Page 1

www.FreeLibros.me


www.FreeLibros.me


BIOLOGÍA MOLECULAR FUNDAMENTOS Y APLICACIONES

www.FreeLibros.me


www.FreeLibros.me


BIOLOGÍA MOLECULAR FUNDAMENTOS Y APLICACIONES

Dr. en C. CARLOS BEAS ZÁRATE Químico Farmacobiólogo y Doctorado en Ciencias de la Salud Investigador titular del Centro de Investigación Biomédica de Occidente del IMSS Profesor titular de Biología Molecular del Departamento de Biología Celular y Molecular del Centro Universitario de Ciencias Biológicas y Agropecuarias de la Universidad de Guadalajara Profesor titular en los Posgrados de Ciencias Biomédicas y de Biología Molecular en Medicina

Dr. DANIEL ORTUÑO SAHAGÚN Investigador Titular de la Universidad de Guadalajara Maestro en Ciencias en Biología Celular Doctor en Ciencias en Biología Molecular en la Universidad Autónoma de Madrid Posdoctor por el Instituto Cajal de Neurociencias, en Madrid, España Coordinador en el CUCBA del Doctorado en Ciencias Biomédicas de la Universidad de Guadalajara

Dr. JUAN SOCORRO ARMENDÁRIZ BORUNDA Doctorado en Bioquímica en el Centro de Investigación y de Estudios Avanzados del Instituto Politécnico Nacional Posdoctorado en Biología Molecular en la Universidad de Tennessee Jefe del Departamento de Biología Molecular y Genómica, Centro Universitario de Ciencias de la Salud de la Universidad de Guadalajara Ex Presidente de la Asociación Mexicana de Biología Molecular en Medicina

MÉXICO • BOGOTÁ • BUENOS AIRES • CARACAS • GUATEMALA LISBOA • MADRID • NUEVA YORK • SAN JUAN • SANTIAGO • SAO PAULO AUCKLAND • LONDRES • MILÁN • MONTREAL • NUEVA DELHI SAN FRANCISCO • SIDNEY • SINGAPUR • ST. LOUIS • TORONTO

www.FreeLibros.me


Director editorial: Javier de León Fraga Editor sponsor: Gabriel Romero Hernández Editora de desarrollo: Norma Leticia García Carbajal Corrección de estilo: Eduardo Grijalva Gómez Diseño de portada: Wolfgang Rodolfo Wender Composición y formación: Arturo Rocha Hernández Supervisora de producción: Ángela Salas Cañada

NOTA La medicina es una ciencia en constante desarrollo. Conforme surjan nuevos conocimientos, se requerirán cambios de la terapéutica. El (los) autor(es) y los editores se han esforzado para que los cuadros de dosificación medicamentosa sean precisos y acordes con lo establecido en la fecha de publicación. Sin embargo, ante los posibles errores humanos y cambios en la medicina, ni los editores ni cualquier otra persona que haya participado en la preparación de la obra garantizan que la información contenida en ella sea precisa o completa, tampoco son responsables de errores u omisiones, ni de los resultados que con dicha información se obtengan. Convendría recurrir a otras fuentes de datos, por ejemplo, y de manera particular, habrá que consultar la hoja informativa que se adjunta con cada medicamento, para tener certeza de que la información de esta obra es precisa y no se han introducido cambios en la dosis recomendada o en las contraindicaciones para su administración. Esto es de particular importancia con respecto a fármacos nuevos o de uso no frecuente. También deberá consultarse a los laboratorios para recabar información sobre los valores normales.

BIOLOGÍA MOLECULAR Fundamentos y aplicaciones Prohibida la reproducción total o parcial de esta obra, por cualquier medio, sin autorización escrita del editor.

DERECHOS RESERVADOS © 2009, respecto a la primera edición en español por McGRAW-HILL INTERAMERICANA EDITORES, S.A. de C.V. A subsidiary of The McGraw-Hill Companies, Inc. Prolongación Paseo de la Reforma 1015, Torre A, Piso 17, Col. Desarrollo Santa Fe, Delegación Álvaro Obregón C. P. 01376, México, D. F. Miembro de la Cámara Nacional de la Industria Editorial Mexicana, Reg. No. 736 ISBN 13: 978-970-10-6921-9 1234567890 Impreso en México

08765432109 Printed in Mexico

www.FreeLibros.me


Colaboradores

C.U.C.B.A., Universidad de Guadalajara. Introducción, Capítulo 8

Dra. en C. Adriana María Salazar Montes. Instituto de Biología Molecular en Medicina y Terapia Génica, CUCS, Universidad de Guadalajara. Instituto de Biología Molecular, Centro Universitario de Ciencias de la Salud, Universidad de Guadalajara. Capítulo 5

Dr. Eduardo Vázquez Valls. Unidad de Investigación Médica en Epidemiología Clínica, UMAE, Hospital de Especialidades, CMNO, IMSS y Laboratorio de Inmunodeficiencias y Retrovirus Humanos, Centro de Investigación Biomédica de Occidente, IMSS. Capítulo 13

Dra. Airam Jenny Dávalos Marín. Laboratorio de Neuroinmunobiología Celular y Molecular, División de Neurociencias, C.I.B.O., IMSS. Capítulo 12

Dra. Graciela Gudiño Cabrera. Laboratorio de Desarrollo y Regeneración Neural, Instituto de Neurociencias, Departamento de Biología Celular y Molecular, C.U.C.B.A., Universidad de Guadalajara. Capítulo 11

Dra. Ana Rosa Rincón Sánchez. Instituto de Enfermedades Crónico Degenerativas, CUCS, Universidad de Guadalajara. Capítulo 10 Dra. en C. Ana Soledad Sandoval Rodríguez. Instituto de Biología Molecular en Medicina y Terapia Génica, CUCS, Universidad de Guadalajara. Instituto de Biología Molecular, Centro Universitario de Ciencias de la Salud, Universidad de Guadalajara. Capítulo 5

Dra. Irinea Yáñez Sánchez. Instituto de Biología Molecular en Medicina y Terapia Génica, CUCS, Universidad de Guadalajara. Instituto de Biología Molecular, Centro Universitario de Ciencias de la Salud, Universidad de Guadalajara. Capítulo 7

Dra. Argelia E. Rojas Mallorquín. Departamento de Biología Celular y Molecular, C.U.C.B.A., Universidad de Guadalajara. Capítulo 8

Dr. Juan Armendáriz Borunda. Instituto de Biología Molecular en Medicina y Terapia Génica, CUCS, Universidad de Guadalajara. Introducción, Capítulos 5, 10, 11

Dr. en C. Arturo Becerra Bracho. Departamento de Biología Evolutiva, Facultad de Ciencias, Universidad Nacional Autónoma de México, México, D. F. Capítulo 14

Dra. en C. María del Pilar Alatorre Carranza. Instituto de Biología Molecular en Medicina y Terapia Génica, CUCS, Universidad de Guadalajara. Instituto de Biología Molecular, Centro Universitario de Ciencias de la Salud, Universidad de Guadalajara. Capítulo 7

Dr. Carlos Beas Zárate. Laboratorio de Neurobiología Celular y Molecular, División de Neurociencias, C.I.B.O., IMSS. Laboratorio de Desarrollo y Regeneración Neural, Instituto de Neurociencias, Departamento de Biología Celular y Molecular, C.U.C.B.A., Universidad de Guadalajara. Introducción, Capítulos 4, 6, 11

Dr. en C. Mario Eduardo Flores Soto. Laboratorio de Neurobiología Celular y Molecular, División de Neurociencias, C.I.B.O., IMSS. Capítulo 4

Dr. Daniel Ortuño Sahagún. Laboratorio de Desarrollo y Regeneración Neural, Instituto de Neurociencias, Departamento de Biología Celular y Molecular,

Dra. en C. Martha Escoto Delgadillo. Unidad de Investigación Médica en Epidemiología Clínica, UMAE, Hospital de Especialidades, CMNO, IMSS y Labora-

v

www.FreeLibros.me


vi

Colaboradores

torio de Inmunodeficiencias y Retrovirus Humanos, Centro de Investigación Biomédica de Occidente, IMSS. Capítulo 13 Dra. en C. Miriam Ruth Bueno Topete. Instituto de Biología Molecular en Medicina y Terapia Génica, CUCS, Universidad de Guadalajara. Instituto de Biología Molecular, Centro Universitario de Ciencias de la Salud, Universidad de Guadalajara. Capítulo 7 Dra. en C. Mónica Elisa Ureña Guerrero. Laboratorio de Neurobiología, Departamento de Biología Celular y Molecular, C.U.C.B.A., Universidad de Guadalajara, Guadalajara, Jalisco, México. Capítulo 2 Dr. en C. Óscar Kurt Bitzer Quintero. Laboratorio de Neuroinmunobiología Celular y Molecular, División de Neurociencias, C.I.B.O., IMSS. Capítulo 12 Dr. Reinhard Schliebs. Paul Flechsig Institute for Brain Research, Department of Neurochemistry, University of Leipzig, Jahnallee 59, D-04109 Leipzig, Germany. Capítulo 11

Dra. Rosalba Gutiérrez Rojo. Laboratorio de Microbiología Molecular, Centro de Investigación y Asistencia en Tecnología y Diseño del Estado de Jalisco. Capítulo 9 Dra. en C. Silvia Josefina López Pérez. Laboratorio de Neurobiología, Departamento de Biología Celular y Molecular, C.U.C.B.A., Universidad de Guadalajara, Guadalajara, Jalisco, México. Capítulo 3 Dra. en C. Verónica Chaparro Huerta. Laboratorio de Neurobiología Celular y Molecular, División de Neurociencias, C.I.B.O., IMSS. Laboratorio de Desarrollo y Regeneración Neural, Instituto de Neurociencias, Departamento de Biología Celular y Molecular, C.U.C.B.A., Universidad de Guadalajara. Capítulos 4, 6 Dr. en C. Vidal Delgado Rizo. Instituto de Biología Molecular en Medicina y Terapia Génica, CUCS, Universidad de Guadalajara. Instituto de Biología Molecular, Centro Universitario de Ciencias de la Salud, Universidad de Guadalajara. Capítulo 7

Dr. Rodolfo Hernández Gutiérrez. Centro de Investigación y Asistencia en Tecnología y Diseño del Estado de Jalisco A. C. CIATEJ. Capítulo 1

www.FreeLibros.me


Contenido

Introducción

Capítulo 5

Cronología y evolución histórica de la biología molecular . . . . . . . . . . . . . . . . 1

Regulación de la transcripción. . . . . . . . . . . . 59 Dra. Adriana María Salazar Montes, Dra. Ana Soledad Sandoval Rodríguez y Dr. Juan Armendáriz Borunda

Dr. Carlos Beas Zárate, Dr. Daniel Ortuño Sahagún y Dr. Juan Armendáriz Borunda

Capítulo 6 Síntesis de proteínas . . . . . . . . . . . . . . . . . 71

PARTE I

Dra. Verónica Chaparro Huerta y Dr. Carlos Beas Zárate

Capítulo 1 Estructura molecular, función y métodos de estudio de las proteínas . . . . . . . . . . . . . . . . 5

Capítulo 7 Transducción de señales . . . . . . . . . . . . . . . 87

Dr. Rodolfo Hernández Gutiérrez

Dr. Vidal Delgado Rizo, Dra. Miriam Ruth Bueno Topete, Dra. Irinea Yañez Sánchez y Dra. María del Pilar Alatorre Carranza

Capítulo 2 Composición y estructura de los ácidos nucleicos . . . . . . . . . . . . . . . . 17 Dra. Mónica Elisa Ureña Guerrero

PARTE II

Capítulo 3

Capítulo 8

Replicación del ácido desoxirribonucleico (DNA). . . . . . . . . . . . . . 33

Técnicas de DNA recombinante . . . . . . . . . . . 105

Dra. Silvia Josefina López Pérez

Dr. Daniel Ortuño Sahagún y Dra. Argelia E. Rojas Mayorquín

Capítulo 4

Capítulo 9

Transcripción del ácido ribonucleico (RNA). . . . . 46

Aplicaciones de la biología molecular en la biotecnología . . . . . . . . . . . . . . . . . . 115

Dr. Carlos Beas Zárate, Dr. Mario Eduardo Flores Soto y Dra. Verónica Chaparro Huerta

Dra. Rosalba Gutiérrez Rojo

vii

www.FreeLibros.me


viii

Contenido

Capítulo 10

Capítulo 13

Aplicaciones de la biología molecular en la terapia génica . . . . . . . . . . . . . . . . . 122

Mecanismos moleculares de resistencia del virus de la inmunodeficiencia humana a los antirretrovirales . . . . . . . . . . . . . . . . 154

Dr. Juan Armendáriz Borunda y Dra. Ana Rosa Rincón Sánchez

Dr. Eduardo Vázquez Valls y Dra. Martha Escoto Delgadillo

Capítulo 11 Terapia génica en enfermedades neurodegenerativas . . . . . . . . . . . . . . . . . 130 Dr. Carlos Beas Zárate, Dra. Graciela Gudiño Cabrera, Dr. Juan Armendáriz Borunda y Dr. Reinhard Schliebs

Capítulo 14 Biología molecular y evolución de las primeras células . . . . . . . . . . . . . . . . 166 Dr. en C. Arturo Becerra Bracho Índice alfabético . . . . . . . . . . . . . . . . . . . 173

Capítulo 12 Neuroinmunorregulación . . . . . . . . . . . . . . 143 Dr. Óscar Kurt Bitzer Quintero y Dra. Airam Jenny Dávalos Marín

www.FreeLibros.me


Prólogo

de aspectos básicos como de temas aplicados a sus diferentes áreas de formación profesional. Asimismo, resulta de gran utilidad para el docente de dichas áreas, como material de apoyo didáctico para sus cursos. Finalmente, constituye una referencia importante para el profesionista que esté interesado en conocer más sobre el mundo de la biología molecular, ya que se presenta en un lenguaje claro y accesible. Los autores de los diferentes capítulos son investigadores activos con reconocimiento nacional e internacional, que han hecho su mejor esfuerzo, conociendo las necesidades como docentes, en generar un material de consulta claro y conciso, que incorpore y relacione conceptos recientes del campo de la biología molecular. Los autores desean que el lector de la presente obra encuentre la respuesta a sus dudas y que le motive no solamente el interés por la biología molecular, sino además que surja en él el gusto por el estudio profundo y el entendimiento de la vida a nivel molecular.

La presente obra consta de 14 capítulos organizados en dos partes. La primera se enfoca a los aspectos básicos de la biología molecular y sus fundamentos, desde la forma en que están compuestas y estructuradas las principales biomoléculas: proteínas y ácidos nucleicos, hasta cómo se realiza y se regula su síntesis. Además de referirse a los mecanismos de almacenamiento y transferencia de la información genética, así como a la expresión génica y sus procesos de regulación, los cuales son activados en función de los sistemas de señalización intracelular. La segunda parte inicia con un panorama amplio de las principales técnicas de biología molecular e ingeniería genética, aplicadas a diferentes campos del conocimiento, como la biotecnología, la terapia génica, las enfermedades neurodegenerativas, la neuroinmunobiología, y finaliza con el abordaje de aspectos evolutivos de la célula desde el punto de vista molecular. Este libro fue concebido como un texto de referencia para los estudiantes de ciencias médicas, biológicas, quimicofarmacobiológicas y agropecuarias, para la consulta

Carlos Beas Zárate Daniel Ortuño Sahagún Juan Socorro Armendáriz Borunda

ix

www.FreeLibros.me


www.FreeLibros.me


Introducción

Cronología y evolución histórica de la biología molecular Dr. Carlos Beas Zárate Dr. Daniel Ortuño Sahagún Dr. Juan Armendáriz Borunda

A continuación se presenta una muy breve reseña histórica desde los primeros estudios empíricos, realizados por el ser humano, relacionados con el funcionamiento biológico, hasta los más recientes avances del conocimiento de los mecanismos de función intrínseca de los seres vivos, los cuales constituyen en la actualidad una sólida base del conocimiento científico más avanzado y que se refieren en la primera parte de este libro a lo largo de los primeros siete capítulos. En la segunda parte, se presentan las aplicaciones concretas en diversas áreas del conocimiento de la biología molecular, así como sus repercusiones y perspectivas, que de manera conjunta con la bioinformática podrían ser factibles de desarrollarse en el muy próximo futuro.

Históricamente, podemos referir una serie de acontecimientos que contribuyeron de manera decisiva en el estudio de los fenómenos biológicos y establecieron la pauta para el abordaje a nivel molecular de los mismos. Sin embargo, es posible fijar el punto de partida de la historia más reciente del estudio de la vida a nivel molecular en el año de 1866, cuando Gregor Mendel publicó los resultados de sus experimentos relativos a los principios de recombinación y segregación independiente de las características genéticas. Poco después, en 1869, el científico suizo Friedrich Miescher descubrió en el núcleo de las células una sustancia de carácter ácido a la que llamó nucleína. Luego, en el segundo decenio del siglo xx, el químico alemán Robert Feulgen, mediante una tinción específica, descubrió que el DNA estaba localizado en los cromosomas. A partir de este descubrimiento, todo sucedió muy rápido. En 1944, Avery, McCleod y McCarty comprobaron que el DNA es el portador de la información genética. En 1953, Watson y Crick revelaron la estructura del DNA como una doble hélice complementaria, que recuerda la estructura de una escalera de caracol. Desde entonces y de manera exponencial, se suceden los descubrimientos (enzimas de restricción, polimerasas, etc.) que conducirían a lo que se conoce como la biología molecular y la tecnología del DNA recombinante.

CRONOLOGÍA DE LA BIOLOGÍA • 1750 a.C. Los sumerios fabrican la cerveza. • 1000 a.C. Los babilonios celebran con ritos religiosos la polinización de las palmeras. • 323 a.C. Aristóteles especula sobre la naturaleza de la reproducción y la herencia. • 100-300 Se escriben en la India textos metafóricos sobre la naturaleza de la reproducción humana. 1

www.FreeLibros.me


2

Introducción

Cronología y evolución histórica de la biología molecular

• 1590 Se inventa el microscopio. • 1663 Robert Hooke describe por primera vez a la célula. • 1676 Se confirma la reproducción sexual en las plantas. • 1677 Se contempla el esperma animal a través del microscopio. • 1802 Aparece por primera vez referida la palabra biología. • 1830 Se descubren las proteínas. • 1833 Se aísla la primera enzima. • 1838 Se descubre que todos los organismos vivos están compuestos por células. • 1859 Charles Darwin hace pública su teoría sobre la evolución de las especies. • 1866 Gregor Mendel describe, en los guisantes, las unidades fundamentales de la herencia (que posteriormente recibirán el nombre de genes). • 1871 Se aísla el DNA en el núcleo de una célula. • 1883 Francis Galton acuña el término eugenesia. • 1887 Se descubre que las células reproductivas constituyen un linaje continuo, diferente de las otras células del cuerpo. • 1908 Se establecen modelos matemáticos de las frecuencias génicas en poblaciones mendelianas. • 1909 Las unidades fundamentales de la herencia biológica reciben el nombre de genes. • 1925 Se descubre que la actividad del gen está relacionada con su posición en el cromosoma. • 1927 Se descubre que los rayos X causan mutaciones genéticas. • 1943 Se identifica el DNA como la molécula genética. • 1940-1950 Se descubre que cada gen codifica una única proteína. • 1953 Se propone la estructura en doble hélice del DNA. • 1956 Se identifican 23 pares de cromosomas en las células del cuerpo humano. • 1966 Se descifra el código genético completo del DNA. • 1972 Se sintetiza la primera molécula de DNA recombinante en el laboratorio. • 1973 Tienen lugar los primeros experimentos de ingeniería genética, en los que genes de una especie se introducen en organismos de otra especie y funcionan correctamente. • 1975 La conferencia de Asilomar evalúa los riesgos biológicos de las tecnologías de DNA recombinante, y aprueba una moratoria de los experimentos con estas tecnologías. • 1975 Se obtienen por primera vez los hibridomas que producen anticuerpos monoclonales. • 1976 Se funda en Estados Unidos Genentech, la primera empresa de ingeniería genética.

• 1977 Mediante técnicas de ingeniería genética, se fabrica con éxito una hormona humana en una bacteria. • 1977 Se desarrollan las primeras técnicas para secuenciar con rapidez los mensajes químicos de las moléculas del DNA. • 1978 Se clona el gen de la insulina humana. • 1980 El Tribunal Supremo de Estados Unidos dictamina que se pueden patentar los microbios obtenidos mediante ingeniería genética. • 1981 El primer diagnóstico prenatal de una enfermedad humana por medio del análisis del DNA. • 1982 Se genera el primer ratón transgénico (“superratón”), al insertar el gen de la hormona del crecimiento de la rata en óvulos de ratón hembra fecundados. • 1982 Se produce insulina humana mediante técnicas de DNA recombinante. • 1983 Se desarrolla la técnica de la reacción en cadena de la polimerasa, que permite replicar (copiar) genes específicos con gran rapidez. • 1984 Producción de las primeras plantas transgénicas. • 1985 Se inicia el uso de interferones en el tratamiento de enfermedades víricas. • 1985 Se utiliza por primera vez la “huella genética” en una investigación judicial en Gran Bretaña. • 1986 Se autorizan las pruebas clínicas de la vacuna contra la hepatitis B obtenida mediante ingeniería genética. • 1987 Propuesta comercial para establecer la secuencia completa del genoma humano (proyecto Genoma), compuesto aproximadamente por 100 000 genes. • 1987 Comercialización del primer anticuerpo monoclonal de uso terapéutico. • 1988 Primera patente de un ser vivo producido mediante ingeniería genética. • 1989 Comercialización de las primeras máquinas automáticas de secuenciación del DNA. • 1990 Primer tratamiento con éxito mediante terapia génica en niños con trastornos inmunitarios (“niños burbuja”). Se ponen en marcha numerosos procedimientos experimentales de terapia génica para intentar curar enfermedades cancerosas y metabólicas. • 1994 Se comercializa en California el primer vegetal modificado genéticamente (un tomate) y se autoriza en Holanda la reproducción del primer toro transgénico. • 1995 Se completan las primeras secuencias de genomas de seres vivos: se trata de las bacterias Haemophilus influenzae y Mycoplasma genitalium. • 1996 Por vez primera se completa la secuencia del genoma de un eucarionte, la levadura de la cerveza “Saccharomyces cerevisiae”. Por otra parte, el catálogo de genes humanos que Victor McKusick y colaboradores de la Universidad Johns Hopkins actualizan cada

www.FreeLibros.me


Perspectivas y futuro de la biología molecular con la informática

• •

semana contiene ya más de 5 000 genes conocidos. El Proyecto Genoma, coordinado por HUGO (Human Genome Organization), avanza a buen ritmo. 1997 Clonación del primer mamífero, una oveja llamada “Dolly”. 1999 Se completa la secuenciación del genoma (175 Mb) de Drosophila melanogaster (mosca de la fruta). 2000 Se termina la primera versión del genoma humano (3 200 Mb) y se completa la secuencia de Arabidopsis thaliana (157 Mb). 2002 Presentación del genoma humano por Celera Genomics y el grupo de colaboradores de laboratorios financiados por fundaciones públicas. 2007 Primer “trasplante” de un genoma completo de una bacteria a otra. Se publica como “transmutación de una especie biológica en otra” en Science el 28 de junio de 2007.

PERSPECTIVAS Y FUTURO DE LA BIOLOGÍA MOLECULAR CON LA INFORMÁTICA • 2010 Completar el proyecto para el entendimiento de la función de todos los genes dentro de la organización celular. • 2050 Completar el primer modelo computacional de una célula completa, o quizá por último de un organismo completo.

3

Después de esta breve descripción histórica sobre la evolución de la biología, la genética, la bioquímica y en buena parte del desarrollo tecnológico en paralelo, es posible entender el porqué esta obra se presenta en dos partes: En la primera se establecen los fundamentos básicos esenciales que permiten al principiante entender lo más elemental de la biología molecular y el manejo de las principales moléculas de la vida, como son: la estructura y composición de las proteínas, la composición y propiedades de los ácidos nucleicos, así como el almacenamiento y la transferencia de la información génica en la célula a través de la replicación del DNA, la transcripción del RNA y la síntesis de proteínas, así como algunas formas de regulación intracelular de la expresión génica y mecanismos de transducción intracelular que influyen sobre dicha expresión. En la segunda parte, se presenta una serie de capítulos que muestran desde el desarrollo de la tecnología del DNA recombinante y cómo esta tecnología ha permitido su aplicación en la biotecnología y en la terapia génica, así como lograr entender mejor diversos aspectos relacionados con la salud del ser humano, como son los procesos neurodegenerativos e inmunológicos, hasta llegar a comprender cómo ha sido posible la evolución de la célula con base en el análisis a nivel metabólico y molecular. De esta manera, los autores consideran que la presente obra puede ser un buen apoyo para los estudiantes de biología, medicina, farmacobiología y áreas afines, ya que les permitirá un mejor entendimiento de la biología molecular y el contexto de sus posibles aplicaciones.

www.FreeLibros.me


www.FreeLibros.me


PARTE I

Capítulo

1

Estructura molecular, función y métodos de estudio de las proteínas Dr. Rodolfo Hernández Gutiérrez

PROTEÍNAS

culas a través de las cuales se expresa la información genética.

Nuestros cuerpos y los diversos organismos vivos contienen un número enorme de moléculas diferentes entre sí. En una sola célula, puede haber miles y miles de moléculas; casi todas ellas las fabrican los propios organismos. Los ácidos nucleicos (DNA y RNA) y las proteínas son algunas de estas moléculas, las cuales son sintetizadas en el interior de nuestras células y de las células de todos los organismos vivos. Las proteínas son macromoléculas, polipéptidos naturales y uno de los componentes fundamentales y más abundantes de las células; participan y se encuentran en los procesos y estructuras más importantes de los organismos y muestran una gran diversidad en sus propiedades físicas, desde las enzimas solubles en agua, hasta la queratina insoluble del pelo. Los componentes básicos de las proteínas son los aminoácidos; las cadenas grandes de estos aminoácidos son las proteínas. La información para la síntesis de una proteína está codificada en el DNA, pero realmente son las proteínas y no el DNA las que determinan la forma de las células así como las funciones de reconocimiento, regulación y catálisis; en otras palabras, las proteínas son las molé-

Aminoácidos Todas las proteínas están constituidas por aminoácidos unidos en una secuencia lineal mediante un tipo específico de enlace covalente (enlace peptídico) formado entre el grupo amino de un aminoácido (—NH2) y el grupo carboxilo (—COOH) del aminoácido precedente. Cabe señalar que las células tienen la capacidad de sintetizar proteínas muy diversas, en cuanto a su tamaño, actividad o función biológica mediante el uso combinado de los 20 aminoácidos. A partir de estas combinaciones, las células tienen la capacidad de sintetizar proteínas, como anticuerpos, enzimas, hormonas, proteínas estructurales y más. Todos los aminoácidos que se hallan en las proteínas son alfaaminoácidos; es decir, en todos ellos el carbono α (alfa) es asimétrico y está unido a cuatro grupos diferentes: el grupo carboxilo, el grupo amino, un grupo R y un átomo de hidrógeno (fig. 1-1). Debido a la disposición tetraédrica de los orbitales de enlace alrededor del carbono α, los cuatro grupos pueden ocupar dos disposiciones diferentes en el espacio; a estas dos formas se les denomina enantiómeros o estereoisómeros. Hay 5

www.FreeLibros.me


6

Capítulo 1

Figura 1-1

Estructura molecular, función y métodos de estudio de las proteínas

Glicina (Gly, G)

Estructura básica de un aminoácido.

entonces dos tipos de estereoisómeros: los L (levógiros: disposición a la izquierda) y los D (dextrógiros: disposición a la derecha). Los símbolos L y D se refieren a la configuración de los cuatro componentes alrededor del carbono quiral. Excepto cuando el grupo R (o cadena lateral) es H, los aminoácidos presentan actividad óptica. Todos los aminoácidos de las proteínas tienen configuración L y difieren entre sí por la estructura de sus cadenas laterales o grupos R. En la síntesis de proteínas se utilizan 20 aminoácidos diferentes. Nuestras células carecen de los mecanismos bioquímicos para producir todos los aminoácidos; pueden fabricar sólo 11 de los 20 necesarios para la síntesis de proteínas; los nueve restantes deben ser ingeridos en la dieta y se denominan aminoácidos esenciales. Los aminoácidos se representan por lo general con dos símbolos para cada aminoácido (cuadro 1-1). Uno de ellos consta de las tres primeras letras del aminoácido y son relativamente fáciles de recordar; el otro se compone de una sola

Cuadro 1-1

Simbología y propiedades de los aminoácidos

Aminoácido

Símbolo de tres letras

Glicina Alanina Valina Leucina Isoleucina Prolina Fenilalanina Tirosina Triptófano Cisteína Metionina Serina Treonina Lisina Arginina Histidina Aspartato Glutamato Asparagina Glutamina

Gly (hdrófilo) Ala (hidrófobo) † Val (hidrófobo) †* Leu (hidrófobo) †* Ile (hidrófobo) †* Pro (hidrófobo) † Phe (hidrófobo) †* Tyr (hidrófilo) δ* Trp (hidrófobo) † Cys (hidrófilo) δ Met (hidrófobo) †* Ser (hidrófilo) δ Thr (hidrófilo) δ* Lys (básico) * Arg (básico) * His (básico) * Asp (ácido) Glu (ácido) Asn (hidrófilo) δ Gln (hidrófilo) δ

δ Polares

Símbolo de una letra G A V L I P F Y W C M S T K R H D E N G

sin carga. † No polares sin carga. * Aminoácidos esenciales. La arginina se considera esencial en la población pediátrica

Figura 1-2

Alanina (Ala, A)

Figura 1-3

letra usado para mostrar la composición y la secuencia de los aminoácidos, además de facilitar la comunicación y escribir secuencias de proteínas grandes en espacios pequeños. Los aminoácidos presentan propiedades acidobásicas; son compuestos anfotéricos, es decir, pueden ceder o ganar electrones, contienen tanto grupos ácidos como grupos básicos. Debido a ello, tienen carga neta que depende de la naturaleza de la unión. La carga de una molécula influye en el tipo de interacción con otras moléculas; esta propiedad es útil para el aislamiento y purificación de los aminoácidos y proteínas. Las cadenas laterales de los aminoácidos no forman una serie natural, por lo que no es fácil aprender sus estructuras. Es fácil clasificarlos según sean polares o no polares, aromáticos o alifáticos, o ácidos o básicos; no obstante, estas clasificaciones no son mutuamente excluyentes. El aminoácido más simple es la glicina, el cual sólo tiene un átomo de hidrógeno como cadena lateral (fig. 1-2); le sigue la alanina con un grupo metilo (fig. 1-3); los aminoácidos con cadenas laterales de tres o cuatro carbonos de largo son valina, leucina e isoleucina (fig. 1-4), cuyas cadenas laterales alifáticas son hidrófobas, es decir que tienen una aversión al agua. La prolina también tiene una cadena lateral alifática, pero difiere de los otros 19 aminoácidos en que su cadena lateral está unida al átomo de hidrógeno y al carbono α (fig. 1-5). La estructura cíclica es importante en la estructura de las proteínas. Hay tres aminoácidos con cadenas laterales aromáticas: la tirosina, el triptófano y la fenilalanina. El ani-

Valina (Val, V)

Figura 1-4

www.FreeLibros.me

Leucina (Leu, L)

Isoleucina (Ile, I)


Proteínas

Prolina (Pro, P)

Serina (Ser, S)

7

Treonina (Thr, T)

Figura 1-5 Figura 1-8

llo aromático de tirosina contiene un grupo hidroxilo unido (fig. 1-6), lo que la hace menos hidrófoba que la fenilalanina; el triptófano tiene un anillo unido al grupo metileno; la fenilalanina y el triptófano son altamente hidrófobos. La metionina y la cisteína contienen un áto-

Fenilalanina (Phe, F)

Tirosina (Tyr, Y)

Triptófano (Trp, W)

Enlace peptídico

Figura 1-6

mo de azufre en sus cadenas laterales, la metionina en un enlace tioéter y la cisteína en forma de grupo sulfhidrilo (fig. 1-7); ambas cadenas laterales son hidrófobas y el grupo sulfhidrilo de la cisteína es altamente reactivo y juega un papel importante en la estabilización de algunas proteínas mediante la formación de puentes disulfuro.

Cisteína (Cys, C)

Figura 1-7

La serina y la treonina contienen grupos hidroxilo alifáticos (fig. 1-8), los cuales los hacen mucho más hidrófilos y reactivos que la alanina y la valina. Los aminoácidos con cadenas laterales muy polares son muy hidrófilos. La lisina y la arginina (fig. 1-9) tienen las cadenas laterales más grandes de los 20 aminoácidos y están cargadas positivamente a pH neutro. La histidina puede estar no cargada o cargada positivamente, dependiendo del medio en que se encuentre; su anillo imidazol (fig. 1-10) juega un papel importante y por él este aminoácido se halla en los sitios activos de las enzimas; estos tres aminoácidos se nombran aminoácidos básicos. Hay dos aminoácidos con cadenas laterales ácidas, el ácido aspártico y el ácido glutámico; por lo general se llaman aspartato y glutamato (fig. 1-11). Los derivados sin carga son glutamina y asparagina, los cuales tienen un grupo amida terminal en lugar de un carboxilato (fig. 1-12).

En las proteínas, el enlace peptídico es un enlace covalente que se establece entre el grupo carboxilo de un aminoácido y el grupo amino de otro. La formación de un dipéptido a partir de dos aminoácidos conlleva la pérdida de una molécula de agua (fig. 1-13). La unión de varios aminoácidos mediante enlaces peptídicos forma una

Metionina (Met, M)

Lisina (Lys, K)

Figura 1-9

www.FreeLibros.me

Arginina (Arg, R)


8

Capítulo 1

Estructura molecular, función y métodos de estudio de las proteínas

Histidina (His, H)

Asparagina (Asn, N)

Figura 1-10

Figura 1-12

cadena polipeptídica, la cual no es ramificada (fig. 1-14). En una cadena polipeptídica o proteína, a un aminoácido se le denomina residuo; esta cadena consiste en una parte repetida regularmente llamada cadena principal y de una parte variable que corresponde a las cadenas laterales de los aminoácidos. El peso promedio de un residuo de aminoácido es de alrededor de 110 daltones (un daltón es igual a una unidad de masa atómica). Por ejemplo, una proteína con peso molecular de 30 000 tiene una masa de 30 000 daltones o 30 kDa.

Aspartato (Asp, D)

Glutamato (Glu, E)

Estructura primaria Se refiere al orden lineal y número de los aminoácidos presentes en dichas proteínas (fig. 1-14). Los enlaces peptídicos son los que determinan esta estructura. Las proteínas tienen dirección porque están sintetizadas en cierto orden, y presentan dos extremos, un extremo aminoterminal (izquierdo) donde el aminoácido es el número uno y tiene libre a su grupo amino α, y otro extremo carboxiloterminal (derecho) en el cual el último aminoácido tiene su grupo carboxilo α libre. Por convención, el extremo aminoterminal se toma como el inicio de una cadena polipeptídica y el extremo carboxiloterminal como el fin de ésta (fig. 1-15). La secuencia de aminoácidos de una proteína es importante por varias razones: primera, el conocimiento de la secuencia de una proteína es muy útil, pues indica su mecanismo de acción; segunda, las alteraciones en la secuencia de aminoácidos pueden producir funciones anormales y enfermedades crónicas y letales como la fibrosis quística, y tercera, la secuencia de una proteína revela datos de su historia evolutiva.

Estructura secundaria

Figura 1-11

Estructura de las proteínas La conformación de una proteína se define por cuatro niveles estructurales: 1) estructura primaria, 2) estructura secundaria, 3) estructura terciaria y 4) estructura cuaternaria.

Figura 1-13

Glutamina (Gln, G)

Se define como el orden en el que se encuentran los aminoácidos y la disposición espacial estable que adquieren durante la síntesis de proteínas. Este tipo de estructura así como la estructura terciaria y cuaternaria son determinadas por las características de los grupos funcionales y por enlaces de tipo no covalente. En general, el plegamiento de las proteínas se agrupa en dos grandes clases

Enlace peptídico

Enlace peptídico.

www.FreeLibros.me


ProteĂ­nas

arg

Hoja plegada đ?›ƒ

asp

glu

gln

met

trp

gly

pro

his

ile

ser

arg

val

phe

Figura 1-14

Estructura primaria.

con base en su estructura secundaria, proteĂ­nas globulares o proteĂ­nas ďŹ brilares. Las proteĂ­nas globulares estĂĄn plegadas compactadamente y de modo helicoidal, en tanto que las proteĂ­nas ďŹ brilares son mĂĄs bien ďŹ lamentosas o alargadas. En una sola proteĂ­na, las mĂşltiples regiones de la cadena polipeptĂ­dica pueden asumir diferentes conformaciones, las cuales son determinadas por la secuencia primaria de los aminoĂĄcidos. La estructura secundaria de las proteĂ­nas puede estar organizada en estructuras regulares combinadas, como la hĂŠlice Îą y la hoja plegada β, las cuales se pueden repetir u organizarse al azar.

HĂŠlice đ?›‚ La hĂŠlice Îą es una estructura secundaria encontrada de manera comĂşn en las proteĂ­nas globulares. La formaciĂłn de la estructura de hĂŠlice Îą es espontĂĄnea y se forma al enrollarse helicoidalmente sobre sĂ­ misma la estructura primaria. La estabilidad de la hĂŠlice Îą se debe a la formaciĂłn de enlaces de puentes de hidrĂłgeno que se establecen entre los grupos carboxilo (C=O) de un aminoĂĄcido con el cuarto grupo amino (—NH—) de los aminoĂĄcidos que le proceden (ďŹ g. 1-16). No todos los aminoĂĄcidos favorecen la formaciĂłn de la hĂŠlice Îą; los aminoĂĄcidos A, D, I, L y M favorecen la formaciĂłn de esta estructura, en tanto que G y P actĂşan de manera contraria, lo cual tambiĂŠn es importante, ya que introducen un plegamiento adicional de la cadena polipeptĂ­dica para dar lugar a la formaciĂłn de proteĂ­nas globulares.

Mientras que la hĂŠlice Îą estĂĄ formada de un arreglo lineal simple de aminoĂĄcidos dispuestos helicoidalmente, en las hojas plegadas β la estructura se halla siempre completamente extendida (ďŹ g. 1-17); las cadenas laterales de los aminoĂĄcidos se sitĂşan de manera alternada a la derecha y a la izquierda del esqueleto de la cadena polipeptĂ­dica. Las estructuras β de una misma cadena o de distintas cadenas polipeptĂ­dicas pueden interaccionar entre sĂ­ mediante puentes de hidrĂłgeno, dando lugar a estructuras laminares llamadas por su forma hojas plegadas u hojas β (ďŹ g. 1-17). Las cadenas adyacentes en una hoja β pueden encontrarse en direcciĂłn opuesta (hoja antiparalela β) o en la misma direcciĂłn (hoja paralela β).

Estructura supersecundaria Algunas proteĂ­nas presentan una organizaciĂłn ordenada de las estructuras secundarias y forman distintos dominios funcionales o motivos estructurales denominados estructuras supersecundarias. Algunos ejemplos son el dominio hĂŠlice-vuelta-hĂŠlice de proteĂ­nas bacterianas que regulan la transcripciĂłn y los “zipperâ€? de leucina, los dominios hĂŠlice-burbuja-hĂŠlice y los dedos de cinc que son reguladores de la transcripciĂłn en eucariontes.

Estructura terciaria La estructura terciaria se reďŹ ere a la estructura tridimensional completa de las unidades peptĂ­dicas de una proteĂ­na dada, incluyendo en esta descripciĂłn la relaciĂłn espacial entre las diferentes estructuras secundarias de una cadena polipeptĂ­dica y cĂłmo esas estructuras secundarias se pliegan sobre sĂ­ mismas para la formaciĂłn de la estructura tridimensional de la proteĂ­na. Esta conformaciĂłn tridimensional facilita la solubilidad en el agua, lo que permite realizar las funciones enzimĂĄticas, de transporte, hormonales, etcĂŠtera. La estructura secundaria de las proteĂ­nas la constituyen diversos dominios, y la estructura terciaria

Extremo aminoterminal

Figura 1-15

9

Extremo carboxiloterminal

Cadena peptĂ­dica.

www.FreeLibros.me


10

Capítulo 1

Estructura molecular, función y métodos de estudio de las proteínas

mos; son el producto de la oxidación de dos grupos tiol (uno de cada cisteína). Este tipo de enlace sólo puede formarse en el ambiente oxidante del retículo endoplásmico, por lo que en general los puentes disulfuro se encuentran en proteínas de membrana y de secreción.

Fuerzas hidrófobas

Estructura de hélice α

Figura 1-16

Estructura secundaria.

también describe la relación entre los diferentes dominios de una misma proteína. La interacción de los diferentes dominios está gobernada por distintos tipos de fuerzas que son las que determinan la estructura tridimensional de las proteínas: los puentes de hidrógeno, los puentes disulfuro, las fuerzas hidrófobas, las fuerzas electrostáticas y las fuerzas de van der Waals (fig. 1-18).

Las proteínas están compuestas de aminoácidos que contienen grupos R de carácter tanto hidrófilo como hidrófobo. Es la naturaleza de la interacción de los diferentes grupos R con el medio acuoso la que juega el papel principal en las estructuras de las proteínas. El plegamiento espontáneo de las proteínas globulares es un reflejo del balance entre las fuerzas energéticas opuestas del puente de hidrógeno, los grupos hidrófilos R y el medio acuoso, y la repulsión del medio acuoso por los grupos hidrófobos R. La hidrofobicidad de ciertos grupos R de los aminoácidos tiende a dirigirlos hacia el interior de las proteínas. Estas fuerzas restringen las conformaciones en las cuales las proteínas pueden plegarse.

Fuerzas electrostáticas

Las cadenas polipeptídicas contienen numerosos donadores y aceptores de protones tanto en la cadena principal como en las cadenas laterales (o grupo R) que permiten la formación de este tipo de enlaces.

Las fuerzas electrostáticas son principalmente de tres tipos: carga-carga, carga-dipolo y dipolo-dipolo. Las interacciones típicas carga-carga que favorecen el plegamiento de las proteínas se dan entre dos grupos R con carga opuesta. La interacción carga-dipolo se da entre un grupo R ionizado y el dipolo de una molécula de agua. La forma dipolar de los grupos R afecta la interacción con el agua. Por tanto, es entendible que la mayoría de los aminoácidos que se encuentran en la superficie de las proteínas globulares contienen grupos R cargados o polares.

Puentes disulfuro

Fuerzas de van der Waals

Son enlaces covalentes que se establecen entre dos residuos de cisteína que espacialmente se encuentren próxi-

Son fuerzas de atracción y repulsión que controlan el plegamiento de las proteínas. Las fuerzas de atracción se dan entre dos átomos no cargados y no unidos, pero que provocan la formación de dipolos. Fuerza de repulsión es la que se establece entre dos átomos no cargados que se encuentran muy cerca, pero que no inducen dipolos. Las fuerzas de van der Waals son extremadamente débiles en comparación con las otras fuerzas que gobiernan la conformación de las proteínas; por tanto, son las numerosas interacciones de este tipo las que hacen significante su presencia en el plegamiento de las proteínas.

Puentes de hidrógeno

Estructura cuaternaria Estructura plegada β

Figura 1-17

Estructura plegada.

Las proteínas que contienen más de una cadena polipeptídica representan otro nivel de organización estructural. Cada cadena polipeptídica en este nivel de organización recibe el nombre de subunidad. La estructura cuaternaria se refiere al arreglo espacial de subunidades de proteína y

www.FreeLibros.me


Proteínas

Puente eléctrico

11

1

Interacción hidrófoba

2

4 Puente eléctrico Puente disulfuro 3

Figura 1-18

Estructura terciaria.

Figura 1-19

la naturaleza de sus interacciones (fig. 1-19). Las proteínas con múltiples subunidades se denominan oligoméricas; pueden estar compuestas por subunidades idénticas (homooligoméricas) o distintas (heterooligoméricas). Un ejemplo de estructura cuaternaria es la hemoglobina, la cual consta de dos subunidades α y dos β (heterooligoméricas).

Estructuras proteínicas complejas Muchos de los 20 aminoácidos que forman las proteínas son susceptibles de ser modificados después de la síntesis de una cadena polipeptídica (traducción); por tanto, se les denomina modificaciones postraduccionales. Esas modificaciones determinan funciones especializadas de las proteínas. Por ejemplo, el extremo aminoterminal de muchas proteínas es acetilado, lo cual hace que esas proteínas sean menos susceptibles a degradación. En el caso del colágeno, muchos residuos de prolina se hidroxilan para formar hidroxiprolina, lo cual estabiliza las fibras de colágeno. Las proteínas que tienen carbohidratos unidos covalentemente reciben el nombre de glucoproteínas; éstas son de dos clases dependiendo del tipo de unión que se establece entre la proteína y el carbohidrato: N-glucosídico y O-glucosídico; el primero se forma al unirse el carbohidrato con el grupo amida de la asparagina, y el segundo al unirse el carbohidrato con el grupo hidroxilo de la serina, treonina y con una baja frecuencia a la hidroxilisina. Otra modificación postraduccional a la cual están sujetas las proteínas son la incorporación de lípidos mediante uniones no covalentes. La adición de carbohidratos a las proteínas las hace más hidrófilas, y a la inversa, la adición de ácidos grasos a un grupo amino α o grupo sulfhidrilo de la cisteína las hace más hidrófobas. Muchas proteínas son hidrolizadas (procesadas) después de su síntesis; como un ejemplo, se pueden mencionar las enzimas

Estructura cuaternaria.

digestivas, las cuales son sintetizadas como precursores inactivos que pueden ser almacenadas de manera segura en el páncreas, y después de ser liberadas en el intestino se activan mediante la hidrólisis de un enlace peptídico. Para comprender la estructura química de las proteínas, es necesario determinar la secuencia de sus aminoácidos. Además de éstos, algunas proteínas contienen otros compuestos; a estas proteínas se les conoce como proteínas conjugadas, y la parte que no es aminoácido se denomina grupo prostético. Las glucoproteínas y los proteoglucanos contienen carbohidratos unidos mediante enlaces covalentes, en tanto que las lipoproteínas contienen como grupo prostético a los lípidos.

Funciones de las proteínas El papel medular de las proteínas en las células queda plasmado en el hecho de que la información genética se expresa finalmente en forma de proteína. Para cada proteína expresada en algún momento biológico existe un segmento de DNA (gen) que codifica la información de la secuencia de aminoácidos de la proteína. Una célula es capaz de sintetizar miles de proteínas diferentes a la vez, cada una de ellas codificada por un gen y encargada de una función específica dentro de la biología de la célula o del organismo del cual ésta forma parte. Todas las funciones biológicas de los organismos, sean éstos unicelulares o pluricelulares, incluyen la participación de una o hasta varias proteínas. Las proteínas actúan como estructuras con funciones mecánicas o de soporte, como catalizadores de reacciones enzimáticas y realizando un gran número de funciones. Se conocen numerosas funciones de una gran cantidad de proteínas (y seguramente es mucho más lo que se desconoce). A continuación se mencionan de manera breve algunos ejemplos.

www.FreeLibros.me


12

Capítulo 1

Estructura molecular, función y métodos de estudio de las proteínas

Catálisis Casi todas las reacciones químicas dentro de una célula son catalizadas por proteínas. Un proceso, como la obtención de energía a partir de la glucosa, requiere el funcionamiento y la coordinación de un gran número de enzimas.

Transporte El oxígeno que respiramos es transportado en la sangre al resto del organismo por una proteína llamada hemoglobina, presente en los eritrocitos.

Almacenamiento El hierro se almacena dentro del organismo en el hígado formando un complejo con una proteína llamada ferritina.

Movimiento

Algunas de las metodologías para estudiar, purificar y analizar proteínas son la electroforesis, la cromatografía y la secuenciación.

Aislamiento y purificación de proteínas A menudo, el primer paso para la purificación de proteínas implica separar las moléculas de proteínas de solutos de bajo peso molecular. Después puede llevarse a cabo algún grado de separación de diferentes proteínas con base en propiedades físicas, como la carga eléctrica, el tamaño y la solubilidad diferencial en distintos solventes. Por último, es posible obtener un alto grado de purificación, dependiendo de la afinidad específica de las proteínas hacia ciertos compuestos que están unidos a alguna forma de soporte sólido; a este proceso se le conoce como cromatografía de afinidad.

Diálisis

Las proteínas son fundamentales como componentes de los músculos.

Soporte y estructura El colágeno es una proteína que proporciona la propiedad de tensión de la piel y huesos. La elastina es una proteína elástica que brinda a los tejidos, como arterias y pulmones, la capacidad de estirarse. Estos ejemplos muestran la versatilidad de las propiedades físicas de las proteínas.

Respuesta inmunitaria El sistema inmunitario, el encargado de protegernos de organismos patógenos, está constituido por cientos de proteínas y requiere de la precisa interacción de éstas. Los anticuerpos y las interleucinas son ejemplos de proteínas que participan en los mecanismos de la respuesta inmunitaria.

Impulsos nerviosos Los impulsos nerviosos se transmiten al interior de las células por iones que pasan a través de canales de tipo proteínico.

Métodos de estudio de las proteínas Una de las principales metas de la bioquímica es investigar cómo las secuencias de aminoácidos determinan las conformaciones de las proteínas. Es importante saber cómo las proteínas se unen a sustratos específicos y otras moléculas y cómo intervienen en la catálisis y transfieren energía e información. Un paso indispensable en esos estudios es la purificación de las proteínas de interés.

Por definición, las moléculas de proteínas son de alto peso molecular, en general mayor a 5 000 daltones, por lo que no pasan a través de membranas semipermeables (de celulosa con poros) que sí permiten el libre paso de moléculas más pequeñas. Esta permeabilidad selectiva es la base del proceso denominado diálisis. Por lo general, ésta se realiza colocando la solución de proteína dentro de una bolsa de celofán y sumergiendo la bolsa en un volumen considerable de solución amortiguadora. Las proteínas que tienen dimensiones mucho más grandes que el diámetro del poro son retenidas dentro de la bolsa de diálisis, en tanto que las moléculas más pequeñas y iones difunden hacia el amortiguador a través de la bolsa. Esta metodología es útil cuando, durante el proceso de obtención de proteínas de las células, se utilizó algún compuesto que pueda interferir con el siguiente paso de análisis de proteínas.

Solubilidad selectiva La solubilidad de la mayoría de las proteínas es baja en altas concentraciones de sal, pero difiere de una proteína a otra; por ejemplo, el fibrinógeno, una proteína sérica, precipita a concentraciones de 0.8 M de sulfato de amonio, y la albúmina sérica a concentraciones de 2.4 M. Las proteínas pueden precipitarse selectivamente de una mezcla de diferentes proteínas agregando sales neutras como sulfato de amonio, solventes orgánicos como etanol o acetona, o potentes agentes precipitantes como el ácido tricloroacético. Las proteínas son menos solubles en un solvente dado cuando el pH es igual a su punto isoeléctrico. En el punto isoeléctrico, la proteína no lleva carga eléctrica neta, y por tanto es mínima la repulsión electrostática entre las moléculas de proteínas. Aunque en su punto isoeléctrico una proteína puede llevar grupos car-

www.FreeLibros.me


Proteínas

gados positiva y negativamente, la suma de estas cargas es cero. A valores de pH superiores al punto isoeléctrico, la carga neta será negativa, en tanto que a cifras de pH inferiores la carga neta será positiva. Esta metodología se utiliza cuando se requiere hacer una separación burda de proteínas de un extracto total de células; también es una manera de concentrar y enriquecer proteínas para su análisis.

Filtración en gel Las proteínas pueden separarse según su tamaño por medio de filtración en gel. Esta técnica se basa en la difusión de las moléculas a través de los poros de una matriz de gel en una columna. El dextrán o la agarosa son polímeros de carbohidratos y son el tipo de gel usado por lo general en forma de esferas muy pequeñas; este material se consigue comercialmente como Sefadex, Sefarosa y Bio-gel, con tamaños de poros muy variados. La muestra de proteínas se aplica en la parte superior de la columna, y el resultado es que las proteínas que son de mayor tamaño que el poro de la matriz no difunden dentro de las esferas y se eluyen rápido, en tanto las más pequeñas pueden difundir libremente dentro de las esferas del gel y eluyen de la columna más tarde después que un volumen mayor de regulador ha pasado a través de ella. Se debe observar que el orden de elusión de las proteínas sometidas a filtración en gel es inverso al orden observado en la electroforesis en gel. Esta metodología es útil para separar grandes cantidades de proteínas. Se pueden separar proteínas de alto peso molecular de otras de bajo peso, pero la resolución es mucho más baja que en la electroforesis en gel.

Electroforesis El movimiento de las moléculas de proteína eléctricamente cargadas en un campo eléctrico se denomina electroforesis. Es un método importante para separar proteínas y otras moléculas como DNA y RNA. Las separaciones electroforéticas casi siempre se realizan en geles (o en soportes sólidos como papel). En la electroforesis, las moléculas que son más pequeñas que el poro del gel migran más rápido que las moléculas más grandes que el poro, y las moléculas de tamaño intermedio migran a través del gel con diverso grado de movilidad. Los geles de poliacrilamida son químicamente inertes, y los tamaños del poro pueden ser controlados mediante la elección de las concentraciones de poliacrilamida y metilbisacrilamida. Las proteínas pueden ser separadas con base en su masa mediante electroforesis en geles de poliacrilamida en condiciones desnaturalizantes (SDS-PAGE). El duodecilsulfato de sodio (SDS) es un detergente aniónico que rompe todas las uniones no covalentes de una proteína natural. El β-mercaptoetanol y el ditiotreitol son reduc-

13

tores que rompen los puentes disulfuro. Estos tres compuestos se utilizan por lo regular en la electroforesis de proteínas. Los aniones del SDS se unen a la cadena de proteínas en una relación de una molécula de SDS por cada dos residuos de aminoácidos, lo que da como resultado un complejo SDS-proteína desnaturalizada con una carga negativa neta proporcional a la masa de la proteína; la carga negativa del complejo SDS-proteína es más grande que la de la proteína natural. La dirección de la electroforesis es de arriba hacia abajo y las proteínas se sitúan como bandas en zonas estrechas, pero para ser visualizadas se utilizan métodos de tinción como la plata (capaz de detectar hasta ∼0.02 μg de proteína) y el azul Coomassie (que permite detectar hasta ∼0.1 μg de proteína); también se puede hacer marcaje radiactivo y las proteínas se visualizan al colocar una placa de rayos X sobre el gel (autorradiografía). El SDS-PAGE es un método sensible, rápido y con un alto grado de resolución (permite identificar proteínas con una diferencia de tamaño de 1 kDa); esta metodología combinada con la de la inmunoelectrotransferencia (Western blot) es una herramienta con enormes ventajas en el estudio de las proteínas.

Isoelectroenfoque o electroforesis en dos dimensiones (2D) Las proteínas también se pueden separar electroforéticamente con base en su contenido relativo de residuos ácidos o básicos. El punto isoeléctrico de una proteína es el pH en el cual su carga neta es cero; a ese pH, su movilidad electroforética es igual a cero. Si una mezcla de proteínas se somete a electroforesis en un gradiente de pH en un gel en ausencia de SDS cada proteína se moverá hasta alcanzar una posición en el gel en la cual el pH es igual al punto isoeléctrico de la proteína. El gradiente de pH en un gel se forma por la electroforesis de una mezcla de polianfolitos que tienen muchos valores de punto isoeléctrico. El isoelectroenfoque puede resolver proteínas que difieren hasta de 0.01 de punto isoeléctrico; se combina con SDS-PAGE para realizar separaciones de proteínas de muy alta resolución; primero se separan las proteínas por su punto isoeléctrico y luego por su peso molecular. Esta metodología permite identificar proteínas de interés que pueden ser sometidas a secuenciación para la identificación del tipo de proteína así como para el diseño de oligonucleótidos para hacer pruebas de reacción en cadena de la polimerasa para diagnóstico, clonación de genes, o ambas cosas.

Cromatografía de intercambio iónico Las proteínas pueden ser separadas con base en su carga neta mediante cromatografía de intercambio iónico. Se basa en la interacción electrostática entre una proteína cargada positiva o negativamente con una partícula fija

www.FreeLibros.me


14

Capítulo 1

Estructura molecular, función y métodos de estudio de las proteínas

de resina de intercambio iónico/catiónico que tiene una carga opuesta. Por ejemplo, si una proteína tiene una carga neta positiva a pH de 7.0, ésta se unirá a la columna que tiene grupos carboxilo (carga neta negativa), y de manera contraria, otra proteína con carga neta negativa no se unirá a la columna. Una proteína con carga positiva que está unida a la columna puede ser eluida (liberada) con incremento en la concentración de cloruro de sodio u otras sales en la solución amortiguadora de elusión. Los iones de sodio compiten por unión a la columna con los grupos de la proteína cargados positivamente. Las proteínas que tienen una baja densidad de carga neta positiva eluyen primero de la columna que las que tienen una densidad de carga neta positiva mayor. Las proteínas cargadas negativamente (aniónicas) deben ser separadas mediante cromatografía de intercambio catiónico, es decir, columnas con carga positiva como la dietilaminoetil-celulosa (DEAE-celulosa) y las proteínas cargadas positivamente (catiónicas) mediante cromatografía de intercambio aniónico como la columna de carboximetilcelulosa (CM-celulosa). Es un paso intermedio y una técnica muy utilizada en el proceso de purificación de proteínas.

Cromatografía de afinidad Es otra metodología bastante útil y poderosa utilizada en la purificación de proteínas; se basa en la alta afinidad que presentan muchas proteínas por grupos químicos específicos de otras moléculas. Un ejemplo es una proteína de las plantas, la concanavalina A (Con A), la cual presenta una alta afinidad por la glucosa. En una columna que tiene residuos de glucosa unidos covalentemente, se pasa un extracto crudo de proteínas y la Con A se une a la columna, en tanto que las otras proteínas no; la elusión de la Con A unida a la columna se realiza con una solución concentrada de glucosa; la glucosa de la solución desplaza a la Con A unida a los residuos de glucosa de la columna.

Peso molecular Cada proteína tiene un peso molecular único, de modo que, bajo condiciones específicas, el tamaño o peso molecular de una proteína la distingue de otras proteínas. Las proteínas que poseen una estructura cuaternaria están formadas por varias cadenas polipeptídicas que se mantienen juntas por interacciones no covalentes. Cuando se analizan estas proteínas en condiciones de disociación (p. ej., urea 8.0 M para debilitar los enlaces por puente de hidrógeno y las interacciones hidrófobas; mercaptoetanol 1 mM para romper puentes disulfuro), puede determinarse el peso molecular de las cadenas que la conforman. Al comparar con el peso molecular natural, casi siempre es posible saber cuántas cadenas polipeptídicas están incluidas en la cadena natural.

Determinación de la secuencia del extremo aminoterminal Antes de la secuenciación de los péptidos, es necesario eliminar los puentes disulfuro en los péptidos y entre éstos. El tratamiento más común es usar 2-β-mercaptoetanol o ditioteitrol; ambos compuestos reducen los puentes disulfuro. Una de las principales técnicas para secuenciar péptidos y proteínas del extremo aminoterminal es la degradación de Edman: este método permite obtener secuencia completa de un péptido dado; consiste en el marcaje con fenilisotiocianato del residuo aminoterminal y de su hidrólisis del resto de la cadena peptídica sin alterar la constitución del resto de ésta; se elimina de manera secuencial y cíclica un residuo a la vez del extremo aminoterminal, lo que permite identificar cada aminoácido de la secuencia, empezando por el extremo amino. El fenilisotiocianato reacciona con el grupo aminoterminal no cargado del péptido para formar un derivado feniltiocarbamilo; en condiciones ligeramente ácidas, se libera un derivado cíclico del aminoácido aminoterminal y deja intacto el resto del péptido; el derivado cíclico puede ser identificado por técnicas cromatográficas; la reacción se repite de nuevo sobre el péptido restante una y otra vez hasta completar, determinar la secuencia completa del péptido, o ambas cosas. Teóricamente el método de Edman debería permitir la secuenciación completa de una proteína, pero en la práctica no se pueden secuenciar más de 50 residuos de aminoácidos. Con base en esto, se desarrollaron otras metodologías para secuenciar proteínas, las cuales junto con la de Edman dan resultados favorables. Éstas consisten en la degradación parcial de las proteínas o péptidos de interés mediante métodos químicos o enzimáticos. La degradación de péptidos con bromuro de cianógeno sólo rompe enlaces peptídicos en el lado carboxilo de los residuos de metionina. La tripsina es una enzima proteolítica que rompe cadenas polipeptídicas en el lado carboxilo de la arginina o lisina. Los péptidos obtenidos mediante estos tipos de rompimiento son separados por algún método cromatográfico, y la secuencia de cada péptido purificado se determina por el método de Edman; el análisis de la secuencia se puede hacer por métodos computacionales utilizando una base de datos. NOTA: con la conclusión del Proyecto Genoma Humano y la secuenciación de genomas completos de varios organismos procariontes y eucariontes, no se ha descifrado ni descifrará la compleja biología de los seres vivos; tampoco se han alcanzado las expectativas que se tenían. La comunidad científica ha confirmado con mayor énfasis que las proteínas juegan papeles imprescindibles en todos los sistemas biológicos, por lo que ahora se ha hecho hincapié en el estudio de las proteínas. Esto ha dado lugar al resurgimiento con mayor fuerza de la ciencia de la proteómica que consiste en el estudio de

www.FreeLibros.me


Proteínas

las proteínas expresadas por los diferentes tipos celulares y organismos. El término proteoma se refiere a todas las proteínas expresadas por un genoma; por tanto, la proteómica incluye la identificación de proteínas así como su papel en las funciones fisiológicas y fisiopatológicas en un organismo dado. En teoría, los aproximadamente 30 000 genes definidos por el Proyecto Genoma Humano se traducen entre 300 000 y un millón de proteínas, si se considera el proceso de ajuste (corte y empalme) alternativo y las modificaciones postraduccionales. Un pequeño ejemplo de la importancia de la proteómica consiste en que ésta ha permitido identificar nuevos marcadores (proteínas) de enfermedades en el ser humano y se tiene la confianza que la identificación de éstos será útil para el diagnóstico temprano de enfermedades y el desarrollo de nuevos fármacos, por lo que el futuro de la biotecnología y la medicina será impactado grandemente por la proteómica, “el estudio de las proteínas”.

Preguntas 1. ¿Qué son las proteínas? Escriba una definición propia.

3. ¿Qué son los aminoácidos? Defina cuántos son, cuáles son los esenciales y los no esenciales; mencione tres de sus propiedades. 4. ¿Qué es el enlace peptídico? Escriba su definición. 5. ¿Cuáles son los niveles de organización de las proteínas? 6. Defina cada uno de los niveles de organización de las proteínas. 7. ¿Qué es la hélice α y la hoja plegada β? 8. ¿Cuáles son los tipos de fuerzas que definen la estructura terciaria de las proteínas? 9. Escriba por lo menos cinco métodos que se utilizan en el estudio de las proteínas. 10. ¿Qué método o métodos usaría para identificar el peso molecular y el punto isoeléctrico de una proteína dada, considerando que ya la purificó por cromatografía de afinidad? 11. Describa a manera de ensayo breve la importancia de las proteínas en los sistemas biológicos.

2. ¿Cuáles son las funciones de las proteínas? Defina y explique al menos cinco.

GLOSARIO Ion: átomo o agrupación de átomos que por pérdida o ganancia de uno o más electrones adquiere carga eléctrica.

Anión: ion cargado negativamente. Catión: ion cargado positivamente. Célula: unidad fundamental de los organismos vivos, por lo general de tamaño microscópico, capaz de reproducción independiente y formada por un citoplasma y un núcleo rodeados por una membrana. DNA: ácido desoxirribonucleico. Constituye el material genético de las células y contiene en su secuencia la información para la síntesis de proteínas. Enlace covalente: tipo de enlace que tiene lugar entre átomos al compartir pares de electrones. Enzima: proteína que cataliza específicamente cada una de las reacciones bioquímicas del metabolismo.

15

Molécula: unidad mínima de una sustancia que conserva sus propiedades químicas. Puede estar formada por átomos iguales o diferentes. Patógeno: microorganismo que tiene la capacidad de desarrollar o provocar una enfermedad o de producir daño en otro. Polipéptido: molécula formada por la unión covalente de dos o más aminoácidos. RNA: ácido ribonucleico. Según su función se divide en mensajero, ribosómico y de transferencia.

www.FreeLibros.me


16

Capítulo 1

Estructura molecular, función y métodos de estudio de las proteínas

BIBLIOGRAFÍA Berg JM, Tymoczko JL, Stryer L, Freeman WH. Protein structure and function; exploring proteins. En: Biochemistry. 5a. ed. New York: Freeman Press, 2002;17-45. Mathews CK, Van Holde KE, Ahern KG. Introduction to proteins: the primary level of protein structure. En: Cummings B (ed.). Biochemistry. 3a. ed. San Francisco, California, 1999;127-249.

Lehninger AL, Nelson DL, Cox MM. Aminoacids, peptides and proteins. En: Lehninger principles of biochemistry. 3a. ed. New York: Worth Publishers, 2000;111-197. Voet D, Voet JG. Biomolecules. En: Biochemistry. 2a. ed. New York: John Wiley & Sons, 1995;77-195.

Sitios web recomendados http://sebbm.bq.ub.es/BioROM/contenido/av_biomo/material. html http://sebbm.bq.ub.es/BioROM/contenido/av_biomo/Mat3b. html

http://prospector.ucsf.edu/ucsfhtml4.0/msdigest.htm http://www.expasy.ch/

www.FreeLibros.me


Capítulo

2

Composición y estructura de los ácidos nucleicos Dra. Mónica Elisa Ureña Guerrero

lares (composición y estructura) de los ácidos nucleicos, los cuales se han seleccionado para almacenar y codificar la información genética (genotipo), de manera que pueda ser traducida para determinar las características morfológicas y funcionales de cada individuo (fenotipo).

INTRODUCCIÓN El estudio de los seres vivos debe comenzarse con el conocimiento de los componentes moleculares que los estructuran: las biomoléculas o moléculas de la vida. Este tipo de moléculas se rige por las mismas leyes físicas y químicas que rigen a la materia inerte; sin embargo, su grado de complejidad y organización es propio de la materia viva. Las biomoléculas se componen principalmente de átomos de carbono (C), hidrógeno (H), oxígeno (O) y nitrógeno (N). Los átomos de carbono se unen entre sí a través de enlaces covalentes y forman cadenas o esqueletos moleculares de base, cuyas valencias libres pueden interactuar con H, O y N, o bien, con grupos funcionales o radicales formados por diferentes combinaciones de éstos. Así, dentro de los seres vivos, C, H, O y N, solos o en combinación con otros elementos, forman compuestos de bajo peso molecular (biomoléculas) como los monosacáridos, ácidos grasos, aminoácidos y nucleótidos, que constituyen los sillares monoméricos de macromoléculas (biopolímeros) como los polisacáridos, los lípidos, las proteínas y los ácidos nucleicos, respectivamente. Cada tipo de biomolécula y biopolímero se ha seleccionado, a través de miles de millones de años de evolución, para cumplir con un grupo de funciones específicas. Así, en esta sección se describen las características molecu-

COMPOSICIÓN DE LOS ÁCIDOS NUCLEICOS Todos los seres vivos (procariontes y eucariontes) cuentan con dos tipos de ácidos nucleicos, el ácido desoxiribonucleico (DNA) y el ácido ribonucleico (RNA), cada uno de ellos constituido por nucleótidos específicos. Cada nucleótido tiene tres componentes característicos: una base nitrogenada, un azúcar de 5 carbonos (pentosa) y al menos un fosfato (fig. 2-1). Las bases nitrogenadas son moléculas heterocíclicas, cuyos anillos moleculares están estructurados tanto por carbono como por nitrógeno. Derivan de dos tipos de compuestos conocidos como purina (estructura cíclica de nueve puntas, hexágono-pentágono fusionados) y pirimidina (estructura cíclica de seis puntas, hexagonal) (fig. 2-2). La adenina (A) y la guanina (G) son bases púricas comunes a ambos tipos de ácidos nucleicos, en tanto que la citosina (C) también está presente en ambos tipos de ácidos nucleicos; la timina (T) exclusiva 17

www.FreeLibros.me


18

Capítulo 2

Composición y estructura de los ácidos nucleicos

Base nitrogenada Fosfato

Pentosa Configuración planar

Figura 2-1

Representación esquemática de la composición y estructura de un nucleótido.

del DNA y el uracilo (U) exclusivo del RNA son bases pirimídicas (fig. 2-2). Las pentosas son monosacáridos de cinco carbonos que adquieren estructuras heterocíclicas tipo furano (β-furanosas), a través de la esterificación del oxígeno del grupo carbonilo aldehídico con el hidroxilo del último carbón asimétrico de la molécula (fig. 2-3). Los desoxiribonucleótidos del DNA contienen 2-desoxi-D-ribosa, en tanto que los ribonucleótidos del RNA contienen

PURINAS

PIRIMIDINAS

Heterociclo de 9 puntas

Heterociclo de 6 puntas

Adenina

Timina

Figura 2-3

Configuración tipo furano

Adquisición de la configuración tipo furano de la ribosa. En la configuración planar, aparecen en gris los grupos funcionales que intervienen en esta transformación.

D-ribosa (fig. 2-4). Tanto los anillos heterocíclicos de las bases nitrogenadas como los de las pentosas se enumeran según la convención internacional para purina, pirimidina y furano; sin embargo, para hacer la distinción, los números de la pentosa se designan como primos (1′-5′) (fig. 2-5). Cada base nitrogenada se une covalentemente a la pentosa para formar un nucleósido (denominados adenosina, guanosina, timidina, citidina y uridina, respectivamente), a través de una unión N-β-glucosil (N-9 de las purinas y N-1 de las pirimidinas) al carbono 1′ de la pentosa. Este tipo de unión se forma al quitar un grupo hidroxilo de la pentosa y un hidrógeno de la base, con la consecuente formación de una molécula de agua y un enlace O-glucosídico (fig. 2-6).

Citosina

Ribosa

Guanina

Figura 2-2

Uracilo

Estructura de las bases nitrogenadas de los ácidos nucleicos. Las zonas sombreadas corresponden a los átomos que intervienen en la unión de cada base nitrogenada con la pentosa, los cuales corresponden al N9 de las purinas y al N1 de las pirimidinas.

2-desoxirribosa

Figura 2-4

www.FreeLibros.me

Comparación estructural de la ribosa y la 2-desoxirribosa.


Descubrimiento de los ácidos nucleicos

19

Adenina (base pirimídica)

Timina (base púrica)

Monofosfato de adenosina (AMP)

Ribosa

Figura 2-5

Orden numeral de los átomos de las bases nitrogenadas y las ribosas.

Difosfato de adenosina (ADP)

El fosfato se esterifica al carbono 5′ de la pentosa (fig. 2-6) y permanece como un radical que puede interactuar con otros grupos fosfato, dando lugar a nucleótidos monofosfatados, difosfatados y trifosfatados (fig. 2-7),

Trifosfato de adenosina (ATP)

Figura 2-7

Monofosfato de adenosina (AMP)

Monofosfato de citidina (CMP)

Estructura representativa de los nucleótidos monofosfatados, difosfatados y trifosfatados tomando como base a la adenosina.

pero también puede unirse a otro nucleótido para dar origen a las cadenas de ácidos nucleicos, a través del enlace 3′-5′-fosfodiéster (fig. 2-8).

DESCUBRIMIENTO DE LOS ÁCIDOS NUCLEICOS

Monofosfato de guanosina (GMP)

Figura 2-6

Monofosfato de timidina (TMP)

Estructura y composición de los ribonucleótidos. Obsérvese que el azúcar que se representa es la ribosa y las moléculas aparecen monofosfatadas.

El estudio de los ácidos nucleicos se inició con los trabajos iniciales de Johan Friedrich Miescher, quien en 1869 logró aislar el contenido nuclear. Miescher observó que se trataba de una sustancia ácida, rica en fósforo, compuesta por moléculas grandes, a la que llamó “nucleína”. Propuso que la nucleína podría ser “una forma de almacenar fósforo dentro de la célula o que tal vez pudiera estar implicada en la herencia”. En 1885, Oscar Harting propuso que la nucleína era la sustancia encargada no sólo de la fecundación, sino también de la transmisión de las características hereditarias; sin embargo, esta idea no

www.FreeLibros.me


20

Capítulo 2

Fosfato

Composición y estructura de los ácidos nucleicos

Base púrica

Cronología del descubrimiento de la composición química de los ácidos nucleicos

Cuadro 2-1 Año 1874

Se descubre la presencia de bases púricas en los ácidos nucleicos. Piccard aísla ácidos nucleicos del guano de las aves e identifica la presencia de guanina e hipoxantina (un derivado de la adenina) en los mismos.

1879

Kossel1 obtiene xantina e hipoxantina del contenido nuclear de levaduras, confirmando las observaciones de Piccard.

18851886

Kossel logra identificar la presencia de adenina en los ácidos nucleicos y demuestra su conversión a hipoxantina.

1891

Kossel identifica la presencia de algún azúcar reductor dentro de los ácidos nucleicos.

1894

Hammarsten establece que el azúcar reductor descrito por Kossel es una pentosa.

18931894

Kossel y Neumann extraen ácidos nucleicos de timo e identifican una nueva base nitrogenada a la que denominaron timina.

19001901

Ascoli logra separar y purificar la molécula de uracilo.

1902

Kossel, Steudel y Levene2 identifican y purifican a la citosina.

Unión fosfodiéster Base pirimídica

Figura 2-8

Cadena de desoxirribonucleótidos donde se muestra la estructura del enlace 3´-5´fosfodiéster, el cual se señala dentro de la zona sombreada.

sería comprobada experimentalmente, sino hasta 1944 por el grupo de Oswald Avery. La nucleína de Meischer era en realidad una mezcla de ácido desoxirribonucleico (DNA), ácido ribonucleico (RNA) y proteínas coexistentes de manera estrecha a ambos ácidos. Sin embargo, hacia 1889, el grupo de Meischer logró purificar por completo la nucleína, eliminando totalmente a las proteínas; fue entonces cuando Richard Altmann introdujo el término “ácido nucleico” para referirse a ese extracto purificado libre de proteínas. Así, durante los últimos años del siglo XIX, los estudios sobre el contenido nuclear se enfocaron en el análisis e identificación de cada uno de los componentes de los ácidos nucleicos, hechos históricos que se resumen en el cuadro 2-1. A principios del siglo pasado, ya con los componentes de los ácidos nucleicos aislados, se dieron los primeros pasos hacia el entendimiento de la estructura de los mismos. Así, entre 1900 y 1915, Phoebus Levene demostró que el DNA estaba formado por cuatro tipos diferentes de nucleótidos y que cada uno poseía una desoxirribosa, un fosfato y una base nitrogenada: A, T, G o C. Después, hacia finales del decenio de 1930, Levene logró establecer las diferencias entre DNA y RNA y propuso que los nucleótidos estaban unidos entre sí por enlaces fosfodiéster que formaban cadenas polinucleotídicas. Sin embargo, Levene planteó un modelo erróneo para la estructura de los ácidos nucleicos, según el cual los nucleótidos se repetían uniformemente en series de cuatro, a manera de unidad tetranucleotídica, de modo particular para cada

Acontecimiento histórico

1 Albrecht Karl Ludwig Martin Leonard Kossel, quien dedicó más de 15 años de su vida académico-científica al estudio de la química de los ácidos nucleicos, recibió el premio Nobel en 1910, por sus contribuciones al conocimiento de la química de la célula. 2 Phoebus Aaron Theodor Levene, discípulo de Kossel, publicó alrededor de 700 trabajos sobre la composición química de la célula.

ácido nucleico. Esta condición impediría la variación genética, por lo que durante varios años el estudio del origen del material genético se orientó hacia las proteínas. Fueron entonces de gran importancia los trabajos de Frederick Griffith (en el decenio de 1920), quien propuso que entre las diferentes cepas de Streptococcus pneumoniae existía un “factor transformante” de origen molecular que podía pasar de un individuo a otro. A principios del decenio de 1940, Avery, McLeod y McCarty lograron identificar la naturaleza química del factor transformante de S. pneumoniae y establecer que se trataba de los ácidos nucleicos. Además de esto, Delbrück, Luria, Hershey y Chase, a través del estudio de los bacteriófagos, demostraron en 1948 que la información genética estaba contenida en el DNA. Por ello, a partir de ese momento, el interés en establecer un modelo sobre la estructura del DNA, que pudiera explicar las bases de la transmisión de la información genética, se intensificó de manera significativa.

www.FreeLibros.me


Ácido desoxirribonucleico

ÁCIDO DESOXIRRIBONUCLEICO Estructura secundaria del DNA. La doble hélice Después de conocer el trabajo de Avery, publicado en 1944, Erwin Chargaff se interesó en el estudio de los ácidos nucleicos, y mediante técnicas cromatográficas analizó el DNA de varios tipos celulares, logrando establecer que la cantidad de adeninas era similar a la de timinas ([A] = [T]), y la de guaninas a la de citosinas ([G] = [C]), proponiendo que en el DNA existe la misma cantidad de bases púricas y pirimídicas ([purinas] = [pirimidinas]) (fig. 2-9). Estas observaciones se dieron a conocer en 1951 y originaron lo que algunos autores refieren como “leyes de equivalencia de las bases nitrogenadas”. Chargaff también observó que la composición de bases nitrogenadas en el DNA variaba entre especies, pero se mantenía constante en una misma especie, independientemente de la edad o del estado nutricional. Las observaciones de Chargaff pusieron de manifiesto, además de la complementariedad entre bases púricas y pirimídicas, la posibilidad de una estructura de doble hélice para el DNA.

Par adenina-timina

Par guanina-citosina

Figura 2-9

Complementariedad entre las bases nitrogenadas que conforman el DNA, a través de puentes de hidrógeno, los cuales se señalan dentro de la zona sombreada.

21

Por otro lado, Rosalind Franklin y Maurice Wilkins, a través de la cristalografía de rayos X, describieron a principios del decenio de 1950 que el DNA generaba una imagen helicoidal de doble hélice, con una estructura extendida, ordenada y constante, que poseía un diámetro de 20 Å (2 nm) y donde las bases nitrogenadas se encontraban apiladas en planos cuya separación era de 3.4 Å (0.34 nm). Así, al analizar las evidencias químicas y físicas sobre la composición y estructura del DNA, James Watson y Francis Crick propusieron, en 1953, el modelo de la “doble hélice” (www.nature.com/nature/dna50/watsoncrick.pdf), según el cual el DNA está formado por dos cadenas helicoidales, que giran alrededor del mismo eje en sentido dextrógiro, y con sus átomos orientados en sentido inverso, es decir, las cadenas son antiparalelas. En este modelo, la β-D-desoxirribosa de un nucleótido se une a la del contiguo, a través de un enlace 3′-5′-fosfodiéster. En la parte externa de la hélice, se alternan fosfatos y desoxirribosas, en tanto que las bases se proyectan perpendicularmente hacia el interior de la doble hélice. Cada 3.4 Å (0.34 nm) se presenta un residuo nucleotídico, el cual se desplaza cerca de 36° en relación con el anterior, lo que hace posible que cada 10 pares de bases (pb) generen una vuelta (360°) (fig. 2-10), en tanto que la distancia del fosfato al eje longitudinal de la fibra de DNA es de 10 Å (1 nm). Los giros de las hebras del DNA no son simétricos a un solo eje; existe una proyección de los giros, que da origen a huecos asimétricos entre cada vuelta y que, por sus dimensiones, se denominaron hueco mayor y hueco menor (22 y 12 Å de ancho, respectivamente) (fig. 2-10). Dado que en este modelo los fosfatos se encuentran por fuera de la doble hélice, los cationes y las moléculas polares, como el agua, pueden acceder con facilidad a ella, por lo que Watson y Crick propusieron que un menor contenido de agua podría ocasionar que la estructura se compactara. Para 1953, Freiser y Furberg ya habían propuesto que los fosfatos se hallaban en la parte externa de la molécula. No obstante, Freiser proponía un modelo de triple hélice, tal y como lo hicieron en su momento Pauling y Corey, ambos erróneos. Además de que el modelo de Watson y Crick era diferente a los propuestos con anterioridad, incluía la propuesta novedosa de que las cadenas de la doble hélice se mantienen unidas a través de puentes de hidrógeno que se establecen entre la purina de una hebra y la pirimidina de la otra. El modelo supone que las bases nitrogenadas dentro del DNA se encuentran en su configuración tautomérica más estable (grupo ceto) y propone apareamientos específicos adenina-timina (A-T) y guanina-citosina (G-C), tal y como sugirió Chargaff en sus estudios. Dentro de las restricciones estructurales, Watson y Crick indican en su descripción que la pentosa debe posicionarse de modo perpendicular a las bases nitrogenadas y que los puentes de hidrógeno que se forman entre las bases nitrogenadas de las dos hebras deben ser también rigurosamente perpendiculares al eje longitu-

www.FreeLibros.me


22

Capítulo 2

Composición y estructura de los ácidos nucleicos

Hueco mayor

Hueco menor

Detalle de antiparalelismo y complementariedad de las hebras

Dimensiones de la doble hélice

Figura 2-10

Conformación de doble hélice del DNA, según el modelo de Watson y Crick. En la parte izquierda, se muestra la estructura planar, en tanto que en la derecha se representa la doble hélice.

dinal de la doble hélice. Además, la estructura que ellos describen sólo puede formarse si la pentosa es una 2-desoxirribosa, ya que el oxígeno de la posición 2 del azúcar generaría fuerzas de van der Waals más estrechas. En el modelo de doble hélice, se propuso de manera errónea que el apareamiento de bases era a través de dos puentes de hidrógeno tanto para A-T como para G-C. Hoy en día se conoce que la A interactúa con la T precisamente a través de dos puentes de hidrógeno, pero la interacción G-C es más fuerte, ya que puede establecer

hasta tres puentes de hidrógeno (fig. 2-9). Visionariamente, Watson y Crick propusieron que la complementariedad entre bases podría ser el mecanismo de copiado y duplicación del material genético, hecho que se revisa con detalle en el capítulo de replicación del DNA.

Formas alternativas de la doble hélice Tal y como emitieron la hipótesis Watson y Crick, la hidratación de los cristales de DNA y el contenido de

www.FreeLibros.me


Ácido desoxirribonucleico

sales en los mismos modifica significativamente la laxitud de la doble hélice, originando las formas A-E del DNA, todas ellas en configuración de doble hélice dextrógira. Los procesos de deshidratación cercanos a 30% originan la forma A del DNA (A-DNA), en tanto que la forma B del DNA (B-DNA) se presenta a través de un proceso de deshidratación menor a 10% y utilizando sodio como contraión para favorecer la cristalización. Las formas C-E del DNA se obtienen a través de procesos de cristalización en presencia de algún contraión (metales o poliaminas) con niveles intermedios de deshidratación, entre las formas A y B. Las características estructurales descritas en el modelo de la doble hélice se acercan a las del B-DNA, por lo que con base en esta configuración se hacen las comparaciones de las demás formas (fig. 2-11). Según las características de humedad en que se origina, se considera que el B-DNA es la forma en que se presenta la mayor parte del DNA dentro de las células, en tanto que el A-DNA puede presentarse de manera momentánea, cuando se estructuran híbridos DNA-RNA durante la transcripción o en zonas de interacción del DNA con algunas proteínas. El A-DNA es una doble hélice dextrógira más ancha, más estrecha y más corta que el B-DNA; característicamente tiene cerca de 11 pb por vuelta completa, en lugar de las 10 que tiene el B-DNA. Además, el A-DNA tiene un hueco mayor mucho más profundo y menos diferente en amplitud al hueco menor que en el B-DNA (fig. 2-11). Se cree que las formas C-E sólo se presentan in vitro. Por otro lado, el contenido de bases también puede modificar las características de la doble hélice. Así, en 1979, se describió la conformación de un DNA con una secuencia alternada de C y G, caracterizada por girar hacia la izquierda cada 12 pb, con sus bases más expuestas hacia el exterior que en el B-DNA, y con huecos reducidos y prácticamente simétricos, que semejaban una imagen de zig-zag, por lo que a esta forma se le conoce como Z-DNA (fig. 2-11). En la actualidad se conoce que cualquier secuencia alternante de purinas y pirimidinas puede dar origen al Z-DNA y que esta forma se favorece por metilación de las bases nitrogenadas, lo cual establece un mecanismo de regulación dentro de las células para la adquisición de la forma Z. Tal mecanismo es relevante, pues se ha demostrado que las zonas del DNA que se encuentran en configuración Z son sitio de interacción de varias proteínas durante la transcripción. En este sentido, también se conoce que el Z-DNA es una forma inestable que puede transformarse en B-DNA fácilmente. Otras configuraciones del DNA se relacionan con el superenrollamiento de la doble hélice, fenómeno que biológicamente puede ser inducido por un grupo de enzimas conocidas como topoisomerasas para favorecer la compactación del DNA (disminución de su longitud) o por la abertura intermedia de la doble hélice en los extre-

Figura 2-11

23

Esquema representativo de algunas configuraciones de la doble hélice de DNA.

mos de avance de la abertura, durante los procesos de replicación y transcripción del DNA. Así, la forma P del DNA (P-DNA) es una forma superenrollada de la doble hélice, cuya periodicidad de giro se da cada 2.6 pb, por lo que es mucho más delgada y alrededor de 75% más larga que el B-DNA. Este superenrollamiento obliga a las bases nitrogenadas a quedar completamente expuestas hacia el exterior de la hélice, lo que rompe los puentes de hidrógeno intrahelicoidales y deja a las bases nitrogenadas relativamente libres. Además de la posibilidad de que el P-DNA se presente de manera transitoria durante la replicación y la transcripción, se ha observado que, en algunos bacteriófagos, el DNA adquiere esta configuración, estabilizándose a través de proteínas de empaquetamiento. Estas evidencias modifican significativamente la imagen rígida, estable y constante descrita por Watson y Crick para el DNA, dándole vida al concebirlo como una molécula dinámica, dependiente de la secuencia de bases nitrogenadas que lo componen y sensible a los diferentes factores químicos y físicos a que se encuentra expuesto, sea en el interior celular o fuera de él.

Conformaciones de hebra sencilla, de triple y cuádruple hebra para el DNA Porciones del DNA con secuencias de polipirimidinas (poli-Pi) complementarias a secuencias de polipurinas (poli-Pu), que se someten a un superenrollamiento negativo (levógiro) o a un pH bajo, dan origen a la estructu-

www.FreeLibros.me


24

Capítulo 2

Figura 2-12

Composición y estructura de los ácidos nucleicos

Representación esquemática del H-DNA.

ra denominada H-DNA (H, del término en inglés hinged o embisagrado) (fig. 2-12). La doble hélice se destuerce en una porción poli-Pi/poli-Pu y la secuencia de poli-Pi interactúa con otra porción poli-Pi/poli-Pu, generando una triple hélice dextrógira de secuencias poli-Pi/poliPu/poli-Pi, al mismo tiempo que una porción de poli-Pu permanece en conformación hebra sencilla, en tanto que las secuencias restantes del DNA permanecen en estructura doble hélice, por lo que la porción triple funciona como una bisagra de interacción entre dos porciones de doble hebra. Una configuración previa a la formación del H-DNA es la forma S del DNA que es una forma superenrollada en sentido negativo y muy extendida de la doble hélice. Las secuencias poli-Pi/poli-Pu son comunes, y en el genoma humano se presentan cada 140-150 kb (mil pares de bases). Además, se ha observado que las regiones con probabilidades de adquirir la configuración del H-DNA participan en la recombinación, transfección y regulación de algunos genes. Por otro lado, en las regiones teloméricas de los cromosomas de vertebrados hay repeticiones de la secuencia TTAGGG, que alcanzan longitudes de entre 5 y 8 kb, con una porción de 100 a 200 bases en configuración de hebra sencilla hacia el extremo 3′, las cuales se repliegan dando origen a una estructura terminal cuádruple, también conocida como G-DNA (fig. 2-13). Las repeticiones de las secuencias son agregadas por un grupo de enzimas, conocidas como telomerasas, durante la replicación del DNA, como un mecanismo para garantizar que no se pierda la información de las últimas bases que se encuentran en el extremo 3′ durante la síntesis de la hebra retardada (véase capítulo de replicación). La presencia de estas

secuencias está asociada con la regulación de la tasa replicativa y se ha relacionado de diferentes formas con la proliferación de células tumorales. En relación con el DNA de una sola hebra, además de encontrarlo de manera momentánea en células eucariontes cuando se forma la configuración H-DNA, también se puede hallar en virus, cuyo material genético está representado precisamente por una hebra sencilla de DNA; en estos casos, la molécula es estabilizada a través de su interacción con proteínas durante el empaquetamiento y conformación del virus mismo, tal y como sucede en algunos fagos.

DNA circular Clásicamente, esta conformación de DNA es característica del DNA plasmídico y celular de procariontes, de virus y de algunos organelos intracelulares de células eucariontes, como es el caso de las mitocondrias y los cloroplastos. De manera sencilla, se podría pensar que es sólo una doble hélice de DNA que tiene sus extremos cerrados, pero, desde su descubrimiento en 1963, se ha observado que a diferencia del modelo de la doble hélice, en el DNA circular predomina la configuración levógira; que su desnaturalización es más complicada que la de moléculas lineales, condición que ha llevado a proponer que la estructura del DNA circular es regulada por interacciones extrínsecas a la molécula o diferentes a la complementariedad de bases, que ejercen una fuerza cooperativa para evitar la desnaturalización. En este sentido, modelos recientes proponen un DNA circular con las hebras en configuración casi planar (fig. 2-14), debido a la alternan-

www.FreeLibros.me


Ácido desoxirribonucleico

Compactación del DNA

Repeticiones teloméricas GGGTTA

Conformación cuádruple hebra

Figura 2-13

Modelaje de la adquisición de estructura GDNA para la repetición de bases consenso de la región telomérica de los cromosomas eucariontes.

cia de porciones en configuración levógira y en configuración dextrógira, en proporción 1:1. Sin embargo, debe recordarse que al menos en el DNA lineal ya se ha demostrado que la transición de una configuración a otra es un proceso rápido.

A

Figura 2-14

25

Según el modelo de la doble hélice, un genoma representado por un poco más de 3 000 millones de pares de bases, como el humano, tendría una longitud de un poco más de 1 m, siendo mucho más largo que la célula que los contiene, las cuales en promedio tienen un diámetro de entre 10 y 100 µm. Sin embargo, las células han desarrollado mecanismos para compactar el DNA, es decir, para acortar su longitud. Hay dos mecanismos fundamentales para compactar el material genético dentro de las células: el primero consiste en superenrollar la doble hélice; es decir, a través de nuevos giros inducir el repliegue de la molécula para disminuir su longitud; esto se conoce como compactación plectonémica (fig. 2-15); el segundo consiste en enredar la molécula de DNA sobre estructuras proteínicas, mecanismo conocido como compactación toroidal (fig. 2-16). En general, se puede considerar que en organismos procariontes predomina la compactación plectonémica, y en eucariontes la compactación toroidal, aunque ambas formas pueden presentarse parcialmente en ambos tipos de organismos. Como se mencionó, el superenrollamiento del DNA es regulado por un grupo de enzimas denominadas topoisomerasas, de las cuales se han descrito dos tipos. Las de tipo I cortan sólo una de las dos hebras del DNA, lo que permite el relajamiento progresivo de hélices superenrolladas, después de lo cual vuelven a ligar la hebra. Este es un proceso energéticamente espontáneo después del corte, por lo que no se requiere energía para realizarlo. Las de

B

C

Representación esquemática de las posibles conformaciones del DNA circular. A, DNA circular en conformación doble hélice dextrógira. B, DNA circular con la porción superior en conformación doble hélice dextrógira y la parte inferior en conformación doble hélice levógira. C, DNA circular con porciones alternadas de conformaciones doble hélice dextrógira y levógira.

www.FreeLibros.me


26

Capítulo 2

Composición y estructura de los ácidos nucleicos

A

Figura 2-15

C

B

Compactación del DNA circular. A, molécula de DNA circular relajada. B, molécula de DNA circular compactada por superenrollamiento. C, representación de un nucleoide bacteriano compactado por superenrollamiento y con su estructura estabilizada a través de proteínas representadas por las esferas.

tipo II cortan ambas hebras; las mantienen estabilizadas y son capaces de inducir giros con intencionalidad al lado derecho (diestra) o al lado izquierdo (siniestra), aunque éstos no sean energéticamente favorecidos, condición por la cual son enzimas que requieren de la hidrólisis de ATP para poder llevar a cabo su función. Una variante de las topoisomerasas II lo constituyen las girasas, propias de procariontes y, que además de torcer la doble hebra, pueden cambiar de posición las hebras sencillas, permitiendo la separación o el engarzamiento de los DNA circulares durante la replicación. El genoma de las bacterias suele estar representado por una molécula de DNA circular. Sin embargo, en algunas de ellas se han identificado hasta dos moléculas de DNA circular, además de algunos DNA plasmídicos mucho más pequeños que también se encuentran en conformación circular. Las moléculas de DNA circular de la mayoría de las bacterias deben compactar su longitud en unas 1 000 veces para conformar lo que se conoce como nucleoide bacteriano. Esta estructura se compone en la mayoría de los casos de DNA circular con superenrollamiento siniestroso y asociado a proteínas de compactación tipo histona (véase más adelante) que acortan su longitud estabilizando sus dobleces (fig. 2-15). En el nucleoide bacteriano de E. coli, posiblemente el mejor conocido, se ha observado que el acortamiento de la molécula de DNA está dado por compactación plectonémica y toroidal en casi 50% para ambas. Sin embargo, la compactación toroidal que se presenta en bacterias es radicalmente diferente a la de eucariontes, ya que no origina estructuras regulares como los nucleosomas (véase más adelante). En eucariontes, el genoma está representado por varias moléculas lineales de DNA, cada una de las cuales llega a conformar un cromosoma (máximo nivel de compactación). Es probable que tanto en bacterias como en

eucariontes la compactación del DNA esté regulada por el ciclo celular; sin embargo, el aspecto de los cromosomas hace mucho más evidente esta regulación en los cromosomas eucariontes, cuya estructura se pone de manifiesto de modo visual durante la división celular, en tanto que durante la interfase el material genético se encuentra, por decirlo de alguna manera, irregularmente distribuido dentro del núcleo celular. En eucariontes, el DNA se halla de manera constante interactuando con proteínas, formando un complejo al que se le conoce desde el siglo antepasado como cromatina, por su aspecto colorido con tinciones a base de anilinas para microscopio compuesto. Así, a la observación microscópica del núcleo, se hallan zonas densas y claras, donde podría encontrarse DNA más compactado y menos compactado, también conocidos como heterocromatina y eucromatina, respectivamente. El grado de compactación del DNA limita su expresión, por lo que para que porciones de DNA se repliquen o se transcriban, deben descompactarse, lo cual sugiere que las zonas de eucromatina incluyen porciones de DNA que se están expresando, en tanto que las porciones de heterocromatina no lo hacen. Es importante considerar que a lo largo del ciclo celular las porciones de DNA que se encuentran en forma de eucromatina pueden variar. Hay dos tipos generales de proteínas que intervienen en la compactación del DNA eucariótico las de tipo histona y las tipo de no histona. Las histonas son un grupo de proteínas globulares básicas con peso molecular medianamente bajo (de 11 a 24 kilodaltones, kD). Tienen un alto contenido de aminoácidos básicos cargados positivamente, como la histidina, la arginina (Arg) y la lisina (Lys). De manera característica, las diferencias en el contenido de Arg y Lys, así como en su peso molecular, generan diferencias en la distancia que recorren en una electroforesis, parámetros que permitieron establecer la

www.FreeLibros.me


Ácido ribonucleico

existencia de cinco histonas diferentes, conocidas como: H1 (24 kD), H2A (14 kD), H2B (14 kD), H3 (15 kD) y H4 (11 kD). Dos moléculas de cada una de las proteínas H2-H4 forman un octámero, alrededor del cual cerca de 140 pb de la doble hélice del DNA da dos vueltas, formando un complejo conocido como nucleosoma (fig. 2-16), el cual se repite a todo lo largo de la molécula generando una imagen de rosario de cuentas (fig. 2-17), donde los nucleosomas o cuentas están separados entre sí por segmentos de DNA de casi 60 pb. El diámetro aproximado de la fibra de nucleosomas es cinco veces mayor que el diámetro de la doble hélice, esto es, 10 nm. Entre nucleosoma y nucleosoma, en el segmento de 60 pb, se intercala una molécula de H1; a lo largo de la fibra de nucleosomas, las H1 interactúan obligando a la fibra a girar, formando una espiral de nucleosomas conocida como fibra solenoide de unos 30 nm de diámetro, la cual se pliega sobre sí misma, formando primero una espiral del solenoide y luego un grupo de bucles de la espiral de solenoide (300 nm de diámetro) que se estructuran sobre proteínas fibrilares no histona que determinan la forma de los cromosomas (fig. 2-17). Además, en esta

DNA

Histonas nucleosómicas (H2A, H2B, H3, H4)2

Histona internucleosómica (H1)

Figura 2-16

Conformación de los nucleosomas.

27

fase interviene la topoisomerasa II, la cual determina la formación de los bucles y el montaje de los mismos sobre la estructura fibrilar del esqueleto cromosómico. Durante la interfase, la mayor parte del DNA sólo se encuentra parcialmente compactada como fibra de nucleosomas y en algunas porciones como fibra solenoide, por lo que como parte de los mecanismos de expresión génica se incluye la descompactación del DNA, los cuales pueden ser inducidos in vitro por cambios de temperatura o pH, e in vivo por modificaciones bioquímicas de las histonas (acetilación, fosforilación y metilación) o del mismo DNA (interacción competitiva con otras proteínas).

ÁCIDO RIBONUCLEICO Después de la identificación del DNA como la molécula donde se almacena la información genética y de conocer las propiedades que determinaban su estructura, se hizo evidente la necesidad de identificar los mecanismos a través de los cuales la información contenida en el DNA se expresa en moléculas funcionales que determinan el fenotipo celular. En este sentido, originalmente se acuñó el término gen para referirse a la secuencia de nucleótidos de DNA que determinaba la secuencia de aminoácidos de una proteína. Sin embargo, en la actualidad el concepto de gen se aplica a las secuencias de nucleótidos de DNA que determinan la secuencia de moléculas funcionales, incluidas las moléculas de RNA y las proteínas. En este sentido, Francis Crick, a principios del decenio de 1960, propuso que entre el DNA y las proteínas debería haber alguna molécula adaptadora, lo que enfocó la atención en el RNA, pues con base en el principio de complementariedad de bases, la síntesis de un RNA copiado de una región génica del DNA parecía sencilla. Así, se originó una secuencia de hechos relacionados con expresión de la información genética, que incluía la duplicación del DNA (replicación), la síntesis de RNA a partir de DNA (transcripción) y la síntesis de proteínas a partir de RNA (traducción). La secuencia y direccionalidad de los hechos se conocieron durante varios años como el “dogma central” de la biología molecular. Al cabo de los años, se ha descrito que la direccionalidad puede invertirse en algunos de los sucesos, tal y como ocurre en la retrotranscripción, proceso a través del cual se sintetiza DNA tomando como molde una molécula de RNA. Las moléculas de RNA son polirribonucleótidos de hebra sencilla en dirección 5′-3′, las cuales pueden encontrarse en conformaciones lineales, o en conformaciones cerradas con tallos y bucles, cuando intrínsecamente algunas porciones de las moléculas pueden establecer complementariedad de bases. De manera característica, las bases nitrogenadas que componen al RNA (A, G, C y U) establecen apareamientos similares a los del DNA, es

www.FreeLibros.me


28

Capítulo 2

Composición y estructura de los ácidos nucleicos

Cromosoma (1 400 nm)

Figura 2-17

Espiral de bucles del solenoide (700 nm)

Bucles del solenoide (300 nm)

Fibra solenoide (30 nm)

Fibra de nucleosomas (10 nm)

DNA (2 nm)

Compactación del DNA lineal. La imagen muestra desde el nivel máximo de compactación hasta la doble hélice y, en cada nivel, dentro del paréntesis, se citan las dimensiones del ancho de cada estructura.

decir, G con C y A con U. La presencia del OH en la posición 2′ de la ribosa de los ribonucleótidos le proporciona a las hebras de RNA mayor laxitud si se comparan con las hebras de DNA. Los tres tipos principales de RNA, que se encuentran tanto en organismos eucariontes como procariontes, se definen según su participación en la síntesis de proteínas como: RNA mensajero (RNAm), RNA de transferencia (RNAt) y RNA ribosómico (RNAr). Además, en eucariontes se ha descrito la existencia de los RNA nucleares pequeños (RNAnp), nucleolares (RNAnop) y citoplásmicos (RNAcp). En virus, algunos genomas están conformados por RNA de una o dos hebras, en tanto que algunos RNA con porciones en conformación de doble hebra, al ser catalizados por la endonucleasa conocida como Dicer, originan un RNA de doble hebra pequeño, al que se le ha dado la categoría de interferente (RNAi), debido a que interfiere con la expresión de algunos genes. Por otro lado, los RNA con capacidad catalítica, conocidos como ribozimas, existen tanto en virus como en eucariontes y procariontes. Son pequeñas enzimas de RNA con sitios de reconocimiento específicos, pero menos eficientes que las enzimas proteínicas; de hecho, muchas ribozimas ejercen su actividad catalítica sólo una vez y después pierden estabilidad y se degradan. Las ribozimas existen tanto en eucariontes como en procariontes y virus; muchas de ellas son secuencias intrónicas (véase más adelante) de algún RNA, otras son estructuralmente especializadas e incluidas en complejos supramacromoleculares mayores.

Los diferentes estudios filogenéticos y moleculares de los RNA han permitido establecer que su existencia data de alrededor de 3.8 mil millones de años, lo cual los ubica como la molécula con capacidad catalítica y de almacenamiento de información genética más antigua, precediendo al DNA. En este sentido, toma importancia la capacidad catalítica autorreplicativa, la cual ha sido demostrada para moléculas muy similares a los RNA actuales. A continuación se describen las características generales de los tres tipos principales de RNA (fig. 2-18).

RNA mensajero Como su nombre lo indica, este tipo de RNA es el encargado de determinar la secuencia de aminoácidos que compondrán la proteína, a través de un código donde cada tres nucleótidos (codón) de RNAm codifican para un aminoácido en la proteína (véase código genético). Según esto, cada RNAm tiene una composición particular de nucleótidos, la cual estará en correspondencia con la proteína que codifican. La conformación de los RNAm en todos los casos es lineal de hebra sencilla, con dirección 5′-3′. Los RNAm de procariontes son policistrónicos, es decir, codifican para la secuencia de aminoácidos de más de una proteína; se transcriben y traducen de manera simultánea, por lo que estructuralmente, en el extremo 5′, tienen un nucleótido trifosfatado y en el extremo 3′ el último nucleótido codificante. Entre la secuencia de codones que determina una proteína y la siguiente hay una secuencia de polipurinas (secuencia de Shine-Dalgar-

www.FreeLibros.me


Ácido ribonucleico RNAm

29

RNAr (16S)

5´-7-mG

Poli-A-3´

RNAt (forma de L) 5´

Aminoácido

Región anticodón

Figura 2-18

Comparación estructural de los RNA mensajero, de transferencia y ribosómico.

no), flanqueada por los codones de paro y de inicio (véase código genético). Algunos RNAm procarióticos poseen secuencias intercistrónicas variables, pero la mayoría carece de ellas. La traducción simultánea de estos RNAm hace que la vida media de éstos sea de hasta alrededor de 5 min, tiempo relativamente largo, considerando que por su longitud estos RNAm tenderían a degradarse rápido. En eucariontes, los RNAm son monocistrónicos, pues codifican para una sola proteína, se sintetizan en el interior del núcleo celular y son transportados a través del complejo de poro nuclear hacia el citoplasma donde son traducidos. Inmediatamente después de su transcripción, los RNAm son más largos que cuando son traducidos en el citoplasma; esto se debe a que luego de su síntesis pueden eliminarse de manera alternativa algunas porciones, las cuales reciben el nombre de intrones, en tanto que las porciones que permanecen se ajustan también de modo alternativo, pudiendo originar, a partir de un mismo preRNAm, varios RNAm maduros, en un proceso que puede ser regulado por diferentes señales celulares (véase capítulo de transcripción) y donde se requiere la intervención de varios RNAnp. Además de la eliminación alternativa de intrones, el extremo 5′ se modifica, agregándole un residuo de 7-metilguanosina (cap de 7-mG), en tanto que al extremo 3′ se le adiciona una cadena de poliadeninas (cola poli A) de longitud variable con hasta 200 residuos (fig. 2-18). La presencia de cap de 7 mG es determinante para la interacción de los RNAm con los ribosomas, sobre todo durante la formación del complejo de inicio con la subunidad menor, en tanto que la cola poli A le proporciona estabilidad prolongando la vida media de los RNAm, la cual puede llegar a ser de horas.

RNA de transferencia El RNAt es prácticamente la molécula traductora de la síntesis de proteínas, es decir, es el encargado de reconocer el código que se encuentra en el RNAm y según eso proporcionar el aminoácido correspondiente. Desde el punto de vista estructural, con menos de 100 nucleótidos, los RNAt son la variante más pequeña de este ácido nucleico. En un estado de relajación molecular completa, poseen una conformación de hoja de trébol, originada por porciones de tallo y bucles, con tres brazos que dan vuelta y un tallo donde se ubican ambos extremos, 5′ y 3′. El extremo 3′ es la posición donde se une covalentemente el aminoácido que será transferido a la proteína durante su síntesis. Cuando el aminoácido ya se ha agregado, entonces la molécula se conoce como aminoacil-RNAt, y por tanto, la enzima encargada de catalizar esta reacción se conoce como aminoacilsintetasa de RNAt. El bucle opuesto al tallo de los extremos 5′ y 3′ contiene la región anticodón, la cual reconoce e interactúa con cada codón del RNAm a través de la complementariedad de bases. Los dos brazos restantes participan en las interacciones de los RNAt con el ribosoma o con la sintetasa. La hoja de trébol se repliega dando origen a una estructura terciaria en forma de “L”, en cuyo brazo corto se encuentra la región aceptora del aminoácido y en el brazo largo la región anticodón (fig. 2-18). Los RNAt se generan a través de mecanismos complicados de maduración de transcritos primarios de longitud mayor que pueden originar más de una molécula. En procariontes, los transcritos primarios pueden incluir la secuencia de hasta más de 20 moléculas de RNAt, en

www.FreeLibros.me


30

Capítulo 2

Composición y estructura de los ácidos nucleicos

tanto que en eucariontes parecen ser monoméricos. Sin embargo, todos los transcritos primarios poseen secuencias intrónicas que, al eliminarse de manera alternativa y propiciar el ajuste también alternativo de exones, pueden dar lugar a las diversas moléculas de RNAt. Además, las bases nitrogenadas de los RNAt son modificadas enzimáticamente, dando origen a bases nitrogenadas propias de este tipo de RNA, como la seudouridina, la inosina y la ribotimidina, entre otras. En eucariontes, el porcentaje de bases nitrogenadas modificadas puede llegar a representar hasta un tercio del total, en tanto que en procariontes la proporción de este tipo de bases es menor. En procariontes, se estima que hay al menos 20 RNAt diferentes, en tanto que en eucariontes el número puede ser ligeramente mayor.

participan en la síntesis de proteínas. En el nucléolo confluyen además los RNA nucleolares pequeños, los cuales son esenciales para el procesamiento del pre-RNAr. Al igual que para los RNAm y RNAt, los transcritos primarios de RNAr también poseen regiones intrónicas que se eliminan. Los ribosomas son el sitio específico que permitirá la interacción de los diferentes participantes en la síntesis de proteínas: el RNAm con el código que determina la secuencia de aminoácidos de la proteína; los RNAt que leen el mensaje, lo traducen y transportan al aminoácido correspondiente, y diversos factores proteínicos que estabilizan el proceso. Además, son los ribosomas los encargados de formar el enlace peptídico entre los diferentes aminoácidos que conformarán la proteína.

RNA ribosómico

PERSPECTIVAS

Los RNAr son la variante de mayor peso molecular de este ácido nucleico; su tamaño y conformación son constantes en las células de un mismo organismo, donde su presencia llega a representar más de 50% del RNA celular total. Son componentes fundamentales de los ribosomas, los cuales son complejos supramacromoleculares de RNAr y proteínas que se estructuran en dos subunidades, las cuales según sus dimensiones se conocen como subunidad mayor y menor del ribosoma. De manera característica, estos RNA poseen una estructura secundaria de tallos y bucles que se originan cuando la molécula se cierra por la existencia de secuencias de bases nitrogenadas complementarias (fig. 2-18). Tanto los RNAr como las subunidades ribosómicas de procariontes son más pequeños que los de eucariontes. Así, en procariontes se han descrito tres RNAr cuya velocidad de sedimentación en un campo centrífugo es de 23S, 16S y 5S (S corresponde a las unidades Svedberg), en tanto que en eucariontes se presentan los RNAr 28S, 18S, 5.8S y 5S. Excepto el RNAr 5S de eucariontes, los demás se transcriben en un pre-RNAr de aproximadamente 13 kb, el cual se procesa para dar origen a cada uno de los demás RNAr, los cuales se autoensamblan con las proteínas ribosómicas para formar las subunidades, en el área del nucléolo, dentro del núcleo, de donde son transportadas como complejos individuales hacia el citoplasma, permaneciendo independientes hasta el momento en que

El establecimiento de la estructura del DNA fue el gran paso hacia el entendimiento de los mecanismos implicados en el almacenamiento y transmisión de la información genética, reorientando dichos estudios hacia los ácidos nucleicos de manera definitiva. Watson, Crick y Wilkins fueron reconocidos en 1962 con el Premio Nobel por sus aportaciones al establecimiento de la estructura del DNA. Después de ellos, muchos investigadores más han sido reconocidos por sus aportaciones en el establecimiento de los mecanismos de expresión de la información genética. Todo esto originó lo que hoy conocemos como biología molecular, para referirse precisamente a los mecanismos e interacciones moleculares que sustentan y regulan la expresión de la información genética. En la actualidad, el surgimiento de técnicas avanzadas de biología molecular, así como de equipos sistematizados de análisis, han permitido que la ciencia avance de la genómica a la proteómica, en el manejo de varios recursos para beneficio humano. Así, se ha llegado a establecer la secuencia de varios genomas y algunos incluso se han modificado y clonado, lo que ha ocasionado toda una polémica social, que exige a los investigadores apegarse con rigor a diversas consideraciones éticas. Sin embargo, nadie puede negar lo beneficiosas que han resultado las técnicas de biología molecular, las cuales se han convertido en una herramienta cotidiana incluso en procesos de diagnóstico.

www.FreeLibros.me


Sitios web de interés

31

BIBLIOGRAFÍA Aboul-ela F, Bowater RP, Lilley DM. Competing B-Z and helixcoil conformational transitions in supercoiled plasmid DNA. J Biol Chem, 1992;267(3):1776-1785. Alberts B, Johnson A, Lewis J, Raff M, Roberts K, Walter P. Molecular biology of the cell. 4a. ed. New York: Garland Publishing Inc., 2002. Belotserkovskii BP, Arimondo PB, Cozzarelli NR. Topoisomerase action on short DNA duplexes reveals requirements for gate and transfer DNA segments. J Biol Chem, 2006;281(35):25407-25415. Belotserkovskii BP, Krasilnikova MM, Veselkov AG, Kamenetskii MD. Kinetic trapping of H-DNA by oligonucleotide binding. Nucleic Acids Res, 1992;20(8):1903-1908. Berg JM, Tymoczko JL, Stryer L. Biochemistry. 5a. ed. New York: Freeman and Company, 2002. Biegeleisen K. Topologically non-linked circular duplex DNA. Bull Math Biol, 2002;64(3):589-609. Corral DM. mRNA specific subcellular localization represents a crucial step for fine-tuning of gene expression in mammalian cells. Biochem Biophys Acta, 2007;1773(4):473-475. Crick FHC, Wang JC, Bauer WR. Is DNA really a double helix? J Mol Biol, 1979;129:449-461. Dorman CJ. DNA supercoiling and bacterial gene expression. Sci Prog, 2006;89(Pt 3-4):151-166. Ellison MJ, Kelleher RJ, Wang AH, Habener JF, Rich A. Sequence-dependent energetics of the B-Z transition in supercoiled DNA containing nonalternating purine-pyrimidine sequences. Proc Natl Acad Sci USA, 1985;82(24):8320-8324. Jiménez LF, Merchant H. Biología celular y molecular. 1a. ed. México: Prentice Hall, 2003. Karp G. Cell and molecular biology. Concepts and experiments. 3a. ed. New York: John Wiley & Sons Inc., 2003. Lewin B. Genes VII. 1a. ed. Oxford: Oxford University Press, 2000. Lodish H, Berk A, Zipursky SL, Matsudaira P, Baltimore D, Darnell J. Molecular cell biology. 4a. ed. New York: Freeman and Company, 2000. Mathews CK, Van Holde KE, Ahern KG. Biochemistry. 3a. ed. San Francisco: Addison Wesley Longman Inc., 2000. Mello JA, Almouzni G. The ins and outs of nucleosome assembly. Curr Opin Genet Dev, 2001;11(2):136-141. Nelson DL, Cox MM. Lehninger principles of biochemistry. 3a. ed. New York: Worth Publishers, 2000.

Plasterk RH, van de Putte P. The invertible P-DNA segment in the chromosome of Escherichia coli. EMBO J, 1985;4(1):237242. Premilat S, Albiser G. Helix-helix transitions in DNA: fibre X-ray study of the particular cases poly(dG-dC), poly(dG-dC) and poly(dA), 2poly(dT). Eur Biophys J, 1999, 28(7):574-582. Reichow SL, Hamma T, Ferre-D’Amare AR, Varani G. The structure and function of small nucleolar ribonucleoproteins. Nucleic Acids Res, 2007;35(5):1452-1464. Sergiev PV, Bogdanov AA, Dontsova OA. Ribosomal RNA guanine-(N2)-methyltransferases and their targets. Nucleic Acids Res, 2007;35(7):2295-2301. Sprinzl M. Chemistry of aminoacylation and peptide bond formation on the 3’terminus of tRNA. J Biosci, 2006;31(4):489496. Stefl R, Cheatham TE 3rd, Spackova N, Fadrna E, Berger I, Koca J, Sponer J. Formation pathways of a guanine-quadruplex DNA revealed by molecular dynamics and thermodynamic analysis of the substates. Biophys J, 2003;85(3):1787-1804. Strider W, Camien MN, Warner RC. Renaturation of denatured, covalently closed circular DNA. J Biol Chem, 1981;256(2):7820-7829. Stryer L. Bioquímica. 4a. ed. Barcelona: Reverté, 1995;II. Thanbichler M, Wang SC, Shapiro L. The bacterial nucleoid: a highly organized and dynamic structure. J Cell Biochem, 2005;96(3):506-521. Thirumalai D. Native secondary structure formation in RNA may be a slave to tertiary folding. Proc Natl Acad Sci USA, 1998;95(20):11506-11508. Tohl J, Eimer W. Interaction of a G-DNA quadruplex with monoand divalent cations A force field calculation. Biophys Chem, 1997;67(1-3):177-186. Watson JD, Crick FHC. Molecular structure of nucleic acids. Nature, 1953;4356:737-738. Wu J, Grunstein M. 25 years after the nucleosome model: chromatin modifications. Trends Biochem Sci, 2000;25(12):619623. Yang CJ, Wang L, Wu Y, Kim Y, Medley CD, Lin H, Tan W. Synthesis and investigation of deoxyribonucleic acid/locked nucleic acid chimeric molecular beacons. Nucleic Acids Res, 2007;35(12):4030-4041.

Sitios web de interés Información sobre composición y estructura de los ácidos nucleicos http://www.ehu.es/biomoleculas/AN/AN.htm http://mx.geocities.com/avolaje2/apuntes/acidosnuc_b2.html http://www.arrakis.es/~lluengo/anucleicos.html http://superfund.pharmacy.arizona.edu/toxamb/c1-1-1-3.html http://www.um.es/~molecula/anucl.htm

http://www.geocities.com/fdocc/w-c.htm http://www.visionlearning.com/library/module_viewer. php?mid=63&l=s&c3 http://www.qo.ub.es/WEB01/Grups/home10n.sp.html http://www.virtual.unal.edu.co/cursos/ingenieria/25055/lecciones/acidos_nucleicos.html

www.FreeLibros.me


32

Capítulo 2

Composición y estructura de los ácidos nucleicos

http://www.angelfire.com/magic2/bioquimica/nucle_tidos_y__ cidos_nucleicos.htm Descubrimiento del DNA http://www.nature.com/nature/dna50/index.html http://www.ciencias.uma.es/publicaciones/encuentros/encuentros86/histbioq5.htm http://www.lclark.edu/~autumn/bio151/lectures/09-DNA.pdf http://www.emc.maricopa.edu/faculty/farabee/BIOBK/BioBookDNAMOLGEN.html http://dwb.unl.edu/Teacher/NSF/C10/C10Links/mills.edu/RESEARCH/FUTURES/JOHNB/biohistory.html http://www.agls.uidaho.edu/biotech_society/Documents/historical_timeline_biotechnolog.htm http://www.biotik.dk/viden/afsnit2/kap15/biografi/ http://www.madsci.org/posts/archives/mar99/922909300. Sh.r.html

http://biocrs.biomed.brown.edu/Books/Chapters/Ch%208/DHPaper.html http://www.pbs.org/wgbh/aso/databank/entries/do53dn.html http://www.chemheritage.org/EducationalServices/chemach/ ppb/cwwf.html Información sobre secuencias génicas http://maine.ebi.ac.uk:8000/services/cogent/ http://www.elpais.es/especiales/2000/genoma/graficos/genes2. htm http://www.hgmp.mrc.ac.uk/GenomeWeb/genome-centres.html http://www.genoscope.cns.fr/ http://www.intlgenome.org/ http://www.ornl.gov/sci/techresources/Human_Genome/home. shtml http://www.tigr.org/

www.FreeLibros.me


Capítulo

3

Replicación del ácido desoxirribonucleico (DNA) Dra. Silvia Josefina López Pérez

temporales que conforman su ciclo denominado ciclo celular (fig. 3-1). En la fase G1, la célula inicia su ciclo de vida con un tamaño reducido. Durante esta etapa, se dedicará a aumentar su tamaño y a llevar a cabo las funciones celulares típicas de la interfase. En algún momento de G1, las células pueden entrar en una etapa de especialización denominada G0, donde realizarán funciones específicas y no se dividirán por un tiempo indeterminado. En este caso están las neuronas y las células hepáticas maduras. Las células que no entran en G0 continúan a la fase S, que es la etapa en la cual se replica el material genético. Durante este periodo, la célula debe asegurar que todo el DNA que conforma su genoma se copie, generando dos moléculas idénticas. En la siguiente fase, denominada G2, se activan los mecanismos de revisión y reparación del genoma, para asegurar en la medida de lo posible que las moléculas de DNA generadas en la fase S no contengan errores de copia que sean incompatibles con la supervivencia de la descendencia. En esta fase es cuando se activan también los mecanismos de división celular que darán origen a las células hijas. Finalmente, en la fase M se lleva a cabo la división física de la célula original, que ahora da lugar a dos células hijas, cada una de las cuales contiene una de las copias de DNA que se generaron durante la fase S.

INTRODUCCIÓN La preservación de las especies sobre el planeta implica la necesidad de la reproducción de las diferentes formas de vida. Cada especie tiene características únicas, que en su mayoría son el resultado de la expresión de su carga genética. Desde este punto de vista, uno de los procesos biológicos celulares más relevante es la replicación del DNA, molécula que guarda en su secuencia de bases la información genética que distingue a los individuos como integrantes de una especie en particular. El DNA está formado por dos hilos de nucleótidos enrollados uno sobre el otro, formando una hélice doble guardada en la profundidad de las células. En cada ciclo celular, las hebras de la molécula de DNA se separan y se copian con la más alta fidelidad, para luego volver a reformar la doble hélice, en una danza eterna que mantiene vigente la vida hasta nuestros días.

CICLO CELULAR EN ASOCIACIÓN CON LA REPLICACIÓN Todos los organismos vivos tienen un ciclo de vida, compuesto de etapas que se van alcanzando de manera consecutiva en el tiempo. Las células, como componentes básicos de todos los organismos, también atraviesan fases 33

www.FreeLibros.me


34

Capítulo 3

Replicación del ácido desoxirribonucleico (DNA) Ciclo celular

La célula se especializa

Fase M

G0 G1 División celular

Fase G1

Fase G2

Fase G0

Interfase Mitosis

S

M

Fase S

Síntesis del DNA Cada célula recibe una copia de DNA G2

Ciclinas Revisión y reparación del DNA

Figura 3-1

Figura 3-2

Las etapas del ciclo celular se suceden en orden, y necesariamente debe terminar una etapa completa para que inicie la siguiente. Las etapas G1 y G2 se consideran de revisión. La duración de cada etapa varía con la especie.

El control temporal de la sucesión de etapas del ciclo celular depende de una familia de cinasas de proteínas, que forman complejos con ciclinas, un tipo de proteínas que, como su nombre lo indica, presentan un ciclo temporal de síntesis y degradación: se acumulan en la célula durante G1, desaparecen hacia el término de S, se sintetizan de nuevo durante G2 y se degradan al final de M. Así, la actividad de los complejos ciclinas-cinasas (complejos Cdk) se incrementa y disminuye en varios puntos del ciclo celular, y esta oscilación se relaciona directamente con cambios en el estado de fosforilación de varias proteínas intracelulares, que inician o regulan los principales sucesos de la vida celular, entre ellos, la replicación del DNA (fig. 3-2).

ORIGEN DE LA REPLICACIÓN El DNA es una hebra doble de nucleótidos con una secuencia determinada, que no tiene señales adicionales que diferencien las funciones de una secuencia en particular. Se sabe que en esas hileras de nucleótidos están ubicados los genes, y que cada uno de ellos proporciona información para construir organismos, pero no hay señales que muestren dónde inicia y dónde termina determinado gen; del mismo modo, sabemos que, además de genes, el DNA

Cinasas

El control del ciclo se ejerce mediante la activación de cinasas de proteínas mediante su interacción con ciclinas. Una vez activadas, las cinasas activan a su vez a otras proteínas efectoras de varias funciones celulares. Las ciclinas presentan concentraciones altas durante G1 y G2, y bajas durante S y M. La concentración de cinasas se mantiene constante durante todo el ciclo celular.

también contiene secuencias específicas que no generan productos génicos, pero que son primordiales para que los genes puedan regularse de manera adecuada. Entre otras secuencias de esta naturaleza, está el llamado origen de replicación, que es el sitio donde debe iniciar la copia del material genético, en cada ciclo celular. En los organismos procariontes, cuyos genomas son relativamente sencillos, hay un solo origen de replicación, en tanto que en los eucariontes, con genomas más amplios y complejos, se encuentran varios orígenes de replicación. Según algunos autores, existen 330 orígenes en el genoma de 14 Mb de la levadura común, y probablemente más de 10 000 en los metazoarios. En las bacterias, cuyo organismo modelo es la enterobacteria Escherichia coli, el sitio de origen se denomina OriC, y está formado por módulos cortos de secuencia repetida, con una gran cantidad de nucleótidos de adenina y timina dispuestos en cuatro módulos con la secuencia 5′-TGTGGATAA-3′ y tres módulos con la secuencia 5′-GATCTNTTTATTT-3′. En las levaduras, los orígenes de replicación se llaman ARS (siglas de autonomous replicate sequence, pues son secuencias que pueden iniciar replicación cuando se colocan en un plásmido). Las secuencias ARS se dividen en módulos funcionales denominados dominios A y B. El A

www.FreeLibros.me


Enzimas participantes en la replicación

35

una de las copias nuevas forma una doble hélice con la hebra original que le sirvió de molde. El conjunto básico de las enzimas que participan en el proceso se conoce como maquinaria de replicación, y está formada por las siguientes proteínas.

A

Polimerasa de DNA Origen

B

Figura 3-3

Origen

La replicación del DNA sucede bidireccionalmente a partir del origen, tanto en cromosomas circulares procariontes (panel A) como en cromosomas lineales eucariontes (panel B).

contiene la secuencia central A/TTTTATG/ATTTA/T, que muestra un alto grado de conservación entre diferentes orígenes. El B muestra más variabilidad en su secuencia, sin que esta variabilidad tenga un efecto notorio sobre el inicio de la replicación. A partir del origen de replicación, se forman dos sitios de copia activa del DNA, denominados horquillas de replicación. Como ya se ha demostrado desde hace varios decenios, el movimiento de estas horquillas es bidireccional a partir del origen, de manera que, según avanza la copia del DNA, las horquillas se van separando entre sí en direcciones contrarias, tanto en el genoma circular de E. coli como en los cromosomas lineales de los eucariontes superiores (fig. 3-3). Entonces, estos sitios de origen de replicación señalan el lugar específico donde el proceso de copia del DNA inicia, y funcionan como sitios de anclaje para las proteínas que realizan el proceso.

Actualmente se conocen tres tipos de polimerasas de DNA, caracterizadas en E. coli, denominadas I, II y III, según el orden en que fueron descubiertas. Las de tipo I y II funcionan sobre todo en los procesos de reparación del DNA, en tanto que la de tipo III es la encargada de catalizar la elongación de la cadena del DNA durante el proceso de replicación. Esta proteína es de estructura compleja; está formada de varias subunidades, que juntas constituyen una molécula de 600 kDa aproximadamente. Las subunidades α, ε y θ forman el núcleo de la enzima, que contiene las actividades de polimerización 5′→3′ y de exonucleasa 3′→5′, que le permiten agregar nucleótidos trifosfatados a la cadena en crecimiento, y retirar en el momento cualquier nucleótido que se haya insertado de manera equivocada (corrección de lectura). La subunidad β es un homodímero con estructura en forma de aro, que tiene la capacidad de abrirse y cerrarse alrededor del DNA, y luego deslizarse por toda la longitud de la molécula, con el centro enzimático de la enzima unido a ella (fig. 3-4). A esta capacidad de mantenerse sobre la cadena molde se le llama procesividad. Las subunidades γ, δ, δ′, χ y ψ forman en conjunto el complejo γ, cuya función es abrir y ubicar a la subunidad β sobre el dúplex de DNA, en una reacción que requiere ATP, y descargarla cuando se ha completado el proceso de replicación. Por último, la subunidad τ tiene la función de mantener unidos dos núcleos de polimerasa en una sola molécula. En conjunto, todas estas subunidades forman un complejo enzimático que trabaja con un grado de eficiencia y rapidez sumamente notable: tiene la capacidad de unir 500 nucleótidos por segundo en las bacterias y 50 nucleótidos por segundo en mamíferos, con una tasa de equivocación de apenas un nucleótido por cada 109 nucleótidos agregados. A pesar de ser una enzima eficiente, la polimerasa de DNA no tiene la capacidad de iniciar la síntesis de DNA de novo, y siempre requiere la presencia de una pequeña molécula de RNA llamada cebador (primer), que le proporciona un extremo 3′ para iniciar la síntesis.

ENZIMAS PARTICIPANTES

Helicasas

EN LA REPLICACIÓN

Son proteínas que utilizan la energía de los enlaces del ATP para catalizar el desenrollamiento parcial y transitorio de moléculas de ácidos nucleicos de doble hebra. Para realizar su función, las helicasas por lo general se reúnen en estructuras hexaméricas que adquieren una forma tridimensional de anillo. El hexámero contiene un

La replicación del DNA es un proceso dinámico, que comprende la participación de varias enzimas que se coordinan para generar una copia casi siempre 100% idéntica a la molécula original. Al final del proceso, cada

www.FreeLibros.me


36

Capítulo 3

Replicación del ácido desoxirribonucleico (DNA) Helicasas

Complejo γ

Subunidad β

3’ (cebador)

A

A 5’ (Cadena molde)

Centro enzimático B

B

C

Figura 3-5 C

Figura 3-4

La polimerasa de DNA se compone de varias subunidades, que se ensamblan de manera secuencial: el complejo γ engancha a la subunidad β sobre un extremo 3′ recién sintetizado (panel A); esto permite el ensamble del centro enzimático (panel B). La polimerasa añade nucleótidos todo el tiempo a un extremo 3′, por lo que su movimiento se define como 5′→3′.

dominio de unión al origen, que reconoce el sitio de origen de replicación y le permite ensamblarse a él. Este ensamble produce la distorsión y separación de la doble hebra de DNA, en presencia de ATP y iones Mg++. Una vez sobre el DNA, las helicasas pueden desplazarse a lo largo de cada una de las hebras en dirección 5′→3′. A medida que se desplazan, utilizan energía química que proviene de la hidrólisis del ATP para romper los puentes de hidrógeno entre las bases, produciendo así la abertura de la molécula (fig. 3-5).

Primasas Las primasas son enzimas que catalizan la formación de pequeños segmentos de RNA, de unos 11 nucleótidos de longitud, llamados cebadores o primers, y que son absolutamente indispensables para que la polimerasa de

A, las helicasas reconocen el sitio de inicio de la replicación, e interaccionan con esa región. B, una vez posicionadas sobre las hebras de DNA, se translocan a lo largo de la hélice con la participación de ATP. C, su movimiento genera el rompimiento de los puentes de hidrógeno entre las bases nitrogenadas, produciendo la separación de las hebras.

DNA funcione, ya que ésta, como se mencionó, requiere la presencia de un extremo 3′ libre preexistente para iniciar la síntesis de DNA (fig. 3-6).

Proteínas ssb Llamadas de este modo por las siglas en inglés de “proteína estabilizadora de la hebra simple” (single strain binding protein), son moléculas que se unen cooperativamente a la hebra abierta del DNA, impidiendo que tome su configuración de hebra doble. Se presentan en forma de homotetrámeros, cada uno de los cuales abarca alrededor de 35 nucleótidos, a los que se unen sin ningún tipo de especificidad.

Ligasas Son enzimas que catalizan la formación de enlaces fosfodiéster entre los extremos de dos hebras de ácidos nucleicos. Hay dos clases, según la fuente de energía que prefieren: las que utilizan NAD+ como cofactor y que existen en las bacterias, y las que usan ATP como cofactor, específicas de los eucariontes. Su mecanismo de acción requiere tres pasos (fig. 3-7):

www.FreeLibros.me


Mecanismo integral de replicación

Nucleótidos

A

Primasa

5´ Hebra molde

37

relajando de este modo la molécula. No requieren ATP para funcionar. Tipo II: al contrario del tipo I, éstas se unen a DNA relajado, induciendo superenrollamientos. Sin embargo, en presencia de DNA superenrollado negativamente, inducen corte y ligamiento de la doble hebra, produciendo su relajación, en un proceso que requiere la presencia de ATP. En las bacterias, las enzimas girasas son topoisomerasas de este tipo.

MECANISMO INTEGRAL DE REPLICACIÓN 5´ 3´

B

Para su estudio, el proceso de replicación puede dividirse en etapas, cada una de las cuales incluye diferentes enzimas de la maquinaria de replicación. •

Cebador 3´

5´ 3´

C

Figura 3-6

Las primasas sintetizan un segmento corto de nucleótidos (paneles A y B) (utiliza ribonucleótidos) denominado cebador o primer, dejando un extremo 3′ libre disponible para que la polimerasa de DNA inicie la síntesis (panel C).

a) Formación de un enlace covalente entre la enzima y su cofactor. Esto produce la liberación de una molécula de PPi. b) Transferencia del nucleótido del AMP al fosfato del extremo 5′ del DNA que se va a sellar. c) Formación de un enlace fosfodiéster con la liberación de AMP.

Topoisomerasas

Son enzimas que cortan y ligan el DNA cambiando su topología, sea induciendo la formación de giros o relajando superenrollamientos. El corte se hace a nivel del enlace fosfodiéster, transfiriéndolo a un residuo de tirosina de la enzima, en un proceso que requiere la presencia de iones magnesio. Según el efecto que tienen las topoisomerasas sobre la molécula de DNA, se han clasificado como sigue: •

Tipo I: interaccionan de preferencia con DNA superenrollado, induciendo un corte en una de las hebras, pasando la otra hebra por el corte, y volviendo a sellar,

Etapa 1. Reconocimiento del origen de replicación: la replicación inicia en sitios específicos dentro del genoma, llamados orígenes de replicación. Éstos son reconocidos por helicasas específicas mediante una reacción en la que se utiliza ATP. Los sitios de origen de replicación tienen la característica de ser módulos cortos de secuencia repetida, con abundancia de adeninas y timinas. Una vez que las helicasas reconocen el origen, producen la abertura de ese segmento. A partir de ahí, otras helicasas con estructura de anillo se encargarán de inducir la abertura del resto de la cadena, translocándose a través de ella, de modo bidireccional a partir del origen de replicación. Etapa 2. Mantenimiento de la abertura de la hélice: una vez que la hélice de DNA se ha separado en el sitio de origen, las pequeñas proteínas ssb se asocian con los nucleótidos de cada hebra, impidiendo que se regeneren los puentes de hidrógeno entre ellos. De esta manera permanecen separadas las hebras para dar cabida al resto de enzimas participantes. Etapa 3. Síntesis del cebador: una vez separada la hebra de DNA en el sitio de inicio, una primasa sintetiza un segmento corto de RNA, que servirá como cebador para la siguiente enzima. Etapa 4. Inicio de la copia: el extremo 3′ del cebador funciona como punto de anclaje para la polimerasa de DNA, que se ensambla secuencialmente: primero la subunidad β, con la participación del complejo γ, y después el centro enzimático. Una vez ensamblada la enzima completa, el centro enzimático añade nucleótidos complementarios a la cadena que está copiando. Según se propone, la polimerasa III forma un dímero, con uno de sus monómeros ensamblado sobre la cadena líder (la que tiene la orientación 5′→ 3′) y el otro ensamblado sobre la cadena acompañante (con orientación 3′→ 5′). Dada la capacidad de polimerización 5′→ 3′ de la polimerasa, la cadena líder se copia

www.FreeLibros.me


38

Capítulo 3

Replicación del ácido desoxirribonucleico (DNA)

Enzima A

Cofactor +

+

+

+

+

+ Ligasa + Ligasa

Ligasa

+ Ligasa

Ligasa Ligasa

Adenosina

B

Figura 3-7

C

Las ligasas catalizan la formación de un enlace fosfodiéster entre dos extremos de DNA. La enzima se une a su cofactor y después al extremo 5′ del sitio del corte, con la participación de ATP (panel A). El grupo OH del extremo 3′ cercano se une con un grupo fosfato del ADP y genera el enlace fosfodiéster (panel B). La reacción produce AMP (panel C).

en un proceso continuo, en tanto que la acompañante se copia en un proceso discontinuo que genera fragmentos pequeños de hebra nueva, que en un primer momento están separados unos de otros. Estos segmentos, denominados fragmentos de Okazaki, se unen mediante la acción posterior de una ligasa. Etapa 5. Relajación de superenrollamientos: por delante de la maquinaria de replicación, y como resultado del avance de la misma por el dúplex de DNA, se generan superenrollamientos en la hebra, que si no son relajados en un momento dado interrumpirán el paso de la maquinaria de replicación. Las topoisomerasas son las enzimas encargadas de relajar estos superenrollamientos, asegurando el paso libre de la maquinaria de replicación en toda la longitud de la cadena de DNA. Etapa 6. Terminación de la replicación: de la misma forma que existen sitios específicos de inicio de replicación, se han descrito sitios de terminación del proceso, que también tienen la característica de ser secuencias cortas repetidas, además de presentar una disposición encontrada. Se sabe que hay ciertas proteínas denominadas RTP (replication terminator protein) cuya función es inhibir el desplazamiento de las helicasas, y que están incluidas con la disociación de estas enzimas en los sitios de terminación de la replicación.

En la figura 3-8 se esquematizan todos los elementos participantes en el proceso.

Si bien todos los organismos utilizan mecanismos similares para replicar su DNA, cada una de las enzimas básicas participantes se conoce con un nombre particular según la especie de interés. Los organismos modelo de la replicación en procariontes y eucariontes son la bacteria E. coli y las levaduras, respectivamente. En el cuadro 3-1 se encuentran los nombres particulares de las enzimas que forman la maquinaria de replicación de estos organismos modelo.

CONTROL DE LA REPLICACIÓN La replicación del DNA es uno de los procesos mejor controlados en la célula, dada su importancia en la preservación de la identidad genética de las especies; en la mayoría de los casos, este control se ejerce en el inicio de la replicación. Una vez que el DNA ha sido replicado, se reclutan sobre los orígenes de replicación recién copiados varias proteínas que forman un complejo de reconocimiento del origen (ORC), denominadas Orc1- 6; algunas de éstas presentan sitios de unión para ATP, lo que le confiere al complejo actividad de ATPasa, en tanto que otras presentan sitios susceptibles de fosforilación por complejos ciclina-cinasa, lo que las convierte en blancos de regulación. Para iniciar la replicación, al ORC se suman otras proteínas reguladoras al inicio de la fase G1, cuando no hay actividad de complejos ciclina-cinasa: Cdc6, Cdt1, seis

www.FreeLibros.me


Control de la replicación

39

Nucleótidos

DNApol

ssb Helicasa

Topoisomerasas 5´

Ligasa 3´

5´ Movimiento de la horquilla de replicación

Fragmentos de Okazaki

Figura 3-8

La participación coordinada de varias enzimas permite la generación de cadenas nuevas de DNA a partir de los moldes. La cadena continua (dirección 3′→5′) se replica en un segmento único, en tanto que la cadena retrasada (dirección 5′→3′) se replica en fragmentos de Okazaki.

pequeñas proteínas Mcm, y la proteína recientemente descubierta Noc3. En conjunto, estas proteínas forman el denominado complejo pre-replicativo (pre-RC) (fig. 3-9). La formación del pre-RC no significa el inicio inmediato de la replicación del DNA en todos los orígenes de replicación, pues se sabe que en los organismos eucariontes éstos se activan en tiempos diferentes durante toda la fase S. En la transición G1/S, Cdc6 y Cdt1 son desplazadas del pre-RC, para permitir la formación del complejo de pre-inicio (pre-IC), mediante el reclutamiento de un segundo conjunto de iniciadores: Cdc7 dependiente de Dbf4 (DDK), Mcm10 (una proteína nuclear abundante) y Cdc45 (se cree que representa el puente entre el pre-RC y las proteínas que se requieren para la elongación de la cadena naciente de DNA) (fig. 3-9).

Cuadro 3-1

Enzimas de la maquinaria de replicación en organismos modelo

Enzima

E. coli

Levadura

Sitio de inicio

OriC

ARS

Helicasa

DnaB

MCM2-7

Proteínas ssb

SSB

RPA

Primasa

DnaG

Pri1

Complejo γ

Complejo γ

RFC

Cargador de la polimerasa de DNA

Subunidad β

PCNA

Polimerasa de DNA

Pol III

Pol δ

Ligasa

Ligasa

Ligasa I

Topoisomerasa

Girasa

Topo I, II, III

Los mecanismos que controlan la activación temporal de los orígenes de replicación parecen relacionarse con la fosforilación de las proteínas Mcm (que se cree son las helicasas replicativas) por parte de los complejos ciclina-cinasa propios de la fase S y por DDK. Una vez fosforiladas, el complejo originalmente globular que forman las Mcm cambia su conformación al típico anillo de las helicasas replicativas, y la incorporación final de Cdc45 permite la desestabilización de la doble hebra y el inicio de la replicación (fig. 3-9).

Reparación del DNA El mantenimiento de la estabilidad genética es esencial para el éxito reproductivo de las especies, y la conservación del potencial evolutivo. Esto requiere no sólo de un cuidadoso proceso de replicación del DNA, sino también de mecanismos eficaces para reparar las lesiones que ocurren continuamente en él, debido a accidentes metabólicos, radiación de diversas fuentes, exposición a sustancias en el medio, etc., que pueden causar mutaciones por alteración o pérdida de nucleótidos. En respuesta a esto, las células han desarrollado sistemas de reparación del DNA, los cuales se categorizan en cuatro tipos: reparación por supresión de bases (BER; base excision repair), reparación por supresión de nucleótidos (NER; nucleotide excision repair), reparación de pares erróneos (MMR, mismatch repair) y reparación de rompimientos de la doble hebra (DBR, double-strand break repair).

Sistema BER Este sistema entra en acción en los sitios donde se encuentren citosinas, adeninas o guaninas desaminadas; adeninas, guaninas o citosinas alquiladas por agentes

www.FreeLibros.me


40

Capítulo 3

Replicación del ácido desoxirribonucleico (DNA) Mcm Cdc-6

Cdt-1

M A

B

ORC

G1

Complejo pre-RC

Cdc7

DDK

Mcm10

Cdc45

C Cdc6 Cdt1 S

D

Figura 3-9

Complejo pre-IC

El sitio de origen está protegido desde el final de la fase M con un complejo de proteínas denominado ORC. Para activar este sitio de inicio de replicación, se reclutan Cdc-6, Cdt-1 y Mcm (panel A), para formar el complejo pre-RC (panel B). La unión de Cdc-7, DDK, Mcm10 y Cdc45, y la separación de Cdc-6 y Cdt-1 (panel C) señalan la formación del complejo pre-IC, y el inicio de la síntesis de DNA (panel D).

exógenos, o guaninas oxidadas por especies reactivas de oxígeno, que producen 8-oxo-guanina (8-oxoG). La presencia de este nucleótido se utiliza como biomarcador de daño oxidativo, y es un generador común de mutaciones relacionadas con algunos tipos de cáncer. El sistema utiliza dos tipos de proteínas para retirar y sustituir la base modificada: glucosilasas (MutT, MutM y MutY en bacterias; MTH1, OGG1 y MUTYH en humanos) y endonucleasas (Endo IV en E. coli y APE1 en humanos). El proceso se realiza en dos etapas: 1) una glucosilasa identifica la base alterada mediante modificaciones en la estructura de la base, rompe el enlace glucosídico entre la base y la desoxirribosa y retira la base, creando una desoxirribosa que carece de base; 2) una endonucleasa AP (apurínica/apirimidínica) reconoce este sitio sin base; genera un extremo 3′-OH libre, que permite que una polimerasa de DNA inserte el nucleótido faltante; posteriormente, una ligasa sella los extremos (fig. 3-10). Las glucosilasas realizan una suerte de revisión continua de nucleótidos sobre las hebras de DNA, rotando

por completo el nucleótido en turno fuera de la hélice de DNA, y acomodándolo en un recoveco de su estructura. Las bases dañadas se reconocen con base en su forma, su potencial de formar puentes de hidrógeno y su distribución de cargas eléctricas, que son sustancialmente diferentes de las presentadas por bases normales. Según datos experimentales, la glucosilasa humana OGG1 es capaz de revisar millones de pares de bases por segundo, lo que sugiere un mecanismo de revisión y reparación demasiado rápido. La estructura de estas moléculas es adecuada para esta función de revisión: son pequeñas, con menos de 400 residuos de aminoácidos y no más de dos dominios estructurales.

Sistema NER La estructura general del DNA puede verse alterada mediante lesiones que crean deformaciones notables en la hélice, como las que se generan cuando las bases nitrogenadas reaccionan con hidrocarburos como el benzo-

www.FreeLibros.me


Control de la replicación

41

UvrA

MutY

T A

T

A

Endo IV DNApol

Nucleótidos

Ligasa

B

DNApol

Nucleótido

Ligasa

B 3´

Figura 3-11

C

Figura 3-10

MutY es una glucosilasa que ubica bases alteradas en el DNA, y las retira creando un sitio sin base (panel A). Después, una endonucleasa A/P (Endo IV) genera un extremo 3′ en el sitio sin base (panel B), permitiendo que una polimerasa de DNA repare el daño mediante la inserción del nucleótido correspondiente. Los extremos se sellan con la participación de una ligasa (panel C).

pireno, o cuando se generan dímeros entre pirimidinas adyacentes en la misma hebra, debido a exposición a luz ultravioleta o a algunos químicos, como cisplatino, psoraleno o mitomicina C. El sistema NER agrupa varias proteínas que reconocen la lesión y sirven de contacto para nucleasas especializadas que retiran 12 a 30 nucleótidos, incluyendo el sitio de lesión. Para el reconocimiento de la lesión en E. coli, participan al menos tres proteínas, denominadas UvrA, UvrB y UvrC; en humanos, se han encontrado cuando menos 12 participantes en el mismo proceso. Estas proteínas son sensores de la distorsión de la hebra, más que de cambios o alteraciones en las bases individuales. Una vez que se retiran varios nucleótidos del sitio de lesión sobre la hebra afectada, el hueco que se genera se repa-

Los sitios donde hay formación de dímeros de timina son reconocidos por UvrA y proteínas relacionadas (panel A), que retiran un segmento de nucleótidos, que incluyen los que forman el dímero. El hueco se repara con la inserción de nuevos nucleótidos por la polimerasa de DNA y sellado de los extremos por ligasa (panel B).

ra mediante la acción coordinada de una polimerasa de DNA y una ligasa. Una de las alteraciones más frecuentes en el DNA es la formación de dímeros de timina, activada por luz UV. Estos dímeros interrumpen el emparejamiento y apilamiento normal de las bases nitrogenadas, y pueden bloquear los procesos de replicación y transcripción, por lo cual son un blanco común del sistema de reparación NER (fig. 3-11).

Sistema MMR Tiene la capacidad de quitar nucleótidos insertados erróneamente por la polimerasa del DNA durante la replicación, previniendo así mutaciones permanentes en las células. La complejidad de este sistema se refleja en la cantidad de proteínas que participan en él, tanto en E. coli como en humanos: MutS, MutL, MutH, helicasa de DNA II, cuatro exonucleasas (ExoI, ExoVII, ExoX y RecJ), proteínas SSB, polimerasa de DNA III y ligasa. Estas proteínas se unen sólo a la cadena recién sintetizada, que se

www.FreeLibros.me


42

Capítulo 3

Cuadro 3-2 E. coli

Replicación del ácido desoxirribonucleico (DNA)

Resumen de los componentes del sistema MMR en E. coli y sus homólogos humanos Humanos

Función

A

MutS

HmutSα hMutSβ

Reconocimiento del sitio de daño

MutL

HmutLα hMutLβ hMutLγ

Reconocimiento del sitio de daño, actividad endonucleasa

MutH

No identificada

Discriminación de hebra

UvrD

No identificada

Actividad de helicasa

ExoI, ExoVII, ExoX, RecJ

ExoI

Corte del DNA, retiro del nucleótido erróneo

Polimerasa III

Polδ PCNA

Resíntesis de DNA en el hueco

SSB

RPA

Protección de DNA de hebra simple, requerida para el retiro del nucleótido erróneo, promotor de la resíntesis de DNA

RFC

Carga de PCNA al dúplex de DNA, reparación en la dirección 3′, activación de la endonucleasa MutLα

Ligasa

Ligasa I

MutS

GATC

GATC Sitio del daño

MutL MutS Muth ATP B

GATC

GATC

Exonucleasas Helicasa Ssb DNApol Ligasa

C

GATC

Figura 3-12

Sellado de los sitios de corte

identifica por la carencia transitoria de metilación de las adeninas en las secuencias GATC. En el cuadro 3-2 se resumen los homólogos humanos de cada una de estas proteínas, así como sus funciones. El primer paso en la reparación mediante el sistema MMR es la unión de MutS al sitio del error; luego se localiza y corta la secuencia GATC más cercana, mediante la acción conjunta de MutS, MutL, MutH y ATP. Este sitio de corte es el punto donde inicia el retiro de bases mal emparejadas. En presencia de MutL, la helicasa tipo II desenrolla la doble hélice desde el corte hacia el sitio específico del error, al mismo tiempo que proteínas ssb protegen el segmento desenrollado. Dependiendo de la dirección del error con respecto del sitio de corte, ExoI/ ExoX (exonucleasas 3′→5′) o ExoVII/RecJ (exonucleasas 5′→3′) retiran los nucleótidos de la hebra, desde el sitio de corte hasta un poco más allá del sitio del error. El hueco resultante es entonces reparado por la polimerasa de DNA III y ligasa (fig. 3-12). Debido a que los mecanismos del sistema MMR muestran un alto grado de conservación evolutiva, los estudios que describen su funcionamiento en E. coli constituyen un excelente modelo del mismo sistema en eucariontes.

MutS

MutS

La reparación de daños al DNA mediante el sistema MMR requiere múltiples proteínas, que reconocen el sitio de daño (panel A), cortan la hebra dañada en la secuencia GATC más cercana (panel B), y eliminan todos los nucleótidos desde el sitio de corte hasta el sitio del daño. Luego, varios componentes de la maquinaria básica de replicación actúan coordinadamente para rellenar el hueco y sellar los extremos (panel C).

Sistema DBR Otra posibilidad de daño directo al DNA es el rompimiento físico de la doble hélice, que puede ocurrir por exposición a radiación ionizante, a químicos genotóxicos y a la presencia de algunos productos metabólicos celulares, como los que se producen durante el estrés oxidativo. Hay dos vías para reparar rompimientos de este tipo: la unión de extremos no homólogos (NHEJ; non-homologous end joining) y la recombinación entre homólogos (HR, homologous recombination). La NHEJ incluye la reunión directa de los extremos rotos del DNA, con un mínimo de procesamiento de las secuencias de los extremos, lo que sugiere que este mecanismo se activa cuando no hay pérdida de nucleótidos en los extremos. En este caso, la secuencia de suceso inicia con el reconocimiento del rompimiento por el dímero Ku70-Ku80 y cinasas de proteínas dependientes de DNA

www.FreeLibros.me


Control de la replicación DNA-Pkcs

Ku70-ku80 A

B

KLF-XRC4 Ligasa IV C Artemisa

(DNA-PKcs), que interaccionan entre sí para mantener los extremos muy cercanos uno del otro. La unión de una tercera proteína, Artemisa, y la consiguiente fosforilación de todos los componentes induce el procesamiento final de los extremos por un complejo formado por XLF, XRCC4 y ligasa IV (fig. 3-13). Durante la reparación por HR, uno de los extremos del sitio del rompimiento es reconocido por el complejo MRE11-RAD50-NBS1. Luego, los extremos del DNA son recortados, permitiendo la unión de RPA, RAD51 y RAD52 al extremo de DNA de cadena simple. El complejo RPA-RAD51-RAD52 rastrea una región homóloga en un DNA intacto (cromosoma homólogo) e inicia el emparejamiento, que se facilita mediante la acción de RAD54. La síntesis de DNA ocurre desde el extremo de DNA invasor, extendiendo la región reparada y formando una unión de Holliday. Esta unión se transloca a lo largo del DNA en un proceso mediado por un complejo de migración. Por último, los extremos son reunidos para terminar con dos secciones de DNA intactas (fig. 3-14).

Recombinación génica

D

Figura 3-13

43

En la reparación de rompimientos de la doble hélice mediante el sistema NHEJ, los extremos separados son identificados por Ku70-Ku80 y DNA-PKcs (paneles A y B) que los mantienen juntos. La fosforilación de los componentes y la actividad de XLF-XRC4 y ligasa (panel C) da como resultado la unión final de los extremos y la regeneración del sitio dañado (panel D).

RAD50

A

El proceso de recombinación genera diversidad genética entre los individuos de una población que comparten un genoma particular. Desde hace más de dos decenios se reconoce que existe una asociación espacio-temporal entre la replicación y los procesos de recombinación, de tal manera que la segunda ocurre en etapas del ciclo celular muy cercanas a la fase S. En las células se reconocen dos clases de recombinación: la recombinación entre homólogos (RH) y la recombinación entre sitios específicos (SE).

B RPA

MBS1 MRE11

RAD51

RAD52

C

D RAD51 RAD52 RAD54

Figura 3-14

La reparación mediante recombinación de homólogos implica el reconocimiento de los extremos separados (paneles A y B), así como de la región homóloga en el par correspondiente (panel C) por complejos formados por varias proteínas, para permitir la generación de entrecruzamientos entre pares homólogos (panel D).

www.FreeLibros.me


44

Capítulo 3

Replicación del ácido desoxirribonucleico (DNA)

Recombinación entre homólogos Implica el intercambio genético entre dos regiones extensas que presenten secuencias homólogas, localizadas en copias diferentes del mismo cromosoma. En estos casos, el intercambio de segmentos grandes de DNA se realiza mediante una sinapsis, que se define como un sitio de rompimiento y entrecruzamiento de dos cadenas de DNA (panel D, fig. 3-14). El proceso requiere varias proteínas especializadas, en particular la proteína RecA, cuyos monómeros se unen de manera cooperativa al DNA en largos agregados que pueden formar filamentos con más de una cadena de DNA al mismo tiempo, lo que le permite catalizar reacciones de sinapsis entre regiones homólogas de cadenas de DNA diferentes. Una vez establecida la sinapsis, la región compartida se extiende a través de un proceso unidireccional denominado migración de la bifurcación, que produce una región compartida de DNA que incluye miles de pares de bases (fig. 3-15). En la mayoría de los casos, la extensión de la región compartida forma una estructura intermediaria conocida como unión de Holliday, donde las dos hélices que comparten secuencias permanecen unidas durante el intercambio recíproco de dos de las cuatro hebras (fig. 3-16).

Recombinación entre sitios específicos La existencia de elementos genéticos móviles fue postulada por McClintock en el decenio de 1940, y en la actualidad se sabe que residen en los genomas de todos los organismos. Estos segmentos contienen 1 000 a 12 000 pares de nucleótidos, y presentan la particularidad de

A 5´

RecA

B 5´

Figura 3-15

La formación de sinapsis durante el proceso de recombinación entre homólogos requiere la estabilización de las hebras participantes por la proteína RecA, que además permite el desplazamiento del punto de bifurcación.

A

Figura 3-16

B

Las estructuras de Holliday se observan durante la recombinación génica, producidas por el intercambio de hebras entre sitios homólogos (panel A). La isomerización de las estructuras de Holliday puede generar diversos intermediarios mediante rotación en el espacio (panel B).

moverse por el genoma, de forma aparentemente aleatoria, por medio de dos mecanismos que requieren enzimas especializadas e incluyen sitios específicos del DNA: 1) recombinación transposicional y 2) recombinación conservativa. Durante la recombinación transposicional, los elementos que se mueven (denominados transposones) no tienen tipo de selectividad alguno por su sitio de destino, de tal manera que pueden insertarse casi en cualquier sitio del genoma. Los transposones tienen información que codifica una enzima transposasa, cuya función es cortar al transposón de las regiones flanqueantes de su sitio de origen y catalizar su inserción en el sitio de destino, sin que se tenga claro qué es lo que promueve tal movimiento. En el cuadro 3-3 se resumen las principales características que permiten la clasificación de los transposones en tres grupos. Otro tipo de reacomodo de elementos móviles se realiza mediante la llamada recombinación conservativa, que implica la integración temporal de dos moléculas de DNA inicialmente independientes. El mecanismo se ha estudiado con respecto a la integración del genoma del bacteriófago λ al genoma de la bacteria hospedadora. Cuando el virus entra a la célula, se sintetiza una proteína vírica llamada integrasa λ, que cataliza la unión covalente del DNA vírico con el cromosoma bacteriano, mediante el reconocimiento de secuencias específicas en ambos genomas, y las consecuentes reacciones de corte y resellado del DNA hospedador. Al final del proceso, el DNA vírico forma parte integral del genoma bacteriano, lo que facilita su replicación automática. Este mecanismo también funciona a la inversa, promoviendo la separación de un elemento móvil de un segmento de DNA, catalizado por un complejo de integrasa, algunos factores producidos por el hospedador y una proteína vírica adicional, llamada excisionasa, que se produce a partir del genoma vírico bajo condiciones de estrés del hospedador.

www.FreeLibros.me


Bibliografía

Cuadro 3-3

45

Características de los tres grupos de transposones

Grupo

Proteínas codificadas

Característica estructural

Mecanismo de movimiento

Ejemplo

Transposones de DNA

Repeticiones cortas e invertidas en sus extremos

Transposasa

Se mueven como DNA mediante corte y pega, o siguiendo una vía replicativa

Elemento P (Drosophila) Ac-Ds (maíz) Tn3/IS1 (E. coli)

Retrotransposones (semejantes a retrovirus)

Repeticiones iguales y largas en sus extremos

Transcriptasa inversa

Se mueven como intermediarios de RNA

Copia (Drosophila) Ty1 (levadura) THE-1 (humano) Bs1 (maíz)

Retrotransposones no retrovirales

Producen un transcrito con 3′-poli-A

Transcriptasa inversa

Se mueven con intermediario de RNA

Elemento F (Drosophila) L1 (humano) Cin4 (maíz)

BIBLIOGRAFÍA Alberts B, Johnson A, Lewis J, Raff M, Roberts K, Walter P. Molecular biology of the cell. 4a. ed. New York: Garland Science, 2002;235-466. Bielinski A, Gerbi S. Where it all starts: eukaryotic origins of DNA replication. Journal of Cell Science, 2005;114:643651. Bryant J, Moore K, Aves S. Origins and complex: the initiation of DNA replication. Journal of Experimental Botany, 2001;52:193-202. Cunningham E, Berger J. Unraveling the early steps of prokaryotic replication. Current Opinion in Structural Biology, 2005;15:68-76. David S, O’Shea V, Kundu S. Base-excision repair of oxidative DNA damage. Nature, 2007;447:941-950. DePamphilis M. Cell cycle dependent regulation of the origin recognition complex. Cell Cycle, 2005;4:70-79. Downs J, Nussenzwig M, Nussenzwig A. Chromatin dynamics and the preservation of genetic information. Nature, 2007;447:951-958. Jiricny J. The multifaceted mismatch-repair system. Nature Reviews, 2006;7:335-346. Lei M, Tye B. Initiating DNA synthesis: from recruiting to activating the MCM complex. Journal of Cell Science, 2003;114:1447-1454.

Lewin B. Genes VIII. 8a. ed. USA: Benjamin Cummings, 2003;428-455. Li G-M. Mechanisms and functions of DNA mismatch repair. Cell Research, 2008;18:85-98. Lodish H, Berk A, Kaiser CA, Krieger M, Scott M, Bretscher A, Ploegh H, Matsudaira P. Molecular cell biology. 6a. ed. New York: W.H. Freeman and Co. LTD, 2007;131-136. Méndez J, Stillman B. Perpetuating the double helix: molecular machines at eukaryotic DNA replication origins. Bioessays, 2003;25:1158-1167. Sasaki T, Gilbert D. The many faces of the origin recognition complex. Current Opinion in Cell Biology, 2007;19:337343. Schwob E. Flexibility and governance in eukaryotic DNA replication. Current Opinion in Microbiology, 2004;7:680-690. Sclafani R, Fletcher R, Chen X. Two heads are better than one: regulation of DNA replication by exameric helicases. Genes and Development, 2004;18:2039-2045. Viollier P, Shapiro L. Spatial complexity of mechanisms controlling a bacterial cell cycle. Current Opinion in Microbiology, 2004;7:572-578. Yang W. Structure and mechanism for DNA lesion recognition. Cell Research, 2008;18:184-197.

www.FreeLibros.me


Capítulo

4

Transcripción del ácido ribonucleico (RNA) Dr. Carlos Beas Zárate Dr. Mario Eduardo Flores Soto Dra. Verónica Chaparro Huerta

su vez se determinan por el posicionamiento del nucleosoma dependiente de la restructuración de la cromatina. La condensación de esta última inhibe la transcripción. La frecuencia del inicio transcripcional en un promotor determinado depende de la eficiencia con la cual éste se une y organiza el complejo de iniciación transcripcional. Los promotores con frecuente iniciación se llaman fuertes. Los promotores débiles rara vez dirigen la iniciación transcripcional. Todos los organismos tienen una proteína que abarca o une directamente la polimerasa de RNA tipo I al DNA. En procariontes es el factor σ (sigma). En eucariontes, hay diferentes complejos de factores transcripcionales que son los encargados para el posicionamiento de las polimerasas de RNA I, II y III.

INTRODUCCIÓN Definición de conceptos La iniciación de la transcripción es crucial para determinar qué genes se pueden expresar, cuándo y dónde. Es importante descifrar la iniciación de la transcripción por todas las polimerasas de RNA a través de la identificación del sitio de inicio para la transcripción. En eucariontes, la regulación del inicio de la transcripción ocurre a diferentes niveles: Nivel promotor Nivel estimulador Nivel de la dinámica del nucleosoma Nivel de condensación del cromosoma

TIPOS Y ESTRUCTURA

Los primeros dos niveles son utilizados por los procariontes. Promotor son señales del DNA que le indican al aparato de transcripción cómo debe iniciar una transcripción en un sitio específico cerca del promotor. La actividad del promotor puede ser regulada por la unión de factores auxiliares en sitios disponibles y éstos a

DE LAS POLIMERASAS DE

RNA

Procariontes Tanto las polimerasas de DNA como las de RNA agregan nucleótidos trifosfatados (NTP) sobre una cadena de áci-

46

www.FreeLibros.me


Proceso de transcripción en procariontes

Figura 4-1

Estructura molecular de la polimerasa de RNA (Thermus aquaticus) en procariontes.

dos nucleicos preexistente. Sin embargo, una diferencia muy importante es que la polimerasa de RNA sí es capaz de iniciar la síntesis de una cadena nueva sobre una ya existente, en tanto que la de DNA no. La reacción catalizada por una polimerasa de RNA es la adición de NTP en un sentido de 5′ a 3′ con eliminación de un difosfato al medio; el primer NTP conserva los tres fosfatos, en tanto que en la terminal del OH en 3′ es el lugar donde se agregará el resto de los NTP con el extremo 5′. La velocidad de reacción en bacterias es del orden de 40 nucleótidos; adicionados por segundo a 37°C es la misma velocidad de traducción (15 aminoácidos/s). La estructura de la polimerasa de RNA de E. coli comprende cuatro subunidades proteínicas [2α (37 kD), β (151 kD) y β′ (156 kD)] y una accesoria denominada factor σ del cual existen varios tipos que varían en su peso molecular desde 28 a 70 kD. Este factor es determinante en el reconocimiento del sitio de iniciación en la transcripción; además, posee actividad de helicasa que permite la abertura del DNA. La síntesis de nucleótidos la realizan las otras cuatro proteínas que en su conjunto se conoce como núcleo, en tanto que el conjunto de las cinco proteínas se denomina holoenzima (fig. 4-1).

Eucariontes En eucariontes, hay tres tipos de polimerasas de RNA, I, II y III. La estructura de las polimerasas de RNA de eucariontes comprende dos subunidades grandes equivalentes al β y β′ de procariontes, además de 12 a 15 proteínas pequeñas adicionales (fig. 4-2). Sin embargo, estas polimerasas carecen de las proteínas equivalentes al factor σ de procariontes, por lo que la iniciación de la transcripción la debe realizar otro tipo de proteínas. La polimerasa II resulta ser la más importante, debido a que es la encargada de transcribir los genes que originan las proteínas y algunos RNAnp, en tanto que las otras dos polimerasas transcriben sólo genes de RNA. La polimerasa I se localiza en el nucléolo y transcribe genes de RNAr excepto RNA 5S, la III también se localiza en el nucléolo y transcribe RNA 5S, RNAt, U6 RNAnp y algunos pequeños genes de RNA (cuadro 4-1).

Figura 4-2

47

Estructura molecular de la polimerasa de RNA tipo II de eucariontes.

PROCESO DE TRANSCRIPCIÓN EN PROCARIONTES Iniciación El mecanismo de transcripción inicia cuando la polimerasa de RNA se une a la cadena molde de DNA y reconoce la primera base para copiarse. Según las reglas de apareamiento de bases, la presencia de guanina en este sitio produce que dicha polimerasa seleccione un CTP de la mezcla de los cuatro diferentes tipos de nucleótidos de trifosfato existentes. En tal polimerasa se produce un cambio conformacional, el cual permite la lectura de la siguiente base expuesta sobre la cadena molde del DNA, la cual es una adenina; así, la presencia de adenina en esta segunda posición induce a que la enzima seleccione a un UTP y la formación de un enlace fosfodiéster en el carbón de la posición 3′-terminal del primer nucleótido. Esta reacción permite eliminar un pirofosfato del UTP con liberación de grandes cantidades de energía necesarias para la formación del enlace fosfodiéster. El complejo de transcripción del que forma parte la polimerasa de RNA necesita factores de iniciación que se unen a secuencias específicas del DNA para reconocer el sitio donde la transcripción ha de iniciar y se sintetice el nuevo RNA. Las secuencias de DNA en las que

Cuadro 4-1 Tipo de polimerasa de RNA

Polimerasas de RNA de eucariontes

RNA transcrito

Demandas de iones

I

RNA ribosómico (RNAr) 28S, 18S, 5.8S

Mg2+

II

RNA nucleares pequeños (RNAnp) y RNAm

Mg2+

III

RNAt, RNAr 5S, un RNA nuclear pequeño

Mn2+

www.FreeLibros.me


48

Capítulo 4

Transcripción del ácido ribonucleico (RNA)

A

Cuadro 4-2 Pol RNA

–10

–35

+1 punto de inicio 5´

Promotor

3´ Factor σ

B

+1 punto de inicio

3´ 5´

–35 Promotor Factor σ

Figura 4-3

–10

5´ 3´

Promotor en el DNA

Secuencias consenso y factores transcripcionales más comunes en procariontes y eucariontes Posición en el DNA

Factor de transcripción

Secuencia consenso

–10

σ (sigma)*

TATAAT

Proc. TGA

–35

Sigma (σ)*

TTGACA

Euc. Inr

+1

TBP

PiPiAN(T/A) PiPi

Euc. TATA

–35 ~ –20

TBP

TATAAA

Euc. CAAT

–200 ~ –70

CBP, NF1, C/EBP

CCAAT

Euc. GC

–200 ~ –70

SP1

GGGCGG

Proc. TATA

Pol RNA

Complejo de iniciación. A, unión de la holoenzima a la región promotora (complejo cerrado). B, separación de la doble hebra (complejo abierto).

se ensamblan los complejos de transcripción se llaman promotores (fig. 4-3A). Los promotores tienen secuencias de nucleótidos definidas, donde las más conocidas son la caja TATAAT y la caja TTGACA. Los promotores se localizan en los extremos 5′-terminales de los genes, es decir, por lo general en posiciones antes de iniciar la transcripción (fig. 4-3B). La polimerasa de RNA se une a las secuencias promotoras que incluyen la caja TATAAT y TTGACA (cuadro 4-2). La secuencia promotora está formada por unos 70 pares de bases (pb) nitrogenadas, que concuerda con el tamaño de la holoenzima polimerasa de RNA que es una esfera de unos 20 nm de diámetro. Es común ver en células procariontes la participación de una serie de proteínas llamadas factores σ que tienen como fin guiar a la polimerasa de RNA al promotor conveniente. La polimerasa de RNA se une a una de las caras del DNA bicatenario y éste se enrolla en la enzima de forma similar a como lo hace con el nucleosoma. La interacción entre la polimerasa de RNA y el DNA se estabiliza por varios tipos de enlaces débiles como interacciones iónicas, interacciones de van der Waals y enlaces de hidrógeno. La unión de polimerasas de RNA a DNA se llama complejo cerrado (fig. 4-3A). El reconocimiento del promotor por la polimerasa de RNA corre a cargo de la subunidad σ. Aunque la búsqueda del promotor por esta polimerasa es muy rápida, la formación de la burbuja de transcripción o abertura del DNA y la síntesis del RNA es muy lenta. La burbuja de transcripción es una abertura de DNA desnaturalizado de 18 pares de bases,

*Peso molecular en kDa; CBP = proteína de unión a CAAT; C/EBP = CAAT/proteína de unión al estimulador; N = puede ser cualquier base (A, T, C o G); Pi = pirimidina (C o T); Proc. = procariontes; Euc. = eucariontes.

donde empieza a sintetizarse el RNA a partir del nucleótido número 10 del molde de DNA en la burbuja de transcripción (fig. 4-3B). La burbuja de transcripción se llama complejo abierto. Los ribonucleótidos de trifosfato se van uniendo al molde del DNA para formar el RNA. La subunidad σ abandona el complejo de transcripción cuando el RNA alcanza una longitud de 10 ribonucleótidos.

Crecimiento La polimerasa de RNA cataliza el crecimiento de la cadena del RNA. Una cadena de RNA se une por apareamiento de bases a la cadena de DNA, y para que se formen correctamente los enlaces de hidrógeno que determina el siguiente nucleótido del molde de DNA, el centro activo de esta polimerasa reconoce a los ribonucleótidos trifosfato entrantes. Cuando el nucleótido entrante forma los enlaces de hidrógeno idóneos, entonces la polimerasa cataliza la formación del enlace fosfodiéster que corresponde. A esto se le llama crecimiento, la segunda etapa de la transcripción del RNA (fig. 4-4).

Terminación Al finalizar la síntesis de RNA, esta molécula ya se ha separado por completo del DNA (que recupera su forma original) y también de la polimerasa de RNA terminando la transcripción. La terminación es otra etapa distinta de esta última, porque justo cuando el complejo de transcripción se ha ensamblado activamente, debe desensamblarse una vez que el crecimiento se ha completado. La terminación está señalizada por la información contenida en sitios de la secuencia del DNA que se está trans-

www.FreeLibros.me


Proceso de transcripción en eucariontes

RNA en crecimiento 3´ 5´

–35 Promotor

5´ p p p

PROCESO DE TRANSCRIPCIÓN EN EUCARIONTES Formación del complejo de preiniciación

ppp NTP

–10

5´ 3´

Pol RNA Factor σ

Figura 4-4

49

Factor σ se disocia

Crecimiento en dirección 5‘ → 3‘; a los 12 nucleótidos transcritos, el factor σ se disocia.

cribiendo, por lo que la polimerasa de RNA se detiene al transcribir algunas secuencias especiales del DNA. Estas secuencias son ricas en guanina y citosina, situadas en el extremo 3′ de los genes, seguidas de secuencias ricas en timina, formando secuencias palindrómicas, que cuando se transcriben en el RNA recién sintetizado, adoptan una estructura en horquilla que desestabiliza el complejo RNA-DNA, obligando a separarse de la polimerasa de RNA, renaturalizándose la burbuja de transcripción (fig. 4-5A). Algunas secuencias de DNA carecen de la secuencia de terminación; poseen otra secuencia a la que se une una serie de proteínas reguladoras específicas para la terminación de la transcripción, como es la proteína ρ (rho), que constituye un segundo mecanismo de terminación en algunos genes en células procariontes (fig. 4-5B).

La iniciación de la transcripción del RNA en eucariontes constituye uno de los pasos más importantes para la expresión génica. Así, las polimerasas de RNA de eucariontes, a diferencia de los procariontes, requieren más de una proteína para reconocer el promotor y desdoblar la doble hélice del DNA, de modo que conformen un complejo de preiniciación a manera de preparación para la iniciación transcripcional. Así, en la polimerasa tipo I para transcribir el precursor del RNAr que contiene la información correspondiente a RNAr 28S, 18S, 5.8S y pequeños RNA, el gen correspondiente cuenta con dos regiones en el DNA localizadas previo a inicio, un elemento central más cercano a la iniciación y otro elemento de control a –100 pb aproximadamente; estas regiones del DNA se reconocen por dos factores proteínicos de unión al DNA (UBF) necesarios para comenzar la formación del complejo de preiniciación; ambos factores forman un doblamiento del DNA que subsecuentemente permite el reclutamiento de la proteína de unión a la caja TATA (TBP), así como los factores asociados (TAF1), como requisito para que la polimerasa de RNA I pueda unirse y formar dicho complejo de preiniciación (fig. 4-6). Para el caso de la polimerasa de RNA III que sintetiza el RNAr 5S, los RNAt y el U6 RNAnp, contiene en el gen correspondiente para el RNAt una región reguladora en el interior de la región que se transcribe conocida como

A

N

Templado de DNA

Región rica en C-G 5´ . . . . . NNAAGCGCCG NNNN CCGGCGC T T TT TT NNN .... 3´ 3´ . . . . . NNTTCGCGGC NNNN GCCCGCG AAAAAA NNN .... 5´ Región rica en A-T

Transcrito de RNA 5´ . . . . . NNAAGCCGCCGNNNNCCGGCCGCUUUUUU — OH 3´

N

N

N

C G-C C-G C-G G-C C-G G-C A-U A-U 5´ .....NNNN UCUU-OH 3´

B Pol RNA ADP+Pi

ATP+H2O Factor Rho

Figura 4-5

A, terminación de la transcripción por la formación en horquilla y cola de poli U. La parte gris muestra la región palindrómica de la secuencia. B, terminación dependiente de ρ (rho).

www.FreeLibros.me


50

Capítulo 4

Transcripción del ácido ribonucleico (RNA) +1

–100

CORE

UCE

Gen de pre-RNAr

UBF

UBF UBF

SL1 (TAF + TBP)

Pol l

UBF UBF

se componen por diversas proteínas; así, el TFIID está conformado por la proteína que reconoce, y se une a la caja TATA parte central del promotor (TBP) y diversos factores asociados (12 proteínas pequeñas) a esta proteína conocidos como TAF; una de éstas, conocida como TAF250, posee actividad de acetiltransferasa para la histona, la cual puede por último interferir con la del DNA y de la histona. Cabe señalar que al parecer el TFIIA no es absolutamente necesario para la formación del complejo de preiniciación; sin embargo, en esta ocasión se tomará en cuenta su participación. El ensamblaje del complejo de preiniciación inicia con la unión del TFIID, que mediante el TBP reconoce y se une al promotor del DNA; una vez posicionado en el DNA, recluta a TFIIB y a TFIIA; en caso de estar presente, antes que la polimerasa de RNA II se una a este complejo, el TFIIF se unirá a ésta, dado que este factor reconocerá al TFIIB previamente unido al DNA (fig. 4-9). Por último, la polimerasa de RNA II recluta a los factores TFIIE y TFIIH en este orden para formar el complejo de preiniciación (PIC, pre-initiation complex) (cuadro 4-3). El factor TFIIH cataliza la fusión del DNA, dado que tres de sus subunidades que lo compo-

TAF TAF

TP

Caja A

Pol

Caja B Gen de RNAt

TAF B

TF IIIC

Figura 4-6

Estructura del complejo de preiniciación de la polimerasa de RNA tipo I.

caja A y caja B, regiones reconocidas al mismo tiempo por el factor de transcripción III tipo C (TFIIIC); luego se recluta otro factor de transcripción III tipo B (TFIIIB) donde se incluye la proteína TBP para por último permitir la unión de la polimerasa III (fig. 4-7). Para la transcripción del gen de RNAr y 5S, éste posee una región reguladora que se conoce como caja C localizada en la región después del inicio. Esta región se reconoce por el factor de transcripción III tipo A (TFIIIA) que permite el reclutamiento inmediato del factor TFIIIC seguido del TFIIIB para que finalmente la polimerasa de RNA III se una a este complejo multimérico de preiniciación (fig. 4-8). Por último, la polimerasa de RNA II encargada de transcribir la gran mayoría de los RNAm de genes tanto constitutivos como inducibles y algunos RNA pequeños nucleares, a diferencia de las polimerasas I y III, requiere un mayor número de factores de transcripción para formar el complejo de preiniciación. Todos estos factores se denominan TFII (donde TF se refiere a transcription factor y II por la polimerasa II) tipos A, B, D, E, F y H. Es importante destacar que algunos de estos factores

TF IIIC

TF IIIB (TBP + BRF + B´´)

B´´

TBP

TF IIIC

BRF

Pol III

Pol III B´´

TF IIIC

TBP BRF

Figura 4-7

www.FreeLibros.me

Estructura del complejo de preiniciación de la polimerasa de RNA III para la síntesis del RNAt.


Proceso de transcripción en eucariontes

Caja C

TFIID (= TAF + TBP) + TFIIA

TAF

Gen de RNAr 5S A

51

TBP

TF IIIA + B

TFIIIA

TFIIB

+ F

TF IIIC

TFIID + Pol RNA II

Pol RNA II

TF IIIC

+

CTD

E

TFIIIA

TFIIE

+ H

TFIIH

TF IIIB (TBP + BRF + B´´)

TBP

B´´

BRF

TAF

TF IIIC TFIIIA

B

A TBP

F

E Pol RNA II

ATP

CTD

Pol III

H

Metilación DNA Pol III B´´

TBP BRF

TF IIIC

NTP

TFIIIA

Iniciación Fosforilación CTD

Figura 4-8

Complejo de preiniciación de la polimerasa de RNA tipo III para la síntesis del RNAr 5S.

Elongación del RNA

Figura 4-9

nen poseen actividades de helicasa, ATPasa y cinasa que permiten utilizar ATP para la abertura del DNA y la fosforilación del dominio carboxiloterminal de la polimerasa de RNA II para iniciar la transcripción (fig. 4-9).

Iniciación La unión de la polimerasa de RNA II genera un complejo cerrado que se convierte luego en un complejo abierto. Para que comience el movimiento de la enzima, se necesita además un desplegamiento adicional de las cadenas; en este paso, están implicados los factores transcripcionales tipo TFIIE y TFIIH con sus actividades de helicasa. La caja TATA alinea a la polimerasa de RNA a través del factor TFIID y otros factores, de tal modo que se garantiza iniciar en el punto correcto; esto explica por qué la localización de esta secuencia es fija con respecto

Estructura y orden de adición para la formación del complejo de preiniciación de la polimerasa de RNA II en su conformación básica.

al punto de inicio. La unión de TBP a TATA es el hallazgo predominante en el reconocimiento del promotor; también intervienen dos TAF (TAFII250 y TAFII150), que contactan con el DNA en la vecindad del punto de inicio e influyen en la eficiencia de la iniciación. En los promotores TATA, se requieren los mismos factores generales de transcripción, incluyendo TFIID. Aquí, el sitio Inr proporciona el elemento de posicionamiento, y TFIID se une a través de uno o más TAF que reconocen el Inr de manera directa. Aunque in vitro sólo se requieren los factores generales que se ensamblan en el núcleo del promotor (secuencia TATA e Inr), in vivo se necesitan otros factores que reconocen elementos en dirección 5′ para que se realice

www.FreeLibros.me


52

Capítulo 4

Cuadro 4-3

Factor

Transcripción del ácido ribonucleico (RNA)

Factores de transcripción general asociados a la polimerasa del RNA II Número de subunidades

TFIID-TBP

1

TFIID-TAF

12

Peso molecular (kD)

Función

38

Reconoce el centro del promotor y recluta a TFIIB

15 a 250

Asiste en el reconocimiento del promotor y a la activación transcripcional

TFIIA

3

12, 19, 35

Estabiliza a TFIID y se une al promotor

TFIIB

1

35

Recluta a la polimerasa de RNA II y a TFIIF

TFIIF

2

30, 74

Asiste a la polimerasa de RNA II para reconocer al promotor

TFIIE

2

34, 57

Recluta a TFIIH y regula las actividades de helicasa, ATPasa y cinasa del factor THIIH

TFIIH

9

89, 80, 62, 52, 44, 34, 32, 38, 40

Promueve la abertura del DNA con su actividad de helicasa y participa en la reparación del DNA

La nomenclatura para todos los factores de transcripción corresponde a TF (transcription factor); el número romano I, II, III corresponde al tipo de polimerasas de RNA con la que actúan y la letra (A, B, C, etc.) define el nombre o tipo de factor.

la transcripción. Estos factores son los llamados factores 5′ e interactúan con el aparato basal en diferentes etapas durante su ensamblaje.

Factores y elementos 5′ Las secuencias que se encuentran más alejadas del sitio de iniciación hacia el extremo 5′ (las cajas GC, CAAT y el octámero) se reconocen por los factores 5′ para aumentar la eficiencia del suceso de iniciación. La caja GC es reconocida por el factor SP1. La caja GC más cercana suele estar entre 40 y 70 pb en dirección 5′ del punto de inicio, pero el contexto es diferente en cada promotor. El modo más común de uso de los elementos de un promotor es que una secuencia sea reconocida por un determinado factor (o por una familia de factores); no obstante, algunos elementos pueden ser reconocidos por más de un factor. La caja CAAT puede ser reconocida en promotores diferentes por factores diferentes. Entre éstos se encuentran los de la familia CTF, CP1 y CP2 y con los factores C/EBP y ACF. Esta secuencia puede actuar como una diana o blanco específico para la regulación. Así, por ejemplo, en el promotor del gen para la histona H2B sólo se reconoce durante la espermatogénesis en el erizo de mar. Aunque los factores que reconocen esta secuencia se encuentran tanto en la espermatogénesis como en el periodo embrionario, sólo se unen a la secuencia en la espermatogénesis. Durante la embriogenia, hay una proteína (CDP, proteína de desplazamiento del CAAT) que se une a la secuencia e impide la unión del factor correspondiente. El octámero (Oct) es otra secuencia que puede reconocerse por más de un factor transcripcional. El factor

ubicuo Oct-1 se une al octámero para activar los genes de la H2B (y quizás otros también); Oct-1 es el único factor que se une al octámero en tejidos no linfoides. En los de origen linfoide, es un factor diferente; Oct-2 se une al octámero para activar los genes de la cadena ligera de las inmunoglobulinas; así, Oct-2 es un activador específico de tejido, mientras Oct-1 es ubicuo. ¿Por qué el uso de un mismo octámero por dos factores que no tienen el mismo efecto sobre la transcripción? Puede ser que Oct-2 es bastante más necesario para la interacción con otras proteínas que se unen al promotor. Al parecer no basta que se encuentre un factor determinado para predecir si un gen se transcribirá o no; el contexto en que se hallen es otro elemento a tener en cuenta.

Estimuladores Los promotores en eucariontes no trabajan solos para asegurar una transcripción eficaz. En algunos genes o tipos celulares, la actividad de un promotor se aumenta por la presencia de otra secuencia conocida como exaltador o estimulador (fig. 4-10). Las características de los estimuladores son las siguientes: • • • •

Están formados por cientos de bases. Generalmente, incluyen secuencias repetidas. Actúan a distancia, miles de pares de bases del promotor. Son activos en cualquier orientación respecto al promotor, incluso suele encontrárselos dentro del mismo gen.

Los estimuladores, entonces, actúan como reguladores de la expresión génica. No está claro aún el mecanis-

www.FreeLibros.me


Modificaciones postranscripcionales de RNA Potenciador

Silenciador

MODIFICACIONES POSTRANSCRIPCIONALES DE

Inhibidor Activador

IIA

IID

IIB

IIF

Caja TATA COOH

Figura 4-10

IIE

53

RNA

Los productos inmediatos de la transcripción se denominan transcritos primarios y no son necesariamente funcionales; muchos de ellos son específicamente alterados en varias formas como son: 1. Quitar segmentos exonucleotídicos o endonucleotídicos. 2. Adición de secuencias nucleotídicas en cualquiera de los dos extremos (5′ o 3′). 3. Modificación de nucleótidos específicos.

IIH

Pol RNA II

Representación esquemática de cómo los estimuladores actúan como reguladores de la expresión génica en distancias considerables del sitio de inicio de la transcripción.

mo de acción de los estimuladores, más aun cuando éstos se localizan a cualquier distancia (1 000 a 2 000 pb) y dirección del mencionado promotor.

Estas modificaciones no son iguales para todos los tipos de RNA; cada uno tiene sus propias modificaciones particulares.

RNAt Consiste en ≈ 80 nucleótidos, con los cuales asume una estructura en forma de trébol que se pliega sobre sí misma. Esta estructura se logra gracias a la complementariedad de ciertas regiones de la molécula (fig. 4-11). Todos los RNAt tienen una gran cantidad de bases modificadas y una secuencia en el extremo —CCA—OH3′ en la cual se une el aminoácido correspondiente. A un

Crecimiento Después de la formación del complejo de preiniciación, la abertura del DNA por el factor TFIIH, el DNA se abre en la posición –10 pb antes del inicio. Entonces, la polimerasa de RNA II utiliza los ribonucleótidos trifosfato (NTP) para la síntesis y crecimiento del transcrito hasta la señal de terminación. Este proceso ocurre en el sentido de 5′ → 3′, y el CTD (dominio carboxiloterminal) de la subunidad mayor de la polimerasa de RNA II resulta ser importante para este proceso del crecimiento del transcrito, ya que en la fase de iniciación de este segmento no está fosforilado, pero durante el crecimiento del transcrito éste se fosforila en los residuos de aminoácidos de prolina, serina y treonina, lo que permite mantener su actividad y movilidad a lo largo de la lectura de la cadena de molde del DNA. Así, cuando hay unos 30 nucleótidos sintetizados, se añade un nucleótido modificado como protector, la 7-metilguanina (m7 Gppp) al extremo 5′.

Brazo aceptor Aminoácido

Brazo TψC

Brazo DHU

Terminación Este punto parece estar relacionado con una secuencia TTATTT. En el caso del RNAm, se corta y se le añade un segmento de adeninas (poli A) por una polimerasa de poliadenilato. Este RNA sintetizado es el RNA heterogéneo nuclear (RNAhn) o transcrito primario, el cual debe modificarse antes de salir del núcleo.

Anticodón Brazo anticodón

Figura 4-11

www.FreeLibros.me

Estructura bidimensional del RNAt en modelo de hoja de trébol.


54

Capítulo 4

Transcripción del ácido ribonucleico (RNA)

RNAt que lleva a su aminoácido correspondiente se le denomina RNAt “cargado”. En E. coli, hay ≈ 60 genes para RNAt, casi todos componentes de operones de RNAr. En el transcrito primario, existen nucleótidos extra en posiciones 3′ y 5′ que se eliminan por las RNAsa P, E, F y D. La longitud de los RNAt varía de especie a especie y en los eucariontes de organelo a organelo, y su longitud es desde 60 hasta 95 nucleótidos (18 a 28 kD), pero la mayoría tiene 76 nucleótidos, aproximadamente. Casi todos los RNAt, como reconoció Holley, presentan una estructura de trébol. Empezando por el extremo 5′, los RNAt tienen las siguientes características comunes: 1. Grupo fosfato en extremo 5′. 2. Un brazo de siete pares de bases que incluye al nucleótido 5′ y puede contener pares de bases diferentes a los de Watson-Crick como G-U. 3. Un brazo de tres a cuatro pares de bases que termina en un giro que con frecuencia contiene la base de uracilo modificada dihidroxiuracilo (D en la figura 4-11), por lo cual se denomina brazo D. 4. Un brazo de tres pares de bases que termina en un giro que contiene el anticodón, el triplete de bases que es complementario con el codón en el RNAm. A esta región se le denomina brazo del anticodón. 5. Un brazo de cinco pares de bases que termina en un giro que casi siempre contiene la secuencia TψC (en donde ψ representa seudouridina); esta región se llama brazo TψC o simplemente T. 6. Todos los RNAt terminan en una secuencia CCA con el OH del extremo 3′ libre. A esta región se le denomina como brazo aceptor o receptor o brazo del aminoácido, porque el aminoácido se une a la A en el OH libre del extremo 3′ de esta región con secuencia 3′—ACC—. 7. Hay 15 posiciones invariables (siempre tienen la misma base) y ocho posiciones semiinvariables (contienen sólo una purina o pirimidina) que se presentan en los giros. El sitio de mayor variabilidad en los RNAt se encuentra en el denominado brazo variable, que tiene tres a 21 nucleótidos y puede tener una región lineal de siete o más pares de bases. La estructura tridimensional del RNAt fue resuelta de manera independiente por Rich y Sung Hou Kim, y en un cristal diferente por Klug en 1974, a través de estudios de cristalografía de rayos X en el RNAtPhe de levadura. La molécula asume una conformación en forma de L, en la cual la longitud de la L está dada por los brazos T y receptor formando una doble hélice. La parte restante de la L se forma por los brazos D y del codón (fig. 4-12). Muchos pre-RNAt eucariontes tienen intrones que varían de cientos a miles de nucleótidos. Estas estructuras no tienen la secuencia —CCA en 3′ que está presente en los RNAt de E. coli; por el contrario, la secuencia es

Figura 4-12

Estructura tridimensional sobre la estructura del RNAt en forma de L.

agregada por la nucleotidiltransferasa de RNAt, una enzima que también existe en procariontes, pero su función está en la reparación del RNAt.

RNAr Los siete operones para RNAr en E. coli contienen una copia casi idéntica de los tres genes para RNAr. Sus transcritos primarios, policistrónicos, son mayores de 5 500 nucleótidos; contienen en su extremo 5′ al RNAr de 16S seguido de los transcritos 1 o 2 de RNAt, el RNAr de 23S, luego el RNAr de 5S y en algunos operones también hay 1 o 2 RNAt más en el extremo 3′. La elucidación de la maduración de estas moléculas se realizó con mutaciones en una o más de las enzimas que catalizan el proceso. El procesamiento inicial que produce pre-RNAr comienza cuando los transcritos todavía se están sintetizando. El proceso consiste en cortes endonucleotídicos específicos que son catalizados por la RNAsa III, la RNAsa P, la RNAsa E y la RNAsa F, nucleasas para las cuales existen sitios de corte específicos en el transcrito (fig. 4-13).

Metilación La incrustación de radicales metilo es una de las modificaciones más frecuentes en los ácidos nucleicos; así, el RNAr 16S y 23S son metilados en 24 nucleósidos específicos de su secuencia. El donador de los grupos metilo es la S-adenosilmetionina (SAM). Este proceso produce a los residuos N6,N6-dimetiladenina u O2′-metilrribosa. Se sabe que la degradación de estos ácidos nucleicos por las RNAsa requiere del grupo OH en posición 2′ de la ribosa, por lo cual se cree que la metilación en esta posición es un protector de los enlaces fosfodiéster (fig. 4-14).

www.FreeLibros.me


Modificaciones postranscripcionales de RNA

55

guanina (GMP, GDP o GTP), pero en ausencia de proteínas, su único intrón de 413 nucleótidos se autocorta y se unen los exones adyacentes. Este proceso de autoedición también ocurre en las mitocondrias de hongos y plantas; e igual se ha encontrado en los cloroplastos. La reacción de corte consiste en una serie de esterificaciones que no necesitan de energía externa. Probablemente el intrón adquiere estructura terciaria específica que lo hace asemejarse a una enzima de RNA; a este tipo de moléculas se les conoce como ribozimas. La observación de que los ácidos nucleicos (pero no las proteínas) pueden dirigir su propia síntesis ha llevado a la hipótesis de que el RNA fue la molécula catalítica original en los tiempos precelulares (el llamado mundo del RNA) y que las moléculas proteínicas químicamente más versátiles aparecieron de manera tardía en la evolución molecular. Figura 4-13

Mecanismo de la modificación postranscripcional del RNAr.

Semejanza entre procariontes y eucariontes El genoma de los eucariontes contiene típicamente cientos de copias repetidas de genes de RNAr que están contenidos en el nucléolo. El nucléolo es el sitio de transcripción y procesamiento del RNAr y de ensamblaje de las subunidades ribosómicas.

Autoeditables Pocos genes para RNAr eucariontes poseen intrones. Thomas Cech, al estudiar este proceso de ajuste (corte y empalme) (edición) en el RNA en el ciliado Tetrahymena thermopila, descubrió que el RNA puede actuar como una enzima. Cuando se aísla el pre-RNAr de este organismo y se incuba con guanosina o nucleótidos libres de

RNAm En los procariontes, la mayoría de los transcritos primarios son funcionales inmediatamente después, e incluso durante su síntesis. Es decir, estos RNAm participan en la traducción, sin modificación alguna. De hecho, en estos organismos, los ribosomas por lo general comienzan la traducción en la cadena naciente del RNAm. En los eucariontes por el contrario, el RNAm se produce en el núcleo, y su traducción ocurre en el citoplasma. En el nucleoplasma, durante el camino al citoplasma, los RNAm sufren alteraciones en su estructura. A estos cambios se les denomina modificaciones postranscripcionales que son un proceso de maduración en donde se incluyen modificaciones en el OH-3′ con la adición de un poliadenilato y en ppp-5′ con la adición de un protector y la edición que consiste en el corte y unión alternante para eliminar los intrones y unir los exones.

Maduración del RNAm Adición del protector en ppp-5′ Los RNAm eucariontes maduros poseen un protector que se agrega enzimáticamente y que consiste en un residuo de 7-metilguanosina unido en el extremo inicial (5′) por un enlace trifosfato (5′ppp-5′) (fig. 4-15). La estructura del protector de los RNAm eucariontes se puede encontrar en tres formas: 0: no tiene modificaciones (forma predominante en organismos eucariontes unicelulares). 1: el nucleótido líder está 02′metilado (forma predominante en organismos multicelulares). 2: los dos primeros nucleótidos están 02′metilados.

S-adenosilmetionina (SAM)

Figura 4-14

Sitio específico para la metilación del RNAr.

El protector se une por una guanililtransferasa específica; después de ≈ 20 nucleótidos, define el sitio de inicio

www.FreeLibros.me


56

Capítulo 4

Transcripción del ácido ribonucleico (RNA)

tienen información únicamente para un gen, a diferencia de los operones procariontes. La señal de terminación de la transcripción en los eucariontes no se ha determinado con precisión, debido a que el proceso es impreciso, es decir, los transcritos primarios de los genes estructurales tienen secuencias 3′ heterogéneas. A pesar de lo anterior, los RNAm maduros presentan secuencias 3′ definidas; casi todos ellos terminan en colas de poli A de 20 a 50 nucleótidos, que no son necesarios para la transcripción in vitro. Las colas de poli A se unen a la proteína de unión al poli A (PABP), lo que genera una ribonucleoproteína. PABP protege al RNAm y su presencia reduce la velocidad de degradación del RNAm (fig. 4-16). La mutación de la cola de poli A de un transcrito presenta una vida media (t1/2) menor a 30 min en el citoplasma; por el contrario, el mismo transcrito con su cola de poli A tiene una t1/2 que varía de horas a días. Esta cola se agrega al transcrito primario en dos reacciones.

Base 1

7-metilguanilato Base 2

Base 3 Pi fosfohidrolasa metilo

PPi guanililtransferasa Guanino-7-metiltransferasa

metilos

Figura 4-15

1. El transcrito se corta en una posición entre 15 y 25 nucleótidos, pasando una secuencia conservada AAUAAA, que, al mutarse, inhibe el corte y la poliadenilación. 2. La cola de poli A se genera a partir de ATP, gracias a la catálisis de la polimerasa de poli A.

2‘0-metiltransferasa

Proceso de maduración del RNAm a través de la adición del protector (cap) en la terminal 5‘.

Adición del RNAm La mayor diferencia entre los genes estructurales eucariontes y procariontes es que las secuencias de la mayoría de los genes eucariontes combinan secuencias de expresión con secuencias de no expresión. Los transcritos primarios son muy heterogéneos en longitud, desde ≈ 2 000 hasta más de 20 000 nucleótidos y son mucho más largos de lo que se esperaría para el tamaño de las proteínas que producen. La longitud de los intrones en los vertebrados varía entre ≈ 65 y ≈ 200 000 nucleótidos con periodicidad no

de la traducción. Si el nucleótido líder es adenosina (por lo general es una purina), puede estar también metilada en posición N6.

Adición del poliadenilato (poli A) en OH-3′ Los RNAm eucariontes a diferencia de los procariontes son siempre monocistrónicos; esto quiere decir que con-

oli

l

ña

Se

A

p de

a

5´ -gccccctttcacctccag

g gt

cc

ac

Endonuclesa RNAm 5´

aataaa Polimerasa de poli A RNAm de poli A

Figura 4-16

aataaa

Proceso de maduración del RNA por la adición de la cola de poli A en la terminal 3′.

www.FreeLibros.me


Regulación de la transcripción

57

(U1-RNAnp, así llamada porque pertenece a la subfamila de RNAnp ricos en U), es parcialmente complementaria a la secuencia consenso de la unión 5′. Hay otras RNPnp: U2-RNAnp, U4-U6 y U5-RNAnp, que juntas forman el editosoma que tiene entre 50 y 60S. Esta molécula consiste en 5 RAN y al menos 50 polipéptidos; es comparable en tamaño y complejidad con la subunidad grande (50S) del ribosoma de E. coli que consta de 2 RNA y 31 polipéptidos. Al parecer, el proceso consiste en la escisión de los intrones de manera individual en dirección 5′ → 3′ (fig. 4-17).

obvia. La formación del RNAm eucarionte comienza con la transcripción del gen estructural completo, que incluye a los intrones formando el pre-RNAm; después viene la adición del protector en el extremo ppp5′ y la del poli A en OH-3′; luego, se cortan los intrones y se pegan los exones, dando origen al RNAm maduro. Este proceso de ajuste (corte y empalme) se hace con mucha precisión, pues si se deja o corta una base de más, la proteína que se produce puede no ser funcional; los exones nunca se mueven de lugar, tienen el mismo orden en el RNAm maduro que en el gen. La comparación de los sitios de unión de los intrones y exones de muchos genes eucariontes indica que tienen un alto grado de homología. Breathnach y Chambon describieron por primera vez una región invariable GU en la unión 5′ del intrón y una región AG en la unión 3′. Estas señales son necesarias y suficientes para definir el proceso de ajuste (corte y empalme) (edición) de las uniones. ¿Cómo es el reconocimiento entre exones? Parte de la respuesta se debe a experimentos realizados por Steiz. Desde 1960 se conoce que el núcleo contiene numerosas copias de diferentes RNA muy conservados que varían entre 60 y 300 nucleótidos y que se denominan RNA nucleares pequeños (RNAnp). Estas moléculas forman complejos con pequeñas proteínas. A estos complejos se les denomina ribonucleoproteínas nucleares pequeñas (RNPnp). Steiz reconoció que una de estas proteínas

Metilación Durante o poco tiempo después de la síntesis de los preRNAm de vertebrados, ≈ 0.1% de los residuos de A están metilados en la posición N6. Estos m6As tienden a ocurrir en secuencia RRm6ACX, en donde X es rara vez una G. La función de este proceso se desconoce, pero una gran cantidad de estos residuos forma parte del RNAm maduro.

REGULACIÓN DE LA TRANSCRIPCIÓN Dentro del metabolismo celular, encontraremos enzimas que son necesarias de manera continua y otras que sólo lo serán en determinadas circunstancias. Las primeras se sintetizan siempre, mientras las segundas sólo en determinadas condiciones. Es decir, que la célula debe contar

Inicio de la transcripción

EXÓN 1

INTRÓN

EXÓN 2

Promotor Secuencias de corriente arriba

Secuencias de corriente abajo

Transcripción

EXÓN 1

INTRÓN

EXÓN 2

PreRNAm

Edición

EXÓN 1

EXÓN ´2

Se agrega caperuza y cola CAP 5´

Figura 4-17

EXÓN 1

EXÓN ´2

AAAAA

3´ RNAm

Proceso de ajuste del RNAm por corte y unión alternativos de exones y eliminación de intrones por ribonucleoproteínas.

www.FreeLibros.me


58

Capítulo 4

Transcripción del ácido ribonucleico (RNA)

con mecanismos que le permitan regular esta síntesis, ya que sería un gasto de energía innecesario el transcribir y traducir una proteína que luego no se ha de utilizar. Los principales mecanismos de regulación de la expresión génica recaen en el proceso de transcripción. Es así como la célula podrá “elegir” qué genes transcribe

y cuáles no, dependiendo de las necesidades metabólicas reinantes en ese momento. Cada día se postulan más mecanismos por los cuales la transcripción puede ser regulada. Así, el siguiente capítulo de esta obra explica algunos de los mecanismos más comunes que utiliza la célula para este proceso de regulación.

Páginas web para consulta y complemento conceptual http://www.web-books.com/MoBio http://en.wikipedia.org/wiki/Molecular_biology http://www.bmbq.uma.es/RE/re_protocolos.html http://www.molecularstation.com/ http://users.rcn.com/jkimball.ma.ultranet/BiologyPages/T/ Transcription.html

http://en.wikipedia.org/wiki/Transcription_(genetics) http://web.indstate.edu/thcme/mwking/rna.html http://www.elmhurst.edu/~chm/vchembook/583rnatrans.html http://www.phschool.com/science/biology_place/biocoach/ transcription/intro.html

www.FreeLibros.me


Capítulo

5

Regulación de la transcripción Dra. Adriana María Salazar Montes Dra. Ana Soledad Sandoval Rodríguez Dr. Juan Armendáriz Borunda

La información genética de una célula está contenida en su DNA. El DNA contiene la información necesaria para crear miles de moléculas diferentes y con ello conformar un individuo completo. Un organismo procarionte como una bacteria, consta de millones de nucleótidos, en tanto que uno eucarionte, como el humano, cuenta con varios billones. A pesar de contener toda esa información, la célula expresa sólo una fracción de sus genes, lo que le da un fenotipo característico, de tal modo que cada uno de los 10 000 tipos de células que constituyen a los organismos multicelulares expresan genes diferentes. Aunque los diversos tipos de células en un organismo multicelular contienen la misma información genética, difieren ampliamente en estructura y función. Una neurona y un linfocito por ejemplo son muy diferentes, por lo que sería difícil pensar que estas dos células contienen el mismo genoma como sucede en realidad. Por esta razón, se pensaba que los genes se perdían cuando las células se diferenciaban. Ahora se sabe que las células de un organismo multicelular son distintas porque sintetizan diferentes RNAm y por ende diferentes proteínas a partir del mismo genoma.

REGULACIÓN DE LA EXPRESIÓN GÉNICA Uno de los principios fundamentales de la biología celular es que la actividad y propiedades de cada célula están determinadas por las proteínas que contienen. Pero, ¿qué determina los tipos y la cantidad de proteínas que se encuentran en una célula? ¿Qué determina la frecuencia con que los RNAm son traducidos y la estabilidad de las proteínas? El término expresión génica se refiere al proceso mediante el cual la información codificada en un gen es traducida en una proteína. Aunque la expresión de un gen puede regularse a diferentes niveles desde su transcripción a partir del DNA, hasta la formación de una proteína madura y activa (fig. 5-1), el mayor punto de control se da a nivel de la transcripción. Sin embargo, la expresión génica puede ser regulada en cualesquiera de los siguientes niveles: 1. Transcripción. 2. Procesamiento del transcrito primario de RNA. 3. Transporte del RNAm al citoplasma.

59

www.FreeLibros.me


60

Capítulo 5

Regulación de la transcripción

DNA 1 Transcripción

Célula

Núcleo

RNA Procesamiento de RNAm 2 Citoplasma

6

Actividad de la proteína

Transporte de 3 RNAm

Degradación de RNAm

5

Traducción 4

Proteína

Figura 5-1

4. Traducción del RNAm. 5. Degradación del RNAm. 6. Activación e inactivación de proteínas. La estructura de los genes cambia cuando van a ser transcritos, lo que sugiere que un cambio conformacional es el primer paso en la expresión génica.

CONTROL TRANSCRIPCIONAL La primera evidencia de que había proteínas reguladoras fue descubierta en 1950. Al realizar análisis genéticos en bacterias, se observó que ciertas proteínas se unían a secuencias específicas del DNA y que esta unión era necesaria para la activación e inactivación de genes.

Control transcripcional en procariontes En las bacterias, el control de la transcripción está dado principalmente por los cambios en el ambiente donde se encuentran, lo que determina su crecimiento y proliferación. Aunque en organismos multicelulares la expresión de algunos de sus genes es también controlada por la disponibilidad de alimento, en la mayoría de ellos el proceso de la transcripción es regulado por programas genéticos que controlan su desarrollo embrionario y la diferenciación celular. Muchos de los principios de regulación transcripcional se descubrieron en las bacterias y se aplican también a células eucariontes.

Operón Lac Escherichia coli es una bacteria que puede usar glucosa u otros azúcares como fuente de energía. Cuando esta bacteria crece en un medio que contiene glucosa, la actividad de las enzimas degradadoras de lactosa están apagadas. Sin embargo, en un medio abundante en lactosa,

la expresión de estas enzimas se activa. Las enzimas producidas por la presencia de lactosa son codificadas en una estructura llamada operón Lac, la cual incluye tres genes: Z, Y y A (fig. 5-2); los genes Z y Y participan en el metabolismo de la lactosa. El Y codifica para una permeasa de lactosa, la cual se localiza en la membrana de la bacteria; usando la energía del gradiente electroquímico, bombea la lactosa a través de la membrana hacia adentro de la célula. El gen Z codifica para la β-galactosidasa, una enzima que rompe el enlace glucosídico de la lactosa, liberando los dos monosacáridos que la constituyen (la glucosa y la galactosa); estos azúcares son metabolizados por enzimas codificadas en otros operones. El gen A codifica para la enzima tiogalactosidasa transacetilasa, cuyas funciones fisiológicas no han sido bien dilucidadas. Todos los genes del operón Lac son coordinadamente regulados. El operón Lac provee uno de los más sencillos ejemplos de regulación génica. Algunas moléculas de estructura similar a la lactosa pueden inducir la expresión del operón, aunque no pueden ser hidrolizados por la β-galactosidasa. En el funcionamiento normal del operón Lac, existe una proteína llamada represor que inhibe su expresión. En ausencia de lactosa, esta proteína permanece unida al DNA. Cuando la lactosa está presente en el medio, se une al represor impidiendo que éste se una al DNA, permitiendo así la transcripción del operón Lac y con ello la expresión de los tres genes que actuarán en la degradación de la lactosa.

Control transcripcional en eucariontes La transcripción génica es controlada por una región de DNA ubicada cerca del sitio de inicio de la transcripción a la que se le llama región reguladora. Algunas regiones reguladoras son sencillas y constan de un fragmento pequeño de DNA de secuencia definida; estas regiones están regidas por una sola señal y actúan controlando la actividad de los genes. Otras son complejas, responden a una variedad de señales y actúan como pequeños microprocesadores que interpretan e integran el “encendido y apagado” de genes vecinos. La transcripción es controlada por proteínas especializadas llamadas proteínas reguladoras de un gen o factores transcripcionales. Un mismo factor transcripcional puede servir como controlador común a muchos genes al mismo tiempo. Esto se debe a que todos ellos comparten la misma secuencia en su promotor, la cual es reconocida por el factor transcripcional. Las proteínas reguladoras se unen a secuencias específicas de DNA de aproximadamente 20 pares de nucleótidos de longitud cerca de los genes que regulan. El reconocimiento entre la proteína y el DNA se realiza a través del surco mayor y se debe a que la estructura de la proteína es complementaria a la superficie espacial de la doble hélice; la proteína hace contacto con el DNA

www.FreeLibros.me


Control transcripcional

61

Represor unido al operador

Inductor se une al represor

Represor unido al operador

Inductor se une al represor

Figura 5-2

a través de puentes de hidrógeno, enlaces iónicos e interacciones hidrófobas. Aunque estos tipos de enlaces son débiles, los más de 20 contactos aseguran que la unión sea fuerte y sumamente específica (fig. 5-3). Las secuencias de DNA donde se unen estos factores transcripcionales con frecuencia se encuentran localizadas lejos del sitio de inicio de la transcripción, algunas

veces hasta miles de pares de base, corriente arriba o abajo del mismo. La polimerasa de RNA inicia la transcripción en una base específica dentro del promotor corriente arriba de las regiones codificadoras. Los primeros genes en ser secuenciados y estudiados fueron los virales y los que codifican para proteínas que

www.FreeLibros.me


62

Capítulo 5

Regulación de la transcripción

en una tasa constante, los cuales codifican para proteínas expresadas de modo permanente; a estos genes se les llama genes de expresión constitutiva. Entre estos genes se encuentran el gen de deshidrogenasa de gliceraldehído3-fosfato (GA3PDH) y actina β, entre otros. Los genes constitutivos no contienen caja TATA o iniciador en su promotor, pero contienen regiones ricas en GC que son reconocidas por factores transcripcionales especiales. Además de los elementos reguladores mencionados, la transcripción de muchos genes eucariontes puede ser estimulada por elementos de control llamados potenciadores, los cuales se localizan a miles de pares de bases de distancia del sitio de inicio de la transcripción.

ESTRUCTURA DE LAS PROTEÍNAS REGULADORAS

Figura 5-3

participan en el ciclo celular. Todos estos genes tienen una tasa de transcripción alta; contienen una secuencia altamente conservada llamada caja TATA (por estar compuesta de timinas y adeninas), la cual se encuentra entre 25 y 35 pares de bases corriente arriba del sitio de inicio de la transcripción (fig. 5-4). Estudios in vitro de mutagénesis dirigida han demostrado que el cambio en una sola base en esta estructura disminuye de manera drástica la transcripción de los genes adyacentes a ella. En la mayoría de los casos, cambios en las secuencias existentes entre la caja TATA y el sitio de inicio de la transcripción no afectan la tasa de transcripción. La transcripción de los genes que contienen caja TATA o iniciador comienza en sitios bien definidos a una distancia de alrededor de 20 a 200 pares de bases de ellos. Hay genes que se transcriben

Proteínas reguladoras

El análisis conformacional de los factores transcripcionales ha permitido sugerir que hay ciertas estructuras comunes, pequeñas partes dentro de la molécula a través de las cuales se unen al DNA o a otros factores. Estos dominios son los encargados de la activación de la transcripción, ya que a través de ellos las proteínas reguladoras interactúan con el aparato basal. Según su estructura, los factores transcripcionales se han clasificado en cuatro grupos.

Hélice-vuelta-hélice Las primeras proteínas de unión al DNA en reconocerse fueron las que tienen estructura de hélice-vuelta-hélice (helix-turn-helix, HTH por sus siglas en inglés); se encuentran tanto en eucariontes como en procariontes, y casi todas las proteínas de unión al DNA tienen esta conformación; constan de dos estructuras de hélice α unidas por una cadena corta de aminoácidos, lo cual provoca un giro específico en la estructura de cada una de las proteínas y les permite unirse a una región determinada de DNA. Un ejemplo de este tipo de proteína es el represor del operón Lac (fig. 5-5).

Factores generales de transcripción Potenciador

Potenciador

Región codificadora Sitio de inicio de la transcripción Promotor

Figura 5-4

www.FreeLibros.me


Estructura de las proteínas reguladoras

Vuelta

Hélice 2

Hélice 1

COOH

NH2

Figura 5-5

63

estructura se observan dos subgrupos de gran relevancia: el primero está formado por moléculas con una disposición estructural de hélice α y una hélice β plegada unidas por un átomo de cinc; a este arreglo se le pueden agregar más moléculas de cinc posteriormente. El segundo subgrupo consta de una estructura similar a la de hélicevuelta-hélice, en la cual dos hélices α están unidas por dos átomos de cinc (fig. 5-6). Los receptores de esteroides, glucocorticoides y estrógenos tienen dos dedos de cinc en su estructura. Cada uno de los dedos controla una función específica de la proteína. El dedo derecho controla la habilidad para unirse al DNA; el dedo izquierdo le permite unirse a otras proteínas para formar dímeros. Entre otras proteínas con este tipo de estructura está el factor transcripcional SP1, el cual consta de tres dedos de cinc. Factores transcripcionales que asisten a las polimerasas de RNA II y III como el factor basal TFIIIA presentan también este tipo de estructura.

Dedos de cinc

Cierre de leucinas

Un segundo grupo importante de proteínas de unión al DNA contiene en su estructura una o más moléculas de cinc y se denominan dedos de cinc. En este tipo de

Las proteínas reguladoras que se unen al DNA por lo general lo hacen formando dímeros, quizá porque así se consigue una unión más fuerte. El dominio de la proteína

COOH COOH

Zn++ Zn++

NH2

NH2

Zn++

Zn++

Figura 5-6

www.FreeLibros.me

Zn++


64

Capítulo 5

Regulación de la transcripción

que se fija a otra para formar dímeros suele diferir del de la unión al DNA; sin embargo, existe una estructura que combina estas dos funciones en un solo dominio; se conoce como cremallera o cierre de leucinas, porque las hélices α de cada monómero contienen un residuo de leucina cada siete a ocho aminoácidos y se unen por interacciones hidrófobas entre los aminoácidos que los componen para formar un enrollamiento corto. Las hélices α se mantienen unidas por interacciones hidrófobas entre los aminoácidos que las componen. Este tipo de proteínas reguladoras puede formar homodímeros si los monómeros son idénticos, o heterodímeros cuando son diferentes. El factor transcripcional AP-1 es un buen ejemplo de este tipo de estructura. Esta proteína es un heterodímero formado por dos subunidades llamadas fos y jun; la región terminal C de jun está incluida en la dimerización y en la unión al DNA (fig. 5-7).

Arreglo de hélice-asa-hélice Las dos características fundamentales de las proteínas de unión al DNA que son la presencia de regiones helicoidales y la habilidad para formar dímeros las encontramos en este grupo de proteínas. Constan de una hélice α corta conectada por una horquilla a otra hélice α más grande. Las proteínas pertenecientes a este grupo pueden formar homodímeros o heterodímeros. Una región de la proteína con aminoácidos básicos es la que se une

al DNA. Un dímero cuyas subunidades tengan esta característica puede unirse al DNA con ambas subunidades (fig. 5-8).

ACTIVACIÓN DE LOS FACTORES TRANSCRIPCIONALES La actividad de una proteína que actúa como factor transcripcional es regulada por modificaciones postranscripcionales. Hay diversos mecanismos por los cuales los factores transcripcionales pueden ser activados. 1. La proteína se sintetiza sólo cuando se necesita y se degrada rápidamente por proteólisis, de tal manera que nunca se acumula. 2. Un factor puede ser activado o inactivado por la unión a su ligando. Un ejemplo es el receptor de esteroides. Esta proteína se encuentra de manera natural e inactiva en el citoplasma de las células. Por su naturaleza lipófila, los esteroides atraviesan la membrana celular por difusión simple, uniéndose a su receptor en el citoplasma propiciando así su transporte hacia el núcleo y su unión al DNA. 3. Activación por fosforilación. Este mecanismo es el más comúnmente utilizado y consiste de la adición de un grupo fosfato en algún aminoácido del factor transcripcional por una cinasa, lo que conlleva a la activación del mismo. Casi todos los factores trans-

COOH COOH Leu Leu Leu Leu Leu NH2

NH2

Leu

Figura 5-7

www.FreeLibros.me

Leu Leu Leu Leu Leu Leu


Activación de los factores transcripcionales

65

Vuelta

Hélice 1

Hélice 2 NH2

COOH

Figura 5-8

cripcionales se activan a través de este mecanismo; entre ellos está AP-1 (proteína activadora 1). 4. La formación de un complejo entre varias proteínas da como resultado un factor transcripcional activo con capacidad de migrar al núcleo y unirse al DNA. 5. El factor transcripcional se encuentra en complejo con otra proteína que funciona como inhibidor. Cuando el inhibidor es fosforilado, se desprende del factor transcripcional, permitiendo su traslado al núcleo y su unión al DNA. El factor transcripcional NF-κB se activa a través de este mecanismo en donde la proteína que funciona como inhibidor se llama I-κB (fig. 5-9). Las mutaciones en factores transcripcionales pueden ocasionar que éstos actúen desordenadamente activando o inactivando genes sin control convirtiéndose en oncogenes.

Activación e inactivación de genes La regulación de la transcripción en eucariontes es muy compleja y difiere de la de procariontes, principalmente en los siguientes pasos: a) La polimerasa del RNA eucarionte no puede iniciar por sí misma la transcripción; requiere de un grupo de proteínas reguladoras llamadas factores generales de la transcripción, las cuales se ensamblan al DNA en un sitio llamado promotor, localizado corriente arriba del sitio de inicio de la transcripción. El ensamblaje

de los factores generales consta de varias etapas en donde la velocidad depende de las señales reguladoras que se reciban. b) La mayoría de los factores transcripcionales actúa a miles de bases de distancia del promotor que regulan, lo que significa que un promotor puede ser controlado por un número ilimitado de secuencias reguladoras localizadas a lo largo de la cadena del DNA.

Factores generales de transcripción El hallazgo de que la polimerasa del RNA eucarionte por sí sola no puede iniciar la transcripción condujo al descubrimiento de proteínas adicionales conocidas como factores generales de la transcripción. Estas proteínas, conocidas como TFIIA, TFIIB, TFIID, TFIIE, TFIIF, TFIIH y TFIIJ (por sus siglas en inglés transcriptional factor, TF y II por estar asociadas a la polimerasa del RNA II), se ensamblan en el promotor de los genes de manera coordinada asistiendo la unión y acción de la polimerasa del RNA. El ensamblaje se inicia con la unión del factor transcripcional TFIID a la secuencia TATA en el promotor (formada por dos tipos de proteínas diferentes: TBP y TAF, TATA binding protein y TBP asociates factors, respectivamente). Después se incorporan los factores TFIIA y TFIIB y sólo entonces la polimerasa de RNA II acomplejada con el TFIIF puede unirse al promotor. TFIIE, TFIIH y TFIIJ se acoplan después a este complejo. Una vez reunidos todos estos elementos, TFIIE con su acción de helicasa desenrolla el DNA y TFIIH

www.FreeLibros.me


66

Capítulo 5

Regulación de la transcripción

Subunidad de unión al DNA Adición de subunidad

Desenmascaramiento Inhibidor

Núcleo

Estimulación de entrada al núcleo Proteína inhibidora Unión al ligando

Fosforilación de proteína

Figura 5-9

fosforila a la polimerasa del RNA II activándola. En este momento, todos los componentes del complejo de los factores generales de transcripción se liberan y se inicia la transcripción (fig- 5-10).

Regulación mediante potenciadores En 1979, causó sorpresa el descubrimiento de ciertas secuencias de nucleótidos en los promotores de eucariontes, llamadas potenciadores, las cuales participan en la transcripción de los genes. Esta secuencia sirve como sitio de anclaje para proteínas reguladoras, las cuales a través de un cambio conformacional y formando una horquilla interactúan directamente con los factores generales de la transcripción y la polimerasa del RNA para el inicio de la transcripción.

de los factores transcripcionales actúa en complejos, aunque algunos lo hacen de manera individual. No todos los factores transcripcionales activan la transcripción, pues algunos son proteínas represoras que la suprimen, por lo que un factor transcripcional puede formar parte de complejos que activan o inhiben la transcripción.

CONTROL POSTRANSCRIPCIONAL El control en el inicio de la transcripción es la forma predominante de regulación génica; sin embargo, hay otros controles menos comunes que regulan la expresión de un gen en el paso de RNA a proteínas, los cuales se conocen como controles postranscripcionales (cuadro 5-1).

Atenuación de la transcripción

Región reguladora (promotor + potenciador) La región reguladora de un gen es una secuencia de DNA de tamaño variable constituida por el promotor y el potenciador; su nombre obedece a que a través de ella se regula la velocidad de transcripción. Así, una región reguladora en un gen eucarionte consta de dos variantes: a) promotora, en donde se ensamblan los factores generales de transcripción y la polimerasa de RNA y b) potenciadora, en donde se unen los factores transcripcionales inducibles que controlan la velocidad de transcripción. La mayoría

En organismos procariontes como las bacterias, la expresión de ciertos genes es inhibida por la terminación prematura de la transcripción, fenómeno que se denomina atenuación de la transcripción. En estos casos, la cadena de RNA recién sintetizada adopta una estructura que interactúa con la polimerasa del RNA y trunca la transcripción. Cuando la proteína codificada por este gen es requerida por la célula, las proteínas reguladoras se unen a la cadena naciente de RNA y reacomodan su estructura, permitiendo así la restauración de la transcripción y, por tanto, la producción de una molécula de RNAm completa.

www.FreeLibros.me


Control postranscripcional

67

TAF

TBP 5´

3´ TATA

Sitio de inicio de la transcripción

Promotor

TFIID TATA

TFIIB

TFIIF TFIID

TFIIE

TFIIH TFIIB

RNA Pol ll

TFIID

TFIID

RNAPolI RNA Pol ll

TFIIF

RNA Pol ll

Figura 5-10

La atenuación de la transcripción en eucariontes puede ocurrir por distintos mecanismos. En células infectadas por adenovirus o retrovirus (p. ej., el virus de la inmunodeficiencia humana, VIH), las proteínas que se ensamblan en el promotor determinan si la polimerasa de RNA puede truncar la transcripción. Estas proteínas pueden ser diferentes de una célula a otra, y la célula puede controlar el nivel de atenuación de un gen en particular.

Control del procesamiento del RNA Gran cantidad de genes son transcritos como RNA precursores y son procesados después para crear una molécula madura de RNAm. Este proceso se realiza durante el corte y empalme y se conoce como control de procesamiento del RNA, en el cual los intrones son retirados del

RNAm precursor, dejando exclusivamente las secuencias exónicas que contienen la información para formar un péptido. En una misma célula, el RNA precursor puede ser procesado de diversas formas, dando lugar a diferentes cadenas polipeptídicas a partir de un mismo gen. En algunos casos, se realiza un procesamiento alternativo porque ciertos fragmentos en la secuencia codificadora se toman algunas veces como intrones y otras como exones, fenómeno que se conoce como secuencia intrónica ambigua. Este procesamiento del RNA es regulado de manera negativa o positiva. La regulación negativa se hace a través de moléculas que impiden a la maquinaria de procesamiento el acceso al sitio de corte en el RNA; la regulación positiva la realizan moléculas que dirigen a la maquinaria de procesamiento hasta el sitio exacto de corte.

www.FreeLibros.me


68

Capítulo 5

Cuadro 5-1

Regulación de la transcripción

Modificaciones postranscripcionales

Atenuación de la transcripción

Terminación prematura de la transcripción, ocasionada por interacción con la polimerasa del RNA

Control del procesamiento del RNA

Retiro de intrones del RNAm precursor; incluye también el corte y empalme alternativo

Edición del RNA corte y empalme

Inserción o eliminación de nucleótidos del RNAm; la modificación más frecuente es la adición de un uracilo

Control del transporte del RNA

El paso del RNAm por el poro nuclear al citoplasma implica que se ha modificado adecuadamente

Control de la traducción

El reconocimiento del codón de inicio de la traducción puede ser deficiente generando orígenes alternativos

Fosforilación en la síntesis de proteínas

El factor de iniciación de la traducción del IF2 es regulado por fosforilaciones

Proteínas inhibidoras de la traducción

Proteínas que se unen al extremo 5’ del RNAm bloqueando la traducción

Control de la degradación del DNA

Colas de poli A menores a 30 Nt inducen la degradación del RNA

EDICIÓN DEL RNA Este tipo de control postranscripcional se refiere a la modificación debida a inserciones o eliminaciones de nucleótidos en la secuencia original del RNAm, provocando cambios en el mensaje original. La modificación más frecuente es la inserción del uracilo, con lo que se altera hasta 50% la secuencia original. En mitocondrias de plantas, se han observado cambios de citocinas por uracilo (C a U) sin inserción o eliminación de nucleótidos, afectando sólo 10% de la secuencia de aminoácidos de las proteínas formadas a partir de estos RNAm. El descubrimiento de este mecanismo de edición ha permitido sugerir que es la herramienta más utilizada por la célula para cambiar la expresión de los genes. El proceso de edición del RNAm es limitado en mamíferos y sólo se ha observado en los genes de la ApoB y de la proteína de canal del calcio en el cerebro. En el primer caso, una citocina se cambia por un uracilo, generando un codón de terminación prematuro que produce una versión truncada de la proteína; en el segundo caso, se cambia un nucleótido a la mitad de la molécula del RNAm. Esto origina el reemplazo de un aminoácido por otro, lo que altera la permeabilidad del canal del calcio.

sale del núcleo; el resto (80%) es degradado en el núcleo antes de salir. El RNA como cualquier otra molécula sale del núcleo a través del poro nuclear; se trata de un proceso activo que requiere de un nucleótido modificado que sirve como cubierta en el extremo 5′ de la molécula y de la adición de una cadena de adeninas en el extremo 3′ (poliadenilación) llamada cola de poli A. Cuando una molécula de RNAm recién sintetizada cruza por un poro nuclear y se introduce al citoplasma, se encuentra con los ribosomas, los cuales la traducen en una cadena polipeptídica. Si el RNAm codifica para una proteína de secreción o de membrana, la presencia de un péptido, señal en la región aminoterminal determina su transporte hacia el retículo endoplásmico. Este péptido es reconocido por la célula tan pronto sale del ribosoma y entonces el complejo formado por el ribosoma, el RNAm y la proteína naciente se dirigen a la membrana del retículo endoplásmico, donde la cadena polipeptídica terminará de sintetizarse. En otros casos, la proteína entera es sintetizada por ribosomas libres en el citosol, y señales en su estructura la dirigen al sitio en la célula en donde se necesita. Asimismo, algunos RNAm se dirigen a ciertos organelos para sintetizar ahí las proteínas propias del mismo.

Control de la traducción

Control del transporte de RNA

Sitio de inicio

Transporte del núcleo al citoplasma El RNA transcrito primario es aproximadamente 10 veces más grande que el RNAm maduro que sale al citoplasma. Se estima que sólo 20% de la longitud del RNA sintetizado

La traducción comienza cuando la subunidad pequeña del ribosoma reconoce el codón de iniciación en el RNAm. Los nucleótidos vecinos participan en este reconocimiento. Si éste es deficiente, la subunidad ribosómica

www.FreeLibros.me


Mecanismos de fosforilación en la síntesis de proteínas

ignorará el primer codón AUG y saltará hasta el segundo o tercero. Este fenómeno, conocido como búsqueda de escape, es una estrategia para producir dos o más proteínas, diferentes en su extremo aminoterminal a partir de un mismo RNAm. En RNAm virales, se realiza la traducción usando este tipo de mecanismos. Estos RNAm cuentan con secuencias de nucleótidos específicas llamadas sitios internos, las cuales no son reconocidas por el ribosoma, y la traducción se inicia en el segundo codón AUG.

MECANISMOS DE FOSFORILACIÓN EN LA SÍNTESIS DE PROTEÍNAS Otro mecanismo por el cual se puede regular la expresión de un gen es mediante fosforilaciones. Las células eucariontes disminuyen la síntesis de proteínas en condiciones adversas (p. ej., carencia de factores de crecimiento, infecciones víricas, choque térmico, etc.). En este mecanismo de regulación, participa el factor de iniciación EIF-2 (elongation increasing factor, EIF), el cual es fosforilado por cinasas específicas, con lo cual se disminuye la síntesis de proteínas. El EIF-2 forma un complejo con el GTP y media la unión del metionil-RNAt a la subunidad ribosómica pequeña, facilitando el reconocimiento del codón de iniciación. El EIF-2 hidroliza GTP y se libera de la subunidad ribosómica pequeña. Sólo entonces la subunidad ribosómica grande se acopla para formar el ribosoma e iniciar la síntesis de proteínas. Debido a que el EIF-2 se fija fuertemente a GDP, se requiere otra proteína denominada EIF-2B para liberar a GDP; otra molécula de GTP puede entonces unirse de nuevo a la molécula del EIF-2. La fosforilación del EIF-2 bloquea el recambio de GTP; ya fosforilado el EIF-2 se une con mayor fuerza al EIF-2B. Se esperaría que la disminución de la actividad del EIF-2 mermara la traducción de todos los RNAm en la misma proporción. Contrario a esto, la fosforilación del EIF-2 tiene efectos selectivos, incrementado la traducción del RNAm específicos. La regulación por el EIF-2 es importante en el paso de mitosis a la fase Go en células de mamíferos en la cual se minimiza la síntesis de proteínas.

Proteínas inhibidoras de la traducción La traducción puede ser bloqueada también por proteínas que se unen a los RNAm cerca del extremo 5′, donde se inicia la traducción. Este tipo de mecanismo se llama control negativo de la traducción. El acoplamiento de tales proteínas a una molécula de RNAm disminuye o inhibe la traducción. Los RNAm en células bacterianas son muy inestables; su vida media es de unos minutos. Debido a esto, una bacteria puede adaptarse rápido a cambios ambienta-

69

les. En células eucariontes, el RNAm es más estable; por ejemplo, el de la globina β tiene una vida media de 10 h, cuando la de otros es de sólo 30 min. Los más inestables codifican a menudo para proteínas reguladoras, cuya síntesis cambia rápidamente ante un estímulo. La inestabilidad de estos RNAm se debe a que su secuencia es rica en A y U en la región 3′ no traducida (UTR), lo que acelera la degradación del RNAm por estimulación en la eliminación de la cola de poli A. Otros RNAm inestables contienen sitios de reconocimiento en sus extremos 3′ UTR para endonucleasas que cortan al RNAm. Sin embargo, la estabilidad de un RNAm puede cambiar en respuesta a señales extracelulares. En el caso del RNAm que codifica para las histonas, por ejemplo en la fase de síntesis (S) del DNA en el ciclo celular, periodo en el que se requiere de nuevas histonas, tiene una vida media de 1 h; cuando la síntesis de DNA se detiene, los RNAm se inestabilizan y son degradados en pocos minutos. Así, si la síntesis de DNA se inhibe con algún fármaco, los RNAm de las histonas se inestabilizan debido quizá a la acumulación de histonas libres en ausencia de nuevos DNA. La velocidad de degradación de los RNAm depende de manera directa de las señales que actúan en el extremo 3′, en donde se sospecha que comienza la degradación del RNAm.

Control de degradación del RNAm

Cola de poli A y estabilidad del RNAm La adición de la cola de poli A a una molécula de RNAm sucede en todos los RNAm de eucariontes, en el núcleo. En el citosol, la cola de poli A, con una longitud promedio de 200 nucleótidos, se va acortando con el tiempo. No se observan colas de menos de 30 adeninas, lo que sugiere que este es el tamaño mínimo requerido para mantener la estabilidad del RNAm. La observación de que RNAm con colas de sólo 10 a 30 adeninas no son traducidas apoya esta aseveración.

Interrupción de la traducción El proceso de síntesis de proteínas es automático; esto es, una vez iniciado debe terminarse. En casos especiales, un proceso llamado recodificación traduccional puede alterar el curso final de la síntesis de una proteína. Los tipos de recodificación más observados a menudo son los cambios en el marco de lectura. Este tipo de recodificación se usa de ordinario por retrovirus, en el que más de una proteína se sintetiza a partir de un solo RNAm. Estos virus producen tanto las proteínas de la cápside (proteínas gag), como la transcriptasa inversa vírica y las integrasas (polimerasas de proteínas) del mismo transcrito. Los virus necesitan muchas más copias de las proteínas gag que de las polimerasas de proteínas. Para cumplir con estas demandas, los virus hacen este ajuste cuanti-

www.FreeLibros.me


70

Capítulo 5

Regulación de la transcripción

tativo al tener los genes gag y pol en marcos de lectura abierta diferentes, asegurando con un codón de terminación en el extremo de la secuencia codificadora para gag, que sólo traduzca esta proteína. Todos los mecanismos de control postranscripcionales dependen del tipo de molécula de RNA, por lo que algunos pueden ser controlados a través del procesamiento, edición o degradación del RNAm. Dichos mecanismos se acompañan a menudo de proteínas de unión al RNA especializadas. En otros casos, se debe a la presencia de moléculas de RNA complementarias al RNAm que al unirse a él bloquean su transcripción. A este tipo de estrategias se le conoce como RNA antisentido y se han empleado de modo experimental para regular la expresión de algunos genes de células procariontes y eucariontes. Los estudios con RNA antisentido son de gran interés, ya que nos

permiten entender procesos evolutivos. Se cree que las primeras células carecían de DNA y proteínas, y sólo contenían RNA. Estas células primitivas utilizaban el mecanismo antisentido para regular sus funciones. Una buena parte de las reacciones catalizadas por RNA que suceden en las células hoy en día representan los descendientes de moléculas fósiles que controlaban el metabolismo celular hace más de 3.5 billones de años. En la actualidad, gracias a la tecnología del DNA recombinante se pueden obtener in vitro grandes cantidades de RNA puro de cualquier tipo que, en presencia de polimerasas de RNA, nos permiten estudiar con detalle las reacciones químicas catalizadas por RNA. A través de estos y más estudios, se pretende conocer en un futuro no muy lejano los mecanismos de regulación de la expresión génica de las células in vivo.

BIBLIOGRAFÍA Alberts B, Bray D, Lewis J, Raff M, Roberts K, Watson JD. Control of gene expression. En: Alberts B, Bray D, Lewis J, Raff M, Roberts K, Watson JD (eds.). Molecular biology of the cell. 3a. ed. New York: Garland Publishing, 1994:401-474. Armendáriz BJ, Simkevich CP, Roy N, Raghow R, Kang AH, Séller JM. Activation of ITO cells involves regulation of AP-1 binding protein and induction of type I collagen gene expression. Biochem J, 1994;304:1-8. Chan L, Seeburg PH. RNA editing. Scientific American Science & Medicine, 1995:68-77. Lewin B. Genes VII. En: Lewin B (ed.). Regulation of transcription: factors that activate the basal apparatus. 7a. ed. New York: Oxford University Press Inc., 2000:649-684. Lodish H, Berk A, Zipursky L et al. Regulation of transcription initiation. En: Lodish H, Berk A, Zipursky L et al. (eds.).

Molecular cell biology. 4a. ed. Freeman and Company, 2000:341-403. Pabo CT, Sauer RT. Transcription factors: structural families and principles of DNA recognition. Ann Rev Biochem, 1992;61:1053-1095. Sassone CP, Ransone LJ, Lamph WW, Verna IM. Direct interaction between FOS and JUN nuclear oncoproteins: role of the “leucine zipper” domains. Nature, 1988;336:692-695. Tijan R. Molecular machines that control genes. Scientific American, 1995:38-45. Vinson RC, Sigler BP, McKnight LS. Scissors-grip model for DNA recognition by a family of leucine zipper proteins. Science, 1989;246:911-915.

www.FreeLibros.me


Capítulo

6

Síntesis de proteínas Dra. Verónica Chaparro Huerta Dr. Carlos Beas Zárate

que la información correspondiente para sintetizar sus enzimas específicas esté presente en sus células y en su descendencia.

INTRODUCCIÓN Las proteínas, por su tamaño, no pueden atravesar la membrana plasmática de la célula; por eso, existe en su interior un mecanismo que las construye (síntesis) según las necesidades que tenga en ese momento la célula. La síntesis de proteínas o traducción tiene lugar en los ribosomas del citoplasma celular. Los aminoácidos son transportados por el RNA de transferencia (RNAt), específico para cada uno de ellos, y llevados hasta el RNA mensajero (RNAm), donde se aparean el codón de éste y el anticodón del RNA de transferencia, por complementariedad de bases, y de esta manera se sitúan en la posición que les corresponde. Cuando termina la síntesis de una proteína, el RNAm queda libre y puede leerse de nuevo. De hecho, es muy frecuente que antes que finalice una proteína, se inicia la lectura para otra, con lo cual una misma molécula de RNAm es utilizada por varios ribosomas simultáneamente. Este proceso es de fundamental importancia, ya que básicamente todas las características que presenta la célula (fenotipo) se regulan por la suma de sus actividades enzimáticas. En pocas palabras, todo lo que la célula es y puede realizar depende de la acción enzimática específica. Como casi todas las enzimas son proteínas, la morfología y funcionamiento celular depende del tipo de proteína que la célula debe armar. Con el transcurso de la evolución, todos los organismos se aseguraron

CARACTERÍSTICAS DEL RNAT La síntesis del RNAt se realiza a través de la catálisis de la polimerasa del RNA III tal y como se vio en el capítulo de transcripción. Éste se encuentra disperso por todo el citoplasma; es el más pequeño de los tres tipos de RNA y su estructura tiene forma de hoja de trébol. Los RNAt se estructuran por alrededor de 80 nucleótidos con pesos moleculares de cerca de 25 000 daltones (fig. 6-1). Todos los RNAt tienen pG en el extremo 5′ y pCpCpA en el extremo 3′. El extremo 3′ se conoce como brazo del aminoácido o también brazo de unión al aminoácido o “aceptor”. El correspondiente brazo del anticodón contiene el triplete anticodón, el cual reconoce el codón del RNAm y se relaciona con éste por medio de formación de puentes de hidrógeno, siguiendo las reglas de complementariedad de las bases. Cada tipo de RNAt lleva antepuesto el nombre del aminoácido que transporta. Por ejemplo, leucinil-RNAt para la leucina, lisinil-RNAt para la lisina, fenilalanilRNAt para la fenilalanina, metionil-RNAt para la metionina, etcétera. Sin embargo, para poder efectuar esta unión y reconocimiento específico del RNAt con su respectivo aminoácido, se necesita la participación de una enzima 71

www.FreeLibros.me


72

Capítulo 6

Síntesis de proteínas OH

Complejo treonil-polimerasa de RNAt

Aminoacilpolimerasa de RNAt Sitio de revisión

RNAt

Brazo aceptor

Sitio de activación

Lazo del anticodón

Anticodón

Figura 6-1

Reconocimiento específico del lazo del anticodón

Representación esquemática del RNAt. Figura 6-2

específica denominada aminoacilsintetasa, misma que se describe a continuación.

Interacción del brazo aceptor y del brazo anticodón del RNAt con la aminoaciltransferasa.

ACTIVACIÓN Y UNIÓN RNAT

AMINOACILSINTETASA

DEL AMINOÁCIDO AL

Es la enzima que cataliza la activación y la unión del aminoácido correcto al RNAt correcto. Son doblemente específicas por reconocimiento molecular:

Los aminoácidos se activan por medio de las aminoacilsintetasas específicas y de ATP, antes de unir los aminoácidos a su RNAt específico. Los aminoácidos, una vez activados, forman el complejo aminoaciladenilato monofosfatado, liberando el pirofosfato, producto secundario del ATP (fig. 6-3). La misma enzima aminoacilsintetasa localiza al RNAt específico para el aminoácido correspondiente y da lugar a la formación del aminoacil-RNAt, liberándose la enzima para reiniciar otro ciclo con otro aminoácido similar (fig. 6-4).

1. Para cada aminoácido: reconocen propiedades de carga, hidrofobicidad y tamaño. 2. Para cada RNAt correspondiente: interactúan específicamente con el brazo aceptor y con el brazo del anticodón (fig. 6-2). 3. Conocen e interpretan el código genético. Así, son capaces de corregir errores, pues contienen sitios especiales de “revisión”; si el aminoácido es incorrecto, se hidrolizan del RNAt y tienen alta fidelidad. Existen 20 aminoacilsintetasas de RNAt diferentes, cada una específica para reconocer a un aminoácido y al RNAt compatible con él. Ambos reconocimientos permiten que cada uno de los 31 tipos de RNAt se una a sólo uno de los 20 aminoácidos utilizados durante la síntesis proteínica. Ello es posible porque cada aminoacilsintetasa de RNAt identifica al RNAt por el anticodón, la parte más específica del RNAt.

Ribosaadenina + Ppi Aminoácido

Figura 6-3

www.FreeLibros.me

Aminoacil-adenilato (aminoacil-AMP)

Reacción de activación de un aminoácido.


Iniciación de la síntesis de proteínas RNAt

73

Lugar de unión del aminoácido

Asa T

Asa D

Figura 6-4

Representación del aminoacil-RNAt.

MADURACIÓN Y/O PREPARACIÓN DEL RNAT PARA UNIRSE AL RIBOSOMA El trabajo de los RNAt consiste en tomar del citosol los aminoácidos y conducirlos al ribosoma en el orden marcado por los nucleótidos del RNAm, que son los moldes del sistema. Así, la función básica de los RNAt es alinear a los aminoácidos siguiendo el orden de los codones para poder cumplir con sus funciones; los RNAt adquieren una forma característica semejante a un trébol de cuatro hojas. Los cuatro brazos se generan por la presencia en los RNAt de secuencias de tres a cinco pares de nucleótidos complementarios, los cuales se aparean entre sí como los nucleótidos de las dos cadenas del ácido desoxirribonucleico (fig. 6-5). En la punta de uno de los brazos confluyen los extremos 5′ y 3′ del RNAt. El extremo 3′ es más largo, de modo que sobresale el trinucleótido CCA que fue incorporado durante el procesamiento postranscripcional del RNAt. Este brazo se llama aceptor, porque a él se liga el aminoácido, que se une a la A del CCA. Los tres brazos restantes poseen en sus extremos secuencias de 7 a 8 nucleótidos no apareados, con forma de asas, cuyas denominaciones derivan de los nucleótidos que las caracterizan. Una de ellas contiene el triplete de nucleótidos del anticodón, por lo que su composición varía en cada tipo de RNAt. Otra, en virtud de que contiene dihidrouridinas (D), se denomina asa D. La tercera se conoce como asa T, por el trinucleótido TΨC que la identifica. La letra T simboliza a la ribotimidina y la Ψ a la seudouridina. Entre el asa T y el anticodón, existe un asa adicional llamada variable, porque su longitud difiere en los distintos RNA de transferencia.

Anticodón

Figura 6-5

Esquema del RNAt maduro para su unión con el ribosoma.

Un plegamiento ulterior en el RNAt hace que deje de parecerse a un trébol de cuatro hojas y adquiera la forma de la letra L (fig. 6-6). El cambio se debe a que se establecen apareamientos poco comunes entre algunos nucleótidos, como la combinación de un nucleótido con dos a la vez. Una vez que el RNAt adquiere la forma L, las asas D y T pasan a la zona de unión de sus dos ramas, y el brazo aceptor y el triplete de bases del anticodón se sitúan en las puntas de la molécula.

INICIACIÓN DE LA SÍNTESIS DE PROTEÍNAS Procariontes Se comienza con la subunidad menor sola. IF-1 se une a la base del sitio A para forzar que el primer fMet-RNAt entre en el sitio P. IF-3 tiene una doble función, ya que se le necesita para estabilizar la subunidad 30S y para que el RNAm interaccione con dicha subunidad. IF-2 (como otros muchos factores de traducción) es del tipo de proteínas G que sirve para depositar el aminoacil-RNAt (fMet-RNAt en este caso) en el ribosoma.

www.FreeLibros.me


74

Capítulo 6

Síntesis de proteínas

Sitio de enganche del aminoácido

Puentes de hidrógeno entre los pares de bases

Anticodón

Figura 6-6

Plegamiento del RNAt para adquirir la forma L.

Los tres IF junto con el RNAm, el fMet-RNAt y la subunidad 30S forman el complejo de iniciación. El RNAt iniciador que reconoce el AUG (en ocasiones GUG y rara vez UUG) es especial, ya que porta una formil-Met; presenta modificaciones postranscripcionales específicas; sólo puede usarse en iniciación, y es el único capaz de entrar en el sitio P (no el A) sin la subunidad mayor del ribosoma. La hidrólisis de GTP y la interacción con la subunidad 50S permiten la liberación de los tres factores de iniciación (fig. 6-7).

Eucariontes El mecanismo de eucariontes es básicamente el mismo que el de procariontes, con la mayor parte de las diferencias acumuladas en la iniciación. Las principales son: • El ribosoma y sus subunidades son más grandes (40S + 60S → 80S). • Los RNAr son mayores y hay más proteínas por subunidad ribosómica. • La subunidad mayor contiene los RNAr 28S y 5S, pero además una 5.8S adicional que no existe en procariontes. • El ribosoma no tiene sitio E. • El RNAm es diferente y sus elementos distintivos son importantes. • Durante el viaje al citoplasma, el RNAm puede adquirir una estructura secundaria que el ribosoma tiene que eliminar antes de traducirlo. • El codón de iniciación es siempre AUG y no hay secuencias Dalgarno.

• La Met iniciadora no está formilada. • El RNAm tiene que prepararse para interaccionar con el ribosoma. • Los factores de traducción son distintos (aunque muchos tienen funciones análogas) y se nombran comenzando por “e”. La subunidad 60S del ribosoma se estabiliza con el eIF-6. eIF-3, eIF-1 y eIF-1A se unen a la subunidad menor. Junto con el RNAtaa a eIF-2, van a formar el complejo 43S. Como en procariontes, unidos los RNAtaa llegan acompañados de un factor (eIF-2) que se reciclará mediante el factor eIF-2B. Gracias a eIF-5B, el Met-RNAti se coloca correctamente. El RNAm es reconocido por eIF-4F (formado a su vez por los factores 4G, 4A, 4B, 4E) a través de la caperuza. El complejo 43S se une al RNAm/eIF-4F y comienza a rastrear el RNAm desde su extremo 5′ en busca del AUG iniciador. Este rastreo es necesario para deshacer las estructuras secundarias que se han producido en el traslado del RNAm desde el núcleo hasta el citoplasma. Una vez que lo encuentra, se forma el complejo de iniciación 48S. eIF-1 y eIF-1A estabilizan este complejo, además de catalizar su disociación (fig. 6-8). El eIF-4G sirve de punto de anclaje de formación de todos los factores que componen eIF-4F, además de interaccionar con eIF-3. eIF-4E reconoce la caperuza. eIF4A es una ATPasa dependiente de RNA con actividad de helicasa de RNA, cuya misión es relajar los 15 primeros nucleótidos del RNAm, así como ayudar en la migración del ribosoma para buscar el AUG iniciador. En la migración le asiste eIF-4B. eIF-3 podría ser una especie de

www.FreeLibros.me


Iniciación de la síntesis de proteínas

E

P

Entre IF-1 e IF-3 provocan la disociación de las subunidades del ribosoma

A

75

IF-3

IF-1

P

Subunidad 30S

A

IF-1 IF-3

E

P

P

A

A GTP

RNAm

F-Met

Secuencia ShineDalgarno

IF-2

Codón de iniciación

Subunidad 50S F-Met

GTP

E

P

IF-2 IF-1

IF-3

A

Complejo de iniciación 30S

La hidrólisis de GTP y la interacción con la subunidad 50S permiten la liberación de los tres IF

IF-3

GDP

IF-2

IF-1 E

P

A F-Met

Complejo de iniciación 70S

Figura 6-7

Representación de la etapa de iniciación en procariontes.

pinza que, mediante interacciones con eIF-1 y complementariedad con los RNAr, estabiliza el complejo 48S e interacciona con eIF-4G. El RNAm no está unido linealmente al ribosoma, sino formando una estructura circular por la interacción de la cola de poli A con eIF-4G. Esta estructura permite un reinicio de la traducción del RNAm muy eficiente, incluso reciclando el mismo ribosoma. De hecho, la eficiencia de la traducción está estrechamente ligada a la longitud del poli A. El eIF-5 activa la actividad GTPasa de eIF-2 para indicar que el rastreo del AUG ha concluido y liberar todos los factores.

Cuando la subunidad mayor se une, se libera eIF-6 y se forma el complejo de iniciación 80S, con el MetRNAti en el sitio P. El Met-RNAti que ha entrado con eIF-2, como en procariontes, no se usará luego en la elongación, a pesar de llevar una Met sin formilar. El GTP unido a eIF-2 se hidroliza por la intervención de eIF-5, y es la señal que indica que se ha encontrado el AUG iniciador, provocando la liberación de todos los factores, incluidos los propios eIF-2 y eIF-5. El factor eIF2 se reciclará mediante el factor eIF-2B con consumo de ATP y es un punto de regulación estrecha.

www.FreeLibros.me


76

Capítulo 6

Síntesis de proteínas

eIF-2 Met

Pi +

GDP

eIF-2 y OTRAS DISOCIACIONES DE FACTORES DE INICIACIÓN

GTP RNAt iniciador Pequeña subunidad ribosómica con unión a RNAt iniciador

E

E P A

AAAAAAAA

A

UNIONES DE GRANDE SUBUNIDAD RIBOSÓMICA

Met

P

AUG

aa

eIF-4G eIF-4E Met

RNAm Cap 5´

GTP

RNAm

Met aa

Factores de iniciación adicional

AUG

E P A 3´

P i + ADP Met

AUG

FORMAS DE ENLACE DEL PRIMER PÉPTIDO (fase 2)

RNAt INICIADOR SE MUEVE A TRAVÉS DEL RNA EN BUSCA DEL PRIMER AUG

ATP

UNIONES DE AMINOACIL-RNAt (fase 1)

Met

aa

GTP

E P A 5´

AUG

AUG

etc.

Figura 6-8

Representación de la fase de iniciación de la síntesis de proteínas en eucariontes.

ELONGACIÓN DE LA CADENA PEPTÍDICA Procariontes El crecimiento de la cadena polipeptídica en el ribosoma es un proceso cíclico que se repite tantas veces como aminoácidos se incorporen. Cada ciclo consta de cuatro pasos: ubicación del nuevo RNAtaa, verificación o corrección del aminoácido introducido, formación del enlace peptídico y translocación. Los sitios E y A cooperan negativamente, puesto que nunca se encuentran ocupados a la vez.

Ubicación El RNAt aminoacilado se dirige al sitio A con el factor de elongación EF-Tu (EF-1A), que, al igual que IF-2, lleva GTP. Cuando el aminoacil-RNAt se aloja en el sitio A, el GTP se hidroliza y se libera EF-Tu/GDP. Los RNAtaa

pueden unirse al sitio A sin EF-Tu, pero a demasiado poca velocidad como para permitir el crecimiento celular. En la regeneración de EF-Tu interviene el factor de elongación EF-T (ahora EF-1B) que al unirse físicamente a EF-Tu permite el intercambio de GDP por GTP en EFTu: GTP/EF-Tu es la molécula capaz de unir el RNAtaa, en tanto que GDP/EF-Tu no presenta afinidad alguna por él.

Corrección Para dejar el RNAtaa en su sitio, EF-Tu tiene que hidrolizar el GTP. Esto es un proceso relativamente lento (se pueden aislar complejos GTP/EF-Tu/RNAt y GDP/EF-Tu/RNAt), que da tiempo a verificar el apareamiento codón-anticodón. Si es correcto, el GTP se hidroliza y se libera EF-Tu/ GDP, ya que esta molécula ha cambiado su conformación y ahora no presenta afinidad por el RNAtaa sino por el GDP. Si el apareamiento codón-anticodón es incorrecto, el aminoacil-RNAt se rechaza y queda de nuevo libre el

www.FreeLibros.me


ElongaciĂłn de la cadena peptĂ­dica

sitio A para aceptar el aminoacil-RNAt correcto. Cuanto mĂĄs tarde EF-Tu en hidrolizar el GTP, menos errores se cometen en la traducciĂłn. Se veriďŹ ca siempre el apareamiento codĂłn-anticodĂłn, nunca codĂłn-aminoĂĄcido.

TranspeptidaciĂłn La cadena polipeptĂ­dica enganchada al RNAt del sitio P se transďŹ ere sobre el aminoĂĄcido transportado por el RNAt del sitio A. Esta transferencia la cataliza el sitio peptidiltransferasa de la subunidad 50S. Concretamente, el RNAr 23S alojado en este sitio catalĂ­tico es quien realiza la funciĂłn catalĂ­tica fundamental, actuando como ribozima. El sitio peptidiltransferasa tambiĂŠn impide que la cadena naciente se hidrolice del RNAt al que va unida, evitando la terminaciĂłn prematura. Lo consigue evitando la entrada de molĂŠculas de agua al centro activo peptidiltransferasa, esencialmente mediante un entorno hidrĂłfobo; esto explica por quĂŠ muchos antibiĂłticos que inhiben la sĂ­ntesis de proteĂ­nas poseen una estructura claramente hidrĂłfoba.

TranslocaciĂłn El RNAt descargado del sitio P se transďŹ ere al E, y el RNAt que tiene el pĂŠptido en el sitio A pasa al P. El desplazamiento hace que el ribosoma avance tres nucleĂłtidos por el RNAm. Ambas subunidades del ribosoma no se trasla-

Sitio E

Sitio P

dan simultĂĄneamente, sino que en primer lugar avanza la subunidad mayor y luego la menor. Para ello, se necesita el factor EF-G (EF-2) que tambiĂŠn lleva un GTP unido que se consume con el movimiento. La estructura de EF-G mimetiza la estructura del complejo GTP/EF-Tu/RNAtaa, por lo que EF-G podrĂ­a competir con ĂŠl por el sitio A y desplazar al peptidil-RNAt hacia el sitio P. Por eso, EF-G sĂłlo puede entrar en acciĂłn si EF-Tu se ha liberado del ribosoma. Tras la translocaciĂłn, la cooperaciĂłn negativa entre E y A hace que no pueda entrar otro RNAtaa nuevo en A hasta que el que hay en E no ha salido. En este momento, se ha completado el ciclo, con la diferencia de que ahora la cadena polipeptĂ­dica ha crecido en un residuo y el ribosoma estĂĄ desplazado tres nucleĂłtidos en el RNAm.

Eucariontes Los factores de elongaciĂłn que intervienen en eucariontes son anĂĄlogos a los procariontes: • eEF-1đ?›‚ es una proteĂ­na G anĂĄloga a EF-Tu (EF-1A) (el que aporta los aminoacil-RNAt al ribosoma). Reconoce cualquier RNAt menos el iniciador. Como no tiene aďŹ nidad por el ribosoma, se desprende de ĂŠl cuando el RNAtaa se ďŹ ja al ribosoma con hidrĂłlisis de GTP. • eEF-1đ?›ƒđ?›„ es anĂĄlogo a EF-T (EF-1B) (su funciĂłn es reciclar y regenerar el eEF-1Îą). • eEF-2 es otra proteĂ­na G anĂĄloga a EF-G (EF-2) que interviene en la translocaciĂłn del ribosoma.

Sitio E

Sitio A FormaciĂłn del enlace peptĂ­dico

Sitio P

Figura 6-9

Sitio P

Sitio A

TranslocaciĂłn 30S

TranslocaciĂłn 50S

Sitio E

77

Sitio A

RepresentaciĂłn de la etapa de elongaciĂłn en procariontes.

www.FreeLibros.me

Sitio E/P

Sitio P/A


78

Capítulo 6

Síntesis de proteínas

TERMINACIÓN DE LA SÍNTESIS DE PROTEÍNAS Procariontes Al llegar un codón de terminación al sitio A, éste es reconocido por alguno de los factores de liberación; RF1 reconoce los codones UAA y UAG, y RF2 reconoce UAA y UGA. Estos factores ocupan el sitio A; su estructura recuerda a la del RNAt, y en la parte de la molécula que se sitúa sobre el sitio peptidiltransferasa del ribosoma contiene el motivo Gly-Gly-Gln (GGQ) que lleva coordinada una molécula de agua. La reacción de fin de traducción consiste en la transferencia del péptido desde el sitio P a dicha molécula de agua. Para sacar los RF1 o RF2 del ribosoma, es necesario que intervenga RF3 (otra proteína de la familia de las GTPasas) e hidrolice una molécula de GTP. RF3 se parece estructuralmente a EF-G. Tal cual ha quedado el ribosoma con el factor RF3 unido, y también el RNAt en el sitio P está estable, pero no se puede utilizar en otra ronda de síntesis (fig. 6-10).

que ahora sea el agua la que actúe como agente nucleófilo. El RNAt está en el sitio P del ribosoma y el eRF1 en el sitio A. Para disociar este complejo y regenerar el ribosoma útil, entra en funcionamiento el factor eRF3 (otra proteína G que se parece a eEF-1α) que ha estado en todo momento físicamente asociado a eRF1 (por eso, antes se creía que sólo había un factor, el eRF). eRF3 lleva una molécula de GTP que se hidroliza para permitir esta liberación.

RECICLAJE DEL RIBOSOMA Para reciclar el ribosoma, se necesita la intervención de RRF (factor de reciclaje del ribosoma) que también tiene una estructura que simula un RNAt, sobre el sitio A. Después interviene el factor de elongación EF-G hidrolizando una molécula de GTP, lo que permite que se disocien las dos subunidades del ribosoma, aunque queda todavía el último RNAt que se incorporó. Para eliminarlo, interviene el factor de iniciación IF3, lo que nos devuelve el ribosoma justo a la situación del inicio de traducción, pero en el marco de lectura siguiente.

MADURACIÓN

Eucariontes El eRF1 (con estructura que recuerda al RNAt) se une al ribosoma en el sitio A cuando aparece cualquier codón de terminación, alterando las propiedades hidrófobas del sitio peptidiltransferasa. También tiene el motivo GGQ que altera la actividad del sitio peptidiltransferasa para

DE LA CADENA PROTEÍNICA Puede ocurrir cuando finalizó la síntesis del péptido, una vez liberado del ribosoma o, con más frecuencia, de manera simultánea a su síntesis. Son muchos los tipos de modificaciones que se pueden encontrar.

Terminación

Unión del factor de liberación hacia el sitio A

Figura 6-10

Etapa de terminación de la síntesis de proteínas.

www.FreeLibros.me


Maduración de la cadena proteínica

Tipos de modificaciones

Aminoácidos modificables Sin tener en cuenta modificaciones del tipo entrecruzamiento, la unión de fosfatidil-inositol, la formación de piroglutamato, la formación de diftamida, la formación de al-lisina o la formación de dionas, los aminoácidos que no se suelen modificar son Gly, Ala (aminoácidos pequeños), Leu, Ile, Val o Trp (aminoácidos hidrófobos) (cuadro 6-1).

Desformilación La desformilasa procariótica elimina el formilo de la fMet en la primera posición de las proteínas al poco de aparecer el extremo N fuera del ribosoma.

Puentes disulfuro Se trata de la formación de un enlace covalente entre dos Cys de la misma o distintas cadenas polipeptídicas.

Cuadro 6-1 Aminoácido

Modificación

79

Se consigue mediante una reacción redox (reacción de oxidorreducción) catalizada por la proteína-disulfuroisomerasa en presencia de glutatión, que sufre el proceso inverso (rotura de su doble enlace). Si se revierte esta modificación, la proteína se desnaturaliza.

Glucosilación Se trata de la unión covalente de varios glucosilos (radicales de glúcidos) encadenados, o sea, oligosacáridos o glucanos. Se glucosilan proteínas que se van a secretar o son de membrana, y nunca se da en procariontes. La función de estos oligosacáridos añadidos es: 1. Favorecer o estabilizar la conformación final de la proteína extracelular o de membrana. 2. Aumentar la vida media de la proteína, incrementando su estabilidad y su resistencia a la digestión por las proteasas. 3. Aumentar la solubilidad en un medio acuoso. 4. Aportar las estructuras que van a reconocer algunos receptores (p. ej., los antígenos). La adición de los oligosacáridos tiene lugar tanto cotraduccional (mientras se importa al RER) como postraduccionalmente (en el Golgi) y no es fija, por lo que las proteínas se identifican en gel como una banda borrosa. La glucosilación comienza en el lado citosólico del RER con las glucosiltransferasas asociadas a membranas. La hay de dos tipos (no excluyentes): La O-glucosilación sobre el hidroxilo de Ser o Thr: produce oligosacáridos simples que comienzan por N-acetilgalactosamina normalmente. Es postraduccional porque siempre comienza en el Golgi. La N-glucosilación sobre la amida de la Asn: está dos aminoácidos antes de Ser, Thr o Cys. Comienza con la adición de N-acetilglucosamina sobre un lípido: el dolicolfostato. Tras varias etapas de polimerización sobreviene una reorientación, de manera que ahora el oligosacárido está de lado de la luz del RER. Se completa entonces la síntesis y se transfiere a una Asn del péptido que se está introduciendo en el RER. El péptido parcialmente glucosilado se dirige al Golgi donde se completa la modificación de la cadena oligosacarídica. Esto puede implicar también eliminación de algunos residuos de monosacáridos. Los glucanos unidos por N-glucosilación son más complejos y diversos que los introducidos por O-glucosilación.

Extremo N

Formilación, acetilación, acilación, miristoilación, glucosilación

Extremo C

Metilación, ADP-ribosilación

Arginina

N-etilación, ADP-ribosilación

Asparagina

N-glucosilación, N-metilación, desamidación

Aspartato

Fosforilación, metilación, hidroxilación

Cisteína

Formación de disulfuros, formación de selenocisteína, acilación, prenilación, unión de grupos prostéticos (p. ej., hemo)

Glutamato

Metilación, carboxilación, ADP-ribosilación

Glutamina

Desamidación

Histidina

Metilación, fosforilación, ADP-ribosilación

Lisina

N-acetilación, N-metilación, oxidación, hidroxilación, ubiquitinación

Metionina

Formación de sulfóxidos

Fenilalanina

β-hidroxilación, O-glucosilación

Prolina

Hidroxilación, O-glucosilación

Serina

Fosforilación, O-glucosilación, acetilación

Treonina

Fosforilación, O-glucosilación, metilación

Fosforilación

Triptófano

β-hidroxilación

Tirosina

Fosforilación, yodación, adenilación, sulfonilación, hidroxilación

Se trata de una modificación estrictamente postraduccional, una vez que la proteína está por completo sintetizada y plegada. Afecta a grupos OH de Ser, Tre y Tir, ocasionando un incremento notable de carga negativa en la proteína. Es reversible y muy frecuente. La fosforila-

© Gonzalo Claros http://av.bmbq.uma.es/bma

www.FreeLibros.me


80

Capítulo 6

Síntesis de proteínas

ATP

ADP

Cinasa de tirosina

Carboxilasa (+vit K)

Fosfatasa de fosfotirosina

γ-carboxiglutamato

Glutamato P

Figura 6-11

Figura 6-13

Carboxilación.

Fosforilación de una proteína.

ción la realizan las cinasas de proteína, transfiriendo el grupo γ del ATP. La desfosforilación la catalizan las fosfatasas de proteína (fig. 6-11).

Acetilación Se trata de una modificación covalente por introducción de un grupo acetilo en el amino de un aminoácido. Lo más frecuente es la acetilación de la Met del extremo amino (lo que hace que la proteína no se pueda secuenciar), pero también puede ocurrir sobre las Lys de las histonas para cambiar su afinidad por el DNA (fig. 6-12).

Carboxilación Se puede producir la carboxilación del CH2 en posición β de un Asp o el CH2 en posición γ de un Glu. Para la carboxilación de los factores sanguíneos, se necesita vitamina K, que es el cofactor de la carboxilasa. La presencia de γ-carboxiglutamato actúa como quelante de Ca2+, imprescindible para la coagulación (fig. 6-13).

Metilación La metilación no es un fenómeno exclusivo de los ácidos nucleicos. En las proteínas, se pueden incorporar grupos

metilo en el amino ε de una cadena de Lys o en el carboxilo γ de un Glu. La reacción está catalizada por metiltransferasas. En el caso de la Lys, se pueden incorporar hasta tres metilos en el mismo grupo amino. Ejemplos de proteínas que sufren este tipo de modificaciones son la histona H4, algunas proteínas musculares, el citocromo C y la calmodulina (ésta contiene trimetil-Lys) (fig. 6-14).

Hidroxilación Consiste en la incorporación de grupos OH en residuos de Pro y Lys en el caso del colágeno. Esta modificación la realizan varias hidroxilasas presentes en el retículo endoplásmico. La reacción es químicamente compleja, pues conlleva la descarboxilación de la molécula donadora del OH.

Acilación Se trata de una modificación cotraduccional, que consiste en la unión de un ácido graso para aumentar la hidrofobicidad de la proteína y el lípido haga de anclaje a la membrana, normalmente por la cara interna. Suele ocurrir sobre las Ser, Thr o Cys. Muchas proteínas implicadas en la transducción de señales (cinasas de Ser/Thr/ Tyr, proteínas G, etc.) están miristiladas y ocurre sobre una secuencia N-Glu-X-X-X-(Ser,Thr)-Y-Y donde Y son aminoácidos básicos.

Otras modificaciones

Polipéptido

Figura 6-12

Acetilación de una proteína.

Polipéptido

La prenilación consiste en unir radicales terpenoides (derivados del isopreno) a las Cys de las proteínas citosólicas y servirles de anclaje a la membrana, como en la acilación. Los terpenoides más habituales son el geranilo (10C), farnesilo (15C) y el geranilgeranilo (20C). También se prenilan las proteínas G y algunas proteínas de la matriz nuclear (lamininas). La proteólisis parcial de un péptido puede servir para generar la proteína madura. Se produce en el retículo endoplásmico, Golgi o citoplasma. Ocurre durante la acti-

www.FreeLibros.me


Regulación de la síntesis de proteínas

81

SAM Metiltransferasa

Lisina

Figura 6-14

Metil-Lys

Dimetil-Lys

Trimetil-Lys

Metilación.

vación de los cimógenos (de proproteínas a proteínas), las proteínas con péptidos de tránsito (de preproteína a proteína madura) y a las caspasas durante la apoptosis. Algunos grupos prostéticos se unen covalentemente a la enzima, como por ejemplo la biotina en la carboxilasa de acetil-CoA, o el grupo hem del citocromo C. En otros, como el de la sintetasa de glutamina de procariontes, las enzimas se pueden adenilar (añadir AMP) para regular su actividad. La ADP-ribosilación es una modificación reversible sobre residuos de His, Arg, Asn, Lys o Glu, utilizando NAD+ como cosustrato. Las toxinas diftérica, colérica y pertúsica ADP-ribosilan proteínas intracelulares (p. ej., eIF-2) inespecíficamente, por lo que perturban la fisiología celular. También existe esta actividad en una proteína telomérica para regular el ensamblaje y desensamblaje del telómero. En algunas proteínas, se pueden sulfatar las Tyr en el Golgi. También se pueden ubiquitinar las Lys, pero esto es una señal de degradación.

DINÁMICA DE TRANSPORTE Y VIDA MEDIA DE LAS PROTEÍNAS Velocidad de la traducción Aunque la velocidad puede variar en función del uso de codones a 37°C, un ribosoma de E. coli puede formar un polipéptido de 300 residuos en 20 segundos (s), o sea, 15 tripletes por segundo, velocidad similar a la de la transcripción procarionte, lo que indica que el RNAm se traduce a la misma velocidad con la que se transcribe. La etapa limitante es la elongación. La velocidad de síntesis es bastante menor en eucariontes, no superándose normalmente los dos a cuatro aminoácidos por segundo.

Cuadro 6-2 Etapa

BALANCE ENERGÉTICO Sin contabilizar la energía necesaria para corregir las pruebas durante la elongación, rastrear el AUG (en eucariontes) y plegar las proteínas tras la síntesis, el balance mínimo final se presenta en el cuadro 6-2. Cada enlace peptídico cuesta cuatro enlaces fosfoanhidro (–30.5 kJ/mol), de manera que 30.5 × 4 = 122 kJ/ mol cuando la energía libre (∆G = ∆H – T∆S) que se necesita para formarlo es tan sólo de 21 kJ/mol. Este exceso de gasto energético sirve para asegurarse que el polipéptido tiene una secuencia perfectamente definida. O lo que es lo mismo, disminuir la entropía (∆S), ya que se ha sintetizado sólo uno de los 20N polipéptidos posibles.

Procariontes

Activación de 2 × N ATP RNAtaa Iniciación

1 ATP 1 GTP

Eucariontes

Función

2 × N ATP Ligasa de RNAtaa

1 GTP 1 GTP

Formilación de Met Reciclaje de (e) IF2 Unión de eIF-4F

Elongación

N-1 GTP N-1 GTP

N-1 GTP N-1 GTP

Reciclaje (e)EF-1A Translocación

Terminación

1 GTP 1 GTP

1 GTP ?

Reciclaje de (e)RF3 Reciclaje del ribosoma (EF2)

TOTAL

4N + 2

4N + 1

© Gonzalo Claros http://av.bmbq.uma.es/bma

www.FreeLibros.me


82

Capítulo 6

Síntesis de proteínas Factor intercambiador del nucleótido de guanina eIF-2B eIF-2 inactivo

eIF-2 activo GDP

GDP

GTP

GDP

Figura 6-15

GTP

Reciclaje del eIF-2 utilizado por un factor intercambiador del nucleótido de guanina (eIF-2B).

mecanismo que permite que entren en un estado de descanso no proliferativo (llamado G0), en el cual el índice de la síntesis de la proteína total se reduce a cerca de un quinto del número de células en proliferación.

REGULACIÓN DE LA SÍNTESIS DE PROTEÍNAS Fosforilación de un factor inicial como regulador Las células de eucariontes disminuyen su índice total de la síntesis de la proteína como respuesta a una variedad de situaciones, incluyendo la privación de los factores de crecimiento o de nutrientes, la infección por los virus, y aumentos repentinos en temperatura. Mucha de esta disminución la causa la fosforilación del factor eIF-2 de la iniciación de la traducción por las cinasas de proteína específicas que responden a los cambios de condiciones, porque eIF-2 se une muy firmemente al GDP, un factor de intercambio del nucleótido de guanina, señalando que eIF-2B se requiere para la liberación del GDP, de modo que una molécula nueva de GTP pueda unirse y eIF-2 pueda ser reutilizado (fig. 6-15). La reutilización de eIF-2 se inhibe cuando es fosforilado; éste se une al eIF-2B inusualmente de manera firme, haciendo inactivo eIF-2B. Hay más eIF-2 que eIF-2B en células, e incluso una fracción de eIF-2 fosforilado puede atrapar casi todo el eIF-2B. Esto previene la reutilización del eIF-2 no fosforilado y retarda mucho la síntesis de la proteína (fig. 6-16). La regulación del nivel de eIF-2 activo es especialmente importante en células mamíferas, siendo parte del

Unión de proteínas a la región 5′ y 3′-UTR de RNAm En RNAm bacterianos, un estiramiento conservado de seis nucleótidos, la secuencia Shine-Dalgarno, siempre se encuentran algunos nucleótidos contracorriente del codón de inicio AUG. Esta secuencia forma pares con la subunidad ribosómica pequeña del RNA 16S, colocando de manera correcta el codón de inicio AUG en el ribosoma. Dado que esta interacción hace una contribución importante a la eficacia de la iniciación, ésta provee a la célula bacteriana una manera simple de regular síntesis de la proteína a través de mecanismos de control negativo de traducción. Estos mecanismos implican por lo general el bloqueo de la secuencia Shine-Dalgarno cubriéndola con una proteína unida o incorporándola en una región de bases apareadas en la molécula del RNAm. Muchos RNAm bacterianos tienen proteínas represoras de traducción específicas que pueden unirse en la vecindad de la secuencia Shine-Dalgarno de tal modo que inhiban la traducción solamente de especies de RNAm. Por ejemplo, algunas proteínas ribosómicas pueden reprimir la traducción de sus propios RNAm al unirse a la región 5′ no traducible.

eIF-2B eIF-2 inactivo

P

P GDP

GDP

Cinasa de proteína fosforila eIF-2

Figura 6-16

GDP

eIF-2 fosforilado secuestra todos los eIF-2B como un complejo inactivo

En ausencia de eIF-2B activo, eIF-2 excedente permanece en su forma inactiva unida a GDP y la síntesis de proteína se reduce de modo impresionante

La fosforilación de eIF-2 controla la síntesis de la proteína por la unión de eIF-2B.

www.FreeLibros.me


Antibióticos para inhibir síntesis de proteínas

Este mecanismo funciona sólo cuando las proteínas ribosómicas se producen en exceso y por tanto no se incorporan en los ribosomas. De esta manera, permite que la célula mantenga cantidades correctamente balanceadas de los diferentes componentes necesarios para formar los ribosomas. No es difícil preguntarse cómo este mecanismo pudo haberse desarrollado. Las proteínas ribosómicas ensamblan en los ribosomas al unirse a los sitios específicos en el RNAr; ingeniosamente, algunas de ellas logran esta capacidad de unirse al RNA para regular su propia producción, al unirse a sitios similares presentes en sus propios RNAm. Los RNAm de eucariontes no contienen secuencias Shine-Dalgarno. En su lugar, la selección del codón AUG como sitio de inicio de la traducción se determina en gran parte por su proximidad al cap del extremo 5′ de la molécula del RNAm, que es el sitio en el cual la subunidad pequeña del ribosoma se une al RNAm y comienza a buscar este codón AUG. A pesar de las diferencias en la iniciación de la traducción, los eucariontes también utilizan represores de traducción. Otros reconocen secuencias de nucleótidos en el extremo 3′ UTR de los RNAm específicos y disminuyen la iniciación de la traducción, interfiriendo con la comunicación entre el cap 5′ y la cola de poli A que se requiere para una traducción eficiente.

Codones AUG antes del sitio de inicio de traducción Los nucleótidos que rodean el codón AUG influyen en la eficiencia del inicio de la traducción. Si el sitio de reconocimiento es bastante deficiente, las subunidades ribosómicas ignoran el primer codón AUG en el RNAm y buscarán un segundo o tercero en su lugar. Este fenómeno conocido se utiliza para producir dos o más proteínas relacionadas diferenciadas sólo en su aminoácido terminal del mismo RNAm. Otro tipo de control que se encuentra en eucariontes son unos o más marcos de la lectura abiertos y cortos entre el extremo 5′ del RNAm y el principio del gen. A menudo, las secuencias del aminoácido codificadas por estos marcos de lectura abiertos corriente arriba (uORF) no son críticas; los uORF tienen una función puramente reguladora. Un uORF presente en una molécula del RNAm disminuirá por lo general la traducción del gen corriente abajo capturando el complejo de iniciación del ribosoma y causando que el ribosoma traduzca el uORF y se disocie del RNAm antes que alcance las secuencias de codificación de la proteína. Cuando la actividad del factor general de traducción, como es el eIF-2, se reduce, se pensaría que la traducción de todos los RNAm se reduciría igual. Contrario a esta explicación, la fosforilación del eIF-2 puede tener efectos selectivos, aumentando la traducción de RNAm específicos que contengan uORF.

83

ANTIBIÓTICOS PARA INHIBIR SÍNTESIS DE PROTEÍNAS Los antibióticos que interfieren en la síntesis de proteínas son muy variados y abundantes y la mayoría de ellos funciona interfiriendo con el ribosoma, sobre todo los que se unen a proteínas ribosómicas y/o a alguno de los RNA ribosómicos.

Tetraciclinas Son antibióticos de muy amplio espectro (frente a grampositivos, gramnegativos, rickettsias y clamidias, e incluso micoplasmas), producidos por distintas especies de Streptomyces. Actúan como bacteriostáticos, siempre y cuando las bacterias estén en crecimiento activo. Como se puede ver por su espectro, son útiles incluso contra bacterias que viven como parásitos intracelulares (como las rickettsias), ya que su carácter hidrófobo facilita su difusión a través de membranas.

Mecanismo de acción Provocan que la unión del RNAtaa al sitio A del ribosoma sea inestable y esté distorsionada, con lo cual se evita la elongación de la cadena. In vitro, actúan tanto frente a ribosomas 70S como frente a los 80S. Entonces, ¿por qué in vivo sólo inhiben a las bacterias? La explicación está en el hecho de que las bacterias transportan complejos tetraciclina-Mg de manera “suicida”, cosa que no ocurre en eucariontes. Al llegar la tetraciclina a la subunidad 30S, se une a las proteínas S4 y S18 del ribosoma 70S intacto, ejerciendo el efecto que hemos descrito en el párrafo anterior.

Aminoglucósidos Es un grupo amplio y variado de antibióticos producidos por diversas especies de Streptomyces. Todos tienen en común varios rasgos químicos: son muy polares, policatiónicos; presentan un anillo de aminociclitol (un ciclohexitol o inositol con grupo amino); uno o más azúcares, que incluyen al menos un aminoazúcar (aparte del aminociclitol). Así, por ejemplo, la estreptomicina contiene como aminociclitol la llamada estreptidina, mientras otros aminoglucósidos presentan la 2-desoxiestreptamina. Dentro de los aminoglucósidos están: estreptomicina, kanamicina, amikacina, neomicina y gentamicina.

Mecanismo de acción Como se ve en seguida, su mecanismo no se limita a lo que se mencionó con anterioridad (inducir errores en la lectura del mensajero), sino que tienen efectos pleiotró-

www.FreeLibros.me


84

Capítulo 6

Síntesis de proteínas

picos (múltiples), que influyen entre sí. El mecanismo se puede desglosar en varias fases: 1. Unas pocas moléculas del antibiótico entran a la bacteria, probablemente aprovechando pequeñas imperfecciones de la membrana en crecimiento. 2. Estas moléculas se unen a los polisomas, es decir, los polirribosomas que están traduciendo el RNAm (p. ej., la estreptomicina se une al RNAr 16S de la subunidad 30S). Ahí provocan errores en la lectura del RNAm, al distorsionar la estructura del ribosoma. Concretamente, el efecto aquí es que los codones del RNAm se emparejan con RNAt cargados “erróneos”, en los que sólo dos de las tres bases del anticodón corresponden correctamente con las del codón. 3. Por tanto, la bacteria comienza a sintetizar proteínas defectuosas; algunas de ellas son proteínas de membrana, que al incorporarse a la bicapa lipídica, introducen imperfecciones en su funcionamiento y estructura. Se van formando cada vez más “canales”, correspondientes a defectos en esa membrana. 4. A través de los nuevos “canales” e imperfecciones de la membrana, entran cada vez más moléculas del antibiótico, con lo cual todo el proceso se acelera y retroalimenta positivamente, de modo autocatalítico. El efecto final es bactericida: se detiene finalmente la síntesis de proteínas y se producen daños irreversibles a las membranas. Cada aminoglucósido se une a una zona distinta de la subunidad 30S del ribosoma, por lo que no suelen darse reacciones cruzadas de resistencia entre distintos antibióticos de este grupo. La mayoría de los aminoglucósidos se une a varios sitios a la vez, dentro de la subunidad 30S, por lo que la aparición espontánea de mutaciones de resistencia a ellos suele ser baja. Una excepción a esto es el caso de la estreptomicina.

Mecanismo de acción Se une a varios lugares de la subunidad 50S, entre los cuales el más importante es la proteína L16, que forma parte del centro peptidiltransferasa, cerca del sitio del ribosoma donde encaja el extremo aminoacil del RNAt, en el sitio A. El cloranfenicol ha sido muy útil en el estudio de los ribosomas, ya que estabiliza los polisomas rápidamente.

Lincomicina y clindamicina La lincomicina está producida por Streptomyces lincolniensis, y la clindamicina es un derivado clorado del anterior, mucho más eficaz y con mejor absorción intestinal. Son útiles para tratar infecciones donde no pueda aplicarse penicilina y contra anaerobios como Bacteroides.

Mecanismo de acción Se une a la subunidad 50S del ribosoma procariótico, bloqueando la formación del enlace peptídico. Parece que esto lo logra, interfiriendo con la colocación adecuada del RNAtaa en el sitio A, y del RNAtpp en el sitio P. Hace que se desorganicen los polisomas, disociándose en sus subunidades 30S y 50S.

Carbomicina La carbomicina (producida por Streptomyces halstedii) y otros macrólidos se unen a la proteína L4 de la subunidad 50S, inhibiendo la formación del enlace peptídico.

Inhibidores de la translocación

Se trata de un grupo variado y heterogéneo de antibacterianos que interfieren con el centro peptidiltransferasa de la subunidad grande del ribosoma.

El representante más típico es otro macrólido, la eritromicina. (Actualmente se usan mucho en clínica dos derivados semisintéticos de ella: la roxitromicina y la claritromicina.) Producida por Streptomyces erithraeus, es un bacteriostático que se administra en infecciones de vías respiratorias ocasionadas por Mycoplasma pneumoniae, Legionella pneumophila (legionelosis), Corynebacterium dyphtheriae (difteria) y Bordetella pertussis (tos ferina).

Cloranfenicol

Mecanismo de acción

Antiguamente la industria lo obtenía a partir de Streptomyces venezuelae, pero hoy en día es más barato fabricarlo por síntesis química. Es un bacteriostático de amplio espectro. Se absorbe bien por vía oral y penetra bien en todos los tejidos, incluyendo cerebro y líquido cefalorraquídeo, por lo que se puede usar frente a meningitis ocasionadas por Haemophilus influenzae, así como tratamiento de fiebres tifoideas y anaerobios gramnegativos.

Se une a la proteína L15, que forma parte del centro peptidil-transferasa. Bloquea el paso de translocación, interfiriendo específicamente con la liberación del RNAt desacilado, es decir, impide que el RNAt “descargado” (una vez que ha cumplido su misión al transferirse el péptido naciente al RNAtaa del sitio A) salga del sitio P; por tanto, el RNAtpp cargado y situado en el sitio A no puede translocarse al sitio P, y se produce la detención de la síntesis de proteínas.

Antibióticos inhibidores de la formación del enlace peptídico

www.FreeLibros.me


Antibióticos para inhibir síntesis de proteínas

85

biendo la liberación del complejo EFG-GDP, por lo que el RNAtpp queda fijado en el sitio P, lo cual impide se pueda unir el complejo ternario EFTu-GTP-RNAt.

Inhibidores de los factores de elongación

Tiostreptón Es un antibiótico policíclico muy grande, producido por ciertas especies de Streptomyces. Se une a la subunidad 50S, concretamente a la proteína L11 y a una zona concreta del RNAr 23S, impidiendo la unión de los factores de elongación EFTu y EFG.

Ácido fusídico Es un derivado esteroide producido por hongos del género Fusarium, usado contra estafilococos resistentes a betalactámicos. Se une al factor de elongación EFG, inhi-

Kirromicina y pulvomicina Se unen al factor EFTu. La kirromicina bloquea la liberación del complejo binario EFTu-GDP y la pulvomicina bloquea la adición de RNAtaa al EFTu para formar el complejo ternario. En resumen, hay antibióticos que afectan prácticamente cualquier aspecto de la función del ribosoma. Muchos de estos antibióticos, aparte del interés clínico que puedan tener, han sido de mucha utilidad para desentrañar diversos aspectos de la estructura y función del ribosoma.

BIBLIOGRAFÍA Abelson CR, Trotta, H. Li. tRNA splicing J. Biol Chem, 1998;273:12685-12688. Anfinsen CB. Principles that govern the folding of protein chains. Science, 1973;181:223-230. Baker BS. Sex in flies: the splice of life. Nature, 1989;340:521524. Benne R. RNA editing: how a message is changed. Curr Opin Genet Dev, 1996;6:221-231. Cline TW, Meyer BJ. Vive la difference: males vs females in flies vs. worms Annu. Rev Genet 1996;30:637-702. Cohen FE. Protein misfolding and prion diseases J Mol Biol, 1999;293:313-320. Crick FHC. The genetic code: III. Sci Am, 1966;215(4):55-62. Dever TE. Translation initiation: adept at adapting trends. Biochem Sci, 1999;24:398-403. Dever TE. Translation initiation: adept at adapting. Trends Biochem Sci, 1999;24:398-403. Fedorov AN, Baldwin TO. Cotranslational protein folding. J Biol Chem, 1997;272:32715-32718. Frank J. The ribosome-a macromolecular machine par excellence. Chem Biol, 2000;7:R133-141. Frankel AD, Young JAT. HIV-1: fifteen proteins and RNA. Annu Rev Biochem, 1998;67:1-25. Franklin TJ, SNOW GA. Biochemistry of antimicrobial action. Londres: Chapman and Hall, 1989. Goldman E. Translational control by RNA. Encyclopedia of Life. Sciences, 2001. Graveley BR. Alternative splicing: increasing diversity in the proteomic world Trends Genet, 2001;17:100-107. Gray NK, Wickens M. Control of translation initiation in animals. Annu Rev Cell Dev Biol, 1998;14:399-458. Green R. Ribosomal translocation: EF-G turns the crank. Curr Biol, 2000;10:R369-R373. Hartl FU. Molecular chaperones in cellular protein folding. Nature, 1996;381:571-580.

Hentze MW, Kulozik AE. A perfect message: RNA surveillance and nonsense-mediated decay. Cell, 1999;96:307-310. Hershko A, Ciechanover A, Varshavsky A. The ubiquitin system. Nat Med, 2000;6:1073-1081. Hinnebusch AG. Translational regulation of yeast GCN4. A window on factors that control initiator-tRNA binding to the ribosome J Biol Chem, 1997;272:21661-21664. Holcik M, Sonenberg N, Korneluk RG. Internal ribosome initiation of translation and the control of cell death. Trends Genet, 2000;16:469-473. Ibba M, Soll D. Aminoacyl-tRNA synthesis. Annu Rev Biochem, 2000;69:617-650. Jansen RP. mRNA localization: message on the move. Nat Rev Mol Cell Biol, 2001;2:247-256. Kisselev LL, Buckingham RH. Translation termination comes of age. Trends Biochem Sci, 2000;25:561-566. Kleinhauf H, von Döhren H. Biosynthesis of peptide antibiotics. Ann Rev Microbiol, 1987;41:259-289. Knight et al. Selection, history and chemistry: the three faces of the genetic code. Trends Biochem Sci, 1999;24(6):241-247. Kolter R, Moreno F. Genetics of ribosomally synthesized peptide antibiotics. Annu Rev Microbiol, 1992;46:141-164. Kozak M. Initiation of translation in prokaryotes and eukaryotes. Gene, 1999;234:187-208. Llave C. Micro-RNA como reguladores génicos en plantas. BioPress.net 7, 2003. Londei P. Translation initiation models in prokaryotes and eukaryotes. Encyclopaedia of Life Sciences, 2001. http:// www.els.net Martin JF, Liras P. Organization and expression of genes involved in the biosynthesis of antibiotic and other secondary metabolites. Ann Rev Microbiol, 1989;43:173-206. Nissen P, Hansen J, Ban N et al. The structural basis of ribosome activity in peptide bond synthesis. Science, 2000;289:920930.

www.FreeLibros.me


86

Capítulo 6

Síntesis de proteínas

Nureki O, Vassylyev DG, Tateno M et al. Enzyme structure with two catalytic sites for double-sieve selection of substrate. Science, 1998;280:578-582. Pestanova TT, Hellen CUT. Ribosome recruitment and scanning: what’s new? Trends Biochem Sci, 1999;24:85-87. http:// av.bmbq.uma.es/bma/apuntes/index.htm Pollard VW, Malim MH. The HIV-1. Rev Protein. Annu Rev Microbiol, 1998;52:491-532. Prusiner SB. Nobel lecture. Prions. Proc Natl Acad Sci USA, 1998;95:13363-13383. Rich A, Kim SH. The three-dimensional structure of transfer RNA. Sci Am, 1978;238:(1):52-62. Rodina MV, Wintermeyre W. Ribosome fidelity: tRNA discrimination, pro of reading and induced fir. Trends Biochem Sci, 2001;26(2):214-230. Roll-Mecak et al. Engaging the ribosome: universal IFs of translation. Trends Biochem Sci, 2001;25(12):705-709. Sachs AB, Varani G. Eukaryotic translation initiation: there are (at least) two side to every story. Nat Struct Biol, 2000;7:356361. Sharp PA. RNA interference – 2001. Genes Dev, 2001;15:485490.

The Genetic Code. Cold Spring Harbor Symposium on Quantitative Biology, vol XXXI. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press, 1966. Turner GC, Varshavsky A. Detecting and measuring cotranslational protein degradation in vivo. Science, 2000;289:21172120. Varshavsky A, Turner G, Du F et al. The ubiquitin system and the N-end rule pathway. Biol Chem, 2000;381:779-789. Voges D, Zwickl P, Baumeister W. The 26S proteasome: a molecular machine designed for controlled proteolysis. Annu Rev Biochem, 1999;68:1015-1068. Wilson KS, Noller HF. Molecular movement inside the translational engine. Cell, 1998;92:337-349. Wilusz CJ, Wormington M, Peltz SW. The cap-to-tail guide to mRNA turnover. Nat Rev Mol Cell Biol, 2001;2:237-246. Wimberly BT, Brodersen DE, Clemons WM et al. Structure of the 30S ribosomal subunit. Nature, 2000;407:327-339. Yusupov MM, Yusupova GZ, Baucom A et al. Crystal structure of the ribosome at 5.5 A resolution. Science, 2001;292:883896.

www.FreeLibros.me


Capítulo

7

Transducción de señales Dr. Vidal Delgado Rizo Dra. Miriam Ruth Bueno Topete Dra. Irinea Yáñez Sánchez Dra. María del Pilar Alatorre Carranza

En este capítulo se analizan ejemplos de las vías de transducción que comprenden procesos, como proliferación celular inducida por factores de crecimiento, citocinas que producen inflamación y el factor transcripcional clásico, en este proceso NF-κB, además de proteínas G y señales de cicatrización.

INTRODUCCIÓN En el mantenimiento de la homeostasia, las células que forman parte de un tejido responden a señales extracelulares, regulando el metabolismo de la célula con un solo fin: mantener vivo al organismo del cual forman parte. Para este propósito, la célula regula sus actividades enzimáticas y vías metabólicas induciendo a la célula a: • • • • • • •

TIPOS DE SEÑALES CELULARES

Modificar su expresión génica. Secretar moléculas. Fagocitar partículas. División celular. Apoptosis. Diferenciación celular. Procesos de migración.

Las células se comunican y responden a su microambiente mediante moléculas que se secretan a su entorno, como: a) hormonas y citocinas, b) moléculas de adherencia y componentes de la matriz extracelular y c) neurotransmisores. Las hormonas y citocinas actúan a concentraciones muy bajas, por lo general ≤ 10−8 M, y sus correspondientes receptores presentan una alta afinidad por su ligando con una constante de afinidad Ka >108 L/ mol. Las formas en que se transmiten las señales celulares se clasifican según la distancia en que éstas llegan a su célula blanco. Las señales endocrinas son aquellas que se secretan por una estirpe celular hacia el torrente circulatorio y actúan a distancia sobre células blanco. En esta categoría se encuentran las hormonas. Como ejemplo está el glucagon, hormona producida por las células α del páncreas, secretada al torrente circulatorio y con un efecto en hepatocitos. El glucagon estimula la degra-

Estos procesos son inducidos por moléculas que en una célula pueden tener un efecto, por ejemplo: inducir la proliferación celular, pero en otra un efecto totalmente contrario, inhibirla. Esto indica que en la respuesta celular están incluidos no sólo los ligandos y receptores, sino también una serie de segundos mensajeros y proteínas reguladoras, que en el citosol y núcleo forman una compleja red de señales y vías intracelulares, muchas de las cuales llegan hasta el núcleo, modificando la expresión génica mediante factores transcripcionales. 87

www.FreeLibros.me


88

Capítulo 7

Transducción de señales

Sistema circulatorio Célula blanco

Célula secretora

Célula blanco A

Señales endocrinas

B

Señales paracrinas

Neurotransmisor

Célula blanco

Célula nerviosa

Sinapsis química C

Figura 7-1

Señales autocrinas

D

Célula-célula

Tipos de señales celulares. A, Endocrinas; las hormonas son transportadas a través del sistema circulatorio para actuar a distancia en diferentes células blanco. B, Paracrinas; una molécula es secretada de una célula y afecta a células vecinas. C, Autocrinas; la misma célula produce moléculas a las cuales responde. D, Célula-célula; las neuronas utilizan neurotransmisores para transmitir el impulso nervioso.

dación del glucógeno y la gluconeogénesis mediante la activación de la cascada del AMPc. En contraste con las señales endocrinas, están las señales paracrinas, moléculas que se liberan y actúan en células vecinas en el mismo tejido o microambiente donde se hallan, por ejemplo la interleucina 6 (IL-6), secretada en el hígado por las células de Kupffer, células endoteliales y células estelares hepáticas (HSC). Esta citocina tiene un efecto sobre los hepatocitos al participar de esta manera en la respuesta de fase aguda. Por último, las señales autocrinas se secretan por una célula y se dirigen hacia ellas mismas, como en las HSC que producen TGF-β y lo captan receptores ubicados en la membrana plasmática, estimulando la producción de proteínas de matriz extracelular como respuesta al TGF-β (fig. 7-1).

Casi todas las señales celulares, como la insulina, glucagon, citocinas y factores de crecimiento, entre otros, son moléculas de naturaleza hidrófila, incapaces de cruzar la membrana plasmática, por lo cual las células blanco muestran receptores en su superficie para transducir la señal al interior de la célula. Así, el receptor, al unirse con su ligando, origina una cascada de fenómenos al abrir canales de calcio, acoplarse a proteínas G o inducir la actividad intrínseca de cinasa de proteína del receptor (fig. 7-2). Por otra parte, se encuentran las señales de naturaleza hidrófoba, como las hormonas esteroides, el ácido retinoico, la vitamina D y los glucocorticoides. Este tipo de señales tiene receptores en el citosol que, al unirse a su ligando, translocan hacia el núcleo donde modifican la expresión génica (fig. 7-3).

www.FreeLibros.me


Receptores acoplados a proteínas G (AMPc) A

Receptor unido a proteína G

89

Ligando

Proteína G activada

Proteína G Enzima o canal iónico

C

II

Enzima o canal iónico activado

Receptor con actividad cinasa

I

II

P

P

Ligando D

I

I

Receptor unido a enzima

P

Ligando

Iones B

Receptor unido a canal iónico Dominio catalítico inactivo

Figura 7-2

Dominio catalítico activo

Tipos de receptores de superficie. A, El receptor se encuentra asociado a proteínas G que transducen la señal. B, Un receptor forma un canal iónico al unirse a su ligando. C, El receptor se activa (fosforilación intracelular en residuos de cinasa de serina-treonina) cuando se le une su ligando en la fracción extracelular y puede activar otras proteínas. D, El receptor tiene actividad intrínseca de cinasa de proteína al unirse el ligando en la parte extracelular y en la intracelular se activa el sitio catalítico.

Membrana plasmática

Hormona esteroide

RECEPTORES ACOPLADOS A PROTEÍNAS

G (AMPC)

Receptor

Estímulo

Receptor

Núcleo

AMPc

Respuesta

Núcleo Transcripción

Figura 7-3

Acción de hormonas esteroides. Las hormonas esteroides son hidrófobas, propiedad que les permite atravesar la membrana libremente. Una vez en el citosol, se unen a receptores intracelulares formando un complejo que migra al núcleo y estimula la transcripción de genes específicos.

En esta categoría hay una gran cantidad de receptores que, como características, presentan una hélice α en el extremo aminoterminal hacia la parte extracelular y la parte carboxiloterminal hacia el lado citosólico; además, el receptor cruza la membrana plasmática siete veces entrando y saliendo a manera de hilo de costura. Estos receptores se encuentran acoplados a unas proteínas de unión a nucleótidos de guanina llamadas proteínas G. Éstas constan de tres subunidades, designadas α, β, y γ, razón por la cual se les conoce como proteínas G hete-

www.FreeLibros.me


90

Capítulo 7

Transducción de señales

rotriméricas para diferenciarlas de otras que también unen nucleótidos de guanina como las proteínas Ras. La subunidad α tiene la propiedad de unir los nucleótidos de guanina, los cuales regulan la actividad de la proteína G. En el estado inactivo α se encuentra unida a GDP y a las subunidades β y γ; al unirse el ligando al receptor induce un cambio conformacional en la parte citosólica del receptor para inducir a la subunidad α a liberar el GDP e incorporar GTP, además de disociarse de las subunidades β y γ. En este estado, se dice que la proteína G está activada y es capaz de activar a la enzima ciclasa de adenilato, la cual forma AMP cíclico (AMPc) a partir del ATP. La subunidad α tiene actividad intrínseca de GTPasa, es decir, hidroliza al GTP que está unido a ella. Al hidrolizar el GTP al GDP, se inactiva uniéndose otra vez en el complejo ternario inactivo α, β y γ (figs. 7-4 y 7-5). Las señales intracelulares se descubrieron por primera vez al estudiar la acción hormonal de la adrenalina, la cual ocasiona la degradación del glucógeno a glucosa en el tejido muscular. En 1958, Earl Sutherland descubrió que el efecto de la adrenalina era mediado por incrementos en la concentración de AMPc, conduciendo al concepto de que el AMPc funcionaba como un segundo mensajero en respuesta a un primer mensajero que es la señal hormonal. Para cerrar el círculo, una vez formado el AMPc, éste se degrada a AMP por la enzima fosfodiesterasa del AMPc. Casi todos los efectos del AMPc son mediados por la cinasa de proteína A, una enzima descubierta por Donald

Walsh y Ed Krebs en 1968. La forma inactiva de la cinasa de proteína A es un tetrámero formado por dos subunidades catalíticas (C) y dos subunidades reguladoras (R). La forma inactiva de la cinasa de proteína A es cuando se encuentra el tetrámero completo; cuando se incrementan los niveles de AMPc, éste se une a las subunidades reguladoras, produciendo un cambio conformacional que conduce a la disociación de las unidades catalíticas, las cuales de esta manera se hallan enzimáticamente activas y capaces de fosforilar residuos de serina en otras proteínas blanco (fig. 7-6). En muchas variedades celulares, el incremento en los niveles de AMPc, activa la transcripción de genes que contienen secuencias reguladoras llamadas elementos de respuesta a AMPc (CRE). ¿Cómo llega la señal del AMPc hasta el núcleo para activar la transcripción? La subunidad catalítica de la cinasa de proteína es capaz de pasar a través de los poros nucleares y, una vez dentro del núcleo, fosforila la proteína de unión a CRE (CREB). CREB es un factor transcripcional que, al ser fosforilado se dimeriza, fenómeno muy común en los factores transcripcionales y en esta forma es capaz de unirse a los genes que contengan las secuencias de CRE en sus regiones reguladoras para modificar su transcripción (fig. 7-7). Uno de los genes que en su promotor tiene elementos de respuesta a AMPc es el gen de la carboxicinasa de fosfoenolpiruvato (PEPCK), una enzima citosólica que en el hígado cataliza la primera reacción irreversible de la gluconeogénesis, el paso clave de la conversión del oxalace-

Receptor

La subunidad α se activa al hidrolizarse el GTP, y la inactivación se presenta al formarse el complejo βγ-α-GDP

En estado inactivo, la subunidad α está ligada al GDP en un complejo con βγ GDP

Proteína G (estado inactivo) Hidrólisis de GTP

Hormona Cambio de nucleótido

GTP

Receptor

GTP

Proteína G (estado activo)

GDP

Proteína G (estado inactivo)

Proteínas blanco GDP

El complejo GTP unido a la subunidad α y el complejo βγ se disocian del receptor e interactúan con su blanco

Figura 7-4

La unión de la hormona induce una interacción del receptor con la proteína G, estimulando la liberación de GDP y el cambio a GTP

Regulación de proteínas G.

www.FreeLibros.me


Receptores acoplados a proteínas G (AMPc)

91

Hormona Adenilciclasa Receptor

Membrana plasmática

Proteína G

ATP

AMPc

Proteína G activada

Figura 7-5

Activación hormonal de la ciclasa de adenilato. La unión de las hormonas a sus receptores promueve su interacción con las proteínas G. La subunidad α de estas proteínas se activa y se disocia del receptor, estimulando a la ciclasa de adenilato, la cual cataliza la conversión de ATP a AMPc.

tato a fosfoenolpiruvato. La regulación de esta enzima es única, ya que, a diferencia de casi todas las enzimas que participan en la homeostasia de la glucosa, la actividad de PEPCK no es influida por la modificación covalente o alostérica, sino por incrementos en la cantidad de enzima, la que a su vez es regulada principalmente a nivel transcripcional. En este caso, el glucagon es el encargado de regular este gen, ya que dispara los niveles de AMPc. Una dieta rica en proteínas, el ejercicio y el ayuno aumentan los niveles de glucagon con el consecuente incremento de AMPc y activando la transcripción de PEPCK; por el contrario, dietas ricas en carbohidratos incrementan los niveles de insulina que antagonizan los efectos del glucagon al disminuir las cifras de PEPCK. La propiedad del promotor de la PEPCK, de ser regulable por la dieta, lo ha hecho un blanco para clonarlo con otros DNAc con el propósito de utilizarlo con fines terapéuticos.

Fosfolípidos y Ca+2 La membrana plasmática está formada por fosfolípidos, de los cuales los más abundantes son fosfatidilcolina, fosfatidilserina y fosfatidiletanolamina; además se hallan en concentraciones menores el fosfatidilinositol 4,5-difosfato (PIP2). Este lípido puede ser hidrolizado por la enzima fosfolipasa C (PLC) para producir y liberar de la membrana dos compuestos el inositol 1,4,5-trifosfato (IP3) y el diacilglicerol (DAG); ambos son importantes segundos mensajeros. El IP3 se une a su receptor en el retículo endoplásmico y abre canales del Ca2+, estimulando un incremento en los niveles del Ca2+ intracelular; de esta manera, activa enzimas sensibles al calcio como la cinasa de proteína C (PKC), la cual también es coactivada por la presencia de DAG (fig. 7-8).

AMPc

AMPc AMPc

R

AMPc

AMPc

AMPc

R

C

AMPc

R

R

C

C

C Inactiva

Figura 7-6

AMPc

Activa

Regulación de cinasa de proteína A. La forma inactiva de esta proteína consiste en un tetrámero (dos subunidades reguladoras [R] y dos catalíticas [C]). La unión del AMPc a las subunidades R induce cambios conformacionales que estimulan la disociación de las subunidades C y su consecuente activación.

www.FreeLibros.me


92

Capítulo 7

Transducción de señales

Tanto la PLC-δ como la PLC-β tienen que tener acceso a su sustrato, el PIP2, en la membrana para poder hidrolizarlo. Se sabe que la fosfatidilserina y fosfatidilcolina disminuyen la actividad de PLC-β, ya que hacen menos accesibles el sitio de corte del PIP2; por otro lado, la presencia de esfingomielina puede inhibir PLC-δ por un mecanismo similar; de lo contrario, la fosfatidiletanolamina permite una mejor penetración de la PLC-δ a la membrana y una mejor interacción entre las proteínas G activadas y PLC-β.

AMPc

R

Cinasa de proteína A

R

C

C

AMPc

AMPc AMPc

R C

R

AMPc

C

Citoplasma

SEÑALES DE PROLIFERACIÓN

C

Para cada estirpe celular, hay diferentes estímulos que inducen la proliferación celular; en general, se les llama factores de crecimiento, pero esto no excluye a hormonas y citocinas. A continuación se describe un diagrama muy simple de cómo un estímulo llega al núcleo para inducir mitosis, aunque se explica con detalle la vía de transducción, empezando con los receptores con actividad de cinasa de tirosina.

Núcleo C

ATP

ADP

P

P

Transcripción

CREB CREB

Estímulo

CRE

Figura 7-7

Receptor

DNA

Genes inducidos por AMPc. La subunidad catalítica de las cinasas de proteínas A se transloca al núcleo y fosforila al factor transcripcional CREB. Una vez fosforilado, CREB dimeriza y tiene la propiedad de unirse a regiones reguladoras en el DNA, dirigiendo la expresión de genes inducibles por AMPc.

Las fosfolipasas que inician la cascada ya descrita tienen seis principales familias PLC β, γ, δ, ε, η y ζ, de las cuales las más estudiadas son la PLC-β y PLC-δ. La familia de la PLC-β es activada por las proteínas G heterotriméricas, por lo cual su actividad es inducida por los receptores de angiotensina II, catecolaminas, endotelina 1, prostaglandina F2α, etc., en tanto que PLC-δ contiene dominio SH2, la cual se fosforila y activa cuando interacciona con receptores tipo cinasa de tirosina. Un ejemplo es la estimulación de la respuesta por el factor de crecimiento derivado de plaquetas, el cual al unirse a su receptor desencadena la activación de PLC-δ. La PLC-δ se encuentra prácticamente en todos los tejidos. Como otras PLC, requiere de Ca2+ para estar activa, aunque a los niveles de calcio basales se mantiene inactiva; por ello, necesita que otro mecanismo inicie el aumento de calcio intracelular para funcionar.

Fosforilación

Respuesta celular Proliferación

Receptores con actividad de cinasa de tirosina A diferencia de los receptores acoplados a proteínas G, hay una gran familia de receptores con actividad de cinasa de tirosina (RTK). Se conocen más de 50 RTK, entre ellos los receptores para el factor de crecimiento de hepatocitos (HGF), el factor de crecimiento epidérmico (EGF), el factor de crecimiento derivado de plaquetas (PDGF) y el receptor para insulina (IR), entre otros. Los RTK catalizan la transferencia del fosfato γ del ATP a los grupos hidroxilo de los residuos de tirosina en proteínas blanco. Los RTK juegan un papel fundamental en los procesos celulares, los cuales incluyen migración, metabolismo, proliferación y diferenciación celular. Todos los RTK contienen un dominio extracelular, el cual interactúa con su ligando. Este dominio por lo general está glucosilado; el dominio extracelular del receptor se conecta al dominio citoplásmico por una sola hélice α transmembrana. El dominio citoplásmico contiene una porción conservada con actividad de cinasa de tirosinaproteína (PTK) y secuencias adicionales reguladoras que son objeto de autofosforilación y fosforilación por cinasas de proteínas heterólogas (fig. 7-9).

www.FreeLibros.me


Señales de proliferación

Factor de crecimiento

93

Membrana plasmática

Membrana plasmática PIP2

IP3

OH

Ca 2+

Receptor de IP3

Citosol

PLC-γ

ATP ADP

A

Figura 7-8

Retículo endoplásmico

B

Activación de fosfolipasa C por cinasas de proteína-tirosina. A, La fosfolipasa C se activa al fosforilarse por el receptor en respuesta a un factor de crecimiento. La fosfolipasa C cataliza la formación de dos segundos mensajeros, el diacilglicerol (DAG) y el inositol 1,4,5-trifosfato (IP3). B, Movilización del Ca2+ por IP3. El IP3 se une a receptores en el retículo endoplásmico para liberar Ca2+ hacia el citosol.

Con excepción del receptor de insulina, todos los RTK son monómeros en la membrana celular. Su ligando induce dimerización de estos receptores, induciendo su autofosforilación. La autofosforilación del receptor es

en realidad una fosforilación cruzada de cada una de las cadenas, es decir, cada cadena fosforila a la otra. La primera fosforilación de los residuos de tirosina dentro de los dominios catalíticos del receptor juega un

Factor de crecimiento N

N Membrana plasmática

Dominio cinasa de tirosina C

C

N N Factor de crecimiento

Membrana plasmática

Dimerización del receptor

Figura 7-9

N N

Membrana plasmática

Factor de crecimiento

P C

C

Autofosforilación

P C

C

Receptores con actividad de cinasa de proteína. La unión de factores de crecimiento a este receptor induce su dimerización. Una vez estabilizado el dímero por el factor de crecimiento, se autofosforila en residuos de tirosina. La fosforilación es cruzada; cada una de las cadenas fosforila a las otras. La fosforilación dentro de los dominios catalíticos del receptor incrementa la actividad intrínseca de cinasa de tirosina.

www.FreeLibros.me


94

Capítulo 7

Transducción de señales NN

tores enclavados en la membrana y proteínas libres en el citosol para iniciar una cascada de señalización intracelular (fig. 7-10).

Factor de crecimiento Membrana plasmática

Ras, Raf y la vía de las cinasas de MAP Molécula señal corriente abajo

C

C

La vía de las cinasas de MAP se refiere a una cascada de cinasas de proteína altamente conservadas a través de la evolución y que juegan un papel central en la transducción de las señales en todas las células eucariontes (desde la levadura hasta el humano). Los elementos centrales en esta familia de cinasas de serina-proteína son las cinasas de MAP (cinasas de proteína activadas por mitógenos, mitogen-activated-protein kinases). Las cinasas de MAP son activadas en respuesta a una gran variedad de factores de crecimiento y otras señales celulares (figs. 7-11 y 7-12). Las proteínas mejor caracterizadas de este grupo son las que pertenecen a la familia de las cinasas reguladas por señal extracelular (extracelular signal-regulated kinases, ERK). La activación de ERK juega un papel central en la inducción de la proliferación celular estimulada por factores de crecimiento. Estos factores actúan a través de receptores acoplados a proteínas G o a receptores con actividad de cinasas de tirosina. Además, AMPc y Ca2+ se intercalan con la vía de ERK para inducir o inhibir esta vía, según el tipo celular. La activación de ERK es mediada corriente arriba por dos cinasas de proteínas, las cuales se encuentran acopladas al receptor por una proteína de unión a GTP llamada Ras. La activación de Ras induce la activación de una cinasa de serina/treonina Raf, la cual fosforila y activa una segunda cinasa de proteína denominada cinasa de MAP/cinasa de ERK (MEK). MEK es una cinasa dual que fosforila residuos de treonina y tirosina separados por un aminoácido en las proteínas ERK. Una

Molécula señal corriente abajo

Dominio SH2

Figura 7-10

Asociación de receptores de cinasas de proteína-tirosina y moléculas de señal corriente abajo. Interactúan dominios de unión SH2 con receptores activados, fosfotirosinas que contienen péptidos. Proteínas que contienen dominios SH2 en su estructura que se unen a los residuos de tirosina en los receptores activados para iniciar una cascada de señalización al interior de la célula.

papel regulador, incrementando la actividad intrínseca de cinasa de tirosina. La segunda fosforilación fuera del sitio catalítico crea sitios específicos de unión a otras proteínas de señalización intracelular. Estos sitios funcionan como sitios de unión para proteínas que contengan dominios SH2. El dominio SH2 fue reconocido en cinasas de tirosina relacionadas con la proteína oncógena del virus del sarcoma de Rous Src. El domino SH2 consiste en aproximadamente 100 aminoácidos de la proteína que tiene afinidad por una porción de otra proteína donde hay residuos de fosfotirosinas. Los dominios SH2 proveen un mecanismo de ensamblaje y reclutamiento entre recep-

Factor de crecimiento Membrana plasmática

Ras

GTP

ATP

MEK

Raf

ADP

ATP

ATP

ERK ADP

ADP

Proteínas citosólicas y nucleares

Figura 7-11

Vía de las cinasas de MAP. La estimulación de receptores a factores de crecimiento conducen a la activación de la proteína de unión a GTP ”Ras”. Ras interactúa con la cinasa de proteína Raf, la cual fosforila y activa a MEK. MEK fosforila a ERK. ERK es una cinasa que fosforila tanto proteínas citosólicas como proteínas nucleares.

www.FreeLibros.me


Señales de proliferación Citocinas Estrés

Factores de crecimiento Ésteres de forbol

MEK1

Figura 7-12

MEK2

MEK3

MEK6

EGF Estrés oxidativo

MEK4

MEK7

MEK5

MAPKK

ERK1 ERK2

p38

JNK

ERK5

MAPK

Elk1

ATF2 Elk-1 MEF-2C

ATF2 Elk-1 c-Jun

MEF-2C

Factor transcripcional que se activa en núcleo

Vías de activación de MAPK. Ante el estímulo recibido, las MAPKK transmitirán la señal hasta el núcleo activando MAPK específicas y éstas a su vez activarán factores transcripcionales específicos.

vez activado ERK, fosforila una variedad de proteínas blanco que se hallan en el citosol y en el núcleo (fig. 7-13).

ERK Citoplasma

Núcleo

ATP

ERK

ADP

P DNA

Transcripción

Elk-1

SRF

El papel central de la vía de ERK en células de mamífero emerge de estudios de las proteínas Ras, las cuales fueron identificadas por primera vez como proteínas oncógenas codificadas en el genoma de virus que causan sarcomas en ratas (de aquí el nombre de Ras [rat sarcoma virus]). En 1982 se descubre que Ras se encuentra implicado en el desarrollo de cánceres humanos. Además, inyectar la proteína Ras en su forma activa induce la proliferación de células normales de mamífero. Por el contrario, tratar células con anticuerpos dirigidos a Ras bloquean la proliferación celular producida por factores de crecimiento. La activación e inactivación de Ras es similar a la subunidad α de las proteínas G heterotriméricas, es decir, Ras-GTP es la forma activa y Ras-GDP la inactiva. La activación de Ras es mediada por factores de intercambio de nucleótidos de guanina que estimulan la liberación del GDP unido a Ras, intercambiándolo por GTP. La actividad de Ras-GTP se termina cuando la actividad intrínseca de GTPasa de Ras hidroliza el GTP a GDP.

SRE

Figura 7-13

95

GTPasa

Inducción de genes tempranos por ERK. ERK activado se transloca al núcleo y fosforila al factor transcripcional Elk-1. Elk-1 se une a secuencias consenso en el DNA llamadas elementos de respuesta séricos (SRE). Estos elementos se encuentran en la familia de genes llamados “genes tempranos”.

Ras-GTP (activo)

Ras-GDP (inactivo) P

En diferentes tipos de cáncer humano, se han detectado formas mutantes de la proteína Ras, la cual tiene dis-

www.FreeLibros.me


96

CapĂ­tulo 7

TransducciĂłn de seĂąales

minuida la capacidad de hidrolizar el GTP a GDP; de esta manera se mantiene en la forma activa, aun en ausencia del estĂ­mulo del factor de crecimiento que de manera normal desencadena esta cascada de fenĂłmenos. Hasta el momento se ha descrito la cascada desde el estĂ­mulo extracelular hasta ERK. En el citoplasma ERK fosforila a la fosfolipasa A2, la cual cataliza la formaciĂłn de ĂĄcido araquidĂłnico. ÂżCĂłmo llega la seĂąal hasta el nĂşcleo? ERK fosforilada transloca al nĂşcleo, donde regula factores de transcripciĂłn por fosforilaciĂłn. La estimulaciĂłn de una cĂŠlula por factores de crecimiento induce la transcripciĂłn de una familia que comprende entre 50 y 100 genes llamados genes tempranos. La inducciĂłn de un nĂşmero importante de genes tempranos es mediada por la secuencia reguladora de los genes llamada elemento de respuesta al suero (SRE); a esta secuencia se unen complejos de factores transcripcionales, entre ellos el factor de respuesta al suero (SRF) y Elk-1. ERK fosforila y activa Elk-1, proporcionando una relaciĂłn directa entre la familia de cinasas de ERK y la inducciĂłn de genes tempranos. Muchos genes tempranos codiďŹ can para factores transcripcionales; de esta manera, su inducciĂłn en respuesta a factores de crecimiento modiďŹ ca la expresiĂłn de una baterĂ­a de genes, estableciendo una nueva programaciĂłn de la expresiĂłn gĂŠnica.

ProteĂ­nas STAT

INF-Îł

JAK2

STAT1

US

GAS

Figura 7-14

RECEPTORES SIN ACTIVIDAD DE CINASA DE PROTEĂ?NA, LA VĂ?A

JAK/STAT

Hay receptores a citocinas que no estĂĄn acoplados a proteĂ­nas G y que carecen de actividad de cinasa de proteĂ­na; a esta categorĂ­a de receptores pertenecen receptores como el de los interferones e interleucinas 2, 3, 4, 5, 6, 7 y 13, ademĂĄs de factores de crecimiento. Este tipo de receptores estĂĄ unido no covalentemente a proteĂ­nas con actividad de cinasa de tirosina llamadas JAK, en alusiĂłn a Janus el dios romano que controla el acceso a las puertas, aunque tambiĂŠn se les conoce como Just Another Kinases. El receptor de estas citocinas es susceptible de fosforilaciĂłn en residuos de tirosinas y, como ya se mencionĂł, proteĂ­nas con dominios SH2 se unen a estas regiones. En este caso en particular, al receptor se unen las proteĂ­nas denominadas STAT, acrĂłnimo de SeĂąales de TransducciĂłn y Activadores de la TranscripciĂłn. Una vez unidas estas proteĂ­nas, son susceptibles de fosforilaciĂłn por las JAK. Una vez fosforiladas las STAT, migran al nĂşcleo y se unen a secuencias consenso llamadas ISRE (elemento de respuesta estimulada por interferĂłn, Interferon-Stimulated Response Element) y GAS (Îł-Activated Sequence) (ďŹ g. 7-14).

JAK1

Modelo JAK/STAT. El IFN-Îł al unirse a su receptor activa a las cinasas de proteĂ­nas llamadas JAK; estas enzimas fosforilan a factores transcripcionales denominadas STAT (Signal Transducer and Activator of Transcription) que migran al nĂşcleo para unirse a los sitios GAS (Gamma Activated Sequence).

Hay al menos seis tipos de STAT numerados del 1 al 6, ademĂĄs de dos formas dominantes negativas capaces de ser fosforiladas, migrar al nĂşcleo, pero no activar la transcripciĂłn; sencillamente ocupan el lugar de una STAT, provocando una inhibiciĂłn competitiva. Las STAT se pueden encontrar activadas en forma homodimĂŠrica, por ejemplo, STAT1/STAT1 en respuesta al IFN-Îł o en forma heterodimĂŠrica STAT1/STAT2 en respuesta a IFN-Îą. (cuadro 7-1).

VĂ­a del NF-đ?›‹B La activaciĂłn de la familia de factores transcripcionales del NF-ÎşB/Rel conduce a la translocaciĂłn de complejos citoplĂĄsmicos al nĂşcleo, en donde tienen la capacidad para inducir la transcripciĂłn de genes proinamatorios y participar de manera crucial en la respuesta inmunitaria e inamatoria. El NF-ÎşB se identiďŹ cĂł como un regulador del gen que codiďŹ ca para la cadena ligera Îş en linfocitos B; subsecuentemente se encontrĂł en muchas estirpes celulares.

www.FreeLibros.me


Seùales de cicatrización TGF-β/Smad

Cuadro 7-1

Citocinas que desencadenan la activaciĂłn y dimerizaciĂłn de los diferentes tipos de STAT

Citocina

STAT

Masa en kDA

IFN-Îł

1ι,1β

91, 84

IFN- ι/β

2

113

IL-6, EGF, G-CSF, prolactina

3

92

IL-12

4

89

IL-2, IL-3, IL-5, IL-7, IL-15, GM-CSF

5A, 5B

77, 80

IL-3, IL-4, IL-13

6

94

La familia de NF-ÎşB incluye: p50/p105, NF-ÎşB1, p52/ p100, NF-ÎşB2, p65 RelA, RelB y c-Rel. Casi todos los miembros de esta familia pueden formar homodĂ­meros y heterodĂ­meros. La forma mĂĄs comĂşn del NF-ÎşB es un heterodĂ­mero que consiste en las subunidades p50 o p52 con p65; este dĂ­mero contiene dominios de transactivaciĂłn para la inducciĂłn de la transcripciĂłn gĂŠnica. El NF-ÎşB se encuentra en el citoplasma de manera inactiva asociado a una proteĂ­na reguladora llamada inhibidor de ÎşB (IÎşB). La activaciĂłn del NF-ÎşB depende de la fosforilaciĂłn de su inhibidor IÎşB por la cinasa de IÎşB (IKK). La forma fosforilada del IÎşB es entonces marcada con ubiquitina para ser degradada por el proteasoma 26S. Libre el NF-ÎşB transloca del citosol al nĂşcleo y se une a los elementos o sitios ÎşB de regiones reguladoras de genes participantes en la respuesta inmunitaria e inamatoria (ďŹ g. 7-15). La vĂ­a del NF-ÎşB es de vital importancia en la respuesta inamatoria por la capacidad de inducir la transcripciĂłn de citocinas proinamatorias: quimiocinas, molĂŠculas de adherencia, metaloproteasas, Cox-2 y la sintasa de Ăłxido nĂ­trico inducible (ďŹ g. 7-16). El incremento en la activaciĂłn de la vĂ­a del NF-ÎşB juega un importante papel en la patogenia de artritis reumatoide, arterioesclerosis, esclerosis mĂşltiple, asma, gastritis asociada a Helicobacter pylori. El bloqueo de la vĂ­a del NF-ÎşB en la terapĂŠutica de estas enfermedades se ha abordado desde varias estrategias, desde la utilizaciĂłn de la aspirina hasta la terapia gĂŠnica (cuadro 7-2). La tecnologĂ­a del DNA recombinante permite seguir diferentes estrategias para inhibir vĂ­as de transducciĂłn. La utilizaciĂłn de un dominante negativo de IKK-β y bloquear la degradaciĂłn del inhibidor del NF-ÎşB son dos ejemplos; ademĂĄs, encontramos una estrategia utilizada in vivo para tratar artritis experimental en ratas al usar oligonucleĂłtidos sintĂŠticos que tienen aďŹ nidad (ODN) (decoy oligonucleotides) por NF-ÎşB y que compiten con

97

la secuencia consenso de los genes para producir una inhibiciĂłn competitiva.

SEĂ‘ALES DE CICATRIZACIĂ“N TGF-đ?›ƒ/SMAD El factor de crecimiento transformante β (TGF-β) es el prototipo de una gran familia de factores de crecimiento que incluye las activinas y las proteĂ­nas morfogenĂŠticas de hueso (MBP, morfogenetic bone protein) que actĂşan a travĂŠs de receptores con actividad de cinasa de serina/ treonina. La seĂąalizaciĂłn de la cascada se inicia cuando el ligando se une al receptor tipo II para despuĂŠs reclutarse el receptor tipo I. El receptor tipo II fosforila el receptor tipo I en un sitio rico en glicinas y serinas llamado sitio GS. Una vez fosforilado el receptor tipo I es activado para fosforilar proteĂ­nas llamadas Smad y propagar la seĂąal corriente abajo. Las Smad se clasiďŹ can en tres grupos: las reguladas por el receptor (R-Smad), las que actĂşan como mediadores comunes (co-Smad) y las inhibidoras (I-Smad). El receptor completo para TGF-β activado (formado por el receptor tipos I y II) se asocia con las R-Smad (Smad 2 o Smad 3). Las R-Smad se fosforilan en el extremo carboxiloterminal en la secuencia de aminoĂĄcidos SSXS (donde S son serinas y X es cualquier aminoĂĄcido). Fosforilado, las R-Smad se disocian del receptor y forman un complejo heterotrimĂŠrico con la co-Smad 4, para translocar al nĂşcleo (ďŹ g. 7-17). Al contrario de las R-Smad, las I-Smad funcionan como un potente antagonista de la seĂąalizaciĂłn del TGF-β. Smad 7 se une al complejo de receptores del TGF-β o MBP y previene el acceso y fosforilaciĂłn de las respectivas R-Smad. Smad 6 inhibe de preferencia la vĂ­a activada por las MBP, interactuando con el receptor o uniĂŠndose a Smad 1 fosforilada, previniendo la formaciĂłn de un complejo heteromĂŠrico con Smad 4. La transcripciĂłn de las I-Smad es inducida por los miembros de la familia del TGF-β, proporcionando un mecanismo de regulaciĂłn negativa; ademĂĄs, la expresiĂłn de Smad 6 y Smad 7 es potenciada por mĂşltiples seĂąales, que incluyen EGF, ĂŠsteres de forbol “TPAâ€? e IFN-Îł, dotando a la cĂŠlula de importantes mecanismos donde estas vĂ­as pueden regular negativamente la activaciĂłn de las Smad. En las Smad se pueden identiďŹ car dos dominios: MH1 (Mad homology 1) y MH2 (Mad homology 2). Estos dominios se hallan en el extremo amino y carboxiloterminal, respectivamente, unidos por una regiĂłn denominada linker. En cĂŠlulas que sobreexpresan R-Smad, la regiĂłn linker cumple funciones reguladoras, siendo susceptible de fosforilaciĂłn por la vĂ­a de MAPK/ERK. En Smad 2 y Smad 3, se han encontrado cuatro sitios susceptibles de fosforilaciĂłn por ERK, lo que conduce a la inhibiciĂłn de la translocaciĂłn de las R-Smad, con un concomitante bloqueo en la vĂ­a de seĂąalizaciĂłn por TGF-β.

www.FreeLibros.me


98

Capítulo 7

Transducción de señales

ESTRÉS Intermediarios reactivos oxígeno Luz UV

INFECCIÓN VÍRICA O BACTERIANA LPS RNA doble cadena

CITOCINAS lL-1, TNF-α

ESTÍMULOS

Fosforilación de IKK

Ubiquitinación de IκB

Degradación de IκB

Ubiquitina

Inhibidores de proteasoma (ALLN,Z-LLF, lactacistina) NF-κB libre

Sitios κB

PROTEÍNAS REL IκB IκB-a, p 105, c-Rel

Regulación de la respuesta del NF-κB

Figura 7-15

NF-κB genes de respuesta

FASE AGUDA DE LA RESPUESTA DE PROTEÍNAS Angiotensinógeno, proteína amiloide sérica, ácido glucoproteínico-α1, complemento C3, factor B del complemento Inflamación

MOLÉCULAS DE ADHERENCIA VCAM-1, ELAM-1, ICAM-1

CITOCINAS IL-1, 1L-2, 1L-2R, IL-6, IL-8, G-CSF, GM-CSF, TNF-α, TNF-β, IFN-β

Reparación y migración de células

Activación de inmunocitos

GENES

RESPUESTA

Proteínas IκB y NF-κB. La activación de la cinasa de IκB (IKK), en respuesta a diversos estímulos, hace que IKK fosforile IκB que inmediatamente se ubiquitina y degrada por el proteasoma 26S. Libre NF-κB transloca al núcleo y se une a sitios κB en diversos genes para regular el proceso inflamatorio y la respuesta inmunitaria.

El TGF-β es una citocina con importantes propiedades profibrógenas, que juega un papel preponderante en todo evento de cicatrización donde se tengan que depositar proteínas de matriz extracelular. Sin embargo, la expresión descontrolada del TGF-β en procesos patológicos tiene efectos conocidos como el lado oscuro de esta citocina. Estos efectos se relacionan con la producción excesiva de proteínas de matriz extracelular y la baja tasa de degradación de éstas. Dentro de estas alteraciones es

posible encontrar la cirrosis hepática, fibrosis renal, fibrosis pulmonar y cicatrices queloides en piel, entre otras. Dada la importancia de estos padecimientos y la falta de tratamientos eficaces, se ha hecho evidente la incursión de la terapia génica experimental mediante la expresión de sus inhibidores Smad 7 o receptores dominantes negativos que unen al TGF-β, pero no transducen la señal, para bloquear esta vía y evitar el depósito excesivo de proteínas de matriz extracelular.

www.FreeLibros.me


Señales de transducción y el citoesqueleto

99

TGF-β RI y RII

PAMP TLR

Smad 7

Fosforilación P

MyD88 P

Smad 2/3

P

Smad 4

P TAB1

Membrana nuclear

IRAK1 P

P TRAF6

Smad 4 Smad 2/3 P

P P

P

Figura 7-17

Activación de cinasas de MAP

Activación de NF-κB

Figura 7-16

Señalización de TLR. Para la señalización de los TLR, es necesaria la participación de moléculas adaptadoras que finalmente llevarán la señal a las vías del NF-κB y cinasas de MAP para la activación de los factores transcripcionales que se unirán a los genes blanco.

SEÑALES DE TRANSDUCCIÓN Y EL CITOESQUELETO Las secciones anteriores se enfocaron en las vías que regulan los cambios en el metabolismo o expresión génica en respuesta a una hormona, citocinas o factores de crecimiento. Sin embargo, es obvio que las funciones celulares se encuentran directamente afectadas por la adherencia celular y los componentes del citoesqueleto.

Cuadro 7-2

Estrategia

Estrategias terapéuticas utilizadas en humanos y animales de experimentación encaminadas a bloquear la activación del NF-κB Ejemplo

Terapia génica

Dominante negativo de lKK-b

Farmacológica

Antiinflamatorios, como corticoesteroides, aspirina (ácido acetilsalicílico), antioxidantes, etcétera

ODN (decoy nucleotides)

Oligonucleótidos sintéticos con afinidad a NF-κB

P

Interacción Smad 4

Smad ma 4 m Smad ad d 2/3

IRAK4

TAB2 P TAK1

(bloqueador)

Transcripción

Gen blanco

Transducción de señal de la familia TGF-β. El TGF-β, al unirse al receptor tipo II, inicia una serie de eventos que incluye el reclutamiento del receptor tipo I. El receptor activado fosforila las proteínas R-Smad 2/3, las cuales forman un complejo con la co-Smad 4. Juntos Smad 2/4 o Smad 3/4 translocan al núcleo para inducir la expresión de genes blanco. La I-Smad 7 tiene la capacidad de inhibir esta vía, uniéndose al receptor y bloqueando la fosforilación de la R-Smad.

Los receptores encargados para la adherencia celular inician una cascada de fenómenos que modifican aspectos del comportamiento celular, que incluyen la expresión génica, modificaciones o adecuaciones del citoesqueleto para proporcionar motilidad o una forma específica a la célula. Las células se unen a los componentes de la matriz extracelular, en parte, por receptores de superficie pertenecientes a la familia de las integrinas. Estas últimas son proteínas heterodiméricas transmembrana formadas por una subunidad α y una subunidad β. Las combinaciones entre los diferentes subtipos de cadenas α y β forman al menos 21 tipos de receptores. La diversidad de las integrinas provee a las células con una capacidad de reconocimiento de sustratos adhesivos y componentes de la matriz extracelular. Al igual que los miembros de la superfamilia de receptores a citocinas, las integrinas tienen una porción citoplásmica muy corta que carece de cualquier actividad enzimática per se. Sin embargo, la fosforilación de residuos de tirosina es una respuesta inmediata a la interacción de las integrinas con los componentes de la matriz extracelular, sugiriendo que las integrinas están unidas a cinasas de tirosina que no son receptores. En particu-

www.FreeLibros.me


100

Capítulo 7

Transducción de señales

lar, una cinasa de tirosina llamada FAK (focal adhesion kinase, cinasa de adherencia focal) tiene un papel importante en la señalización por integrinas. Como su nombre lo dice, FAK se localiza en las adherencias focales y rápidamente se fosforila después de la unión de las integrinas con componentes de la matriz extracelular, como fibronectina. Como otras cinasas de tirosina en la activación de FAK, está incluida la autofosforilación en residuos de serina, resultando de esta manera la proteína Src a través de su dominio SH2. Src fosforila entonces un sitio adicional de FAK, en el cual se une el complejo Grb2-Sos. Sos es un factor de intercambio de nucleótidos de guanina que conduce a la activación de Ras al intercambiar GDP por GTP e iniciar la cascada de señalización a través de ERK y cinasas de MAP (fig. 7-18).

HORMONAS ESTEROIDES Y LA SUPERFAMILIA DE LOS RECEPTORES A ESTEROIDES Las señales celulares actúan uniéndose a receptores que se expresan en las células blanco. En la mayoría de los casos, estos receptores se encuentran en la superficie

celular, pero algunos receptores son proteínas intracelulares localizadas en el citosol o en el núcleo. Estos receptores intracelulares se unen a pequeñas moléculas hidrófobas que son capaces de difundir a través de la membrana plasmática. Las hormonas esteroides son los clásicos ejemplos de este tipo de señales que incluyen hormonas tiroideas, vitamina D3 y ácido retinoico. A los receptores que unen a estas señales se les conoce como la superfamilia de receptores esteroides; son factores de transcripción que contienen dominios donde se une su ligando, dominios para unirse al DNA y dominios para activar la transcripción. La unión del ligando al receptor regula la función de activar o reprimir sus genes blanco; así, las hormonas esteroides y moléculas relacionadas regulan directamente la expresión génica (fig. 7-19). La unión del ligando tiene diversos efectos en distintos receptores. Algunos miembros de la superfamilia de receptores a esteroides, como los estrógenos y receptores a glucocorticoides, son incapaces de unir al DNA en ausencia de hormona. La unión de la hormona induce un cambio conformacional en el receptor, permitiendo la unión de éste al DNA en secuencias reguladoras y activa la transcripción de genes blanco. En otros casos, el

MAP cinasa

Dominio cinasa

Grb2 FAK P

P

Src

Sitio de autofosforilación

Sos Ras GTP

Membrana plasmática

Integrinas

Figura 7-18

Modelo de cinasas de proteína-tirosina FAK. Las integrinas son proteínas transmembrana: por la parte extracelular interactúan con componentes de la matriz extracelular y por la intracelular con la cinasa “FAK” (Focal Adhesion Kinase). Como otras cinasas de tirosina en la activación de FAK, se encuentra incluida la autofosforilación en residuos de serina, resultando de esta manera la proteína Src a través de su dominio SH2. Src fosforila entonces un sitio adicional de FAK, en el cual se une el complejo Grb2-Sos. Sos es un factor de intercambio de nucleótidos de guanina que conduce a la activación de Ras al intercambiar GDP por GTP e iniciar la cascada de señalización a través de ERK y cinasas de MAP.

www.FreeLibros.me


Fin de la señalización por degradación de los factores transcripcionales (vía de ubiquitina proteasoma)

Hormona esteroide

101

Ausencia de hormona

Membrana plasmática

Receptor de hormona tiroidea

Transcripción reprimida

Receptor

Hormona adherida

Núcleo Transcripción activada

Transcripción A

Figura 7-19

Acción de hormonas esteroides

B

Regulación génica por receptores a hormonas tiroideas

Hormonas esteroides. Los esteroides son moléculas que difunden a través de la membrana plasmática y llevan a cabo la inducción de expresión génica de dos formas: A, Se unen a receptores citosólicos y ambos translocan al núcleo para unirse a secuencias reguladoras e inducir la expresión génica. B, Las proteínas receptoras se encuentran unidas a regiones reguladoras de los genes reprimiendo su expresión; cuando la hormona difunde hasta el núcleo, se une a esta proteína y, de ser represora, cambia a inductora de la transcripción.

receptor se une al DNA en la presencia o ausencia de la hormona. La unión de la hormona altera la actividad del receptor como molécula reguladora transcripcional; por ejemplo, el receptor de la hormona tiroidea actúa como un represor en la ausencia de hormona, aunque está unido al DNA en ausencia o presencia de la hormona. Al unirse la hormona al receptor ocurre un cambio conformacional que modifica la función del receptor, de represor a inductor de la transcripción (fig. 7-19).

FIN DE LA SEÑALIZACIÓN DEBIDO A DEGRADACIÓN DE LOS FACTORES TRANSCRIPCIONALES (VÍA DE UBIQUITINA PROTEASOMA) La transcripción génica en células eucariontes incluye el armado de un complejo de proteínas en la región promotora y potenciadora del gen, en las cuales interaccionan proteínas del aparato basal de transcripción y factores de transcripción que son regulados por distintas vías de transducción de señales. La actividad de un factor transcripcional puede ser regulada de diferentes maneras: modificando la velocidad de síntesis o degradación, por modificaciones postransduccionales del factor de transcripción o alterando su localización subcelular. La proteólisis participa de manera crucial en la regulación de muchos factores transcripcionales. Una forma selectiva y programada de marcar factores transcripcionales

para promover su degradación en células eucariontes es mediante el sistema de ubiquitina proteasoma. La ubiquitina es una proteína nuclear y citosólica formada por 76 residuos de aminoácidos que existen en las células de manera libre o unidas de modo covalente a otras proteínas, fue descubierta en timo y se pensó que era una hormona de este órgano; sin embargo, en posteriores investigaciones se encontró en todos los tejidos y en todos los organismos eucariontes y su distribución ubicuota dio origen a su nombre. El sistema de ubiquitina proteasoma tiene como proteínas blanco para su degradación: factores transcripcionales, reguladores del crecimiento celular, señales de transducción, reguladores del ciclo celular, proteínas supresoras de tumores, oncoproteínas, enzimas de vida media corta, proteínas víricas y receptores. La degradación de la proteína blanco por el sistema de ubiquitina proteasoma incluye dos pasos distintos y sucesivos: primero unión covalente de múltiples moléculas de ubiquitina a la proteína blanco; segundo, reconocimiento y degradación de la proteína por un complejo proteolítico formado por varias subunidades proteínicas denominado proteasoma 26S. La ubiquitina es liberada en este proceso de degradación, de suerte que puede ser reutilizada en otro ciclo. Los dos pasos de esta vía, el marcaje y la degradación, son reacciones dependientes de ATP. La unión de la ubiquitina marca a la proteína para su rápida degradación, de tal manera que la estabilidad de muchas proteínas se determina por este paso. La ubiquitinación de una proteína es un proceso que comprende

www.FreeLibros.me


102

Capítulo 7

Transducción de señales

varios pasos. Primero, la ubiquitina es activada al unirse a la enzima activadora de ésta, E1; después de esto, es transferida a una segunda enzima llamada enzima conjugadora de ubiquitina, E2. En algunos casos, la ubiquitina es transferida de E2 a la proteína blanco; sin embargo, en la mayoría de los casos se transfiere a una tercera enzima, la ubiquitina ligasa o E3, y de ahí a la proteína blanco. Casi todas las células poseen sólo un tipo de E1, pero tanto E2 como E3 son miembros de una gran familia de proteínas. Diferentes miembros de las familias de E2 y E3 reconocen diferentes sustratos; esta es la clave para la selección y marcaje de la proteína para su posterior degradación (fig. 7-20). Diferentes factores transcripcionales y proteínas reguladoras son objeto de degradación de estas vías dentro de los cuales se encuentran las Smad, los componentes de AP-1 “c-Jun” y “c-Fos”, el inhibidor del NF-κB “IκB”.

Ubiquitina

Por otra parte, se ha demostrado que los factores transcripcionales STAT-1 y STAT-2 son degradados por el proteasoma en infecciones víricas como un mecanismo de defensa de los virus contra los efectos del interferón. El interferón se secreta como una citocina que activa la reacción inmunitaria en respuesta a infecciones víricas. La respuesta de las células a los diferentes tipos de interferones incluye la activación de las cinasas JAK y fosforilación de las STAT. Las STAT, como se explicó en la sección correspondiente, dimerizan, translocan al núcleo y activan genes participantes en la respuesta antivírica. Se ha señalado que los paramixovirus bloquean la respuesta del interferón, induciendo la degradación de las STAT. La proteína V del virus 5 de los simios marca a STAT1 para su degradación, en tanto que el virus de la parainfluenza (paragripal) marca STAT2, induciendo su degradación por el proteasoma.

ATP ADP

E1

Poliubiquitinación

E1

E2 E3

ATP ADP

Proteasoma 26S

Péptidos

Figura 7-20

Vía de ubiquitina proteasoma. La ubiquitina es una proteína que marca a otras proteínas para su degradación por el proteasoma 26S. Primero, se activa al unirse a la enzima activadora, E1. Después de esto, es transferida a una segunda enzima llamada enzima conjugadora, E2. En algunos casos, la ubiquitina es transferida de E2 a la proteína blanco; sin embargo, en la mayoría de los casos es transferida a una tercera enzima, la ligasa o E3, y de ahí a la proteína blanco. La mayoría de las células posee sólo un tipo de E1, pero tanto E2 como E3 son miembros de una gran familia de proteínas. Diferentes miembros de las familias de E2 y E3 reconocen diferentes sustratos; esta es la clave para la selección y marcaje de la proteína para su posterior degradación.

www.FreeLibros.me


Bibliografía

103

BIBLIOGRAFÍA Davis RJ. Signal transduction by the JNK group of MAP kinases. Cell, 2000;103:239-252. Desterro J, Rodríguez MS, Hay RT et al. Regulation of transcription factors by protein degradation. Cell Mol Life Sci, 2000;57:1207-1219. Drin G, Scarlata S. Stimulation of phospholipase Cb by membrane interactions, interdomain movement, and G protein binding. Cell Signaling, 2007;19:1383-1392. Ghosh S, May MJ, Kopp EB. NF-κB and rel proteins: evolutionary conserved mediators of immune responses. Annu Rev Immunol, 1998;16:225-260. Itoh S, ten Dijke P. Negative regulation of TGF-beta receptor/ Smad signal transduction. Curr Opin Cell Biol, 2007;19:176184. Kraus S, Brand MD. Quantitation of signal transduction. FASEB J, 2000;14:2581-2588.

Massagué J, Blain SW, Lo RS. TGFβ signaling in growth control, and heritable disorders. Cell, 2000;103:295-309. O´Keefe G, Corn, Dark I. Cell signaling. En: Geoffrey M (ed.). The cell a molecular approach. Washington: ASM Press, SINAUER, 1997;521-560. Schelssinger J. Cell signaling by receptor tyrosine kinases. Cell, 2000;103:211-225. Tak P et al. NF-κB: a key role in inflammatory diseases. J Clin Invest, 2001;107:7-11. Tomita T, Takeuchi E, Tomita M, Morishita R, Kaneko M, Yamamoto K, Nakase T et al. Suppressed severity of collageninduced arthritis by in vivo transfection of nuclear factor kappa B decoy oligodeoxynucleotides as a gene therapy. Arthritis Rheum, 1999;42:2532-2542. Wrana J. Crossing Smads. Science’s stke, 2000;23:1-8.

www.FreeLibros.me


www.FreeLibros.me


PARTE II

Capítulo

8

Técnicas de DNA recombinante Dr. Daniel Ortuño Sahagún Dra. Argelia E. Rojas Mayorquín

que han dado lugar a la biotecnología, uno de los campos más activos y de mayor crecimiento de la investigación científica de los últimos dos decenios. Estas técnicas permiten a los investigadores aislar genes de muy diferentes organismos, manipular el DNA purificado en el laborato-

INTRODUCCIÓN Las técnicas de DNA recombinante comprenden una gran cantidad y variedad de desarrollos tecnológicos (cuadro 8-1), en permanente avance durante los últimos 30 años,

Cuadro 8-1

Antecedentes históricos de la biotecnología

• 1909 El físico británico Archibald Garrod es el primero en proponer la relación entre los genes y las proteínas. Propone que los genes pueden estar incluidos en la formación de las proteínas que realizan las reacciones del metabolismo. • 1928 Franklin Griffith descubre que la información genética puede ser transferida de bacterias muertas a bacterias vivas por incremento de la temperatura. Este fenómeno fue denominado transformación. • 1930 Mediante experimentos realizados con cepas mutantes de levaduras de Neurospora, George Beadle y Edward Tatum aportan evidencias que apoyan la hipótesis de Garrod. Esta evidencia da origen a la hipótesis: “un gen, una proteína”, es decir, que cada proteína de la célula resulta de la expresión de un gen. • 1944 Oswald Avery, Maclyn McCarty y Colin MacLeod identifican al DNA como el “agente transformante” de Griffith. • 1957 Durante una epidemia de disentería en Japón, un grupo de biólogos descubrió que ciertas cepas de bacterias eran resistentes a antibióticos. Posteriormente se descubriría que esta resistencia se debía a plásmidos. • 1961 Sidney Brenner y Francis Crick proponen el código genético, estableciendo que los aminoácidos de las proteínas están codificados por grupos de tres nucleótidos o codones en el DNA. • 1966 Se descifra el código genético al descubrir, mediante análisis bioquímicos el aminoácido que determina cada codón. • 1970 Hamilton Smith, en la Escuela de Medicina del Johns Hopkins, aísla por vez primera una enzima de restricción. • 1972 Stanley Cohen y Herbert Boyer combinan sus esfuerzos para generar la tecnología del DNA recombinante, lo que da origen a la industria biotecnológica. • 1976 Herbert Boyer es cofundador de Genentech, la primera compañía que aplica la tecnología de DNA recombinante. • 1978 Se sintetiza la primera proteína humana mediante tecnología de DNA recombinante, la somatostatina, que regula a las hormonas del crecimiento.

105

www.FreeLibros.me


106

Capítulo 8

Técnicas de DNA recombinante

rio, y posteriormente transferir estos genes a otros organismos. Los experimentos de clonación de genes han sobrevivido a la histeria del decenio de 1970, durante el cual el temor a la creación de organismos patógenos que causaran plagas incontrolables amenazó con suspender esta línea de experimentación desde sus orígenes. Estos temores han resultado infundados a partir de la Conferencia de Asilomar y del desarrollo de procedimientos por el National Institute of Health (NIH) para conducir los experimentos de DNA recombinante. Por otra parte, conforme se han acumulado evidencias experimentales, y ha quedado demostrado el potencial beneficioso de estas nuevas tecnologías, tanto para la investigación básica como aplicada, son consideradas en la actualidad como uno de los desarrollos científicos más importantes de la historia. En el presente capítulo se abordan principalmente los conceptos básicos relativos a la tecnología del DNA recombinante, así como, de manera breve, la descripción de algunas técnicas relacionadas y los avances más recientes en este tema, planteando los logros y las metas a futuro de esta tecnología.

ASPECTOS BÁSICOS DE LOS ÁCIDOS NUCLEICOS La información genética necesaria para sintetizar las proteínas de todas las células está contenida en el DNA (ácido desoxirribonucleico). El DNA, en el núcleo de las células eucariontes, está asociado con proteínas histonas que conforman la cromatina, una estructura con un grado de empaquetamiento variable que dará lugar a los cromosomas. Por su parte, los procariontes, las mitocondrias y los cloroplastos contienen su propia información genética en una molécula circular de DNA. En ambos casos, éste contiene dos hebras antiparalelas, que originan una estructura de doble hélice. Las hebras complementarias son polímeros de nucleótidos (base nitrogenada + azúcar + fosfato). La información hereditaria está codificada en la secuencia de bases nitrogenadas púricas (adenina y guanina) y pirimídicas (citosina y timina), que agrupadas de tres en tres constituyen un codón, o unidad básica de información genética. Cada codón se traduce a un aminoácido, y establece su posición en la secuencia de una proteína. La posición que ocupa una adenina en una hebra se aparea con una timina en la hebra complementaria mediante dos puentes de hidrógeno, en tanto que la guanina y la citosina se aparean entre sí mediante tres puentes de hidrógeno. Antes de la división celular, deben generarse dos copias completas del DNA, de tal manera que cada célula hija asegure conservar la información genética completa. Este proceso de producción de dos copias idénticas de

DNA se denomina replicación o duplicación. La información almacenada en el DNA es transferida al RNA mensajero (RNAm) mediante el proceso de transcripción. El RNAm es complementario a la hebra de DNA de la cual fue copiado. Las bases nitrogenadas que lo componen son las mismas que el DNA, con excepción de la timina que es sustituida por el uracilo. Luego, la información contenida en el RNAm será decodificada para la síntesis de proteínas mediante el proceso de traducción. Este proceso lo llevan a cabo en el citoplasma celular los ribosomas, complejos supramacromoleculares encargados de la lectura y traducción a proteínas del mensaje genético. La región codificante del DNA es la que contiene los codones que serán traducidos a proteína a través del RNAm. En procariontes, la región codificante del DNA está por lo general ininterrumpida y produce directamente al RNAm, el cual prácticamente no sufre procesos de maduración y se traduce de inmediato. Sin embargo, en eucariontes no ocurre así; en ellos, las regiones del DNA que contienen las secuencias codificantes (exones) están separadas por secuencias no codificantes (intrones). Así, la transcripción inicial del DNA genera una molécula de RNA de gran tamaño denominada RNA heterogéneo nuclear (RNAhn), el cual sufrirá en el interior del núcleo un proceso de maduración denominado ajuste (proceso de corte y empalme o de edición), en el que los intrones serán cortados y eliminados, y los exones son empalmados entre sí para dar lugar al RNAm maduro, el cual saldrá al citoplasma donde servirá de molde para la síntesis de proteínas. La función precisa de los intrones no es completamente conocida aún; no obstante, es obvio que el proceso de producción del RNAm en eucariontes es mucho más complejo que en procariontes. Debido a las cargas negativas de los grupos fosfato, los fragmentos de DNA se mueven cuando se someten a la acción de un campo eléctrico. Cuando esto se hace a través de determinadas matrices con consistencia de gel, la velocidad de migración es inversamente proporcional a la longitud de las moléculas de DNA. Esta característica permite separar por tamaño diferentes fragmentos de DNA, que luego pueden visualizarse después de teñir la matriz de gel con algún colorante específico del DNA, como el bromuro de etidio, para su observación con luz ultravioleta.

TECNOLOGÍA DEL DNA RECOMBINANTE El desarrollo de estas técnicas ha tenido como objetivo fundamental el aislamiento de genes discretos a partir de los genomas de los seres vivos, unicelulares o pluricelulares, tanto procariontes como eucariontes, para su estudio en el laboratorio. Para su manejo, un determinado genoma se reduce a una genoteca, que consiste en una mezcla de fragmentos de DNA en la que está representado prácti-

www.FreeLibros.me


Genotecas

camente todo el genoma de partida. Las genotecas, como se ve más adelante, son fácil y rápidamente amplificables y rastreables en busca de los genes de interés. La secuencia de DNA que codifica una proteína específica representa alrededor de un millonésimo de un genoma eucarionte. Para lograr localizarla podemos usar tres aproximaciones básicas. En primer lugar, la clonación molecular en un sistema celular (genotecas), la cual consiste, de manera breve, en inducir la formación de cepas bacterianas que contengan una copia del fragmento de DNA de interés, para su posterior selección. En segundo lugar, la hibridación, la cual consiste en la síntesis de una cadena sencilla de DNA o RNA marcada radiactivamente (P32, P33, S35) o químicamente (digoxigenina o fluoresceína), y su posterior acoplamiento con el DNA a identificar. En tercer lugar, la reacción en cadena de la polimerasa (PCR), que consiste en obtener múltiples copias de una región específica de DNA por métodos bioquímicos dentro de un tubo de ensayo. Diversos descubrimientos científicos han sido de crucial importancia para el desarrollo de la tecnología de DNA recombinante, cuya técnica original la presentaron Cohen y Boyer en 1974. Los elementos participantes en la clonación molecular son: a) plásmidos, moléculas circulares de DNA capaces de replicarse dentro de una bacteria de manera independiente de su genoma; b) inserto, DNA de interés; c) enzimas de restricción, endonucleasas que cortan el DNA en secuencias específicas; d) ligasa de DNA, enzima capaz de unir por sus extremos dos fragmentos de DNA, lo que permite la formación de un DNA circular, y e) proceso de transformación, introducción del DNA recombinante manipulado in vitro en una célula hospedadora para su propagación, identificación y aislamiento. Es destacable el descubrimiento de un tipo de enzimas bacterianas, las endonucleasas de restricción. Se obtienen a partir de diferentes cepas de bacterias, y hasta la fecha se han descubierto más de 100 enzimas de este tipo. Poseen la capacidad única de cortar ambas hebras del DNA de doble cadena en sitios específicos. La especificidad de estas enzimas está determinada por la secuencia de nucleótidos del DNA, llamada secuencia de reconocimiento, que identifica en torno al sitio de corte, y que va por lo general de cuatro a seis pares de nucleótidos. Una endonucleasa de restricción hace posible cortar una molécula de DNA en un sitio preciso. Las secuencias de reconocimiento son palindrómicas, es decir, se leen de la misma manera en sentido 3′-5′ que en sentido inverso en la hebra complementaria. Bacteria

Enzima

Sitio de reconocimiento

Escherichia coli

Eco RI

GAATTC CTTAAG

Haemophilus aegyptius Hae III

GC CC CC GG

107

Por otra parte, el desarrollo de técnicas de síntesis y secuenciación de moléculas de DNA ha sido fundamental para el avance de la tecnología de DNA recombinante. Las técnicas de secuenciación de DNA recientemente desarrolladas permiten la secuenciación de DNA y RNA en corto tiempo. El conocimiento de la secuencia de bases nitrogenadas es de obvia importancia en la selección de las endonucleasas de restricción apropiadas. La síntesis de moléculas de DNA, incluso las que codifican para pequeñas proteínas o péptidos, es aún una ardua labor. A pesar de ello, estas técnicas se utilizan mucho para la síntesis de pequeñas secuencias de DNA (de 10 a 50 pb) denominadas oligonucleótidos, en las cuales se pueden incorporar los sitios de corte (sitio de restricción) de endonucleasas específicas, lo cual es de gran trascendencia en el proceso de clonación de genes. Las técnicas de DNA recombinante permiten insertar y expresar, en el genoma de un ser vivo, pequeños fragmentos de DNA ajenos al mismo. En la mayor parte de los experimentos, las células hospedadoras son bacterias. Hay dos razones principales para usar bacterias en estas metodologías debido a: 1) la relativa simplicidad para producir RNAm maduro y su proteína correspondiente, comparado con un sistema eucarionte, y 2) la capacidad de las bacterias para multiplicarse de manera exponencial en periodos muy cortos, con lo cual es posible obtener grandes cantidades del DNA o de la proteína de interés. La bacteria utilizada con más frecuencia para este propósito es Escherichia coli.

GENOTECAS Las genotecas pueden ser de dos tipos, lo cual depende de que los fragmentos de DNA que las componen representen directamente el genoma del ser vivo o a la población de RNAm presente tanto en un tejido como en un momento del desarrollo determinado. En el primer caso, las genotecas de genomas eucariontes presentan diversos problemas, pues los genes eucariontes son muy grandes, y contienen 80 a 90% de secuencia no codificante (intrones y secuencias reguladoras), por lo que, incluso si se clona un fragmento genómico que incluyera un gen completo en un cósmido, los procariontes no poseen las enzimas requeridas para el proceso de ajuste, ni realizan las modificaciones postraduccionales específicas que se realizan, tanto en el sistema de retículos como en el aparato de Golgi. Por ello, la expresión en un sistema procarionte de un gen clonado de esta forma no es posible. Por otra parte, en el segundo caso, la genoteca es una recolección de DNA complementarios (DNAc) (copias de RNAm en forma de DNA), que se propagan en un vector de clonación. Las genotecas de DNAc tienen tres características principales: son lo suficiente numerosas como

www.FreeLibros.me


108

Capítulo 8

Técnicas de DNA recombinante

para contener una representación adecuada de casi todos los RNAm presentes en las células o tejidos de los cuales se obtuvieron; contienen muy pocos fragmentos pequeños, ya que, en su mayor parte, abarcan fragmentos de gran tamaño y pueden incluir copias completas de los RNAm de donde se elaboraron. Las genotecas de DNAc pueden contener los insertos en una orientación específica, relativa a la polaridad transcripcional de los RNAm de partida o no. Las genotecas direccionales se construyen por lo general para favorecer la expresión del gen clonado mediante un promotor controlable, y ya que son potencialmente capaces de expresar un antígeno, los clones individuales pueden ser aislados mediante un rastreo diferencial utilizando anticuerpos que detecten la expresión de la proteína correspondiente. Por otra parte, los componentes de una genoteca no direccionada incluyen insertos clonados en cualquiera de dos orientaciones (sentido o antisentido), por lo que tan sólo 50% de los clones estará en la dirección conveniente para su expresión. Las genotecas pueden generarse de diversas formas y en diferentes vectores. La construcción de una buena

Cuadro 8-2

genoteca de DNAc comienza con la obtención de RNAm de alta calidad. Para lograr resultados de óptima calidad, el RNAm debe ser purificado en una columna de afinidad que utilice como matriz oligo(dT) celulosa, la cual seleccionará de preferencia el ácido ribonucleico mensajero poliadenilado (mRNA poli-A+). La cantidad de RNAm necesaria para preparar la genoteca es dependiente de la eficiencia de las etapas individuales requeridas para convertir el RNAm en una forma que pueda ser clonada, así como de la eficiencia con la que las moléculas recombinantes puedan introducirse en un vector. Los vectores de clonación son diversos y deben reunir ciertas características: poseer un origen de replicación (que les da la capacidad para ser replicados de manera independiente del genoma de la célula que los contenga), tener un marcador que permita identificar las células que lo contengan, sitios de restricción (secuencias de corte identificables por endonucleasas de restricción específicas) compatibles con los que estén en el fragmento a insertar, y tener un mecanismo de incorporación a la célula hospedadora una vez construidos (cuadro 8-2).

Vectores de clonación VECTORES PLASMÍDICOS Ventajas

Poseen un origen de replicación que permite realizar múltiples copias en una misma célula (100 a 200 copias por célula). Presentan marcadores de selección. Resistencia a ampicilina, mediante la producción de la enzima betalactamasa que inactiva por proteólisis a la penicilina. Resistencia a kanamicina, mediante la producción de una fosfotransferasa que fosforila a la kanamicina impidiendo su unión al ribosoma. Identificación de clones positivos. Mediante plásmidos con doble marcador de resistencia (pBR322), el sitio de inserción del inserto elimina la resistencia a tetraciclina. Los transformantes con insertos son resistentes a ampicilina, pero sensibles a tetraciclina, en tanto que los transformantes sin inserto son resistentes a ambos antibióticos. Mediante un marcador cromógeno (pUC plasmids), el sitio de inserción rompe el gen de lac Z. Los transformantes con insertos son blancos, en tanto que los transformantes sin inserto son azules. Incluyen sitios de restricción únicos y son diseñados con sitios de clonaje múltiple (Polylinker), lo cual incrementa la flexibilidad en términos de la selección de la o las enzimas de restricción utilizadas para el clonaje (pBluescript o pUC18). Diseñados con un promotor específico en ambos extremos del sitio de inserción o clonaje, lo cual permite la transcripción del inserto en ambas direcciones. Diseñados con orígenes de replicación de bacteriófagos para la producción de DNA de cadena sencilla en ambos extremos del sitio de inserción o clonaje, el cual puede ser utilizado para secuenciación. (continúa)

www.FreeLibros.me


Genotecas

Cuadro 8-2

109

Vectores de clonación (continuación) Desventajas:

Permiten el clonaje únicamente de fragmentos pequeños. Insertos de 4 a 5 kb en promedio con un máximo de aproximadamente 15 kb. Vector

Tamaño promedio del inserto

Plásmido

4-5 kb

Lambda

15-20 kb

Cósmido

40-45 kb

YAC

400 kb VECTORES DE BACTERIÓFAGO LAMBDA

Construcción: mediante una enzima de restricción se remueve la porción central del genoma del bacteriófago lambda (unas 20 kb), que codifica para las proteínas de la cápside. Se aíslan los brazos izquierdo y derecho que portan los genes requeridos para la replicación y para el empaquetamiento en la cabeza del fago. Inserción: el DNA genómico que quiera clonarse es parcialmente digerido, generando grandes fragmentos, lo que incrementa la posibilidad de que puedan contener genes enteros intactos. Después, los brazos del fago y estos fragmentos serán ligados, formando un largo concatenado unido por sitios coadyacentes. Este concatenado se mezcla con extractos de las proteínas de empaquetamiento de la cápside, las cuales se autoensamblan in vitro en las cabezas del fago. Las células hospedadoras son infectadas con el bacteriófago así construido. Cada placa de lisis representa un fragmento diferente de la genoteca. Ventajas Permiten clonar grandes fragmentos (promedio de 15 a 20 kb y hasta de 50 kb). Presentan una alta eficiencia de transformación. VECTORES DE CÓSMIDOS Construcción: se introduce un par de sitios cos en un plásmido utilizado como vector y se corta con una enzima de restricción en un sitio adyacente a los sitios cos. Se digiere parcialmente el DNA genómico con una enzima de restricción complementaria y se liga el producto de ambas digestiones para construir un concatenado de gran tamaño. El DNA concatenado se mezcla entonces con un extracto de proteínas de la cápside del fago lambda, las cuales se autoensamblan empacando al DNA en los extremos del fago. Luego se infectan células. En lugar de formar placas, el DNA de lambda se recirculariza formando un plásmido. Los transformantes son seleccionados por la resistencia a antibióticos conferida por el plásmido. A pesar de ser muy grande el plásmido, la presión de selección lo mantiene en las bacterias. Ventajas Permiten clonar grandes fragmentos (más de 45 kb), lo que incrementa la probabilidad de clonar genes eucariontes completos. Permiten una alta eficiencia de incorporación de plásmidos de gran tamaño en bacterias. VECTORES YAC (Yeast Artificial Chromosomes) Son cromosomas artificiales lineales. Se construyen con grandes fragmentos de DNA (de hasta ~1 000 kb) Contienen secuencias ARS de levadura para su replicación. Contienen secuencias CEN de levadura para su segregación. Contienen telómeros de levadura para la estabilidad del cromosoma. Contienen marcadores de levadura (uno en cada brazo del cromosoma) para su identificación.

www.FreeLibros.me


110

Capítulo 8

Técnicas de DNA recombinante

Clonación El procedimiento de clonación de un gen o fragmento de DNA es una técnica en la que una secuencia de DNA es introducida en un virus o bacteria, los cuales son cultivados en condiciones que propicien su máximo crecimiento y tiene básicamente los siguientes pasos: 1) el aislamiento inicial o síntesis del fragmento de DNA de interés; 2) el acoplamiento de esta secuencia a un vehículo o vector portador, entendiendo por vector a una molécula de DNA que es capaz de replicarse de modo independiente del genoma dentro de un sistema celular; 3) la incorporación del complejo vector-DNA en la célula hospedadora, procedimiento denominado transformación, y 4) la expresión del DNA en la célula hospedadora. La secuencia de DNA introducida será entonces replicada junto con el DNA natural durante el crecimiento. Cuando se alcanza la cantidad necesaria, la secuencia de DNA puede ser extraída en cantidad equivalente al número de bacterias o virus producidos, logrando la amplificación de dicha secuencia. La técnica de clonación depende de un grupo de enzimas de restricción endonucleasas obtenidas de bacterias. Para clonar una secuencia, tanto el DNA de interés como el plásmido que se utilizará como vector son digeridos con una endonucleasa de restricción, generando fragmentos compatibles. En caso de la clonación de secuencias para inducir su expresión, cuando se introduce el vector con el inserto en las células donde se expresará, éstas mantendrán reprimida o inactiva la transcripción hasta que se añada al medio una sustancia inductora que active al promotor. A continuación se revisan en detalle estos procedimientos.

Preparación del DNA El DNA de seres vivos multicelulares contiene la información codificada de una enorme cantidad de proteínas, por lo que localizar la secuencia determinada que codifique para una proteína específica, por ejemplo la hemoglobina, es sumamente difícil. Además, el DNA incluye una gran proporción de secuencia no codificante (intrones) insertada entre la secuencia codificante (exones). Si un fragmento de DNA de tales características fuera insertado y transcrito de manera directa en un sistema bacteriano, la bacteria no sería capaz de procesar el RNAm precursor inmaduro y no ocurriría la síntesis de la proteína correspondiente, debido a que no posee la maquinaria enzimática necesaria. Por ello, para lograr la producción de una proteína concreta en un sistema bacteriano, es necesario incorporar a éste la secuencia definitiva del RNAm, en forma de secuencia de DNA, a partir de la cual la bacteria sería capaz de transcribir el mensajero adecuado e incluso traducirlo en la proteína correspondiente.

La transcriptasa inversa es una enzima capaz de sintetizar una molécula de DNA a partir de un molde de RNA. El DNAc así producido es idéntico a la porción codificante del DNA a partir del cual el RNA en cuestión fue transcrito en un principio. Una vez obtenido el DNAc, es necesaria la síntesis de la cadena complementaria (segunda cadena), separando al DNAc del RNAm original, el cual es digerido, y procediendo a la síntesis de la segunda cadena mediante una enzima polimerasa de DNA, con lo que se obtiene un DNAc de doble cadena representativo de los RNAm originales, el cual puede ser incorporado al sistema bacteriano mediante su inserción en un vector adecuado (cuadro 8-2). Este sistema tiene sus limitaciones, pues no es capaz de lograr, por ejemplo, modificaciones postraduccionales, que son indispensables en muchas proteínas para ser funcionales; sin embargo, permite obtener, en la mayor parte de los casos, grandes cantidades de proteína, la cual puede purificarse para diversas aplicaciones, por ejemplo la obtención de anticuerpos. Otro sistema para producir una molécula de DNA determinada es mediante la síntesis química directa, lo cual es sólo posible, y costeable, para moléculas muy pequeñas. Obviamente, es indispensable conocer la secuencia de la molécula que se quiera reproducir por síntesis.

Construcción del plásmido o complejo de DNA vector-insertos Una vez producido el DNA a clonar, es necesario incorporarlo a un sistema en el cual pueda ser expresado. Esto implica la inserción del fragmento en cuestión en un vector, para lo cual es indispensable la elaboración de un mapa de restricción, que permita localizar el número y la posición de los sitios de corte de las endonucleasas que se utilizarán. Los vectores usados más a menudo son plásmidos bacterianos, es decir, pequeños DNA circulares que no forman parte del genoma bacteriano y que son capaces de replicarse de manera autónoma a éste. Por tanto, cuando el plásmido se replique, se copiará también el fragmento que le fue insertado. Dado que el sistema bacteriano es capaz de replicar, transcribir y traducir la información contenida en estos plásmidos, es posible, al menos en teoría, que ocurra lo mismo con la secuencia de nuestra elección que haya sido insertada en dicho sistema, lo que permite producir la proteína correspondiente. A fin de lograr la clonación o inserción del fragmento de DNA de interés en el vector correspondiente, utilizamos una o varias enzimas de restricción. Una forma de hacerlo es identificando primero una secuencia única de corte en el vector, que permita abrirlo para insertar después el fragmento correspondiente mediante una ligasa de DNA. Por supuesto, no debe haber un sitio de corte identificable por esa enzima dentro del inserto, ya que lo

www.FreeLibros.me


Genotecas

partiría impidiendo su inserción. Podemos sintetizar químicamente pequeños fragmentos de DNA que contengan diversos sitios de corte para endonucleasas de restricción específicas y luego ligarlos a ambos extremos del DNA a clonar, o incluso en el vector mismo. Cuando actúa una endonucleasa de restricción, se producen dos tipos de extremos en la molécula de DNA: los extremos romos, cuando el corte se efectúa de modo exacto en el mismo nucleótido en ambas cadenas, y los extremos cohesivos, cuando se hace a diferente distancia en ambas cadenas (de uno a cinco nucleótidos de diferencia), quedando, por tanto, una cadena más larga que la otra. En ambos casos, la molécula (inserto) que se ligará después de manera covalente debe tener el mismo tipo de corte, sea con extremos romos o cohesivos, para poder ligarse adecuadamente (fig. 8-1). La eficiencia del proceso de clonación dependerá de diversos factores, entre los cuales los más importantes son: una acción completa de la endonucleasa de restricción (digestión del fragmento), los tamaños y cantidades relativos de inserto y vector, la acción de la ligasa, así como del tipo de extremos que se quiera ligar.

Transformación Una vez que el complejo vector-inserto se ha formado, debe incorporarse a una bacteria. Este procedimiento se denomina transformación. El mecanismo preciso de cómo ocurre la incorporación de dicho complejo a través de la membrana bacteriana aún no es completamente conocido. Sin embargo, se sabe que comprende un cambio transiente en la permeabilidad de la membrana, y que es un proceso lento y poco eficiente, por lo que una vez realizado deben determinarse cuidadosamente cuáles bacterias han incorporado el plásmido y cuáles no. El método más común para monitorear el proceso de transformación es el uso de plásmidos que contengan un gen que confiera a la bacteria que lo incorpore, una resistencia específica a ciertos antibióticos.

Fragmento A

Cuando se han transformado, las bacterias son crecidas en un medio selectivo en presencia del antibiótico correspondiente. Sólo las bacterias transformadas podrán crecer en estas condiciones. Este procedimiento se realiza en placas de Petri, de suerte que cada colonia obtenida se originó de una sola bacteria transformada, y todas las bacterias de esa colonia derivan de ella, por lo cual cada una constituye un clon, pues todas las bacterias que la conforman son idénticas. A este proceso se le llama clonación. Como se mencionó, no todos los plásmidos obtenidos luego del proceso de inserción y ligamiento contienen el fragmento de DNA, por lo cual es necesario seleccionarlos. Por otra parte, en los experimentos de clonación de genes en los que partimos de RNAm para producir DNAc de doble cadena, también es muy heterogénea la población de moléculas utilizadas; por ello, en estos casos debe hacerse una cuidadosa selección de aquel clon bacteriano que contenga exactamente el inserto de interés y no otro. Se ha diseñado una amplia variedad de procedimientos para poder detectar el clon de interés, así como su producto, una proteína. Si el fragmento de DNA no codifica para una proteína, el método usado con mayor frecuencia para identificarlo es el marcaje de un fragmento complementario a aquel que interesa identificar. Dicho marcaje puede ser radiactivo, mediante P32, o químico, con digoxigenina. El DNA de los clones será extraído e hibridado con esta sonda, lo cual permitirá identificar de manera específica el fragmento correspondiente. Por otra parte, si el inserto codifica para una proteína, la elección del procedimiento dependerá de las propiedades de ésta. Por ejemplo, si la proteína a identificar cataliza una reacción enzimática específica o posee alguna actividad biológica característica, esto nos permitirá detectarla. Otro método muy utilizado es el uso de anticuerpos marcados, sea radiactivamente o con fluorescencia. Estos anticuerpos pueden ser preparados a partir de inyectar a un animal la proteína contra la cual se quieren obtener. El sistema

Fragmento B

Extremos cohesivos

Figura 8-1

111

Molécula de DNA con dos extremos.

www.FreeLibros.me

Fragmento A

Fragmento B

Extremos romos


112

Capítulo 8

Técnicas de DNA recombinante

inmunitario reconocerá esta proteína como extraña a él y producirá entonces anticuerpos que la reconozcan de manera específica. Los anticuerpos así producidos pueden ser aislados y marcados. Los experimentos de clonación génica también se utilizan para purificar fragmentos específicos de DNA. Si sólo se puede obtener por síntesis o aislamiento una pequeña cantidad de determinado fragmento de DNA, su clonación nos puede permitir obtener grandes cantidades de dicho fragmento. Una vez obtenido un clon bacteriano que contenga el fragmento, a partir de este clon es posible obtener prácticamente cualquier cantidad de copias del mismo.

Expresión del DNA clonado en un sistema bacteriano Para lograr que el DNA clonado se exprese en un sistema bacteriano, es necesario tomar en cuenta ciertos aspectos adicionales. El DNA a expresar debe ser clonado en un plásmido (vector) reconocible por la enzima encargada de la producción de RNAm mediante la transcripción. Son dos los sitios de reconocimiento específico necesarios para la expresión del DNA en un sistema bacteriano: el promotor, que es el sitio donde la polimerasa de RNA encargada de la transcripción se une, y el sitio de unión del ribosoma. Este sitio debe estar presente en el RNAm para permitir su unión al ribosoma y su traducción a proteína. Por su parte, la eficiencia del proceso de expresión dependerá de varios factores: el número de copias de plásmido por célula, la eficiencia del promotor, el índice de frecuencia de uso de codones, la estabilidad o vida media del RNAm, así como el nivel de proteólisis de la célula hospedadora. Por ello, es tanto ciencia como arte el lograr construir un plásmido de manera tal que el DNA clonado sea expresado correctamente en un sistema bacteriano. En la mayor parte de los experimentos de clonación, es indispensable conocer la secuencia exacta, tanto del vector como del fragmento a ser clonado, así como la posición y número de sitios de corte para una serie de enzimas de restricción, lo cual nos permitirá manipular los diferentes fragmentos de DNA. Es decir que, al usar tanto sistemas de síntesis como de secuenciación de DNA, y combinándolos con ciertas enzimas de restricción, es posible construir, clonar y expresar, en un sistema bacteriano y al menos en teoría, prácticamente cualquier molécula de DNA.

APLICACIONES DE LA TECNOLOGÍA DEL

DNA

RECOMBINANTE

A partir de lo presentado hasta ahora, es evidente que uno de los principales usos de la tecnología de DNA recombinante es la producción, en gran escala, de sustancias de

importancia clínica. Es el caso del interferón, el cual tiene un gran potencial como antivírico; sin embargo, había sido muy difícil la obtención incluso de muy pequeñas cantidades de interferón humano. Es necesario conseguir grandes cantidades de cualquier sustancia que desee probarse con fines terapéuticos, no sólo para realizar una gran cantidad de experimentos previos a su uso, sino para su aplicación clínica misma. A este respecto, las tecnologías de DNA recombinante proveen a los investigadores con poderosas herramientas para producir cantidades prácticamente inagotables de, en teoría, casi cualquier proteína con actividad biológica, desde un pequeño péptido hasta una proteína de alto peso molecular, tal es el caso de proteínas de importancia clínica, además del interferón, como la insulina y la hormona del crecimiento. Por otra parte, algunos padecimientos genéticos que incluyan la producción de una proteína deficiente concreta son susceptibles de tratamiento por terapia de reemplazo de dicha enzima, siendo el factor limitante la cantidad de la misma que pueda obtenerse y proporcionarse. En teoría, la tecnología de DNA recombinante es capaz de generar grandes cantidades de enzimas para este y otros propósitos. Entre la causa de muchas enfermedades, como la anemia falciforme, la enfermedad de Tay-Sachs, y otras, está un defecto en un solo gen. El reemplazo del gen deficiente por una versión funcional llevaría a la completa curación del padecimiento. Hasta hace poco esta posibilidad de tratamiento era ciertamente improbable, pues incluiría la inserción de DNA en una célula eucarionte y su posterior expresión. El DNA de los eucariontes pluricelulares es mucho más complejo que el de las bacterias, no sólo por estar permanentemente asociado a proteínas (histonas y no histonas), sino por sus diferentes niveles de organización estructural y compactación. No obstante, en fecha reciente, Mantei, Boll y Weissman han logrado clonar el DNA de la subunidad β de la hemoglobina. Insertaron este DNA en células de ratón y el DNA funcionó de modo correcto y produjo RNAm funcional. Además, Cline y colaboradores, han logrado transformar células de médula ósea con el DNA de la enzima reductasa de dihidrofolato, haciéndolas resistentes al metotrexato. Reincorporaron las células a la médula ósea y observaron que las células no sólo se comportaban de manera normal, sino que eran capaces de producir la enzima y ésta era funcional. En ambos experimentos, el DNA codificante para una proteína específica fue insertado en una célula eucarionte y funcionó de manera al parecer normal; es decir, era capaz de producir un RNAm traducible en una proteína funcional. Conforme las técnicas de DNA recombinante sean más refinadas y mientras más se conozcan los mecanismos de funcionamiento del DNA en las células de los seres vivos multicelulares, se podrán realizar en ellos las complejas manipulaciones genéticas que se hacen hoy en día en las

www.FreeLibros.me


Glosario

bacterias. En conjunto, estos estudios llevarán paulatinamente a etapas donde la terapia de reemplazo génico sea casi sistemática. Las técnicas de DNA recombinante son las encargadas del descubrimiento de las secuencias espaciadoras (intrones) en el DNA de los seres vivos multicelulares,

y jugarán sin duda un papel crucial en los esfuerzos por comprender su funcionamiento. Las aplicaciones potenciales de la tecnología de DNA recombinante, tanto en la investigación básica como la aplicada, parecen tener sus límites hasta donde alcance la imaginación de los investigadores que las utilizan.

GLOSARIO Clonación: a nivel molecular, consiste en inducir, en un sistema celular, la formación de una cepa bacteriana que contenga una copia de un fragmento de DNA de interés en forma de plásmido, y su posterior selección. A nivel de célula y de organismo, consiste en la obtención de muestras genéticamente idénticas (copias idénticas) de determinada célula u organismo. DNA recombinante: molécula de DNA sintetizada in vitro, sin intervención de una célula, mediante la unión de fragmentos de DNA de origen natural o sintético, y que es capaz de replicarse dentro de una célula de modo independiente a su genoma. Enzimas de restricción: endonucleasas que cortan el DNA de doble cadena en secuencias específicas (secuencias de reconocimiento), rompiendo los enlaces fosfodiéster, es decir, Eco R1 corta en la secuencia GAATTC y BamH1 corta en la secuencia GGATCC. Presentes en bacterias, son enzimas utilizadas para protección, principalmente de bacteriófagos, pues degradan DNA exógeno, a diferencia del propio, el cual está modificado por metilación en dichas secuencias. Episoma: fragmento de DNA extracromosómico que se incorpora a un cromosoma. El DNA incorporado puede provenir de un virus o de un plásmido. Aunque algunos autores lo emplean como sinónimo de plásmido, otros consideran que es también un virus, al considerar al bacteriófago λ (lambda) como un episoma. Extremos cohesivos: se denomina así al extremo de un fragmento de DNA en el que una cadena es más larga que la complementaria, y favorecen el ligamiento con fragmentos complementarios. Extremos romos: se llama así al extremo de un fragmento de DNA en el que ambas cadenas terminan en el mismo nucleótido complementario. Ingeniería genética: técnica de remover, modificar o añadir genes a una molécula de DNA. Es la aplicación de la tecnología de DNA recombinante a la solución de problemas prácticos. Por ejemplo, en

113

terapia génica, obtención de organismos transgénicos, obtención de proteínas recombinantes y otros. Inserto: DNA de interés, el cual será incorporado al plásmido utilizado como vector. Ligasa de DNA: enzima capaz de unir por sus extremos dos fragmentos de DNA, permitiendo la formación de una molécula de DNA en general circular. Trabaja especialmente bien si los extremos de ambos fragmentos son cohesivos y complementarios. Manipulación génica: formación de nuevas combinaciones de material hereditario mediante la inserción in vitro de fragmentos de DNA en un virus, plásmido o cualquier otro vector que permita su incorporación al genoma de una célula u organismo hospedador en el cual dicho fragmento no se encontraba antes de manera natural, pero a partir de entonces se propague normalmente. Mapa de restricción: localización, en una secuencia de DNA, de los sitios de corte de diversas endonucleasas. Plásmidos: moléculas circulares de DNA capaces de replicarse de manera independiente del genoma bacteriano dentro de una bacteria (únicamente se pueden replicar moléculas de DNA circular dentro de una bacteria o una levadura). Son portadores de genes de resistencia a antibióticos. Se convierten en vectores de clonación, pues son reestructurados para contener un origen de replicación, un gen marcador (por lo general el de resistencia a un antibiótico), así como sitios de restricción únicos para poder insertar otros fragmentos de DNA. Muchos codifican además para polimerasa de RNA específicas, lo que les permite ser utilizados como vectores de transcripción. Transducción: mecanismo de intercambio genético en el cual el material genético (DNA) es transferido de una célula a otra a través de un virus. Puede clasificarse como específica o genérica. Transformación: proceso de intercambio o incorporación genética que ocurre de manera natural, y que permite que porciones de DNA sean transferidas a

www.FreeLibros.me


114

Capítulo 8

Técnicas de DNA recombinante

una célula. Este proceso fue inicialmente observado en Streptococcus pneumoniae introducido en un ratón. Por otra parte, se denomina así al mecanismo de introducción del DNA recombinante manipulado in vitro en una célula hospedadora (sistema bacteriano o eucarionte) para su propagación, identificación y aislamiento. Esto puede realizarse por un procedimiento relativamente simple, en una solución de cloruro de calcio y mediante la aplicación de un choque térmico (a 42°C) durante

90 segundos. El DNA así transformado es capaz de replicarse y expresarse. Transformante: se denomina así a una célula (bacteria o eucarionte) que ha incorporado DNA recombinante manipulado en el laboratorio. Transgénico: se llama así al organismo que ha incorporado en su genoma DNA recombinante manipulado en el laboratorio.

BIBLIOGRAFÍA CLÁSICA RECOMENDADA Berg P, Singer MF. The recombinant DNA controversy: twenty years later. PNAS, 1995;92:9011-9013 and Biotechnology, 1995;13:1132-1134. Cline MJ, Stang H, Mercola K, Moise L, Ruprecht P, Browne J, Salser W. Gene transfer in intact animals. Nature, 1980;284:422-425. Goeddel DV, Yelverton E, Ullrich A, Heyneker HL, Miozzari G, Holmes W, Seeburg PH, Dull T, May L, Stebbing N, Crea R, Maeda S, McCandliss R, Sloma A, Tabor JJ, Gross M, Familletti PC, Pestka S. Human leukocyte interferon produced by E. coli is biologically active. Nature, 1980;287:411-416.

Itakura K, Hirose T, Crea R, Riggs AD, Heyneker HL, Bolivar F, Boyer HW. Expression in Escherichia coli of a chemically synthesized gene for the hormone somatostatin. Science, 1977;198:1056-1063. Mantei N, Boll W, Weissmann C. Rabbit betaglobin mRNA production in mouse L cells transformed with cloned rabbit beta-globin chromosomal DNA. Nature, 1979;281:40-46. Watson JD, Gilman M, Witkowski J, Zoller M. Recombinant DNA. 2a. ed. New York: Scientific American Books, W.H. Freeman and Company, 1992.

www.FreeLibros.me


Capítulo

9

Aplicaciones de la biología molecular en la biotecnología Dra. Rosalba Gutiérrez Rojo

bebidas alcohólicas por fermentación. Los antiguos egipcios fueron tan lejos en aquel tiempo que incluso utilizaron pan mohoso como cataplasma para curar las heridas infectadas e introdujeron un servicio para detectar la gestación basado en el efecto de la orina en la velocidad de germinación del trigo. El término biotecnología se ha introducido en fecha reciente en el lenguaje popular como resultado del gran potencial resultante de la aplicación de las técnicas de biología molecular. Por otra parte, el avance más significativo de esta última ha sido tal vez el desarrollo de la reacción en cadena de la polimerasa (PCR, por sus siglas en inglés). La aparición de la PCR ha revolucionado todas las áreas de investigación científica, hasta el punto de convertir en rutina automática multitud de procesos que antes requerían procedimientos artesanales e imprecisos. Con ella, en pocos años, la promesa de que la biotecnología podía llegar a constituir un éxito comercial se ha convertido en realidad. Asimismo, la relativamente recién aparecida manipulación genética in vitro ha ampliado el número de productos susceptibles de ser generados por los microorganismos y ha proporcionado nuevos métodos para incrementar el rendimiento en la obtención de los ya existentes. Asimismo, la tecnología del DNA recombinante ha supuesto un impacto significativo en la industria, debido a la posibilidad ilimitada de separar un gen o una secuen-

INTRODUCCIÓN Desde tiempos inmemoriales, la humanidad ha utilizado a los seres vivos para su beneficio. De diferentes maneras, a veces por accidente y otras con gran ingenio, se han ido descubriendo procedimientos para obtener mejoras en las variedades animales y vegetales. La revolución agrícola, la domesticación de animales y la producción de vino, cerveza y yogur no son sino diversas manifestaciones de la biotecnología.1 La biotecnología se ha definido como la aplicación de organismos, sistemas y procesos biológicos en las industrias manufactureras y de servicios. Sin embargo, la biotecnología moderna es la que se sirve de las técnicas del DNA para realizar mejoras en los seres vivos, con miras a su utilización. La biotecnología no existe como una disciplina científica, sino más bien como una amplia variedad de áreas temáticas. Sus frutos han nacido de un árbol cuyas raíces son las ciencias biológicas, en particular la microbiología, la genética, la biología molecular y la bioquímica. Parece que esta palabra se utilizó por primera vez al comienzo del decenio de 1920 por el Leeds City Council del Reino Unido, cuando sus miembros fundaron un Instituto de Biotecnología. No obstante, los procesos biotecnológicos son anteriores a esta fecha; datan de hace unos 5000 años, cuando se descubrió la producción de 115

www.FreeLibros.me


116

Capítulo 9

Aplicaciones de la biología molecular en la biotecnología

cia de DNA de cualquier fuente y transferirlo a otro organismo, de modo que éste sea capaz de replicarse y transmitirse a la descendencia. Esta secuencia puede ser un gen que codifique para un producto comercialmente útil, que se transfiere a especies en las cuales puede ser sintetizado de manera eficaz y económica, o una nueva característica para el microorganismo hospedador.2 Los elementos esenciales de la técnica del DNA recombinante son: 1) La obtención de fragmentos específicos de DNA (enzimas de restricción). Las endonucleasas de restricción constituyen una herramienta de valor incalculable para fragmentar el DNA en sitios específicos, ya que reconocen una secuencia específica, la cual difiere para distintas especies y cepas.3 2) Ligación o reasociación covalente. Para reasociar dos moléculas de DNA, es necesario reconstituir un enlace fosfodiéster; aquí entra en acción una enzima llamada ligasa de DNA. 3) Mecanismo para introducir en el organismo el DNA recombinante (transformación). 4) Mecanismo para asegurar la replicación e identificación de la molécula recombinante dentro de la célula. Si queremos que el DNA transferido sea capaz de replicarse, debe ser ligado a una molécula susceptible de multiplicación en la célula hospedadora. Se requiere una molécula pequeña que además posea la capacidad de replicación autónoma (es decir, independiente del cromosoma). A estas moléculas se les denomina vectores. En la naturaleza hay dos clases de vectores: los plásmidos (moléculas de DNA extracromosómico que se encuentran en forma de múltiples copias en muchas especies bacterianas4 y por lo general no son necesarios para la viabilidad de la célula, aunque pueden transportar algunos genes, como los que confieren resistencia a antibióticos), y los virus bacterianos o fagos, los cuales pueden replicarse dentro de una bacteria y originar muchas moléculas idénticas. Las moléculas ligadas se introducen a las células hospedadoras, y se seleccionan por medio de genes marcadores presentes en el vector de clonación. Dentro de su secuencia, los vectores de clonación contienen señales que inducen la replicación del DNA. Actualmente, con la introducción de la PCR por Kary Mullis en 1983, las enzimas de restricción y las técnicas de secuenciación e hibridación, las secuencias de un único gen pueden ser localizadas, entre una abundancia de otras secuencias, cortadas en sitios específicos y amplificadas de modo exponencial hasta rendir una cantidad analizable. La PCR ha incrementado las posibilidades que ofrece la tecnología del DNA, ya que permite la amplificación de secuencias de DNA específicas sin la necesidad que sea clonado en células. El presente capítulo pretende mostrar en qué forma la biología molecular ha proporcionado el mayor impulso en el desarrollo de la biotecnología y describir la manera como puede ser utilizado el potencial de estas técnicas en la obtención de productos o procesos útiles para el hombre en algunas de las áreas en las que ha tenido mayor

impacto, como la industria farmacéutica y agroalimentaria.

INDUSTRIA FARMACÉUTICA Y SALUD El surgimiento de la ingeniería genética y su impresionante desarrollo a la fecha ha permitido iniciar el análisis a fondo de la estructura y mecanismo de acción del programa genético de un ser vivo. Las aplicaciones de este nuevo conocimiento han consolidado el origen de una nueva medicina que busca conocer las bases moleculares de la salud y la enfermedad. La medicina actual utiliza con éxito la tecnología genética que permite la producción de proteínas recombinantes necesarias para el diagnóstico y tratamiento de enfermedades genéticas e infecciosas y para la elaboración de nuevas vacunas. El uso de estas metodologías también ha tenido efecto en el diagnóstico y tratamiento de trastornos hereditarios y pronto ofrecerá un nuevo tipo de terapia para introducir genes sanos a células con genes defectuosos dentro de nuestro cuerpo.5 La aplicación comercial de la tecnología del DNA recombinante se inició a finales del decenio de 1970 con la producción de proteínas con el objeto de utilizarlas como agentes terapéuticos. Hoy en día, mediante las técnicas de biología molecular, han aparecido infinidad de agentes terapéuticos nuevos basados en anticuerpos obtenidos mediante ingeniería genética, tecnología antisentido y otros productos y terapias génicas. No obstante, las proteínas terapéuticas son las que han alcanzado el mayor impacto en su uso. Además, se ha conseguido su síntesis a cantidades requeridas para su uso terapéutico. Ejemplos típicos son: la transferencia a Escherichia coli del gen de la insulina humana, utilizada en el tratamiento de la diabetes;6 los genes del interferón, para enfermedades víricas y en combinación con otros agentes en el tratamiento de diferentes tipos de cáncer;7 el mensajero de la hormona de crecimiento humano, en el tratamiento del enanismo hipofisario;8 la eritropoyetina, que estimula la producción de eritrocitos y se usa en el tratamiento de anemias agudas o relacionadas con tratamientos terapéuticos, y el factor estimulante de la colonia mieloide, para complementar la terapia anticancerosa y en los trasplantes de médula ósea. Tan pronto como los biólogos moleculares comenzaron a satisfacer las necesidades de proteínas auténticas y puras, comenzó la demanda de derivados no auténticos. Con las herramientas de clonación, secuenciación y expresión de proteínas, se empezaron a preparar derivados proteínicos con secuencias aminoacídicas alteradas denominadas muteínas. Éstas son proteínas con actividad biológica nueva o mejorada, que sirven para estudiar el modo de acción y el papel fisiológico de algunas sustancias.9 Entre los ejemplos de muteínas que se han evaluado en estudios clínicos o en modelos de enfermedad

www.FreeLibros.me


Industria farmacéutica y salud

están el factor de necrosis tumoral, carcinoma de células renales10 y el factor de crecimiento de fibroblastos básico (úlceras gástricas inducidas por el ácido acético).11 Por otra parte, la levadura Saccharomyces cerevisiae ha incrementado su uso en los últimos años para la obtención de proteínas heterólogas. S. cerevisiae fue desarrollado como el primer sistema de expresión eucariótico, ya que al ser un microorganismo unicelular podía ser manipulado genéticamente mediante la mayoría de las técnicas comúnmente utilizadas para E. coli, y como organismo eucarionte es un hospedador apropiado para la producción de proteínas eucariontes auténticas. S. cerevisiae es además adecuado por su seguridad para la producción de productos farmacéuticos recombinantes porque, a diferencia de E. coli, no produce pirógenos o endotoxinas.12 Un amplio grupo de proteínas heterólogas se ha expresado en S. cerevisiae. Algunas se han producido comercialmente, como la vacuna contra la hepatitis B, el factor de necrosis tumoral y la insulina. Los sistemas de expresión de S. cerevisiae son potentes y versátiles, ya que no presentan limitaciones. Frecuentemente es necesario experimentar con métodos diferentes antes de llevar a cabo una expresión óptima, y aun entonces, puede no ser posible la producción de proteínas glucosiladas auténticas. Hospedadores de levaduras alternativos, como Pichia pastoris, están siendo desarrollados para la expresión de genes heterólogos con niveles de expresión superiores y mayor eficiencia en las modificaciones postraduccionales (fosforilizaciones y glucosilaciones) que los obtenidos por S. cerevisiae.13 El cultivo de células de mamíferos es más costoso que el de bacterias y levaduras. Por razones de economía, su utilización está limitada a la obtención de moléculas y productos naturales de células animales. Los dos ejemplos más característicos son los anticuerpos monoclonales y los interferones. El valor de estos productos justifica el alto costo de su producción.13 Las técnicas del DNA recombinante también han sido muy útiles para identificar y convalidar nuevos fármacos, sobre todo en el área de las enfermedades infecciosas. Determinados genes víricos potencialmente importantes se han aislado del genoma vírico, mutado hasta destruir su actividad y, a continuación, reinsertados para saber si el producto génico es esencial para la patogenicidad. Esta técnica se aplicó para demostrar cuáles son los genes blanco válidos en la terapia contra el sida.14 Aunque los tratamientos terapéuticos basados en los ácidos nucleicos todavía no se han comercializado, la capacidad de estos sistemas es bastante buena. Las tecnologías antisentido o terapia oligonucleotídica y la terapia génica constituyen las dos principales categorías de tratamientos futuros basados en los ácidos nucleicos. La terapia oligonucleotídica consiste en la inhibición de la expresión de genes mediante la hibridación de oligonucleótidos antisentido con una determinada región

117

del RNAm “con sentido” o por medio de oligonucleótidos que actúan sobre el propio gen que forman un tríplex de DNA cuando éste se une al surco principal de la doble cadena de DNA. Esta tecnología se ha usado en la inhibición de la expresión de oncogenes, así como para inhibir el crecimiento de virus en cultivo. En teoría, cualquier enfermedad caracterizada por una sobrexpresión génica inadecuada es susceptible de terapia oligonucleotídica.15 La terapia génica consiste en la transferencia de un gen exógeno y la expresión estable del DNA transferido. Ésta se ha utilizado en el tratamiento de deficiencias génicas, enfermedades infecciosas y actualmente se contempla su uso como terapia contra el cáncer.14 En su forma más simple, la terapia génica se puede aplicar a células que pueden ser retiradas del cuerpo, y reintroducidas de nuevo (ex vivo), tal es el caso de las células sanguíneas. No obstante, aun en los casos más difíciles, como las enfermedades en tejidos no regenerables, como en el músculo, ya hay investigaciones para aplicar la terapia génica. En la actualidad, se ha aprobado la aplicación de procedimientos de terapia génica en enfermedades, como la fibrosis quística y algunos tipos de cáncer.

Medicina forense La determinación de las huellas dactilares genéticas constituye otra aplicación de las técnicas moleculares, de modo específico la PCR y las enzimas de restricción. Estas técnicas se aplican en la actualidad en medicina forense e investigaciones policiales con el fin de identificar individuos a partir de muestras biológicas, como sangre, semen, saliva, piel, cabellos, encontrados en casos de muerte, violación, y otro tipo de agresiones. El perfilado de DNA permite la identificación de tales evidencias con un grado de certeza que antes se consideraba imposible, ya que es posible comparar muestras diferentes de DNA para comprobar si pertenecen a un individuo o no, o si hay parentesco entre ellos. De manera similar, la técnica puede suministrar pruebas evidenciales en caso de paternidad reclamada o no reconocida.16

Vacunas La vacunación contra las enfermedades bacterianas y víricas ha sido uno de los grandes éxitos de la historia de la medicina humana y veterinaria. El ejemplo más significativo de la eficacia de la vacunación tal vez es la erradicación de la viruela. A pesar del tremendo progreso conseguido, las enfermedades contagiosas son todavía el gran problema de la humanidad. Más de 10 millones de muertes al año en todo el mundo se deben a enfermedades infecciosas.17 Las vacunas son la vía más simple y económica para reducir los costos que provocan las enfermedades infec-

www.FreeLibros.me


118

Capítulo 9

Aplicaciones de la biología molecular en la biotecnología

ciosas. La manipulación genética proporciona nuevas técnicas para abordar el problema de diferentes maneras. Hay dos estrategias clásicas para la vacunación. Una de ellas consiste en la vacunación con microorganismos patógenos muertos o con subunidades de éstos. La otra utiliza virus o bacterias vivas atenuados que no causan la enfermedad, pero proceden de un microorganismo patógeno. La utilización de microorganismos manipulados genéticamente representa una alternativa atractiva para la producción de vacunas. El objetivo que se persigue al producir una vacuna es que contenga moléculas que produzcan la misma respuesta antigénica, sin causar la proliferación nociva del patógeno en el organismo. Esto se logra mediante virus que de alguna manera se transforman en apatógenos. Ayudados de las técnicas de biología molecular, existe la posibilidad de clonar y expresar en bacterias los genes de las proteínas de la envoltura vírica, utilizando el producto bacteriano como vacuna.18 Las vacunas habituales destinadas a enfermedades infecciosas en seres humanos más comunes son difteria, tétanos, tos ferina, poliomielitis, sarampión, paperas, rubéola etc.; hay también otras vacunas para circunstancias especiales, por ejemplo la vacuna del cólera, fiebre amarilla, encefalitis japonesa, hepatitis B, etcétera. Existen vacunas también satisfactorias desde el punto de vista de la medicina veterinaria: peste bovina, fiebre aftosa, enfermedades producidas por Clostridium spp., enfermedades de Newcastle y Marek, contra enfermedades en animales. Para algunos patógenos cuyo cultivo in vitro es difícil, como es el caso del virus de la hepatitis B, el agente de la sífilis humana (Treponema pallidum) y la bacteria que causa la lepra (Mycobacterium leprae), la tecnología del DNA recombinante permite la transferencia de la información genética desde el microorganismo patógeno a otros hospedadores más manejables como E. coli, levaduras o células de mamíferos que hacen posible la obtención de vacunas vivas atenuadas o inactivadas.1

INDUSTRIA ALIMENTARIA En la industria de los alimentos, el pan y los quesos son sólo dos de los alimentos incluidos con ciertas manipulaciones genéticas, que están disponibles para el consumidor. Las levaduras se han utilizado desde la antigüedad en las fermentaciones alimentarias en la masa del pan y en la producción de bebidas fermentadas. El conocimiento de la genética y la bioquímica de las levaduras ha conducido al desarrollo de nuevas cepas mediante técnicas moleculares.19 En levaduras, la producción de nuevas cepas con crecimiento rápido y alto rendimiento tiene un valor potencial; en la elaboración del pan, se han conseguido nuevas

cepas de crecimiento rápido y con buena producción de dióxido de carbono.20 En la industria de bebidas se han provisto ciertos cambios, mediante el clonado de levaduras en muchas enzimas, para la producción de cervezas más ligeras gracias a la actividad más eficiente de la amilasa, el control de los sabores no deseados debidos a la producción de diacetilos y fenoles, mejoramiento en la filtrabilidad gracias a una reducción de glucanos β residuales, así como mejoras en la calidad de almacenamiento mediante el control de la humedad.21 De la misma manera, se puede prever una serie de mejoras para los productos lácteos, como la capacidad para producir ácidos estables y facilitar la hechura del queso, en la producción de intensificadores del sabor y textura del queso y en la aceleración de la maduración. En la actualidad, están bajo pruebas comerciales algunas cepas nuevas producidas a través de técnicas no recombinantes, como Lactobacillus casei spp. ramosum GG, con capacidad de unirse a las células por la mucosa intestinal humana, estabilidad a ácidos y sales biliares, producción in vitro de una sustancia antimicrobiana. Su utilidad reside en la producción de una bebida de suero fermentado y un producto tipo yogur, ideados con el fin de promover la salud humana, ayudando al control de la diarrea y el estreñimiento.22 Con respecto a los alimentos que hacen uso de microorganismos lácticos producidos por técnicas de DNA recombinante, se pueden mencionar los quesos que utilizan la enzima quimosina (encargada de la coagulación de la leche), el principal componente del cuajo de ternera, producida por tres microorganismos transgénicos diferentes Kluveromyces lactis, Aspergillus niger variante awamori y E. coli K-12. Esta enzima ha demostrado ser idéntica a la producida por terneras.23 La quimosina producida a partir de microorganismos transgénicos con respecto al cuajo puede ser recogida más rápido, contener una concentración mayor de enzima activa y producir quesos con propiedades de textura y aroma controlables; además, el incentivo para su producción reside en la economía. Hay muchos procesos en la industria alimentaria, los cuales pueden ser susceptibles a la utilización de enzimas, lo cual representa un campo potencial en la modificación genética de especies de microorganismos, con el fin de mejorar su estabilidad, especificidad y producción. En la actualidad, se ha clonado un buen número de enzimas usadas en la alimentación. Es importante mencionar que, cuando las fuentes derivan de microorganismos modificados genéticamente, su aprobación tendrá que ser conseguida antes que sea posible su uso con fines comerciales. Existe un extenso grupo de productos que incluyen aditivos alimentarios, como edulcorantes bajos en calorías, modificadores del sabor, vitaminas, colorantes,

www.FreeLibros.me


Industria alimentaria

deshidratantes y complementos nutricionales que están esperando su aprobación para entrar al mercado. Un ejemplo es una cepa modificada de Acetobacter capaz de producir una nueva forma de celulosa bacteriana con una gran capacidad de hidratación, por lo que puede ser un eficaz adelgazante.24 En el análisis de calidad alimentaria, las técnicas del DNA recombinante ofrecen la posibilidad de identificación, caracterización y cuantificación de microorganismos patógenos, alterantes y de adulterantes de los alimentos. Un número cada vez mayor de sondas de DNA se ha usado en la detección de patógenos, como Salmonella, Listeria monocytogenes, Yersinia enterocolitica, Vibrio cholerae y ciertos virus.25 Otra técnica que ofrece un método más rápido y sensible en la detección de microorganismos en los alimentos es la producción mediante ingeniería genética de cepas sensoras capaces de producir bioluminiscencia. Los nuevos métodos de detección e identificación de patógenos microbianos, basados en el DNA, ofrecen ventajas tanto para los productores como para los consumidores. La seguridad microbiológica de los alimentos continúa suscitando gran preocupación en todos los puntos de la cadena alimenticia. En el último decenio, los análisis tradicionales se han sustituido por métodos mucho más rápidos que se sirven del DNA. Un técnico puede realizar el diagnóstico en cuestión de horas, en tanto que las técnicas antiguas podían llevarle varios días a un microbiólogo altamente preparado. Estos nuevos métodos al utilizar información genética para la detección proporcionan resultados más precisos que los tradicionales. Gracias a estos métodos, se puede identificar, caracterizar y cuantificar rápido un patógeno presente en un alimento. Esta información es en particular útil, ya que permite decidir el destino industrial de las materias primas utilizadas en la elaboración de los mismos, así como retirar de la venta los alimentos afectados.

Plantas Las plantas, aparte de la provisión de alimentos, son también una fuente importante de materia prima. Las plantas constituyen también una fuente relevante de medicamentos valiosos. El estudio de las plantas, desde el punto de vista molecular, ha estado rezagado respecto a otros microorganismos. La tecnología del DNA recombinante no tuvo en el área de las plantas un impacto tan inmediato como en el área de la salud. Esta situación ha cambiado en los últimos años. Muchos grupos de investigación han detectado la importancia de aplicar estas técnicas a la biología vegetal y el gran potencial que tiene la manipulación de las plantas. La posibilidad de realizar ingeniería genética en plantas depende, al igual que en los microorganismos,

119

de que se logre introducir en ellas material genético exógeno y que éste se establezca y herede de una célula a otra. En el caso de las plantas, esto se facilita con la ayuda del microorganismo Agrobacterium tumefasciens. Esta bacteria ha podido hacer plantas transgénicas desde hace millones de años invadiendo la planta e introduciendo un segmento de DNA, llamado plásmido Ti, desarrollando un tumor. Otro fenómeno que ha facilitado la ingeniería en plantas es la capacidad de regeneración de las plantas, ya que muchas plantas son capaces de generar un organismo más completo a partir de una célula (totipotencial). Hoy en día se puede introducir DNA en plantas sin necesidad de esta bacteria.1 En los últimos años, se han establecido mecanismos para transformar y regenerar plantas mediante biobalística. Con esta técnica, el DNA se hace penetrar a las células, atravesando la pared celular, mediante múltiples disparos con balas microscópicas que llevan los genes y los insertan en el tejido vegetal.1 Las primeras pruebas de ensayo en plantas transgénicas tuvieron lugar en 1986, y desde entonces ha habido un aumento impresionante en su utilización. El rápido desarrollo de las técnicas de la biología molecular proporciona mayores avances en la modificación de los tratamientos útiles, desde el punto de vista agrícola en cultivos vegetales. En la actualidad, es técnicamente posible identificar, aislar, modificar, transferir y obtener la expresión de una amplia serie de genes específicos; de éstos se cuenta con múltiples ejemplos en los que a un cultivo vegetal se le ha hecho una modificación estable económicamente con un fenotipo útil. La ingeniería genética de semillas utilizada en la alimentación es un campo que se está desarrollando muy rápido. En teoría, es posible obtener plantas específicamente diseñadas para poseer la mayoría de las combinaciones de cualidades deseables, como la resistencia a enfermedades, tolerancia al estrés, capacidad de fijar nitrógeno, producción de plantas más grandes, mejora en las propiedades de almacenamiento y atributos sensoriales, aceleración o retardo de la maduración y obtención de nuevas fuentes de proteínas. Para cada cultivo, existen diferentes objetivos de mejora, y dentro de una misma especie puede aparecer una serie de necesidades más específicas.26 Las técnicas de biología molecular pueden utilizarse de varias maneras para facilitar la mejora de los cultivos, sea para aumentar los procesos de desarrollo ordinarios como para incrementar la calidad de las variedades ya existentes. Las propiedades bioquímicas de los cultivos pueden también ser modificadas para mejorar la calidad en relación con las necesidades tecnológicas e industriales; por ejemplo, la mejora en la calidad del trigo para la fabricación del pan y la calidad de la cebada en la fabricación de cerveza.

www.FreeLibros.me


120

Capítulo 9

Aplicaciones de la biología molecular en la biotecnología

Otro objetivo que persigue la ingeniería en plantas está relacionado con la resistencia a insectos, virus, hongos, bacterias y nematodos. Se han producido también avances muy rápidos en la utilización de las técnicas moleculares para identificar patógenos de plantas y semillas y en la producción de plantas resistentes a herbicidas.27 Las técnicas moleculares se utilizan en los procesos agrícolas para disminuir las pérdidas ocasionadas por una maduración acelerada debida a la producción de etileno.

Las dos enzimas participantes en la vía de producción de etileno ya se han clonado. La producción de etileno no se realiza en las plantas transgénicas que expresan construcciones sin sentido para estas enzimas. Los cultivos transgénicos de mango y tomate, por ejemplo, pueden ahora continuar sin pudrirse más tiempo que las otras plantas y ser transportados con menor riesgo. Un proceso similar puede usarse para prolongar el transporte y la vida media de algunas flores.26

GLOSARIO Adulterante: es aquella sustancia o cosa que se agrega para falsificar algo, material o inmaterial, mezclándola o añadiéndola en sustitución a ello; por ejemplo, un alimento adulterado es aquel al cual se le agregan sustancias que no corresponden a su propia naturaleza, en cuanto a su composición y definición (leche adulterada con grasa vegetal). Alterante: es aquel que modifica las características y condiciones determinadas. Apatógeno: que no causa enfermedad. Bioluminiscencia: producción de luz fría por algunos organismos (bacterias, hongos, luciérnagas, peces abisales, etc.). Tiene diferentes funciones: atracción sexual, reconocimiento, atracción de presas, defensa. Cataplasma: masa húmeda y caliente que se aplica sobre la piel para conseguir los efectos terapéuticos del calor húmedo.

Edulcorante: que endulza. Sustancia de sabor dulzón que se usa como sucedánea del azúcar. Endógeno: que se origina o nace en el interior. Exógeno: que se origina o nace en el exterior del cuerpo; que se debe a una causa externa. In vitro: se aplica a los procesos biológicos cuando se producen experimentalmente, aislados del conjunto del organismo. Oncogén: en biología y medicina, gen derivado de otro que forma parte del genoma normal de una célula, y que es capaz de convertir dicha célula en cancerosa. Pirógeno: que produce fiebre. Quístico: perteneciente o relativo a quistes.

BIBLIOGRAFÍA 1. Soberón MF. Ingeniería genética y la nueva biotecnología. La ciencia para todos. 1a. ed. México: Fondo de Cultura Económica, 1996:145. 2. Gingold EB. Introducción a la tecnología del DNA recombinante. En: Biología molecular y biotecnología. 2a. ed. Zaragoza, España: Acribia, 1997:23-51. 3. Kelly TJ, Smith HO. A restriction enzyme Haemophilus influenza (II). Base composition of the recognition sequence. Journal of Molecular Biology, 1970;51:393-409. 4. Broda P. Plasmids. San Francisco: Freeman and Company, 1979:5-23. 5. Dykes GW. Biología molecular en la industria farmacéutica. En: Biología molecular y biotecnología. 2a. ed. Zaragoza, España: Acribia, 1997;173-196. 6. Villa KL, Efstratiadas AL, Broome S, Lomedico P, Tizard R, Naber SP, Chick WL, Gilbert W. A bacterial clone synthesizing proinsulin procedures of the Natural Academy of Science USA, 1978;75(8):3727-3731.

7. Nagata S, Taira H, Hall A, Hohnsiud L, Sreuli M, Ecsodi J, Boll W, Cantell K, Werssman C. Synthesis in E. coli of a polypeptide with human leukocyte interferon activity. Nature (London), 1980;27;284(5754):316-320. 8. Goeddel DV, Kleid DG, Bolivar F, Heyneker HL, Yansura DG, Crea R, Hirose T, Kraszewski A, Itakura K, Riggs AD. Expression in Escherichia coli of chemically synthesized genes for human insulin. Procedures of the Natural. Academy of Science USA, 1979;76(1):106-110. 9. Medynski D. Genetic approaches to protein structure and function: point mutations as modifiers of protein function. Biotechnology (NY), 1992;10(9):1002-1006. 10. Otto U, Conrad S, Sneider AW, Klosterhalfen H. Recombinant interferon gamma in the treatment of metastatic renal cell carcinoma. Results of a phase II trial. Arzneimittelforschung, 1988;38(11):1658. 11. Satoh H, Shino A, Inatomi N, Nagaya H, Satoh F, Szabo S, Folkman J. Effects of rhbFGF mutein CS23 (TGP-580) on

www.FreeLibros.me


Bibliografía the healing of gastric ulcers induced by acetic acid in rats. Gastroenterology, 1991;100:A155. 12. Curran BPG, Bugeja VC. Levadura: clonación y biotecnología. En: Biología molecular y biotecnología. 2a. ed. Zaragoza, España: Acribia, 1997:93-110. 13. Romanos MA, Scorer CA, Claret JJ. Foreign gene expression in yeast: a review. Yeast, 1992;8:423-488. 14. Gorman JA, Chan W, Gorman JW. Repeated use of GAL1 for gene disruption in Candida albicans. Genetics, 1991;129(1):19-24. 15. Crooke ST. Therapeutic applications of oligonucleotides. Biotechnology (NY), 1992;10(8):882-886. 16. Higuchi R, Beroldigen CH, Sensabaugh GF, Erlichm GA. DNA typing from single hairs. Nature (London), 1988;332:543546. 17. Halstead SB. Children’s vaccine initiative. AIDS Research Human Retroviruses, 1992;8(8):1533. 18. Mackett M. Vacunación y manipulación genética. En: Biología molecular y biotecnología. 2a. ed. Zaragoza, España: Acribia, 1997:237-261. 19. Chapman JW. The development and use of novel yeast strains for food and drink manufacture. Trends in Food Science and Technology, 1991;2:176-179.

121

20. Gist BNV. European patent (EP 0328229). A2 0, 1989;306307. 21. Donnelly WJ. Applications of biotechnology and separation technology in dairy processing. Journal of the Society of Dairy Technology, 1991;44(3):67-72. 22. Salminem S, Gorbach S, Salminem K. Fermented whey drink and yogurt-type product manufactures using Lactobacillus strain. Food Technology, 1991:45,112. 23. Van den berg G, De Koning PL. Gouda cheesemaking with purified calf chymosin and microbially produced chymosin. Netherlands Milk Dairy Journal, 1990;44:189-205. 24. Kent RA, Stephens RS, Westlan JA. Bacterial cellulose fiber provides an alternative for thickening and coating. Food Technology, 1991;45(6):108. 25. Wolcott MJ. DNA-based rapid methods for detection of foodborne pathogens. Journal of Food Protection, 1991;54(5):387-401. 26. Jones MGK, Lindsey K. Biotecnología en plantas. En: Biología molecular y biotecnología. 2a. ed. Zaragoza, España: Acribia, 1997;137-172. 27. Botterman J, Leemans J. Engineering herbicide resistance in plants. Trends Genetics, 1988;4:219-222.

www.FreeLibros.me


Capítulo

10

Aplicaciones de la biología molecular en la terapia génica Dr. Juan Armendáriz Borunda Dra. Ana Rosa Rincón Sánchez

ANTECEDENTES BÁSICOS

• La regulación de un gen puede ser alterada, sea mediante encendido o apagado.

Para entender con claridad los objetivos de la terapia génica, consideramos pertinente hacer antes la descripción de algunos conocimientos básicos importantes en forma de preguntas y respuestas.

¿Qué estudia la terapia génica? La terapia génica estudia la inserción de un gen “normal” para reemplazar un gen “anormal” (el gen causante de la enfermedad). A la molécula portadora se le conoce como un vector y se usa para enviar el gen terapéutico a las células blanco del paciente.

¿Qué es la terapia génica? La terapia génica es un área de la medicina genómica que utiliza el arsenal de que dispone la biología molecular, para introducir de manera dirigida copias sanas de genes defectuosos en células específicas del organismo y modificar el curso de la enfermedad.

¿Qué se usa como vector en la terapia génica?

¿Cómo trabaja la terapia génica?

El vector utilizado con más frecuencia es un virus que ha sido genéticamente modificado para llevar DNA normal humano y que no puede replicarse de manera autónoma. Los virus han desarrollado de manera natural la forma de encapsular y entregar sus genes a células humanas, pero en una forma patogénica. Los científicos han utilizado esta capacidad, y después de manipular el genoma del virus han insertado genes terapéuticos con el fin de corregir la enfermedad y tomando control de la replicación del vector viral.

Los investigadores han realizado varias estrategias para corregir los genes defectuosos: • Insertar el DNA complementario de un gen normal dentro del genoma para reemplazar al gen no funcional. • Intercambiar un gen anormal por uno normal por recombinación homóloga. • Reparar por mutación selectiva inversa el gen anormal, para que regrese el gen a su función normal. 122

www.FreeLibros.me


El hígado como órgano blanco

¿Cuál es el estado actual en las investigaciones de terapia génica? La administración de fármacos y alimentos en Estados Unidos (Food and Drug Administration [FDA]) es el organismo encargado de aprobar cualquier producto que salga a la venta y se utilice como terapia del gen humano. Mucha de la terapia génica en este momento se encuentra en fase experimental y no mucha ha demostrado éxito en estudios clínicos. El primer estudio clínico de terapia génica se realizó en 1990.

¿Por qué es importante conocer de terapia génica? La importancia de la terapia génica en México radica fundamentalmente en dar a conocer estos avances a los estudiantes de medicina y carreras del área de la salud con el fin de que conozcan esta nueva metodología. En el área de investigación, es primordial informar a la comunidad científica los adelantos logrados en esta área por investigadores mexicanos en diversas áreas de la medicina. Por último, resulta de gran trascendencia situar a la comunidad científica, que nuestro país participa en esta área tanto en proyectos preclínicos como en métodos clínicos y en ambos con resultados alentadores.

INTRODUCCIÓN La terapia génica puede definirse como la introducción de cualquier ácido nucleico al interior de células eucariontes (pero no a células germinativas) con el propósito de alterar el curso de una alteración médica o bien corregir un trastorno metabólico o genético. Originalmente, la terapia génica se concibió de manera específica para tratar trastornos monógenos (el defecto en un solo gen), pero es claro ahora que un solo gen puede ser considerado como un nuevo “agente farmacológico” para tratar muchos tipos de alteraciones. En los últimos 10 años, la idea inicial de terapia génica se ha hecho real con 636 procedimientos clínicos en el mundo en los cuales 3 496 pacientes están incluidos y la mayoría se está llevando a cabo en Estados Unidos.1 Aunque las expectativas han excedido el éxito inicial de este campo relativamente nuevo, se ha obtenido información muy importante de métodos clínicos y preclínicos. Aunque la terapia génica puede considerarse como una ciencia joven, es muy relevante destacar que gracias a los adelantos tecnológicos recientes ha logrado grandes avances, por lo que podrá usarse para tratar una amplia variedad de enfermedades.2 Este hecho se ha reflejado en los resultados prometedores que se mostraron en pacientes afectados por el síndrome de inmunodeficiencia combinada grave ligada al X (SCID) y la hemofilia B.3-5 Sin

123

embargo, es pertinente mencionar que hay varias barreras que limitan el éxito de la terapia génica. El obstáculo más difícil de resolver ha sido la incapacidad de transferir eficazmente el “gen terapéutico” a una célula blanco dada o tejido, de suerte que una cantidad apropiada del producto del gen se obtenga (por lo general una proteína), y corrija la enfermedad. Esto se debe en parte a que las células, órganos, o ambas cosas, han desarrollado mecanismos poderosos para evitar la acumulación interna de material genético extraño.2 Casi todos los esfuerzos en los sistemas desarrollados de terapia génica en seres humanos se han enfocado sólo a células somáticas, dado que hay un alto grado de preocupación respecto a la posibilidad de introducir material genético exógeno dentro de células germinativas. No obstante eso, recientes trabajos han explorado la posibilidad de transferir genes al útero de animales con el objetivo de corregir anormalidades en el embrión.6,7 Estos datos requieren consideraciones más amplias, pero sin lugar a dudas abren una gama extensa de posibilidades terapéuticas. Básicamente, los métodos para la transferencia clínica de genes en células humanas se basan en tres estrategias generales: ex vivo, in vivo e in situ. Por ejemplo, los métodos ex vivo se basan en obtener principalmente leucocitos del paciente, sembrarlos y estimular su crecimiento en cultivo; entonces se introduce el material genético y se mantienen las células en cultivo. Estas células que ahora expresan el gen apropiado se inyectan de nuevo en el hospedador afectado (fig. 10-1). En contraste con las técnicas in vivo, se evita este proceso previo de varias fases, introduciendo de manera directa el gen terapéutico en el torrente sanguíneo del hospedador, llegando así al órgano específico.2 La entrega in situ de genes se realiza mediante el envío de un gen dado, el cual se inyecta de manera directa en un vector apropiado, por ejemplo, en el caso de tumores sólidos (cáncer de próstata).

EL HÍGADO COMO ÓRGANO BLANCO El hígado posee una serie de características que lo hacen atractivo para la terapia génica. Es un órgano en donde las vías metabólicas esenciales tienen lugar y, por ende, el hígado está afectado en muchas enfermedades metabólicas congénitas. Debido a su particular posición con respecto a la circulación del torrente sanguíneo, el hígado puede funcionar como una glándula secretora para la liberación de proteínas terapéuticas. Dada la estructura peculiar del endotelio hepático, el parénquima hepático es accesible a moléculas tan grandes como fragmentos de DNA o virus recombinantes circulantes en el torrente sanguíneo. En el último decenio, se ha dado testimonio de la ejecución de varios procedimientos para transferir genes

www.FreeLibros.me


124

Capítulo 10

Aplicaciones de la biología molecular en la terapia génica EX VIVO

Células humanas

Vectores

2

Vector Gen terapéutico

3

1

Células alteradas

IN VIVO

4

Figura 10-1

Transferencia de genes en células humanas. Métodos in vivo y ex vivo.

en hígados normales o enfermos.8,9 Diferentes investigadores han usado métodos simples, como la inyección directa de DNA plasmídico, desnudo o unido con diferentes ligandos, inyectando en el torrente sanguíneo vectores virales recombinantes complejos, los cuales son liberados con precisión en los lóbulos hepáticos. Así, se ha tratado repetidamente de alcanzar un nivel de expresión del transgén de una manera eficaz y estable en gran cantidad de hepatocitos.10,11

Terapias actuales No se ha establecido terapia definitiva alguna para la cirrosis hepática. Sin embargo, recientes discernimientos en la patogenia molecular de la fibrosis hepática y el papel de las células estelares hepáticas activadas ofrecen esperanzas para un futuro desarrollo de una terapia exitosa.

Avances en la tecnología génica del vector

Estrategias terapéuticas para la fibrosis hepática En teoría, los tratamientos antifibróticos eficaces deben satisfacer varios criterios importantes. Primero, cualquier terapia debe tener una base biológica legítima, pero también un tratamiento potencial ventajosamente farmacológico, en el entendido de que los niveles de compuestos activos han de llegar al hígado en concentraciones altas y producir pocos efectos extrahepáticos. Por último, un agente terapéutico debe permanecer en el micromedio del tejido blanco por largos periodos.

El principal impedimento en el desarrollo de la terapia génica es la disponibilidad de sistemas de vectores eficaces para enviar de manera dirigida un determinado gen. Un vector ideal sería aquel que crece de modo eficiente en títulos altos en la célula blanco, y persiste in vivo sin efectos secundarios tóxicos o inmunológicos. El desarrollo de este vector ideal aún no se ha logrado y no es probable que haya un solo vector satisfactorio para todo tipo de aplicaciones en un futuro cercano. No obstante, hay informes de una variedad de desarrollos interesantes por

www.FreeLibros.me


El hígado como órgano blanco

diferentes grupos que trabajan en terapia génica alrededor del mundo. Ciertamente, se está avanzando rápido en esta área biotecnológica. Hasta ahora, los retrovirus continúan siendo ampliamente estudiados, debido a la ausencia de inmunogenicidad y una capacidad única de integrarse en los cromosomas de la célula hospedadora. Casi todos los usos para los retrovirus son para enfermedades hematopoyéticas, donde diferentes subfamilias de retrovirus (oncovirus, lentivirus y retrovirus espumante) (foamy) despliegan una variedad de habilidades capaces de integrarse en las células progenitoras. El mejor ejemplo exitoso de terapia génica humana (hasta la fecha) continúa siendo el tratamiento de varios niños afectados con el síndrome de inmunodeficiencia combinada grave (SCID-XI).12 Por otro lado, los vectores lentivirales se vuelven cada vez más seguros y fáciles de usar. Líneas celulares inducibles, con multicomponentes empacables, permiten ahora la producción de preparados con títulos altos de recombinantes con fenómenos de replicación competente no detectables.13 Los sistemas lentivirales ahora han aumentado su capacidad de clonación y despliegan buena eficacia para la integración en células que no se están dividiendo, sobre todo en células progenitoras hematopoyéticas tanto en adultos como in utero. Los virus espumantes están recibiendo mayor atención, debido a que despliegan una capacidad mayor de clonación de cualquier subfamilia retroviral, en tanto que se integran de manera eficiente en las células hematopoyéticas progenitoras.14 Los virus adenoasociados (AAV) son vectores que se están convirtiendo rápido en uno de los sistemas más usados. Estos vectores pueden crecer en títulos relativamente altos y muy pocos despliegan efectos secundarios inmunológicos. Los AAV han aumentado la esperanza de una cura eventual para la hemofilia, debido a su expresión eficaz en hígado, según datos recientes de los grupos de Kay y High.4,15 En un estudio inicial, se enviaron AAV a músculo, produciendo niveles bajos de factor IX circulante. Se están llevando a cabo nuevos estudios mediante el envío de genes clonados en AAV hacia el hígado. A pesar de las promesas de que los AAV evitan completamente la respuesta citotóxica de las células T, está claro que algunas combinaciones de transgenes y promotores pueden llevar a problemas serios. Sin duda, ésta es una barrera que hay que vencer en el futuro. Los adenovirus han tenido diferentes grados de popularidad. Los recientes fracasos del año 2001 en estudios clínicos hacen preocupante su uso en lo que respecta a la seguridad, aunque la opinión global sobre el uso de estos vectores es que son muy útiles y se están volviendo más benévolos. Los vectores adenovirales los utilizan ahora muchos grupos alrededor del mundo participantes en la ingeniería de vectores.1 Un hecho establecido es que los vectores adenovirales tienen una gran cantidad de seroti-

125

pos diferentes y esto ha sido la clave que ha permitido un gran progreso en la aplicación particular de serotipos y proteínas de superficie blanco alteradas (funcionamiento como ligandos) para evitar tipos de células específicas. Totalmente borrado o vacío de su contenido, el adenovirus puede crecer en títulos extremadamente altos y superar la mayoría de los problemas inmunitarios, aunque se ha mostrado en fecha reciente que combinaciones particulares de elementos del promotor del transgén y ciertas alteraciones patológicas son capaces de sacar anormalidades inmunitarias residuales.16,17 Los plásmidos desnudos, el más simple de los vectores, se envían cada vez de más maneras diferentes y en algunos casos pueden igualar los niveles de transducción de los virus como lo ha demostrado el grupo de Leaf Huang.18 Una ventaja de los sistemas de envío de virus es que cada vez más se incrementa la capacidad de traducir en la célula blanco particular comparada con los sistemas no virales. Sin embargo, crece la preocupación relacionada con la seguridad de algunos virus, combinados con una alta capacidad de envío de los vectores blanco no virales (sobre todo a través de combinación con moléculas del ligando); por último, esta ventaja puede ser cada vez más obsoleta. Es difícil predecir el futuro que estas ventajas pueden traer, pero es seguro que si la tecnología del vector se desarrolló en un tiempo muy corto, nos pone ahora más cerca de la realidad de terapia génica humana. Además, la opción de vectores adecuados que llevan genes terapéuticos depende de las necesidades individuales de cada terapeuta génico. Como ya dijo, el diseño y la ingeniería de un vector universal completamente seguro todavía no se ha puesto en práctica.

Terapia génica en fibrosis hepática Hay un número de publicaciones recientes que han usado terapia génica para mejorar cirrosis en diferentes modelos inducidos por varios agentes causales. Así, la introducción del gen de la telomerasa se ha avocado en inhibir y aun proteger en contra de la fibrosis hepática inducida por CCl4 en ratones.19 Un grupo diferente ha informado que la transferencia al hígado de la sintasa del óxido nítrico neuronal en ratas cirróticas mejora la hipertensión portal.20 En otro estudio interesante, Uesugi et al. propusieron que la inhibición del NF-κB mediante el envío de su represor el IκB reduce lesión temprana en ratas inducida por alcohol.21 Además, un vector adenoviral que codifica para hiper-IL-6 (una citosina superagonista diseñada que consiste en IL-6 humana ligada por una cadena peptídica flexible para ser secretada en forma de receptor de IL-6) fue capaz de mantener la función hepática, prevenir el avance de necrosis e inducir regeneración en un modelo murino de daño hepático agudo inducido por administración de D-galactosamina.22 Nuestro grupo de

www.FreeLibros.me


126

Capítulo 10

Aplicaciones de la biología molecular en la terapia génica

trabajo ha señalado que vectores adenovirales pueden ser transducidos en hepatocitos de hígados cirróticos y se demostró que éstos no se alojan en otros órganos, a pesar de ser introducidos por vía general (vena iliaca de la rata). Como cualquier fármaco, el gen terapéutico debe administrarse en cierta dosis para producir el efecto terapéutico y no tener efectos tóxicos, por lo cual se hicieron curvas de dosis-respuesta.23,24

Hechos relevantes A pesar de las estrategias utilizadas para aliviar enfermedades hepáticas experimentales crónicas, se vuelve más evidente que esas estrategias ideales para el tratamiento de la cirrosis deben incluir prevención de la fibrogénesis, como sería la inducción de proliferación de células hepáticas, formación de nuevos vasos hepáticos y reorganización de la estructura hepática. Un hecho importante es la capacidad de los vectores adenovirales (de primera, segunda y tercera generaciones) en ser transducidos en hígados cirróticos; en el caso de hígados murinos, este problema no se había resuelto. Una ventaja del hígado es que es el sitio elegido por el adenovirus, así que la mayoría de las partículas se internaliza en los hepatocitos y no en las células no parenquimatosas. Esto es, que los vectores adenovirales entregarán el gen terapéutico de una manera preferencial al hígado después de inyectarse por vía general. Este envío a un órgano específico reducirá la toxicidad general. En cambio, una desventaja de muchos portadores adenovirales es que la expresión del gen y la función que ejerce la proteína correspondiente no dura mucho tiempo. Otros investigadores han informado de expresiones durante dos a tres semanas a bien de dos a tres meses. Como se mostró, este hecho dependerá principalmente de la calidad y titulación de cada lote de vectores adenovirales.23,24 No obstante, hay una esperanza en un futuro cercano para resolver este problema, puesto que están por llegar vectores de la nueva generación, los llamados “gutted” (vacíos). Por otro lado, el uso de liposomas fusionados a cualquier molécula es bastante circunstancial y este envío no es específico. En conclusión, la principal pregunta clínica que desea ser contestada para los clínicos es si se puede revertir la cirrosis hepática. Para responder a esta respuesta, primero se tenía que comprobar la “prueba de concepto”; para esto, nuestro grupo incluyó su validez en dos modelos experimentales.24,25,26 Los estudios in vivo se llevaron a cabo en el modelo de CCl4 y el de ligadura del conducto biliar. En estos estudios se probó la eficacia de transducción con 3 × 1011 partículas víricas/kg del vector adenoviral portando el gen de la metaloproteasa de matriz 8 (MMP8).27 El razonamiento de utilizar MMP8 fue el de la promoción de la

degradación in situ de las proteínas de la matriz extracelular, liberando el factor de crecimiento hepático (HGF) y dejando espacio libre para la proliferación de células hepáticas.28 Nuestros resultados fueron prometedores en ambos modelos; en el modelo de ligadura biliar, se observó una disminución de 45% de fibrosis con una merma del contenido de hidroxiprolina y en el modelo de CCl4 la disminución fue de 56%. Por otro lado, se usó otro gen terapéutico que fue el plasminógeno urocinasa humano (HuPA); con este gen se logró una reducción de 85% de la fibrosis hepática al día 10 posterior a la inyección del adenovirus.25,26 La administración del adenovirus con el gen HuPA llevó a resolución casi completa de fibrosis periportal y centrilobular, alcanzando una reducción de 85% en fibrosis hepática al día 10, hecho que se correlacionó con un aumento en la expresión de MMP-2. Además, hígados cirróticos mostraron numerosas células con α-SMA positivas. Además de la resolución de la fibrosis, se advirtió un aumento en la regeneración del hígado en ratas tratadas con Ad-HuPA. Dos días después de la administración de Ad-HuPA, las secciones de hígado mostraron un aumento sustancial en el número de figuras mitóticas, hepatocitos binucleados y células que expresan el antígeno de proliferación nuclear (PCNA). Hay muchos datos que necesitamos recabar antes de intentar aplicar estas estrategias biotecnológicas en pacientes humanos.

Terapia antisentido Se trata de otra estrategia metodológica, en donde las enfermedades caracterizadas por una proteína anormal o la producción en exceso de una proteína normal pueden potencialmente tratarse mediante un bloqueo selectivo del gen o los genes que causan esta enfermedad. Cuando un gen se expresa, la secuencia de bases del DNA se transcribe a una sola cadena de RNA y luego se traduce a una proteína. La idea principal de la terapia antisentido es evitar la expresión del gen o del RNA de la proteína; esto es, interrumpir el flujo de la información genética usando oligonucleótidos sintéticos que tienen como blanco secuencias específicas de RNAm. Desde 1977, algunos investigadores habían conseguido usar terapia antisentido para inhibir la expresión de DNA, por lo menos en sistemas de células libres. Desde entonces, ha surgido la idea de regular la expresión de algunos genes, incluso usando bacterias y células de mamífero. Los investigadores han tratado con secuencias específicas de silenciar algún gen blanco.

Mecanismo Hay dos posibles mecanismos por los cuales la traducción del RNAm puede ser bloqueada por la unión de un oligonucleótido complementario.

www.FreeLibros.me


El hígado como órgano blanco

• Hibridación base específica; así se previene el acceso del RNAm por la maquinaria de traducción de la célula (hibridación de arresto). • Rotura del híbrido RNA-DNA por la enzima ribonucleasa H. Las moléculas antisentido por lo general son pequeños segmentos de DNA o RNA, los cuales presentan ciertas características: a) Son un polímero sintético de una sola cadena con sentido 3′-5′. b) Generalmente son de DNA, aunque en ocasiones pueden ser de RNA. c) Tienen una secuencia específica que, por complementariedad, se une a un RNAm. Lo que intenta la terapia antisentido básicamente es interrumpir la expresión del gen en alguna de las dos fases del procesamiento de la proteína (fig. 10-2). La primera fase es en la transcripción; esta fase se refiere a la codificación de un gen en un RNA mensajero que sale del núcleo de la célula. La idea es diseñar un oligonucleótido antisentido capaz de inhibir el crecimiento específico de la doble hélice de DNA, de tal modo que se crea una triple hélice dentro de un gen o en uno de sus elementos del promotor. Esto previene la codificación del gen que será leído. La otra fase que puede ser interrumpida es la traducción, donde el mensajero actúa como una instrucción grabada que habilita a la célula en los ribosomas para sintetizar una proteína. La idea es bloquear de manera directa al mensajero. Si una hebra antisentido puede unirse e hibridar con un mensajero específico, la hebra

dúplex resultante DNA-RNA impediría la lectura del mensaje por los ribosomas. Una idea un poco diferente, pero también relacionada con este bloqueo del mensaje, está relacionada con la presencia de ribozimas, en donde se pretende la rotura del híbrido RNA-DNA por la enzima ribonucleasa H. Las ribozimas son enzimas de RNA que se sintetizan con una secuencia blanco específica, pero como parte la estructura del RNA son capaces de autocatalizarse, y el sitio de rotura está en el RNA mensajero blanco.

Propósito Cualquiera que sea el mecanismo, la meta es interrumpir al RNAm en una célula viva; esto es más complicado que el solo diseño teórico probado en cultivos celulares, ya que la hebra antisentido tiene que alcanzar la célula blanco librando una serie de barreras. En primer lugar, debe tener una protección para poder ser resistente a las nucleasas circulantes. Así, su diseño debe darle protección de días en lugar de horas para que pueda llegar al sitio específico que será blanco de la acción de esta terapia antisentido. Otro punto importante es que el oligonucleótido debe entrar a la célula blanco; los ácidos nucleicos desnudos tienen una fuerte carga negativa que hace a la molécula soluble en agua, pero poco soluble en lípidos, y este es un impedimento para que pueda cruzar la membrana plasmática. La célula también posee diferentes tipos de receptores que facilitan la introducción de moléculas a su interior (fig. 10-2). Otra idea es la de asociar al oligonucleótido con un portador; en este punto, los liposomas son moléculas útiles para este fin. Hay que considerar también la presen-

Citoplasma

Núcleo

Antisentido Proteína

DNA

Figura 10-2

127

RNAm RNAm

Terapia antisentido. La hebra antisentido bloquea la síntesis de la proteína.

www.FreeLibros.me


128

Capítulo 10

Aplicaciones de la biología molecular en la terapia génica

cia de los endosomas y lisosomas, que son los encargados de degradar pequeños fragmentos circulantes. Una vez que es capaz de librar estas barreras y entrar al núcleo a través de un poro nuclear, ahí debe encontrar su blanco. Si el gen o bien el mensajero no se encuentra de modo lineal a fin de poder hibridarse con la secuencia blanco con la que fue diseñada, el éxito de lograr su inhibición está lejos de alcanzar: de hecho, ambos DNA y RNA están plegados, y también se hallan cubiertos con proteínas de regulación, mismas que pueden ocultar la secuencia blanco. Características de la secuencia: de 12 a 15 bases o 13 a 30 bases.

CONSIDERACIONES DE INTERÉS Hay otro punto importante que se relaciona con él cuando desactiva el mensaje. El antisentido de una hebra de DNA seguirá participando en la destrucción de mensaje-

ros. De igual modo, la ribozima seguirá destruyendo al mensajero; sin embargo, se presenta una degradación de ambos sistemas. En este caso, lo importante es que se pueda mantener por más tiempo la inhibición del mensaje. Los dúplex de DNA-DNA son más débiles que los de RNA-RNA, y se ha intentado diseñar un DNA que se parezca más a un RNA.

NUEVAS ESTRATEGIAS En casos de translocaciones, lo ideal es atacar a la nueva proteína oncógena resultante de la fusión de dos secuencias no oncogénicas. El problema en estos casos es que el punto de rotura parece estar inaccesible. Otro punto en contra es que después que se lleva a cabo este intercambio de secuencias a tiempos más largos, cada célula madre se divide y también engendra una célula de la hija que posee el cambio, propagando muy rápido este defecto en el genoma.

BIBLIOGRAFÍA 1. Gene therapy clinical trials. The journal of gene medicine. www.wiley.co.uk/genmed. Annals of Hepatology, 2002; 1(4):169-174. 2. Kay M, Liu D, Hoogerbrugge P. Gene therapy. Proc Natl Acad Sci USA, 1997;94:12744-12746. 3. Hacein BS, Le Deist F, Carlier F, Bouneaud C, Christophe HCH, De Villartay J, Thrasher A et al. Sustained correction of X linked severe combined immunodeficiency by ex vivo gene therapy. N Eng J Med, 2002;346(16):1185-1193. 4. Kay M, Manno C, Ragni M, Larson P, Couto L, McClelland A, Glader B et al. Evidence for gene transfer and expression of factor IX in haemophilia B patients treated with an AAV vector. Nature Genetics, 2000;24:257-261. 5. Hacein BFF, Cavazzana CM. Gene therapy of severe combined immunodeficiencies. Nat Rev Immunol, 2002;2(8):615-621. 6. Porada Ch, Tran N, Eglitis M, Moen R, Troutman L, Flake A, Zhao Y et al. In utero gene therapy: transfer and long-term expression of the bacterial neo gene in sheep after direct injection of retroviral vectors into preimmune fetuses. Human Gene Therapy, 1998;9:1571-1585. 7. Zanjani E, Anderson W. Prospects for in utero human gene therapy. Science, 1999;285:2084-2088. 8. Zern M, Kresina T. Hepatic drug delivery and gene therapy. Hepatology, 1997;25(2):484-491. 9. Ferry N, Heard J. Liver-directed gene transfer vectors. Human Gene Therapy, 1998;9:1975-1978. 10. Martínez FD, Mullersman J, Purchio A, Armendáriz BJ, Martínez HA. Nonenzymatic glycosylation of poly-L-lisine: a

new tool for targeted gene delivery. Hepatology, 1994;20(6): 1602-1608. 11. De Godoy J, Malafosse R, Fabre M, Mitchell C, Mehtali M, Houssin D, Soubrane O. A preclinical model of hepatocyte gene transfer: the in vivo, in situ perfused rat liver. Gene Therapy, 2000;7:1816-1823. 12. Bataller R, Brenner D. Hepatic stellate cells as a target for the treatment of liver fibrosis. Seminars in Liver Disease, 2001;21(3):437-451. 13. Kafr T. Lentivirus vectors: difficulties and hopes before clinical trials. Curr Opin Mol Ther, 2001;3(4):316-326. 14. Russell D, Miller AD. Foamy virus vectors. Journal of Virology, 1996;70(1):217-222. 15. Olivares E, Hollis R, Chalberg T, Meuse L, Kay M, Calos M. Site specific genomic integration produces therapeutic factor IX levels in mice. Nature Biotechnology, 2001;20: 1124-1128. 16. Stephen S, Ehrhardt A, Giehm J, Meuse L, Pham T, Kay M. Transposition from a gutless adeno-transposon vector stabilizes transgene expression in vivo. Nature Biotechnology, 2002;20:999-1005. 17. Hartigan OD, Amalafitano A, Chamberlain J. Improved production of gutted adenovirus in cells expressing adenovirus preterminal protein and DNA polymerase. Journal of Virology, 1999;73(9):7835-7841. 18. Liu F, Huang L. Development of non-viral vectors for systemic gene delivery. Journal of Controlled Release, 2002;78: 259-266.

www.FreeLibros.me


Bibliografía 19. Rudolph KL, Chang S, Millard M, Schreiber AN, DePinho RA. Inhibition of experimental liver cirrhosis in mice by telomerase gene delivery. Science, 2000;287:1253-1258. 20. Yu Q, Shao R, Quian HS, George SE, Rockey DC. Gene transfer of the neuronal NO synthase isoform to cirrhotic rat liver ameliorates portal hypertension. J Clin Invest, 2000;105(6):741-748. 21. Uesugi T, Froh M, Arteel GE, Bradford BU, Gabele E, Wheeler MD, Thurman RG. Delivery of IkB superrepresor gene with adenovirus reduces early alcohol-induced liver injury in rats. Hepatology, 2001;34:1149-1157. 22. Hecht N, Pappo O, Shouval D, Rose JS, Galun E, Axelrod JH. Hyper-IL-6 gene therapy reverses fulminant hepatic failure. Molecular Therapy, 2001;3(5):683-687. 23. Qi Z, Atsuchi N, Ooshima A, Takeshita A, Ueno H. Blockade of type beta transforming growth factor signaling prevents liver fibrosis and dysfunction in the rat. Proc Natl Acad Sci USA, 1999;96:2345-2349. 24. Aguilar L, Aguilar CE, Ando D, Armendáriz B J, Brud P, Butler E, Carter B et al. A prescription for gene therapy. Molecular Therapy, 2000;1(5):385-388.

129

25. García BJ, Siller López F, Miranda A, Aguilar LK, Aguilar CE, Armendáriz BJ. Cirrhotic rat livers with extensive fibrosis can be safely transduced with clinical-grade adenoviral vectors. Evidence of cirrhosis reversion. Gene Therapy, 2002;9:127-134. 26. Salgado S, García J, Vera J, Siller F, Bueno M, Miranda A, Segura A et al. Liver cirrhosis is reverted by urokinase-type plasminogen activator gene therapy. Molecular Therapy, 2000;2(6):545-551. 27. Siller F, Salgado S, Sandoval A, Salazar A, García J, Vera J, Galván FJ, Armendáriz BJ. Treatment with human metalloproteinase-8 gene delivery ameliorates experimental rat liver cirrhosis. Gastroenterology, 2004;126(4):1122-33. 28. Ueki T, Kaneda Y, Tsuitsui H, Nakanishi K, Sawa Y, Morishita R, Matsumoto K et al. Hepatocyte growth factor gene therapy of liver cirrhosis in rats. Nat Med, 1999;5:226-230.

www.FreeLibros.me


Capítulo

11

Terapia génica en enfermedades neurodegenerativas Dr. Carlos Beas Zárate Dra. Graciela Gudiño Cabrera Dr. Juan Armendáriz Borunda Dr. Reinhard Schliebs

la presencia de elementos reguladores asociados a éstos indican un alto grado de regulación del aparato transcripcional, con lo que puede permitir la regulación de la expresión de estos genes por algunos fármacos. Por otro lado, con el surgimiento de estas tecnologías, ha sido posible la creación de modelos animales transgénicos, lo que permite evaluar los efectos de la adición, alteración o eliminación de genes individuales tanto constitutivos como inducibles participantes en la etiopatología y fisiopatología de algunas enfermedades neurológicas, como la esquizofrenia. Por esta razón, el presente capítulo pretende dar a conocer algunos de los mecanismos básicos de los procesos neurodegenerativos, la caracterización de algunos trastornos homónimos, así como los modelos de estudio en la aplicación de la terapia génica para su tratamiento y por último se presenta una visión de los más recientes avances en el conocimiento de la enfermedad de Alzheimer.

INTRODUCCIÓN En los últimos cinco años, las estrategias sobre la transferencia de genes se han estado integrando a las investigaciones de la función del cerebro con un enfoque sobre los mecanismos celular y molecular del desarrollo neuronal, la plasticidad y la degeneración. Estas técnicas también se estudian como estrategias de tratamiento prospectivo de diversas enfermedades neurodegenerativas, como Parkinson, Alzheimer, Huntington, epilepsia, etcétera. Hoy en día, ha habido un progreso considerable en el desarrollo de vectores víricos eficientes y seguros que permite la transferencia de genes a células del cerebro, así como el surgimiento de técnicas de trasplante de células de tipo neuronales, no neuronales (Ridet et al., 1999) y células progenitoras (Ross et al., 1999) que son modificadas genéticamente para liberar productos de genes terapéuticos al sistema nervioso central. Sin embargo, una de las preocupaciones fundamentales en el desarrollo de estas tecnologías consiste en evitar los efectos secundarios no deseados, mismos que pueden ser inducidos por los productos de genes. Por tanto, el esclarecimiento de la estructura y organización de genes promotores y

MECANISMO NEUROEXCITOTÓXICO En el último decenio, la incidencia de enfermedades neurodegenerativas se incrementó de manera importante, 130

www.FreeLibros.me


Enfermedades neurodegenerativas

no sólo en personas de edad avanzada, sino también en adultos jóvenes. Las diferentes manifestaciones de estas alteraciones afectan de modo notable la calidad de vida del individuo, lo que ha motivado la ejecución de líneas y modelos de investigación para el estudio de los procesos degenerativos del sistema nervioso. Particularmente, una de las líneas de investigación más documentada en los últimos 30 años se refiere al papel neuroexcitotóxico del ácido glutámico (Glu). De esta manera, la muerte neuronal producida por Glu se conoce como excitotoxicidad, y al parecer se relaciona con los procesos neurodegenerativos ocasionados por hipoxia-isquemia cerebral, traumatismo craneoencefálico, crisis convulsivas y algunos trastornos neurodegenerativos, como la enfermedad de Parkinson, demencia de Alzheimer, corea de Huntington, esclerosis lateral múltiple, etcétera. Por ello, resulta trascendente analizar los mecanismos básicos a través de los cuales un incremento en la concentración de Glu en el espacio interneuronal produce daño y muerte neuronal, hechos semejantes a los que se presentan en los procesos neurodegenerativos, así como los diversos modelos de terapia génica que se han utilizado para prevenir la aparición de éstos.

Excitotoxicidad neuronal Poco después que se descubrieron los efectos excitadores del Glu, los trabajos iniciales de Lucas y Newhouse permitieron observar que, en concentraciones altas, el Glu era capaz de producir degeneración neuronal. Hacia el decenio de 1970, después de observar los efectos tóxicos del Glu en diferentes preparados neuronales de diversas especies animales, Olney propuso que el Glu promovía la muerte neuronal al sobreactivar a sus receptores, a través de un proceso al que denominó excitotoxicidad neuronal. Estudios in vitro han demostrado que, dependiendo del esquema de aplicación, el Glu puede promover la neurodegeneración a través de dos procesos diferentes. La muerte neuronal aguda se presenta después de exposiciones breves al Glu; es un proceso dependiente de Na+ y Cl– y se caracteriza por cambios neurodegenerativos inmediatos, como la picnosis nuclear y la inflamación edematosa del soma neuronal y las dendritas, en tanto que la exposición prolongada a Glu produce muerte neuronal retardada, la cual depende del ingreso de Ca++ y requiere de varias horas para presentarse. Es importante señalar que algunos autores han relacionado estos dos procesos con la muerte neuronal necrótica y apoptótica, respectivamente. Datos experimentales sugieren que el ingreso excesivo de Ca++ promueve el daño neuronal excitotóxico, mediante de la activación de diferentes mecanismos intracelulares que conducen a la muerte neuronal, entre

131

los que destacan: 1) la generación de radicales libres, que favorecen la lipoperoxidación de los lípidos membrana; 2) la síntesis de óxido nítrico, que puede actuar como un retromensajero y potenciar la liberación de Glu, al incrementar su efecto excitotóxico; 3) la activación inespecífica de múltiples vías de señalización intracelular promotoras de la proteólisis del contenido citoplásmico, y 4) la disfunción mitocondrial, que altera el metabolismo energético (fig. 11-1). En este sentido, se sabe que al disminuir la tasa metabólica intracelular e interrumpirse la cadena respiratoria, la mitocondria pierde su capacidad para mantener la homeostasia del Ca++, y por tanto la susceptibilidad a los efectos tóxicos del Glu se incrementa de modo notable (fig. 11-1).

ENFERMEDADES NEURODEGENERATIVAS Corea de Huntington

Curso clínico La corea de Huntington (CH) se caracteriza por una tríada de anormalidades motoras, emocionales y cognitivas. Los síntomas por lo general inician entre los 35 y 50 años de edad, aunque se pueden presentar desde la edad juvenil hasta la adulta. De manera característica, la muerte ocurre 15 a 20 años después de los primeros síntomas; a diferencia de Alzheimer, los pacientes con CH son capaces de recordar sucesos de la memoria más que almacenarlos en ésta. Con frecuencia, presentan síntomas psiquiátricos, entre ellos depresión, irritabilidad y apatía. La expresión conductual de estos síntomas puede incluir impulsividad explosiva, retiro social y suicidio. En resumen, el adulto con CH pasa por tres etapas: la etapa inicial, que incluye manifestaciones con cambios sutiles de coordinación en movimientos involuntarios; dificultad para pensar y resolver problemas con humor irritable o depresión. En la etapa intermedia, los movimientos motores voluntarios son más difíciles y presentan disfagia y disartria, algunas veces con deficiencias cognitivas. En la etapa avanzada, se presenta mayor rigidez, bradicinesia con demencia global; sin embargo, no hay un tratamiento específico que permita una reducción en la progresión clínica de la CH (Ross et al., 2006).

Aspectos moleculares El gen para la CH (IT15 o huntingtina) se identificó en 1993 (Ross et al., 2006). La mutación consiste en una expansión repetitiva del codón CAG en el gen correspondiente, mismo que consta de 67 exones tanto en el ratón como en el ser humano; se localiza entre los marcadores D4S127 y D4S180 del cromosoma 4p16.3 sobre una

www.FreeLibros.me


132

Capítulo 11

Terapia génica en enfermedades neurodegenerativas Glutamato Receptor NMDA [Ca2+]i

NOS 2

Hinchamiento mitocondrial Rotura de la membrana externa

O2

[Ca2+]i

NOS

Estrés oxidativo O2 FIA

[Ca2+]i 4

4 O2 SOD

1 ONOO–

2 NO+O2

] Ca2+] i

NO+O2

ONOO–

3

Activación PTP

[Ca2+]i

OXIDACIÓN

Receptor NMDA

Cambios ATP

3

1

Glutamato

Cyt CASPASA 9 c

H2O

H2O2

FIA

CATALASA

dATP

NÚCLEO

OH– 1 PROTEÍNAS LÍPIDOS DNA Y RNA

3 NÚCLEO

ACTIVACIÓN PADRi-P

Activación de cascada de caspasas

APOPTOSIS NECROSIS

ATP, NAD

Figura 11-1

región genómica de 900 kb y se transcribe en dos versiones del RNAm que varían sólo en la longitud del extremo 3′ de la región sin transducir. El gen codifica para una proteína de 350 kDa con poca homología respecto a proteínas conocidas. Estudios de inmunocitoquímica demuestran que la huntingtina está presente en el soma neuronal, dendritas y terminales nerviosas asociada con elementos de citoesqueleto y vesículas intracelulares. La mayoría de los pacientes jóvenes con CH posee 60 o más tripletes de CAG, en tanto que el límite normal tiene 29 tripletes. De esta forma, la proteína correspondiente que se sintetiza de este gen, la huntingtina, posee un segmento de poliglutamina; se localiza en inclusiones intranucleares, citoplásmicas y en neuritas distróficas (DiFiglia et al., 1997).

cerebrales, lo que permite una pérdida del peso cerebral de 25 a 30% en los casos avanzados. En el estriado, hay una pérdida importante de neuronas de proyección de espinas medianas que sintetizan GABA y encefalinas; este suceso se acompaña de astrocitosis reactiva (Kowall et al., 1987). En la corteza cerebral, las neuronas grandes de las capas III y V de proyección al tálamo son gravemente afectadas. De esta manera, la mayoría de los síntomas clínicos de la CH se correlaciona con la enfermedad de los ganglios basales y de la corteza cerebral. La neurodegeneración también se observa en otras regiones, como el cerebelo, el tallo encefálico, el hipotálamo, la amígdala y porciones del tálamo; sin embargo, la relación entre estos cambios y las características clínicas no es clara.

Neurotoxicología Neuropatología La CH se caracteriza por una atrofia y pérdida selectiva de neuronas en el SNC, sobre todo en caudado y putamen que conforman el estriado, así como en la corteza cerebral, en particular la materia blanca y otras regiones

La administración de agonistas del receptor NMDA, como el ácido quinolínico, al estriado produce una enfermedad semejante a la CH, así como la administración de toxinas mitocondriales como el ácido 3-nitropropiónico. Así, estos experimentos sugieren varias vías metabólicas

www.FreeLibros.me


Enfermedades neurodegenerativas

para inducir la muerte de neuronas en la CH, por lo cual tanto la excitotoxicidad como el envenenamiento metabólico pueden ser mediados en parte por radicales libres que tal vez incrementen la muerte neuronal programada, mejor conocida como apoptosis; ésta a su vez es posible sea desencadenada por un grupo de proteasas de aspartato, llamadas caspasas y GAPDH que sirven como factores iniciadores. También se han encontrado, en cerebros obtenidos de individuos postmortem con CH, notorias deficiencias en la actividad del complejo II, III y IV mitocondrial (Gu et al., 1996). Sin embargo, en un intento por conocer mejor el papel funcional de la huntingtina y la patogenia de la CH, se ha estudiado la interacción de ésta con otras proteínas que contienen glutamina de manera repetitiva, como es el caso de la enzima GAPDH, así como algunos correpresores nucleares y factores de transcripción, proteínas que participan en la regulación del desarrollo y la neurogénesis del SNC. Así, el acceso terapéutico para la CH, que hasta el momento se ha limitado a tratamientos sintomáticos, puede estar dirigido hacia diferentes niveles tal como lo proponen Margolis y Ross (2001; 2003), en donde se consideran los aspectos metabólicos mitocondriales, con antioxidantes y fármacos que inhiben proteasas como la excitotoxicidad como la apoptosis (fig. 11-2)

133

Esclerosis lateral amiotrófica

Curso clínico La esclerosis lateral amiotrófica (ELA) se caracteriza por una parálisis crónicamente progresiva y letal, que se debe a una muerte de neuronas motoras del neuroeje, esto es, la médula espinal, la corteza y el tallo encefálico. Las causas se desconocen, pero la mayoría de los casos inicia entre los 50 y 55 años de edad del individuo y la supervivencia promedio a la ELA es de tres a cinco años, en tanto que casi todos los casos son esporádicos; de 5 a 10% se transmiten por una característica autosómica dominante. Las características clínicas de la ELA se definen según el tipo de muerte de neuronas motoras. Así, cuando inicia con la muerte de neuronas motoras bajas, hay signos de músculo punzante y debilidad. Si las neuronas motoras superiores de los fascículos corticoespinales resultan con degeneración y muerte, se presenta debilidad y espasticidad. Esta pérdida de neuronas se acompaña de astrogliosis significativa. Otra característica es que se presentan agregados focales de proteínas de citoesqueleto tanto en los somas neuronales como en los axones proximales (Brown, 2001; Maimone et al., 2001).

POSIBLE PATOGENIA

TERAPIA POTENCIAL

Expansión del gen con las bases CAG

Terapia génica

Expansión de la poliglutamina en la proteína

Figura 11-2

Alteración de la conformación e interacción en la proteína

Agentes chaperones Estimuladores

Disregulación transcripcional Toxicidad mitocondrial Activación de caspasas

Inhibidores de la excitotoxicidad Estimuladores metabólicos Inhibidores de las caspasas

Muerte selectiva de neuronas

Inhibidores de la apoptosis Neurotrofinas

Signos y síntomas

Neurolépticos, antidepresivos

Estrategias para reducir o detener algunas manifestaciones de la corea de Huntington (CH) según lo propuesto por Ross y Margolis, 2001.

www.FreeLibros.me


134

Capítulo 11

Terapia génica en enfermedades neurodegenerativas

O2–

A

SOD1-Cu2+-Zn

+NO ONOO

B

H2O

Fe2+

Fe2+

OH

(1)

SOD1-Cu2+-Zn

(2)

ONOO + H-Tir

(3)

H2O2 + SOD1-Cu1+-Zn + R

R-(·OH) + SOD1-Cu2+-Zn + OH–

(4)

SOD1-Cu2+ (no Zn) + O2

SOD1-Cu1+-O2–

SOD1-Cu1+- + NO

SOD1-Cu1+- OONO–

(5)

Figura 11-3

H2O2

SOD1 + Cu2+ + Zn SOD1-Cu2+-Zn

NO2-Tir + OH–

SOD1-Cu2+-Zn + (SOD1-Cu2+-Zn/ SOD1-Cu2+-Zn)n

(SOD1-Cu2+-Zn/ SOD1-Cu2+-Zn)n+1 (agregados)

A, posibles reacciones citosólicas de la SOD1, la cual convierte el anión (O2–) superóxido en peróxido de hidrógeno (H2O2), mismo que se convierte en agua por la catalasa y la peroxidasa de glutatión. El anión superóxido se combina con el óxido nítrico (NO) de manera no catalítica para formar el peroxinitrito (ONOO–). La interacción del H2O2 y del peroxinitrito con metales reducidos, como el Fe++ o el Cu++, pueden formar radicales hidroxilo y otras especies reactivas de oxígeno. B, posibles reacciones de la SOD Cu/Zn mutante. Todas estas reacciones asumen que las mutaciones alteran la estabilidad conformacional de la proteína SOD. 1, mutaciones asociadas a una reducción en la afinidad de la SOD1 por el Cu o el Zn. 2, aniones nitronio que se pueden formar más rápido por reacción de ONOO– con la SOD mutante y aceleran la transferencia de grupos nitrato a tirosinas. 3, la SOD1 mutante permite una reducción más rápida del Cu2+; esto aumenta la habilidad de la SOD1 para reducir sustratos de peróxido. 4, en ausencia de Zn, el O2 puede reducir al Cu2+ en SOD1 y producir anión superóxido en un canal activo y potencialmente puede interactuar con NO para formar peroxinitrito. 5, la SOD1 puede formar agregados complejos.

Aspectos moleculares En un grupo de familias que presentaron la ELA se encontró una mutación del gen que codifica para la enzima dismutasa de superóxido citosólica (SOD1) (Juneja et al., 1997). Este gen se localiza en el cromosoma 21q22. En la actualidad se han identificado más de 80 mutaciones de este gen de la SOD1. La SOD1 es una metaloproteína con 153 aminoácidos que cataliza la conversión del anión superóxido O2– a peróxido de hidrógeno H2O2 (fig. 11-3). Así, se le considera para funcionar como antioxidante; luego, el H2O2 se convierte en H2O por la catalasa o la reductasa de glutatión. La SOD1 es altamente conservada y se expresa de manera ubicua.

Neuropatología Estudios moleculares y anatómicos demuestran que las neuronas motoras son más vulnerables a la neurodegeneración que otras; estas neuronas son de cuerpo celu-

lar y prolongación axónica grandes, lo que requiere de altas demandas energéticas y por tanto gran actividad mitocondrial y de un citoesqueleto robusto. Una característica de estas neuronas para ser susceptibles al daño excitotóxico es la presencia de receptores a glutamato del tipo AMPA; estos receptores son los encargados de la transmisión excitadora rápida en el SNC y se conforman de cuatro subunidades, GluR1-GluR4. La presencia de la subunidad GluR2 hace al receptor impermeable al ingreso de calcio hacia la neurona. Este hecho puede implicar que las neuronas sean más permeables al calcio a través de la activación del receptor AMPA y por ello más vulnerables a la excitotoxicidad del glutamato. Otra característica es la carencia de proteínas que unen calcio del tipo D28k y parvalbúmina, proteínas que amortiguan la concentración de calcio intracelular y evitan el daño a neuronas. La observación de que la actividad de la SOD1 cerebral se encuentra reducida en algunos casos de ELA sugiere que un mecanismo de toxicidad se debe a una mutación

www.FreeLibros.me


Enfermedades neurodegenerativas

Cuadro 11-1

135

Variaciones genotípicas y terapias correspondientes en la esclerosis lateral amiotrófica Gen

Terapéutica Cu2+;

Dismutasa de superóxido 1

Quelantes de

Interleucinas o receptores a interleucinas

Antiinflamatorios, antagonista del receptor a interleucina 1

Factores neurotróficos y receptores para neurotróficos

Factores neurotróficos exógenos o transfectados (WDNF, fig. 11-1).

Moléculas relacionadas con la apoptosis antiapoptóticas

Inhibidores de caspasas, sustancias

Receptores a glutamato

Riluzol

Transportadores a glutamato

Riluzol

en la proteína de SOD1 con deficiencia en la eliminación de radicales libres, causantes del estrés oxidativo, cuyas inferencias resultan en un daño oxidativo de proteínas funcionales, como los neurofilamentos y factores neurotróficos, así como de lípidos de membrana con liberación de factores mitocondriales y del DNA.

Neurotoxicología Hay diversas hipótesis que intentan explicar el mecanismo preciso de la toxicidad de la proteína de SOD1 mutante en la ELA: 1) una posible explicación es que las moléculas son menos estables y pueden plegarse para formar agregados que son dañinos para las neuronas, ya que pueden inducir apoptosis y muerte. Esta alterada estabilidad de la proteína posee un efecto adverso secundario que consiste en la liberación de iones cobre y cinc, cuya actividad puede ser tóxica. 2) Otro mecanismo neurotóxico de la SOD1 mutante es a través de una vía aberrante de reacciones oxidativas; es decir, la SOD1 puede aceptar peroxinitritos (ONOO—) como sustrato y formar iones nitronio que puede donar grupos nitrato para residuos de tirosina y formar nitrotirosina, tanto libre como la unida a proteínas. 3) Un tercer posible mecanismo de toxicidad de la SOD1 es la gran actividad de peroxidación, ya que una reacción crítica es la interacción del H2O2 con el Cu++ reducido, consistente con los altos niveles de radicales hidroxilo que se tienen en esta enfermedad. También hay diversos sitios de acción de la SOD1 mutante: a) la SOD1 incrementa la toxicidad del glutamato por reducción en la captura del glutamato al inhibir, reducir, o ambas cosas, la expresión del transportador astroglial EAAT-2; b) otro sitio de acción de la SOD1 es sobre los canales de sodio sensibles a voltaje, y c) con interferencia del transporte axonal (Brown, 2001; Maimone et al., 2001). Hoy en día se desconoce si la neurotoxicidad del glutamato es la causa inicial de la pérdida de neuronas motoras en la ELA, pero este mecanismo neuroexcitotóxico representa un mecanismo patogénico

barredores de radicales libres

común para la mayoría de enfermedades neurodegenerativas. Por esta razón, resulta importante el descubrimiento de nuevos y más eficaces antagonistas a receptores de glutamato o inhibidores de la liberación de glutamato, así como la aplicación de técnicas de terapia génica que permita reducir la vulnerabilidad de las neuronas motoras a la excitotoxicidad glutamatérgica, lo mismo que la estimulación de factores neurotróficos que estimulen la supervivencia de estas motoneuronas tal como se aprecia en el cuadro 11-1.

Enfermedad de Parkinson

Curso clínico La enfermedad de Parkinson (EP) se caracteriza por una degeneración selectiva de las neuronas dopaminérgicas de la sustancia negra y una subsecuente reducción de los niveles de dopamina en el estriado, lo que produce una disfunción motora. Los síntomas clínicos no son evidentes antes de la pérdida de al menos 80% de las cifras de dopamina en el estriado; las características clínicas incluyen lentitud de movimientos, rigidez, temblor y pérdida de reflejos posturales. Las causas de la EP se desconocen, pero estudios de laboratorio, epidemiológicos y neuropatológicos sugieren un origen multifactorial que incluye la predisposición genética, la edad y toxinas del medio.

Aspectos moleculares El primer gen que se identificó para ser la forma de EP autosómica dominante es el que codifica para la proteína sinucleína α; se localiza en los cromosomas 2p y 4p. La sinucleína α es una proteína de 140 aminoácidos, soluble y desdoblada, que se localiza en las terminales sinápticas de neuronas del SNC. En fecha reciente, se han descrito dos mutaciones en el gen de la sinucleína α, A53T y A30P (fig. 11-4). Su función no es del todo conocida, pero parece estar incluida en la plasticidad neuronal; sin embar-

www.FreeLibros.me


136

Capítulo 11

Terapia génica en enfermedades neurodegenerativas

Sinucleína α humana 1

30

41

53

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVA Mutaciones

P

101

T

TVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGA 140 PQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Figura 11-4

Secuencias de la sinucleína α humana. Se observan las mutaciones en las bases.

go, hace poco se le ha relacionado con la formación de los cuerpos de Lewy y su agregación a fibrillas amiloides insolubles que preceden a la acumulación de ubiquitina y neurofibrillas. Estudios recientes demuestran una importante asociación entre un alelo polimórfico del promotor NAC-rep1, específicamente en combinación con la apoliproteína (Apo) E del alelo 4 y el riesgo de adquirir la EP. Otro gen causal para una forma de EP autosómica recesiva se ha localizado en el cromosoma 6q25.2-27. Este gen está estructurado por 12 exones que codifican para una proteína de 465 residuos de aminoácidos denominada parkina, cuya función se desconoce aún. El parkinsonismo que se debe a las mutaciones sobre el gen de la parkina conlleva una degeneración de la sustancia negra, pero no la presencia de cuerpos de Lewy, lo que implica un proceso patogénico diferente a la EP esporádica. También se han descrito otros genes participantes en la EP esporádica, particularmente en el exón 4 de la ubiquitina hidrolasa del carboxilo terminal-L1, sobre el cromosoma 4, lo que indica que una anormalidad en los mecanismos proteolíticos puede favorecer la agregación y ubiquitinización de proteínas como la sinucleína α. En resumen, las formas hereditarias que se han identificado para la EP representan una minoría de la población con esta enfermedad; no obstante, su estudio es muy valioso para entender los mecanismos patogénicos de esta enfermedad (cuadro 11-2).

Neuropatología Las características neuropatológicas de la EP son la degeneración de células que contienen neuromelanina localizadas en la pars compacta de la sustancia negra en el tallo encefálico, así como la presencia de neuronas sobrevivientes con inclusiones eosinófilas conocidas como cuerpos de Lewy. Estas inclusiones son concéntricas con la parte central densa y rodeada por un halo filamentoso estructurado principalmente por tubulina y ubiquitina.

Neurotoxicología Diversos estudios intentan explicar el proceso por el cual se inicia la neurodegeneración de las neuronas dopaminérgicas del estriado, en cuyo cuadro clínico se produce la EP. Esto ha motivado generar o proponer diversas hipótesis para explicar dichos fenómenos; así, la hipótesis genética es la misma que se ha tratado en parte en la sección correspondiente de aspectos moleculares de EP. Estudios recientes han demostrado que las neuronas dopaminérgicas en la EP son susceptibles al estrés oxidativo, ya que presentan bajos niveles de glutatión y un excesivo contenido de hierro libre, por lo que se da la hipótesis del estrés oxidativo, que consiste en lo siguiente: las moléculas de dopamina (DA) pueden generar radicales libres por autooxidación a través de la monoaminooxidasa tipo B; estos radicales que median algún daño celular son inactivados por lo general por la SOD, la reductasa de glutatión, así como la presencia de algunos metales de transición. Recientemente, se han descrito algunos polimorfismos en el gen que codifica para la enzima aminooxidasa B en la EP, que muestra una unidad

Cuadro 11-2

Posibles genes y modelos de estudio para la enfermedad de Parkinson

Posibles genes deficientes Sinucleína α, parkina, hidrolasa de ubiquitina, hidroxilasa de tirosina, receptor D2

www.FreeLibros.me

Efectos Pérdida de neuronas dopaminérgicas en el cuerpo estriado

Modelos de estudio Adenovirus para la descarboxilasa de aminoácidos aromáticos, neurotrofina, dismutasa de superóxido, BcL-2, receptor D2


Enfermedades neurodegenerativas

Cuadro 11-3

137

Perspectivas de tratamiento y terapia preventiva de la enfermedad de Parkinson Gen

Terapia

Monoaminooxidasa B

Inhibidores de la monoaminooxidasa (selegilina, rasagilina, lazabemida)

Receptores o transportadores para glutamato

Remacemida

Factores neurotróficos o receptores a factores neurotróficos

Factores neurotróficos endógenos o exógenos transfectados (GDNF)

Interleucinas o receptores para interleucinas

Antiinflamatorios, interleucina 1, antagonistas a receptores

Moléculas relacionadas con la apoptosis

Antiapoptóticos, inhibidores de caspasas

N-acetiltransferasa

Evitar exposición a tóxicos exógenos

Transferasa de glutatión

Evitar contaminantes, glutatión exógeno

Receptor a DA tipo D2

L-DOPA

Receptores a DA

L-DOPA,

agonistas a receptores

Obtenido de las referencias: Maimone et al., 2001.

de GT repetitiva en el intrón 2 de dicho gen (Tan et al., 2000a; 2000b; 2000c). Por ello, si estos polimorfismos en el gen de monoaminooxidasa B incrementan el riesgo de adquirir la EP, una intervención en estado preclínico con inhibidores de esta enzima, como selegilina, rasagilina, etc., podrían ser de gran utilidad (cuadro 11-3). Por otro lado, un análisis de la cadena respiratoria mitocondrial en cerebros de pacientes con EP ha revelado una deficiencia del complejo I, lo que trae como consecuencia una disfunción mitocondrial en las neuronas dopaminérgicas de la sustancia negra. Esta deficiencia en la actividad del complejo I parece ser secundaria a una toxicidad de compuestos acumulados de manera endógena o exógena, ya que una intoxicación con el contaminante de algunas sustancias, la metilfeniltetrahidropiridina (MPTP), causa de síndrome de Parkinson después de una intoxicación, se convierte al ion metilfenilpiridio (MPP+) por la monoaminooxidasa B, inhibe la reductasa del complejo I mitocondrial. El daño oxidativo mitocondrial podría tener efectos de mutación sobre el DNA mitocondrial, mismos que podrían traer un incremento en el umbral patológico de la EP. Sin embargo, resulta importante determinar las inferencias que tendrían estas mutaciones mitocondriales en la EP. También se ha observado que la actividad glutamatérgica excitadora de la neocorteza y núcleos subtalámicos hacia la sustancia negra está incrementada en la EP (Chase et al., 2000). Aunque no hay datos directos sobre excitotoxicidad mediada por un aumento en la liberación de glutamato y sobre activación de sus receptores en la EP, datos recientes de nuestro laboratorio demuestran que la activación de los receptores ionotrópicos a glutamato del tipo NMDA y kainato sobrestimula la libe-

ración de DA en el estriado (Chaparro et al., 1997), lo que podría demandar el consumo de más ATP por las neuronas dopaminérgicas, mismas que poseen una disfunción mitocondrial por deficiencia del complejo I. Así, el incremento de los niveles de Ca++ intracelular a través de receptores ionotrópicos podría activar la sintasa de óxido nítrico con la subsecuente generación de radicales libres tóxicos, como los peroxinitritos; también los radicales oxidantes podrían modificar el estado de activación de los receptores, en particular el NMDA, y mantener abierto el canal del Ca++, lo que puede reforzar la toxicidad hacia la neurona dopaminérgica. Este potencial mecanismo de daño puede inhibirse con antagonistas del receptor a glutamato, o acciones dirigidas hacia los genes del mismo, así como del transportador a glutamato (cuadro 11-4). También un metabolismo alterado de la DA y la neurotransmisión dopaminérgica, en donde se incluyen varios genes como el de la hidroxilasa de tirosina, el transportador de DA, el receptor a DA, la monoaminooxidasa A o B, la catecol-O-metiltransferasa, así como en la destoxificación de metabolitos, como el citocromo P450, N-acetiltransferasa, la transferasa de glutatión, el complejo de la deshidrogenasa de α-cetoglutarato y la SOD de manganeso, entre otras; se han asociado de manera significativa con la EP, por lo que estos genes se convierten en blancos importantes para la terapia de la EP (Oliveri et al., 1999; Tan et al., 2000b). Además, gran cantidad de factores neurotróficos muestran efectos protectores sobre las neuronas dopaminérgicas, entre ellos el factor neurotrófico derivado de la neuroglia, factor básico de crecimiento de fibroblastos (FbCF), factor derivado del cerebro, neurotrofina 3, neurotrofina 4/5, factor neuro-

www.FreeLibros.me


138

Capítulo 11

Cuadro 11-4

Terapia génica en enfermedades neurodegenerativas

Variaciones genotípicas y perspectivas de terapias correspondientes Gen

Terapia

Precursor de la proteína amiloide (PPA)

Inmunización con proteína amiloide β, anticuerpos proteína antiamiloide β, inhibidores de secretasas β y γ, estimuladores de secretasas α

Presenilina 1

Inmunización con proteína amiloide β, anticuerpos proteína antiamiloide β, inhibidores de secretasas γ

Interleucina 1α/β

Antiinflamatorios (p. ej., ibuprofeno, inhibidores de ciclooxigenasa 2), antagonista del receptor a interleucina 1

Genes relacionados con apoptosis

Antiapoptóticos, inhibidores de caspasas

α-1-antiquimiotripsina

Antiinflamatorios (p. ej., ibuprofeno, inhibidores de ciclooxigenasa 2), antagonista del receptor a interleucina 1

Receptores muscarínicos

Inhibidores de acetilcolinesterasas

Apolipoproteína E

Inhibidores de acetilcolinesterasa

trófico ciliar y el factor de crecimiento transformante β (TWF-β), así como la presencia de una gran cantidad de citocinas (IL-β, interferón γ, TNF-α) como reacción inflamatoria de las células de microglia y astrocitos que son detectados en la sustancia negra en la EP (Hirsch et al., 2000). Estos factores pueden promover apoptosis a través de las caspasas 3, Bax y Bcl-2 (cuadro 11-5). Algunos de éstos inducen la formación de radicales libres y se expresan bajo condiciones de estrés oxidativo, por lo que el inhibir la liberación de estos factores y la modulación en la actividad de las enzimas podría resultar benéfico para la EP.

Enfermedad de Alzheimer

Curso clínico La enfermedad de Alzheimer (EA) se caracteriza por dos aspectos morfopatológicos: uno es la presencia de placas neuríticas extracelulares denominadas placas seniles en la región cortical e hipocampal. Estas placas seniles son depósitos compactos de una cadena peptídica denominada amiloide β (β-A). El segundo es la presencia de una estructura ramificada de neurofibrillas intracelulares que ocupan gran parte del citoplasma de las células piramidales, cuyo principal componente es una proteína insoluble e hiperfosforilada llamada τ (tau) asociada a los microtúbulos. La característica principal de la EA es una pérdida progresiva de neuronas con atrofia cerebral en regiones específicas, particularmente la proyección colinérgica de los núcleos basales de Meynert hacia la corteza cerebral. Diversos estudios demuestran la deficiencia en el aprendizaje y la memoria que se observa en pacientes con EA; esta pérdida de neuronas es paralela con la reducción de

marcadores colinérgicos, como los receptores nicotínicos, muscarínicos, la enzima acetiltransferasa de colina y los niveles de acetilcolina; estos cambios se correlacionan con el grado de demencia y la extensión neuropatológica en el cerebro. Con la tomografía por emisión de positrones con el uso de glucosa marcada con 18F/11C, ha sido posible conocer que la EA también está relacionada con considerables cambios en el metabolismo de la glucosa y energético cerebral. Esto ha emitido la hipótesis de que la patogenia inicial de la EA esporádica puede ser una disfunción en la transducción del receptor neuronal a insulina (Hoyer, 2000). Sin embargo, a partir de las plaquetas seniles en cerebros con EA, también se ha vinculado con células de la microglia activadas y astrocitos reactivos como reacción inflamatoria en la patogenia de la EA. En este sentido, hay datos de que la β-A puede promover la inflamación a través de la liberación de mediadores inmunes por los neurogliocitos (McGeer et al., 2000; McGeer, 2000).

Aspectos moleculares El mayor componente de las placas neuríticas es un péptido de β-A de 4 kDa que se deriva de una proteína mayor denominada precursor de la proteína amiloide (PPA). Ésta pertenece a una familia de proteínas transmembrana glucosiladas que se expresan de manera ubicua y abundante en el cerebro; también hay diversas isoformas derivadas de la edición de los exones 16 y 17 del gen de la β-A y que se localiza en el cromosoma 21 (Selkoe, 2000; Hardy, 2001). La estructura del PPA consiste en un dominio extracelular largo y una región embebida en la membrana plasmática y una región corta intracelular que posee el carboxilo terminal. La proteína precursora posee una secuencia de 39 a 42 aminoácidos de la β-A

www.FreeLibros.me


Enfermedades neurodegenerativas

y se procesa para ser secretada, o una vía endosómicalisosómica, formando productos no amiloidógenos por degradación o péptidos amiloidógenos β, respectivamente. Para generar el β-A, el PPA debe ser cortado por dos proteasas que también se han denominado secretasas β y γ. El corte por la secretasa β produce un PPA truncado, pero este fragmento también se corta por la secretasa γ en el aminoácido 711 o 713 para producir β-A1-40 o β-A142, respectivamente (fig. 11-5). La vía secretora no amiloidógena incluye la degradación proteolítica del PPA por una secretasa α entre las posiciones de los aminoácidos 17 y 17 del dominio del β-A que resulta en la liberación del ectodominio del PPA, llamado sPPA-α. El segmento restante anclado en la membrana de 83 aminoácidos del PPA se degrada por una secretasa γ para producir el péptido p3 (Sinha et al., 1999; Selkoe, 2000b). Estudios recientes se han enfocado sobre la caracterización de las secretasas que procesan el PPA, ya que la estimulación de la secretasa α o la inhibición de la secretasas β o γ pueden representar estrategias terapéuticas en la EA. También diversos estudios han sugerido que las presenilinas pueden ser secretasas γ (Haass y De Strooper, 1999). Recientemente, otra proteína, la nicastrina, se ha identificado para participar en el procesamiento del PPA mediado por presenilina (Schenk, 2000).

139

Aspectos neuroquímicos Hay una fuerte evidencia de que el procesamiento de PPA se controla por la activación de diversos receptores para neurotransmisores acoplados a la cinasa de proteína C, ya que la liberación de sPPA-α se incrementa por estimulación de los receptores muscarínicos de los subtipos m1 y m3, pero no del m2 y el m4. La activación de los receptores muscarínicos en células transfectadas con receptores humanos de los subtipos m1 o m3 incrementa la secreción de sPPA-α, pero disminuye la liberación de β-A, lo que sugiere que la actividad colinérgica normal puede suprimir la formación de potenciales derivados amiloidógenos. También la activación de la cinasa de proteína C por ésteres del forbol aumenta la secreción de sPPA-α, indicando que los receptores muscarínicos median su efecto sobre el procesamiento de PPA mediante la activación de la vía del fosfatidilinositol. La secreción de sPPA-α se incrementa por estímulo eléctrico en rebanadas de tejido de hipocampo, corteza, estriado y cerebelo, el cual puede inhibirse por la tetrodotoxina, un antagonista de canales del sodio. De igual modo, estudios in vivo de lesión colinérgica selectiva proveen de una fuerte evidencia de que el procesamiento del PPA se controla por la actividad de estas neuronas colinérgicas que se originan en el encéfalo basal.

Proteína precursora de β amiloide N-terminal

β-amiloide

Placas neurofibrilares

Muerte neuronal

C-ter

β-secretasa

N-terminal

β-amiloide

Tau hiperfosforilada

C-ter Daño membranal por lipoperoxidación

γ-secretasa Presenilinas C-ter β-amiloide

Activación de cinasas Cdk5/p25, PKC, ERK2, RTK Inflamación ROS

Ca++

Glucosilación de Tau

Tau

Calpaína Cdk/p35

Figura 11-5

Cdk/25

Sistema colinérgico

Placas seniles

Muerte neuronal

Cascada de sucesos que finalmente resultaría en la degeneración neuronal en la enfermedad de Alzheimer. La explicación se proporciona en el texto. ROS, especies reactivas de oxígeno; Cdk, cinasa dependiente de ciclina; C-ter, terminal C de la proteína precursora amiloide; PKC, cinasa de proteína C; ERK, cinasa reguladora de señal extracelular; RTK, receptor cinasa de tirosina.

www.FreeLibros.me


140

Capítulo 11

Terapia génica en enfermedades neurodegenerativas

Por otro lado, diversas mutaciones en el gen de las presenilinas producen un incremento en la formación del péptido β-A conocido para poseer propiedades altamente tóxicas. Sin embargo, el β-A activa el proceso inflamatorio a través de un aumento en la secreción de citocinas proinflamatorias, como la interleucina 1 (IL-1), la IL-6 y el factor de necrosis tumoral α (TNF-α) (Apelt y Schliebs, 2001). También se ha observado que los pacientes que portan el alelo ε (épsilon) 4 (E4) de la apolipoproteína E (ApoE) poseen un alto riesgo para adquirir la EA, comparado con los individuos homocigotos del alelo E1, ya que la presencia de la ApoE incrementa la densidad de las plaquetas de β-A y depósitos vasculares (Saunders, 2000). Por otra parte, en la EA los elementos citoesqueléticos, como la proteína τ (tau) y los neurofilamentos, se transforman en filamentos helicoidales e insolubles, un proceso asociado a la hiperfosforilación de la proteína τ por diversas cinasas de proteínas, como la cinasa CaM II, cinasas de proteína A, ERK2, GSK3, ciclina dependiente de la cinasa 5 (cdk5)/p35. En cambio, la hipofosforilación de la τ reduce la habilidad de unirse a los microtúbulos y promover su ensamblaje, lo que permite interferir con el transporte axonal, la agregación y depósito citoplásmico de los neurofilamentos y por último la muerte celular. Así, la patología de la proteína τ también resulta importante en diversas enfermedades mentales, como la de Pick, parálisis supranuclear progresiva, degeneración corticobasal, la demencia frontotemporal y la de Parkinson ligada al cromosoma 17 (Buée et al., 2000).

Modelos de estudio El conocimiento de las mutaciones en los genes para el PPA y las presenilinas para producir enfermedades, así como la disponibilidad de técnicas para insertar genes humanos únicos a roedores, ha permitido la producción de animales transgénicos para estimular la amiloidogénesis. En este sentido hay diversos modelos de estudio para inducir la producción de β-A, como: la inserción de un cromosoma artificial que contiene una mutación en gen del PPA a nivel del aminoácido 670/671 típico de una mutante originaria de Suecia, o del 717 de origen londinense, que produce un incremento del β-A y reduce la secreción del sPPA-α; el ratón transgénico que contiene el gen londinense regulado por el promotor del factor de crecimiento derivado de plaquetas desarrollado por Games y col. (1995); el ratón transgénico desarrollado que contiene el promotor específico para neuronas Tir-1 y que se ha utilizado para expresar la doble mutación del PPA de origen sueco. Estos modelos transgénicos se usan por lo general como herramientas apropiadas para el estudio de los mecanismos de inducción de la EA y

también podrían permitir el desarrollo de estrategias para interferir con el proceso esencial para la formación o progresión de la EA. Aun cuando en el último decenio se ha incrementado de manera sustancial el conocimiento sobre la EA, su patogenia no se ha comprendido del todo. En la figura 11-5 se resumen algunos factores tentativos que contribuyen en ésta. Así, en las estrategias para intervenir en la transmisión colinérgica con las secretasas β y γ, prevenir la formación o agregación de β-A por antioxidantes, el tratamiento con antiinflamatorios, interferencia en la cascada de hiperfosforilación de la proteína τ, así como de neuroprotección constituyen alternativas terapéuticas o preventivas para la EA.

MODELOS DE TERAPIA GÉNICA EN ENFERMEDADES NEURODEGENERATIVAS El origen de diversas enfermedades neurodegenerativas se ha identificado en los últimos años. De esta manera, el tratamiento de trastornos del sistema nervioso central, en particular los que implican pérdida de neuronas, ha sido posible enfocarlo mediante estrategias de terapia celular y con terapia de genes tanto in vivo como en ex vivo, así con células progenitoras de origen neuronal derivadas del SNC, utilizando factores de crecimiento para el estudio de diversos fenómenos de linaje y diferenciación celular, así como sus propiedades biológicas en presencia del SNC adulto, por lo que las células progenitoras o modificadas genéticamente que pueden ser trasplantadas en regiones específicas de cerebro representan una estrategia prometedora para liberar y expresar factores neurotróficos específicos, enzimas que sintetizan diversos neurotransmisores y proteínas reguladoras que participan en las enfermedades neurodegenerativas. También, el uso de promotores de regulación específica puede ser un potencial control de expresión de genes que se les requiera en dosis y tiempo en estas estrategias terapéuticas. No obstante, en los últimos cinco años ha habido un avance extraordinario tanto en la ideación de estrategias y modelos de investigación para la transferencia, implantación y expresión de genes como la posibilidad de su aplicación en la parte preclínica y clínica; todavía hay diversos aspectos secundarios no deseados, reproducibilidad y sobre todo el esclarecimiento de las bases biológicas de la neurodegeneración que deben ser resueltos y refinarse antes de su aplicación definitiva. En el cuadro 11-5 se muestra un condensado de los modelos y estrategias más recientes, así como su posible aplicación en la solución de diversas enfermedades neurodegenerativas.

www.FreeLibros.me


Modelos de terapia génica en enfermedades neurodegenerativas

Cuadro 11-5

141

Modelos de estudio en perspectiva de terapia génica para diversas enfermedades neurodegenerativas

Tipo de enfermedad

Posibles genes deficientes

Efectos

Modelos de estudio

Referencias

Esclerosis lateral amiotrófica

Factor neurotrófico derivado de la neuroglia (GDNF) y el ciliar (CNF), IGF-1, Bcl-2, Bcl-xL

Neuronas DAérgicas y motoras

Implantación de mioblastos con vector adenoviral con gen para GDNF y CNF

Bohn et al., 2000 Aebischer et al., 1996; Maimone et al., 2001

Mucopolisacaridosis tipo VII

β-Glucuronidasa

Anormalidad en órganos periféricos y SNC

Implantación de microcápsulas intraventrículo lateral

Ross et al., 2000

Huntington

Desconocido Factores neurotróficos: ciliar (CNF), derivado del cerebro (GDNF), crecimiento (NWF)

Neuronas GABAérgicas de estriado

Implante intraventricular de microcápsulas con células productoras de CNF; adenovirus con GDNF, NWF

Bachoud-Levi et al., 2000; Bemelmans et al., 1999; Kordower et al., 1999

Parkinson

Desconocido; sinucleína α; parkina ubiquitina carboxiterminal hidrolasaL1; descarboxilasa de aminoácidos aromáticos (DAA), hidroxilasa de tirosina (TH), receptor D2,

Pérdida de neuronas DAérgicas en estriado

Inyección de adenovirus con el gen de: GDNF, DAA, TH, R-D2, dismutasa de superóxido, neurotrofina 3, ciclohidrolasa 1 de GTP, Bcl-2

Connor et al., 1999; Leff et al., 1999; Xu et al., 1998; Ikari, et al., 1999; Barkats et al., 1998; Kang, 1998; Offen et al., 1998; Maimone et al., 2001.

Canavan

Aspartoacilasa (ASPA)

Aumento de ácido N-acetilaspártico en SNC con retraso mental y muerte

Ratón deficiente (knock out) en ASPA Adenovirus con ASPA recombinante en cápsulas policatiónicas condensadas

Matalon et al., 2000. Leone et al., 2000

Alzheimer

Desconocido Proteína amiloide β, y su precursora; secretasas τ

Pérdida de neuronas colinérgicas de los núcleos basales de Mayner

Implantación de fibroblastos con adenovirus que transporta factor de crecimiento nervioso, ApoE

Blesch y Tuszynsksi, 1995; Baum et al., 2000

BIBLIOGRAFÍA Apelt J, Schliebs R. Beta-amyloid-induced glial expression of both pro- and anti-inflammatory cytokines in cerebral cortex of aged transgenic Tg2576 mice with Alzheimer plaque pathology. Brain Res, 2000;894(1):21-30. Brown RH Jr, Robberecht W. Amyotrophic lateral sclerosis: pathogenesis. Semin Neurol, 2001;21(2):131-139. Buée L, Bussière T, Buée-Scherrer V, Delacourte A, Hof PR.Tau protein isoforms, phosphorylation and role in neurodegenerative disorders. Brain Res Brain Res Rev. 2000;33(1):95130. Review. Chase TN, Oh JD. Striatal mechanisms and pathogenesis of parkinsonian signs and motor complications. Ann Neurol, 2000;47(4 Suppl. 1):S122-9;discussion S129-30. Review.

Chaparro HV, Beas ZC, Guerrero MU, Feria VA. Nitric oxide involvement in regulating the dopamine transport in the striatal region of rat brain. Neurochem Int, 1997;31(4):607-616. DiFiglia M, Sapp E, Chase KO, Davies SW, Bates GP, Vonsattel JP, Aronin N. Aggregation of huntingtin in neuronal intranuclear inclusions and dystrophic neurites in brain. Science, 1997;277(5334):1990-1993. Games D, Adams D, Alessandrini R, Barbour R, Berthelette P, Blackwell C, Carr T, Clemens J, Donaldson T, Gillespie F et al. Alzheimer-type neuropathology in transgenic mice overexpressing V717F beta-amyloid precursor protein. Nature, 1995;373(6514):523-527.

www.FreeLibros.me


142

Capítulo 11

Terapia génica en enfermedades neurodegenerativas

Gu M, Gash MT, Mann VM, Javoy AF, Cooper JM, Schapira AH. Mitochondrial defect in Huntington’s disease caudate nucleus. Ann Neurol, 1996;39(3):385-389. Hardy J. Genetic dissection of primary neurodegenerative diseases. Biochem Soc Symp, 2001;(67):51-7. Review. Haass C, De Strooper B. The presenilins in Alzheimer’s disease —proteolysis holds the key. Science. 1999;286(5441):916-9. Review. Hirsch EC, Périer C, Orieux G, François C, Féger J, Yelnik J, Vila M, Levy R, Tolosa ES, Marin C, Trinidad Herrero M, Obeso JA, Agid Y. Metabolic effects of nigrostriatal denervation in basal ganglia. Trends Neurosci, 2000;23(10 Suppl.):S78-85. Review. Hoyer S. Brain glucose and energy metabolism abnormalities in sporadic Alzheimer disease. Causes and consequences: an update. Exp Gerontol, 2000;35(9-10):1363-1372. Review. Juneja T, Pericak VMA, Laing NG, Dave S, Siddique T. Prognosis in familial amyotrophic lateral sclerosis: progression and survival in patients with glu100gly and ala4val mutations in Cu,Zn superoxide dismutase. Neurology, 1997;48:55-57. Kowall NW, Kosik KS. Axonal disruption and aberrant localization of tau protein characterize the neurophil pathology of Alzheimer’s disease. Ann Neurol, 1987;22(5):639-643. Maimone D, Dominici R, Grimaldi LM. Pharmacogenomics of neurodegenerative diseases. Eur J Pharmacol, 2001;413(1):11-29. Review Margolis RL, Ross CA. Diagnosis of Huntington disease. Clin Chem, 2003;49(10):1726-32. Review. Margolis RL, Ross CA. Expansion explosion: new clues to the pathogenesis of repeat expansion neurodegenerative diseases. Trends Mol Med, 2001;7(11):479-482. McGeer PL. Cyclo-oxygenase-2 inhibitors: rationale and therapeutic potential for Alzheimer’s disease. Drugs Aging, 2000a;17(1):1-11. Review. McGeer PL, McGeer EG, Yasojima K. Alzheimer disease and neuroinflammation. J Neural Transm Suppl, 2000;59:53-57. Oliveri RL, Annesi G, Zappia M, Civitelli D, Montesanti R, Branca D, Nicoletti G, Spadafora P, Pasqua AA, Cittadella R, An-

dreoli V, Gambardella A, Aguglia U, Quattrone A. Dopamine D2 receptor gene polymorphism and the risk of levodopainduced dyskinesias in PD. Neurology, 1999;22;53(7):14251430. Ridet JL, Corti O, Pencalet P, Hanoun N, Hamon M, Philippon J, Mallet J. Toward autologous ex vivo gene therapy for the central nervous system with human adult astrocytes. Hum Gene Ther, 1999;20;10(2):271-280. Ross CJD, Ralph M, Chang PL. Delivery of recombinant gene products to the central nervous system with nonautologous cells in alginate microcapsules. Hum Gene Ther, 1999;10:49–59. Ross CA, Margolis RL, Reading SA, Pletnikov M, Coyle JT. Neurobiology of schizophrenia. Neuron, 2006;52(1):139-153. Review. Saunders AM. Apolipoprotein E and Alzheimer disease: an update on genetic and functional analyses. J Neuropathol Exp Neurol, 2000;59(9):751-758. Review. Schenk D. Alzheimer’s disease. A partner for presenilin. Nature, 2000;407(6800):34-35. Sinha S, Lieberburg I. Cellular mechanisms of beta-amyloid production and secretion. Proc Natl Acad Sci USA, 1999; 96(20):11049-11053. Review. Selkoe DJ. The genetics and molecular pathology of Alzheimer’s disease: roles of amyloid and the presenilins. Neurol Clin, 2000;18(4):903-922. Review. Selkoe DJ. Notch and presenilins in vertebrates and invertebrates: implications for neuronal development and degeneration. Curr Opin Neurobiol, 2000b;10(1):50-57. Review. Tan CB, Lam HS, Jinkins JR. Clinics in diagnostic imaging (47). Huntington’s disease. Singapore Med J, 2000a;41(3):135138. Tan EK, Khajavi M, Thornby JI, Nagamitsu S, Jankovic J, Ashizawa T. Variability and validity of polymorphism association studies in Parkinson’s disease. Neurology, 2000b;55(4):533538. Tan EK, Jankovic J, Ondo W. Bruxism in Huntington’s disease. Mov Disord, 2000c;15(1):171-173.

www.FreeLibros.me


Capítulo

12

Neuroinmunorregulación Dr. Óscar Kurt Bitzer Quintero Dra. Airam Jenny Dávalos Marín

INTRODUCCIÓN

ANTECEDENTES

La biología molecular representa una herramienta clave en el estudio y comprensión de la neuroinmunorregulación, ya que interviene en una amplia gama de procesos biológico-moleculares, en donde hay mediadores que participan en la comunicación entre el sistema nervioso central (SNC) y el sistema inmunológico (SI), proceso bidireccional regulado por el eje hipotálamo-hipófisisadrenales. Hay múltiples conexiones anatómicas y fisiológicas entre el SNC y el SI, las cuales incluyen el “cableado” del sistema nervioso autónomo (SNA) a través de la estimulación del nervio vago y fibras nerviosas simpáticas hacia órganos del SI, como bazo, médula ósea, timo y ganglios linfáticos, aparato gastrointestinal y piel.1 Los dos sistemas (SNC y SI) comparten múltiples mensajeros químicos, que incluyen desde pequeñas moléculas como el factor liberador de corticotropina (CRF) hasta grandes proteínas, como citocinas, neurotransmisores, neuropéptidos y factores de crecimiento.1-3 El SI envía señales hacia el cerebro para responder al daño causado por virus, bacterias y parásitos por medio de un elaborado sistema de información bidireccional. La relación entre el cerebro y el SI se realiza a través de la barrera hematoencefálica (BHE), la cual funciona como un “filtro” de moléculas solubles entre ambos sistemas.2,3

La interacción entre el sistema inmunológico, el sistema endocrino y el sistema nervioso fue descubierta por Hans Selye en la Universidad de McGill a mediados del decenio de 1930. Selye demostró que ciertos estímulos de tipo físico, químico, biológico y emocional, administrados a las ratas, eran capaces de activar el eje hipotálamo-hipófisisadrenales (fig. 12-1).4 Para muchos de los científicos precursores en el campo de la psiconeuroinmunología (PNI) ha representado un reto convencer a los inmunólogos tradicionalistas y a los neurocientíficos que la PNI es una ciencia real y que ha mostrado avances impresionantes en los últimos 20 años, ayudando a comprender las complejas interacciones entre estos sistemas.5 La comunicación entre estos sistemas (el SNC y el SI) incluye un flujo recíproco de información, en donde las citocinas liberadas por macrófagos activados y por monocitos durante procesos infecciosos tienen como “blanco neural” la regulación de la termogénesis, los cambios en el comportamiento, el sueño, cambios de estados de ánimo, entre otros.6 Dentro del sistema nervioso central, se ha podido detectar la producción de citocinas como resultado de daño en el cerebro, durante infecciones virales y bacterianas y en procesos neurodegenerativos.6,7 143

www.FreeLibros.me


144

Capítulo 12

Neuroinmunorregulación Luz retina

Opioides Endorfinas Encefalinas

G. pineal melatonina

Hipotálamo

Simpática

Simpática

Tiroides

as rfin

do En

Simpática

Hipófisis anterior

Células T Tejido onas linfoide Horm as tímic a es l n uli ua Islotes Ins sex s Gónadas na o m or Adrenales H

Co rt Ca icoe tec ste ola roi mi des na s

Timo

Metencefalina/leuencefalina

Figura 12-1

Eje hipotálamo-hipófisis-adrenales.

El SI envía señales hacia el cerebro para responder al daño causado por virus, bacterias y parásitos por medio de un elaborado sistema de información bidireccional. La relación entre el cerebro y el SI se realiza mediante una “ventana” en la barrera hematoencefálica; está constituida por los órganos circunventriculares, que incluyen a la glándula pineal, el órgano subfornical, la eminencia media, el lóbulo neural de la hipófisis, el área postrema, el órgano subcomisural y el órgano vasculoso de la lámina terminal.2,3 Los órganos circunventriculares permiten la transmisión de mediadores solubles liberados por el sistema inmunológico para arribar a sitios específicos en el hipotálamo así como en otras áreas del SNC (fig. 12-1).1 Las vías a través de los sistemas endocrino y nervioso autónomo (de manera primaria sistema nervioso simpático o SNA) permiten la llegada de moléculas biológicamente activas (hormonas, neurotransmisores, neuropéptidos y citocinas) que interactúan con células del SI (linfocitos, macrófagos, células epiteliales y células dendríticas, entre otras) a través de receptores en estas células inmunocompetentes.2,8,9 Los linfocitos T y B, los monocitos/macrófagos, los linfocitos citolíticos naturales y los granulocitos poseen

receptores para hormonas, neurotransmisores y neuropéptidos, entre los que se incluyen epinefrina (EPI), norepinefrina (NE), dopamina (DA), histamina, acetilcolina (Ach), sustancia P (SP), prostaglandinas (PG), somatostatina (SOM), péptido intestinal vasoactivo, prolactina (PRL), hormona de crecimiento (GH), corticosterona, testosterona, factor liberador de corticotropina (CRF), ACTH, péptidos opioides endógenos como endorfina β y hormona estimulante de los melanocitos α (α-MSH) entre otros.2 La interacción entre factores neuroendocrinos y sus receptores en células inmunocompetentes puede alterar la actividad celular a través de la activación de sistemas de segundos mensajeros que incluyen al AMPc.2 De manera alternativa, factores neuroendocrinos pueden regular respuestas inmunes, afectando la síntesis y liberación de ciertos mediadores, como linfocinas y monocinas.2 Además de la actividad del sistema nervioso simpático (SNS), el SI es influido por el sistema neuroendocrino a través del eje hipotálamo-hipófisis-adrenales (fig. 12-1). Aunque el CRF y la ACTH ejercen un efecto de tipo “regulador” directo sobre el SI, in vivo los mayores efectos se ejercen a través de interacciones con otras hormonas y productos del mismo SI, como es el caso de la urocortina, que es un neuropéptido relacionado con CRF; la urocortina participa en el control neural de funciones inmunes periféricas.2 El eje hipotálamo-hipófisis-adrenales se activa durante infecciones virales y bacterianas, lo que resulta en un importante incremento de los niveles hormonales (incluidos los glucocorticoides), de mediadores inmunológicos y de neuropéptidos y neurotransmisores.2,10,11 Aunque se ha demostrado un papel predominante del hipotálamo en las respuestas del SNC hacia el SI, se ha propuesto que estructuras límbicas y la neocorteza también pueden tener influencia sobre la respuesta inmune, se ha demostrado que ciertas lesiones (por lo general de sistema límbico) producen un aumento de una gran variedad de mediadores inmunológicos, por ejemplo, lesiones en la amígdala y en el hipocampo de la rata incrementan el número de timocitos.2,3 Un estímulo eléctrico por cuatro días directamente en el hipocampo aumenta el número de neutrófilos y el índice fagocítico, y al mismo tiempo reduce el número de linfocitos y los niveles circulantes de corticosterona en ratas.2,3 Lesiones con ácido caínico en el hipocampo aumentan la secreción de IgM e IgG en respuesta a una estimulación con ovoalbúmina.3 Las citocinas se han considerado mediadores de comunicación intracelular y extracelular;3 son potentes reguladores de los sistemas hipotalámicos neuropeptidérgicos que mantienen la homeostasia neuroendocrina y regulan respuestas al estrés.10-14 Una rápida inducción de citocinas, quimiocinas y PG es esencial para generar una potente respuesta por parte del SI.14 Dentro de las citocinas incluidas en este proceso se encuentran el

www.FreeLibros.me


Importancia de las citocinas en el mantenimiento y propagación de la respuesta inmunitaria en sistema nervioso central

TNF-α, las IL-1β, IL-6, IL-10, IL-12, IL-15, IL-17, IL-18, y los interferones (IFN) tipo I (IFN-α e IFN-β) y tipo II (IFN-γ) como potentes reguladores de respuestas en el sistema neuroendocrino,3,14 aunque en la actualidad se ha demostrado que el TNF-α, la IL-1β, la IL-6 y el IFN-γ son rápidamente inducidos en respuesta a procesos neuroinflamatorios.3,14,15 El proceso de inflamación dentro del SNC abarca una amplia variedad de procesos y vías de señalización. Las catecolaminas como NE y EPI están implicadas como importantes reguladores inmunológicos eferentes después de la exposición a un estresante o a daño.16 Las catecolaminas regulan un amplio margen de actividades de las células del SI, entre las que se encuentran la proliferación celular, producción de citocinas, producción y secreción de anticuerpos, actividades líticas y de migración celular, entre otras. Además, se ha detectado NE y EPI en linfocitos y en macrófagos (MQ) después de un estímulo de activación.16 Otro neurotransmisor que tiene efecto sobre el sistema inmunológico es la serotonina (5-HT); se ha demostrado que la activación del sistema serotoninérgico afecta la expresión de citocinas en el cerebelo de ratas, a través de la acción de corticosterona.17,18 En modelos experimentales agudos, se ha demostrado el efecto de las citocinas en los sistemas de neurotransmisión. La IL-1 puede activar sistemas noradrenérgicos y serotoninérgicos, reducir la liberación de Ach en el hipocampo y potenciar los efectos del ácido aminobutírico β (GABA).15-18 Por otro lado, la norepinefrina (NE) induce la liberación de IL-1-β desde neuronas hipotalámicas, en tanto que la Ach la inhibe. La NE induce además RNAm de IL-6 y la proteína en astrocitos de ratas.17,18 La 5-HT estimula la liberación de IL-1 en preparados frescos de cerebro de rata y regula la expresión de RNAm de IL-6 y de TNF-α en astrocitos hipocampales.18-20 Dentro del sistema nervioso, las citocinas son capaces de activar al eje hipotálamo-hipófisis-adrenales; entre las más destacadas se encuentran la IL-1β, IL-6, TNF-α y los IFN;20 TNF-α e IL-1β son inhibidores de glucocorticoides; esto provee un sistema de retroalimentación por citocinas en el proceso de activación del mismo eje hipotálamo-hipófisis-adrenales. Además, el IFN-γ muestra importantes efectos inhibidores sobre este eje, al parecer mediados por receptores opioides; se ha postulado también que hay relación entre IFN-α/IFN-γ y neurotoxicidad, dependiendo del metabolismo alterado del aminoácido triptófano (TRP). Esta vía está mediada por la inducción de la enzima indolamina-2,3-dioxigenasa (IDO), enzima catabolizante de TRP; las concentraciones de TRP se reducen a nivel plasmático; el TRP se cataboliza a través de la vía de las quinureninas hacia quinurenina y ácido quinolínico; este último está considerado como una potente neurotoxina causante de trastornos neurodegenerativos en el SNC.20 Las citocinas también exhiben sus efectos sobre el comportamiento; la IL-1β y el TNF-α muestran activida-

145

des “somnógenas”; estas dos citocinas junto con el IFN-γ son importantes inductores de anorexia (anorexígenas). La actividad locomotora se ve afectada por IL-1β e IFN-γ (IL-1 reduce la actividad exploradora de las ratas). Todas estas respuestas pueden ser mediadas por el factor liberador de corticotropina (CRF).19-21

IMPORTANCIA DE LAS CITOCINAS EN EL MANTENIMIENTO Y PROPAGACIÓN DE LA RESPUESTA INMUNITARIA EN SISTEMA NERVIOSO CENTRAL Durante un proceso de inflamación o daño en el SNC, la neuroglia es capaz de liberar citocinas a nivel central, lo que activa a nivel periférico al linfocito T CD4+ circulante, facilitando su entrada a través de la barrera hematoencefálica al SNC; el linfocito activo en SNC es capaz de liberar mediadores inmunes que participan en la neuroinflamación; durante este proceso, las citocinas periféricas penetran al cerebro a través de la barrera hematoencefálica por mecanismos de transporte activo o mediante estimulación del nervio vago;9 estas citocinas pueden regular mecanismos cognitivos a través de vías colinérgicas y dopaminérgicas.9 Los efectos de las citocinas en SNC dependen en gran manera del tipo de célula y de la presencia de receptores en la membrana expresados por macroglia, microglia y neuronas; en estas últimas se incluyen cambios en la entrada de calcio, liberación de neurotransmisores y procesos de plasticidad sináptica, contribuyendo a la viabilidad neuronal en el tejido dañado del cerebro como un mecanismo de protección. Las células de la neuroglia son la fuente principal de muchas citocinas dentro del SNC, además de ser células “blanco” para las mismas; tienen la capacidad de liberar una importante variedad de sustancias neuroactivas (a neurotrofinas y de factores de crecimiento que promueven la supervivencia neuronal) en respuesta a éstas. La microglia puede secretar sustancias potencialmente neurotóxicas, como es el caso del óxido nítrico, radicales libres de oxígeno (ROS), proteasas y aminoácidos excitadores, entre otros, favoreciendo la muerte neuronal.15 Como se ha mencionado, durante un proceso inflamatorio en el SNC, se liberan en grandes cantidades citocinas pro-inflat, TNF-β e IL-1β. Estas últimas rompen la BHE permitiendo la entrada de linfocitos CD4+ y de moléculas de adhesión hacia el SNC. Todos estos factores inducen edema vasogénico.15 Después de una infección por patógenos neurotróficos, por enfermedades autoinmunes o por procesos de neurotoxicidad, las células T auxiliares (Th) CD4+ son

www.FreeLibros.me


146

Capítulo 12

Neuroinmunorregulación

reclutadas desde la periferia para entrar al SNC donde son “reestimuladas” por los antígenos (Ag) expresados en las células presentadoras de antígenos (APC) locales. Las células T CD4+ (Th1) producen IL-2, IFN-γ y TNF-α, que promueven la inflamación, la activación de macrófagos (MQ) y la destrucción hística.22 Las células Th1 están implicadas en la eliminación de virus neurotróficos, en inmunopatologías de SNC inducidas por infecciones virales y en la patogenia de enfermedades autoinmunes de SNC, como esclerosis múltiple y encefalomielitis experimental autoinmune.22 La activación de células que secretan citocinas tipo Th2 (IL-4, IL-10, IL-13) con actividad antiinflamatoria ocurre durante infecciones y procesos de autoinmunidad en el SNC y juega un papel importante en la supresión de respuestas tipo Th1 y en la activación de MQ.22,23 Una vez que las células T CD4+ “marcadas” han cruzado el endotelio de la BHE e ingresado al SNC, su grado de activación y capacidad de polarización (intercambio entre Th1/Th2) es influido por el microambiente dentro del SNC ejercido por las citocinas.22,23 La síntesis de moléculas con actividad inmunosupresora (TGF-β), los neurolépticos, la ausencia o baja expresión de complejo principal de histocompatibilidad (MHC), las moléculas de adherencia o coestimuladoras del SNC y la eliminación de células T por apoptosis se han propuesto como mecanismos importantes que limitan, bloquean, o ambas cosas, con las respuestas inmunes mediadas por células dentro del SNC, razón por la cual se ha denominado al cerebro como un órgano “inmunológicamente privilegiado”.24-26 La microglia y los astrocitos representan dos poblaciones celulares altamente reactivas del SNC que responden a estímulos infecciosos e inflamatorios. La microglia es capaz de “evolucionar” hacia células tipo MQ capaces de expresar mediadores proinflamatorios (IL-1β, TNF-α), antiinflamatorios (IL10, TGF-β), PGE2, así como quimiocinas participantes en el reclutamiento de leucocitos.22 La sobrerregulación de moléculas MHC de clase II y de moléculas de adherencia/coestimuladoras (CD11a, CD40, CD54, CD80 y CD86) en la microglia activada durante el curso de enfermedades de SNC mediadas inmunológicamente sugiere que estas células pueden adquirir la función de células presentadoras de antígeno y jugar un importante papel en la “reestimulación” de las células T.22-24 Se ha determinado que existe una compleja red de interacciones entre la microglia, los astrocitos y las células T invasoras, que afecta el balance entre señales Th1/Th2 y determina la respuesta inmune dentro del SNC.22,23 En condiciones normales del SNC, la microglia no despliega actividad fagocítica o endocítica, y expresa niveles bajos de marcadores de activación (CD45, CD14, receptores Fc) y de moléculas MHC clase II. Las señales derivadas de las células T CD4+ preactivadas en la peri-

feria son cruciales para la activación de la microglia; el IFN-γ (liberado por linfocitos citolíticos naturales y células Th1) induce la expresión de moléculas MHC clase II en la microglia; esta citocina regula a su vez la expresión de moléculas de adhesión/coestimuladoras en cultivos de microglia de seres humanos y de ratones, e incrementa de manera considerable la capacidad de la misma citocina para sostener la activación de las células T dependiente del estímulo antigénico.22,27 Por otro lado, estudios recientes han demostrado que la microglia puede actuar como una muy eficiente APC por la reestimulación de las células Th1.26,27 Se ha encontrado que muchas de las moléculas expresadas por neuronas pueden regular el estímulo de activación basal de las células de la microglia in vivo. Las neuronas expresan el marcador CD200, en tanto que la microglia expresa CD200R. Cuando la expresión de CD200 se suprime en ratones deficientes, la microglia despliega un “fenotipo activado” (expresión elevada de CD45, de MHC clase II, y del receptor 3 del complemento) en ausencia de un estímulo patogénico, y despliega una muy rápida y potente activación en presencia de daño celular o de un estímulo patogénico,27 en donde datos recientes demuestran la participación de un nuevo receptor de microglia, el TREM-2 (triggering receptor expressed on myeloid cells-2). Su función está involucrada en el proceso de fagocitosis de la microglia y se requiere para la “limpieza” de desechos dentro del SNC.24,27 TREM-2 participa en la presentación de Ag en células dendríticas inmaduras y en la regulación de la producción de óxido nítrico por los macrófagos.27 La expresión microglial de TREM-2 es inducida como respuesta a cualquier señal neurodegenerativa temprana.27 Por otro lado, TREM-2 es uno de los genes altamente transcritos en la microglia en reposo no estimulada,25,27 que controla la función de principalmente tres tipos celulares derivados del linaje mieloide, las células dendríticas inmaduras, los osteoclastos y las células de la microglia (fig. 12-2). Específicamente en la microglia, TREM-2 regula la capacidad migratoria de ésta a través de la proteína adaptadora DAP12 y la tirosina de cinasa ERK. Esta activación por TREM2 induce cambios en la polimerización de actina y en la organización del citoesqueleto. La activación de TREM2 por Ac estimula la fagocitosis como una función “beneficiosa” de la microglia al conservar la homeostasia hística.24 La primera citocina liberada por la neuroglia en procesos de neuroinflamación es la IL-1β (fig. 12-3). La señal dependiente de la transducción de IL-1β se inicia por la asociación del ligando de IL-1R y de IL-1R-AcP a través de sus dominios extracelulares. El complejo activo de la IL-1R-AcP “recluta” a la cinasa IRAK, mediante la proteína adaptadora MyD88. Esta molécula no posee una porción transmembrana, pero presenta dominios de muerte

www.FreeLibros.me


Importancia de las citocinas en el mantenimiento y propagación de la respuesta inmunitaria en sistema nervioso central

147

Expresión TREM-2

Osteoclasto

Célula madre hematopoyética

Microglia activada

Microglia

Progenitor mieloide

Célula dendrítica inmadura

Célula dendrítica madura

Macrófago

Granulocito

Figura 12-2

Expresión microglial de TREM-2 inducida por señales neurodegenerativas.

en su porción aminoterminal. El dominio carboxiloterminal de esta proteína presenta una hemoglobina alta con los segmentos citoplásmicos de la familia de los receptores de la IL-1. Luego, IRAK se fosforila, se disocia del complejo del receptor e interactúa con TRAF-6, el cual libera la señal de 2 IK-B-cinasas (IKK-1 e IKK-2) vía NIK, y se activa el factor de transcripción NF-κB. De manera similar, la IL-18 se une al IL-1Rrp e induce la activación de IRAK, TRAF-6, NF-κB y JNK en las células Th1 (fig. 12-3).12 El NF-κB es un activador transcripcional de las citocinas incluidas en la respuesta inmune innata, TNF-α, IL-1 e IL-6, entre otras (fig. 12-4);14,17 además de que muestra importantes funciones a nivel de respuesta inmune adaptativa17 y en las respuestas de tipo inflamatorias como la inducida por el LPS bacteriano.19 La respuesta inmune innata se lleva a cabo a través de un sistema de reconocimiento específico (MHC); en la interacción entre el LPS, el receptor de membrana CD14 y el receptor tipo TOLL 4 (TLR4)13,15 se expresan de manera constitutiva en órganos circunventriculares, plexos coroideos y leptomeninges. El LPS circulante es capaz de evocar una rápida activación transcripcional de genes que codifican para CD14 y para TLR4, así como para una amplia gama de moléculas proinflamatorias dentro de los órganos circunventriculares.15,16 El LPS, así como otros PAMP, es reconocido por una clase de receptores denominados “receptores tipo TOLL” o TLR;17-19 mediante la proteína sérica LBP, el LPS se une al receptor CD14 en la membrana de la célula, el cual

IL-1 IL-1R

AcP

MyD88

DD IRAK

TRAF6

NIK IKK

NF-κB

Figura 12-3

Vía de señalización de IL-1β en la neuroglia en procesos de neuroinflamación.

presenta a la molécula de LPS al receptor TLR4, que es el encargado de llevar la señal hacia el interior de la célula (fig. 12-4).

www.FreeLibros.me


148

Capítulo 12

Neuroinmunorregulación LPS TLR4 Md2 Activa Dominio-TIR

Cd14 Membrana plasmática

MyD88

IRAK-1

TOLLIP

TRAF-6

TAK-1 TAB 1-2 (proteínas unidoras de TAK-1) Libera

p50 p65 NFκB

IκB Translocación a núcleo

NFκB p50 c-fos

p65 c-jun

Núcleo

Figura 12-4

Citocinas proinflamatorias Moléculas de adherencia

Reacción inflamatoria generalizada

Óxido nítrico

NF-κB como activador transcripcional de genes de citocinas proinflamatorias.

En la superficie celular se agregan TLR4, CD14 y MD2; esto conduce a la activación de la vía de señalización de complejos intracelulares, donde se incluye MyD88 (factor de diferenciación mieloide), TIRAP (proteína adaptadora que contiene un dominio TOLL/IL-1) y TOLLIP (proteína interactuante de TOLL); la fosforilación de IRAK-1(cinasa asociada al receptor de IL-1) recluta a TRAF-6 (factor 6 asociado al receptor de TNF); se forma un complejo entre TRAF-6, TAB 1-2 (proteínas unidoras de TAK-1) y TAK-1 (cinasa activada 1); este complejo es activado por IRAK-1 y por TOLLIP. Esta activación del complejo mencionado fosforila al NF-κB/IκB lo que libera al IκB permitiendo que el factor de transcripción se transloque al núcleo y se transcriban los genes que codifican para citocinas proinflamatorias (fig. 12-4). Todos los TLR tienen la capacidad de activar vías de señalización similares a las activadas por la IL-1. El receptor tipo I de la IL-1 presenta el mismo dominio de homología TOLL/IL-1R capaz de interactuar con MyD88 (fig. 12-4), la proteína adaptadora que es reclutada después de la activación de IL-1R o de receptores TLR. Esto induce la activación de la vía de señalización dependiente de NF-κB y la activación transcripcional de genes de citocinas (IL-1, IL-2, IL-6, TNF-α, LT-β, LT-α, GM-CSF), de moléculas de adhesión intracelular (VCAM, ICAM, ELAM), de proteínas de fase aguda, de enzimas inducibles (iNOS, COX2), entre otras moléculas.15,18,20 El sistema de inmunidad innata del cerebro se encuentra bajo el control de una amplia gama de moléculas

mediadoras; el LPS activa a las células inmunes en la periferia para que secreten citocinas; una vez presentes en el torrente sanguíneo, éstas pueden mediar ciertos efectos a nivel central como la fiebre (provocando un incremento en la temperatura corporal directamente sobre centros hipotalámicos), y activando el eje hipotálamo-hipófisisadrenales.15 Se ha demostrado que el LPS cuenta con un receptor endógeno (CD14) dentro del cerebro, en zonas donde es compartida la circulación general (órganos circunventriculares); su administración general activa la transcripción del gen de CD14 en células de la microglia a través del parénquima cerebral.15 Durante la endotoxemia grave, se lleva a cabo la interacción entre LPS y CD14 en los órganos circunventriculares, en los que se observa una rápida transcripción de los genes de citocinas proinflamatorias: primero dentro de dichos órganos y después a través de todo el parénquima cerebral.15

Interleucina 1 La IL-1β se considera como la citocina proinflamatoria más importante que se expresa en el cerebro durante procesos inflamatorios localizados y generales.15,17,21-23 La familia de la IL-1 consiste en tres diferentes genes localizados en el brazo largo del cromosoma 2 en seres humanos, que codifican para tres distintas proteínas con cierto grado de homología estructural. IL-1α e IL-1β actúan como moléculas agonistas opuestas al tercer

www.FreeLibros.me


Importancia de las citocinas en el mantenimiento y propagaciĂłn de la respuesta inmunitaria en sistema nervioso central

miembro de la familia, el receptor antagonista de IL-1 o IL-1Ra, que se une a los mismos receptores que los dos tipos de IL-1, pero no induce una seĂąal intracelular y por tanto actĂşa como un inhibidor endĂłgeno de la actividad de IL-1.21,22 IL-1Îą e IL-1β exhiben diferentes mecanismos de expresiĂłn, sĂ­ntesis y secreciĂłn. El gen de IL-1Îą no contiene las secuencias correspondientes a la iniciaciĂłn clĂĄsica de la transcripciĂłn, como la “caja TATAâ€?, en tanto que en el gen de la IL-1β sĂ­ es posible encontrar esta secuencia.21 La transcripciĂłn del gen de IL-1β estĂĄ controlada por regiones promotoras que contienen elementos de respuesta a AMPc (CRE); contiene NF-IL-6, un elemento que responde al estĂ­mulo del LPS, elementos anĂĄlogos al factor de transcripciĂłn NF-ÎşB, entre otros sitios de uniĂłn.21 Esto explica la capacidad de los monocitos de sangre perifĂŠrica para sintetizar IL-1β en respuesta a muy bajas concentraciones de LPS, aunque el gen de esta interleucina no es expresado de manera constitutiva por estas cĂŠlulas.21 Las IL-1Îą, IL-1β e IL-1Ra comparten los mismos tipos de receptores, denominados receptor tipo 1 de IL-1 (IL-1RI), receptor tipo II de IL-1 (IL-1RII) y la proteĂ­na accesoria del receptor a IL-1 (IL-1R-AcP). La uniĂłn de la IL-1β a su receptor tipo I induce la formaciĂłn del complejo IRAK/TRAF6; este complejo “reclutaâ€? a la proteĂ­na adaptadora MyD88 y activa a las cinasas NIK/IKK, lo que conduce a la fosforilaciĂłn y degradaciĂłn del IÎşB; luego el NF-ÎşB es translocado al nĂşcleo y se une a sus secuencias consenso ÎşB en los genes “blancoâ€?.21

TNF-đ?›‚ El TNF-Îą es una citocina proinamatoria, pleiotrĂłpica, originalmente reconocida por su potente actividad antitumoral; es sintetizada por neutrĂłďŹ los, monocitos/ macrĂłfagos activados, linfocitos T, linfocitos B, astrocitos, mastocitos, cĂŠlulas endoteliales, cĂŠlulas de mĂşsculo liso, cĂŠlulas sinoviales, cĂŠlulas ependimarias cerebrales y cĂŠlulas de la microglia.15,21 La uniĂłn del TNF-Îą a su receptor de reconocimiento lleva a la formaciĂłn de un complejo denominado TRADD (dominio de muerte asociado a TNF-R1)/TRAF2; este complejo activa al NF-ÎşB y a la cascada de sucesos de seĂąalizaciĂłn generada por ĂŠste (ďŹ g. 12-5). La proteĂ­na de dominio de muerte asociada a Fas (FADD/MORT1), TRAF2 y la proteĂ­na que interactĂşa con el receptor de cinasa del dominio de muerte (RIP) son reclutadas y pueden actuar directamente con TRADD (ďŹ g. 12-5).21 El complejo FAAD/MORT1 es esencial en el proceso de apoptosis inducida por TNF; RIP y TRAFF2 son molĂŠculas clave en el proceso de activaciĂłn del NF-ÎşB y cinasa de c-jun N terminal (JNK). Este reclutamiento conduce a la activaciĂłn de la cinasa de proteĂ­na IKK (compuesta

149

TNF TNF/R1 (p55)

Membrana celular

DD DD FADD

TRADD

DD

TRADD

TRADD

RIP

TRAF2 C-IAP1

Pro-caspasa 8

TRAF1

NF-ÎşB

Apoptosis

Figura 12-5

C-IAP2

Cinasas MAP

Cascada de eventos de seĂąalizaciĂłn generados por la uniĂłn del TNF-Îą a su receptor de reconocimiento.

por dos subunidades catalĂ­ticas, IKK-Îą e IKK-β y por una subunidad reguladora IKK-Îł/NEMO (subunidad proteĂ­nica reguladora). IKK-Îł/NEMO se requiere para la activaciĂłn del NF-ÎşB por el TNF-Îą, aunque sĂłlo la subunidad catalĂ­tica IKK-β es esencial para activar el estĂ­mulo del NF-ÎşB en respuesta a la citocina. El NF-ÎşB “libreâ€? es ahora translocado al nĂşcleo para activar genes “blancoâ€? proinamatorios (ďŹ g. 12-6).21 Una de las funciones mejor caracterizadas del TNF-Îą es la de estimular el reclutamiento de monocitos y neutrĂłďŹ los al sitio de la infecciĂłn y activar a estas cĂŠlulas de una manera paracrina para eliminar el material extraĂąo (antĂ­genos). El mecanismo por el cual funciona el TNF abarca miembros de la familia de las quimiocinas como la proteĂ­na 1 quimiotactante de monocitos (MCP-1), y el proceso transcripcional se encuentra bajo el control directo de la cascada previamente seĂąalada que incluye TRADD/TRAF2/RIP/IKK/NF-ÎşB, induciendo cambios endocrinos, incremento de ďŹ ebre y activaciĂłn del eje hipotĂĄlamo-hipĂłďŹ sis-adrenales.21

Interleucina 6 La IL-6 estĂĄ considerada como una citocina pleiotrĂłpica incluida en la regulaciĂłn de funciones inmunes como la diferenciaciĂłn de cĂŠlulas B, de cĂŠlulas T citotĂłxicas, la producciĂłn de IL-2, la expresiĂłn del receptor de IL-2 en las cĂŠlulas T, crecimiento de cĂŠlulas T, hematopoyesis y en reacciones de fase aguda.15,21

www.FreeLibros.me


150

Capítulo 12

Neuroinmunorregulación

LPS

TNF

TNF TNF-R1

MyD88

MEKK1

TRADD RIP

CD14 TLR4 IRAK

ATP

TRAF2 P65

P65

P65 P50

P50

P50 P65 P50

Núcleo

Figura 12-6

P50 P65

Genes blanco

Esquema comparativo entre la vía de señalización del TNF-α y de LPS.

Esta citocina participa en la síntesis de proteínas de fase aguda (APP); su RNAm se ha encontrado en poblaciones celulares específicas del SNC. La administración intraperitoneal o intravenosa de LPS provoca una rápida activación transcripcional del gen de IL-6 en áreas como los plexos coroideos y los órganos circunventriculares, estructuras que carecen de barrera hematoencefálica; esto aporta datos de que la IL-6 puede ser secretada dentro del líquido cefalorraquídeo.21 El primer paso para la inducción de la transducción de señales por la IL-6 es la unión del ligando a su subunidad receptora, la IL-6R, localizada en la superficie celular o presente como factor soluble. La asociación entre IL-6 e IL-6R con las subunidades de membrana gp130 forma un complejo de alta afinidad que inicia la transducción específica de señales hacia el núcleo (fig. 12-7).21 La proteína gp130 no sólo funciona como una señal de transducción para IL-6, sino que además está asociada con el factor neurotrófico ciliar (CNTF), con el factor inhibidor de la leucemia (LIF), con la oncostatina M (OSM), y con la IL-11.21 Como se ha mencionado, en la primera fase de transducción de señales por la IL-6, ésta se une a su receptor, la IL-6R; el complejo IL-6/IL-6R se une a la subunidad de membrana gp130, formando a su vez un complejo de alta afinidad que inicia la transducción de señales hacia el interior de la célula. Existen tres miembros de la familia de las cinasas Janus cercanamente relacionados con gp130, la JAK1, la JAK2 y la TYK2, que se activan en

Citocina

Receptor de citocina

JAK

JAK

STAT

Y

STAT

STAT

Y

P Y

P

Núcleo

STAT

P Y Y P

STAT

Transcripción

Figura 12-7

www.FreeLibros.me

Esquematización de la vía de señalización utilizada por IL-6 y por IFN-γ.


Importancia de las citocinas en el mantenimiento y propagación de la respuesta inmunitaria en sistema nervioso central

presencia de IL-6; estas cinasas fosforilan residuos de tirosina de los dominios citoplásmicos de gp130, lo que conduce al “reclutamiento” y fosforilación de al menos dos factores de transcripción que activan a dos miembros de la familia de las proteínas STAT, STAT1 y STAT3, y de una fosfatasa de tirosina, la SHP-2. Una vez activadas las proteínas STAT, son capaces de activar diferentes genes en combinación con sus dominios SH2 para formar homodímeros. La SHP-2 es capaz de activar a la proteína de membrana Ras, lo que induce la expresión de las cinasas MAP ERK1 y ERK2. Hay dos vías que relacionan a SHP-2 y Ras: la primera utiliza a la proteína adaptadora Gab1, que se asocia con la cinasa de IP-3; la segunda es a través del complejo Grb2/SOS. La activación de las cinasas MAP lleva a la inducción de proteínas nucleares, como NF-IL-6, APRE, EBS, CRE, TRE, entre otras.21 Las células que conforman la barrera hematoencefálica se encuentran en una posición privilegiada para transmitir información desde la circulación periférica hacia el parénquima cerebral, induciendo fenómenos moleculares que tienen lugar en el endotelio de las arteriolas cerebrales, en capilares pequeños y en vénulas durante un “ataque” inmunológico general; cuando las citocinas son secretadas por células mieloides en la circulación periférica activan una serie de sucesos en forma de cascadas que llevan a vías de transducción de señales a través de cinasas MAP, de NF-κB o de JAK/STAT en el interior de células asociadas a la vasculatura del SNC.21,22-24 En respuesta a diferentes estímulos de tipo inflamatorio, como el generado por el LPS, es posible detectar una importante activación de NF-κB en los capilares del endotelio del cerebro. La administración general de LPS, de IL-1β o de TNF-α provoca una rápida expresión de novo de RNAm de IκB (indica actividad del NF-κB) en el endotelio de los vasos sanguíneos cerebrales y en las células de la microglia parenquimatosa; entre los genes que este factor puede transcribir se encuentra el gen que codifica para COX2; la transcripción de COX2 por NF-κB puede responder a diferentes ligandos inmunógenos como TNF-α e IL-1β.21 La activación del endotelio cerebral ocurre en respuesta al LPS circulante; las células del endotelio del cerebro no expresan CD14 en su superficie, pero responden al estímulo del complejo LPS/LBP a través de receptores solubles, estimulando la fosforilación de cinasas MAP. La expresión del gen COX2 en la microvasculatura cerebral induce la producción de prostaglandinas (PG).21-23

Apoptosis en sistema nervioso central La apoptosis es un mecanismo de muerte celular evolutivamente conservado dependiente de energía que requiere de la regulación de complejos programas genéticos.28 A través de la apoptosis, los organismos lisan células que han perdido su función o que no funcionan de mane-

151

ra apropiada, o de células que han completado su ciclo de vida.29 La apoptosis ocurre en células en las que existe daño en el DNA, causado por radiación, quimioterapia citotóxica, células que sufren por ablación hormonal o por privación de citocinas.28,29 El proceso de muerte celular activa puede dividirse en tres fases: 1. Fase de iniciación. 2. Fase efectora. 3. Fase de degradación. Hay numerosos estímulos capaces de inducir la apoptosis, entre los que se incluyen activadores fisiológicos como TNF-α, ligando de Fas, calcio, choque térmico, especies reactivas de oxígeno (ROS), células T citotóxicas, p53, y estados de sepsis, entre otros.28-30 La apoptosis y la necrosis representan dos tipos distintos de muerte celular. La apoptosis se ha definido como un proceso con tiempos definidos en el que se observan cambios morfológicos en el citoplasma, condensación de la cromatina, fragmentación nuclear, pérdida de la adherencia celular y rotura de la pared celular; en contraste con la necrosis, donde no es posible apreciar los cambios celulares morfológicos característicos de la apoptosis y donde, en la necrosis, el proceso ocurre muy rápido después de la lesión inicial,31 aunque la apoptosis y la necrosis pueden compartir algunos mediadores comunes, por ejemplo bajos niveles en la sobreactivación del receptor a glutamato pueden activar ambas vías. La concentración intracelular de ATP puede ser un elemento indispensable en la selección de la vía de muerte celular; una concentración alta de ATP favorece la apoptosis, en tanto que las concentraciones bajas conducen a la célula hacia la muerte celular por necrosis.31 La actividad de la poli-(ADP-ribosa) polimerasa I es también crucial en la selección de la vía de muerte celular, si la poli-(ADP-ribosa) polimerasa I es activada. NAD+ se utiliza como sustrato para la ribosilación del ADP y la disminución de ATP, pudiendo hacer que se resintetice NAD+, llevando a la célula hacia la necrosis. Sin embargo, si la poli-(ADP-ribosa) polimerasa I es inactivada por caspasa 3 haciendo un corte proteolítico en dos de sus subunidades, la concentración de ATP no puede ser repletada, lo que favorece la apoptosis.31 La apoptosis participa en la regulación del número de células durante la fase del desarrollo y en la homeostasia hística. La disregulación en la apoptosis puede resultar en un desequilibrio en la actividad asociada con una variedad importante de trastornos clínicos, como el cáncer, enfermedades autoinmunes, enfermedades neurodegenerativas, trastornos hematopoyéticos e infertilidad.31 La transducción de señales puede ocurrir a través de dos vías diferentes: una vía extrínseca o ligada a receptor y otra vía intrínseca o apoptosis mediada por mitocon-

www.FreeLibros.me


152

Capítulo 12

Neuroinmunorregulación Apoptosis Vía de las caspasas

Célula blanco Vía FAS

Granzimas FAS β

CD54 (ICAM-1)

α

Perforina

α ξξ

β γ ε ε δ FAS-L

Cd18

Expresión de IL-2

Proliferación de CTL

Figura 12-8

Cd11a

Célula-CTL

Esquematización del proceso de apoptosis en el sistema nervioso central.

drias.31 La vía extrínseca o ligada al receptor requiere de la unión del ligando a un receptor de muerte en la superficie celular; por ejemplo, el TNF-α se une al receptor de muerte TNF tipo I, el cual recluta a dos moléculas de transducción de señales, TRADD (proteína de dominio de muerte asociada a TNFR-I) y FADD (proteína de dominio de muerte asociada a Fas). El complejo formado por TRADD/FADD se une a procaspasa 8 para activar a caspasa 8, iniciando de esta manera la cascada de proteasas que conduce a la apoptosis (fig. 12-8).31 La vía intrínseca de la apoptosis está mediada por la liberación mitocondrial de citocromo C; esta vía se activa en respuesta a un daño en el DNA que no es reparado por genes de control (checkpoint). El inicio del proceso de apoptosis puede ocurrir de inmediato o al poco tiempo después del daño al DNA, y la respuesta puede ser dependiente o no de la presencia del factor de transcripción nuclear p53.31,32

p53 actúa como “guardián del genoma” en respuesta a estrés de tipo genotóxico (daño al DNA, hipoxia celular, reducción de aporte de nucleótidos, activación de oncogenes lo que induce que se frene la salida del ciclo celular y finalmente envejecimiento celular.32 Durante el proceso de sepsis o en el choque endotóxico, se generan mediadores como el óxido nítrico, compuesto con efectos citotóxicos y mutágenos si se encuentra en grandes concentraciones y en tipos celulares específicos.33 La vía de señalización iniciada por el óxido nítrico abarca la acumulación de p53 y cambios en la función mitocondrial, y se han demostrado dos vías mayores de señalización: una que incluye la liberación de citocromo C y la activación de caspasas a través del factor Apaf-I (factor 1 activador de la proteasa apoptótica)30,33 y otra vía dependiente de Fas/caspasa 8, que comprende la interacción de proteínas receptoras de muerte con proteasas asociadas a receptores de muerte y la activación de caspasas “corriente abajo”.31,33-36

www.FreeLibros.me


Bibliografía

153

BIBLIOGRAFÍA 1. Steinman L. Elaborate interactions between the immune system and nervous system. Nature Immunology, 2004;5(6):575-581. 2. Wrona D. Neural-immune interactions. An integrative view of the directional relationships between the brain and immune system. Journal of Neuroimmunology, 2006;172:38-58. 3. Haddad JJ, Saade NE, Safich GB. Cytokines and neuro-immune-endocrine interactions: a role for the hypothalamicpituitary-adrenal revolving axis. Journal of Neuroimmunology, 2002;133:1-19. 4. Anisman H, Baines M, Berczi I, Bernstein CHN, Blennerhassett M, Gorczynsky RM, Greenberg AH, Kisil FT, Mathison RD, Nagy E, Nance D, Perdue MH, Pomerantz DK, Sabbadini ER, Stainsz A, Warrington RJ. Neuroimmune mechanisms in health and disease: 1 Health. Can Med Asoc J, 1996;155(7):867-874. 5. Kelley KW. From hormones to immunity: the physiology of immunology. Brain, Behavior and Immunity, 2004;18:95113. 6. Horst Ibelgaufs 1999. Neuroimmune Network. En: COPE with cytokines OnLine Pathfinder Encyclopedia. http:// www.copewithcytokines.de 7. Wilson CJ, Finch CE, Cohen HJ. Cytokines and cognition – the case of a head-to-toe inflammatory paradigm. Geriatric Bioscience, JAGS, 2002;50:2041-2056. 8. Szelenyi J. Cytokines and the central nervous system. Brain Research Bulletin, 2001;54(4):329-338. 9. Bitzer QOK, Ortiz GG, Ruiz RL, Torres MBM, Vázquez VE, Rodríguez PM. Effects of melatonin on plasma levels of TNF-α, IL-1 and IL-6 in mice after lipopolysaccharide administration. Biological Rhythm Research, 2005;36(1/2):159168. 10. Rivest S. How circulating cytokines trigger the neural circuits that control the hypothalamic-pituitary-adrenal axis. Psychoneuroimmunology, 2001;26:761-788. 11. Licino J, Frost P. The neuroimmune endocrine axis: pathophysiological implications for the central nervous system cytokines and hypothalamus-pituitary-adrenal hormone dynamics. Brazilian Journal of Medicine and Biology Research, 2000;33:1141-1148. 12. Tracey KJ. The inflammatory reflex. Nature, 2002;420 (6719):853-859. 13. Blalock JE. The immune system as a sixth sense. Journal of Internal Medicine, 2005;257:126-138. 14. Rivest S. Molecular insights on the cerebral innate immune system. Brain, Behavior, and Immunity, 2003;17:13-19. 15. Allan SM, Rothwell NJ. Inflammation in the central nervous system injury. Phil Trans R Soc Lond B, 2003;358:16691677. 16. Madden KS. Catecholamines, sympathetic innervations and immunity. Brain, Behavior, and Immunity, 2003;17:S5-S10. 17. Gemma C, Imeri L, Opp MR. Serotoninergic activation stimulates the pituitary adrenal axis and alters interleukin-1 mRNA expression in the rat brain. Psychoneuroimmunology, 2003;28:875-884. 18. Libert C. Inflammation: a nervous connection. Nature, 2003;28:875-884.

19. Vitkovic L, Bockaert J. Normal Brain? Journal of Neurochemistry, 2000;74(2):457-471. 20. McCann SM, Kimura M, Karanth S, Yu W, Mastronardi C, Rettori V. The Mechanism of action to control the release of hypothalamic and pituitary hormones in infection. Ann J NY Acad Sci, 2000;917:4-18. 21. Downing JEG, Miyan JA. Neural immunoregulation: emerging roles for nerves in immune homeostasis and disease. Immunology. Today, 2000;21(6):281-289. 22. Aloisi F, Serafini B, Adorini L. Glia-T cell dialogue. Journal of Neuroimmunology, 2000;107:111-117. 23. Li M, Wang Y, Guo R, Bai Y, Yu Z. Glucocorticoids impair ability to induce T cell proliferation and Th1 polarization. Immunol Lett, 2007;15;109(2):129-137. 24. Neumann H, Takahashi K. Essential role of the microglial triggering receptor expressed on myeloid cells-2 (TREM-2) for central nervous system tissue immune homeostasis. Journal of Neuroimmunology, 2007;184:92-99. 25. Siegel G, Arganof B, Albers VW, Molinoff P. Basic neurochemistry. Molecular, cellular and medical aspects. 5a. ed. New York: Raven Press, 1994;628-694. 26. Simeone TA, Sánchez RM, Rho JM. Molecular biology and ontogeny of glutamate receptors in mammalian central nervous system. J Child Neurol, 2004;19:343-360. 27. Melchior B, Puntambekar SS, Carson MJ. Microglia and the control of autoreactive T cell responses. Neurochem Int, 2006;49(2):145-153. 28. Mahidhara R, Billiar TR. Apoptosis in sepsis. Critical Care Medicine, 2000;28(4):105-114. 29. Götz C, Montenarh M. p53: DNA-damage, DNA-repair, and apoptosis. Rev Physiol Biochem Pharmacol, 1995;127:6595. 30. Thiery J, Echchakir H, Dorothée G, Ameyar ZM, Haddada H, Mami CF, Chouaib S. Role of p53 in the sensitization of tumor cells to apoptotic cell death. Molecular Immunology, 2001;38:977-980. 31. Kiechle FL, Zhang X. Apoptosis: biochemical aspects and clinical implications. Clinica Chimica Acta, 2002;326:2745. 32. Burns TF, El-Deiry W. The p53 pathway and apoptosis. Journal of Cellular Physiology, 1999;181:231-239. 33. Li Ch-Q, Trudel LJ, Wogan GN. Nitric oxide-induced genotoxicity, mitochondrial damage, and apoptosis in human lymphoblastoid cells expressing wild-type and mutant p53. PNAS, 2002;99(16):10364-10369. 34. Wang XU, Vermeulen W, Coursen JD, Gibson M, Lupold SE, Forrester K, Xy G, Elmore L, Yeh H, Hoeijmakers JHJ, Harris CC. Genes & Development, 1996;10:1219-1232. 35. Johnson TM, Yu Z-X, Ferrans VJ, Lowenstein RA, Finkel T. Reactive oxygen species are downstream mediators of p53-dependent apoptosis. Proc Natl Acad Sci USA, 1996;93:11848-11852. 36. Giaccia AJ, Kastan MB. The complexity of p53 modulation: emerging patterns from divergent signals. Genes & Development, 1998;12(19):2973-2983.

www.FreeLibros.me


Capítulo

13

Mecanismos moleculares de resistencia del virus de la inmunodeficiencia humana a los antirretrovirales Dr. Eduardo Vázquez Valls Dra. Martha Escoto Delgadillo

En los últimos 20 años, el avance en el tratamiento de la infección por el virus de la inmunodeficiencia humana (VIH) se significa por un incremento de las expectativas y calidad de vida de los pacientes, debido, en gran parte, al creciente número de antirretrovirales (ARV) disponibles para el tratamiento de la infección y a las diferentes estrategias moleculares que estos fármacos incluyen.1,2 A pesar del éxito de la terapia antirretroviral altamente activa (TARAA), que consiste en la combinación de tres o más fármacos con diferentes mecanismos de acción, a la fecha no se ha logrado la inhibición completa de la replicación viral o la erradicación del VIH de los reservorios del hospedador y sólo es factible referirse a un control eficaz de la replicación viral por periodos prolongados.2 El fracaso al régimen terapéutico después del primer año de haber iniciado el tratamiento es común entre 10 y 30% de los individuos con terapia inicial y entre 40 y 60% de los pacientes que previamente han fallado al tratamiento.3,4 Las principales causas de la falla al tratamiento antiretroviral son: la resistencia a los ARV, limitada potencia

antiviral, inadecuada adherencia del paciente al régimen terapéutico, defectos en la absorción del medicamento, interacciones farmacológicas, inadecuada activación del fármaco (resistencia celular) y, por último, la replicación viral en los santuarios linfoides.5-7 La resistencia a los ARV es la principal causa de la falla al tratamiento y se debe a una serie de sustituciones de nucleótidos en los genes que codifican para las glucoproteínas 120 y 41, las enzimas retrotranscriptasa (RT), proteasa e integrasa, blancos en los que actúan estos fármacos.8

TRATAMIENTO ANTIRRETROVIRAL Desde el descubrimiento del VIH, se han centrado las estrategias terapéuticas en la estructura química y en el ciclo biológico del virus, lo que favoreció la creación de los medicamentos disponibles en la actualidad. Así, a medida que aumenta la comprensión de los mecanismos fisiopatológicos involucrados, la interacción de la envoltura viral con receptores específicos en la membra154

www.FreeLibros.me


Blancos terapéuticos

155

na celular, la replicación, y hasta la liberación de nuevas partículas infecciosas, surgen nuevas opciones para inhibirlos.9,10 En el ciclo del virus, se han identificado pasos críticos, que son blanco de los ARV que hoy se utilizan en la inhibición de la replicación, como los inhibidores de entrada, los inhibidores de la retrotranscriptasa, los inhibidores de proteasa y los inhibidores de la integrasa.9,11-13 El tratamiento ARV ofrece claros beneficios a los individuos infectados por el VIH. Cuando se utiliza TARAA, la cual por lo general implica la combinación de dos análogos de nucleósidos y un inhibidor de proteasa, se logra mejorar la calidad y cantidad de vida del paciente, así como disminuir la frecuencia de algunas infecciones por microorganismos oportunistas.2,12 En la actualidad, el objetivo del tratamiento es mantener la carga viral en niveles indetectables e incrementar progresivamente el recuento de los linfocitos CD4+, por el mayor tiempo posible y se cuenta con más de 20 ARV diferentes para el tratamiento del paciente con VIH (cuadro 13-1).12,14

personas que poseen una mutación en el alelo CCR5 y generan una proteína truncada no funcional. Así, cuando son homocigotos no expresan el CCR5 y tienen una protección relativa a la infección por el VIH; en cambio los heterocigotos pueden adquirir la infección, pero la evolución de la enfermedad es más lenta.17 Por otro lado, CXCR4 se encuentra en 50% de pacientes con enfermedad avanzada y su presencia en los linfocitos se asocia con evolución rápida. Dado que el CXCR4 se expresa junto con su ligando SDF1α, cuando este último se inhibe de manera conjunta con el CXCR4, paralelamente se alteran las funciones de hematopoyesis, cardiacas y de desarrollo cerebral.17 Entre los inhibidores del CCR5, podemos encontrar nuevos fármacos como el maraviroc, un inhibidor no competitivo del sitio de unión del correceptor, y al vicroviroc, que al igual que el TAK-770, induce cambios conformacionales en CCR5 que afectan la unión de gp120. Entre los inhibidores de CXCR4, está el AMD070 que bloquea a SDF1α, con los efectos secundarios descritos en el párrafo anterior.17

BLANCOS TERAPÉUTICOS

Inhibidor de la fusión

Proteínas de la envoltura

En la actualidad, sólo existe un inhibidor de esta clase, la enfuvirtida. Se trata de un péptido de 36 aminoácidos que previene la terminación de la secuencia de la fusión del VIH. La enfuvirtida es un análogo sintético del fragmento peptídico HR2, que se une a una porción HR1 y desestabiliza el proceso de la formación de la horquilla proteínica que se requiere en la formación del complejo de poro y la fusión del virus a la membrana celular.2,16

El VIH se adhiere a la célula a través de la interacción del complejo de glucoproteínas de la envoltura del virus (gp160) con el receptor de superficie linfocítico CD4+ y dependiendo de la evolución de la infección, con los correceptores CCR5 y CXCR4.15 La gp160 está compuesta de dos subunidades, la glucoproteína de superficie gp120, que es la que interactúa con los receptores celulares, y la subunidad transmembrana gp41, que es la causa de la fusión del virus.15 Después de la unión de la gp120 y el receptor celular CD4+, ocurre un cambio conformacional en la gp120 que permite una interacción más cercana entre los correceptores CCR5 y CXCR4 de la superficie de las células CD4+ y la gp120. Esta segunda interacción produce un cambio en la gp41, lo que provoca que quede expuesta la región hidrófoba de la parte central de la proteína de gp41. Cerca de esta región se encuentran el HR1 (heapted repeat 1) y el HR2, que se componen de seis hélices que forman una estructura en “horquilla” y como consecuencia el poro de fusión, por donde el RNA viral entra al linfocito CD4+.2,7,16

Estructura y función de la proteasa La proteasa del VIH es un dímero simétrico con 99 aminoácidos, con un sitio activo situado en la hendidura existente en la interfase entre los dos monómeros desde la posición 25 a la 27 de cada monómero. La función de esta enzima es cortar la poliproteína que se forma como producto de la traducción del RNAm de los genes gag, pol y env, para transformarlas en proteínas funcionales o activas de la cápside interna (p17, p24, p7 y p6), las enzimas esenciales (RT, proteasa e integrasa) y las glucoproteínas de la envoltura (gp120 y gp41), que se requieren para la producción de virus maduros e infecciosos.7,18

Inhibidores de la proteasa Inhibidores de receptores celulares Dentro de esta clase de fármacos se encuentran los inhibidores de CCR5 y de CXCR4. Probablemente, los primeros sean más prometedores, ya que, al obstruir al receptor, logran un efecto similar al observado en las

Los inhibidores de proteasa utilizados actualmente se unen al sitio activo mediante dos mecanismos: el primero simula el estado de transición durante la incisión peptídica, y el segundo se ajusta al sitio activo como un complemento estérico.

www.FreeLibros.me


156

Capítulo 13

Cuadro 13-1

Mecanismos moleculares de resistencia del virus de la inmunodeficiencia humana a los antirretrovirales

Antirretrovirales utilizados en el tratamiento de personas infectadas por VIH

Clase Inhibidor de entrada

Antirretrovirales

Abreviatura

Vicroviroc

SCH 471690

CCR5

Maraviroc

UK-427,857

CCR5

AMD070 Inhibidor de la retrotranscriptasa análogo de los nucleósidos

Zidovudina

AZT

Didanosina

DdI

Zalcitabina

DdC

Estavudina

D4T

Lamivudina

3TC

Abacavir

ABV

Emcitabina

FTC

Análogo de nucleótido

Tenofovir

TFV

Inhibidor de la retrotranscriptasa no análogo de los nucleósidos

Nevirapina

NVP

Delavirdina

DLV

Efavirenz

EFV

Inhibidores de proteasa

Saquinavir

SQV

Indinavir

IDV

Ritonavir

RTV

Nelfinavir

NFV

Amprenavir

APV

Lopinavir

LPVr

Atazanavir

ATV

Fosamprenavir

FAPV

Tripanavir

TPV

Darunavir

DAR

Elvitegravir

GS 9137

Raltegravir

MK-0518

Enfuvirtida

T-20

Inhibidores de integrasa

Inhibidores de fusión

Blanco

Cuando se bloquea la función de la proteasa, se interrumpe la formación de las proteínas de la cápside interna, lo que provoca que el ensamblaje de los viriones inmaduros no se lleve a cabo y por tanto pierdan su infectividad. Hoy en día están aprobados para su uso clínico nueve inhibidores de esta enzima (cuadro 13-1).7,18,19

Mecanismo de acción Inducen cambios conformacionales en CCR5 que afectan la unión de gp120

CXCR4

Bloquea a SDF1α

Retrotranscriptasa

Fosforilados por enzimas celulares Competitivamente inhiben la síntesis de DNA viral o causan la terminación de la cadena

Retrotranscriptasa

No fosforilados, se unen directamente a la enzima e impiden la transcripción

Proteasa

Se unen al sitio activo de la enzima, inhiben el ensamble correcto y conformación de las proteínas

Integrasa

Inhiben el proceso de integración del complejo de preintegración viral al DNA celular

Envoltura gp41

Se unen a la región HR1 de gp41 e impiden la fusión del virus con la célula CD4+

Estructura y función de la retrotranscriptasa La retrotranscriptasa (RT) convierte el RNA viral en un DNA de doble cadena para su integración en el genoma de la célula hospedadora. Se deriva del precursor Gag-

www.FreeLibros.me


Principales causas de la falla al tratamiento antirretroviral

pol que es procesado por la proteasa para producir una enzima heterodimérica compuesta por una proteína de 66 kDa (p66) y una de 51 kDa (p55). La p66 se divide en dos subunidades p51 y p15. La actividad de polimerasa se encuentra en el fragmento p51, y la actividad de RNasa en p15. Para una actividad óptima de la polimerasa, se requieren ambas proteínas, p66 y p51.20 Por medio de cristalografía, se determinó la estructura de la enzima y se dedujeron algunas de sus propiedades. Se puede hacer una representación esquemática de p66 al comparar su estructura y función con una mano derecha, con rasgos estructurales denominados “palma”, “pulgar” y “dedos”. La plantilla iniciadora pasa a través de la hendidura existente entre los dedos y el pulgar donde se localiza el sitio catalítico de la enzima. La incorporación de los desoxinucleótidos (dNTP) se da en los primeros dos dedos, y el crecimiento del templado es procesado a través de la palma de la mano.7,19 El sitio activo de la enzima es una región altamente conservada (secuencia motif MDD) que comprende los aminoácidos codificados por los codones 183 a 186. La sustitución de cualquiera de estos aminoácidos disminuye la actividad de la polimerasa in vitro. Esta actividad se asocia con la unión de los sustratos y con el complejo templado-iniciador que interactúa con los aminoácidos 73-90 y 141-174 con el templado y 227-235 con el iniciador.20 La unión de los dNTP se asocia con los aminoácidos 65, 72, 110, 113, 115, 116, 151, 160, 183, 184, 186 y 219, los cuales median la interacción magnesio-dependiente.20

Inhibidores de la retrotranscriptasa El primer ARV aprobado en 1987 para el tratamiento del VIH fue la zidovudina y pertenece a esta clase de inhibidores. Su éxito motivó el surgimiento de otros inhibidores tanto análogos como no análogos de los nucleósidos. Actualmente están en uso 11 ARV que actúan bloqueando esta enzima: ocho son análogos de los nucleósidos y tres no análogos de éstos (cuadro 13-1).21

Inhibidores de la retrotranscriptasa análogos de los nucleósidos En términos prácticos, los inhibidores de la retrotranscriptasa análogos de los nucleósidos (IRTAN) estructuralmente se asemejan a los dNTP naturales que son trifosfatados en el núcleo de la célula, e incorporados en la cadena de DNA que se desarrolla durante la retrotranscripción del RNA del VIH. Los IRTAN inhiben este proceso a través de dos mecanismos: por inhibición competitiva de los dNTP y en la terminación prematura de la cadena de DNA debido a la modificación del grupo 3′ OH hidroxilo. En estos ARV no existe este grupo; por tanto,

157

se previene la formación del enlace fosfodiéster entre la cadena en crecimiento de DNA y el nuevo nucleósido trifosfatado 5′.7,19,20

Inhibidores de la retrotranscriptasa no análogos de los nucleósidos Los inhibidores de la retrotranscriptasa no análogos de los nucleósidos (IRTNN) se unen al hueco hidrófobo localizado en la palma, cerca del sitio activo de la enzima, lo que causa un cambio conformacional. Esta unión inhibe la función de la RT por un mecanismo alostérico mediante el cual se desplaza la asparagina respecto al sitio de unión de la polimerasa.7,19

Estructura y función de la integrasa La integrasa es una proteína de 288 aminoácidos que se codifica por el gen pol y tiene tres dominios funcionales: 1) el N-terminal (aminoácidos 1-50), posiblemente incluido en la multimerización de las proteínas, compuesto por el motif HHCC que coordina los puentes de cinc para una actividad enzimática eficiente; 2) el centro catalítico (aminoácidos 51-212), donde se encuentra en el sitio activo de esta enzima, y se localiza el motif DDE; 3) dominio terminal C (aminoácidos 213-288), que está menos conservado y se relaciona con la unión del complejo de integración del DNA viral y del hospedador.22 La integrasa tiene dos pasos catalíticos bien caracterizados: la eliminación de dos nucleótidos de cada 3′ terminal de la doble cadena viral, formando el complejo de preintegración, y el transporte de éste a través de la envoltura nuclear hacia el núcleo, donde la integrasa inserta las terminaciones DNAc viral al DNA celular.22,23

Inhibidores de la integrasa Hay varios estudios clínicos en desarrollo sobre los inhibidores de la integrasa, entre ellos el elvitegravir (GS-9137) y raltegravir (MK-0518); son los fármacos más conocidos tanto por su eficacia clínica como por su mecanismo de acción, al unirse al motivo DDE de la integrasa, bloqueando el sitio catalítico de la enzima e impidiendo la unión del DNA viral al DNA de la célula.22

PRINCIPALES CAUSAS DE LA FALLA AL TRATAMIENTO ANTIRRETROVIRAL A pesar del éxito de la TARAA en el tratamiento del paciente con VIH, muchos pacientes experimentan falla al tratamiento; se estima que casi 30% de los individuos no logra suprimir o disminuir a niveles indetectables el RNA viral, a pesar de una combinación terapéutica efectiva. Además, entre 40 y 60% de los sujetos, después

www.FreeLibros.me


158

Capítulo 13

Mecanismos moleculares de resistencia del virus de la inmunodeficiencia humana a los antirretrovirales

de un año de haber iniciado TARAA, experimentan un “rebote” viral, luego de haber suprimido el RNA viral a niveles indetectables.3,4 Los factores que contribuyen al fracaso terapéutico son:5,7,24,25 a) Inadecuada adherencia a los ARV, por esquemas farmacológicos complejos, tolerancia, horarios, otros medicamentos concomitantes, etc.; la falta de adherencia se traduce en reducción de la potencia del tratamiento. b) Factores farmacológicos, como las interacciones entre medicamentos y poca absorción gastrointestinal de los ARV. c) Factores del hospedador, inadecuada activación de los ARV (IRTAN), la carga viral y el recuento de linfocitos CD4+ en el momento de iniciar tratamiento. d) Limitada potencia de algunos regímenes de TARAA. e) Replicación viral en los “santuarios”. f) Resistencia a los ARV. Cabe mencionar que los ARV no causan las mutaciones que generan resistencia; más bien alteran el medio intracelular, ya que las mutaciones son espontáneas.7 Si estas mutaciones confieren una ventaja sobre los virus que no la presentan, la población de virus con mutaciones crecerá más rápido que la “normal” o de tipo natural y se convertirá en la población dominante del paciente. Como estos virus con mutaciones de resistencia son capaces de replicarse en presencia de los ARV, ocasionan que la carga viral se incremente y que progrese la enfermedad.7

FACTORES PARTICIPANTES EN LA RESISTENCIA A LOS ANTIRRETROVIRALES La resistencia a los ARV es la principal causa de la falla al tratamiento y se genera por una serie de sustituciones de nucleótidos en los genes que codifican para el receptor gp41 y para las enzimas RT y proteasa, blancos en los que actúan los ARV.8 La velocidad de mutación del genoma del VIH está dada por la enzima retrotranscriptasa; ésta carece de actividad de exonucleasa en la incorporación de las bases durante la síntesis de la doble cadena de DNA, donde un nucleótido puede ser sustituido al azar por otro.19,26 El genoma del VIH contiene aproximadamente 10 000 bases y se estima que la tasa de error de la RT es alrededor de un nucleótido por cada 10 000 nucleótidos copiados, que equivale a una mutación puntual en cada ciclo de replicación.27,28 La producción diaria de 1 a 10 billones de partículas del VIH, aunada al reemplazo todos los días de más de la

mitad de la población viral y a la propia presión selectiva, tanto de los fármacos como del sistema inmunitario, son factores que favorecen la inducción de resistencia a los ARV.19,27 La mayoría de las variantes que se generan con mutaciones del VIH tiene poco o ningún efecto en la función viral o en la capacidad de replicación, y muchas otras pueden ser letales para el propio virus. Sin embargo, las mutaciones en sitios importantes, por ejemplo en genes de las enzimas virales, afectan la capacidad del virus o pueden conferir resistencia a uno o varios ARV.19,26-28 Otro factor que contribuye a la diversidad genética y a la resistencia de los ARV es la recombinación de las dos cadenas de RNA. Ésta constituye una parte intrínseca del ciclo normal de replicación viral y puede mediar la reparación de genomas virales defectuosos, incrementar la diversidad viral o acelerar la propagación de mutaciones beneficiosas entre las cuasiespecies virales.29

MUTACIONES DE RESISTENCIA A LOS ANTIRRETROVIRALES El desarrollo de resistencia a los ARV es el mayor obstáculo para el éxito de la TARAA. La resistencia aparece a distinta velocidad en los diferentes ARV.8 Cuando se valora la resistencia en la primera falla virológica, ésta se asocia por lo general con los ARV que son más “débiles” o con mayor probabilidad de generar resistencia por sí mismos, en lugar de todos los componentes del régimen terapéutico.30 La diferencia en el surgimiento de la resistencia a un componente específico del tratamiento se explica por las barreras genéticas del propio ARV. Para los IRTNN y lamivudina (3TC), una sola mutación puede conferir resistencia y en algunos casos generar resistencia para todos los de esta misma clase. Para el resto de los IRTAN y los inhibidores de proteasa, el desarrollo de niveles altos de resistencia requiere varias mutaciones.24,26 La continua replicación en presencia de los ARV lleva a la acumulación de varias mutaciones, permitiendo por último el desarrollo de resistencia cruzada dentro de la misma clase de ARV, afectando para un futuro los esfuerzos para reducir de nuevo la replicación viral. Cuando son necesarias múltiples mutaciones para conferir resistencia, se dice que hay una barrera genética.24

Resistencia a los inhibidores de receptores celulares Los bloqueadores de estos receptores actúan en la célula en lugar de alguna proteína viral. Algunas formas de adquirir resistencia son: a) en presencia de los inhibidores de CCR5, el virus puede cambiar a X4 y viceversa; b) el virus puede evolucionar a tener una mayor afinidad

www.FreeLibros.me


Mutaciones de resistencia a los antirretrovirales

159

al correceptor, utilizar niveles bajos de correceptor para la replicación y patogenia, la variabilidad natural de la región expuesta de la gp120.31

Resistencia a los inhibidores de la retrotranscriptasa análogos de los nucleósidos

Resistencia al inhibidor de fusión

Todas las mutaciones de resistencia parecen influir tanto en el sitio de unión de los dNTP como en el lugar de unión de la enzima a la plantilla iniciadora. La mayoría de estas mutaciones se cree que aumentan la especificidad enzimática en el reconocimiento de los dNTP naturales.20 Se requieren varias mutaciones en la RT para mostrar alta resistencia fenotípica a estos inhibidores, aunque el número de mutaciones fluctúa entre cada ARV, con excepción de 3TC que con una sola mutación en el codón 184 genera resistencia. Cada IRTAN induce un grupo predecible de mutaciones. Por ejemplo, la resistencia a AZT se desarrolla con la selección secuencial de mutaciones específicas que incluyen los codones 41, 67, 70, 210, 215 y 219, también conocidas como mutaciones análogas a la timidina (TAM). La resistencia a la didanosina (ddI) comprende los codones 65, 74 y 184, en tanto que la zalcitabina (ddC) incluye los codones 65, 69, 74 y 184 (cuadro 13-2). Sin embargo, ocurre la sobreposición de algunas mutaciones entre diferentes ARV de la misma clase, lo que genera la resistencia cruzada entre éstos.24,30 Diversos grupos de mutaciones dentro del gen de la RT causan varios grados de resistencia cruzada; en algunas ocasiones, éstas generan resistencia a un grupo específico de ARV, en tanto que en otras ocasiones resistencia a todos los ARV del grupo. Un ejemplo es la mutación 65R que se selecciona y causa una disminución variable de la susceptibilidad de ddI, abacavir (ABV) y tenofovir (TFV). Estudios previos sugieren que esta mutación muy probablemente genere resistencia cruzada a todos los IRTAN, excepto a AZT (cuadro 13-2). La resistencia multinucleosídica se confiere por tres tipos distintos: TAM, el complejo de inserción en el codón 69 y el complejo Q151M (cuadro 13-2).24,30

La resistencia a este ARV se encuentra cerca de la región N-terminal HR-1 de gp41, que es altamente conservada y es indispensable para el proceso de fusión. El tipo de resistencia se muestra en el cuadro 13-2.7,16 Una sola mutación en la posición 36 y 38 en el dominio de HR1 genera una disminución significativa de la susceptibilidad a enfuvirtida. Se cree que los cambios en los aminoácidos fueran de HR1, e incluso en gp120 están asociados con la susceptibilidad del virus a enfuvirtida.16 Esto explica el amplio margen de susceptibilidad entre las cepas del VIH a este inhibidor.7,16

Resistencia a los inhibidores de proteasa Las sustituciones de aminoácidos que generan resistencia a la proteasa se localizan cerca del sitio activo de la enzima o en aminoácidos fuera de la región activa. Directa o indirectamente estos cambios en los aminoácidos modifican el número y la naturaleza de los puntos de contacto entre los inhibidores y la proteasa; por tanto, se reduce la afinidad por la enzima.18 Las mutaciones en la proteasa se clasifican en: mutaciones primarias o mayores y mutaciones secundarias o menores. Las primarias son aquellas que reducen la susceptibilidad de los ARV por sí mismas, en tanto que las secundarias disminuyen la susceptibilidad o mejoran la capacidad de replicación de las cepas con mutaciones primarias. Algunas mutaciones pueden ser consideradas como primarias para un ARV pero secundarias para otro ARV, de suerte que no pueden generalizarse a todos los ARV, ni por grupos de fármacos.19,32 Por lo general, para niveles altos de resistencia se requiere una serie de sustituciones de aminoácidos, que por lo general varía entre diferentes inhibidores de proteasa (cuadro 13-2). Algunas mutaciones son seleccionadas únicamente por un inhibidor, reflejando particularidades en la estructura química del mismo.18 Sin embargo, hay muchas sobreposiciones entre la combinación de las mutaciones que desarrollan resistencia a estos inhibidores, explicando el amplio margen de resistencia cruzada (cuadro 13-2). Un ejemplo de mutación de resistencia específica es D30N que sólo confiere resistencia a nelfinavir (NFV). Las mutaciones que de manera característica confieren resistencia cruzada entre los inhibidores de proteasa incluyen los codones 82, 84 y 90. Otro ejemplo es el codón I50V que causa resistencia a amprenavir (Apv) y contribuye a la resistencia cruzada con lopinavir (LPVr).7,19,24

Resistencia a los inhibidores de la retrotranscriptasa no análogos de los nucleósidos Todas las mutaciones de resistencia a los IRTNN se localizan en el hueco de unión que abarca los codones 100-110 y 180-190. Contribuyen a la resistencia, alteran la interacción entre los IRTNN y el hueco, con lo que se reduce la afinidad del inhibidor por la enzima.33 En contraste con la mayoría de IRTAN, una sola mutación puede generar altos niveles de resistencia a los IRTNN. Las mutaciones más comunes en el VIH inducidas por esta clase de inhibidores son: L100I, K103N, V106A, V108I, Y181C/I, Y188C/L, G190A/E/S. P225H y P236L (cuadro 13-2).24,30

www.FreeLibros.me


160

Capítulo 13

Cuadro 13-2

Mecanismos moleculares de resistencia del virus de la inmunodeficiencia humana a los antirretrovirales

Tipos de resistencia a los antirretrovirales

Antirretrovirales

Mutaciones

IRTAN Abacavir

K65R, L74V, Y115F, M184V

Didanosina

K65R, L74V

Emtricitabina

K65R, M184VI

Lamivudina

K65R, M184VI

Estavudina

M41L, D67N, K70R, L210W, T215W, T215YF, K219QE

Tenofovir

K65R, K70R

Zidovudina

M41L, D67N, K70R, L210W, T215YF, K219QE

IRTNN Delavirdina

K103N, V106M, Y181C, Y188L, P236L

Efavirenz

L100I, K103N, V106M, V108I, Y181CI, Y188L, G190SA, P225H

Nevirapina

L100I, K103N, V106AM, 108I, Y181CI, Y188CI, Y188CLH, G190A

MULTIRRESISTENCIA INSERCIÓN 69

M41L, A62V, 69, K70R, L210W, T215YF, K219QE

COMPLEJO 151

A62V, V75I, F77L, F116Y, Q151M

TAM

M41L, D67N, K70R, L210W, T215YF, K219QE

IP Atazanavir±ritonavir

L10IFVC, G16E, K20RMITV, L24I, V32I, L33IFV, E34Q, M36ILV, M46IL, G48V, I50L, F53LY, I54LVMTA, D60E, I62V, I64LMV, A71VITL, G73CSTA, V82ATFI, I84V, I85V, N88S, L90M, I93LM

Fosamprenavir/ritonavir

L10FIRV, V32I, M46IL, I47V, I50V, I54LVM, G73S, V82AFST, I84V, L90M

Darunavir/ritonavir

V11I, V32I, L33F, I47V, I50V, I54ML, G73SA, L75V, I84V, L89V

Indinavir/ritonavir

L10IRV, K20MR, L24I, V32I, M36I, M46IL, I54V, A71VT, G73SA, V77I, V82AFT, I84V, L90M

Lopinavir/ritonavir

L10FIRV, K20MR, L24I, V32I, L33F, M46IL, I47VA, I50V, F59L, I54VLAMTS, L63P, A71VT, G73S, V82AFTS, I84V, L90M

Nelfinavir

L10FI, D30N, M36I, M46IL, A71VT, V77I, V82AFTS, I84V, N88DS, L90M

Saquinavir/ritonavir

L10IRV, L24, G48V, I54VL, I62V, A71VT, G73S, V77I, V82AFTS, I84V, L90M

Tipranavir/ritonavir

L10V, I13V, K20MR, L33F, E35G, M36I, K43T, M46L, I47V, I54AMV, Q58E, H69K, T74P, V82LT, N83D, I84V, L90M

IF Enfuvirtida

G36DS, I37V, V38AME, Q39R, Q40H, N42T, N43D

IRTAN, inhibidores de la retrotranscriptasa análogos de los nucleósidos; IRTNN, inhibidores de la retrotranscriptasa no análogos de los nucleósidos; TAM, mutaciones análogas a la timidina; IP, inhibidores de proteasa; IF, inhibidores de fusión.

Todos los inhibidores de la retrotranscriptasa no análogos de los nucleósidos se unen al mismo hueco hidrófobo, lo que explica la resistencia cruzada que se observa

en esta clase de inhibidores, que con sólo la mutación K103N o Y188L afecta la utilidad clínica de estos fármacos (cuadro 13-2).23,30

www.FreeLibros.me


Pruebas para la detección de resistencia

Resistencia a los inhibidores de integrasa

161

Pruebas fenotípicas

La resistencia a estos inhibidores está relacionada con las mutaciones que se producen en el sitio catalítico de la enzima y que provocan cambios conformacionales. El grado de resistencia depende del número de mutaciones en la integrasa. Algunas de las mutaciones tienen más efecto en la viabilidad de las variantes virales, por ejemplo la mutación C130S, que daña la replicación viral. Se considera que son inhibidores con baja barrera genética. Se ha observado in vitro el perfil de resistencia para elvitegravir, seleccionando las mutaciones H51Y, E92Q, S147G, E157Q; también se han relacionado las mutaciones T66I y R263K. En el caso de raltegravir, no se han revelado las mutaciones de resistencia, pero se ha advertido que la mutación E92Q reduce la susceptibilidad, generando resistencia cruzada con elvitegravir.22,23,34

SUBTIPOS DEL VIH Y RESISTENCIA A LOS ANTIRRETROVIRALES El conocimiento que se tiene actualmente acerca del desarrollo de resistencia a los ARV en el VIH-1 se sustenta en estudios de cepas del subtipo B, que es el predominante en países desarrollados.35 Sin embargo, con la introducción de los ARV en otras partes del mundo, se demostró que el subtipo viral sí influye en la eficacia del tratamiento. El VIH-2 y el VIH-1 subtipo O tienen en su secuencia consenso natural en el codón 181 el aminoácido isoleucina y cisteína, respectivamente, generándoles de manera natural resistencia a todos los IRTNN.19 En ausencia del tratamiento con ARV, se observó que la RT y proteasa del VIH-1 del subtipo B y no B son diferentes entre 40 y 30% de los aminoácidos, respectivamente. En los virus con subtipo no B, algunas de estas sustituciones están presentes de manera natural y ocurren con alta frecuencia en las posiciones asociadas con resistencia en el subtipo B.19,32,36

PRUEBAS PARA LA DETECCIÓN DE RESISTENCIA Las pruebas de resistencia a los ARV se han incorporado rápido al tratamiento integral del paciente. Ayudan a determinar cuál ARV no está funcionando y cuáles pueden ser más eficaces, o utilizarse por tiempo más prolongado.7,21 Actualmente hay dos tipos de pruebas para valorar la resistencia a los ARV: las pruebas fenotípicas y las pruebas genotípicas.7,21

Este tipo de pruebas mide la capacidad de la replicación del virus en presencia de varias concentraciones de los ARV. Estas pruebas proporcionan una medida directa de la sensibilidad del medicamento, con resultados generados como índice inhibidor a 50 o 90% (IC50 o IC90), la cantidad de ARV que inhibe la replicación a 50 o 90%. Otra ventaja es que son útiles en aportar información sobre resistencia cruzada y además estas pruebas son de fácil interpretación para los médicos tratantes.26 Entre las desventajas de las pruebas fenotípicas en comparación con las genotípicas están: son muy laboriosas en cuanto a su realización, mucho más costosas, se llevan a cabo en un número limitado de laboratorios, y el tiempo de proceso y entrega de resultados es más prolongado. Los valores de corte sólo están establecidos y estandarizados para pocos ARV; además no se detectan poblaciones virales menores de 10 a 25% ni mutaciones tempranas. En algunas pruebas fenotípicas que no utilizan la tecnología de recombinantes sino la de cultivo de células mononucleares de sangre periférica, algunas variantes se pueden adaptar o cambiar rápido en el medio de cultivo, pero sin ser las que predominen en el paciente, dando un resultado de resistencia erróneo.37

Pruebas genotípicas Se utilizan para detectar mutaciones específicas en el gen de la proteasa y RT, asociadas con resistencia fenotípica a un ARV en específico. Están disponibles tres tipos de metodologías: hibridación del producto amplificado, la utilización de “chips” que examinan múltiples codones por hibridación y por análisis de secuenciación del gen pol. Estas pruebas detectan mutaciones en poblaciones por arriba de 5 a 20%; son más sencillas en su realización en comparación con las fenotípicas; el tiempo de obtención de resultados es mucho más corto, y pueden detectar mutaciones tempranas previas a la aparición de resistencia fenotípica. Entre las desventajas de las pruebas genotípicas se encuentran: miden indirectamente la resistencia; la interpretación de los resultados es más difícil, ya que se requiere experiencia en el análisis de la secuencia y el uso de logaritmos que correlacionan las mutaciones de resistencia con datos de las mutaciones conocidas que confieren resistencia fenotípica; por último, de algunas mutaciones se desconoce su importancia clínica.7,21,26,37 Las pruebas de resistencia a los ARV comúnmente conocidas como genotipos requieren condiciones controladas desde el momento de la solicitud hasta la realización de la técnica. Los pacientes no deben suspender su tratamiento por lo menos dos semanas antes de la toma

www.FreeLibros.me


162

Capítulo 13

Mecanismos moleculares de resistencia del virus de la inmunodeficiencia humana a los antirretrovirales

sanguínea. La cepa natural tiene mayor capacidad de replicación que las cepas con resistencia; por tanto, con la suspensión del tratamiento el genotipo no detectará las cepas con resistencia y éstas reaparecerán cuando el paciente inicie tratamiento. De preferencia, los niveles plasmáticos de RNA viral deben ser mayores a 5 000 copias, con la finalidad de detectar la resistencia circulante; también es conveniente que la separación del plasma sea inmediatamente después de su extracción y en un ambiente estéril y con material libre de RNasa, para evitar su degradación. La muestra sanguínea se debe procesar en laboratorios certificados con estricto control de calidad. La técnica consiste en la extracción de RNA viral mediante gradiente de densidad y solventes, seguido de la amplificación de las regiones de la proteasa y RT del virus, y por último la purificación y secuenciación de los productos obtenidos. Los resultados de esta última se analizan en una base de datos actualizada de manera constante con los codones de resistencia conocidos internacionalmente para cada uno de los ARV. La verificación la debe hacer un experto, con el objeto de eliminar los errores que se producen durante el procedimiento ordinario. El envío de muestras con varias horas entre la toma y su procesamiento o el uso de papel filtro origina resultados falsos que habrá que considerar en su aplicación clínica.

APLICACIÓN EN LA CLÍNICA Hay datos suficientes acerca de los beneficios y limitaciones de las pruebas de resistencia a los ARV en la elección del régimen terapéutico más eficaz; sin embargo, hay ciertas consideraciones con respecto a la falla al tratamiento, cambio de éste y las pruebas de resistencia (fig. 13-1).37 La falla al tratamiento no se define por las pruebas de resistencia; para el cambio del tratamiento, se debe considerar el incremento de los niveles del RNA viral, la baja en el recuento de los linfocitos CD4+ y la progresión clínica. Además, hay que tomar en cuenta la historia de los tratamientos previos para la elección de un nuevo esquema y evitar utilizar el o los ARV en que se compruebe resistencia.24,26,37 La Asociación Internacional de sida de Estados Unidos,30 la Guía Europea38 y la Guía para la Atención Médica de la Secretaría de Salud12 recomiendan el uso de estas pruebas bajo las siguientes circunstancias: a) Individuos sin tratamiento ARV previo con infección primaria o con menos de 12 meses de seroconversión para la detección de la transmisión de cepas resistentes. b) Respuesta subóptima a la terapia. Cuando no se logra disminuir la carga viral en un periodo de ocho a

VIH-positivos

Con tratamiento ARV

Sin respuesta al tratamiento CD4+ Carga viral

Sin tratamiento ARV

Efectos secundarios o enfermedades oportunistas, poca adherencia

Pacientes que inician tratamiento Mujeres embarazadas Hijos de madres infectadas Probable infección por riesgo laboral

Se recomiendan pruebas de resistencia genotípica a los ARV

Figura 13-1

Indicación de las pruebas de resistencia genotípica.

www.FreeLibros.me


Impacto económico

c)

d) e)

f) g)

12 semanas, lo que sugiere la preexistencia de resistencia. Antes de iniciar tratamiento en pacientes con infección establecida. Cuando la prevalencia regional de resistencia sea mayor a 5%, aunque en algunos casos se detecte la cepa silvestre, ya que la resistente permanece como minoría. Después de la primera falla al tratamiento. Cambio de terapia. Sólo si se sospecha que sea por resistencia, con cargas virales por arriba de 500 a 1 000 copias. Múltiples fallas terapéuticas. Embarazo. Si en la madre se detecta RNA viral, como profilaxis en la transmisión vertical.

PREVALENCIA E IMPACTO DE LA RESISTENCIA A LOS ANTIRRETROVIRALES Pacientes sin tratamiento antirretroviral previo La detección de mutaciones relacionadas con resistencia a los ARV en individuos que no se han expuesto a éstos se debe principalmente a la transmisión de las cepas resistentes de sujetos tratados con anterioridad o por mutaciones espontáneas del virus.39 La prevalencia de resistencia en pacientes sin tratamiento previo observada en Europa y Estados Unidos está por arriba de 10 y 20%, respectivamente.40-42 Latinoamérica informa prevalencias similares en individuos con infección reciente; Argentina con 15.6%, y Brasil con 6.6%.43,44 Hay pocos estudios de prevalencia de resistencia a los ARV en pacientes sin tratamiento previo con infección establecida del VIH; en Estados Unidos, Canadá y México se encontraron prevalencias entre 8.3 y 20%. En Europa, Bélgica tiene una prevalencia de 7.2%.45-48

163

La transmisión de la resistencia ha aumentado en los últimos años, teniendo como consecuencia una poca respuesta al tratamiento ARV en pacientes sin tratamiento previo, convirtiéndose en un problema agregado de salud.24

Pacientes con tratamiento antirretroviral previo Tratándose de pacientes con tratamiento antirretroviral previo, la prevalencia de resistencia en individuos infectados con RNA viral detectable es aproximadamente de 78% en Estados Unidos y Canadá.24 Los IRTAN representan la mayor resistencia con 70%, seguidos de los inhibidores de proteasa con 42% y por último 31% para los IRTNN; los pacientes que desarrollan más resistencia incluyen aquellos con la enfermedad más avanzada.24,49 Esta alta prevalencia tiene consecuencias en la transmisión de cepas resistentes y la intervención eficiente del tratamiento ARV.24,49

IMPACTO ECONÓMICO Aunque este tipo de pruebas son costosas, su uso racional ayuda a soportar decisiones de tratamiento que tienen un costo-eficacia positivo, ya que la administración de fármacos a los que se tiene resistencia supone un desembolso económico innecesario.37,50 El gasto que se genera cuando un paciente presenta falla al tratamiento se incrementa, ya que las enfermedades por microorganismos oportunistas, hospitalización y utilización de servicios de diagnóstico aumentan; por tanto, se requieren medicamentos adicionales para su control, más personal para la atención del paciente y por último se produce una disminución en la productividad del paciente, aumento de incapacidades y un impacto en la economía nacional.37,50

BIBLIOGRAFÍA 1. Krambovitis E, Porichis F, Spandidas DA. HIV entry inhibitors: a new generation of antiretroviral drug. Acta Pharmacol Sin, 2005;26:1165-1173. 2. Clavel F, Hance AJ. Medical progress: HIV drug resistance. N Engl J Med, 2004;350:1023-1035. 3. Vigano A, Schneider L, Giacomet V, Bianchi R, Cicero ML, Soster F, Bulgheroni E, Rusconi S. Efficacy and tolerability of multiple drug therapy in HIV-1 infected children. J Infect, 2005;50:404-411.

4. Gerreti AM, Easterbrook P. Antiretroviral resistance in clinical practice. Int J STD AIDS, 2001;12:145-153. 5. Kuritzkes DR. Extending antiretroviral therapy to resourse-poor setting: implications for drug resistance. AIDS, 2004;18(Suppl. 3):45-48. 6. Luzzi GA, Peto TEA, Weiss RA, Conlon CP. HIV and AIDS. En: Warrell DA, Cox TM, Firth JD, Benz EJ. Oxford Textbook of medicine. 4a. ed. Oxford, United States of America: Oxford University Press, 2003. Pág 1-37

www.FreeLibros.me


164

Capítulo 13

Mecanismos moleculares de resistencia del virus de la inmunodeficiencia humana a los antirretrovirales

7. Potter SJ, Beng Chew CB, Steain M, Dwyer DE, Saksena. Obstacles to successful antiretroviral treatment of HIV-1 infection problems and perpectives. Indian J Med Res, 2004;119:217-237. 8. Turner D, Brenner B, Routy JP, Moisi D, Rosberger Z, Roger M, Wainberg MA. Diminished representation of HIV-1variants containing select drug resistance conferring mutations in primary HIV-1 infection. J Acquir Immune Defic Syndr, 2004;37:1627-1631. 9. Morten HN, Finn SP, Jorgen K. Molecular strategies to inhibit HIV-1 replication. Retrovirology, 2005;2:10-30. 10. Nisole S, Saïb A. Early steps of retrovirus replicative cycle. Retrovirology, 2004;1:9-28. 11. Rousseau MN, Vergne L, Montes B, Peeters M, Reynes J, Delaporte E, Segondy M. Patterns of resistance mutations to antiretroviral drugs in extensively treated HIV-1-infected patients with failure of highly active antiretroviral therapy. JAIDS, 2001;26:36-43. 12. Soto RLE, Hernández TG, Varela TC, León JEA, Vázquez VE. Guía de manejo antirretroviral de las personas que viven con el VIH/SIDA. 1a. ed. México: Secretaría de Salud, 2004;1-160. 13. Hatano H, Deeks SG. Drug resistant HIV. BMJ, 2007;334:11241125. 14. Thaker HK, Snow MH. HIV viral suppression in the era of antiretroviral therapy. Posgrad Med J, 2003;36-42. 15. Kilby JM, Eron JJ. Novel therapies based on mechanisms of HIV-1 cell entry. N Engl J Med, 2003;348:2228-2238. 16. Jamjian MC, McNicholl IR. Enfuvirtide: first inhibitor for treatment of HIV infection. Am J Health Syst Pharm, 2004;61:1242-1246. 17. Shaheen F, Collman RG. Co-receptor antagonists as HIV-1 entry inhibitors. Curr Opin Infect Dis, 2004;17:7-16. 18. Miller V. Resistance to protease inhibitors. JAIDS, 2001;26(Suppl. 1):34-50. 19. Shafer RW. Genotypic testing for human immunodeficiency virus type 1 drug resistance. Clin Microbiol Rev, 2002;15:247-277. 20. Loveday C. Nucleoside reverse transcriptase inhibitor resistance. JAIDS, 2001;26(Suppl. 1):10-24. 21. Podzorski RP. HIV genotyping: we can’t resist. Rev Med Microbiol, 2003;14:25-34. 22. Lataillade M, Kozal MJ. The hunt for HIV-1 integrase inhibitors. AIDS Patient Care STDS, 2006;20:489-501. 23. Nair V, Chi G. HIV integrase inhibitors as therapeutic agents in AIDS. Rev Med Virol, 2007;17:277-295. 24. Kuritzkes DR. Preventing and managing antiretroviral drug resistance. AIDS Patient Care STDs, 2004;18:259–273. 25. Liuzzi G. Genotipic resistance test for the management of the patients failing highly active antiretroviral therapy: the resistance pattern in different biological compartments. Sacand J Infect Dis, 2003;35(Suppl. 106):90-93. 26. Richman DD, Schooley RT, Kuritzkes DR, Saag MS, Eron JJ. Utilizing HIV drug resistance test reports. UCSD, 2003;5:47. 27. Bangsberg DR, Moss AR, Deeks SG. Paradoxes of adherence and drug resistance to HIV antiretroviral therapy. J Antimicrob Chemother, 2004;53:696-699. 28. Aceti A. Genotipic resistance test in the management of the HIV-infected patient at virological failure. Scand J Infect Dis, 2003;35(Suppl. 106):61-104.

29. Nájera R, Delgado E, Pérez AL, Thomson MM. Genetic recombination and its role in the development of the HIV-1 pandemic. AIDS, 2000;16(Suppl. 4):S3-S16. 30. Johnson VA, Brun VF, Clotet B, Kuritzkes DR, Pillay D, Schapiro JM, Richman DD. Update of the drug resistance mutations in HIV-1: Fall, 2006. Top HIV Med, 2006;14(3):125130. 31. Pierson TC, Doms RW, Pohlmann S. Prospects of HIV-1 entry inhibitors as novel therapeutics. Rev Med Virol, 2004;14:255-270. 32. Kantor R, Katzenstein D. Drug resistance in non-subtype B HIV-1. J Clin Virol, 2004;29:152-159. 33. Clotet B, Menéndez AL, Ruiz L, Tural C, Brun VF, Loveday C, Burger D, Schapiro J, Boucher CH, D’Aquila R, Richman D. Guía para el manejo de las resistencias en la infección por el VIH y de las farmacocinéticas de los antirretrovirales. 2a. ed. Barcelona: TAISA, 2002;1-313 34. Jones G, Ledford RM, Yu F et al. In vitro resistance profile of HIV-1 mutants selected by the HIV-1 integrase inhibitor, GS-9137 (JTK-303). 14th Conference on Retroviruses and Opportunistic Infections. February 25-28, 2007. Los Angeles. Abstract 627. 35. Deroo S, Robert I, Fontaine E, Lambert C, Plesseria JM, Arendt V, Staub T, Hemmer R, Schneider F, Schmit JC. HIV-1 subtypes in Luxemburg, 1983-2000. AIDS, 2002;16:24612467. 36. Shafer RW, Schapiro JM. Drug resistance and antiretroviral drug development. J Antimicrob Chemother, 2005;55:817820. 37. Richman DD. Benefits and limitations of testing for resistance to HIV drugs. J Antimicrob Chemother, 2004;53:555– 557. 38. The EuroGuidelines group for HIV resistance. Clinical and laboratory guidelines for the use of HIV-1 drug resistance testing as part of treatment management: recommendations for the European setting. AIDS, 2001;15:309-320. 39. Wensing A, Boucher C. Worldwide transmision of drug-resistant HIV. AIDS Rev, 2003;5:140-155. 40. Lazzari S, Felici A, Sobel H, Bertagnolio S. HIV drug resistance surveillance: summary of an april 2003 WHO consultation. AIDS, 2004;18:S49-S53. 41. Girardi E. Epidemiological aspects of transmitted HIV-1 drug resistance. Scand J Infect Dis, 2003;35(Suppl. 106):17-20. 42. Chaix ML, Descamps D, Harzic M, Schneider V, Deveau C, Tamalet C, Pellegrin I, Izopet J, Ruffault A, Masquelier B, Meyer L, Rouzioux C, Brun-Vezinet F, Costagliola D. Stable prevalence of genotypic drug resistance mutations but increase in non-B virus among patients with primary HIV-1 infection in France. AIDS, 2003;17:2635-2643. 43. Soares MA, Brideiro RM, Tanuri A. Primary HIV-1 drug resistance in Brazil. AIDS, 2004;18(Suppl. 3):9-13. 44. Brindeiro RM, Díaz RS, Sabino EC, Morgado MG, Pires IL, Brigido L, Dantas MC, Barreira D, Teixeira PR, Tanuri A. Brazilian network for drug resistance surveillance. Brazilian network for HIV drug resistance surveillance (HIVBresNet): a survey of chronically infected individuals. AIDS, 2003;17:1063-1069. 45. Weinstock HS, Zaidi I, Heneine W, Bennett D, García LJG, Douglas JM Jr, LaLota M, Dickinson G, Schwarcz S, Torian

www.FreeLibros.me


Bibliografía L, Wendell D, Paul S, Goza GA, Ruiz J, Boyett B, Kaplan JE. The epidemiology of antiretroviral drug resistance among drug-naive HIV-1-infected persons in 10 US cities. J Infect Dis, 2004;189:2174-2180. 46. Derdelinckx I, Van Laethem K, Maes B, Schrooten Y, De Wit S, Florence E, Fransen K, Ribas SG, Marissens D, Moutschen M, Vaira D, Zissis G, Van Ranst M, Van Wijngaerden E, Vandamme AM. Current levels of drug resistance among therapy-naive HIV-infected patients have significant impact on treatment response. J Acquir Immune Defic Syndr, 2004;37:1664-1666. 47. Escoto DM, Vázquez VE, Ramírez RM, Corona NA, Amaya TG, Quintero PN, Panduro CA, Torres MBM. Drug-resistance

165

mutations in antiretroviral-naive patients with established HIV-1 infection in Mexico. HIV Med, 2005;6:403-409. 48. Smith D, Moini N, Pesano R, Cachay E, Aiem H, Lie Y, Richman D, Little S. Clinical utility of HIV standard genotyping among antiretroviral-naive individuals with unknown duration of infection. Clin Infect Dis, 2007;44:456-458. 49. Kantor R, Katzenstein D. Polymorphism in HIV non-subtypes protease and reverse transcriptase and its potential impact on drug susceptibility and drug resistance evolution. AIDS Rev, 2003;5:25-35. 50. Richman DD. HIV chemotherapy. Nature, 2001;410:9951001.

www.FreeLibros.me


Capítulo

14

Biología molecular y evolución de las primeras células Dr. en C. Arturo Becerra Bracho

que la comparación de secuencias de aminoácidos o de nucleótidos permitía no sólo la construcción de filogenias moleculares, sino también, en algunos casos, datar los procesos de especiación aun cuando se carezca de información paleontológica. Durante cerca de 10 años, este enfoque permitió no sólo comparar proteínas como las hemoglobinas, el citocromo C, las ferrodoxinas y otras más, sino también construir árboles evolutivos que podían incluir organismos tan distintos entre sí como las bacterias y los hongos, lo cual hubiera sido imposible con los criterios morfológicos tradicionales. Sin embargo, estos cambios han abierto nuevos debates, sobre todo en la apreciación del alcance y los límites de las metodologías moleculares. Algunos ejemplos de esta controversia se dan en la caracterización de las primeras células, el origen de los diferentes componentes de la célula eucarionte, y en la validez de los sistemas taxonómicos tradicionales. Es claro que el desarrollo pleno del potencial de las filogenias moleculares dependerá no sólo de refinamientos metodológicos que permitan mejorar los algoritmos que se usan para reconstruir la historia evolutiva con datos moleculares, sino también del análisis crítico de su armazón teórica, que incluye varios conceptos centrales adoptados directamente por la biología molecular de la teoría clásica evolutiva. El reconocimiento de que los genomas son documentos históricos de los cuales se puede extraer información

BIOLOGÍA MOLECULAR Y ESTUDIO DE LA EVOLUCIÓN La biología molecular se ha convertido en uno de los campos más prometedores de la investigación científica, ya que su rápido desarrollo ha permitido no sólo describir procesos celulares inéditos, sino también provocado verdaderas revoluciones conceptuales dentro de las ciencias naturales. Sin duda, la biología evolutiva ha sido una de las áreas más beneficiadas, pues pudo instituir nuevas herramientas con las que es factible escudriñar en lo más íntimo de las relaciones filogenéticas, generando hipótesis que hubieran sido imposibles con los métodos ordinarios. “Cuando no se dispone de evidencia paleontológica, la relación filogenética entre los animales puede ser deducida basándose en la similitud de las estructuras de las formas actuales”, escribió George H. Nutall, en 1904, cuando publicó un libro donde resumía los resultados obtenidos de la comparación de sueros sanguíneos entre diferentes animales, con la intención de reconstruir las relaciones evolutivas que dichos organismos guardaban entre sí, siendo este el primer intento de usar caracteres moleculares como marcadores filogenéticos. Sin embargo, no fue sino hasta 1965 cuando Emile Zuckerkandl y Linus Pauling publicaron un trabajo en donde mostraban 166

www.FreeLibros.me


Cenancestro o último ancestro común de los linajes celulares

evolutiva ha incrementado el margen de estudios filogenéticos a muy alto nivel. El surgimiento de las técnicas de análisis de los ácidos nucleicos, que ha permitido la secuenciación de genomas completos, combinado con el rápido desarrollo de la informática, ha llevado no sólo a un crecimiento explosivo de información en los bancos de datos y nuevas herramientas complejas para su análisis, sino también al reconocimiento de que diferentes macromoléculas pueden funcionar como cronómetros moleculares en la reconstrucción de filogenias universales. El trabajo de este tipo más destacado ha sido la comparación evolutiva de las subunidades pequeñas del RNA ribosómico (RNAr), que permitió la construcción de un árbol sin raíz en el que todos los organismos conocidos quedaron agrupados en uno de los tres linajes celulares: Bacteria, Archaea y Eucarya (Woese et al., 1990). Aunque este tipo de análisis se puede criticar por su carácter reduccionista, es evidente que la identificación de estos tres linajes no es una ilusión provocada por el uso de una sola molécula como marcador evolutivo (fig. 14-1). Por ejemplo, en 1999 tres grupos de trabajo demostraron, de modo independiente, que la representación gráfica del contenido total de secuencias en los genomas completos secuenciados mostró cómo los tres dominios y las distintas líneas biológicas que las constituyen se pueden identificar sin problemas (Snel et al., 1999; Tekaia et al., 1999a; Fitz y House, 1999). Por otro lado, también es cierto que la congruencia entre los árboles de RNAr y otras moléculas no siempre es ideal, ya que se han encontrado topologías que se escapan de lo esperado (Rivera y Lake, 1992; Gupta y Golding, 1993).

Bacteria

Archaea

Eucarya

Cenancestro DNA, RNA, proteínas

RNA, proteínas

Mundo del RNA

Origen de la vida

Figura 14-1

Reconstrucción filogenética de los tres dominios celulares, basada en 16s/18s RNAr, y su extrapolación al pasado prebiótico.

167

Sin embargo, diferentes reconstrucciones de árboles filogenéticos con base en las polimerasas de DNA y RNA, los factores de elongación, las subunidades hidrófilas de ATPasas, las proteínas ribosómicas y un número cada vez más grande de enzimas biosintéticas han confirmado una y otra vez la existencia de los tres principales linajes celulares (Doolittle y Brown, 1994; Doolittle, 1999).

CENANCESTRO O ÚLTIMO ANCESTRO COMÚN DE LOS LINAJES CELULARES Aunque los tres linajes celulares están separados por una enorme distancia evolutiva, es evidente que todos ellos provienen de un ancestro común. Sin embargo, tanto la distancia filogenética que hay entre los tres linajes como las diferencias moleculares que los separan llevaron a Woese y Fox (1977) a sugerir que el ancestro común era una entidad mucho más simple que cualquier procarionte, en donde operaba una versión aún rudimentaria de la expresión de la información genética. Es decir, Woese y Fox supusieron que en el punto de la trifurcación de los tres linajes celulares había habido una entidad biológica hipotética a la que llamaron progenote, y en la cual, a diferencia de lo que ocurre con los organismos contemporáneos, la separación entre genotipo y fenotipo aún no se había completado del todo. No era fácil aceptar esta idea. Es evidente que los organismos contemporáneos debieron haber sido precedidos por sistemas mucho más simples, pero la probabilidad de que el último ancestro común de las eubacterias, las arqueobacterias y el nucleocitoplasma de los eucariontes fuera un progenote resultaba difícil de conciliar con la similitud y la complejidad de los procesos moleculares básicos de cada uno de los linajes. Por otra parte, aunque se pueden proponer esquemas evolutivos que conduzcan a la separación simultánea de tres o más linajes, los eventos de especiación suelen ser dicotómicos; es decir, de un grupo ancestral se derivan dos. Por último, el grupo de Wolfram Zillig demostró, mediante respuestas inmunitarias cruzadas, que las subunidades de las polimerasas de RNA (DNA dependiente) de los eucariontes eran más parecidas en número y estructura a las de las arqueobacterias que cualquiera de ellas a la de las eubacterias. Ello sugería la existencia de una afinidad evolutiva entre las arqueobacterias y el nucleocitoplasma, o sea que ambos tenían un origen común. Sin embargo, el árbol de los 16/18S RNAr obtenido por Woese y Fox carece de raíz, es decir, no posee una polaridad que indique el orden temporal en que divergieron los tres linajes. En otras palabras, la representación gráfica de las relaciones entre las secuencias de los RNAr no permite deducir cuál de los tres fenotipos es el más antiguo. La comparación de las diferencias y similitudes que existen entre los tres linajes permite, en principio, cono-

www.FreeLibros.me


168

Capítulo 14

Biología molecular y evolución de las primeras células

cer no sólo la relación evolutiva que guardan entre ellos, sino también las características de su ancestro, al que Walter Fitsch designó como cenancestro. Aunque hace un decenio las bases de datos no poseían la riqueza de nuestros días, tenían la información suficiente para intentar asomarse a los rasgos del último ancestro. A pesar de las limitaciones de esta metodología (que incluye, de manera destacada, el problema del transporte horizontal de genes), los resultados fueron notables: todo indicaba que el cenancestro poseía, entre otros: a) un sistema de transcripción y traducción de tipo moderno, que incluía ribosomas con proteínas, factores de transcripción y una polimerasa de RNA, DNA dependiente oligomérica; b) metabolismo energético dependiente de ATPasas asociadas a membranas; c) biosíntesis de aminoácidos, nucleótidos y coenzimas, y d) presencia de un genoma de DNA (Iwabe et al., 1989; Lazcano et al., 1992). Es decir, todo indica que el último ancestro común a los tres linajes celulares (y por tanto de todos los seres vivos) tenía la complejidad equivalente a la de cualquier procarionte contemporáneo, y no era un progenote (Lazcano, 1995). La reconstrucción de etapas ancestrales ha adquirido una perspectiva totalmente novedosa gracias a la disponibilidad, a partir de 1995, de un número creciente de genomas celulares por completo secuenciados. Como habían afirmado desde 1965 Zuckerkandl y Pauling, la historia evolutiva de un organismo está contenida en su genoma. Sin embargo, a menudo esta información es difícil de interpretar, debido a una serie de fenómenos biológicos que van desde la falta de preservación de la estructura primaria de los genes, hasta la existencia de niveles de redundancia de las secuencias cuya naturaleza no entendemos del todo, pasando por el transporte horizontal, una de las peores pesadillas que tienen que enfrentar los biólogos evolutivos. Esto llevó a reconstrucciones prematuras que generaron una fuerte polémica que no ha sido superada del todo. Por tanto, siempre partiremos de una muestra incompleta y en ocasiones errónea cuando tratemos de conocer la naturaleza de las etapas ancestrales, por lo que se debe tener mucho cuidado en la extrapolación de nuestros resultados a lo ocurrido en el pasado, en especial cuando se habla del último ancestro de los seres vivos (Becerra et al., 1997). Como se muestra en la figura 14-2, en principio sería fácil detectar el conjunto de genes del cenancestro, ya que éste estaría definido por el conjunto de secuencias presentes en la intersección de los conjuntos que representan los genomas de Archaea, Bacteria y Eucarya. Sin embargo, en la práctica esta reconstrucción ha sido limitada por: a) el hecho de que los genomas secuenciados no reflejan la diversidad biológica real; b) los distintos niveles de conservación de los genes, que distan mucho de ser los mismos para todas las secuencias; c) los problemas en la anotación e identificación de las secuencias presentes

Bacteria

Archaea

Cenancestro

Eucarya

Figura 14-2

Los genes del cenancestro (último ancestro) se pueden definir por el conjunto de secuencias presentes en la intersección de los conjuntos que representan los genomas de Archaea, Bacteria y Eucarya.

en las bases de datos; d) la presencia de secuencias altamente conservadas, cuya función es aún completamente desconocida por no disponer de datos experimentales; e) la pérdida polifilética, es decir, independiente, de secuencias, funciones y vías metabólicas que han sufrido diversos organismos, sobre todo parásitos y simbiontes, y f) el transporte lateral de los genes, que en algunos casos pueden traspasar las fronteras que separan a los grandes dominios (Becerra et al., 2007). Ante un inventario de dificultades como éste, parecería ser imposible definir con precisión los rasgos del último ancestro común; sin embargo, los resultados son alentadores. Por ejemplo, el transporte horizontal de secuencias es un fenómeno real que enturbia la reconstrucción del pasado. Por ejemplo, se sabe que incluso los operones del RNAr pueden llegar a sufrir este fenómeno, pero el hecho de que se mantenga la identidad de los grupos de microorganismos sugiere que hay limitaciones biológicas al intercambio de genes. A pesar de la promiscuidad con la que los seres vivos han intercambiado genes a lo largo de la evolución, la reconstrucción del pasado es posible (Snel et al., 1999; Tekaia et al., 1999a; Fitz y House, 1999), y en especial la caracterización del último ancestro común (Koonin 2003, Yang et al., 2005, Delaye et al., 2005, Ouzounis et al., 2006, Becerra et al., 2007).

www.FreeLibros.me


Conclusiones

NATURALEZA DE LA CÉLULA EUCARIONTE La descripción tripartita del mundo viviente desarrollada por Woese ha sido rechazada por varios investigadores, que arguyen que los dos grupos procariontes (es decir, las eubacterias y las arqueobacterias) son en realidad uno solo, ya que independientemente de las diferencias al nivel molecular, ambos son procariontes (Mayr, 1990; Margulis y Guerrero, 1991; Cavalier, 1992). Además, debido a su naturaleza cladista, los árboles filogenéticos moleculares no permiten representar los procesos de anastomosis que se dieron entre los linajes durante la formación de los diferentes componentes de la célula eucarionte. Así, Margulis y Guerrero (1991) han argumentado que si bien la cladística molecular es la principal herramienta en la reconstrucción filogenética, las clasificaciones taxonómicas no se pueden basar únicamente en la comparación evolutiva de macromoléculas, sino también en la información que brindan las vías metabólicas, la citología, la morfología ultraestructural, los datos bioquímicos, los ciclos de vida, y, cuando estén disponibles, el registro paleontológico y la evidencia geoquímica. En 1967, Margulis propuso que las células eucariontes eran en realidad minúsculas comunidades microbianas que habían resultado de una serie de sucesos endosimbióticos, es decir, que las células nucleadas habían sido precedidas por procariontes que luego se asociaron simbióticamente. Aunque había circulado en algunos medios científicos desde finales del siglo XIX la idea de que mitocondrias y cloroplastos eran descendientes de bacterias de vida libre, Margulis (1993) no sólo revivió de manera independiente la teoría endosimbiótica, sino que la articuló y apoyó con una serie de evidencias morfológicas, bioquímicas, genéticas e incluso geológicas tan contundentes, que sus puntos de vista terminaron por ser aceptados incluso por sus críticos más severos. Cuando Margulis propuso por primera vez su teoría endosimbiótica, no estaba clara la naturaleza biológica del hospedador que había alojado a las bacterias que luego se convirtieron en mitocondrias, cloroplastos y undulipodia, es decir, no se tenía una idea precisa sobre el origen del nucleocitoplasma. Los micoplasmas, parásitos intracelulares que carecen de pared celular, parecían ser buenos candidatos, debido a su metabolismo estrictamente fermentativo (como el del citoplasma eucarionte), y a que la ausencia de pared hubiera facilitado la entrada de los endosimbiontes. La idea de la endosimbiosis fue ganando cada vez más adeptos y pronto se convirtió en una de las bases de la clasificación de los seres vivos en cinco reinos. Así, a pesar de que para entonces era cada vez más evidente la existencia de algunas diferencias en los procesos de replicación y expresión genética entre

169

los procariontes y los eucariontes, hacia mediados del decenio de 1970 casi todos los biólogos consideraban que todos los componentes de las células nucleadas provenían de un mismo linaje bacteriano. Las filogenias moleculares han determinado, sin duda, el origen endosimbiótico de los plástidos y la mitocondria. Sin embargo, un número importante de árboles filogenéticos sugieren que buena parte del nucleocitoplasma eucarionte se originó de una célula arqueobacteriana (y no de una bacteria tipo micoplasma) cuyos descendientes conforman al grupo monofilético de los eucariontes (Gogarten-Boekels y Gogarten, 1994). Como afirmaron Woese et al., aunque la presencia de endosimbiontes es de importancia central para los eucariontes, es innegable que éstos tienen una única filogenia principal (Wheelis et al., 1992). Mientras este punto de vista asume una continuidad absoluta entre el nucleocitoplasma y su antepasado directo, los argumentos holistas de Margulis y Guerrero (1991), Cavalier-Smith (1992), y otros más, destacan la emergencia evolutiva de un nuevo tipo de célula como resultado de fenómenos endosimbióticos. Por tanto, el suceso principal de transición a eucariontes fue la adquisición evolutiva de simbiontes intracelulares y, en consecuencia, se puede afirmar que la rama de los eucariontes de los tres linajes celulares propuesta por Woese no representa a las células eucariontes en su conjunto, sino únicamente parte de su compleja historia.

CONCLUSIONES Aunque en los últimos años la relación entre la biología molecular y el estudio de las filogenias celulares ha enfrentado un número enorme de críticas y conflictos, el rápido desarrollo de las bases de datos de secuencias moleculares ha proporcionado una visión única de la evolución de las células procariontes y eucariontes, abriendo nuevas perspectivas en varios campos de las ciencias naturales. La evolución molecular resultó originalmente de la unión de la biología molecular con las ideas neodarwinistas, pero hoy en día se ha transformado en un campo con identidad propia. Sin embargo, su desarrollo pleno requiere no sólo de la puesta en práctica de técnicas de secuenciación menos caras y más rápidas, de algoritmos y computadoras más poderosas para la reconstrucción de hipótesis filogenéticas, sino, sobre todo, del incremento del conocimiento de su objeto de estudio, así como definiciones más precisas de su marco conceptual. Pocas tareas resultan tan complejas y difíciles, como la reconstrucción del pasado biológico. Si bien es cierto que en el marco de la teoría evolutiva es fácil aceptar la existencia de sistemas ancestrales más simples de los cuales descienden los organismos actuales, su estudio no es una tarea fácil, sobre todo si, como ocurre en el caso del cenancestro, hay que remontarse a épocas precám-

www.FreeLibros.me


170

Capítulo 14

Biología molecular y evolución de las primeras células

bricas. La reconstrucción de etapas ancestrales es una tarea multidisciplinaria e interdisciplinaria que tiene que recurrir a actitudes eclécticas que apelen a metodologías que van desde las discusiones sobre el medio primitivo, hasta la anotación automatizada de las secuencias de genomas completos. Los resultados pueden ser confusos. Por ejemplo, la conservación de las secuencias de las ATPasas implica la existencia de membranas de lípidos y fosfolípidos, aunque no podemos saber cuál era la naturaleza quími-

ca de estas últimas. A pesar de estas dificultades, resulta asombroso que haya secuencias, estructuras y funciones, como las que participan en la expresión de la información genética, que se han conservado a lo largo de miles de millones de años. La lectura de estas crónicas moleculares que se han mantenido desde épocas precámbricas nos permite asomarnos, aunque sea de manera limitada, al interior de los procesos biológicos de las células que antecedieron a todas las formas de vida que existen hoy en nuestro planeta.

BIBLIOGRAFÍA Becerra A, Islas S, Leguina JI, Lazcano A. Polyphyletic gene losses can bias backtrack characterization of the cenancestor. J Mol Evol, 1997;45:115-118. Becerra A, Delaye L, Islas S, Lazcano A. The very early stages of biological evolution and the nature of the last common ancestor of the three major cell domains. Annu. Rev. Ecol. Evol. Syst. 2007 38:361-379 Cavalier T. The number of symbiotic origins of organelles. Biosystems, 1992;28(1-3):91-106. Delaye L, Becerra A, and Lazcano A, The last common ancestor: What’s is a name? Orig Life Evol Biosph. 2005;35:537-554 Doolittle WF. Phylogenetic classification and the universal tree. Science, 1999;284:2124-2128. Doolittle WF, Brown JR. Tempo, mode, the progenote and the universal root. Proc Natl Acad Sci USA, 1994;91:67216728. Fitch WM, Upper K. The phylogeny of tRNA sequences provides evidence of ambiguity reduction in the origin of the genetic code. Cold Spring Harbor Symp Quant Biol, 1987;52:759767. Fitz GST, House CH. Whole genome-based phylogenetic analysis of free-living microorganisms. Nucleic Acid Res, 1999;27:4218-4222. Gogarten BM, Gogarten JP. The effects of heavy meteorite bombardment on the early evolution of life-a new look at the molecular record. Origins of Life and Evol Biosph, 1994;25:7883. Gogarten JP, Kibak H, Dittrich P, Taiz L, Bowman EJ, Bowman BJ, Manolson ML, Poole J, Date T, Oshima KL, Denda K, Yoshida M. Evolution of the vacuolar H+-ATPase, implications for the origin of eukaryotes. Proc Natl Acad Sci USA, 1989;86:6661-6665. Gupta RS, Golding GB. Evolution of HSP70 gene and its implications regarding relationships between archaebacteria, eubacteria, and eukaryotes. J Mol Evol, 1993;37:573-582. Iwabe N, Kuma K, Hasegawa M, Osawa S, Miyata T. Evolutionary relationship of archaebacteria, eubacteria, and eukaryotes inferred from phylogenetic trees of duplicated genes. Proc Natl Acad Sci USA, 1989;86:9355-9359.

Kandler O. The early diversification of life. En: Bengtson S (ed.). Early life on earth, Nobel Symposium No. 84. New York: Columbia University Press, 1994;124-131. Koonin EV, Comparative genomics, minimal gene set and the last universal common ancestor. Nat Rev 2003;1:127-136. Lazcano A. Cellular evolution during the early archaean: what happended between the progenote and the cenanestor? Microbiologia SEM, 1995;11:1-13. Lazcano A, Fox GE, Oró J. Life before DNA, the origin and evolution of early archean cells. En: Mortlock RP (ed.). The evolution of metabolic function. Boca Raton: CRC Press, 1992;237-295. Margulis L. Symbiosis in cell evolution. Tomado de New York: W.H. Freeman Press, 1993;452. Margulis L, Guerrero R. Kingdoms in turmoil. New Scientist, 1991;132:46-50. Mayr E. A natural system of organisms. Nature, 1990;348:491. Nuttall GHF. Blood immunity and blood relationship: a demonstration of certain blood-relationships among animals by means of the precipitation test for blood. Tomado de Cambridge: Cambridge University Press, 1904. Review Ouzounis AC, Kunin V, Darzentas N, Goldovsky L. A minimal estimate for gene content of the last universal common ancestor. Res Microbiol, 2006;157:57-68. Rivera MC, Lake JA. Evidence that eukaryotes and eocyte prokaryotes are immediate relatives. Science, 1992;257:7476. Snel B, Bork P, Huynen MA. Genome phylogeny based on gene content. Nature Genetics, 1999;21:108-110. Tekaia F, Dujon B. Pervasiveness of gene conservation and persistence of duplicates in cellular genomes. J Mol Evol, 1999;49:591-600. Tekaia F, Lazcano A, Dujon B. The genomic tree as revealed from whole proteome comparisons. Genome Research, 1999;9:550-557. Wheelis ML, Kandler O, Woese CR. On the nature of global classification. Proc Natl Acad Sci USA, 1992;89:2930-2934. Woese CR. Bacterial evolution. Microbiol Reviews, 1987;51:221271.

www.FreeLibros.me


BibliografĂ­a Woese CR, Fox GE. The concept of cellular evolution. Jour Mol Evol, 1977;10:1-6. Woese CR, Kandler O, Wheelis ML. Towards a natural system of organisms, proposal for the domains Archaea, Bacteria, and Eucarya. Proc Natl Acad Sci USA, 1990;87:4576-4579.

171

Yang S, Doolittle RF, Bourne PE, Phylogeny determined by protein domain content. Proc Natl Acad Sci. USA 2005;103: 73-78 Zuckerkandl E, Pauling L. Molecules as documents of evolutionary history. J Theoret Biol, 1965;8:357-366.

www.FreeLibros.me


www.FreeLibros.me


Índice alfabético

Los números de página seguidos de f indican figuras y los seguidos por c, cuadros.

A Ácidos nucleicos, 17-30 biomoléculas, 17 composición, 17-19 ácido desoxirribonucleico (DNA), 17 ácido ribonucleico (RNA), 17 componentes característicos, 17-19, 18f bases nitrogenadas, 17 fosfato, 19, 19f pentosas, 18-19, 18f descubrimiento, 19-20 “ácido nucleico”, 19 cronología, 20, 20c diferencias entre DNA y RNA, 20 factor transformante de S. pneumoniae, 20 “nucleína”, 20 perspectivas, 30 secuencias de varios genomas, 30 Adenoasociados, virus (AAV), 125 cura eventual para la hemofilia, 125 Alfaaminoácidos, 5 Alimentaria, industria, 118-119 de bebidas, 118 bioluminiscencia, 119 clonación de enzimas usadas en alimentación, 118 detección de patógenos, 119 levaduras, producción de nuevas cepas, 118 mejoras para los productos lácteos, 118 plantas, 119-120 capacidad de regeneración, 119 biobalística, 119 cultivos transgénicos de mango y tomate, 120 fuente de medicamentos valiosos, 119 ingeniería genética de semillas, 119 mejora de cultivos, 119 microorganismo Agrobacterium tumefasciens, 119 primeras pruebas de ensayo, 119 propiedades bioquímicas de los cultivos, 119 resistencia a insectos, virus, hongos, 120 productos que incluyen aditivos alimentarios, 118 seguridad microbiológica de los alimentos, 119 uso de microorganismos lácticos, 118

Alzheimer, enfermedad de, 138-140 aspectos moleculares, 138-139 cascada de la degeneración neuronal, 138, 139f precursor de la proteína amiloide, 138 aspectos neuroquímicos, 139-140 activación de receptores muscarínicos, 139 elementos citoesqueléticos, 140 patología de la proteína τ, 140 curso clínico, 138 aspectos morfopatológicos, 138 neurofibrillas intracelulares, 138 placas seniles, 138 pérdida progresiva de neuronas con atrofia cerebral, 138 reducción de marcadores colinérgicos, 138 modelos de estudio, 140 estrategias para intervenir en transmisión colinérgica, 140 mecanismos de inducción de la EA, 140 Aminoácidos, 5-7 alfaaminoácidos, 5 cadenas laterales ácidas, 7 aspartato y glutamato, 7, 8f cadenas laterales, 6 alanina, 6, 6f glicina, 6, 6f prolina, 6, 7f valina, leucina e isoleucina, 6, 6f cadenas laterales aromáticas, 7, 7f cisteína, 7, 7f histidina, 7, 8f lisina y arginina, 7, 7f serina y treonina, 7, 7f tirosina, 7, 7f triptófano, 7 enlace peptídico, 5 estereoisómeros, tipos, 6 estructura básica, 6, 6f propiedades acidobásicas, 6 simbología y propiedades, 6, 6c Aminoacilsintetasa, 72 interacción del brazo aceptor y del anticodón, 72, 72f Aminoglucósidos, 83-84 efecto bactericida, 84

173

www.FreeLibros.me


174

Índice alfabético

Aminoglucósidos (cont.) mecanismo de acción, 83 efectos pleiotrópicos, 83 rasgos químicos, 83 Antibióticos para inhibir síntesis de proteínas, 83-85. Véase también fármaco específico, p. ej., Eritromicina; Tetraciclinas formación del enlace peptídico, 84 inhibidores de factores de elongación, 84 de translocación, 84 interferencia con el ribosoma, 83 Antígeno de proliferación nuclear (PCNA), 126 Antirretroviral, tratamiento, 154-163 beneficios a infectados por VIH, 155, 156c causas de la falla de, 158 factores farmacológicos, 158 inadecuada adherencia, 158 replicación viral en los “santuarios”, 158 resistencia a los ARV, 158 objetivo de tratamiento, 155 Antisentido, terapia, 126-127, 127f interrupción del flujo de información genética, 126 mecanismo, 126-127 bloqueo directo del mensajero, 127 características de moléculas antisentido, 126-127 hibridación, base específica, 126 interrupción de la expresión del gen, 127 rotura del híbrido RNA-DNA por enzima ribonucleasa H, 126 propósito, 127 asociar al oligonucleótido con un portador, 127 características de la secuencia, 128 interrumpir al RNAm en célula viva, 127 Apoptosis en sistema nervioso central, 151-152, 152f disregulación, 151 fases del proceso de muerte celular activa, 151 necrosis y apoptosis, tipos distintos de muerte celular, 151 vías de transducción de señales, 152 extrínseca o ligada al receptor, 152 intrínseca o apoptosis mediada por mitocondrias, 151 señalización, iniciada por óxido nítrico, 152 B Biobalística, 119 Biología molecular, 1-3 biotecnología, 115-120 cronología de la biología, 1-3 DNA, portador de información genética, 1 estructura del DNA, 1 nucleína, 1 perspectivas y futuro, con la informática, 3 tecnología del DNA recombinante, 1 Biomoléculas, 17 Biopolímeros, 17 Biotecnología, 105, 115-120 antecedentes históricos, 105c ciencias biológicas, 115 definición, 115 desarrollo de la reacción en cadena de polimerasa, 115 industria alimentaria, 118-120 farmacéutica y salud, 116-118 manipulación genética in vitro, 115 mejoras en variedades animales y vegetales, 115 procesos biotecnológicos, 115

técnica del RNA recombinante, 116 clases de vectores, 116 plásmidos, 116 virus bacterianos o fagos, 116 elementos esenciales, 116 enzimas de restricción, 116 ligación o reasociación covalente, 116 replicación e identificación de molécula recombinante, 116 transformación, 116 C Cadena proteínica, maduración, 78-81 tipos de modificaciones, 79 acetilación, 80, 80f acilación, 80 ADP-ribosilación, 81 aminoácidos modificables, 79, 79c carboxilación, 80, 80f desformilación, 79 fosforilación, 79, 80f cinasas de proteína, 80 fosfatasas de proteína, 80 glucosilación, 79 función de los oligosacáridos añadidos, 79 glucosiltransferasas asociadas a membranas, 79 hidroxilación, 80 metilación, 80, 81f metiltransferasas, 80 prenilación, 73-79 unión de radicales terpenoides, 80 proteólisis parcial, 80 puentes disulfuro, 79 Carbomicina, 84 inhibición de formación del enlace peptídico, 84 Carboxicinasa de fosfoenolpiruvato (PEPCK), 90 Cenancestro o último ancestro común de linajes celulares, 167-168, 168f Clonación, 110-112 Cloranfenicol, 84 bacteriostático de amplio espectro, 84 mecanismo de acción, 84 complejo de preinicio, 39 complejo de reconocimiento del origen, 38, 40 Corea de Huntington, 131-132 aspectos moleculares, 131-132 expansión repetitiva del codón CAG en el gen, 131 curso clínico, 131 anormalidades motoras, emocionales y cognitivas, 131 etapas, 131 demencia global, 131 dificultad para pensar, 131 disfagia y disartria, 131 síntomas psiquiátricos, 131 expresión conductual, 131 estrategias para reducir o detener algunas manifestaciones, 133f neuropatología, 132 astrocitosis reactiva, 132 atrofia y pérdida selectiva de neuronas en el SNC, 132 enfermedad de los ganglios basales, 132 neurotoxicología, 132-133 apoptosis, 133 correpresores nucleares y factores de transcripción, 133 factores iniciadores, 133

www.FreeLibros.me


Índice alfabético D Desoxirribonucleico, ácido (DNA), 17, 21-28 compactación, 25-27 cromatina, 26 cromosoma, 26 DNA lineal, 26, 28f fibra solenoide, 27 nucleoide bacteriano, 26 nucleosoma, 27, 27f plectonémica, 25, 26f topoisomerasas, tipos, 25 toroidal, 25 conformaciones de hebra sencilla, triple y cuádruple, 23 estructura G-DNA, 24, 25f representación esquemática del H-DNA, 23, 24f DNA circular, 24, 25f configuración dextrógira, 25 configuración levógira, 25 estructura secundaria, 21 complementariedad entre bases, 22 conformación de doble hélice del DNA, 21, 22f formas alternativas de la doble hélice, 22, 23f huecos asimétricos, 21, 22f leyes de equivalencia de bases nitrogenadas, 21 puentes de hidrógeno, 21f, 22 superenrollamiento de la doble hélice, 23 DNA recombinante, técnica de. Véase Técnicas de DNA recombinante E Edman, degradación de, 14 Electroforesis, 13 autorradiografía, 13 combinada con inmunoelectrotransferencia, 13 Enzimas participantes en la replicación de DNA, 35-36 helicasas, 35-36 estructuras hexaméricas, 35 reconocen sitio de inicio de replicación, 36 ligasas, 36-37, 38f mecanismos de acción, 36-37 polimerasa de DNA, 35 subunidades, 35, 36f formación de complejo enzimático, 35 tipos, 35 primasas, 36 síntesis de segmento corto de nucleótidos, 36, 37f proteínas ssb, 36 hebras abiertas del DNA, 36 topoisomerasas, 37 clasificación, 37 enzimas que cortan y ligan el DNA, 37 Eritromicina, 84 bacteriostático, 84 mecanismo de acción, 84 bloquea el paso de translocación, 84 Esclerosis lateral amiotrófica, 135-136 aspectos moleculares, 134 reacciones citosólicas de la SODI, 134, 134f curso clínico, 133 característica autosómica dominante, 133 debilidad y espasticidad, 133 parálisis crónicamente progresiva y letal, 13 signos de músculo punzante y debilidad, 133 supervivencia promedio, 133 neuropatología, 134-135 carencia de proteínas, 134

deficiencia en eliminación de radicales libres, 135 vulnerabilidad de neuronas motoras, 134 neurotoxicología, 135 gran actividad de peroxidación, 135 moléculas menos estables, 136 sitios de acción de la SODI mutante, 135 vía aberrante de reacciones oxidativas, 135 variaciones genotípicas y terapias correspondientes, 135, 135c Estereoisómeros, tipos, 6 Eucariontes proceso de transcripción, 49-53 crecimiento, 53 dominio carboxiloterminal, 53 estimuladores, 52, 53f características, 52 reguladores de la expresión génica, 52 factores y elementos 5′, 52 formación del complejo de preiniciación, 49, 51f ensamblaje del complejo de preiniciación, 50, 51f factores de transcripción general asociados a polimerasa de RNA II, 51, 52c síntesis de RNAt, 49 iniciación, 51-52 unión de TBP a TATA, 51 terminación, 53 RNA heterogéneo nuclear, 53 síntesis de proteínas en, 74 Evolución de las primeras células, 166-168 biología molecular y estudio de evolución, 166-167 caracterización de las primeras células, 166 construir árboles evolutivos, 166 reconstrucción filogenética, 167, 167f revoluciones conceptuales, 166 subunidades pequeñas del RNAr, 167 técnicas de análisis de ácidos nucleicos, 167 cenancestro o último ancestro común de linajes celulares, 167 comparación entre los linajes, 168 erogenote, 167 eventos dicotómicos de especiación, 167 genes del cenancestro, 168, 168f genomas celulares,168 rasgos del último ancestro común, 168 naturaleza de la célula eucarionte, 169 adquisición evolutiva de simbiontes intracelulares, 169 clasificación de los seres vivos en cinco reinos, 169 filogenias moleculares, 169 teoría endosimbiótica de Margulis, 169 reconstrucción de etapas ancestrales, 170 F FAK, cinasa de tirosina, 100 Fibrosis hepática, terapia génica en, 125 gen de la telomerasa, 125 inhibición del NF-κB, 125 Fosfato, 19 enlace 3′-5′-fosfodiéster, 19, 20f Fusídico, ácido, 85 uso contra estafilococos resistentes a betalactámicos, 85 G Geles de poliacrilamida en condiciones desnaturalizantes (SDS-PAGE), 13

www.FreeLibros.me

175


176

Índice alfabético

Genotecas, 107-112 clonación, 110-112 construcción del plásmido o complejo de DNA vector-insertos, 110 enzimas de restricción, 110 molécula de DNA con dos extremos, 111, 111f eficiencia del proceso, factores en, 111 enzimas de restricción de endonucleasas, 110 expresión del DNA clonado en un sistema bacteriano, 112 eficiencia del proceso de expresión, 112 sitios de reconocimiento específico, 112 preparación del DNA, 110 limitaciones, 110 vectores de clonación, 108c-109c, 110 procedimiento, 110 transformación, 111-112 cambio transitorio en permeabilidad de membrana, 111 marcaje de un fragmento complementario, 111 uso de anticuerpos marcados, 111 diversas formas y vectores, 108 recolección de DNA complementarios, 107 características, 107 insertos en una orientación específica, 108 vectores de clonación, 108, 108c-109c Glucosilación, 79 H Helicasas, 35-36 estructuras hexaméricas, 35 reconocen sitio de inicio de replicación, 36 Heterotriméricas, proteína G, 90 Hígado como órgano blanco, 123-126 avances en tecnología génica del vector, 124-125 fenómenos de replicación-competente no detectables, 125 plásmidos desnudos, 125 retrovirus, 125 sistema de envío de virus, ventaja, 125 virus adenoasociados, 125 cura eventual para la hemofilia, 125 virus espumantes, 125 capacidad de vectores adenovirales, 125 curvas dosis-respuesta, 126 estrategias terapéuticas para fibrosis hepática, 124 base biológica legítima, 124 liberación de proteínas terapéuticas, 123 prevención de fibrogénesis, 126 terapia génica en fibrosis hepática, 125 terapias actuales, 124 cirrosis hepática, 124 transferir genes en hígados normales o enfermos, 124 vectores de la nueva generación, 126 Hormonas esteroides y superfamilia de receptores a esteroides, 100 regulación de la expresión génica, 100 unión del ligando, efecto en receptores, 100 Huntington, corea de. Véase Corea de Huntington I Industria farmacéutica y salud, 116-118 células sanguíneas en terapia génica, 117 cultivo de células de mamíferos, 117 diagnóstico y tratamiento de trastornos hereditarios, 116 enfermedades infecciosas, 117 medicina forense, 117 muteínas, 116 factor de necrosis tumoral, 117

obtención de proteínas heterólogas, 117 producción de proteínas recombinantes, 116 proteínas terapéuticas, 116 terapia oligonucleotídica, 117 tratamientos futuros basados en ácidos nucleicos, 117 vacunas, 117-118 enfermedades bacterianas y víricas, 117 erradicación de la viruela, 117 estrategias clásicas, 118 medicina veterinaria, 118 vacunas habituales en enfermedades infecciosas, 118 Inmunodeficiencia combinada grave, síndrome, 125 terapia génica en niños con, 125 Inmunodeficiencia humana, virus, resistencia a los antirretrovirales, 154-163 Integrasa, inhibidores de la, 157 elvitegravir, 157 raltegravir, 157 Interleucina 1, 148 Isoelectroenfoque o electroforesis en dos dimensiones, 13 K Kirromicina, 85 L Lewy, cuerpos de, 135-136 Ligasas, 36-37, 38f mecanismo de acción, 36-37 Lincomicina, 84 mecanismo de acción, 84 bloqueo de formación del enlace peptídico, 84 producida por Streptomyces lincolniensis, 84 M Meischer, nucleína de, 20 Monofosfatados, difosfatados y trifosfatados, nucleótidos, 19, 19f N Neuroinmunorregulación, 143 antecedentes, 143-145 activación del sistema serotoninérgico, 145 citocinas efecto en los sistemas de neurotransmisión, 145 efectos sobre el comportamiento, 145 mediadores de comunicación intracelular y extracelular, 145 eje hipotálamo-hipófisis-adrenales, 143-144 flujo recíproco de información de SNC y SI, 143 regulación de la termogénesis, 143 moléculas biológicamente activas, 144 proceso de inflamación dentro del SNC, 145 producción de citocinas, 143 urocortina, 144 “ventana” en barrera hematoencefálica, 144 conexiones anatómicas y fisiológicas entre SNC y SI, 143 importancia de las citocinas, 145 apoptosis en sistema nervioso central, 151-152, 152f célula de la neuroglia, 145 liberación de sustancias neuroactivas, 145 interleucina 1, 148 mecanismos de expresión, síntesis y secreción, 149 interleucina 6, 149-151 familia de las cinasas Janus, 150 inducción de transducción de señales, 150, 150f regulación de funciones inmunes, 150 síntesis de proteínas de fase aguda, 149

www.FreeLibros.me


Índice alfabético mecanismos cognitivos a través de vías colinérgicas y dopaminérgicas, 45 microglia células altamente reactivas, 146 TREM-2, nuevo receptor, 146, 147f NF-κB como activador transcripcional, 147, 148f “receptores tipo TOLL”, 147 sobrerregulación de moléculas MHC de clase II, 146 “reestimulación” de las células T, 146 TNF α, 149 cascadas de sucesos de señalización, 149, 149f citocina proinflamatoria pleiotrópica, 149 vía de señalización de IL-1β en la neuroglia, 147, 149f mensajeros químicos, 143 procesos biológico-moleculares, 143 Neuromelanina, 136 Nitrogenadas, bases, 17, 18f adenina, 17 citosina, 17 guanina, 17 pirimidina, 17 purina, 17 timina, 17 uracilo, 18 O Operón Lac, 60 P Parkinson, enfermedad de, 135-136 aspectos moleculares, 135-136 anormalidad en mecanismos proteolíticos, 136 formación de los cuerpos de Lewy, 136 mutaciones sobre el gen de parkina, 136 posibles genes y modelos de estudio, 136, 136c secuencias de la sinucleína α humana, 135, 136f curso clínico, 135 origen multifactorial, 135 pérdida de reflejos posturales, 135 modelos de estudio en perspectiva de terapia génica, 135, 138c neuropatología, 136 degeneración de células con neuromelanina, 136 neurotoxicología, 136 actividad glutamatérgica, 137 disfunción mitocondrial, 13 estrés oxidativo, 136 generación de radicales libres tóxicos, 137 hipótesis genética, 136 metabolismo alterado de la DA, 344 polimorfismos en gen de monoaminooxidasa B, 137 variaciones genotípicas y perspectivas de terapias, 138c perspectivas de tratamiento y terapia preventiva, 136, 137c Pentosas, 18 comparación estructural de ribosa y 2-desoxirribosa, 18, 18f configuración tipo furano de la ribosa, 18 formación de un nucleósido, 18 orden numeral de los átomos, 18, 19f Péptido, enlace, 7-8, 8f Polimerasa de DNA, 35 subunidades, 35, 36f formación de complejo enzimático, 35 tipos, 35

Polimerasa de RNA, tipos y estructuras, 46-47, 47f eucariontes, 47, 47c estructura de polimerasa RNA tipo II, 47, 47f iniciación de la transcripción, 47 procariontes, 46 núcleo, 47 nucleótidos trifosfatados, 46 subunidades proteínicas, 47 Primasas, 36 síntesis de segmento corto de nucleótidos, 36, 37f Procariontes proceso de transcripción, 47-49 crecimiento, 48, 49f iniciación, 47-48, 48f complejo abierto, 48 complejo cerrado, 47 polimerasa de RNA se une a la cadena molde de DNA, 47 promotores, 48, 48f secuencias de nucleótidos definidas, 48 secuencias consenso y factores transcripcionales, 48, 48c terminación, 48, 49f síntesis de proteínas en, 73-74, 76f Proteínas, 5-15 aminoácidos, 5-7, 6f-8f enlace peptídico, 7-8, 8f estructura, 8-11 cuaternaria, 10-11, 11f arreglo espacial de subunidades de proteína, 10 primaria, 8, 9f cadena peptídica, 8, 9f extremo aminoterminal, 8 extremo carboxiloterminal, 8, 9f importancia de la secuencia de aminoácidos, 8 secundaria, 8-9, 10f hélice α, 9 formación espontánea, 9 hoja plegada β, 9, 10f cadenas adyacentes, 9 estructura completamente extendida, 9 supersecundaria, 9 dominio hélice-vuelta-hélice de proteínas bacterianas, 9 terciaria, 9-17, 11f fuerzas de van der Waals, 10 electrostáticas, 10 hidrófobas, 10 puentes de hidrógeno, 10 puentes disulfuro, 10 solubilidad en el agua, 9 estructuras proteínicas complejas, 11 funciones, 1-12 almacenamiento, 12 ferritina, 12 catálisis, 12 impulsos nerviosos, 12 movimiento, 12 respuesta inmunitaria, 12 soporte y estructura, 12 colágeno, 12 transporte, 12 hemoglobina, 12 información para la síntesis de una proteína, 5

www.FreeLibros.me

177


178

Índice alfabético

Proteínas (cont.) métodos de estudio, 12-14 aislamiento y purificación de proteínas, 5 cromatografía de afinidad, 14 de intercambio iónico, 13-14 diálisis, 12 electroforesis, 13 filtración en gel, 13 isoelectroenfoque, 13 peso molecular, 14 solubilidad selectiva, 12-13 determinación de secuencia del extremo aminoterminal, 14 degradación de Edman, 14 síntesis. Véase Síntesis de proteínas Proteínas G, receptores acoplados, 89-91 activación hormonal de la ciclasa de adenilato, 90, 91f AMPc, segundo mensajero, 90 cinasa de proteína A, 90 fosfolípidos, y Ca 2 +, 91 activación de fosfolipasa C por cinasas de proteína-tirosina, 91, 93f genes inducidos por AMPc, 90, 92f carboxicinasa del fosfoenolpiruvato (PEPCK), 90 regulación, de cinasa de proteína A, 90, 90f de proteínas G, 90, 90f Proteínicas complejas, estructuras, 11 enzimas digestivas, 11 glucoproteínas, 11 grupo prostético, 11 hidroxiprolina, 11 modificaciones postraduccionales, 11 Proteómica, ciencia de la, 14-15 Proyecto Genoma Humano, 14 Pulvomicina, 85 R Regulación de la transcripción, 59-70 activación de los factores transcripcionales, 64-66 activación e inactivación de genes, 65 factores generales de la transcripción, 65-66, 67f ensamble de proteínas en el promotor de genes, 65 mecanismos, 64-65 activación por fosforilación, 64 síntesis y degradación de proteínas, 64 mutaciones, 65 región reguladora (promotor + potenciador), 66 regulación mediante potenciadores, 66 sitio de anclaje para proteínas reguladoras, 66 control postranscripcional, 66-67 atenuación de la transcripción, 66-67 distintos mecanismos, 66 control del procesamiento del RNA, 67 secuencia intrónica ambigua, 67 modificaciones postranscripcionales, 66, 68c control transcripcional, 60-62 eucariontes, 60-62, 62f caja TATA, 62, 62f genes de expresión constitutiva, 62 potenciadores, 62 región reguladora, 60 procariontes, 60 cambios en el ambiente, 60 operón Lac, 60, 61f

edición del RNA, 68-69 control de la traducción, 68-69 sitio de inicio, 68 búsqueda de escape, 69 control del transporte de RNA, 68 transporte del núcleo al citoplasma, 68 cadena polipeptídica, 68 genes de la ApoB, 68 inserción del uracilo, 68 estructura de las proteínas reguladoras, 62-64 arreglo de hélice-asa-hélice, 64, 65f homodímeros o heterodímeros, 64 cierre de leucinas, 63, 64f factor transcripcional AP-1, 64 interacciones hidrófobas, 64 dedos de cinc, 63, 63f receptores de esteroides, 63 subgrupos, 63 hélice-vuelta-hélice, 62 represor del operón Lac, 63, 63f fenotipo característico, 59 mecanismos de fosforilación en la síntesis de proteínas, 69 control de degradación de RNAm, 69 cola de poli A y estabilidad de RNAm, 69 factor de iniciación EIF-2, 69 interrupción de la traducción, 69-70 recodificación traduccional, 69 cambios en el marco de lectura, 69 RNA antisentido, 70 proteínas inhibidoras de la traducción, 69 control negativo de la traducción, 69 inestabilidad de los RNAm, 69 velocidad de degradación de los RNAm, 69 regulación de la expresión génica, 59, 60f niveles, 59 Reparación de DNA, 39-44, 41f recombinación génica, 43 entre homólogos, 44, 43f migración de la bifurcación, 44, 44f unión de Holliday, 44 entre sitios específicos, 44 grupos de transposones, 44, 45c recombinación conservativa, 44 recombinación transposicional, 44 sistema BER, 39 etapas del proceso, 40 8-oxo-guanina, 40 sistema DBR, 42 dímero Ku70-Ku80, 42 reparación de rompimientos de doble hélice, 42, 43f sistema MMR, 41-42 componentes, en E. coli, 41 prevención de mutaciones permanentes, 41 reparación de daño al DNA, 42 unión de MutS al sitio de error, 42 sistema NER, 40-41 formación de dímeros de timina, 41, 41f reparación de DNA. Véase Reparación de DNA Replicación del DNA, 33-44 ciclo celular y, 33-34 ciclo temporal de síntesis y degradación, 34 etapas, 33, 34f fase G1, 33 fase S, replicación de material genético, 33 fase M, división física de la célula, 33, 34f

www.FreeLibros.me


Índice alfabético complejo de preinicio, 39 complejo de reconocimiento de origen, 38, 40f control de replicación, 38-44 enzimas participantes, 35-37. Véase también tipo específico, p. ej., Helicasas mecanismo integral, 37-38 elementos participantes en el proceso, 38, 39f enzimas de la maquinaria de replicación, 38, 40f inicio de la copia, 37-38 mantenimiento de la abertura de la hélice, 37 reconocimiento de origen de la replicación, 37 relajación de superenrollamientos, 38 relajación síntesis del cebador, 37 terminación de la replicación, 38 mecanismos que controlan la activación temporal, 39 origen, 34, 35 copia del material genético, 34 horquillas de replicación, 35, 35f proceso de copia del DNA, 35 reparación de DNA. Véase Reparación de DNA secuencias ARS, 34 Resistencia del VIH a los antirretrovirales, 154-163 blancos terapéuticos, 155-157 estructura y función de las integrasas, 157 dominios funcionales, 157 centro catalítico, 157 dominio terminal C, 157 N-terminal, 157 inhibidores de la integrasa, 157 pasos catalíticos, 157 estructura y función de la proteasa, 155 inhibidores de la proteasa, 155, 156c mecanismos de unión al sitio activo, 155 estructura y función de la retrotranscriptasa, 156-157 inhibidores de la retrotranscriptasa, 157 precursor Gal-pol, 156 sitio activo de la enzima, 157 proteína de la envoltura, 155-156 glucoproteína de superficie gp120, 155 inhibidor de la fusión, 155 enfuvirtida, 155 inhibidores de receptores celulares, 155 CCR5, maraviroc, 155 CXCR4, 155 subunidad transmembrana gp41, 155 causas de la falla al tratamiento antirretroviral, 157 factores participantes, 158 resistencia a inhibidores de integrasa, 161 de proteasa, 158 clasificación de mutaciones, 159 sustitución de aminoácidos, 159 de receptores celulares, 158 de retrotranscriptasa análogos de los nucleósidos, 159 de retrotranscriptasa no análogos de los nucleósidos, 159 resistencia al inhibidor de fusión, 159 resistencia cruzada, 158 sustituciones de nucleótidos de los genes, 158 velocidad de mutación del genoma de VIH, 158 impacto económico, 163 costo-eficacia positivo, 163 prevalencia e impacto, 163 pacientes con tratamiento antirretroviral previo, 163 sin tratamiento antirretroviral previo, 163

pruebas para detección de resistencia, 161 aplicación en la clínica, 162-163 recomendaciones, 162 condiciones controladas, 161 fenotípicas, 161 desventajas, 161 medida directa de sensibilidad al medicamento, 161 genotípica, 161, 162f desventajas, 161 metodologías, 161 muestra sanguínea, técnica, 162 subtipo de VIH y resistencia a ARV, 17 terapia antirretroviral altamente activa, 154 causas de la falla de, 154 tipos de resistencia, 158-159, 160c Retrotranscriptasa, inhibidores, 156c, 157 análogos de los nucleósidos, 157 no análogos de los nucleósidos, 157 zidovudina, 157 Ribonucleico, ácido (RNA), 17, 27-30 capacidad catalítica autorreplicativa, 28 comparación estructural, 28, 29f fenotipo celular, 27 mensajero, 28 perspectivas, 30 replicación, 27 retrotranscripción, 27 ribozimas, 28 tipos principales, 28 participación en la síntesis de proteínas, 28 traducción, 27 transcripción, 27 Ribonucleótidos, estructura y composición, 17-18, 19f Ribosoma, ciclaje del, 78 RNA de transferencia, 29-30 aminoacil-RNAt, 29 bases nitrogenadas, 30 comparación estructural, 29, 29f interacciones, ribosoma o sintetasa, 29 molécula traductora de síntesis de proteína, 29 RNA mensajero, 28-29 comparación estructural, 29, 29f composición particular de nucleótidos, 28 eucariontes, 29 procariontes, 28 secuencia de polipurinas, 29 vida media, 29 RNA nucleolares pequeños, 30 RNA ribosómico, 30 bases nitrogenadas complementarias, 30 ribosomas, 30 variante de mayor peso muscular, 30 S Síntesis de proteínas, 71-85 acción enzimática específica, 71 activación y unión del aminoácido al RNAt, 72 formación del aminoacil-RNAt, 72, 73f reacción de activación de un aminoácido, 72, 73f aminoacilsintetasa, 72, 72f antibióticos para inhibir la, 83-85 formación del enlace peptídico, 84 inhibidores de los factores de elongación, 85 inhibidores de translocación, 84 balance energético, 81

www.FreeLibros.me

179


180

Índice alfabético

Síntesis de proteínas (cont.) características del RNAt, 71 brazo de unión al aminoácido, 71 representación esquemática del RNAt, 71, 72f dinámica de transporte y vida media de las proteínas, 81 velocidad de traducción, 81 elongación de la cadena peptídica, 76-77 eucariontes, 77 factores análogos a procariontes, 77 procariontes, 76-77, 77f corrección, apareamiento codón-anticodón, 76 translocación, factor EF-G, 77 transpeptidación, sitio peptidiltransferasa, 77 ubicación, 76 iniciación, 73-75 eucariontes, 74-75, 76f complejo 43S, 74 diferencias, 74 procariontes, 73-74, 75f maduración de la cadena proteínica, 78-81, 80f-81f maduración y/o preparación del RNAt para unirse al ribosoma, 73, 73f brazo aceptor, 73 plegamiento para adquirir la forma L, 73, 74f trébol de cuatro hojas, 73 triplete de nucleótidos del anticodón, 73 reciclaje del ribosoma, 78 factor de elongación EFG, 78 factor de iniciación IF3, 78 regulación, 82-83 codones AUG antes del sitio de inicio de traducción, 83 fosforilación de un factor inicial como regulador, 82 reciclaje del eIF-2, 82 unión del eIF-2B, 82 unión de proteínas a la región 5′ y 3′-UTR de RNAm, 82-83 mecanismos de control negativo de traducción, 82 ribosomas del citoplasma celular, 71 terminación, 78, 78f eucariontes, 78 procariontes, 78 Smad, proteínas, 97 ssb, proteínas, 36 hebras abiertas del DNA, 36 T Tay-Sachs, enfermedad de, 112 Técnicas de DNA recombinante, 105-113 antecedentes históricos de la biotecnología, 105, 105c aplicaciones, 112-113 descubrimiento de las secuencias espaciadoras, 113 producción de sustancias de importancia clínica, 112 interferón, 112 remplazo del gen deficiente, 112 transformación de células de médula ósea, 112 aspectos básicos de los ácidos nucleicos, 106 proteínas histonas, 106 región codificante del DNA, 106 experimentos de clonación de genes, 105 genotecas. Véase Genotecas tecnología del DNA recombinante, 106-107 elementos participantes en la clonación, 107 enzimas de restricción, 107 inserto, 107 ligasa de DNA, 107 plásmidos, 107 proceso de transformación, 107

endonucleasas de restricción, 107 genotecas, 106 oligonucleótidos, 107 reacción en cadena de polimerasa (PCR), 107 secuencias de reconocimiento palindrómicas, 107 técnicas de síntesis y secuenciación de moléculas de DNA, 107 uso de bacterias en estas metodologías, 107 Terapia génica, 122-128 antecedentes básicos, 122-123 estado actual en las investigaciones, 123 estrategias para corregir genes defectuosos, 122 estudio de la la terapia génica, 123 vector en la terapia, génica, 122 barreras que limitan el éxito, 123 corregir anormalidades del embrión, 123 definición, 123 destrucción de mensajeros, 128 hígado como órgano blanco, 123-126 nuevas estrategias, 128 atacar a la nueva proteína oncógena, 128 terapia antisentido, 126-128, 127f interrupción del flujo de información genética, 126 mecanismo, 126-127 bloqueo directo del mensajero, 127 características de moléculas antisentido, 126-131 hibridación base específica, 126 interrupción de la expresión del gen, 127 rotura del híbrido RNA-DNA por enzima ribonucleasa H, 126 propósito, 127-128 asociar al oligonucleótido con un portador, 128 características de la secuencia, 128 interrumpir al RNAm en célula viva, 127 transferencia clínica de genes en células humanas, 123, 124f tratamiento de amplia variedad de enfermedades, 123 Terapia génica en enfermedades autorregenerativas, 130-141. Véase también enfermedad específica, p. ej., Corea de Huntington creación de modelos de animales transgénicos, 130 efectos secundarios no deseados, 130 mecanismo neuroexcitotóxico, 130-131 excitotoxicidad neuronal, 131, 132f activación de mecanismos intracelulares, 131 disfunción mitocondrial, 131 generación de radicales libres, 131 síntesis de óxido nítrico, 131 muerte neuronal aguda, 131 picnosis nuclear, 131 papel del ácido glutámico, 131 modelos de estudio en perspectiva de terapia génica, 140, 141c terapia de genes in vivo como ex vivo, 140 uso de promotores de regulación específica, 140 transferencia de genes a células del cerebro, 130 Tetraciclinas, 83 amplio espectro, 83 bacteriostáticos, 83 mecanismo de acción, 83 Tiostreptón, 85 Topoisomerasas, 37 clasificación, 37 enzimas que cortan y ligan el DNA, 37 Transcripción del ácido ribonucleico (RNA), 46-57 definición de conceptos, 46 frecuencia, 46

www.FreeLibros.me


Índice alfabético iniciación, 46 niveles, en eucariontes, 46 promotor, 46 modificaciones postranscripcionales de RNA, 53-57 RNAm, 55-57 edición, 56 proceso de ajuste del RNAm, 57, 57f maduración, 55, 56f adición del poliadenilato en OH-3′, 56, 56f adición del protector en ppp′5, 55 metilación, 57 RNAr, 21, 21f autoeditables, 55 metilación, 54, 55f semejanza entre procariontes y eucariontes, 55 RNAt, 53-54 brazo variable, 54 estructura tridimensional, 54, 54f modelo de hoja de trébol, 53, 53f características, 53 transcritos primarios, 53-54 proceso eucariontes, 49-53, 50f-51f, 52c procariontes 47-49, 48c, 48f-49f regulación, 57 tipos y estructura de las polimerasas de RNA, 46-47, 47c, 47f Transducción de señales, 87-102 citoesqueleto y, 99-100 FAK, cinasa de tirosina, 100, 100f receptores de superficie, 99 fin de la señalización, 101-102 vía de ubiquitina proteasoma, 101, 102f proteína blanco para su degradación, 101 proteína nuclear y citosólica, 101 rápida degradación, 101 hormonas esteroides y superfamilia de receptores a esteroides, 100-101, 101f

inducción de la proliferación celular, 87 receptores aclopados a proteínas G (AMPc), 89-92, 90f-92f receptores sin actividad de cinasa de proteína, 96-97 vía JAK/STAT, 96, 96f activación y dimerización de tipos STAT, 96, 97c vías del NF-κB, 97, 99f, 99c importancia en la respuesta inflamatoria, 97 señales de cicatrización TGF-β/Smad, 97-98, 99f clasificación de proteínas Smad, 97 expresión descontrolada en procesos patológicos, 98 receptores de actividad de cinasa de serina/treonina, 97 señales de proliferación, 92-96 diagrama, inducción de mitosis, 92 ras, raf y vía de cinasas de MAP, 94-96, 94f-95f activación e inactivación de Ras, 95 elemento de respuesta al suero, 96 formas mutantes de la proteína Ras, 96 genes temprano, 96 inducción de genes temprano por ERK, 94, 95f vías de activación de MAPK, 94, 95f receptores con actividad de cinasa de tirosina, 92, 93f autofosforilación, del receptor, 92 cascada de señalización, de hepatocitos, 94, 94f factor de crecimiento de hepatocitos, 92 fosforilación fuera del sitio catalítico, 94 receptor para insulina, 92 tipos de señales celulares, 87-88, 89f acción de hormonas esteroides, 88 autocrinas, 88 endocrinas, 87 moléculas, 87 paracrinas, 88 tipos de receptores de superficie, 88, 89f V Van der Waals, fuerzas de, 10

www.FreeLibros.me

181


www.FreeLibros.me

188773426 biologia molecular 1edi pdf  
188773426 biologia molecular 1edi pdf  
Advertisement