/9

30 min to Midtown ¡ No Broker Fee ¡ Early & Future Occupancy "ÂŤiÂ˜ĂŠÂœĂ•Ăƒi\ĂŠ/Ă•iĂƒĂŠEĂŠ/…ÕÀÊx\ää‡Ç\{x“ʹÊ->ĂŒĂŠÂ™>“‡£Ó\{x“

EHO

917-634-5295

or apply on line www.parkchesternyc.com *Apts with traditional kitchens still available starting at $1010

We have 1 and 2 family homes in Brooklyn, Queens and The Bronx

OUR HOUSES ALL HAVE: UĂŠ iĂœĂŠÂˆĂŒVÂ…iÂ˜ĂƒĂŠĂœÂˆĂŒÂ…ĂŠĂ€>Â˜ÂˆĂŒiĂŠ>˜` -ĂŒ>ˆ˜Â?iĂƒĂƒĂŠ-ĂŒiiÂ?ĂŠÂŤÂŤÂ?ˆ>˜ViĂƒĂŠ UĂŠ iĂœĂŠ >ĂŒÂ…Ă€ÂœÂœÂ“ĂƒĂŠĂœÂˆĂŒÂ…ĂŠ Ă•ĂƒĂŒÂœÂ“ĂŠ/ˆÂ?iĂŠ UĂŠ>Ă€`ĂœÂœÂœ`ĂŠÂ?ÂœÂœĂ€Ăƒ UĂŠÂˆÂ˜ÂˆĂƒÂ…i`ĂŠ >Ăƒi“iÂ˜ĂŒĂƒ

Register in person at our ofďŹ ce:

st You mur by registe thst JULY 51 Call 00 1-18 718-29W!!! NO ES M ED HO LIMIT AILABLE AV

ÂŁ{·£ÎʈÂ?Â?ĂƒÂˆ`iĂŠĂ›i°]ĂŠ>“>ˆV>ĂŠ 9ĂŠÂŁÂŁ{ĂŽxĂŠ ÞÊ/Ă€>ˆ˜\ĂŠ/>ÂŽiĂŠĂŒÂ…iĂŠÂşÊ/Ă€>ÂˆÂ˜ĂŠĂŒÂœĂŠ-Ă•ĂŒÂŤÂ…ÂˆÂ˜ĂŠ Â?Ă›` ÞÊ >Ă€\ĂŠ/>ÂŽiĂŠ6>Â˜ĂŠ7ĂžVÂŽĂŠĂŒÂœĂŠˆÂ?Â?ĂƒÂˆ`iĂŠĂ›iĂŠ

718-291-1800 START NOW!!


STYLE

www.metro.us Wednesday, June 19, 2013

26

The summer music festival makeup guide Around this time of year, fashion stories telling you what to wear to summer’s big outdoor music festivals are inescapable. But what about glittery eyeshadow that won’t melt and tinted moisturizer that won’t streak after hours of dancing in the sun? We sort you out. ROMINA MCGUINNESS

MELTING LIP GLOSS MAC

RUNNY EYE MAKEUP

STREAKY FOUNDATION

Estee Lauder

Bare Minerals

Double Wear Stay-in-Place Eye Pencil in Onyx, $21, www.esteelauder.com

Ready Foundation Broad Spectrum SPF 20, $29, www.bare escentuals.com

Prep and Prime Lip, $16, www.maccosmetics.com

NARS

L’Oreal Paris

Satin Lip Pencil in Yu, $25, www.nars cosmetics.com

Infallible 24-Hour Eye Shadow in Eternal Sunshine, $7.95, www.lorealparis usa.com

Clinique Superpowder Double Face Makeup, $22, www.clinique.com

Yves Saint Laurent Rouge Pur Couture Vernis A Levres Glossy Stain in Peche Cerra-Colla, $34, www.yslbeautyus.com

Cover Girl

Givenchy

Lash Blast 24-Hour Mascara, $9, www.covergirl.com

Mister Mat Mattifying Foundation Primer, $34, www.givenchy.com

What the makeup artist says: What the makeup artist says:

What the makeup artist says:

“It’s all about creating a base that grips,” explains LA-based makeup artist Melanie Inglessis, who has brushed up the likes of Lea Michele and Miley Cyrus. “For lipstick that lasts and doesn’t bleed, apply a light layer of concealer or powder to your lips before adding

color. Or use a lip pencil that is the same color as your lipstick. Draw the entire lip and color it inside. The pencil is matte and creates a solid base. Avoid products that are moisturizing and contain emollients, such as lip balm, which will slide off your skin.”

“Glitter may be a summer festival must, but don’t use it on your eyelids. It’s a loose particle, so you’d need a creamy base to press the glitter on. And keep away from creamy eye shadow, which will smudge,” warns Ingles-

ONE DAY ONE VISIT

TOOTH CROWN SUMMER

SPECIAL $1150 By Dr. Irina Feldbein UÊ-ˆ˜}iÊ>««œˆ˜Ì“i˜Ì UÊ œÊÌi“«œÀ>ÀÞÊVÀœÜ˜Ã UÊ œÊ>LœÀ>̜ÀÞÊviià Uʈ˜iÃÌÊ̜œÌ…‡ˆŽiʓ>ÌiÀˆ> UÊ œÊ“iÃÃÞʈ“«ÀiÃȜ˜Ã BEFORE

AFTER

-/ÊUÊ " 6  /ÊUÊ",   Quality

n™ÇÊ*>ÀŽÊÛi˜Õi]Ê iÜÊ9œÀŽ]Ê 9ÊÉÊ212 535 1202 guaranteed £ÎÎÊ7iÃÌÊ ˜`ÊÛi˜Õi]Ê ÀœœŽÞ˜]Ê 9ÊÉÊ718 743 2222 www.GorgeousSmileNY.com / www.OneDayCrownNY.com

sis. She recommends a matte eye shadow or waterproof mascara. Another trick is to dab some concealer under the eyes: “The more your skin is bare, the more oil it has. The concealer will keep things in place,” she adds.

“Rule No. 1: Use the right foundation for your skin type,” says Inglessis. “If you have oily skin, don’t go for a liquid foundation, but one that’s powderbased. A face primer will give you a good base. It

absorbs excess oil and mattifies your skin, ensuring that makeup doesn’t move. But if you sweat a lot, it may be best to not use anything other than a good SPF and a concealer or powder as [a] cover up.”


TECHNOLOGY

App Appeal Mobile. We try out a program that’s a less annoying Instagram, plus look at talking cats.

Analog Camera Platform: iOS Cost: $.99 Genre: Pictures

The big question with the new Analog Camera app is this: How is it not Instagram? Both allow photo junkies to mess up pictures, fresh or old, with retro-styled filters, then clog the Internet with the “work� they made with just a few clicks. A smoother interface is a nice touch. Designed by Realmac Software, who made the attractive to-do list app Clear, it puts all the filters in the middle of the screen, allowing one to better judge what one’s doing to the pic before it goes out to the world. There’s also no dorky borders. But is that enough? It wouldn’t be, but there’s also this: The social media aspect has been downplayed. Yes, there are buttons handy that allow one to pester your Twitter buds with pics that look like they were taken circa 1978.

DENTAL CENTER IN THE

CHRYSLER BUILDING

But where Instagram ends with your pictures spreading throughout the Global Village, Analog Camera makes it more of an option. You can just keep your business to yourself, rather than it being in everyone’s faces. Alas, it’s not completely its own thing: Like Instagram, the filters are kind of similar. And Analog doesn’t allow for widescreen vista shots. There’s an entire chunk of the smartphone screen going to waste, fellas. Summation: Instagram is for the oversharing kids, Analog is for the undersharing olds.

Talking Tom Cat Platform: iOS Price: Free Genre: Cats

Though films like “Cats and Dogs� will have us think the former are snooty hellbeasts, the truth is cats are superior to dogs: Smarter, more emotionally complex and far less needy when it comes to waste. Even the cat in Talking Tom Cat is strangely smart. Standing in an alley way, he lets you have your way with him. You can pet his belly and make him purr, give him milk, even give him a live bird. You can also, if you’re sadist,

27

42ND AND LEXINGTON

Invisalign providers since 2005 with Elite status Call us to schedule a complimentary consultation and ďŹ nd out how Invisalign can work for you. Full treatments of any length are only

$3999 www.kakosiandental.com

888-711-0267 Analog Camera is like a less sociable Instagram. / PROVIDED

smack him in the face and knock him down. There are admittedly limited things you can do with him. (There are other a la carte functions you can get, if spending money on an app about a cat is something you would do.) But one feature offers endless (or somewhat endless) amusement: He repeats whatever you say to him, in a nasal voice. Summation: It’s a passable time-suck.

MATT PRIGGE

Second location: 204 East 35th St., Bet 2nd & 3rd

Are You Shy

VII-SAD-1

‰ Do you get anxious in front of others? ‰ Do you feel embarrassed if you have to give a speech or perform at a public function? ‰ Do you avoid meeting new people, going to parties, or dating? ‰ Is it difficult for you to eat, drink, or write while others may be watching you? If your answer is yes to any of these questions, you may be suffering from Social Anxiety Disorder. If you are between 18 and 75 years of age, and feel that these problems interfere with your ability to achieve your goals or to enjoy life fully, you may be eligible for our research study. If you qualify, you will receive studyrelated evaluations with our Board Certified Physician and study medication, at no cost to you. Please call for more information.

(212) 595-5012

matt.prigge@metro.us

Th e Med ica l R e sea rc h Ne two rk , L. L. C. 134 East 93rd Street, New York NY 10128 y www.MedicalResearchNetwork.com Internet

Google aims to abolish child porn pics with new database Google announced plans over the weekend to remove child pornography images from the Web by using a new, picture-sharing database. The program, which the Telegraph reported will be operational within the year, will allow search engines and other Web companies to swap information about images of children being abused or raped. Pictures that have been flagged as inappropriate — especially by child

Child porn pics will be banished by Google search engines. / MASHABLE

protection companies such as the Internet Watch Foundation — will be cleared from the Web. At the moment, flagged or earmarked images are difficult to eliminate entirely, given the absence of a Web-standard database. This new program will increase transparency

between Web engines and — hopefully — speed up the process of tracking down and universally erasing these types of pictures. In an e-mailed statement to Mashable, Google Director of Communications and Public Affairs Scott Rubin said, “We have a zero-tolerance attitude to child sexual abuse imagery online. The fight to remove these images from the Internet is a global one, and we hope these measures will help in that important battle.�

(524!4? ?

WORK ? s7/2+%23 7/2+%23 #/-0%.3!4)/. s#/.3425#4)/. !##)$%.43 s3/#)!,3%#52)49 $)3!"),)49 LAW OFFICES OF

s sä!LLä7ORKä2ELATEDä)NJURIES sä!LLä/CCUPATIONALä$ISEASES s sä#ONSTRUCTIONä!CCIDENTS s sä-OTORä6EHICLEä!CCIDENTS sä.EGLIGENCEää,IABILITYä!CCIDENTS sä3OCIALä3ECURITYä$ISABILITYä33) sä0ERSONALIZEDä3ERVICEä4Oä%VERYä#LIENT sä.Oä!PPOINTMENTä.ECESSARY sä2EPRESENTä5NINSUREDä%MPLOYERS

CALL 212.684.3160

/FlCESäINä1UEENS ä"ROOKLYN ä3TATENä)SLAND ää D

.ASSAUää3UFFOLKä#OUNTY

FREE

HARRIS LAW GROUP, LLP CONSULTATION We Speak Your Language: Spanish, Russian, Chinese, Polish and Bengali


5

WELLBEING

www.metro.us Wednesday, June 19, 2013

TIPS FOR BUILDING A BETTER SALAD

Joy’s Healthy Bite

JOY BAUER, MS, RD WWW.JOYBAUER.COM Health and Wellness expert for the ‘Today’ show and New York Times best-selling author.

If you’re on a summer mission to eat light and healthy, choosing a veggiepacked salad seems like a no-brainer. But salads can pack more calories and fat than you think. A classic Cobb salad with chopped bacon, egg, blue cheese, avocado and creamy dressing can cost you more than 1,000 calories and 80 grams of fat! For some people, that’s more than half their day’s worth of calories. With that said, don’t give up on salads — just follow these strategic steps and you’ll chow down on a slimming and scrumptious meal that fills you up, not out.

1

Start with a strong foundation: Up the nutrition ante by choosing a base that provides important nutrients like folic acid, iron, beta carotene and lutein. Nix anemic iceberg and

instead go for mesclun greens, baby spinach or a spring mix that includes a variety of dark green lettuces. For less than 20 calories per 2-cup serving, you’re o to a great start.

or shrimp. If you’re vegetarian or just want to mix it up, choose cubed tofu, beans and/or lentils. Stay away from fatty meats like bacon and salami, and skip anything fried or in heavy sauce.

2

4

Pile on the veggies: Take advantage of fresh vegetables and load them on top of your greens. Choose a variety of colors to get the most health beneďŹ ts — red bell peppers, broccoli, carrots, sugar snap peas, cucumbers and red onions are all great choices. Stick with raw, steamed, grilled or roasted vegetables and steer clear of anything fried or swimming in oily marinades.

Dress it up lightly: Dressing can take a salad from light and nutritious to ferociously fattening. One tablespoon of your

average vinaigrette is about 80 calories, and one tablespoon of creamy ranch is about 100 calories (restaurants use between 4 and 6 tablespoons — yikes!). Ask for the dressing on the side when ordering and whenever possible, choose light, lowcalorie or low-fat options.

3

Don’t forget the protein: Your salad becomes a meal when you add protein. If you’re opting for animal protein, select a lean source such as egg whites, skinless chicken or turkey breast, water-packed chunk light tuna, wild salmon

TOSS IN SOME SHRIMP FOR A LEAN PROTEIN PUNCH. GETTY IMAGES

28

Top it o

Pick one extra Extras add another dimension and avor to your combo of greens, vegetables and lean protein. While some of these are packed with nutrients, they’re also packed with calories, so they should be added sparingly. Luckily, a little of these high-fat goodies goes a long way, so you won’t need more than one of the following (each with between 40 and 70 calories): •

2 tablespoons cheddar, Parmesan, goat, Swiss or feta cheese

•

1 tablespoon chopped walnuts, pecans or sliced almonds

•

1 tablespoon sunower or pumpkin seeds

•

1 ounce avocado

•

10 small olives

•

Âź cup croutons

•

2 tablespoons dried cranberries or raisins

PODIATRIST The Most Advanced Techniques Used for Bunions and Hammertoes A new approach for treating Tendon Injuries for the Achilles, Tendonitis and Plantar Fasiitis (Heel and Arch Pain) New Treatment For Heel Pain, Shockwave, PRP as seen on the front page of The New York Times

Dr. Paul Drucker, DPM Dr. Martin McGrath, DPM 121 E. 60th St. Suite 3D (Between Lex & Park) New York, NY

(212) 486-7333 162-15 Highland Ave Jamaica, NY 11432

(718) 658-9383

Dr. Ernest Levi, DPM Midtown - Grand Central 30 E. 40th St., Suite 401

212-685-5100 Feet Hurt? Bunions? Hammertoes? Heel Pain? Now Featuring

Helps Eradicate Fungal Nails

Platelet Rich Plasma Therapy (PRP)

Take the Foot Health Checkup s-YTOENAILSARESTREAKED DISCOLORED THICKENED s4HESIDEOFMYTOENAILSDIGINTOTHESKINANDHURT s)HAVEALARGEBUMPBEHINDMYBIGTOEORLITTLETOE which is always red. s)GETANEXTREMELYPAINFULCRAMPINTHEAREAOF MYTHIRDANDFOURTHTOESWHENWEARINGSHOES s-YTOESARENgTSTRAIGHT THEYARECROOKED BENT and hurt. s)HAVEPAINFULCALLUSESONTHEBALLOFMYFOOT WHICHKEEPBUILDINGUP s)HAVECORNSONMYTOESWHICHGETTHICKER NOMATTERWHATSHOESIZE)WEAR s4HEBOTTOMOFMYHEELHURTSALLDAY BUTITgS WORSEWHEN)STEPOUTOFBEDINTHEMORNING s)HAVECRAMPSINMYLEGSWHICHALWAYSHAPPEN WHEN)WALKTHESAMEDISTANCE s-YANKLESARESWOLLENMOSTOFTHETIME s-YFEETAREALWAYSDRYANDSCALY SOMETIMESTHEYITCH s-YFEETJUSTHURTALLOVERWHEN)STANDORWALKALOT s)HAVENUMBNESS BURNING INFECTION PERSISTENT PAIN SKINRASH OROPENSORES

If any of these apply to you, call today.

0ATIENTISRESPONSIBLEFORCO PAYSDEDUCTIBLEs-OSTINSURANCEPLANSACCEPTEDs#OMPLETEFAMILYFOOTCAREs,ASERSURGERYAVAILABLE


WELLBEING

Don’t be shady, wear the right sunglasses Tips. The art of choosing a pair of sunnies goes beyond what looks good on you. When it comes to eye health, most damage comes from UV light. During summertime, when we spend more time outside, the risk greatly increases. “Sunlight literally cooks the retina,” says optometrist Dr. Rupe Hansra, LensCrafters’ senior director of eye care. “Over time, it becomes yellow and hard, and we begin to lose good vision.” Wearing sunglasses year-round protects the retina from damaging

UVA and UVB light and can help delay the onset of cataracts, s macular degeneration and even basal cell carcinomas on the eyelids. “The most common part of the body for skin cancer is the tip of the nose,” Dr. Hansra says. “The second is the lower eyelid, which is very delicate and susceptible to sun damage.” So how do you choose a good pair? Here are Dr. Hansra’s tips:

Just like sunscreen, look for a number “For eye protection, a label that says UV 400 is what people should look

29

More info

What is macular degeneration?

Blake Lively knows that staying safe in the sun can be fashionable. LUXOTTICA, LENSCRAFTERS

for on sunglasses,” he says. Not sure about your glasses’ protection level? Your local LensCrafters or optometrist can test the UV prescription.

Size counts “Typically, bigger is better. Choose large sunglasses that wrap around and block extraneous light coming from the side.”

Macular degeneration is the deterioration of the macula, where color and 20/20 vision occurs. Besides UV light, genetics and smoking, obesity hastens its decline: “I always tell patients: What’s good for your heart is good for the eye,” Dr. Hansra says. “Beta-carotene, omega-3s and, most of all, lutein keep eyes healthy. Lutein is in green, leafy vegetables and most berries.”

Pupil pointers A report from the Healing The Eye and Wellness Center in Florida said that sunglasses harm vision by interfering with pupil dilation, which happens naturally to protect the macula. But you shouldn’t worry, Dr. Hansra says. “When you wear sunglasses, your pupils dilate slightly,” he says. “As long as you have sunglasses with UV 400 protection, pupil dilation isn’t a concern.”

Get ’em polarized 30-second lifesaver

“For driving, everyone should wear polarized sunglasses to cut down glare, which is related to so many accidents. Polarized sunglasses not only save your eyes but could save your life, too.”

LINDA CLARKE

In this new weekly section, we’ll have an expert give us one easy tip that can change your life. This week’s comes from Dr. Linda Franks, medical director of NYC’s Gramercy Park Dermatology and spokeswoman for The Skin Cancer Foundation.

She echoes the sun safety sentiment. •

“Protect your scalp, face and neck from the sun’s harmful ultraviolet rays with tightly woven, wide-brimmed hats and UV-blocking sunglasses.”

letters@metro.us

June is Men’s Health Awareness Month If you love him, take him to the doctor... This is Dr. Susan Beane on behalf of Healthfirst Healthy Living. If you have a special man in your life, keep him feeling his best. You know it can be a challenge to get him to see a doctor—so take charge. Arrange the appointment and make the occasion special; plan a reward. Diabetes, cholesterol, blood pressure and cancer screenings should all be routine. And finally —remind him, loving him means keeping him well. For more men’s health tips and a chance to win an American Express gift card, visit hfhealth.org.

Dr. Susan Beane, VP and Medical Director, Healthfirst

INA13_96(j)


LETTERS AND GAMES

www.metro.us Wednesday, June 19, 2013

Letters

Horoscope

Gemini | May 22-June 20. Some exciting news is making the rounds among your friends. The buzz is likely to be about you. Cancer | June 21-July 22. Some confidential information from an unexpected source could come your way. Act on it! Leo | July 23-Aug. 22. The impression you make on friends today is likely to be so good, everyone will have a feeling that they should be doing something special for you. Don’t be surprised if one or two do.

Virgo | Aug. 23-Sept. 22. You should be exceptionally lucky in terms of fulfilling your chosen goals. Take this opportunity to focus on your biggest objectives. Libra | Sept. 23-Oct. 22. You’re likely to learn something important when trying to teach another. Be nice to those who ask for help, and pay attention. Scorpio | Oct. 23-Nov. 21. Greater returns than what you would normally expect are possible from a sideline endeavor. Review what happens.

Sagittarius | Nov. 22-Dec. 21. You tend to take on the vibes of your associates. A lucky person’s fortune could rub off on you.

Pisces | Feb. 19-March 20. Don’t stop being hopeful regarding the outcome of an important event. Things are getting back on course.

Capricorn | Dec. 22-Jan 20. Things are changing for the better, and it looks like you’re going to get all the help you need for a critical project.

Aries | March 21-April 20. You’ll be particularly good at most anything you take on today. Shoot for the big time.

Aquarius | Jan. 21-Feb 18. That tingle you feel in your chest could be a direct hit from one of Cupid’s arrows. Things could get rather interesting for you in the romance department.

Taurus | April 21-May 21. Yesterday, you were likely to be better at handling small transactions than large endeavors. Conditions are reversed today, however, so think big. BERNICE BEDE OSOL

Sudoku: Easy and hard

3 8

7 2

3

6

1

2

1

6

8

8

9

9

3

4

7

4

8

8

5

3 5

6 2

6 1

30

6 6

2

5

3 2

1

6

7

4 1

1

5 1 6

9 7

9

1

7

4 5

6

3

7

3

7

1

8

6

7 9

3

How to play Fill in the grid so that every row, every column and every 3x3 box contains the digits 1-9. There is no math involved. You solve the puzzle with reasoning and logic.

Have a little faith in religion Re: ‘What’s faith done for anyone?’ (Metro, June 18) Letter writer Amanda Canetti asks a good question. What good is religion? I lament that so many people feel this way — they see wars over religion, they see believers persecuting others — and all because of a “matter of opinion.” Yet this “opinion” can and has done lots Online

Read letters at Metro.us!

of good for many. The nasty, extremist voices usually speak the loudest and give religion a bad image, while the loving voices are drowned out. They are there, though, and always will be. Just look around. ANNIE FERRIS, VIA EMAIL

Wars have historically been fought over resources, even when religion has been used to justify them. Freedom of religion is a right in America. Most religions share the requirement that love and compassion be cultivated and that we not allow our differences to separate us. Amen to that. LINDA WHITTAKER, VIA EMAIL

letters@metro.us

In addition to news, features and more, Metro is now posting letters to the editor on our website. Check it out at Metro.us

Keep them as brief as possible, preferably under 100 words. Metro reserves the right to edit all letters. Please include your name and contact info.

New! You can use your smartphone to discover today’s crossword answers — right now! Download and open the Blippar app on your smartphone and hold the screen over the puzzle — it’s that easy!

rd swo s o r C

Crossword

Across 1 Lion, to Tarzan 6 Freedom org. 10 Gape open 14 Sing like Bing 15 Dow uptick 16 Author — Wiesel 17 Gives a rating 18 Nick and Nora’s dog 19 Vaulted recess 20 Pass near Pikes Peak 21 Downplayed 24 In the middle 26 Perfume essences 27 Sofa end 28 Kind of welcome 30 DeMille movies 33 Made on a loom 34 Buy at auction 37 Vegas rival 38 Spring and ebb 39 Allot 40 Thug’s piece 41 Four-door model 42 Cavalry weapon 43 Had the flu 44 Common gull 45 Trill 48 View 52 Rosetta Stone figures 55 Expected any time 56 “Cope Book” aunt

57 Roam about 58 Fountain orders 60 Senate’s Harry — 61 Swear 62 Like helium 63 This one, to Juan 64 Oater backdrop 65 Yields territory

Down 1 Use steel wool 2 Really ticked 3 Water-lily painter 4 — choy 5 Grabs the phone 6 One more time 7 Autograph site 8 Diet 9 Not knowing 10 Fermenting agents 11 — Centauri 12 More prudent 13 Must-haves 22 Border 23 Like — — of bricks 25 Baylor site 28 Surfer wannabe (hyph.) 29 Level 30 Work unit 31 Few, to Pierre 32 Motel of yore 33 Extensive

34 Float along 35 Dot in the Seine 36 “The,” to Wolfgang 38 Wire 39 Break of day 41 Granary, often 42 Earthshaking 43 Wear off by rubbing 44 Dashboard info 45 Stranger’s query 46 Buenos — 47 Send payment 48 “Phantom of the —” 49 Ran in neutral 50 Beyond the fringe 51 Twig-and-mud homes 53 Romance 54 — Saint Laurent 59 Dijon donkey

Yesterday’s answer

As the world’s largest global newspaper, Metro has more than 18 million readers in over 100 major cities in 23 countries • Metro New York 120 Broadway, New York, NY 10271 • main 212-457-7790 • to advertise 212-457-7735 • sales fax: 212-9521505 • National and Executive Sales Director Ed Abrams • U.S. Circulation Director Joseph Lauletta • U.S. Marketing Director Wilf Maunoir • e-mail sales advertising@metro.us • e-mail distribution distribution@metro.us • Advertisements appearing in Metro are published in good faith. Metro does not endorse and makes no representations about any of the advertising content appearing in its pages. Metro is not responsible for any loss or damage whatsoever resulting from readers using the services of its advertisers. Readers should exercise caution when replying to advertisements, especially those which require any form of payment, and, where necessary, should seek independent legal advice. Editor in Chief Tony Metcalf, tony.metcalf@metro.us @edinchief metro • Managing Editor Dorothy Robinson, dorothy.robinson@metro.us • City Editor Allen Houston, allen.houston@metro.us • Sports Editor Mark Osborne, mark.osborne@metro.us • Books/Parenting/Gossip/Travel Editor Dorothy Robinson, dorothy. robinson@metro.us • Home/Style/Food Editor Tina Chadha, tina.chadha@metro.us • Film/Tech Editor Matt Prigge, matt.prigge@metro.us • Wellbeing/Going Out Editor Meredith Engel, meredith.engel@metro.us • Music Editor Pat Healy, pat.healy@ metro.us • Careers/Education/Dating Editor Julia Furlan, julia.furlan@metro.us • Copy Chief/Theater Editor Tracie Michelle Murphy, tmichelle.murphy@metro.us


SPORTS Donnie Baseball

Mattingly returns to the Bronx Many Yankee fans in their 30s probably had the famous Don Mattingly returns to the Bronx “Hit Manâ€? posters on their walls in tribute to the former Yankee first baseman’s dominant seasons in the mid1980s. Today’s doubleheader will be their chance to express appreciation for Mattingly in a setting other than OldTimer’s Day as he returns to the Bronx for the second time since leaving with Joe Torre following the 2007 season. Appropriately enough, Mattingly’s pregame press conference yesterday lasted 23 minutes. While heavy rains fell, a montage of his highlights played on the scoreboard. “Obviously, it’s good to come back,â€? Mattingly said. “I always really enjoy coming back into the city. ‌ It’s always been, for me, great. You don’t quite understand the relationship, honestly.â€? LARRY FLEISHER

31

Youkilis to undergo surgery on his back MLB. The Yankees received more bad injury news as their third baseman is out three months. When the Yankees signed Kevin Youkilis in December in the wake of Alex Rodriguez’s hip injury, they liked how he hit left-handed pitchers and grinded out at-bats. They also were aware of his recent back troubles. General manager Brian Cashman said yesterday Youkilis has a herniated disk in his back discovered after an MRI. The injury will require surgery tomorrow and will keep him out for 10 to 12 weeks. “Kevin is a helluva player when healthy,� Cashman said. “And he just hasn’t been in a position to show in season what he’s

Teixeira to DL

SPORTS

When he hit three home runs against the Indians two weeks ago, Mark Teixeira sounded upbeat about the condition of his wrist. •

3

Following a 4-for-35 road trip, the good feelings have dissipated, and the Yankees placed him on the 15-day DL.

capable of doing because of the back. “He obviously did so much for Boston over the years, and he’s the type of player that if you could draw it up, that’s the type of player we would want — a gamer with power and plate discipline.�

Watch online

LARRY FLEISHER

sports@metro.us

Highlights of Zack Wheeler’s debut last night against the Braves Metro.us/sports

Quoted

“It’s not how you draw it up. There’s no doubt about that.� Brian Cashman, Yankees general manager On injured Kevin Youkilis, who is now out for 10-12 weeks

Kevin Youkilis may be back before the end of the season, but the Yankees aren’t counting on him. / GETTY IMAGES

DIRECTORY

PASSPORTS

Health & Beauty

& VISAS

To place an ad call Ed Abrams at 212-457-7735 or email ed.abrams@metro.us

10% Discount with this Ad

itseasy30rock.com

877-33-ITS EASY

RUSH SERVICE! 24 Hour Service Available

$1

Laser Teeth Whitening

(w/Check-up and Cleaning*) *covered by your PPO Dental Plan

Up to 12 Shades Whiter in just 1 hour Call (212) 537-6923 - Open Weekends and Evenings 30 East 40th 3TsBLOCKFROM'RAND#ENTRAL3TATION

0H  sWWW:OOMFORCOM

(exp 6/30/2013)


SPORTS

www.metro.us Wednesday, June 19, 2013

Mid-major talent

Wolters could be hidden gem late Nate Wolters is a bit of a mystery because he was an under-the-radar high school player who wasn’t prominent on the AAU circuit, and then went to a midmajor program. But Wolters feels he has a lot to offer should the Knicks grab him. “I’ve watched [the Knicks] a lot because they were on national TV a lot, and they definitely need a point guard. They like to spread the floor out and shoot a lot of 3s, so I think I’d fit in perfectly,â€? Wolters said. “Jason Kidd just retired, and Raymond Felton is a solid point guard, so I definitely feel I can add to it. ‌ I’m really good with the pick-and-roll game, and I know they run a ton of pick-androll.â€? TONY WILLIAMS

32

Knicks work out Dieng with post depth in mind for draft NBA. The former Louisville center could be a ďŹ t for the team at No. 24. The Knicks hosted another workout yesterday with specific needs in mind. Now that both Jason Kidd and Rasheed Wallace have retired, and Pablo Prigioni is still debating whether to return to the team or go back to Argentina, there are a couple of voids at two of the most important spots on the roster — backup point guard and depth in the post. Among the names at the workout were Louisville center Gorgui Dieng and South Dakota State point guard Nate Wolters. The latter will most certainly be available by

Dieng’s defensive game is well ahead of his oensive talents leaving college. / GETTY IMAGES

Directory

Legal and Professional Services

the time the Knicks select at No. 24, while Dieng falls in the 20s in mock drafts. Should he be available, head coach Mike Woodson could use the depth. “I played for a coach who was really demanding, and I came from a winning program. All I care about is winning and whatever it takes, so I don’t think I’ll see a coach again that’ll drive me like him,� said Dieng. “Wherever I go, I won’t have a problem.� He even went as far as to say he’d rather fall to a stable franchise versus a lottery team, because he wants to stick in the league as long as possible. “[Pitino] said I can go anywhere from 12 to 20, [but] when it comes to draft pick, I don’t really care. I just want to go to a [good] team,� Dieng said. “When it comes to the

Quoted

“To me, I don’t care where I’m going. I just want to be a ďŹ rst-round pick and go to the right team, and I’ll take care of the rest.â€? Gorgui Dieng, Louisville center On where he wants to be drafted

draft, you can last only two years or 10. If you have the same talent [coming] out of college and go to a bad team, you can only last two years. But you can go to the right team out of college with the same talent and last 10 years.�

TONY WILLIAMS

sports@metro.us

BANKRUPTCY 917-783-0906

$795+ Court Fees Free Consultation

“I can help you get a fresh start�

To advertise in this directory call Johan Svennerholm at 212.457.7823 or email JOHAN.SVENNERHOLM@METRO.US

Debt relief agency. We help people ďŹ le for bankruptcy relief under the bankruptcy code.

Over 60 Years of Experience

DINERMAN BERGAM & DINERMAN

8::@;<EK6 ALL ACCIDENT CASES HANDLED

ÂŁxäĂ&#x160; ," 79Ă&#x160; 9 Ă&#x160;UĂ&#x160;­Ă&#x201C;ÂŁĂ&#x201C;ÂŽĂ&#x160;Ă&#x201C;Ă&#x2C6;Ă&#x2021;Â&#x2021;Ă&#x2021;xĂ&#x2021;x ASK FOR MARIA

ACCIDENTS & INJURIES â&#x153;ś Truck / Car â&#x153;ś Medical Errors â&#x153;ś Cerebral / Erbs Palsy â&#x153;ś Police Brutality

â&#x153;ś False Arrest â&#x153;ś Construction â&#x153;ś Slips / Falls â&#x153;ś Bedsores

WHEN THE CARELESS NEEDLESSLY ENDANGER THE PUBLIC SAFETY CAUSING HARM, YOU MAY BE ENTITLED TO COMPENSATION

212-926-0050 Rawlins Law Firm

No fee unless successful Free Consultation 24/7

BANKRUPTCY Not Sure Who to See for Bankruptcy? Want an Attorney Who Will Provide Friendly, Caring, Personal Service at a Low Price? Then Call

*AY3IMONs 32 Court Street, Suite 805, Brooklyn Bankruptcy Only, Chapter 7 Specialist, Low Fee, One Set Fee, Installments, Personalized Attention, Free Consultation

The Bankruptcy Whisperer

Evening and Sat appts available

!BSOLUTE$IVORCE starting

Hablamos EspaĂąol

at

Must bring in ad - Expires 6/28/13

#AR"US4RAINs3LIP4RIPAND&ALLs%LEVATORs2EAL%STATE &REE#ONSULTATION

Howard S. Warner, Attorney

Flushing (QNS): 39-01 Main St., Suite 400 Manhattan: 116 West 23rd Street, 5th ďŹ&#x201A;oor

FREE Consultation

$

189

+ court fees

212-504-2985

(ABLAMOS%SPAĂ&#x2014;OL

80 Broad St., 5th Floor, NY, NY 10004

www.absolutedivorceinc.com

POLICE BRUTALITY & FALSE ARREST

7<8C@32-

917-922-2922

4@331=<AC:B/B7=<

<332/:/EG3@-

 #%' 

www.WrongfulArrestLawyer.com

No Fee Unless We Win! Call Now! FREE Consultation!

eee4<:>1Q][ 4SW\S`:Odg>1/bb]`\SgaOb:Oe

Treyvus & Konoski, PC 305 Broadway, 14th Floor, NY, NY 10007

1-800-710-7250

Call

(RS

INJURED? Falls on Sidewalks & in Buildings #AR!CCIDENTSs!LL!CCIDENTS &REE#ONSULTATIONs.O&EE5NTIL7E7IN 30 Years Experience ,!7/&&)#%/&-)4#(%,,&)234 %31 "2/!$7!9 2//- .9.9

! #0`]OReOgÂ&#x2019;AcWbS"<G<G%

EspaĂąol Attorney Advertisement

Employment Discrimination Sexual Harassment (212) 227-2100 Pospis Law, PLLC The Woolworth Building 233 Broadway, Suite 2707 New York, NY 10279 www.pospislaw.com

TO ADVERTISE IN LEGAL & PROFESSIONAL SERVICES

PLEASE CONTACT:

JOHAN SVENNERHOLM

212.457.7823 UĂ&#x160;JOHAN.SVENNERHOLM@METRO.US


SPORTS

Harvey, Mets eek out win

New era

Report: Vigneault signs deal with Rangers After a verbal agreement over the weekend, the Rangers have reportedly inked Alain Vigneault to a deal to officially become their next head coach. The deal is for five years and $10 million, according to multiple sources. Vigneault, 52, reportedly received a similar offer from Dallas, where he interviewed for the vacant job as well. He was fired by the Canucks on May 22 after his team was swept

Vigneault

/ GETTY IMAGES

by San Jose in the first round of the Western Conference playoffs. But Vigneault had tremendous success in hockey-crazed Vancouver, despite not winning a Stanley Cup. Vigneault was with the Canucks since 2006 and made the playoffs every year but 2007-08. He won the Jack Adams Award as top coach in 2007. METRO

MLB. The ďŹ rst of yesterdayâ&#x20AC;&#x2122;s starts by a young ace in Atlanta went mostly as planned. Matt Harvey carried a nohitter into the seventh inning, and the Metsâ&#x20AC;&#x2122; bullpen just managed to hang on for a 4-3 win over Atlanta in the first game of a day-night doubleheader yesterday. Harvey lost his nohitter on an infield hit by Jason Heyward in which Lucas Duda didnâ&#x20AC;&#x2122;t cover first, but he was sterling as usual in earning his sixth win this season.

Harvey was just the ďŹ rst young ace pitching yesterday. Check out www.metro.us for coverage of Zack Wheelerâ&#x20AC;&#x2122;s debut. / GETTY IMAGES

He finished with a line of seven innings, three runs and a career-high 13 strikeouts. All three runs scored in the eighth

DIRECTORY

Medical Research Are you a Gulf War Veteran or Gulf War-Era Veteran? You may be eligible for a research study examining the long-term effects of deployment. Study involves interviews, questionnaires, and laboratory tests over approximately six visits. If eligible, you will be reimbursed for your time and expenses.

6/D307>=:/@27A=@23@-

6OdSB`]cPZS@S[S[PS`W\UBVW\Ua-/`SG]c1c``S\bZg<]b 2S^`SaaSR]`;O\WQ7Ta]g]c[Og_cOZWTgT]`O;]c\bAW\OW`SaSO`QVabcRgSfO[W\W\UbVSSTTSQb ]TO[SRWQObW]\b`SOb[S\b]\[S[]`gO\RObbS\bW]\^`]PZS[a >O`bWQW^ObW]\W\bVWa`SaSO`QVabcRgW\QZcRSa( Â&#x2019; $eSSYa]TbOYW\UOabcRgR`cUSWbVS`UOZO\bO[W\S]`^ZOQSP] Â&#x2019; Be]aSaaW]\a\Sc`]^agQV]Z]UWQOZbSabW\U Â&#x2019; B]bOZaWfabcRgdWaWba Â&#x2019; 1][^S\aObW]\^`]dWRSR

1]\bOQb@]gOOb   "!&' >7(2O\7]aWTSaQc

PI: Julia Golier, MD; VA Project # GOL-11-056 VA IRB approved through 5/1/2014

'(35(66,210(',&$7,21 $1'/2:6(;'5,9( 2)7(1*2+$1',1+$1' &RQVLGHURXUFOLQLFDOUHVHDUFKVWXG\ 0DQ\FR 0DQ\FRPPRQO\SUHVFULEHGDQWLGHSUHVVDQWPHGLFDWLRQVFDQ KDYHVH[ KDYHVH[XDOVLGHHIIHFWVUHVXOWLQJLQODFNRILQWHUHVWLQVH[ODFNRI DURXVDO DURXVDORULQDELOLW\WRUHDFKRUJDVP:HDUHFRQGXFWLQJDFOLQLFDO UHVHDUFKVWXG\WREHWWHUXQGHUVWDQGWKHHIIHFWVRQVH[XDOIXQFWLRQLQJ UHVHDUFK VWX RIDQLQYHVWLJDWLRQDOPHGLFDWLRQZKHQFRPSDUHGZLWKDQDSSURYHGPHGLFDWLRQ <RXPD\EHHOLJLEOHWRSDUWLFLSDWHLI\RX á$UH\HDUVROG á$UHFXUUHQWO\WDNLQJ&HOH[DÄ&#x2014; FLWDOSUDP 3D[LOÄ&#x2014; SDUR[HWLQH RU=RORIWÄ&#x2014; VHUWDOLQH  DQG\RXUGHSUHVVLRQLVZHOOFRQWUROOHG á$UHH[SHULHQFLQJVH[XDOVLGHHIIHFWVWKURXJKWREHFDXVHGE\\RXUDQWLGHSUHVVDQW PHGLFDWLRQ $WWKHĂ°UVWVWXG\YLVLWZHZLOODOVRUHYLHZ\RXUPHGLFDOKLVWRU\DQGRWKHUFULWHULDWRVHH LI\RXDUHHOLJLEOHIRUSDUWLFLSDWLRQ$OOVWXG\UHODWHGRIĂ°FHYLVLWVPHGLFDOH[DPLQD WLRQVSV\FKRORJLFDODVVHVVPHQWVDQGVWXG\PHGLFDWLRQVZLOOEHSURYLGHGDWQRFRVW WRTXDOLĂ°HGSDUWLFLSDQWV<RXPD\DOVRUHFHLYHFRPSHQVDWLRQIRU\RXUWLPHDQGWUDYHO &DOOWRGD\IRUPRUHLQIRUPDWLRQ

%05

 LQIR#EPUVLFRP_ZZZEPUVLFRP

MARK OSBORNE

mark.osborne@metro.us

COLUMBIA UNIVERSITY MEDICAL CENTER I have been diagnosed with schizophrenia or schizoaffective disorder I am taking antipsychotic medication I am interested in learning more about this research study at the New York State Psychiatric Institute at Columbia University Medical Center

Reimbursement for travel expenses and compensation for time and effort will be provided For more information about the study, call (212)543-4239 or studies@nyspi.columbia.edu

DO YOU HAVE PSORIASIS?

Research takes place at the Bronx VA Medical Center and the Mount Sinai School of Medicine. For information, call Melissa Rothstein at (718) 584-9000, x. 6567

inning after he had been removed with the bases loaded. LaTroy Hawkins and Scott Rice allowed the inherited runners to

come in. Bobby Parnell shut things down in the ninth inning to earn his 10th save. John Buck got off the schneid with his first home run since May 24, though he still leads the team. Marlon Byrd continued his hot hitting with two hits, an RBI and a run scored. Rookie Alex Wood, one of the Bravesâ&#x20AC;&#x2122; top pitching prospects and just 22 years old, lasted just three innings and 73 pitches in his first career start.

RESEARCH VOLUNTEERS NEEDED!

To place an ad call Andrea Paz at 212-457-7831 or email andrea.paz@metro.us

)LOH]PVYHS4LKPJHS9LZLHYJO

33

ARE YOU UNHAPPY WITH YOUR CURRENT TREATMENT? Manhattan Medical Research is conducting a research study for adults to test the effectiveness of an investigational medication for moderate to severe psoriasis.

Eligibility Includes: s!DULTSAGESTO s#URRENTLYHAVEMODERATETOSEVEREPSORIASIS (red, thicker patches that may have silvery scales and often itch)

Study Involves: s6ISITSTOOURCLINICALFACILITYOVERANAPPROXIMATE WEEKPERIOD s5SAGEOFSTUDYMEDICATION 1UALIlEDPARTICIPANTSWILLRECEIVESTUDYMEDICATION MEDICALEXAMSANDLABORATORYTESTINGATNOCHARGE #OMPENSATIONFORYOURTIMEMAYALSOBEPROVIDED

Contact us to see if you qualify. Health insurance is not needed. Contact us at cgpipitone@manhattanmedicalresearch.com or at

1-917-409-3919

ATTENTION MEN DO YOU HAVE

LOW TESTOSTERONE? SYMPTOMS OF LOW TESTOSTERONE MAY INCLUDE:

s&ATIGUE s%RECTILEDYSFUNCTION s$ECREASEDSEXUALDESIRE s-OODDISTURBANCE s,OSSOFENERGY

If so, please contact Manhattan Medical Research today to see if you may qualify for our research study of an investigational medication for men with low testosterone.

QUALIFIED PARTICIPANTS MUST: Be 18 to 60 years of age Have been diagnosed with low testosterone or have symptoms of low testosterone QualiďŹ ed participants will receive all study-related care and study medication at no cost, plus compensation for time and travel. There is a chance you might receive placebo.

For more information,

Contact Michael at (718) 502-6456 or myang@manhattanmedicalresearch.com


Wednesday, June 19, 2013

TO PLACE AN AD:

866-900-9473

NEWYORKCLASSIFIEDS@METRO.US

CLASSIFIEDS.METRO.US

CLASSIFIED AD DEADLINE: 5PM TWO (2) BUSINESS DAYS BEFORE PUBLICATION IMPORTANT INFORMATION: All classiďŹ ed advertising is subject to the terms and conditions of the applicable Metro ClassiďŹ ed rate card and to approval and acceptance at Metro U.S. option. Metro US reserves the right to edit, reject, cancel or reclassify an ad, and reserves the right to convert any classiďŹ ed advertising to alternative formats for use and publication in other Metro U.S. publications. It is the advertiserâ&#x20AC;&#x2122;s sole responsibility to check each ad the ďŹ rst day it is published. Metro U.S. assumes no responsibility for any reason, for any error or omission in any ad.

Apartments

Customer Service

IN PRINT & ONLINE

Security / Law Enforcement

Buy Or Sell Avon Order Your Free Catalog Call Now: 718-989-2898 www.yourfreecatalog.com

LOBBY STAFF NEEDED START IMMED. FT/PT ALL SHIFTS NO EXP REQUIRED UP TO $17 P/H BENEFITS INTEVIEWING ASAP CALL: 646.998.5980

Miscellaneous

LAURELTON/SPRINGFIELD- 2 FAM DET.

General Help Wanted

1st

Sales / Marketing Training Got work?

½

PUBLISHERS NOTE All real estate advertising herein is subject to the Federal Fair Housing Act of 1968 and state and local fair housing laws. The Fair Housing Act makes its i l l egal to advertise any preference, limitations or discrimination on the basis of race, color, religion, sex, handicap, familial status, or national origin or an intention to make any such preference, limitation or discrimination. State or local laws may make unlawful advertising that discriminates on the basis of age, marital status, or sexual orientation. Metro US will not knowingly accept any advertising for real estate which violates the law. The law requires that all dwellings advertised are available on an equal opportunity basis. If you have any questions regarding housing discrimination, call the Long Island Housing Services at 1(800) 660-6920 in Long Island or the Anti-Discrimination Center at (212) 346-7600 in New

We Do! Sales on Behalf of Verizon FiOS! Paid Weekly. No experience necessary. Up to $750+per week! 888-493-5456

Facilities Maintenance

# FRONT DESK ATTENDANT # All Shifts

Janitorial Cleaner Manhattan-IMMEDIATE Office Cleaning Temporary. Reqs:Punctual,Reliable, Speak/Understand English,Experience Pref. Call 646-520 -4801, email careers@qbs.co

½

# YONKERS APT AVAILABLE. HEAT & HOT WATER INCL. OWNER 718-729-3461

HOME HEALTH AIDE/CNA TRAINING

Apartments

EXTERMINATION/Termite Certification

Lose Weight & Make Money & Help Others Do the Same

Security / Law Enforcement

Transportation / Travel

# # A AMAZING OPPORTUNITY # #

ViSalusOverView.com Call: 917-882-3136

# # A AWESOME OPPORTUNITY # # Commercial

Healthcare

J/"3

4RAINING !CCESS #.!s-EDICAL!SSISTANTs((! (OME(EALTH!IDE %+'0(,%0HARMACY4ECH%3,,/!.3 #.!&REE4RAINING )F%LIGIBLE "OOKKEEPINGs1UALITY!NALYSTs"USINESS!NALYST 3OLAR4ECHNICIANs!DVANCED#OMPUTER#OURSES

Miscellaneous

call HUD toll-free at (800) 669-9777 or the New York City Commission on Human Rights at (212) 306-7500

Business Opportunity-Owner/ Operator-Open House

General Help Wanted

Cleaners & Sweepers Exterior

Deliver newspapers as an Owner/Operator under agreement with our company in Manhattan. Earn up to $1,000+/month. Must have dependable car. Call 646-277-3795 for details

# Customer Relations Reps #

#ALL   STUDENT VISAS @ LOW COST

Rooms ½

All Manhattan/ Bronx

NOTICE TO THE PUBLIC

AFFORDABLE HOME PROGRAM START WITH AS LITTLE AS

$

## DOOR ATTENDANT NEEDED ##

1,000

'//$ä#2%$)4 ä"!$ä#2%$)4 ä./ä#2%$)4

ALL CASES PROCESSED CALL NOW FOR FREE REGISTRATION MANY HOMES ARE FULLY RENOVATED

BROOKLYN,QUEENS,BRONX, WESTCHESTER AND LONG ISLAND 3.5% TOTAL DOWNPAYMENT NEEDED

Affordable Home Program LLC NYS. Licensed Real Estate Brokers 116-16 Queens Blvd Suite 202, Forest Hills, NY 11375

(718) 544-1200

/N1UEENS"LVD.EXTTO% & 3UBWAY3TNs+EW'ARDENS2D 1UEENS .9

WWWACCESSQUEENSCOM

         

* ! )) )

34  )) )

 Furnished Rooms For Rent! Cable/Internet Ready! Move in Today! All Utilities Inc. Starting Just $125/wk ! Call Us Now: (212)368-2685

Affordable Furnished Rooms in Manhattan

") *      5!+ 5 673+ 8' +  !'5!+ 9:;!3          !!"#$$%%" &'





  !" #$%& ' (%%$% !!)) )*"+,-../0-1/02 Utilities Included Same Day Move In Cable, TV, Internet No Credit Check $125 per week Call 212-862-0457

100â&#x20AC;&#x2122;s Available, All Boroughs

Ultrasound Med Assistant (RMA) Pharmacy Tech (PTCB) Med Billing & CPR Nursing Asstant (CNA) ..................................... $699 Patient Care Tech .............................................. $699 EKG & Phlebotomy Combo ................................ $699 Med Off Admin Financial Aid if qualify for Medical Assistant only at a Flushing location

Private Entry Bath Cooking 1 Person/2 Person $125wk/up room rentals 212-697-3962

NEW YORK YORK MEDICAL MEDICAL C CAREER AREER TRAI TRAINING NING CENTER www.nymedtraining.com www .nymedtraining.coom Manhattan: 212-947-4444 Flushing: 718-460-4340

Call 718-210-3642 TELMKTRS

h ADORABLE YORKIE PUPPIES h CALL TRACY 718 236-1515

F/T EXP ONLY!

MADE YOU LOOK!!!

Now All You Have To Do is Call. Salary + Comm. + Bonus = $8.-$12/Hr. David (212) 563-7500

h English Bull Terrier Puppies Boys & Girls h

Finance Sr. Business Analyst (Flushing, NY): Prepare, analyze & manage ďŹ nancial statements for ďŹ nancial & managerial reporting. Monitor, track, forecast revenues/ expenses & control purchasing costs. Review & prepare wholesale revenue forecasts & budgets, compile ďŹ nancial data & prepare operational reports. Req.: Master/equiv. in Financial Management/ Accounting/ related, 6 months of exp; strong skills in budgeting, cost accounting, ďŹ nancial analysis & ďŹ nancial reporting. ProďŹ cient in advanced Excel & accounting software. Send resume to Ocean Queen USA Inc., 1650 Delta Ct., Hayward, CA 94544. Attn: HR

# # SHIH-TZU PUPPIES # #

Miscellaneous

~#~ WE BUY DIABETIC TEST STRIPS ~#~ Call 888-415-0796#Taking All Brands & dates BUYING all DIABETIC TEST STRIPS HIGHEST PRICES ANYWHERE!! Also Nicotine Patches / Gum Pickup & Midtown Dropoff 5 Days a week

646-400-5270


Wednesday, June 19, 2013

TO PLACE AN AD:

866-900-9473

CLASSIFIEDS.METRO.US

NEWYORKCLASSIFIEDS@METRO.US

CLASSIFIED AD DEADLINE: 5PM TWO (2) BUSINESS DAYS BEFORE PUBLICATION Psychic

Careers

Careers

IN PRINT & ONLINE

Careers

SPIRITUAL READER

Miscellaneous

BUYING !!! 888-210-5873 Medical & Dental Items - Biofreeze, CoaguChek, Medihoney, Drug, HIV & Pregnancy / Fertility tests, monitors Wellness - Crest White Strips, Muchinex, Prilosec, Allegra Vitamins, Supplements, Weight control - All Types Baby Care - Diapers, Vitamins, Organic foods, ETC. Pet Health - Flea Control, Speciality foods, Vitamins

Wanted: Too Many Items to List â&#x20AC;&#x201C; CALL!!

Liquidators, Wholesalers, Cleanouts, Individuals- CALL!!

Careers

1/@33@A4=@B63 AB13<BC@G

Miscellaneous

Want solutions for all your problems? Mr. K heals the body, stops witches, defeats enemies, and offer powerful protection. Do you have problems with relationships, family, financial, property, court, or immigration cases? Then call Mr.K 646-200-1513 spiritualpower40. com

UNIQUE SPIRITUALIST ASTROLOGER INDIA PANDIT: SIDDARTH SHASTRY

Careers

HIGH SCHOOL DIPLOMA FROM HOME 6-8 weeks accredited Get a Diploma! Get a Job!

No computer needed!! Call 24/7 for free brochure 1-800-264-8330

www.diplomafromhome.com Benjamin Franklin High School

Miscellaneous

Miscellaneous

Palm Reading Expert. Removes Black magic, Voodoo, Obeya & all Evils and Gives Protection. Solves problems like Love, Marriage, Business, Job, Money, Kids, Health, Court, Relationship etc. 107-11 120th, 107ave Richmond Hill, NY

SERIGNE 917-679-1518

Spiritual Reader & Coach has helped bring back loved ones.stopped Infidelity In Relationship, Fixed Domestic, issues, jinx, bad luck, court case success in business, stop enemy & offer protection! 100% Guaranteed africanpsychicnyc.com

Â&#x2019;1=C@B@3>=@B7<5 @3/:B7;3E@7B7<5

Â&#x2019;1:=A321/>B7=<7<5

OR VISIT US AT

NYC RED ROOM - Spice Up Your Life!

<3E s 63/:B67<4=@;/B7=<B316<=:=5G

New Adult Toys Store 10% off with this AD 223 Brighton Beach Ave, BR.NY - tel: 917-933-4444 nycredroom.com

Psychic

African spiritualist w/ 40 yrs experience. Solves all problems: Love, bring back loved one, business success, spells, court, career, black magic specialist, luck, protection, impotency, etc.

3ANFORD "ROWN)NSTITUTEs.EW9ORK .9 7HITE0LAINS .9s'ARDEN #ITY

CALL NOW! 646.409.0158

SHEIKH SALEEM 917.254.6647

MYSTICAL AFRICAN MEDIUM & SPIRITUALIST SOLVES ALL YOUR ISSUES, LOVE SPECIALIST, REUNITE LOVERS, BUSINESS, JOB, COURT, LUCK, BLACK MAGIC, PROTECTION, IMPOTENCY, IMMIGRATION, ETC. ENGLISH AND FRENCH SPEAKING. QUICK RESULTS www.africanmedium.com

NOTICE IS HEREBY GIVEN

4]`2WaQZ]ac`S7\T]`[ObW]\dWSe>`]U`O[2SbOWZa.\gQWSRc

that a license, Number 1269623 for Restaurant Wine has been applied for by the undersigned to sell Wine & Beer at retail in a Restaurant under the Alcoholic Beverage Control Law at 1586 1st Ave, New York, NY 10028 for on-premises consumption. Kojun Inc. d/b/a Inase Restaurant

VITAL TAL CAREERS START HERE!

Medical Assistant Surgical Technologist Respiratory Therapist E A R N Y O U R A S S O C I AT E S D E G R E E, NOT just a certificate! OTHER PROGRAMS:

â&#x20AC;˘ HEALTHCARE ADMINISTRATION â&#x20AC;˘ DENTAL ASSISTANT (MEDICAL BILLING AND CODING) â&#x20AC;˘ PHARMACY TECHNICIAN

CALL TODAY!

â&#x20AC;˘ EARN COLLEGE CREDITS â&#x20AC;˘ FLEXIBLE SCHEDULES

1-855-626-3504

MANDL

SCHOOL

THE COLLEGE OF ALLIED HEALTH

Want to work in Healthcare?

877-480-6333

,ICENSEDBYTHE.EW9ORK 3TATE%DUCATION$EPARTMENT

sanfordbrown.edu 0ROGRAMSVARYBYCAMPUS Deliver the Good News! Start training now in

DIAGNOSTIC MEDICAL SONOGRAPHY. Learn to take ULTRASOUND images and make a difference one heartbeat at a time.

Call Sanford-Brown!

866-861-1444

.EW9ORK .9s7HITE0LAINS .9s'ARDEN#ITY .9 ,ICENSEDBYTHE.EW9ORK State Education Department

sanfordbrown.edu 0ROGRAMSVARYBYCAMPUS

CARDIOVASCULAR TECHNOLOGY! Train in this exciting ďŹ eld and you could help save lives! Call now to get started!

866-932-7444

.EW9ORK .9s7HITE0LAINS .9s'ARDEN#ITY .9 Licensed by the New York, State Education Department

sanfordbrown.edu 0ROGRAMSVARYBYCAMPUS

Cars

NOTICE IS HEREBY GIVEN

Legal Notices NOTICE OF FORMATION NOTICE FORMA ATION T Lincoln Avenue of Management, Mana gement, LLC. Art. of Org. ďŹ led with the Secy. Secy. of Sta te of New York Yoork (SSNY) State on 05/27/2011. OfďŹ ce loca ation: Kings County. County. location: SSNY designated designaated as aagent gent of LLC upon whom process against against it may be ser ved. SSNY shall mail served. process to: LLC c/o 983 Lincoln Ave., Brooklyn, NY 11208. Purpose: an la wful activity. anyy lawful activity.

that a license, serial # 1271216, for Liquor, Wine & Beer has been applied for by the undersigned to sell Liquor, Wine & Beer at retail under The Alcoholic Beverage Control Law at 375A 5th Ave., Brooklyn, NY 11215. Kings County, for on premise consumption. Hardwood Productions LLC

NOTICE IS HEREBY GIVEN

that a license, serial # 1271288, for Liquor, Wine & Beer has been applied for by the undersigned to sell Liquor, Wine & Beer at retail under the Alcoholic Beverage Control Law At 4141 Broadway NY, NY 10033. New York County, for on premise consumption. Malecon Restaurant Corp

NOTICE IS HEREBY GIVEN

that a license, serial # 1271233, for Liquor, Wine & Beer has been applied for by the undersigned to sell Liquor, Wine & Beer at retail under the Alcoholic Beverage Control Law at 338 E 92nd St NY, NY 10128. New York County, for on premise consumption. MACC Hospitality LLC

SEARCH IT. FIND IT. BUY IT.

Call now, to get your copy!

NEEDED: People to train in Non-invasive

that a license, Number 1270749, for Liquor, Beer & Wine license has been applied for by the undersigned to sell Liquor, Beer & Wine at retail in a Restaurant under the Alcoholic Beverage Control Law at 152-12 Northern BLVD., Flushing, NY 11354 for on-premises consumption. Kang Ho Dong Baekjeong Inc.

>/@9>:/13<G11]\dS\WS\bZg:]QObSRW\:]eS`;O\VObbO\

Immediate Results. English & French speaking.

\R

1OZZÂ&#x2019;&$$Â&#x2019;!$ Â&#x2019;&& "Â&#x2019;\gQWSRc

www.mandl.edu Get your copy of the Healthcare Career Guide Learn about opportunities, and helpful tips to get you started

NOTICE IS HEREBY GIVEN

2Og3dS\W\UAObc`ROg1ZOaaSaÂ&#x2019;2SU`SS1S`bWÂżQObS>`]U`O[a

254 W 54th Street

PROFESSOR GASSAMA 646.409.0158

s42!.3&%2 #2%$)43 !##%04%$ s6! !002/6%$

@SUWab`ObW]\T]`4OZZBS`[0SUW\a8cZg

OUR ADVISORS WILL HELP EVERY STEP OF THE WAY

Psychic

that a license, Number 1270695, for Liquor, Beer & Wine license has been applied for by the undersigned to sell Liquor, Beer & Wine at retail in a Restaurant under the Alcoholic Beverage Control Law at 1 Greene Ave., Brooklyn, NY 11238 for on-premises consumption. Oxford Kitchen Inc.

>@=5@/;

â&#x20AC;˘ TRANSFER CREDITS ACCEPTED â&#x20AC;˘ DAY/EVE/WEEKEND COURSES TO PLACE AN AD CALL 866-900-9473

NOTICE IS HEREBY GIVEN

Â&#x2019;>/@/:35/: Â&#x2019;;3271/:=44713 A>317/:7AB

BVS1]ZZSUS]T:SUOZ;SRWQOZ>`]TSaaW]\a

Legal Notices

PLACE A LEGAL/PUBLIC NOTICE: Name Changes, Liquor Licenses, Sidewalk CafĂŠ. Call for quote.

(212) 457-7856 or jim.colarusso@metro.us


www.metro.us

FREE INTERNET & FREE COMPUTER CLASSES ARE WAITING FOR YOU at your local public library

Connect with your friends, family, and future. Learn to use e-mail, search online, ямБnd job listings, pay your bills, and share with friends through social media. For class schedules, visit your local

(917-ASK-NYPL).

www.nypl.org THE BRONX t&BTUUI4Ut&BTUSE4Ut.PSSJT"WF t8FTUUI4Ut4PVUIFSO#MWE t&BTUUI4Ut.BSUJO-VUIFS,JOH +S#MWE t8BTIJOHUPO"WFt&BTUUI4U

MANHATTAN

STATEN ISLAND

t&BTUUI4Ut8FTUUI4Ut8FTUUI4U t#FOOFUU4Ut3PCJO3Et$FOUSBM"WF t8FTUUI4Ut8FTUUI4Ut#SPBEXBZ t$BTUMFUPO"WF t"EBN$MBZUPO1PXFMM +S#MWEt&BTU#SPBEXBZ t&BTU)PVTUPO4Ut&BTU#SPBEXBZ

36 new york Wednesday, June 19, 2013

branch or call 917-275-6975 Events are subject to change.

20130619_us_new york  
Read more
Read more
Similar to
Popular now
Just for you