Page 1


CARACTERÍSTICAS TÉCNICAS: • Sistema de escaneado 1000 Hz CMR • Micro Dimming Ultimate • DTS Premium Sound 5.1 • 4 HDMI • 3 USB • Smart TV • 3D • Modo Fútbol Avanzado • Doble Sintonizador • Quad Core + • Medidas (A x H x F): 123,28 x 71,33 x 8,98 cm/con soporte: 123,28 x 75,94 x 23,68 cm • Peso: 17,4 kg/con soporte: 18,9 kg

2

Comprar es muy fácil A tu servicio 24 horas al día durante los 365 días del año


NUEVO 6DPVXQJGDXQQXHYRJROSHGHHIHFWRFRQVXQXHYRWHOHYLVRU6HULH8QGLVH³RH[FOXVLYRFRQXQDHQRUPHSDQWDOOD /('FXUYDGHŔ\XQPDUFR\XQVRSRUWHFDVLLQYLVLEOHVSDUDRIUHFHUWHLP£JHQHVHQWRGRVXHVSOHQGRUVLQREVW£FXORV/D PD\RUDPSOLWXGGHOFDPSRYLVXDOFUHDXQHIHFWRSDQRU£PLFR\XQFRQWUDVWHP£VDFHQWXDGRTXHFDSWDU£WXDWHQFLµQ\WH KDU£IRUPDUSDUWHGHODLPDJHQ$GHP£VSHUPLWHXQDYLVXDOL]DFLµQP£VQ¯WLGDVLQEULOORVGHODOX]DPELHQWH,PDJLQDFµPR YHU£VWXVSHO¯FXODVHQ'FRQODPHMRUFDOLGDG)XOO+'\ODWHFQRORJ¯DGHHVFDQHDGR+]TXHOOHYDDODSHUIHFFLµQKDVWD HOP£VP¯QLPRGHWDOOH3HURDGHP£VSRGU£VœSDUWLUŔHOWHOHYLVRUHQGRVJUDFLDVDVXGREOHVLQWRQL]DGRUFRQHOTXHSRGU£VYHUGRV SURJUDPDVDOPLVPRWLHPSRDPERVHQODSDQWDOODRLQFOXVRHQWXWDEOHWFRQHFWDGRDOWHOHYLVRU6LQROYLGDUODVYHQWDMDVGHVXWHFQRORJ¯D 6PDUW79FDSD]GHUHFRPHQGDUWHVHJ¼QWXVJXVWRV\FRQODTXHSRGU£VDFFHGHUDFRQWHQLGRVH[FOXVLYRVDSOLFDFLRQHVFRPSDUWLU FRPHQWDULRVDWUDY«VGH,QWHUQHWř(VHOPRPHQWRGHSDVDUDODDFFLµQ+D]WH\DFRQWXWHOHYLVRUFRQSDQWDOODFXUYDHQŔRVLSUHŵHUHV XQWDPD³RPD\RUWDPEL«QSXHGHVHOHJLUHOPRGHORHQŔ

OFERTA

LED Curvo Smart TV 3D Samsung UEH8000 + REGALO Dispensador de cerveza

83

55” UE55H8000

2.299€

,46€ /mes*

36 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 3.004,56€

Rf: 24-148.423.16540

EXCLUSIVA

MUNDIAL BRASIL

2014 REGALO Dispensador de cerveza Princess (valorado en 129€)

SOLO

40

UNIDADES

DISPONIBLE TAMBIÉN EN 65”

3.499€ 126,85€/mes* 36 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 4.566,60€ Rf: 24-148.424.00518

)LQDQFLDFLµQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJO«V()&6$2SHUDFLµQVXMHWDDODDSUREDFLµQ GHVX&RPLW«GH&U«GLWR0HQVXDOLGDGP¯QLPDŞ*DVWRVGHHQY¯RLQFOXLGRVHQODFXRWD Ş  &RQLQWHUHVHV7$(7,1

+ info en

902 10 30 10 / latiendaencasa.es

3


$GHP£V GHSHQGLHQGR GHO LPSRUWH GH WX SHGLGR SRGU£V HOHJLURWURPDJQ¯ŵFRUHJDOR BOLSO-NECESER Rf: TC-979.031.00291

0HGLGDV $[+[) [[FP

O AURICULARES

(VWDV YDFDFLRQHV KDFHU XQ SHGLGR HQ /D 7LHQGD HQ &DVD WLHQH UHJDOR VHJXUR XQDV JDIDV GH VRO GH OD VHOHFFLµQ HVSD³ROD ¼QLFDV SDUD DQLPDU D QXHVWUR HTXLSR GXUDQWH HO PXQGLDO 7DPEL«Q ODV WLHQHV GLVSRQLEOHV HQ RWURV FRORUHV SDUD TXHHOLMDVWXIDYRULWRGHOYHUDQR

POR PEDIDOS SUPERIORES A 129€

4

0HGLGDV $[+[) [[FP

TROLLEY

Rf: TC-979.031.00317

0HGLGDV $[+[) [[FP

O RELOJ POR PEDIDOS SUPERIORES A 299€

Negro, Rf: TC-979.106.03071 Blanco, Rf: TC-979.106.03089 Azul, Rf: TC-979.106.03097 Rojo, Rf: TC-979.106.03105

TABLET AIRIS ONEPAD 740

GAFAS DE SOL Selección, Rf: TC-979.195.00153 Negra, Rf: TC-979.195.00161 Roja, Rf: TC-979.195.00179 Azul, Rf: TC-979.195.00187 Blanca, Rf: TC-979.195.00195

Negro, Rf: TC-979.385.02206 Rosa, Rf: TC-979.385.02214

Rf: TC-979.152.06722

POR PEDIDOS SUPERIORES A 599€

CARACTERÍSTICAS TÉCNICAS: • Pantalla multitáctil 7” panorámica • 4 GB Flash • Wi-Fi • Micro USB 2.0 y lector de tarjetas micro SD/SD-HC • Medidas (A x H x F): 19,15 x 11,55 x 1,12 cm.

&RQGLFLRQHVP£[LPRXQUHJDOR0/;/SRUSHGLGR6LWHROYLGDVGHSHGLUWXUHJDORSRGU£VVROLFLWDUORGHVSX«VSHURGHEHU£VDERQDUŞGHJDVWRVGHHQY¯R(QFDVRGHTXHGHYXHOYDVDOJ¼Q DUW¯FXORGHWXSHGLGRGHEHU£VDVXPLUHOFRVWHGHOUHJDOR0Ş/Ş\;/Ş


902 10 30 10 / latiendaencasa.es

5


COMPRAR ES MUY FÁCIL A tu servicio las 24 horas del día durante los 365 días del año.

Por teléfono: Por internet:

902 10 30 10 latiendaencasa.es

TÚ ELIGES LA FORMA DE PAGO Cómodas mensualidades:

Para facilitarte las compras y beneficiarte en todo lo que podamos.

Financiación a medida. Compra todo lo que quieras y págalo en cómodas cuotas, con un importe mínimo de 30€ y hasta 36 meses.

Con tarjeta:

Con la tarjeta de

Tendrás un control total de tus pagos.

Con tarjeta Regalo de

VALOR INICIAL

Consulta condiciones a tu operadora o en latiendaencasa.es

Con otras tarjetas: Visa, MasterCard, American Express, Diners Club, Red 6000, 4B y JCB.

Contra reembolso: Si lo prefieres, puedes abonar tu pedido en el mismo momento en que lo recibas. Esta modalidad de pago tiene un pequeño suplemento de solo 1,50€

EL PEDIDO DONDE TÚ QUIERAS Entrega en tu domicilio: Te llevamos el pedido donde tú elijas (casa, oficina, etc.) en un plazo de diez días laborables. Gastos de envío 9,80€. Encontrarás productos con gastos de envío 5,90€, consulta condiciones a tu operadora o en latiendaencasa.es. En los productos voluminosos, los gastos serán bajo presupuesto. Avisaremos por SMS o email antes de entregar el pedido. No se sirven pedidos a apartados postales.

TOTAL SATISFACCIÓN Para resolver cualquier tipo de duda, incidencia o si el artículo no es de tu total satisfacción puedes devolverlo y te devolvemos el dinero, solo tienes que llamar al 902 302 101.

GARANTÍA CALIDAD Y SERVICIO Todos los artículos que aparecen en el catálogo han sido sometidos a un riguroso control de calidad y están avalados por la garantía de La Tienda en Casa, División de Venta a Distancia de Garantía de Devolución y Atención al Cliente: Tiene un plazo de 14 días naturales para devolverlo. Los gastos de envío y recogida en caso de devolución correrán por cuenta del cliente. Para realizar la devolución el producto debe estar en perfectas condiciones y en su embalaje original. Previa comprobación del estado de la mercancía, se procederá al reintegro de su importe en la misma modalidad en que se efectuó la compra, salvo en efectivo, que se reintegrará mediante transferencia bancaria. Para aquellos productos que requieran montaje, la devolución solo se admitirá en su embalaje original y debidamente desmontado. No se puede realizar cambio ni devolución de todos los artículos de belleza, incluyendo artículos de tocador, cosméticos, aseo personal (afeitadoras, depiladoras), accesorios para el cabello, trajes de baño, lencería, ropa interior, medias, colchones, edredones, fundas, protectores de colchón o almohadas. Los vídeos domésticos, discos, productos informáticos u otros productos susceptibles de copia inmediata solo podrán cambiarse por un título idéntico. Existen hojas de reclamaciones a disposición del cliente, en nuestro domicilio social C/Hermosilla, 112 - 28009 Madrid o en nuestras oficinas de C/Alfonso Gómez, nº8. Garantía de calidad y servicio: El plazo de garantía de todos los productos ofertados en este catálogo se ajusta al Real Decreto Legislativo 1/2007, de 16 de Noviembre, por el que se aprueba el texto refundido de la Ley General para la Defensa de los Consumidores y Usuarios y otras leyes complementarias. Para hacer uso de la garantía dentro del plazo legal establecido de los 2 años siguientes a la entrega del producto es imprescindible la presentación del justificante de compra (talón de venta). Pasado este plazo, y para el supuesto que el producto adquirido tenga una garantía adicional otorgada por el fabricante, deberá presentarse junto con el justificante de compra (talón de venta) el certificado de garantía debidamente cumplimentado.

los productos de este catálogo. - Todos los precios incluyen IVA. - Catálogo válido desde el 28/04/2014 hasta - Los datos que usted nos proporcione serán el 31/08/2014.

- Envíos disponibles a Península y Baleares. - Consúltanos el servicio de instalación y puesta en marcha.

- Solicitaremos tu DNI y la fecha de nacimiento para realizar el envío.

- El Corte Inglés S.A., registrado e inscrito como empresa de venta a distancia (Identificación REVA 25/00), realiza la venta y distribución de

incorporados en un fichero de clientes propiedad de El Corte Inglés S.A. y podrán ser tratados para hacerle llegar ofertas comerciales del grupo El Corte Inglés. Tiene derecho a acceder a dicha información, recopilada en nuestro fichero de clientes, y cancelarla o rectificarla, dirigiéndose por carta a C/Hermosilla, 112. 28009 Madrid, ó llamando al teléfono 902 30 21 01 (Ley Orgánica 15/1999, de 13 de Diciembre).


LED Smart TV 3D en 48” o 55”

Electrónica

Como si estuvieras en el estadio

3UHS£UDWHSDUDYHUWRGRVORVSDUWLGRVGHOPXQGLDOGHODPDQHUDP£VHPRFLRQDQWHFRQHVWH/('6DPVXQJ6XWHFQRORJ¯DGHLPDJHQ )XOO+''RIUHFHODP£[LPDFDOLGDG\UHDO]DORVFRORUHV\HOFRQWUDVWHGHFDGDLPDJHQSDUDQRSHUGHUWHQLXQPRYLPLHQWR&RQVX PRGRI¼WEROLQWHJUDGRGLVIUXWDU£VGHORVSDUWLGRVFRPRVLHVWXYLHUDVHQHOHVWDGLR\DTXHSURSRUFLRQDXQRVDMXVWHVGHVRQLGR\ FDOLGDGGHLPDJHQRSWLPL]DGRV3RGU£VSXEOLFDUFRPHQWDULRVHQWXVUHGHVVRFLDOHVPLHQWUDVYHVXQSDUWLGRHQGLUHFWRRXWLOL]DUHO ]RRPSDUDDPSOLDUODLPDJHQGHXQDSDUWHGHODSDQWDOOD$GHP£VFRQVXWHFQRORJ¯D6PDUW79HOSDUWLGRQRDFDEDDTX¯SRGU£V QDYHJDUSRU,QWHUQHWFRPXQLFDUWHFRQWXVDPLJRVGHVFDUJDUWHDSOLFDFLRQHVFRPSDUWLUIRWRVGHORVPHMRUHVPRPHQWRVř<WRGRD PXFKDP£VYHORFLGDGJUDFLDVDVXSURFHVDGRUGHFXDWURQ¼FOHRVTXHJDUDQWL]DXQDSRWHQWHIXQFLRQDOLGDGPXOWLWDUHD(OLJHWX PRGHORHQŔRŔ\YLYHHOI¼WERODORJUDQGH

799€

30,54€/mes* 34 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 1.038,36€

Rf: 24-148.423.16433

55” UE55H6200

48” UE48H6200

LED Smart TV 3D Samsung UEH6200

1.199€

43,70€/mes* 36 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 1.573,20€

Rf: 24-148.423.16508

48”/55”

0HGLGDV $[+[) Ŕ[[FPFRQSHDQD[[FPŔ[[FPFRQ SHDQD[[FP3HVRŔNJFRQSHDQDNJŔNJFRQSHDQDNJ

)LQDQFLDFLµQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJO«V()&6$2SHUDFLµQVXMHWDDODDSUREDFLµQ GHVX&RPLW«GH&U«GLWR0HQVXDOLGDGP¯QLPDŞ*DVWRVGHHQY¯RLQFOXLGRVHQODFXRWD Ş  &RQLQWHUHVHV7$(7,1

+ info en

902 10 30 10 / latiendaencasa.es

7


NUEVO

Nuevas funciones y mĂĄs posibilidades en 3D

6DPVXQJVLJXHDYDQ]DQGRHQODWHFQRORJÂŻDGHLPDJHQFRQODVPHMRUHVIXQFLRQHV\FDOLGDGSDUDTXHYHUWRGRVORVSDUWLGRVGHOPXQGLDO VHDXQDH[SHULHQFLDPXFKRPÂŁVHQULTXHFHGRUD\HPRFLRQDQWH(VWH/('')XOO+'FRQ+]PHMRUDODYLVLÂľQGHFDGDSHOÂŻFXODFRQ LPÂŁJHQHVLPSDFWDQWHVWDPELÂŤQHQWUHVGLPHQVLRQHV8QQXHYRFRQFHSWRGHWHOHYLVLÂľQJUDFLDVDVXGREOHVLQWRQL]DGRUFRQHOTXHSRGUÂŁV YHUGRVSURJUDPDVDOPLVPRWLHPSRDPERVHQODSDQWDOODRLQFOXVRHQWXWDEOHWFRQHFWDGRDOWHOHYLVRU<WRGRVLQSHUGHU YHORFLGDGHQQLQJXQDGHODVWDUHDVJUDFLDVDVXSURFHVDGRUGHFXDWURQÂźFOHRV8QLGRDWRGDVODVSUHVWDFLRQHV 6PDUW79FRPRDSOLFDFLRQHV,QWHUQHWFRQWHQLGRVĹ&#x2122;KDFHQGHHVWHWHOHYLVRUXQDRSFLÂľQFRPSOHWD \GHFDOLGDG(OLJHWXPRGHORHQĹ&#x201D;RĹ&#x201D;\GHVFÂźEUHOR

40â&#x20AC;?/46â&#x20AC;?

Pack de dos gafas 3D Samsung SSG-P51002,

25

â&#x201A;Ź

Rf: 11-148.704.00737

+ REGALO Dispensador de cerveza 40â&#x20AC;? UE40H7000

 4XLHUHVXQSDUGHJDIDVDGLFLRQDOHVSDUDGLVIUXWDUFRQORVWX\RV GHODPHMRUYLVL¾QWULGLPHQVLRQDO\UHDOLVWD"&RQV¯JXHODVDTX¯ DOPHMRUSUHFLR

LED Smart TV 3D Samsung UEH7000 1.099â&#x201A;Ź

40,08â&#x201A;Ź /mes*

36 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 1.442,88â&#x201A;Ź

Rf: 24-148.421.10448

46â&#x20AC;? UE46H7000

Disfruta con tu familia de la experiencia 3D

1.299â&#x201A;Ź

47,31â&#x201A;Ź /mes*

36 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 1.703,16â&#x201A;Ź

Rf: 24-148.423.16417

Compatibles con todos los modelos Samsung 3D Serie D, E, F y H de 2011, 2012, 2013 y 2014.

8

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ 3D Full HD 1920 x 1080 â&#x20AC;˘ Sistema de escaneado 800 Hz â&#x20AC;˘ Micro Dimming Pro â&#x20AC;˘ DTS Premium Sound 5.1 â&#x20AC;˘ 4 HDMI â&#x20AC;˘ 3 USB â&#x20AC;˘ Smart TV â&#x20AC;˘ Twin Turner â&#x20AC;˘ Medidas (A x H x F) 46â&#x20AC;?: 103,33 x 59,69 x 3,32 cm/ con soporte: 103,33 x 63,92 x 20,88 cm/40â&#x20AC;?: 90,86 x 53,91 x 6,31 cm/con soporte: 90,86 x 57,91 x 20,45 cm. Peso 46â&#x20AC;?: 11,3 kg/con soporte: 12,5 kg; 40â&#x20AC;?: 7,9 kg/con soporte: 8,9 kg

CĂłmodas mensualidades TĂş eliges la forma de pago


MĂĄs adrenalina, mĂĄs emociĂłnâ&#x20AC;Ś pasiĂłn por el mundial en UHD

6LTXLHUHVYLYLUFDGDSDUWLGRFRQODHPRFLÂľQTXHVHPHUHFHQRSHUGHUWHQLXQVHJXQGRGHODVPHMRUHVMXJDGDVĹ&#x2122;HVWHWHOHYLVRU6DPVXQJ /('.6PDUW79Ĺ&#x201D;WHGDUÂŁODPÂŁ[LPDFODULGDGGHLPDJHQSDUDTXHWHVXPHUMDVHQFDGDSDUWLGR6XUHVROXFLÂľQ8+'FXDWURYHFHVOD UHVROXFLÂľQGHORVWHOHYLVRUHV)XOO+'WHGDUÂŁODH[SHULHQFLDGHYLVLRQDGRPÂŁVFHUFDQDDODUHDOLGDGFRQGHWDOOHVLQFUHÂŻEOHVXQFRQWUDVWH VXSHULRU\FRORUHVDÂźQPÂŁVYLYRV$FRPSDÂłDGRSRUVXSURFHVDGRUGHFXDWURQÂźFOHRVTXHSURSRUFLRQDXQDPD\RUYHORFLGDGHQWRGDV ODVDSOLFDFLRQHV\VXPRGRIÂźWEROSHUIHFWRSDUDVHOHFFLRQDU\JXDUGDUODVMXJDGDVPÂŁVLPSRUWDQWHVSDUDYHUODVFXDQGRWÂź TXLHUDV$GHPÂŁVVXWHFQRORJÂŻD6PDUW79FRQ65HFRPPHQGDWLRQUHFRQRFHWXVJXVWRV\WHRIUHFHXQDDPSOLD YDULHGDGGHRSFLRQHVSDUDGLVIUXWDUPÂŁVGHWRGRVORVFRQWHQLGRVGHWXWHOHYLVRU/OÂŤYDWHORDKRUD \GLVIUXWDGHODPDJLDGHOPXQGLDOHQWXVDOÂľQ

50â&#x20AC;?

OFERTA EXCLUSIVA

MUNDIAL BRASIL

2014 REGALO Dispensador de cerveza Princess

(valorado en 129â&#x201A;Ź) por la compra de cualquiera de estos televisores

SOLO

60

UNIDADES

ComunĂ­cate con tu Smart TV LED 50â&#x20AC;? UHD 4K Smart TV 3D Samsung UE50H6900

(VWHWHFODGRLQDOÂŁPEULFRFRQ%OXHWRRWKHVORPHMRUSDUD QDYHJDUGHODIRUPDPÂŁVFÂľPRGDDFFHGHUDWRGDVODV DSOLFDFLRQHV\FRQWURODUODVRSFLRQHVGHWX79

+ REGALO Dispensador de cerveza

1.499â&#x201A;Ź

54,54â&#x201A;Ź /mes*

36 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 1.963,44â&#x201A;Ź

Rf: 24-148.423.16490

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ ResoluciĂłn 3840 x 2160 4K â&#x20AC;˘ Escalado UHD â&#x20AC;˘ Sistema de escaneado 200 Hz â&#x20AC;˘ UHD Dimming â&#x20AC;˘ DTS Premium Sound 5.1 â&#x20AC;˘ 4 HDMI 2.0 â&#x20AC;˘ 3 USB â&#x20AC;˘ Smart TV â&#x20AC;˘ Multi-Link Screen Quad â&#x20AC;˘ Medidas (A x H x F): 112,79 x 61,84 x 5,09 cm/con soporte: 112,79x 70,21 x 27,51 cm. Peso: 14 kg/con soporte: 17 kg.

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQ GHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1

Teclado InalĂĄmbrico Samsung con Bluetooth para Smart TV VG-KBD2000

99â&#x201A;Ź

Rf: 11-148.307.48308

0HGLGDV $[+[)  [[FP3HVRJ

+ info en

902 10 30 10 / latiendaencasa.es

9


NUEVO

LG tiene pasión

9LYHWRGDVODVMXJDGDVGHODVHOHFFLµQFRQODPHMRUFDOLGDGFRQHVWDVHOHFFLµQGHWHOHYLVRUHV/*8QRVGLVH³RVSHUIHFWRVTXHWHRIUHFHPRV HQGLIHUHQWHVSXOJDGDVSDUDTXHVHLQWHJUHQDODSHUIHFFLµQHQFXDOTXLHUHVSDFLR2IUHFHQODPHMRUFDOLGDGGHLPDJHQ)XOO+'XQDFDOLGDG GHVRQLGRGH:FRQVXEZRRIHU\XQVLVWHPDGHDXGLRTXHDGDSWDHOVRQLGRDOFRQWHQLGRTXHHVW«VYLHQGRHQHVHPRPHQWR\DVHD XQDSHO¯FXODXQDVHULHRXQSDUWLGR6X7ULSOH3URFHVDGRU;'(QJLQHGH¼OWLPDJHQHUDFLµQGDXQDUHVSXHVWDYHFHVP£VU£SLGD\XQPHMRU

50” 50LB5610

42” 42LB5610

LED LG LB5610

529

31,38€/mes* 20 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 627,60€

Rf: 24-148.422.05354

699

30,32€/mes* 29 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 879,28€

TOP VENTAS

Graba y revive las mejores jugadas, ¡una y otra vez! 'LVIUXWDGHP£VSRVLELOLGDGHVWRGDY¯DFRQHVWHFRPERJUDEDGRU3RGU£VFRQYHUWLUWXV DQWLJXDVSHO¯FXODV9+6D'9'UHSURGXFLUSHO¯FXODV'LY;IRWRJUDI¯DV\P¼VLFDGLUHFWDPHQWH DWUDY«VGHVXSXHUWR86%$GHP£VSRGU£VVLQWRQL]DUOD7'7\JUDEDUGLUHFWDPHQWHORV SURJUDPDV(OFRPSOHPHQWRSHUIHFWRSDUDWXWHOHYLVRUTXHSXHGHVŵQDQFLDUSRUPX\SRFR GLQHURDOPHV VLQHQWUDGD

Rf: 24-148.423.16979

0HGLGDV $[+[) Ŕ[[FP FRQSHDQD[[FPŔ[ [FPFRQSHDQD[[FP 3HVRŔNJFRQSHDQDNJŔNJ FRQSHDQDNJ

10

latiendaencasa.es es mucho más


por la Roja, Âży tĂş?

UHQGLPLHQWRSDUDFDSWDUWRGRVORVGHWDOOHVHQFXDOTXLHULPDJHQ$GHPÂŁVJUDFLDVDVXVPÂźOWLSOHVFRQH[LRQHVGLVIUXWDUÂŁVGHPD\RU YHUVDWLOLGDGSDUDFRQHFWDURWURVGLVSRVLWLYRV(OLJHWXPRGHORHQĹ&#x201D;RĹ&#x201D;RVLSUHĹľHUHVPD\RUHVSUHVWDFLRQHVHOLJHORVPRGHORV HQĹ&#x201D;\Ĺ&#x201D;FRQWHFQRORJÂŻD6PDUW79LQFRUSRUDGDTXHWHGDUÂŁDFFHVRDORVPHMRUHVFRQWHQLGRVDSOLFDFLRQHVPÂŁVGHFDQDOHV GLIHUHQWHV,QWHUQHWĹ&#x2122;VHDFXDOVHDWXHOHFFLÂľQDKRUDHVWÂŁDWXDOFDQFHDXQSUHFLRÂźQLFRc$SURYÂŤFKDOR

42â&#x20AC;?/50â&#x20AC;?

39â&#x20AC;?/47â&#x20AC;?

REGALO

Participa en una experiencia Ăşnica con LG y la SelecciĂłn EspaĂąola de FĂştbol

UNIDADES

/mes*

11 cuotas SIN ENTRADA TAE 19,56% TIN 18% PVP Final a plazos 337,26â&#x201A;Ź

Rf: 11-148.333.00560

39â&#x20AC;? 39LB5700

SOLO

150

30

,66â&#x201A;Ź

Por la compra de uno de estos productos LG***

LED Smart TV LG LB5700

47â&#x20AC;? 47LB5700

Combo DVD-VHS con TDT LG RCT699H 299â&#x201A;Ź

499â&#x201A;Ź

30,97â&#x201A;Ź/mes* 19 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 588,43â&#x201A;Ź

Rf: 24-148.421.10620

649â&#x201A;Ź

30,78â&#x201A;Ź/mes* 26 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 800,28â&#x201A;Ź

Rf: 24-148.423.17027

***Condiciones en latiendaencasa.es. Necesario registro para sorteo. PromociĂłn vĂĄlida del 1 de mayo al 30 de junio.

0HGLGDV $[+[) [[FP3HVRNJ

0HGLGDV $[+[) Ĺ&#x201D;[[FPFRQSHDQD[[FPĹ&#x201D;[[FPFRQ SHDQD[[FP3HVRĹ&#x201D;NJFRQSHDQDNJĹ&#x201D;NJFRQSHDQDNJ

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQ GHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1

+ info en

902 10 30 10 / latiendaencasa.es

11


NUEVO

La televisiĂłn que te gusta sabe lo que te gusta

42â&#x20AC;?/47â&#x20AC;?

9LYHHOFLQHFRPRQXQFDFRQHVWHWHOHYLVRU/('6PDUW79'GHĹ&#x201D;RĹ&#x201D;GHODVHULH$6GH3DQDVRQLFFRQUHFRQRFLPLHQWR SHUVRQDOL]DEOHHLQWHUDFFLÂľQSRUYR]/DWHOHYLVLÂľQUHFRQRFHWXSDWUÂľQGHYR]DSUHQGHORTXHWHJXVWDYHU\WHHQVHÂłDFRQWHQLGRV DĹľQHVDWXVJXVWRVSDUDTXHHQFXHQWUHVWXVIDYRULWRVGHODPDQHUDPÂŁVIÂŁFLO7LHQHXQSRWHQWHSURFHVDGRUGH+]\PÂźOWLSOHV RSFLRQHVGHFRQHFWLYLGDG$GHPÂŁVLQFRUSRUDODIXQFLÂľQ79$Q\ZKHUHSDUDTXHSXHGDVGLVIUXWDUGHODWHOHTXHPÂŁVWHJXVWDHQWX GLVSRVLWLYRPÂľYLOFXDQGR\GRQGHTXLHUDV7HYDDJXVWDUORTXHYDVYHU

LED Smart TV 3D Panasonic AS650E 42â&#x20AC;? 42AS650E

849â&#x201A;Ź

35,75â&#x201A;Ź /mes*

30 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 1.072,50â&#x201A;Ź

Rf: 24-148.422.05289

47â&#x20AC;? 47AS650E

1.049â&#x201A;Ź

39,10â&#x201A;Ź /mes*

35 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 1.368,50â&#x201A;Ź

0HGLGDV $[+[) Ĺ&#x201D; [[FPFRQSHDQD[[FP Ĺ&#x201D;[[FPFRQSHDQD[[FP

Rf: 24-148.423.16813

Alta tecnologĂ­a de imagen Transmite las seĂąales a otros televisores, ÂĄsin interferencias! (OWUDQVPLVRULQDOÂŁPEULFR(QJHOWUDQVPLWHFXDOTXLHUVHÂłDOGH DXGLR\YÂŻGHRGHXQWHOHYLVRUDRWURVLQFDEOHV\VLQSURYRFDU LQWHUIHUHQFLDVFRQWXUHG:L)LQLFRQRWURVDSDUDWRVHOHFWUÂľQLFRV 6LWLHQHV&DQDO,PDJHQLRSRGUÂŁVYHUWXVSURJUDPDVIDYRULWRV HQFXDOTXLHUWHOHYLVRUGHFDVDVLPSOHPHQWHFRQHFWDQGRHOHPLVRU DWXGHFRGLĹľFDGRU\HOUHFHSWRUHQODKDELWDFLÂľQTXHSUHĹľHUDV 7DPELÂŤQSRGUÂŁVYHUODSURJUDPDFLÂľQGHOD7'7)XOO+'SHOÂŻFXODV GHWX'9'HVFXFKDUODPÂźVLFDGHWXHTXLSRHLQFOXVRYHUODV LPÂŁJHQHVGHWXFÂŁPDUDGHYÂŻGHR

TDT SAT TV CABLE VCR/DVD CAMERA

59

,90â&#x201A;Ź

Rf: 11-979.148.05300

12

/DVLPÂŁJHQHVDORJUDQGHFRQXQDFDOLGDGGHFLQH\XQH[FHOHQWH VRQLGR$VÂŻORYHUÂŁVFRQHOQXHYRVPDUW/('3KLOLSV6FUHHQHRXQ SUR\HFWRUTXHWUDQVIRUPDFXDOTXLHUSDUHGGHODFDVDHQXQDJUDQ SDQWDOODLQWHOLJHQWHGHHQWUHĹ&#x201D;DĹ&#x201D;*UDFLDVDVXVLVWHPD GHSUR\HFFLÂľQGHGLVWDQFLDXOWUDFRUWDVRORWLHQHVTXHFRORFDUORD XQRVFHQWÂŻPHWURVGHODSDUHG GHVGHFPDFP HQFXDOTXLHU KDELWDFLÂľQRLQFOXVROOHYDUORDWXWHUUD]DSDUDXQDVHVLÂľQGHFLQHDO DLUHOLEUH&RQXQDUHVROXFLÂľQGH[SÂŻ[HOHV\OÂźPHQHV GLVIUXWDUÂŁVGHWHFQRORJÂŻDGHDOWDFDOLGDGSDUDSUR\HFWDUWXVIRWRV SHOÂŻFXODVYLGHRMXHJRVGHSRUWHVĹ&#x2122;XQLGRDVXVRQLGRVXEZRRIHU LQWHJUDGR6LQWRQL]DOD7'7\SRGUÂŁVFRQHFWDUWHFRQRWURV GLVSRVLWLYRVDWUDYÂŤVGH:L)L%OXHWRRWK+'0,86%Ĺ&#x2122;LQFOXVRDWX VPDUWSKRQHRWDEOHWGHIRUPDLQDOÂŁPEULFD1XQFDKDVWHQLGRWDQ FHUFDLPÂŁJHQHVWDQJUDQGHV\SRWHQWHV'HVFXEUHHOQXHYRGLVHÂłR GHOFLQH

RECEPTOR

Proyector LED Inteligente Philips Screeneo HDP1590TV + REGALO Reembolso 200â&#x201A;Ź***

EMISOR

Transmisor A/V inalĂĄmbrico 5,8 GHz AV Plus III (incluye 1 emisor y 1 receptor),

Un sistema de proyecciĂłn de 100â&#x20AC;? con TDT integrado en tu salĂłn

EXCLUSIVO

1.690â&#x201A;Ź

Receptor adicional AV Plus III - 5,8 GHz,

39

,90â&#x201A;Ź

Rf: 11-979.148.05326

61

,45â&#x201A;Ź /mes*

36 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 2.212,20â&#x201A;Ź

Rf: 11-148.217.07487

Total satisfacciĂłn Si no quedas satisfecho te devolvemos el dinero

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘Â Sintonizador TDT â&#x20AC;˘ TamaĂąos de pantalla: 50â&#x20AC;? - 100â&#x20AC;? â&#x20AC;˘ ResoluciĂłn: 1280 x 800 pĂ­xel â&#x20AC;˘ 700 LĂşmenes â&#x20AC;˘ Memoria interna 4 GB â&#x20AC;˘ 3 x HDMIâ&#x201E;˘ â&#x20AC;˘ 1 x USB â&#x20AC;˘ Ranura Tarjeta SD â&#x20AC;˘ DLNA â&#x20AC;˘ Bluetooth â&#x20AC;˘ Altavoces integrados con Subwoofer y sistema de sonido Dolby Digital 2.1 â&#x20AC;˘ TecnologĂ­a 3D â&#x20AC;˘ Medidas (A x H x F): 33,9 x 28,7 x 14, 8 cm


La comunicaciĂłn hecha elegancia 8QWHOÂŤIRQRFRQXQGLVHÂłR HOHJDQWHFRQXQDSDQWDOODGH Ĺ&#x201D;FRQĹ&#x201C;6PDUWSKRQH&RQQHFWĹ&#x201D; SDUDUHFLELURUHDOL]DUOODPDGDVGH OÂŻQHDĹľMDGHVGHWX6PDUWSKRQH 6LHPSUHFRQXQDFRPXQLFDFLÂľQ QÂŻWLGD\GHFDOLGDG Panasonic DECT PRW110,

89

,95â&#x201A;Ź

Rf: 11-890.108.20101

NUEVO

Un diseĂąo intuitivo 8QWHOÂŤIRQRFÂľPRGRVHQFLOOR \FRPSDFWRSHUIHFWRSDUDXQD FRPXQLFDFLÂľQQÂŻWLGD\GHFDOLGDG 8QGLVHÂłRLQWXLWLYRFRQSDQWDOOD GHĹ&#x201D;LGHQWLĹľFDGRUGHOODPDGDV DODUPDKDVWDHQWUDGDVGH QÂźPHURVĹ&#x2122;ODVIXQFLRQHVPÂŁV SUÂŁFWLFDVSDUDXQXVRGLDULR Panasonic DECT PRS110,

69

Sonido de Alta DefiniciĂłn 8QDWHFQRORJÂŻDGHDXGLRGHPÂŁ[LPDGHĹľQLFLÂľQ SDUDHVFXFKDUWXPÂźVLFDFRQODPHMRUFDOLGDG8Q GLVHÂłR3UHPLXPFRPSDWLEOHFRQL3RGL3KRQH,SDG\ 6PDUWSKRQH\FRQRWURVGLVSRVLWLYRVDWUDYÂŤVGH86% Panasonic SC-PMX5 287â&#x201A;Ź

35,50â&#x201A;Ź /mes*

,95â&#x201A;Ź

9 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 319,50â&#x201A;Ź

Rf: 11-385.101.08624

Rf: 11-890.108.20093

y sonido para tu hogar

Smartphone no incluido.

G`Teg@98D

eb]XVgbe

REGALO

Reembolso 200â&#x201A;Ź***

***Ver condiciones en latiendaencasa.es. Organiza Sagemcom IbĂŠrica, S.A. Bases disponibles en latiendaencasa.es. Necesario registro. PromociĂłn vĂĄlida del 28-04-14 al 31-05-14.

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQ GHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1

+ info en

902 10 30 10 / latiendaencasa.es

13


Un diseĂąo compacto para proyectar a lo grande Ver vĂ­deo en

REGALO

latiendaencasa.es

Piktor Perfect (valorado en 49,95â&#x201A;Ź)

Mini Proyector Star Wiew Mini + REGALO Piktor Perfect,

119â&#x201A;Ź

Rf: 11-979.713.65958

&XDOTXLHUPRPHQWRHV EXHQRSDUDGLVIUXWDUGHXQD EXHQDSHOÂŻFXOD<VLDGHPÂŁV SXHGHVKDFHUORHQXQDSDQWDOOD JUDQGHODVHQVDFLÂľQVHUÂŁ LQPHMRUDEOH6WDU9LHZ0LQLHV XQPLQLSUR\HFWRUTXHSXHGHVOOHYDU DWRGDVSDUWHV\TXHSUR\HFWDLPÂŁJHQHV GHVGHĹ&#x201D;KDVWDĹ&#x201D;6LPSOHPHQWHWLHQHVTXH FRQHFWDUORDXQDIXHQWHWHOHYLVLÂľQRUGHQDGRU'9' YLGHRFRQVRODRWDUMHWD6'Ĺ&#x2122;\GLVIUXWDUGHLPÂŁJHQHV GHJUDQUHVROXFLÂľQ,QFOX\HPDQGRDGLVWDQFLD\ DGHPÂŁVGH5(*$/2XQNLWGHLPSUHVLÂľQ3LNWRU 3HUIHFWSDUDFUHDULPSUHVLRQHVSURIHVLRQDOHVVREUH OLHQ]RGHIRUPDIÂŁFLOHQPHQRVGHPLQXWRV NUEVO

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ ResoluciĂłn 320 x 240 â&#x20AC;˘ Brillo: 32 lĂşmenes â&#x20AC;˘ Entradas USB, VGA, HDMI, AV, tarjeta SD â&#x20AC;˘ VĂ­deo RMVB/RM, AVI, WMW (WMV7/8/9) FLV â&#x20AC;˘ ImĂĄgenes JPEG, BMP, GIF, TIFF â&#x20AC;˘ Cable VGA â&#x20AC;˘ Adaptador de corriente â&#x20AC;˘ Cable AV 3 en 1 â&#x20AC;˘ Medidas (A x H x F): 12,7 x 5,6 x 12,6 cm. Peso 400 g

ImĂĄgenes grandes para espacios pequeĂąos

+D\HVSDFLRVTXHSLGHQXQWHOHYLVRUTXHQRWHQJDJUDQGHVGLPHQVLRQHV3DUDHOOR+DLHUSUHVHQWDVXVWHOHYLVRUHV/('HQĹ&#x201D;\Ĺ&#x201D;XQRV GLVHÂłRVTXHVHDDGDSWDUÂŁQDFXDOTXLHUHVSDFLR\TXHSURSRUFLRQDQXQDFDOLGDGGHLPDJHQ+'5HDG\MXQWRFRQODV IXQFLRQHVPÂŁVSUÂŁFWLFDVSDUDWHQHUWRGRHOHQWUHWHQLPLHQWRDWXDOFDQFH7'7LQFRUSRUDGR \JUDEDFLÂľQFRQ7LPHVKLIWSRU86%TXHWHSHUPLWLUÂŁYHU\JUDEDU VLPXOWÂŁQHDPHQWHXQSURJUDPDDGHPÂŁV GHUHDQXGDUXQSURJUDPDHQXQSXQWR GHWHUPLQDGRVLWLHQHVXQDLQWHUUXSFLÂľQ <SDUDODVVHULHVRSHOÂŻFXODVTXHWLHQHV JUDEDGDVSRGUÂŁVYHUODVHQWXWHOHYLVRU FRQHFWÂŁQGRORDWUDYÂŤVGHXQDPHPRULD H[WHUQD8QDVRSFLRQHVFRPSOHWDV\ GHFDOLGDGSDUDOOHQDUGHODVPHMRUHV LPÂŁJHQHVFXDOTXLHUKDELWDFLÂľQ

28â&#x20AC;?/32â&#x20AC;?

28â&#x20AC;? LED 28M6000

LED HAIER M6000 229â&#x201A;Ź

199â&#x201A;Ź

31,90â&#x201A;Ź/mes* 8 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 255,20â&#x201A;Ź

Rf: 11-148.417.03011

AHORRA 30â&#x201A;Ź

32â&#x20AC;? LED 32M6000

259â&#x201A;Ź

239â&#x201A;Ź

32,15â&#x201A;Ź/mes* 9 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 289,35â&#x201A;Ź

Rf: 11-148.419.13040

AHORRA 20â&#x201A;Ź

0HGLGDVĹ&#x201D; $[+[) [[FPFRQSHDQD[[FP Ĺ&#x201D;[[FPFRQSHDQD[[FP 3HVRĹ&#x201D;NJFRQSHDQDNJĹ&#x201D;NJFRQSHDQDNJ

14

PodrĂĄs recoger tu pedido en Consulta este servicio a tu operadora o en latiendaencasa.es

por solo 1â&#x201A;Ź


A la vanguardia de la tecnología Samsung Galaxy S5

/OHJDODQRYHGDGP£VHVSHUDGDGH6DPVXQJVXLQFUH¯EOH6PDUWSKRQH*DOD[\6<DKRUDWLHQHVODSRVLELOLGDGGHFRQVHJXLUOR FRQWRGDVODVIDFLOLGDGHVSRUPX\SRFRGLQHURDOPHV8Q6PDUWSKRQHXOWUDŵQR\OLJHURFRQXQDHQRUPHSDQWDOOD6XSHU$02/(' )XOO+'GHŔGRQGHSRGU£VYHUFRQWRWDOFDOLGDG\XQDGHŵQLFLµQHVSHFWDFXODUWRGRVWXVY¯GHRV\DSOLFDFLRQHV8QQXHYRGLVH³RSRUIXHUD \WDPEL«QSRUGHQWUR\DTXHSRGU£VQDYHJDUGHXQDIRUPDPXFKRP£VFODUDHLQWXLWLYDDFFHGHUDWX]RQDSHUVRQDOFRQP£VVHJXULGDG FRQVXHVF£QHUGHKXHOODVGDFWLODUHVSDUDGHVEORTXHDUOR\KDFHUWXVPHMRUHVIRWRVFRQVXF£PDUDGHPHJDS¯[HOHVFRQVXDXWRIRFXV GHVHJ$GHP£VVXIXQFLµQ6+HDOWKFRQSXOVµPHWURSRGµPHWUR\HQWUHQDGRUSHUVRQDOWHD\XGDU£DGLVIUXWDUGHXQHVWLORGHYLGD VDOXGDEOH<SDUDTXHOROOHYHVDWRGDVSDUWHVHVUHVLVWHQWHDODOOXYLDO¯TXLGRVVXGRU\SROYR1RHVSHUHVP£V\GHVFXEUHW¼PLVPRWRGDVVXV SRVLELOLGDGHV Smartphone Libre 5,1” Samsung Galaxy S5 699€

30,32€

5,1”

/mes*

29 cuotas SIN ENTRADA TAE 19,56% TIN 18% PVP Final a plazos 879,28€

Negro, Rf: 11-570.634.03737.XX9 Blanco, Rf: 11-570.634.03745.XX9 Azul, Rf: 11-570.634.03752.XX9

0HGLGDV $[+[) [[FP

EXCLUSIVO

Tu espacio de ocio más decorativo

2UGHQDWRGRVWXVGLVFRVSHO¯FXODVYLGHRMXHJRVGHODPDQHUDP£VSU£FWLFD\GHFRUDWLYDFRQHVWDVHOHFFLµQGHDUFKLYDGRUHV&OHPHQWV\+RIPDQQ 8QRVGLVH³RVTXHWHSHUPLWLU£QDOPDFHQDUKDVWD&'R'9'GHSHQGLHQGRGHOPRGHOR7HQGU£VWRGRHORFLRRUGHQDGR\FODVLŵFDGR

1

2 1.- Archivador Clements Volga, 79,90€

59,90€ 6RORKDVWD

Natural/Cerezo, Rf: 11-979.385.02123 Wengué, Rf: 11-979.385.02131

25% DTO

0HGLGDV $[+[) [[FP &DSDFLGDG'9'R&' 2.- Archivador Clements Alaska, 69€

49€

6RORKDVWD

Cerezo, Rf: 11- 979.385.02180 Negro, Rf: 11-979.385.02172

29% DTO

0HGLGDV $[+[) [[FP &DSDFLGDG&''9'R%OXUD\ )LQDQFLDFLµQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJO«V()&6$2SHUDFLµQVXMHWDDODDSUREDFLµQ GHVX&RPLW«GH&U«GLWR0HQVXDOLGDGP¯QLPDŞ*DVWRVGHHQY¯RLQFOXLGRVHQODFXRWD Ş  &RQLQWHUHVHV7$(7,1

3

3.- Mueble archivador Hofmann 9055, 54,50€

39€

6RORKDVWD

Rf: 11-385.167.18384

29% DTO

0HGLGDV $[+[)  DELHUWR[[FP FHUUDGR[[FP &DSDFLGDG&'

4 4.- Archivador Clements Drawer, 69€

49€

6RORKDVWD

Rf: 11- 979.385.02198

29% DTO

0HGLGDV $[+[) [[FP &DSDFLGDG&'

+ info en

902 10 30 10 / latiendaencasa.es

15


Fotografías o vídeos… tus mejores recuerdos llevan la marca Samsung

NUEVO

8QPRPHQWRSXHGHUHFRUGDUVHSDUDVLHPSUHFRQODVKHUUDPLHQWDVDGHFXDGDV3RUHVR6DPVXQJLQFRUSRUDHQVXVF£PDUDV\YLGHRF£PDUDV ODPHMRUWHFQRORJ¯DµSWLFD\GHJUDEDFLµQSDUDTXHWRGDVWXVIRWRJUDI¯DV\Y¯GHRVWHQJDQXQDFDOLGDGH[FHSFLRQDO6LWHJXVWDKDFHUSHO¯FXODV FRQODYLGHRF£PDUD)FDSWXUDU£VY¯GHRVQ¯WLGRVHQ+'8QDYLGHRF£PDUDFRPSDFWDFRQSDQWDOOD/&'GHŔVHQVRUGHPHJDS¯[HOHV\ LQWHOOL]RRPGH[ ]RRPµSWLFRGH[ TXHWHDFHUFDU£DODDFFLµQDXQTXHHVW«VOHMRVGHODDFFLµQTXHTXLHUHVJUDEDU<VLWXRSFLµQHVOD IRWRJUDI¯DODF£PDUD:%)FRQSDQWDOODGHŔVHQVRUGHPHJDS¯[HOHV\]RRPµSWLFR[WHSHUPLWLU£FDSWXUDULP£JHQHVFRQWRGR GHWDOOH\FRPSDUWLUODVDOPRPHQWRDWUDY«VGH:L)LFRQWRGRVWXVDPLJRV(OLJHODWX\D\GLVIUXWDGHODFDOLGDG6DPVXQJHQFDGDPRPHQWR

3”

Cámara de Fotos Samsung WB1100F + REGALO Tarjeta SD 4GB,

249€

30

Videocámara Samsung HMX-F90BP, 169€

REGALO

,95€

149€

Tarjeta SD 4 GB Hasta el 31-05-14

/mes*

9 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 278,55€

Negra, Rf: 11-148.610.05388 Blanca, Rf: 11-148.610.05404

Negra, Rf: 11-101.142.85561 Roja, Rf: 11-101.142.85579

+ DE 11% DTO

0HGLGDV $[+[) [[FP

REGALO PERFECTO

0HGLGDV $[+[) [[FP

Vigila y graba los movimientos

REGALO PERFECTO

La mejor oferta para iniciarse

de tu bebé

en la astronomía

&RQHVWHYLJLODEHE«VLQDO£PEULFRFRPSXHVWRSRUXQDF£PDUD DFRORUFRQPLFUµIRQRLQFRUSRUDGR\XQDSDQWDOODDFRORU/&' GHŔQRVRORSRGU£VYHUDWXKLMRGHVGHFXDOTXLHUKDELWDFLµQ VLQRTXHWDPEL«QSRGU£VJUDEDU\UHSURGXFLUY¯GHR\SDVDUORVDO RUGHQDGRUSDUDYHUORVFXDQGRTXLHUDV(VWDU£VFRPXQLFDGRHQWRGR PRPHQWR\DTXHSHUPLWHXQDFRPXQLFDFLµQGHYR]ELGLUHFFLRQDO\ FXHQWDFRQYLVLµQQRFWXUQD,QFOX\HXQSU£FWLFRWU¯SRGHSDUDFRORFDU ODF£PDUDHQHOPHMRU£QJXORGHYLVLµQFRQVHJXULGDG/DLGHDP£V SU£FWLFDSDUDVDEHUDOLQVWDQWHFµPRVHHQFXHQWUDWXKLMR

6LWHLQWHUHVDFRQRFHUORVVHFUHWRVGHOXQLYHUVRFRQHVWHSDFN 3HQWDŶH[SRGU£VGHVFXEULUVXVPDUDYLOODV8QWHOHVFRSLRUHIUDFWRU FRQXQDOHQWH%DUORZ[IRFDOPPREMHWLYRGHPP\RFXODU GHPP,QFRUSRUDHUHFWRUGHLPDJHQ[SDUDODREVHUYDFLµQ WHUUHVWUHEXVFDGRU[\SULVPDFHQLWDOGH|DGHP£VGHXQ WU¯SRGHSDUDIDFLOLWDUWHODYLVLµQ<HQHVWHSDFNLQFOX\HXQPDQXDOGH LQLFLDFLµQDODDVWURQRP¯DXQSODQLVIHULRSDUDTXHSXHGDVORFDOL]DU HLGHQWLŵFDUWRGRVORVREMHWRVFHOHVWHVMXQWR FRQXQPDOHW¯QGHWUDQVSRUWH

Vigilabebés con pantalla BM-201, 169,90€

139€ 6RORKDVWD

Rf: 11-979.385.02115

+ DE 18% DTO

2,4”

REGALO

Maletín de transporte + Planisferio + DVD + Manual de iniciación a la Astronomía

Telescopio Refractor AZ-2 60/700 Pentaflex + REGALOS,

89€

Rf: 11-101.401.01568

16

Recibe el pedido donde tú quieras Tú eliges el lugar de entrega


Calidad Réflex para momentos inolvidables /DF£PDUD(26'GH&DQRQLQWHJUDODVIXQFLRQHVP£VSURIHVLRQDOHVSDUDFDSWDUODHPRFLµQGHOPRPHQWRFRQWRGRGHWDOOH \ODVP£[LPDVIDFLOLGDGHVJUDFLDVDVXPRGRGHHVFHQDVDXWRP£WLFRLQWHOLJHQWH$GHP£VGLVIUXWDU£VGHPD\RUYHUVDWLOLGDGJUDFLDV DVXVŵOWURVFUHDWLYRVTXHWHGDU£QPD\RUHVSRVLELOLGDGHVDODKRUDGHUHDOL]DUODVIRWRJUDI¯DVP£VVRUSUHQGHQWHV\RULJLQDOHV<SRU VLIXHUDSRFRWDPEL«QJUDEDY¯GHRV)XOO+'7RGRHQXQGLVH³RUHVLVWHQWH\FµPRGRFRQXQDSDQWDOOD/&'GHŔ(OLJHWXPRGHORFRQ REMHWLYRGHPPRFRQGRVREMHWLYRVPPPPHQHVWDRIHUWDTXHLQFOX\HGRVSU£FWLFRV5(*$/26\XQDGHVFDUJD JUDWXLWDGHODJX¯D&DQRQSDUDDSUHQGHUDVDFDUHOP£[LPRSDUWLGRDWXF£PDUD Cámara Reflex Digital Canon EOS 1200D + REGALOS Bolsa transporte + Tarjeta 8 Gb + Guía Canon Objetivo 18-55IS VUK

559€ 529€ 6RORKDVWD

30,10€ /mes*

21 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 632,10€

Rf: 11-101.141.19497

AHORRA 30€

Objetivo 18-55DC + 75-300 DC VUK

679€ 649€ 6RORKDVWD

30,78€ /mes*

26 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 800,28€

Rf: 11-101.141.19505

AHORRA 30€

REGALO

Bolsa de transporte + Tarjeta 8 GB + Guía Canon EOS (valorado en 99€)

Tecnología que busca la perfección 1XQFDXQDF£PDUDFRPSDFWDKDE¯DGDGRWDQWDVSRVLELOLGDGHVSDUDUHDOL]DUXQDVIRWRJUDI¯DVGH FDOLGDGH[FHSFLRQDOGHXQDIRUPDWDQVHQFLOOD2O\PSXV;=FRQXQDSDQWDOOD/&'DEDWLEOH\W£FWLO GHŔLQWHJUDXQSRWHQWHSURFHVDGRUXQQXHYRVHQVRUGHDOWDVHQVLELOLGDGGHPHJDS¯[HOHV \XQREMHWLYRGHFDOLGDGSDUDIRWRVQRFWXUQDV6XDMXVWH+'5WHSHUPLWLU£FRQVHJXLUODP£[LPD GHŵQLFLµQHQFDGDLPDJHQ\DGHP£VWLHQHVKDVWDŵOWURVDUW¯VWLFRVSDUDFUHDUODVLP£JHQHVP£V FUHDWLYDV<SRGU£VDFFHGHUDWRGDVODVIXQFLRQHVGHIRUPDLQVWDQW£QHDFRQXQVLPSOHJLURGHO DQLOORGHOREMHWLYR/DWHFQRORJ¯DP£VDYDQ]DGDDKRUDFRQXQGHGHVFXHQWR Cámara Réflex Olympus XZ-2

30

,23€ /mes*

10 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 302,30€

SOLO

OFERTA

EXCLUSIVA 499€

349€

269€

AHORRA 230€

53

UNIDADES

Rf: 11-101.142.81396

0HGLGDV $[+[)  [[FP 3HVRJ

)LQDQFLDFLµQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJO«V()&6$2SHUDFLµQVXMHWDDODDSUREDFLµQ GHVX&RPLW«GH&U«GLWR0HQVXDOLGDGP¯QLPDŞ*DVWRVGHHQY¯RLQFOXLGRVHQODFXRWD Ş  &RQLQWHUHVHV7$(7,1

3”

+ info en

902 10 30 10 / latiendaencasa.es

17


DiseĂąo retro para la mĂşsica mĂĄs actual 9XHOYHDGLVIUXWDUGHWXVGLVFRVGHYLQLORGHXQDIRUPDRULJLQDOFRQHVWRVUHSURGXFWRUHVGH/DXVRQ8QRVGLVHÂłRVUHWURTXHDGHPÂŁVGH UHSURGXFLUYLQLORVWDPELÂŤQOHHQ&'03FDVHWHĹ&#x2122;\FRQORVTXHSRGUÂŁVJUDEDUGHVGHHOYLQLORDO86%RWDUMHWDV6'SDUDGLVIUXWDUGHWXV FDQFLRQHVHQIRUPDWRGLJLWDO(OLJHWXPRGHORXQDJUDPRODFRQOXFHVGHQHÂľQDOPÂŁVHVWLORDÂłRVXQWRFDGLVFRVFOÂŁVLFRUHDOL]DGRHQ PDGHUDRXQWRFDGLVFRVHVWLORDÂłRV8QRVGLVHÂłRVTXHQXQFDSDVDUÂŁQGHPRGD\TXHDKRUDHVWÂŁQDWXDOFDQFHSRUPX\SRFR

Tocadiscos retro Lauson CL123, 195â&#x201A;Ź

169â&#x201A;Ź 6RORKDVWD

Rf: 11-385.102.03078

+ DE 13% DTO

CARACTERĂ?STICAS CL123: â&#x20AC;˘Â GrabaciĂłn desde el vinilo, CD y casete al USB y tarjeta SD â&#x20AC;˘Â 3 velocidades tocadiscos â&#x20AC;˘Â FunciĂłn CD/MP3 â&#x20AC;˘Â Radio AM/FM â&#x20AC;˘Â Puerto USB â&#x20AC;˘Â Lector de tarjeta SD â&#x20AC;˘Â CD/USB/SD programable â&#x20AC;˘Â Mando a distancia â&#x20AC;˘Â Medidas (A x H x F): 45,5 x 34,5 x 24 cm

JukeBox Lauson CL130, 851â&#x201A;Ź

32,50â&#x201A;Ź

Tocadiscos retro Lauson CL139,

149

/mes*

â&#x201A;Ź

34 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 1.105â&#x201A;Ź

Rf: 11-385.156.07190

Rf: 24-979.385.JUKBX

CARACTERĂ?STICAS CL139: â&#x20AC;˘Â Reproductor de vinilo/CD/MP3 â&#x20AC;˘Â Graba a tarjeta USB/SD desde el tocasdiscos/ CD â&#x20AC;˘Â Graba desde USB a tarjeta SD o viceversa â&#x20AC;˘Â 3 velocidades tocadiscos â&#x20AC;˘Â Radio AM/FM â&#x20AC;˘Â Medidas (A x H x F): 38,5 x 35,5 x 17,7 cm

Coge tu guitarra y aprende a tocar paso a paso (PSLH]DDWRFDUODJXLWDUUDFRQXQPÂŤWRGRGHDSUHQGL]DMH QRYHGRVRLQWHUDFWLYR\GLGÂŁFWLFR(OLJHWXJXLWDUUD(VSDÂłROD 'XTXHVDR(OÂŤFWULFD+HDYHQ\DSUHQGHUÂŁVWRGRVORVHVWLORVGH IRUPDIÂŁFLO\GLYHUWLGDFRQVXFXUVRHQ'9'TXHLQFOX\H7DPELÂŤQ WHQGUÂŁVWRGRVORVDFFHVRULRVQHFHVDULRVSDUDWXJXLWDUUD\SDUD JXLDUWHHQWXVHMHUFLFLRV&RJHWXJXLWDUUD\DSUHQGHDWXULWPRGH ODPDQRGHORVPHMRUHVSURIHVLRQDOHV

Pack aprende Guitarra ElĂŠctrica Heaven Atalaya (9 productos en 1),

159â&#x201A;Ź

Tostado, Rf: 11-386.307.05481 Negro, Rf: 11-386.307.06497

Pack aprende Guitarra espaĂąola Duquesa Atalaya (7 productos en 1),

89â&#x201A;Ź

Rf: 11-386.304.01446

RESERVA TU PEDIDO Disponibe 07-05-14

PACK APRENDE GUITARRA ESPAĂ&#x2018;OLA: â&#x20AC;˘ Guitarra espaĂąola Duquesa â&#x20AC;˘ Funda â&#x20AC;˘ Curso en DVD â&#x20AC;˘ AďŹ nador, metrĂłnomo y generador de sonidos electrĂłnico â&#x20AC;˘ Set de 6 cuerdas â&#x20AC;˘ Cejilla

18

CARACTERĂ?STICAS JUKEBOX: â&#x20AC;˘Â Grabador vinilo al USB/SD â&#x20AC;˘Â Lector CD, MP3/CD-RW â&#x20AC;˘Â Radio AM/FM â&#x20AC;˘Â Entrada para tarjetas USB/SD â&#x20AC;˘Â Entrada Jack RCA â&#x20AC;˘Â Cable RCA a Jack a 3,5 mm â&#x20AC;˘Â Medidas (A x H x F): 65.5 x 11,77 x 41,3 cm â&#x20AC;˘Â Peso: 37 kg

CĂłmodas mensualidades TĂş eliges la forma de pago

PACK APRENDE GUITARRA ELĂ&#x2030;CTRICA: â&#x20AC;˘ Guitarra elĂŠctrica tipo Stratocaster â&#x20AC;˘ Funda â&#x20AC;˘ AmpliďŹ cador â&#x20AC;˘ Curso en DVD â&#x20AC;˘ Libreto â&#x20AC;˘ AďŹ nador electrĂłnico â&#x20AC;˘ Correa â&#x20AC;˘ PĂşa â&#x20AC;˘ Cable de conexiĂłn


NUEVO

&RQYLÂŤUWHWHHQXQSURIHVLRQDOGHODWHFQRORJÂŻDFRQODVQXHYDV6DPVXQJ*DOD[\3526XLPSUHVLRQDQWHSDQWDOODGHPLOORQHVGH SÂŻ[HOHVRIUHFHODUHVROXFLÂľQPÂŁVDOWDSDUDYHUXQYÂŻGHRKRMHDUXQDUHYLVWDGLJLWDOH[DPLQDUWXVGRFXPHQWRVRYHUXQDSHOÂŻFXODFRQODV LPÂŁJHQHVPÂŁVSUHFLVDV\ORVFRORUHVPÂŁVEULOODQWHVXQLGRDXQVRQLGRH[FHSFLRQDODWUDYÂŤVGHVXVDOWDYRFHVGXDOHV5HDOL]DUÂŁVFXDOTXLHU WDUHDGHPDQHUDPÂŁVSURGXFWLYD\GHIRUPDVLPXOWÂŁQHDJUDFLDVDVXIXQFLÂľQ0XOWL:LQGRZTXHWHSHUPLWHWHQHUDELHUWDVYDULDVSÂŁJLQDVD ODYH]MXHJDQDYHJDSRU,QWHUQHWHGLWDXQGRFXPHQWRĹ&#x2122;WRGRDOPLVPRWLHPSR(OLJHWXPRGHOR1RWH352HQĹ&#x201D;FRQ*%R7DE352 HQĹ&#x201D;RHQĹ&#x201D;FRQ*%7RGRVORVPRGHORVHVWÂŁQGLVSRQLEOHVHQEODQFRRHQQHJURFRQ:L)LRFRQ:L)L\*

8,4â&#x20AC;?

10,1â&#x20AC;?

12,2â&#x20AC;?

Tablet Samsung Galaxy Tab Pro 8,4â&#x20AC;&#x2122;â&#x20AC;&#x2122; 16 GB 399â&#x201A;Ź

Tablet Samsung Galaxy Tab Pro 10,1â&#x20AC;&#x2122;â&#x20AC;&#x2122; 16 GB 499â&#x201A;Ź

Tablet Samsung Galaxy Note Pro 12,2â&#x20AC;&#x2122;â&#x20AC;&#x2122; 32 GB 749â&#x201A;Ź

con Wi-Fi

con Wi-Fi

con Wi-Fi

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Pantalla WQXGA (2560 x 1600) â&#x20AC;˘ CĂĄmara 8 MP AF + Flash + 2 MP â&#x20AC;˘ Bluetooth 4.0 â&#x20AC;˘ GPS â&#x20AC;˘ Android KitKat 4.4 â&#x20AC;˘ Medidas (A x H x F) 8,4â&#x20AC;?: 21,9 x 12,85 x 0,72 cm; 10,1â&#x20AC;?: 24,31 x 17,14 x 0,73 cm; 12,2â&#x20AC;?: 29,56 x 20,40 x 0,79 cm â&#x20AC;˘ Peso 8,4â&#x20AC;?: 331 g; 10,1â&#x20AC;?: 469 g; 12,2â&#x20AC;?: 750 g

/mes*

15 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 459,45â&#x201A;Ź

Blanca, Rf: 11-152.171.05962 Negra, Rf: 11-152.171.05970

30

,97â&#x201A;Ź /mes*

19 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 588,43â&#x201A;Ź

Blanca, Rf: 11-152.171.05988 Negra, Rf: 11-152.171.05996

/mes*

19 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 588,43â&#x201A;Ź

Blanca, Rf: 11-152.171.06002 Negra, Rf: 11-152.171.06010

599â&#x201A;Ź

con Wi-Fi y 4G

con Wi-Fi y 4G

499â&#x201A;Ź

30,97â&#x201A;Ź 30

/mes*

Blanca, Rf: 11-152.171.06028 Negra, Rf: 11-152.171.06036

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQ GHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1

/mes*

31 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 954,18â&#x201A;Ź

849â&#x201A;Ź

,39â&#x201A;Ź

24 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 729,36â&#x201A;Ź

30,78â&#x201A;Ź

Blanca, Rf: 11-152.171.06044 Negra, Rf: 11-152.171.06051

con Wi-Fi y 4G

30,63â&#x201A;Ź

31,04â&#x201A;Ź /mes*

36 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 1.117,44â&#x201A;Ź

Blanca, Rf: 11-152.171.06069 Negra, Rf: 11-152.171.06077

+ info en

902 10 30 10 / latiendaencasa.es

19


EXCLUSIVO

Rendimiento â&#x20AC;&#x153;todo en unoâ&#x20AC;? con REGALO y al mejor precio

7HRIUHFHPRVHO+33DYLOLRQ7RXFK6PDUWIHV$L2XQ3&PXOWLIXQFLRQDOFRQXQSRWHQWHUHQGLPLHQWR\XQHVWLOR\GLVHÂłRTXHWH SHUPLWLUÂŁDKRUUDUHVSDFLR8QRUGHQDGRUWÂŁFWLOTXHWHSHUPLWLUÂŁUHDOL]DUPXOWLWXGGHWDUHDVHQFXHVWLÂľQGHVHJXQGRV&RQDYDQ]DGDV SUHVWDFLRQHVFRPRVX3URFHVDGRU,QWHOp&RUH70L7%GHGLVFRGXURWDUMHWDJUÂŁĹľFD19,',$*H)RUFH*7$86% 86%:HEFDPLQWHJUDGDĹ&#x2122;\WRGRHQXQRUGHQDGRUFX\D&38YLHQHLQWHJUDGDHQVXPRQLWRUGHĹ&#x201D;FRQSDQWDOODWÂŁFWLO:/(' SDQRUÂŁPLFDGH$OWD'HĹľQLFLÂľQ3ÂŁJDORHQFÂľPRGDVFXRWDVGHĹ&#x17E;DOPHV VLQHQWUDGD\GH5(*$/2OOÂŤYDWHXQDPXOWLIXQFLÂľQ+3 SDUDLPSULPLUFRSLDU\HVFDQHDUWRGRVWXVWUDEDMRV

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Procesador IntelÂŽ Coreâ&#x201E;˘ i3-3240 â&#x20AC;˘ 4 GB DDR3 â&#x20AC;˘ Disco Duro 1 TB â&#x20AC;˘ Grabadora de DVD SuperMulti â&#x20AC;˘ Wi-Fi â&#x20AC;˘ Web-cam HP TrueVision con dos micrĂłfonos digitales array integrados â&#x20AC;˘ 4 x USB 2.0; 2 x USB 3.0 â&#x20AC;˘ Medidas (A x H x F): 60,3 x 47,4 x 10,4 cm â&#x20AC;˘ Peso: 9,7 kg

23â&#x20AC;?

SOLO

65

UNIDADES

OFERTA EXCLUSIVA

REGALO MultifunciĂłn Tinta HP Deskjet 3524 (valorado en 79,90â&#x201A;Ź)

Ordenador sobremesa 23â&#x20AC;? HP Pavilion TouchSmart 23-f203es AiO + REGALO MultifunciĂłn Tinta HP Deskjet 3524 Wi-Fi ePrint (valorado en 79,90â&#x201A;Ź)

32 899â&#x201A;Ź

,85â&#x201A;Ź /mes*

36 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 1.182,60â&#x201A;Ź

Rf: 11-979.713.67384

20

latiendaencasa.es es variedad


Comodidad y tecnologĂ­a en menos espacio

<DSXHGHVWHQHUODWHFQRORJÂŻDPÂŁVFRPSOHWDGH+3 HQXQGLVHÂłRÂźQLFRTXHQRRFXSDUÂŁHVSDFLRHQWXKDELWDFLÂľQ RVDOÂľQ8QWRGRHQXQRGHĹ&#x201D;FRQSURFHVDGRU$38$0' (VVHQWLDO(FRQ*UÂŁĹľFD$0'5DGHRQĹ +'\ OD&38LQWHJUDGDHQVXSDQWDOODTXHFXHQWDDGHPÂŁVFRQ XQVLVWHPDGHLQFOLQDFLÂľQKDFLDGHODQWH\KDFLDDWUÂŁVSDUD TXHSXHGDVYLVXDOL]DUORFRQWRWDOFRPRGLGDG'LVIUXWDGHOD PÂźVLFDPÂŁVDFWXDOVLQDQXQFLRVFRQ+3&RQQHFWHG0XVLF \WHQGUÂŁVDFFHVRDOLVWDVGHUDGLRLOLPLWDGDVGXUDQWH PHVHV 8QDVROXFLÂľQH[FHSFLRQDOGRQGHWRGRFDEH HQVRORĹ&#x201D;DKRUDDWXDOFDQFHSRUVRORĹ&#x17E;

20â&#x20AC;?

Ordenador sobremesa AiO 20â&#x20AC;? HP Pavilion 20-2010es

499

â&#x201A;Ź

30,97â&#x201A;Ź/mes* 19 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 588,43â&#x201A;Ź

Rf: 11-152.153.14624

SOLO

85

UNIDADES

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ APU AMD Dual-Core E1-2500 â&#x20AC;˘ 4 GB DDR3 â&#x20AC;˘ Disco Duro 1 TB â&#x20AC;˘ Grabadora de DVD SuperMulti â&#x20AC;˘ Wi-Fi â&#x20AC;˘ 4 x USB 2.0; 2 x USB 3.0 â&#x20AC;˘ Medidas (A x H x F): 49,5 x 33,9 x 7,2 cm â&#x20AC;˘ Peso: 7,03 kg â&#x20AC;˘ Windows 8: Algunas aplicaciones se venden por separado; varĂ­an segĂşn mercado

EXCLUSIVO

** Sujeto a la compra de ordenadores portĂĄtiles, de sobremesa y tablets HP con Windows 8 y Windows 8.1 entre el 10 de abril de 2014 y el 30 de junio de 2015. Se aplican tĂŠrminos y condiciones. MĂĄs informaciĂłn en hp.es/connectedmusic

3 funciones en 1

,PSULPHFRSLD\HVFDQHDFRQHVWDPXOWLIXQFLÂľQ$OOLQ2QH ,QFOX\HGH5(*$/2XQFDUWXFKRH[WUDGHFRORUQHJUR\ RWURPXOWLFRORU\XQSDFNGHSDSHOIRWRJUÂŁĹľFR+3 MultifunciĂłn Tinta HP Envy 4504, + REGALO 2 cartuchos extra tinta y pack papel fotogrĂĄďŹ co (valorado en 49,90â&#x201A;Ź),

119,99â&#x201A;Ź

99,90â&#x201A;Ź

Rf: 11-152.260.13058

SOLO

+ DE 16% DTO

46

0HGLGDV $[+[)  [[FP 3HVRNJ

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQ GHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1

UNIDADES

+ info en

902 10 30 10 / latiendaencasa.es

21


EXCLUSIVO

PortĂĄtil y Tablet: dos mejor que uno

/DSRUWDELOLGDGGHODWDEOHWVHFRPELQDFRQODSURGXFWLYLGDGGHOSRUWÂŁWLOFRQHOQXHYR+36ODWH%RRN8QGLVSRVLWLYRSRUWÂŁWLO WDEOHW3RGUÂŁVHOHJLUHQFDGDPRPHQWRFÂľPRTXLHUHVWUDEDMDUFRQXQSRUWÂŁWLOFRQSDQWDOODGHĹ&#x201D;\WHFODGRRFRQXQDWDEOHW GHXQGLVHÂłRHOHJDQWH\FÂľPRGRSHUIHFWRSDUDOOHYDUDWRGDVSDUWHV\QDYHJDUSRU,QWHUQHWYHUXQDSHOÂŻFXODFRPSDUWLUWXVIRWRJUDIÂŻDV \YÂŻGHRVĹ&#x2122;,QWHJUDXQSURFHVDGRU19,',$p7HJUDp763OXV\$QGURLGTXHWHGDUÂŁDFFHVRDODVPÂŁVLPSRUWDQWHVDSOLFDFLRQHV $GHPÂŁVFRQVXVFRQH[LRQHV+'0,\86%SRGUÂŁVFRPSDUWLUWXVDUFKLYRVFRQRWURVGLVSRVLWLYRVFRQODPHMRUFDOLGDG7HQGUÂŁVKRUDV \KRUDVGHDXWRQRPÂŻD\DTXHWDQWRODWDEOHWFRPRHOWHFODGRWLHQHQEDWHUÂŻDVLQGHSHQGLHQWHVcVLHPSUHHVWDUÂŁVFRQHFWDGR&RQ 6ODWH%RRNWHQGUÂŁVHOGREOHGHYHQWDMDVHQXQÂźQLFRHTXLSRc7ÂźHOLJHVHQFDGDPRPHQWR

10,1â&#x20AC;?

Ordenador 2 en 1 HP 10,1â&#x20AC;? SlateBook 10-h010ss x2

299

â&#x201A;Ź

30,66â&#x201A;Ź/mes* 11 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 337,26â&#x201A;Ź

Rf: 11-152.171.06838

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Procesador NVIDIAÂŽ TegraÂŽ â&#x20AC;˘ 2 GB DDR3 â&#x20AC;˘ 32 GB eMMC â&#x20AC;˘ Wi-Fi â&#x20AC;˘ Bluetooth 4.0 â&#x20AC;˘ 1 x USB 2.0 â&#x20AC;˘ 1 x HDMITM â&#x20AC;˘ Web-cam HP TrueVision HD en la parte frontal con micrĂłfono digital integrado, cĂĄmara FHD trasera (2,0 MP) â&#x20AC;˘ Android 4.2 â&#x20AC;˘ Medidas (A x H x F): 19,38 x 2,05 x 25,8 cm; Solo tablet: 18,22 x 0,96 x 25,8 cm ¡Peso: 1,27 kg; Solo tablet: 610 g

A todas partes con tu portĂĄtil &RQHVWHPDOHWÂŻQ+3SDUDSRUWÂŁWLOHVKDVWDĹ&#x201D;SRGUÂŁVOOHYDUORDWRGDV SDUWHVFRQFRPRGLGDG\VHJXULGDG\DTXHHVWÂŁDFROFKDGRSDUD SURWHJHUORGHJROSHV\FDÂŻGDV7DPELÂŤQLQFOX\HXQUDWÂľQÂľSWLFRFRQ FDEOHSDUDFXDQGRQHFHVLWHVWUDEDMDUFRQPÂŁVSUHFLVLÂľQ MaletĂ­n HP para portĂĄtil hasta 16â&#x20AC;? + RatĂłn Ăłptico,

34,90â&#x201A;Ź

Rf: 11-286.470.04044

0HGLGDV $[+[) [[FP 3HVRJ

22

Total satisfacciĂłn Si no quedas satisfecho te devolvemos el dinero


Descubre la verdadera versatilidad HP: de portĂĄtil a tablet en 360Âş +3SUHVHQWDHOSRUWÂŁWLOPÂŁVYHUVÂŁWLOGHOPHUFDGR6XFRORUWHDSDVLRQDUÂŁVXGLVHÂłRWHVRUSUHQGHUÂŁ\VXWHFQRORJÂŻDWHKDUÂŁYLEUDU(O +33DYLOLRQ[HVXQQXHYRFRQFHSWRGHRUGHQDGRUFRQXQVLVWHPDGHJLURGH|TXHWHSRVLELOLWDUÂŁFDPELDUIÂŁFLOPHQWHGH SRUWÂŁWLODWDEOHW8QHQTXHVHDGDSWDUÂŁDWRGDVWXVQHFHVLGDGHVWDQWRSDUDWUDEDMDUFRPRSDUDGLYHUWLUWHHQWXVGHVSOD]DPLHQWRV &RQXQDSDQWDOODWÂŁFWLOGHĹ&#x201D;WHGHVSOD]DUÂŁVFRQFRPRGLGDGSRUWRGRVORVPHQÂźV\DSOLFDFLRQHV\REWHQGUÂŁVHOPÂŁ[LPRSDUWLGRGH WXRUGHQDGRUHQSRVLFLÂľQYHUWLFDOXKRUL]RQWDO&RQXQSRWHQWHSURFHVDGRU*%GH5$0\'LVFR'XURGH*%WHGDUÂŁPÂŁVYHORFLGDG \RSFLRQHVSDUDGLVIUXWDUGHWRGRVWXVDUFKLYRV<FRQVXVRQLGR%HDWV$XGLRĹ GLVIUXWDUÂŁVGHOPHMRUVRQLGR\GHODPÂźVLFDPÂŁVDFWXDO VLQDQXQFLRVFRQ+3&RQQHFWHG0XVLF\SRGUÂŁVHVFXFKDUOLVWDVGHUDGLRLOLPLWDGDVGXUDQWHPHVHV 7RGRORTXHQHFHVLWDVSDUDWX SURGXFWLYLGDG\HQWUHWHQLPLHQWRDKRUDHQXQDRIHUWDDWXDOFDQFH\DTXHSRGUÂŁVĹľQDQFLDUORSRUĹ&#x17E;DOPHV RSRUĹ&#x17E;

11,6â&#x20AC;?

Ordenador portĂĄtil 11,6â&#x20AC;? rojo HP Pavilion 11-n000es X360 449â&#x201A;Ź

30

,77â&#x201A;Ź /mes*

17 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 523,09â&#x201A;Ź

Rf: 11-152.155.50458

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Procesador IntelÂŽ Celeron N2820 â&#x20AC;˘ 4 GB DDR3 â&#x20AC;˘ Disco Duro 500 GB â&#x20AC;˘ Web-cam TrueVision HD â&#x20AC;˘ Wi-Fi â&#x20AC;˘ BluetoothÂŽ 4.0 â&#x20AC;˘ 1 x HDMITM; 2 x USB 2.0; 1 x USB 3.0 â&#x20AC;˘ Medidas (A x H x F): 30,8 x 21,5 x 2,19 cm â&#x20AC;˘ Peso: 1,4 kg â&#x20AC;˘ Incluye McAfee LiveSafe: versiĂłn de prueba gratuita preinstalada para 30 dĂ­as â&#x20AC;˘ Windows 8: Algunas aplicaciones se venden por separado; varĂ­an segĂşn mercado

** Sujeto a la compra de ordenadores portĂĄtiles, de sobremesa y tablets HP con Windows 8 y Windows 8.1 entre el 10 de abril de 2014 y el 30 de junio de 2015. Se aplican tĂŠrminos y condiciones. MĂĄs informaciĂłn en hp.es/connectedmusic

Comodidad y rapidez en 9â&#x20AC;? por solo 99,90â&#x201A;Ź + Funda de REGALO

EXCLUSIVO

1HFHVLWDVRWURSXQWRGHYLVWDHQWXVFRPXQLFDFLRQHV\DSOLFDFLRQHV3ÂŁVDWHDDOJR PXFKRPÂŁVJUDQGHFRQHVWDWDEOHWGHĹ&#x201D;&RQXQSURFHVDGRU'XDO&RUH$QGURLG *%GHPHPRULD\*%GH5$0HVSHUIHFWDSDUDYHUWXVYÂŻGHRVSHOÂŻFXODVĹ&#x2122;,QFOXVR SRGUÂŁVUHDOL]DUIRWRJUDIÂŻDVDWUDYÂŤVGHVXFÂŁPDUDIURQWDO\WUDVHUD\FRQHFWDUODD RWURVGLVSRVLWLYRVDWUDYÂŤVGHVXVSXHUWRPLQL86%RPLQL+'0,707HQGUÂŁVWRGDOD YHUVDWLOLGDGTXHQHFHVLWDVHQPHQRVGHJGHSHVR&RQVÂŻJXHODHQHVWDRIHUWD H[FOXVLYDSRUVRORĹ&#x17E;\UHFLELUÂŁVGH5(*$/2XQDIXQGDSURWHFWRUD

9â&#x20AC;?

Tablet 9â&#x20AC;? Edertix E_92 + REGALO Funda protectora,

99,90â&#x201A;Ź

Rf: 11- 979.713.67590

0HGLGDV $[+[) [[FP 3HVRJ

REGALO Funda protectora (valorado en 9,90â&#x201A;Ź)

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQ GHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1

+ info en

902 10 30 10 / latiendaencasa.es

23


La combinaciĂłn ganadora de HP: tecnologĂ­a, diseĂąo y precio

NUEVO

&RQVLJXHHOPÂŁ[LPRUHQGLPLHQWRSRUWÂŁWLOSDUDKDFHUWXVWDUHDVPÂŁVH[LJHQWHVFRQHVWH+33DYLOLRQGHĹ&#x201D;9HUVDWLOLGDGSDUDUHDOL]DUPÂźOWLSOHV RSHUDFLRQHVVLQSUHRFXSDUWHSRUODSRWHQFLDJUDFLDVDVXSURFHVDGRU$38$0'(OLWH4XDG&RUH$0FRQ*UÂŁĹľFD$0'5DGHRQĹ  +'*JUÂŁĹľFRVGHĹľQLGRVSDUDWUDEDMDU\MXJDUGHXQDIRUPDPXFKRPÂŁVUHDODVÂŻFRPRVX'LVFR'XURGH*%SDUDDOPDFHQDUWXV YÂŻGHRVIRWRJUDIÂŻDV\PÂźVLFDFRQVHJXULGDG'LVIUXWDGHODPÂźVLFDPÂŁVDFWXDOVLQDQXQFLRVFRQ+3&RQQHFWHG0XVLF\SRGUÂŁVHVFXFKDUOLVWDV GHUDGLRLOLPLWDGDVGXUDQWHPHVHV 8QHTXLSRTXHFRPELQDGLVHÂłR\WHFQRORJÂŻDDODSHUIHFFLÂľQTXHHQHVWDRIHUWDSXHGHVDGTXLULUD XQSUHFLRLPSUHVLRQDQWHVRORĹ&#x17E;\FRQXQJUDQ5(*$/2ODGHVFDUJDJUDWXLWDGHOMXHJR%DWWOHĹľHOG CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘Â Procesador APU AMD Quad-Core A10-4600M â&#x20AC;˘Â 8 GB DDR3 â&#x20AC;˘Â Disco Duro 500 GB â&#x20AC;˘Â Grabadora de DVD SuperMulti â&#x20AC;˘Â Web-cam â&#x20AC;˘Â Wi-Fi â&#x20AC;˘Â GrĂĄďŹ ca AMD Radeon HD 7660G â&#x20AC;˘Â 1 x USB 2.0; 2 x USB 3.0 â&#x20AC;˘Â 1 x HDMITM â&#x20AC;˘Â Medidas (A x H x F): 42 x 3,28 x 26,7 cm â&#x20AC;˘Â Peso: 2,9 kg â&#x20AC;˘Â Windows 8: Algunas aplicaciones se venden por separado; varĂ­an segĂşn mercado

17â&#x20AC;?

REGALO

Descarga gratuita del juego Battlefield 4 (solo hasta el 30-06-14)

599

PortĂĄtil 17â&#x20AC;? HP Pavilion 17-e121ss,

â&#x201A;Ź

30,39â&#x201A;Ź/mes* 24 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 729,36â&#x201A;Ź

Rf: 11-152.155.50367

** Sujeto a la compra de ordenadores portĂĄtiles, de sobremesa y tablets HP con Windows 8 y Windows 8.1 entre el 10 de abril de 2014 y el 30 de junio de 2015. Se aplican tĂŠrminos y condiciones. MĂĄs informaciĂłn en hp.es/connectedmusic

EXCLUSIVO TamaĂąo compacto, sonido impresionante

(VWRVDOWDYRFHVFRQFRQH[LÂľQ 86%VRQSHUIHFWRVSDUD HVFXFKDUPÂźVLFD UHSURGXFLUMXHJRV \YHUSHOÂŻFXODV

OFERTA EXCLUSIVA

Si adquieres el HP Pavilion 17-e121ss o el HP Pavilion 15-n228ss llĂŠvate este altavoz por solo 17,50â&#x201A;Ź.

Tarjeta sintonizadora TV Hauppauge WINTV-MINISTICK-HD,

,99â&#x201A;Ź

Rf: 11-979.286.00358

24

Para ver y grabar la TV

6LQWRQL]DOD7'7HQWXRUGHQDGRUIÂŁFLOPHQWHFRQHVWHSHTXHÂłR VLQWRQL]DGRU7DPELÂŤQSRGUÂŁVJUDEDUDXWRPÂŁWLFDPHQWHWXV SURJUDPDVIDYRULWRV

50% DTO

Altavoz HP Multimedia Speakers Carpo,

34

EXCLUSIVO

SOLO

79

UNIDADES

PodrĂĄs recoger tu pedido en Consulta este servicio a tu operadora o en latiendaencasa.es

39, 99â&#x201A;Ź

Rf: 11-286.453.00709

por solo 1â&#x201A;Ź


¿Quieres tocarlo? HP TouchSmart con pantalla táctil 15”

NUEVO

'HVFXEUHHOGLVH³RTXHVHWRFDGH+3(VWHSRUW£WLO+33DYLOLRQGHŔFRQSDQWDOODW£FWLOHVWXRSFLµQSDUDGLVIUXWDUGHWRGDVODV SRVLELOLGDGHVGHXQDIRUPDPXFKRP£VLQWXLWLYD\FµPRGD6LPSOHPHQWHWRFDQGRGHVOL]DQGRRDFHUFDQGRORVGHGRVSRGU£VDFFHGHUD WXVDUFKLYRVDSOLFDFLRQHVFRUUHRVHOHFWUµQLFRVP¼VLFDř&RQXQSURFHVDGRU,QWHOp&RUH70L8KDU£VWXVWDUHDVDWRGDYHORFLGDG\GHOD PDQHUDP£VŵDEOH$GHP£VVXV*%GHPHPRULD\0%GH'LVFR'XURWHGDU£QHOHVSDFLRTXHQHFHVLWDVSDUDWXVSURJUDPDV\DUFKLYRV 'LVIUXWDGHFRQHFWLYLGDGFRPXQLFDFLµQ\YHUVDWLOLGDGHQFXDOTXLHUPRPHQWR\HQFXDOTXLHUOXJDU6XGLVH³ROLJHUR\GHOJDGRORJUDTXHVH FRQYLHUWDHQHOFRPSD³HURSHUIHFWRHQWRGRVWXVYLDMHV&RQV¯JXHORSRUPX\SRFRGLQHURDOPHV \DGHP£VOO«YDWHGH5(*$/2XQUDWµQ+3

15,6”

OFERTA EXCLUSIVA

REGALO Ratón HP X1000

(valorado en 29,90€)

SOLO

44

UNIDADES

Portátil 15,6” HP Pavilion 15-n228ss + REGALO Ratón HP X1000 (valorado en 29,90€)

30 699€

,32€ /mes*

29 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 879,28€

Rf: 11-979.713.67392

CARACTERÍSTICAS TÉCNICAS: • Procesador Intel® Core™ i5-4200U • 8 GB DDR3 • Disco Duro 500 GB • Grabadora de DVD SuperMulti • Web-cam • Wi-Fi • 1x USB 2.0; 2 x USB 3.0 • 1x HDMITM • Medidas (A x H x F): 38,56 x 2,47 x 25,8cm • Peso: 2,5 kg

Uno para todo ,PSULPHHVFDQHD\FRSLD FRQHVWDLPSUHVRUD$OOLQ2QH 6LQFRPSOLFDFLRQHV\FRQWRGD ODFDOLGDGHQXQGLVH³RFRPSDFWR

Multifunción Tinta HP Deskjet 1510,

49,99€

Rf: 11-152.260.12993

)LQDQFLDFLµQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJO«V()&6$2SHUDFLµQVXMHWDDODDSUREDFLµQ GHVX&RPLW«GH&U«GLWR0HQVXDOLGDGP¯QLPDŞ*DVWRVGHHQY¯RLQFOXLGRVHQODFXRWD Ş  &RQLQWHUHVHV7$(7,1

Comodidad y resistencia sobre tus hombros 8QWUDQVSRUWHVHJXUR\FµPRGR SDUDOOHYDUWXSRUW£WLOGHKDVWDŔ 7LHQHXQDSDUWHLQIHULRUUHIRU]DGD SDUDQHXWUDOL]DUORVJROSHV EROVLOORVSDUDWRGRVWXV DFFHVRULRV\HVUHVLVWHQWHDODJXD

Mochila HP Signature para portátil hasta 16’’,

49,90€

Rf: 11-286.471.00529

+ info en

902 10 30 10 / latiendaencasa.es

25


Destaca en lo mĂĄs importante. Smarpthones AIRIS con un ahorro de hasta 70â&#x201A;Ź NUEVO

(VWRV6PDUWSKRQHVGH$,5,6VRQSHUIHFWRVSDUDDFRPSDÂłDUWHHQHOGÂŻDDGÂŻD\HVWDUVLHPSUHLQIRUPDGRGHORTXHRFXUUHD WXDOUHGHGRU&RQXQRVGLVHÂłRVGHOJDGRV\XOWUDOLJHURVTXHLQWHJUDQXQDLQQRYDGRUDWHFQRORJÂŻDSDUDPRYHUWHFRQODVPHMRUHV DSOLFDFLRQHV\RSFLRQHVGHFRPXQLFDFLÂľQGXDOFRUH*%GHPHPRULDGXDOVLP\$QGURLG(OLJHHOPRGHOR70TXHLQFRUSRUD XQDSDQWDOODGHĹ&#x201D;\XQDFÂŁPDUDWUDVHUDGH0S[2VLSUHĹľHUHVXQWDPDÂłRPD\RUWXRSFLÂľQHVHO70FRQXQDSDQWDOODGHĹ&#x201D;\XQD FÂŁPDUDWUDVHUDGHPHJDSÂŻ[OHVFRQĹśDVK/('7RGRORTXHSXHGHVGHVHDUHQXQ6PDUWSKRQHDKRUDDOPHMRUSUHFLR

1 2

1- Smartphone libre 5â&#x20AC;? dual core AIRIS TM520, 199,90â&#x201A;Ź

2- Smartphone libre 4â&#x20AC;? dual core AIRIS TM420, 149,90â&#x201A;Ź

129,90â&#x201A;Ź 99,90â&#x201A;Ź

5â&#x20AC;?

6RORKDVWD

4â&#x20AC;?

6RORKDVWD

Rf: 11-979.570.00181

Rf: 11-979.570.00173

0HGLGDV $[+[)  [[FP 3HVRJ

0HGLGDV $[+[)  [[FP 3HVRJ

AHORRA 70â&#x201A;Ź

AHORRA 50â&#x201A;Ź

Carcasa trasera AIRIS,

9, 90â&#x201A;Ź

Roja para TM520, Rf: 11-979.286.00390 Roja para TM420, Rf: 11-979.286.00374 Verde para TM420, Rf: 11-979.286.00382

EXCLUSIVO

La mejor oferta para estar conectado:

Netbook 10â&#x20AC;? + Tablet 7â&#x20AC;? de REGALO 'LVIUXWDGHODWHFQRORJÂŻDHQWRGDVSDUWHVFRQHVWDLQFUHÂŻEOHRIHUWDTXHWHSUHVHQWDPRV (VWH1HWERRN$,5,6.LUD1HVXQDRSFLÂľQLGHDOSDUDWUDEDMDUFRQODVPHMRUHV SUHVWDFLRQHVHQFDVDRFXDQGRYD\DVGHYLDMH&RQXQDSDQWDOODSDQRUÂŁPLFDWÂŁFWLO GHĹ&#x201D;$QGURLGFRQWRGDVODVDSOLFDFLRQHVSDUDQDYHJDUSRU,QWHUQHW UHSURGXFLUYÂŻGHRVIRWRJUDIÂŻDVPÂźVLFDĹ&#x2122;\:HEFDPLQWHJUDGDSHUIHFWDSDUDKDEODU 10,1â&#x20AC;? GHVGHODGLVWDQFLDFRQORVWX\RV8QHTXLSRTXHWHIDFLOLWDUÂŁWRGDVWXVWDUHDV\TXH DKRUDFRQVHJXLUÂŁVFRQXQ5(*$/2HVSHFWDFXODUXQDWDEOHWGHĹ&#x201D;$,5,6 FRQSURFHVDGRU'XDO&RUHHOFRPSOHPHQWRSHUIHFWRSDUDOOHYDUDWRGDVSDUWHV \VHJXLUFRQHFWDGRDOOÂŁGRQGHYD\DV Netbook AIRIS KIRA N10050 TĂĄctil + REGALO Tablet 7â&#x20AC;? AIRIS TAB740,

199, 90â&#x201A;Ź Rf: 11-152.169.04373 Pago aplazado SIN ENTRADA* ConsĂşltanos

REGALO

Tablet 7â&#x20AC;? AIRIS (valorado en 89,90â&#x201A;Ź)

7â&#x20AC;?

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Netbook: Procesador: ARM Cortex A8 Core V7 hasta 1.2 GHz; Disco Duro: 4 GB; Memoria RAM: 1 GB; Wi-Fi; 1 x mini HDMITM; Medidas (A x H x F): 24,6 x 2,63 x 17,2 cm; Peso: 950 g. â&#x20AC;˘ Tablet: Procesador ARM Cortex A7 Dual Core V7 hasta 1.0 GHz; Wi-Fi; Medidas (A x H x F): 19,15 x 11,55 x 1,12 cm; Peso: 300 g; Android 4.2.2.

26

AtenciĂłn al cliente A tu disposiciĂłn para cualquier consulta (de lunes a sĂĄbado de 9â&#x20AC;&#x2122;00 a 20â&#x20AC;&#x2122;30 h)


Deporte Dual Bike: el pedaleador de piernas y brazos para todos los niveles 'XDO%LNHHVHODSDUDWRLGHDOSDUDKDFHUHMHUFLFLRVHQFLOORSU£FWLFRFµPRGRI£FLOGHPDQHMDU\ORPHMRUGHWRGRGLVH³DGRSDUDSRGHU XWLOL]DUORVLQVDOLUGHFDVD\VHQWDGRHQWXDVLHQWRIDYRULWR&RQ'XDO%LNHPXHYHVODVSLHUQDV\EUD]RVDOPLVPRWLHPSRHMHUFLWDQGR WRGDVODVDUWLFXODFLRQHVGHOFXHUSRGHVGHORVWRELOORVKDVWDODVURGLOODV\GHVGHODFDGHUDKDVWDHOKRPEUR3RGU£VVHOHFFLRQDUGLIHUHQWHV QLYHOHVGHUHVLVWHQFLDVHDMXVWDI£FLOPHQWHDODDOWXUDTXHGHVHHV\VXGLVH³RHUJRQµPLFRWHD\XGDDPDQWHQHUODSRVWXUDFRUUHFWDGXUDQWH HOHMHUFLFLR8QSHGDOHDGRUFRPSOHWR\FµPRGRTXHWDPEL«QLQFOX\HXQPRQLWRUSDUDPHGLUODGLVWDQFLDHOWLHPSR\ODVFDORU¯DVDV¯WHQGU£V WRGDODLQIRUPDFLµQDFWXDOL]DGDGHWXHQWUHQDPLHQWRc'LVIUXWDGHOHMHUFLFLRP£VFRPSOHWRDFXDOTXLHUKRUD\HQFXDOTXLHUSDUWH

59

Pedaleador Dual Bike,

,95€

Rf: 11-979.084.02478

0HGLGDV%DVH $[) [FP $OWRUHJXODEOHGHVGHFPKDVWDFP

3RGU£VVHOHFFLRQDUI£FLOPHQWH HOQLYHOGHUHVLVWHQFLD

3RGU£VYHUWRGDOD LQIRUPDFLµQGHWXHMHUFLFLR

)LQDQFLDFLµQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJO«V()&6$2SHUDFLµQVXMHWDDODDSUREDFLµQ GHVX&RPLW«GH&U«GLWR0HQVXDOLGDGP¯QLPDŞ*DVWRVGHHQY¯RLQFOXLGRVHQODFXRWD Ş  &RQLQWHUHVHV7$(7,1

+ info en

902 10 30 10 / latiendaencasa.es

27


SupĂŠrate en cada entrenamiento 6LWHJXVWDHOGHSRUWHDWRGDVKRUDVQRORSLHQVHVPÂŁV\HOLJHFDOLGDG%+DOPHMRUSUHFLR&RQHVWDVPÂŁTXLQDVWHQGUÂŁVWRGDVODVIDFLOLGDGHV \SUHVWDFLRQHVSDUDGLVIUXWDUGHXQHMHUFLFLRFRPSOHWR\H[LJHQWHVHDFXDOVHDWXSUHIHUHQFLDFRUUHUHOFLFOLVPRRODELFLFOHWDHOÂŻSWLFD )RUWDOHFHUÂŁVORVPÂźVFXORVDXPHQWDUÂŁVWXUHVLVWHQFLD\TXHPDUÂŁVFDORUÂŻDV7RGRFRQODJDUDQWÂŻDGHXQRVHVSHFLDOLVWDVHQGHSRUWHc(QPDUFKD

***InstalaciĂłn no incluida. Consulta servicio de montaje.

Cinta correr BH Fitness S Pro G6322*** 1.269â&#x201A;Ź

Bicicleta ciclismo indoor Spada GSG*** 1.069â&#x201A;Ź

999â&#x201A;Ź

799â&#x201A;Ź

6RORKDVWD 37â&#x201A;Ź/mes** 27 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIĂ&#x201C;N EXCLUSIVA

6RORKDVWD 31,96â&#x201A;Ź/mes** 25 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIĂ&#x201C;N EXCLUSIVA

Rf: 24-084.465.98883

Rf: 24-084.464.79696

AHORRA 270â&#x201A;Ź

AHORRA 270â&#x201A;Ź

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Motor de 3 CV â&#x20AC;˘ Velocidad 1-19 Km/h â&#x20AC;˘ InclinaciĂłn hasta 12% â&#x20AC;˘ Pantalla LCD 6,8â&#x20AC;? â&#x20AC;˘ 12 perďŹ les predeďŹ nidos â&#x20AC;˘ Test de control de grasa â&#x20AC;˘ Control de ritmo cardĂ­aco â&#x20AC;˘ Ventilador integrado â&#x20AC;˘ Plegable â&#x20AC;˘ SuperďŹ cie de carrera XXL: 140 x 51 cm â&#x20AC;˘ Medidas abierta (A x H x F): 98 x 141 x 180 cm â&#x20AC;˘ Peso: 102 kg â&#x20AC;˘ Peso mĂĄx. usuario: 130 kg

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Volante de aluminio equivalente a 20 kg â&#x20AC;˘ Pantalla LCD con 12 perďŹ les y 32 niveles de intensidad cada uno â&#x20AC;˘ Sistema de freno: magnĂŠtico autogenerado â&#x20AC;˘ TransmisiĂłn: correa Poly-V â&#x20AC;˘ Ajuste horizontal y vertical del sillĂ­n y manillar â&#x20AC;˘ Medidas (A x H x F): 59 x 116 x 130 cm â&#x20AC;˘ Peso: 57 kg â&#x20AC;˘ Peso mĂĄx, usuario: 130 kg

Para todos los espacios 7HFQRYLWDE\%+SRQHDWXDOFDQFHHVWRVDSDUDWRVFRQXQRVGLVHÂłRVHVSHFLDOHV TXHQRRFXSDQHVSDFLR\FRQORVTXHIRUWDOHFHUÂŁVEUD]RVSLHUQDV\DEGRPHQ 3RQGUÂŁVHQIRUPDWRGRWXFXHUSR\DGHPÂŁVWHD\XGDUÂŁDTXHPDUFDORUÂŻDV(OLJH WXHMHUFLFLRIDYRULWRXQDELFLFOHWDHVWÂŁWLFDFRQHVWUXFWXUDDELHUWDXQDFLQWDGH DQGDUXQSHGDOHDGRUSDUDSLHUQDV\EUD]RV\XQDELFLFOHWDHVWÂŁWLFDSDUDXQDV VHVLRQHVPÂŁVH[LJHQWHV6LWHJXVWDHOGHSRUWHcHVWDHVWXPHMRUVHOHFFLÂľQ

Cinta de andar magnĂŠtica Tecnovita by BH YF30*** 299â&#x201A;Ź

33,22â&#x201A;Ź /mes**

9 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIĂ&#x201C;N EXCLUSIVA

Rf: 24-084.465.98495

Bicicleta estĂĄtica con respaldo Tecnovita by BH YF91*** 199â&#x201A;Ź

31,64â&#x201A;Ź /mes*

7 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 221,48â&#x201A;Ź

Rf: 11-084.464.81726

0HGLGDV $[+[)  [[FP 0HGLGDVSOHJDGD $[+[)  [[FP 3HVRNJ

28

CĂłmodas mensualidades TĂş eliges la forma de pago

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Freno magnĂŠtico con 8 niveles de intensidad â&#x20AC;˘ Volante de inercia: 3,5 kg â&#x20AC;˘ Monitor LCD â&#x20AC;˘ SuperďŹ cie de carrera:115 x 33 cm â&#x20AC;˘ Medidas (A x H x F): 67 x 126 x 118 cm/ plegada:67 x 126 x 41 cm â&#x20AC;˘ Peso mĂĄx. usuario: 100 kg â&#x20AC;˘ Peso: 27 kg


Bicicleta elĂ­ptica BH Fitness ZK200*** 499â&#x201A;Ź

379â&#x201A;Ź

6RORKDVWD 37,90â&#x201A;Ź/mes** 10 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIĂ&#x201C;N EXCLUSIVA

***InstalaciĂłn no incluida. Consulta servicio de montaje.

Rf: 24-084.475.64629

AHORRA 120â&#x201A;Ź CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘Â Volante de inercia: 9 kg â&#x20AC;˘Â Monitor LCD â&#x20AC;˘Â Test de control de grasa corporal â&#x20AC;˘Â Test de recuperaciĂłn â&#x20AC;˘Â Regulador manual de carga de 8 niveles â&#x20AC;˘Â Sistema de freno magnĂŠtico â&#x20AC;˘Â MediciĂłn de frecuencia cardĂ­aca â&#x20AC;˘Â Ruedas de transporte â&#x20AC;˘Â Medidas (A x H x F): 167 x 61 x 150 cm â&#x20AC;˘Â Peso: 44 kg â&#x20AC;˘Â Peso mĂĄx. usuario: 110 kg

NUEVO

Cinta de correr BH Fitness G6312 SUPRA*** 799â&#x201A;Ź

669â&#x201A;Ź

6RORKDVWD 39,35â&#x201A;Ź/mes** 17 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIĂ&#x201C;N EXCLUSIVA

Rf: 24-979.084.SUPRA

AHORRA 130â&#x201A;Ź CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Motor de 2,75 CV â&#x20AC;˘ Velocidad 1-18 Km/h â&#x20AC;˘ InclinaciĂłn elĂŠctrica hasta 10% â&#x20AC;˘ 3 pantallas LED â&#x20AC;˘ 12 perďŹ les predeďŹ nidos â&#x20AC;˘ Test de control de grasa â&#x20AC;˘ Control de ritmo cardĂ­aco â&#x20AC;˘ Ventilador integrado â&#x20AC;˘ Plegable â&#x20AC;˘ Ruedas de transporte â&#x20AC;˘ SuperďŹ cie de carrera: 128 x 40 cm â&#x20AC;˘ Medidas abierta/plegada (A x H x F): 73 x 136 x 165/73 x 147 x 82 cm â&#x20AC;˘ Peso: 65 kg â&#x20AC;˘ Peso mĂĄx. usuario: 100 kg

NUEVO Bicicleta ciclismo indoor Tecnovita by BH YF95*** 399â&#x201A;Ź

299â&#x201A;Ź

6RORKDVWD 30,66â&#x201A;Ź/mes* 11 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 337,26â&#x201A;Ź

Rf: 24-979.084.0YF95

AHORRA 100â&#x201A;Ź

Minibike Tecnovita by BH YF612,

139â&#x201A;Ź

Rf: 11-084.460.07547

$OLPHQWDFLÂľQ5HG 0HGLGDV $[+[) [[FP 3HVRNJ

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Volante de 16 kg â&#x20AC;˘ Monitor multifunciĂłn: velocidad, tiempo, distancia y calorĂ­as â&#x20AC;˘ Sistema de freno: zapata de fricciĂłn con 8 posiciones â&#x20AC;˘ TransmisiĂłn: cadena â&#x20AC;˘ Microajuste horizontal del sillĂ­n y manillar â&#x20AC;˘ Medidas (A x H x F): 64 x 122 x 104 cm â&#x20AC;˘ Peso: 30 kg

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQ GHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1 6LQLQWHUHVHV7$(7,1,QWHUHVHVVXEYHQFLRQDGRVSRU (O&RUWH,QJOÂŤV6$

+ info en

902 10 30 10 / latiendaencasa.es

29


Quema calorĂ­as a cada paso con

Fitnesstep

6LQRWLHQHVJDQDVGHLUDOJLPQDVLRVLQRSXHGHVGHMDUGHFRPHUORTXHWHJXVWD\VLQRTXLHUHV FDPELDUWXYLGDGLDULDSDUDKDFHUHMHUFLFLRcQRWHSUHRFXSHV/DVLQFUHÂŻEOHV)LWQHVV6WHSKDFHQ WRGRHVHWUDEDMRSRUWL9ÂŻVWHWHDWXPDQHUD\GLVIUXWDGHWRGRVORVEHQHĹľFLRVFRQODV]DSDWLOODV TXHWHD\XGDUÂŁQDFRUUHJLUODSRVWXUDHVWLOL]DUODĹľJXUD\WRQLĹľFDUWXFXHUSR&RQVXHOD DQWLGHVOL]DQWHFÂŁPDUDGHDLUHWHFQRORJÂŻDGHEDODQFHR\HTXLOLEULRSHUIHFWRHQHOWDOÂľQ\ ODSXQWDWRQLĹľFDUÂŁVWXFXHUSR\SHUGHUÂŁVSHVRDFDGDSDVR(OLJHHOPRGHORTXHPÂŁVWH JXVWH\HPSLH]DDFXLGDUWH6RQODVDXWÂŤQWLFDV)LWQHVV6WHSDQXQFLDGDVHQ79

Sandalias mujer,

59,95â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-177.406.95030.XXX

'LVSRQLEOHHQWDOODV

Zapatillas Negras mujer,

59,95â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-177.301.00777.XXX

'LVSRQLEOHHQWDOODV

2Âş PACK 30% DE DESCUENTO *Descuento aplicado sobre el par de menor importe

Zapatillas hombre,

69,95â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-177.302.02730.XXX

'LVSRQLEOHHQWDOODV

Zapatillas Blancas mujer,

59

,95â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-177.301.99704.XXX

'LVSRQLEOHHQWDOODV

BENEFICIOS: â&#x20AC;˘ PĂŠrdida de peso â&#x20AC;˘ Aporta ďŹ rmeza a los glĂşteos â&#x20AC;˘ TensiĂłn dinĂĄmica en la zona de las pantorrillas, muslos y piernas â&#x20AC;˘ Corrige la postura y aumenta la estatura â&#x20AC;˘ Mejora la circulaciĂłn â&#x20AC;˘ Previene las varices â&#x20AC;˘ Combate la celulitis â&#x20AC;˘ ToniďŹ ca el cuerpo y moldea la ďŹ gura con solo caminar â&#x20AC;˘ Todos los beneďŹ cios del ejercicio cardiovascular â&#x20AC;˘ Triplica los resultados de una caminata â&#x20AC;˘ Quema calorĂ­as sin esfuerzos

30

latiendaencasa.es es garantĂ­a

VER VĂ?DEO latiendaencasa.es


EXCLUSIVO

precio

NUEVO

En forma al mejor

Bicicleta elĂ­ptica CR-06B*** 379â&#x201A;Ź

319â&#x201A;Ź

3RQWHHQIRUPD\DKRUUDKDVWDĹ&#x17E;FRQ HVWDVHOHFFLÂľQGHPÂŁTXLQDVGH)<77(5 TXHWHRIUHFHPRVDKRUDHQXQDVRIHUWDVÂźQLFDV (OLJHODTXHPÂŁVVHDGDSWHDWL\GLVIUXWDGHXQ HMHUFLFLRGHFDOLGDGDOPHMRUSUHFLR\FRQWRGDVODV FRPRGLGDGHV Cinta de correr FYTTER RU8*** 849â&#x201A;Ź

***InstalaciĂłn no incluida. Consulta servicio de montaje.

759â&#x201A;Ź

6RORKDVWD 39,95â&#x201A;Ź/mes** 19 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIĂ&#x201C;N EXCLUSIVA

6RORKDVWD 35,65â&#x201A;Ź/mes* 10 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 356,50â&#x201A;Ź

Rf: 24-979.084.CR06B

AHORRA 60â&#x201A;Ź

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ RegulaciĂłn de intensidad electrĂłnico â&#x20AC;˘ Rueda de inercia 6 kg â&#x20AC;˘ Sistema de transmisiĂłn por correa â&#x20AC;˘ Monitor multifunciĂłn â&#x20AC;˘ MediciĂłn del pulso por contacto en el manillar â&#x20AC;˘ Peso mĂĄx. usuario : 120 kg â&#x20AC;˘ Medidas (A x H x F): 64 x 125 x 157 cm

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Motor 3 CV â&#x20AC;˘ Velocidad: 1-18 Km/h â&#x20AC;˘ InclinaciĂłn hasta 15% â&#x20AC;˘ Pantalla LCD retroiluminada â&#x20AC;˘ 24 perďŹ les predeďŹ nidos â&#x20AC;˘ Test de control de grasa â&#x20AC;˘ Control de ritmo cardĂ­aco â&#x20AC;˘ Sistema exclusivo de amortiguaciĂłn â&#x20AC;&#x153;Ergo Softâ&#x20AC;? â&#x20AC;˘ SuperďŹ cie de carrera: 130 x 60 cm â&#x20AC;˘ Ruedas de transporte â&#x20AC;˘ Peso max. usuario: 130 kg â&#x20AC;˘ Medidas (A x H x F): 80 x 130 x 170 cm â&#x20AC;˘ Peso: 78 kg

Rf: 24-979.084.02262

AHORRA 90â&#x201A;Ź

NUEVO Ciclismo Indoor RI-06B*** 449â&#x201A;Ź

389â&#x201A;Ź

6RORKDVWD 36,56â&#x201A;Ź/mes* 12 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 438,72â&#x201A;Ź

Rf: 24-979.084.RI06B

AHORRA 60â&#x201A;Ź NUEVO Cinta de correr FYTTER RU-04B*** 529â&#x201A;Ź

469â&#x201A;Ź

6RORKDVWD 33,50â&#x201A;Ź/mes** 14 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIĂ&#x201C;N EXCLUSIVA

Rf: 24-979.084.RU04B

AHORRA 60â&#x201A;Ź

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Motor 1,75-2 CV â&#x20AC;˘ Velocidad: 1-16 Km/h â&#x20AC;˘ InclinaciĂłn manual hasta 4,5% â&#x20AC;˘ Monitor multifunciĂłn â&#x20AC;˘ Nuevo sistema de absorciĂłn de impactos â&#x20AC;˘ Plegable â&#x20AC;˘ Ruedas de transporte â&#x20AC;˘ SuperďŹ cie de carrera: 120 x 42 cm â&#x20AC;˘ Medidas (A x H x F): 68 x 130 x 160 cm â&#x20AC;˘ Peso mĂĄx. usuario: 100 kg â&#x20AC;˘ Peso: 48 kg

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Sistema de transmisiĂłn por correa â&#x20AC;˘ Rueda de inercia de 22 kg â&#x20AC;˘ Incluye botella de agua y portabidones â&#x20AC;˘ Monitor multifunciĂłn â&#x20AC;˘ Medidas (A x H x F): 50,5 x 112 x 112 cm â&#x20AC;˘ Peso mĂĄx. usuario: 120 kg

EXCLUSIVO

Toma el pulso a tu ejercicio

/OHYDHOFRQWUROGHWXHMHUFLFLRFRQHVWHUHORMFDUGLRIUHFXHQFÂŻPHWUR+57HQGUÂŁV ODLQIRUPDFLÂľQPÂŁVUHOHYDQWHSDUDXQHQWUHQDPLHQWRVHJXUR\ĹľDEOH\DTXHPLGH HOULWPRFDUGÂŻDFRHQWLHPSRUHDOHLQFRUSRUDFURQÂľPHWUR6HDGDSWDDFXDOTXLHU VLWXDFLÂľQ\DVHDSDUDFRUUHUPRQWDUHQELFLRQDGDU\DTXHHVVXPHUJLEOHKDVWD PHWURVc<WRGRDXQSUHFLRLQVXSHUDEOH Kit reloj cardiofrecuencĂ­metro Oregon HR 102,

39, 90â&#x201A;Ź

Rf: 11-979.084.02908

INCLUYE: â&#x20AC;˘ Banda especial para el tĂłrax â&#x20AC;˘ Kit especial para adaptar al manillar de la bici â&#x20AC;˘ Bolsa de transporte

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQ GHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1 6LQLQWHUHVHV7$(7,1,QWHUHVHVVXEYHQFLRQDGRVSRU (O&RUWH,QJOÂŤV6$

+ info en

902 10 30 10 / latiendaencasa.es

31


EXCLUSIVO

Ejercicio para todos los niveles

'HVFXEUHXQDQXHYDPDQHUDGHGLVIUXWDUGHOHMHUFLFLRFRQHVWHSHGDOHDGRUHOÂŤFWULFR DSURSLDGRSDUDKDFHUUHKDELOLWDFLÂľQFRQHOTXHSRGUÂŁVUHDOL]DUPRYLPLHQWRVKDFLD GHODQWH\KDFLDDWUÂŁV\VHOHFFLRQDUGLIHUHQWHVQLYHOHVGHLQWHQVLGDG<VLORSUHĹľHUHV HOEDQFRGHHMHUFLFLRV-RFFDSDUDHMHUFLWDUORVPÂźVFXORVDEGRPLQDOHVVLQLPSDFWRV JUDFLDVDVXVXSHUĹľFLHGHFLOLQGURVDFROFKDGD\DVXVDVDVODWHUDOHVTXHWHD\XGDUÂŁQ HQORVPRYLPLHQWRVGHVXELGD\EDMDGD$GHPÂŁVGLVSRQHGHXQFRQWDGRUSDUD YLVXDOL]DUODLQIRUPDFLÂľQGHFDORUÂŻDVFRQVXPLGDVDEGRPLQDOHVUHDOL]DGRVWLHPSR c(OLJHHOWX\R

Banco de abdominales Jocca,

59â&#x201A;Ź

Rf: 11-979.084.01686

3DQWDOOD/&' TXHIDFLOLWDOD YLVXDOL]DFLÂľQGH ORVGDWRV

Pedaleador Jocca,

53,90â&#x201A;Ź

Rf: 11-979.084.00647

0HGLGDV $[+[) [[FP 3HVRNJ

0HGLGDVDELHUWRFHUUDGR $[+[) [[[[FP 3HVRNJ

EXCLUSIVO

***InstalaciĂłn no incluida. Consulta servicio de montaje.

ÂżTe apetece una partida de futbolĂ­n? 2UJDQL]DORVPHMRUHVFDPSHRQDWRVFXDQGRWHDSHWH]FDFRQ HVWHPDJQÂŻĹľFRIXWEROÂŻQ5HDOL]DGRFRQ0')ODPLQDGRFRQ 39&HVWÂŁHTXLSDGRFRQWRGDVODVFRPRGLGDGHVQLYHODGRU GHSDWDVPDUFDGRUGHPDGHUDERODVVXMHWDYDVRVĹ&#x2122; 6RORWLHQHVTXHHOHJLUFRQTXÂŤHTXLSRTXLHUHVMXJDU c\FRPHQ]DUODSDUWLGD

FutbolĂ­n Robot Style HX-ST3046*** 399â&#x201A;Ź

199,50â&#x201A;Ź

31,72â&#x201A;Ź/mes* 7 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 222,04â&#x201A;Ź

Rf: 24-084.150.02024

50% DTO SOLO

43

0HGLGDV $[+[) [[FP 3HVRNJ

UNIDADES

NUEVO

Afina tu punterĂ­a

2UJDQL]DODVSDUWLGDVGHGDUGRVPÂŁVHPRFLRQDQWHVFRQHVWRVPRGHORVGHGLDQDVHOHFWUÂľQLFDVTXHWHSURSRQHPRV/D$3FRQ MXHJRV\YDULDFLRQHVSHUIHFWDSDUDFRPSDUWLUHQJUXSR\DTXHSRGUÂŁVVHOHFFLRQDUKDVWDMXJDGRUHV2OD$3FRQMXHJRV\ YDULDFLRQHVWDPELÂŤQKDVWDMXJDGRUHV8QDVFRPSOHWDVGLDQDVFRQSDQWDOODLQFRUSRUDGDSDUDVHJXLUHOMXHJRTXHSRGUÂŁVFRPSOHWDU FRQXQVHWGHDFFHVRULRV Diana electrĂłnica AP-400,

Diana electrĂłnica AP-100,

21

,90â&#x201A;Ź

49,90â&#x201A;Ź

Rf: 11-084.126.00705

$OLPHQWDFLÂľQ5HG

Rf: 11-084.126.00671

$OLPHQWDFLÂľQSLODV$$ QRLQFOXLGDV  INCLUYEN: â&#x20AC;˘ AP-100: 6 dardos â&#x20AC;˘ AP-400: 12 dardos, 12 puntas de recambio y adaptador para la red elĂŠctrica

32

Total satisfacciĂłn Si no quedas satisfecho te devolvemos el dinero

Por

6,90â&#x201A;Ź mĂĄs

LlĂŠvate este Set de accesorios

Rf: 11-084.362.94436 INCLUYE: â&#x20AC;˘ 4 juegos de plumas â&#x20AC;˘ 3 caĂąas de aluminio â&#x20AC;˘ 25 puntas blandas


Urban life: la exclusiva bicicleta plegable de Boomerang

EXCLUSIVO

6LWHJXVWDPRYHUWHFRQOLEHUWDG\DKRUUDUWLHPSR\HVSDFLRODPHMRU RSFLÂľQHVODSUÂŁFWLFDELFLFOHWDSOHJDEOH8UEDQ/LIHGH%RRPHUDQJ *UDFLDVDVXH[FOXVLYRVLVWHPDGHSOHJDGRWHODSRGUÂŁVOOHYDUD FXDOTXLHUSDUWH\YROYHUDPRQWDUODHQSRFRVVHJXQGRV Bicicleta plegable Urban Life PS30,

185â&#x201A;Ź

Rf: 11-084.512.01217 Pago aplazado SIN ENTRADA* ConsĂşltanos

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Cuadro de aluminio 7005 totalmente plegable â&#x20AC;˘ 6 velocidades â&#x20AC;˘ Cambio Shimano â&#x20AC;˘ Manetas de freno y manillar en aluminio â&#x20AC;˘ Equipada con guardabarros, portabultos y caballete â&#x20AC;˘ Pedales plegables â&#x20AC;˘ Medidas (A x H x F): 155 x 102 x 53 cm. Plegada: 77 x 58 x 34 cm â&#x20AC;˘ Peso: 12 kg

EXCLUSIVO

Un nuevo diseĂąo, el mismo sentimiento

ÂĄTrabaja todo el cuerpo!

(O5HDO0DGULGHO&OXEPÂŁVJUDQGHGHODKLVWRULDFRQPÂŁVGH DÂłRVGHWUD\HFWRULDWHSUHVHQWDHOUHORMRĹľFLDO9LFHUR\GHO5HDO 0DGULG8QGLVHÂłRUHQRYDGRFRQGHWDOOHVTXHPDUFDQODGLIHUHQFLD PDTXLQDULDGHFXDU]RFULVWDOPLQHUDOHVIHUDEODQFDFRQGHWDOOHV D]XOHV\VXPHUJLEOHKDVWDPHWURV(VWÂŁGLVSRQLEOHHOPRGHOR FDGHWH\HOPRGHORFDEDOOHURFRQFRUUHDGHFDXFKRRGHDFHUR(OLJH HOWX\R\UHFLELUÂŁVGH5(*$/2XQSLQEDÂłDGRHQSODWDGHOHVWDGLR 6DQWLDJR%HUQDEÂŤX Reloj Real Madrid Viceroy correa caucho + REGALO Pin Estadio Santiago BernabĂŠu,

85â&#x201A;Ź

Cadete, Rf: 11-106.485.19998

REGALO

Pin Estadio Santiago BernabĂŠu

Reloj Real Madrid Viceroy correa acero + REGALO Pin Estadio Santiago BernabĂŠu,

95

â&#x201A;Ź

Caballero, Rf: 11-106.485.20038 Cadete, Rf: 11-106.485.20004

7UDEDMDORVJOÂźWHRVDEGRPHQ\SLHUQDVFRQ HVWHVWHSSHUODWHUDOGH-RFFDTXHVLPXODHO PRYLPLHQWRGHVXELU\EDMDUHVFDOHUDVDOD YH]TXHUHDOL]DPRYLPLHQWRVODWHUDOHV FRQORTXHHOHMHUFLFLRTXHUHDOLFHVVHUÂŁ PXFKRPÂŁVFRPSOHWR8QGLVHÂłR FÂľPRGRFRQSLHVDQWLGHVOL]DQWHVGH FPGHORQJLWXGDVDVDFROFKDGDV SDUDXQDVXMHFLÂľQVHJXUD\ PDQWHQHUODHVWDELOLGDGTXH DGHPÂŁVLQFRUSRUDXQFRQWDGRU FRQIXQFLRQHVVFDQWLHPSR FRQWDGRUGHSDVRV\FDORUÂŻDV FRQVXPLGDV&RQVÂŻJXHORDKRUDD XQSUHFLRPX\HVSHFLDO Stepper lateral Jocca 6107, 89,90â&#x201A;Ź

69,90â&#x201A;Ź 6RORKDVWD

Rf: 11-979.084.02684

+ DE 22% DTO 0HGLGDV $[+[)  [[FP

VER VĂ?DEO latiendaencasa.es

Consulta fecha de disponibilidad.

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQ GHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1

+ info en

902 10 30 10 / latiendaencasa.es

33


NUEVO

Este verano, ÂĄla diversiĂłn estĂĄ en el agua! +D]TXHHVWHYHUDQRVHD LQROYLGDEOH\GLYHUWLGR 3DUDTXHFDGDGÂŻD SXHGDVGLVIUXWDUGHO EXHQWLHPSRHTXLSDWX FDVDFRQXQDSLVFLQD\ GLVIUXWDHQIDPLOLD\FRQ DPLJRVGHORVEDÂłRV PÂŁVUHIUHVFDQWHV1R WHSUHRFXSHVSRUHO HVSDFLRWHRIUHFHPRV PRGHORVGHGLIHUHQWHV WDPDÂłRVSDUDTXHHOLMDV HOTXHPHMRUVHDGDSWDD WXFDVD$GHPÂŁVKD\PÂŁV PHGLGDVGLVSRQLEOHV c7RGRVDODJXD

Piscina redonda acero GRE KIT300ECOE 649â&#x201A;Ź

55,65â&#x201A;Ź /mes***

12 cuotas SIN INTERESES TAE 2,58% TIN 0% Importe total adeudado 667,80â&#x201A;Ź

100% financiaciĂłn

o paga el 30-09-14 6RORKDVWD Rf: 24-105.408.22243

&DSDFLGDG/ 0HGLGDV '[+ [FP

INCLUYE: â&#x20AC;˘ Escalera de tijera â&#x20AC;˘ Filtro de arena de 4m3/h â&#x20AC;˘ Liner PVC azul 30/ 100 â&#x20AC;˘ Manual de instrucciones

Disponible en mĂĄs medidas, consĂşltanos Entra en latiendaencasa.es

Tumbona jardĂ­n, 79â&#x201A;Ź

49â&#x201A;Ź

6RORKDVWD

Rosa, Rf: 11-198.242.00083 Verde, Rf: 11-198.242.00091

+ DE 37% DTO

0DWHULDO$FHUR\SROLÂŤVWHU

El mejor descanso al aire libre

NUEVO

'LVIUXWDGHOEXHQWLHPSR\UHOÂŁMDWHDOVROFRQ HVWDVHOHFFLÂľQGHSDUDVROHVVLOORQHV\WXPERQDV SHUIHFWDVSDUDGHVFDQVDUHQWXWLHPSROLEUH7H RIUHFHPRVXQVLOOÂľQFRQUHVSDOGRUHJXODEOH XQVLOOÂľQUHOD[PXOWLSRVLFLRQHVSDUDTXHHOLMDV ODSRVWXUDPÂŁVFÂľPRGDSDUDOHHUWRPDUHO VROGHVFDQVDURXQDKDPDFDFRQSDUDVRO UHJXODEOHSDUDSURWHJHUWHGHORVUD\RVGHOVRO 7RGDVODVRSFLRQHVSDUDGLVIUXWDUHVWHYHUDQR

SillĂłn relax acolchado,

79, 95â&#x201A;Ź

Rf: 11-105.305.92426

Parasol orientable plegable,

39â&#x201A;Ź

Blanco, Rf: 11-198.279.06009 Rojo, Rf: 11-198.279.06025 Verde, Rf: 11-198.279.06058

$OWXUDFP 0DWHULDO$OXPLQLR 3HVRNJ ,QFOX\HQIXQGDSDUDVXSURWHFFLÂľQ

Tumbona acolchada con parasol,

59, 95â&#x201A;Ź

Rf: 11-105.309.93459

Pie de parasol,

29,90â&#x201A;Ź

Rf: 11-198.308.00223

34

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQGHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1 6LQLQWHUHVHV7$(7,1,QWHUHVHVVXEYHQFLRQDGRVSRU(O&RUWH,QJOÂŤV6$ )LQDQFLDFLÂľQVLQLQWHUHVHVKDVWDHQPHVHVRSDJDHO GH6HSWLHPEUHGH*DVWRVGHJHVWLÂľQĹľQDQFLDGRVĹ&#x17E;,QWHUHVHVVXEYHQFLRQDGRVSRU(O&RUWH,QJOÂŤV6$3RUFRPSUDVVXSHULRUHVDĹ&#x17E;'HODO(MHPSORV


Piscina ovalada acero GRE KIT500ECOE 999â&#x201A;Ź

84,82â&#x201A;Ź /mes***

12 cuotas SIN INTERESES TAE 1,67% TIN 0% Importe total adeudado 1.017,80â&#x201A;Ź

100% financiaciĂłn

o paga el 30-09-14 6RORKDVWD

Rf: 24-105.408.21567

INCLUYE: â&#x20AC;˘ Escalera de tijera â&#x20AC;˘ Filtro de arena de 4m3/h â&#x20AC;˘ Liner PVC azul 30/100 â&#x20AC;˘ Manual de instrucciones

&DSDFLGDG/ 0HGLGDV $[+[)  [[FP

La limpieza mĂĄs sencilla para tu piscina NUEVO

(OXVRFRQWLQXDGRGHODSLVFLQD\VXH[SRVLFLÂľQDODLUHOLEUH KDFHTXHVHHQVXFLH\VHYD\DGHWHULRUDQGRSRFRDSRFR 6LTXLHUHVFRQVHUYDUODFRPRHOSULPHUGÂŻDHVWHURERW.D\DN $GYHQWXUHWHD\XGDUÂŁDPDQWHQHUODOLPSLDVLQHVIXHU]R&RQ XQPRWRUGH9\XQYROXPHQGHDJXDĹľOWUDGDPK\ PHWURVGHFDEOHGLVIUXWDUÂŁVGHIRUPDDXWRPÂŁWLFDGHXQ DJXDOLPSLDWRGRVORVGÂŻDV

/RLQFOX\HQ WRGDVODVPHGLGDV

NUEVO

Un espacio propio para tu jardĂ­n

 7HJXVWDU¯DWHQHUXQMDUG¯QHQFDVDSHURQRWLHQHVHVSDFLRSDUDHOOR"&UHD WXSURSLRMDUG¯QFRQHVWRVPXURV.DURRSHUIHFWRVSDUDFRORFDUHQHOLQWHULRU \H[WHULRU)DEULFDGRVHQSO£VWLFRUHFLFODGRFXHQWDQFRQXQDFDSDFLGDG SDUDSODQWDVHLQFOX\HQXQVLVWHPDGHDXWRULHJR&RQYHUWLU£VFXDOTXLHU HVSDFLRHQXQSUHFLRVRMDUG¯Q Jardín vertical Digebis Karoo,

99, 90â&#x201A;Ź

Gris, Rf: 11- 979.107.KARU1 Blanco, Rf: 11-979.107.KARU2

0HGLGDV $[+[) [[FP

Robot limpiafondos GRE Kayak Adventure 849,70â&#x201A;Ź

72,38â&#x201A;Ź /mes***

12 cuotas SIN INTERESES TAE 1,97% TIN 0% Importe total adeudado 868,50â&#x201A;Ź

100% financiaciĂłn

o paga el 30-09-14 6RORKDVWD

Rf: 24-105.410.06101

0HGLGDV $[+[)  [[FP 3HVRNJ

GHĹľQDQFLDFLÂľQGHFRPSUDV,PSRUWHĹ&#x17E;DSOD]DPLHQWRDPHVHVVLQLQWHUHVHV 7,17$(JDVWRVGHJHVWLÂľQĹ&#x17E;LPSRUWHWRWDODGHXGDGRĹ&#x17E;,PSRUWHĹ&#x17E;DSOD]DPLHQWR DPHVHVVLQLQWHUHVHV7,17$(JDVWRVGHJHVWLÂľQĹ&#x17E;LPSRUWHWRWDODGHXGDGRĹ&#x17E;

+ info en

902 10 30 10 / latiendaencasa.es

35


Belleza y Salud Cuida tus pies

Prepara tu cuerpo

'DOHDWXVSLHVHOFXLGDGRTXHVHPHUHFHQFRQHO HOLPLQDGRUGHGXUH]DV(//(E\%HXUHU8QVLVWHPD SURIHVLRQDOSDUDHOLPLQDUGXUH]DV\FDOORVTXHWUDEDMDHQ WRGDVODV]RQDVGHWXSLHHOLPLQDQGRODVF«OXODVPXHUWDV GHODSLHOGHM£QGRODVXDYH\OLVD'LVSRQHGHOX]/('H[WUD EULOODQWHHLQFRUSRUDDFFHVRULRVXQRŵQR\RWURJUXHVR\ LQWHQVLGDGHV3RGU£VXVDUORVREUHODSLHOVHFDRPRMDGD LQFOXVRWDPEL«QHQPDQRV\FRGRV8QDIRUPDU£SLGD\ VHJXUDGHFXLGDUWXSLHO

Máquina para durezas ELLE by Beurer MPE-50,

59€

Gastos de envío

5,90€

Rf: GE-13-077.555.00084

$OLPHQWDFLµQ3LODUHFDUJDEOH 0HGLGDV $[+[)  [[FP

,QFOX\HGRV FDEH]DOHVŵQR\ JUXHVR

Uñas siempre lisas y brillantes /DVPDQRV\ORVSLHVHVW£QH[SXHVWRVD DJUHVLRQHVH[WHUQDVTXHORVGD³DQ\ORV GHWHULRUDQG¯DDG¯D3DUDSURWHJHUORV\ FXLGDUORVWHRIUHFHPRVHVWHDSDUDWRGH PDQLFXUD\SHGLFXUDSDUDHOWUDWDPLHQWR GHX³DVFXW¯FXODVGXUH]DV\FDOORVLGDGHV &RQXQDYHORFLGDGDMXVWDEOH\URWDFLµQ DGHUHFKDHL]TXLHUGDLQFRUSRUDOX]/(' SDUDXQXVRP£VSUHFLVR\VHJXUR,QFOX\H DFFHVRULRVSDUDGLVWLQWDVDSOLFDFLRQHV LQFOXLGRVDFFHVRULRVGH]DŵURGHJUDQ FDOLGDG\GXUH]D\XQHVWXFKHSDUD OOHYDUORHQWXVYLDMHV Set de manicura y pedicura Medisana Medistyle L,

59,90€

Gastos de envío

5,90€

Rf: GE-979.077.05574

Cero grasa. Todo abdominales 6LQGXGDHVWHHVHOFLQWXUµQTXHPHMRUWHVLHQWD6X VLVWHPDGHYLEUDFLµQFRQQLYHOHVGHLQWHQVLGDG \PRGRPDQXDO\DXWRP£WLFRHOLPLQDODJUDVD\ IDYRUHFHODPXVFXODWXUDGHGLVWLQWDVSDUWHVGHO FXHUSRDEGRPLQDOHVJO¼WHRVFDGHUDFLQWXUD\ EUD]RV2WUDPDQHUDGHSRQHUWHHQIRUPDFDVLVLQ GDUWHFXHQWD Cinturón de Vibración Tecnovita by BH YV07, 85€

68€

6RORKDVWD

Rf: 11-979.084.02486

20% DTO

7UDEDMDGLIHUHQWHV]RQDV

36

Total garantía de calidad y servicio Avalado por la garantía de La Tienda en Casa


para el verano NUEVO

La depilaciรณn mรกs avanzada

<DSXHGHVGLVIUXWDUGHXQDSLHOVXDYHVLQYHOORFRQHO VLVWHPDGHGHSLODFLยตQ6LONvQ*OLGH8WLOL]DODWHFQRORJยฏD GHOX]SXOVDGD+3/p\DKRUDLQFRUSRUDXQVLVWHPD PHMRUDGRTXHRIUHFHSXOVDFLRQHVSDUDXQD HOLPLQDFLยตQGHOYHOORPXFKRPยฃVHลตFLHQWHGXUDQWHPยฃV WLHPSR3XHGHDSOLFDUVHHQWRGRHOFXHUSR\ODFDUD WDQWRHQKRPEUHV H[FHSWRHQODFDUD FRPRPXMHUHV HLQFOXVRHQODVSLHOHVPยฃVRVFXUDVRGHVSXยซVGHOD H[SRVLFLยตQDOVRO&XHQWDFRQFLQFRQLYHOHVGHHQHUJยฏD \GRVPยซWRGRVGHDSOLFDFLยตQSXOVDQGR\GHVOL]DQGRVL GHVHDVXQWUDWDPLHQWRXOWUDUUยฃSLGR<HVWDQSHTXHยณDTXH ODSXHGHVOOHYDUDFXDOTXLHUSDUWH Sistema de fotodepilaciรณn Silkยดn GlideTM 150.000,

CARACTERรSTICAS Tร‰CNICAS: โ€ข Tamaรฑo de la lรกmpara: 3 cm2 โ€ข Disparos por lรกmpara: 150.000 โ€ข Velocidad ajustable โ€ข 5 niveles de energรญa โ€ข Alimentaciรณn: Red

179โ‚ฌ

Rf: 11-077.521.10564

Una limpieza facial profunda en solo 60 segundos NUEVO

3DUDXQDOLPSLH]DIDFLDOGLDULDXWLOL]D6LONvQ6RQLF&OHDQ3OXV70 8QOLPSLDGRUTXHSXULลตFDODSLHOHQVHJXQGRVTXH SXHGHVDSOLFDUHQODIUHQWHSยตPXORVQDUL]\EDUELOOD 3RGUยฃVVHOHFFLRQDUHOPRGRYLEUDFLยตQRSRUSXOVDFLRQHV \GRVYHORFLGDGHVGHSHQGLHQGRVLTXLHUHVXQDOLPSLH]D PยฃVVXDYHRHQSURIXQGLGDG<HVUHVLVWHQWHDODJXD SDUDTXHSXHGDVXWLOL]DUWDPELยซQEDMRODGXFKD/RPยฃV SUยฃFWLFR\HลตFD]SDUDFRQVHJXLUXQURVWURUDGLDQWH \OLPSLRWRGRVORVGยฏDV Tratamiento facial

6LONvQ6RQLF&OHDQ3OXV70,

69โ‚ฌ

Rf: 11-077.511.10862

/LPSLH]DGLDULDHQ SURIXQGLGDGHQ VRORVHJXQGRV

$OLPHQWDFLยตQ5HFDUJDEOH

Ver vรญdeo en

NUEVO

latiendaencasa.es

De la bรกscula al ordenador

(VWDEยฃVFXODWUDQVPLWHWRGRVORVGDWRVGHWXV PHGLFLRQHVGLUHFWDPHQWHDOSRUWDOP\VRKHQOH FRPDWUDYยซVGH:L)LSDUDTXHSXHGDVHQWUDU DWUDYยซVGHWXRUGHQDGRURWDEOHW\VHJXLUWX HYROXFLยตQVLQHUURUHV7HQGUยฃVUยฃSLGDPHQWHOD PHGLFLยตQPยฃVSUHFLVDGHWXSHVR\DGHPยฃV UHDOL]DXQDQยฃOLVLVFRUSRUDOFRQGDWRVGH DJXDJUDVD\PDVDPXVFXODU3XHGH JUDEDUODLQIRUPDFLยตQGH KDVWDXVXDULRV\SDUD QRJDVWDUHQHUJยฏDVH DSDJDDXWRPยฃWLFDPHQWH /DPHMRUD\XGDSDUD FRQWURODUWXSHVR

3RGUยฃVVHJXLU ODHYROXFLยตQGH WXVGDWRVHQ WXRUGHQDGRU WDEOHWRWHOยซIRQR

Bรกscula Soehnle Web Connect Analysis, 125โ‚ฌ

99โ‚ฌ

Rf: 11-078.309.09920

+ DE 20% DTO

CARACTERรSTICAS Tร‰CNICAS: โ€ข Alimentaciรณn: 4 pilas x 1,5 V AAA โ€ข Medidas (A x H x F): 32,1 x 0,6 x 32 cm โ€ข Peso mรกximo usuario: 150 kg

+ info en

902 10 30 10 / latiendaencasa.es

37


Moldea o alisa tu cabello con la tecnologĂ­a iĂłnica de Supreme Styler 0ROGHDRDOLVDWXSURSLRSHLQDGRGHIRUPDIÂŁFLO\UÂŁSLGDFRQ9HOIRUP6XSUHPH6W\OHU 8QFHSLOORWÂŤUPLFRFRQ7HFQRORJÂŻD,21,7<TXHFRPELQDHOFDORUGHODFHUÂŁPLFDSDUD GDUEULOOR\VXDYLGDGFRQODHPLVLÂľQGHLRQHVSDUDKLGUDWDU\SURWHJHUHOFDEHOOR &RQVHJXLUÂŁVUHGXFLUHOHQFUHVSDPLHQWR\DSRUWDUÂŁVPD\RUVHGRVLGDGDOFDEHOOR 9HOIRUP6XSUHPH6W\OHUHVWRGRDODYH]FHSLOORSODQFKD\UL]DGRUcQRQHFHVLWDV QDGDPÂŁV7HGDUÂŁHOSHLQDGRSHUIHFWR\UDGLDQWHTXHTXLHUHVHQVRORPLQXWRV (VWÂŁGLVHÂłDGRFRQSÂźDVGHQ\ORQGHDOWDFDOLGDGDQWLHQUHGRVTXHIDFLOLWDQHO DOLVDGRGHOFDEHOORVLQGDÂłDUOR\DTXHVLHPSUHVHPDQWLHQHQIUÂŻDV&RQVLJXHHO SHLQDGRTXHPÂŁVWHJXVWDFDGDGÂŻDDODYH]TXHFXLGDVWXFDEHOOR Cepillo iĂłnico Velform Supreme Styler + REGALO 3 Pinzas + Cepillo + Bolsa,

69,95â&#x201A;Ź

59,95â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-979.077.05467

+ DE 14% DTO

REGALO 3 Pinzas + Cepillo + Bolsa

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ 2 temperaturas: baja (160ÂşC) para el cabello ďŹ no y alta (180ÂşC) para el cabello grueso â&#x20AC;˘ Potencia: 35 W â&#x20AC;˘ Voltaje: 230 V-50 Hz â&#x20AC;˘ Medidas mango: 18 cm/cabezal: 11 cm; cable: 1,80 cm

VER VĂ?DEO latiendaencasa.es

Pearl Hair: la depilaciĂłn duradera y sin dolor  4XLÂŤQQRKDGHVHDGRHQFRQWUDUXQDGHSLODGRUDTXHHOLPLQHHOYHOORVLQGRORU"<DODKDVHQFRQWUDGRVHOODPD3HDUO +DLU\VHFRQYHUWLUÂŁHQWXGHSLODGRUDGHĹľQLWLYD3HDUO+DLUXWLOL]DHOFDORUSDUDORJUDUXQDGHSLODFLÂľQLQGRORUDHV VHJXUD\HĹľFD]WDQWRSDUDHOYHOORFRUSRUDO\IDFLDOSDUDFXDOTXLHUWLSRGHYHOORFRORUGHSLHO\SHUIHFWDWDQWRSDUD KRPEUHVFRPRPXMHUHV3HDUO+DLUHOLPLQDUÂŁHOYHOORGHVGHODUDÂŻ]DODSXQWD\FXDQWRPÂŁVORXWLOLFHVPHQRVYHOOR VDOGUÂŁ$GHPÂŁVHVLQDOÂŁPEULFDSDUDTXHSXHGDVXWLOL]DUODFXDQGR\GRQGHTXLHUDVFRQWRWDOFRPRGLGDG3HDUO+DLU VHFRQYHUWLUÂŁHQWXGHSLODGRUDGHĹľQLWLYDVHJXUDLQGRORUDSRUWÂŁWLOLQDOÂŁPEULFD&RQVÂŻJXHODDKRUDDOPHMRUSUHFLR Depiladora Pearl Hair, 89â&#x201A;Ź

69,95â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-979.077.04973

20% DTO

$OLPHQWDFLÂľQ5HFDUJDEOH

INCLUYE: â&#x20AC;˘ 1 cabezal grande para brazos, espalda y piernas â&#x20AC;˘ 1 cabezal pequeĂąo para cara, ingles y axilas â&#x20AC;˘ Cepillo de limpieza â&#x20AC;˘ Manual de instrucciones â&#x20AC;˘ Cargador

38

VER VĂ?DEO latiendaencasa.es

CĂłmodas mensualidades TĂş eliges la forma de pago

6HJXUD\HĹľFD]WDQWR SDUDHOYHOORFRUSRUDO FRPRIDFLDO


Reduce ojeras,arrugas y bolsas en cuestión de minutos

6LTXLHUHVYHUWHP£VJXDSDP£VMRYHQ\HVWDUSHUIHFWDSDUDFXDOTXLHURFDVLµQHVSHFLDOWHSUHVHQWDPRVXQWUDWDPLHQWR¼QLFR \WUHPHQGDPHQWHHŵFD]/DFUHPDDQWLDUUXJDV52;FRQHIHFWRLQVWDQW£QHRUHGXFHORVVLJQRVGHHQYHMHFLPLHQWRDUUXJDV RMHUDV\EROVDVGHORVRMRV\WRGRHQFXHVWLµQGHPLQXWRV(VWDIµUPXODDYDQ]DGDFRQVLJXHXQRVUHVXOWDGRVHŵFDFHVVLQGD³DU ODSLHOFRUULJLHQGRODVLPSHUIHFFLRQHV\HOLPLQDQGRODVRMHUDV&RQVRORXQDJRWDREWHQGU£VXQRVUHVXOWDGRVHVSHFWDFXODUHV \OXFLU£VXQDVSHFWRVHQVDFLRQDOGXUDQWHGLH]KRUDVGHG¯DRGHQRFKH(VY£OLGDSDUDWRGRWLSRGHSLHOHVDH[FHSFLµQGHODV P£VVHQVLEOHVWDQWRSDUDKRPEUHVFRPRSDUDPXMHUHV6HFRQYHUWLU£HQWXFUHPDGHŵQLWLYD\FRQVHJXLU£VOXFLUODPLUDGDFRQOD TXHVLHPSUHKDVVR³DGR8QDJUDQLQQRYDFLµQHQFRVP«WLFDDKRUDDODOFDQFHGHWXPDQRSRUVRORŞ

39

Crema antiarrugas ROX,

,95€

Gastos de envío

5,90€

Rf: GE-979.135.00514

2º UNIDAD 50% DE DESCUENTO &DSDFLGDGP/ SDUDDSOLFDFLRQHV 

(QVRORPLQXWRQRWDU£VFµPRVH FRUULJHQODVLPSHUIHFFLRQHVGHWXSLHO

Antes

Después

+ info en

902 10 30 10 / latiendaencasa.es

39


¡Adelgaza sin esfuerzo! /DVSUHQGDV&RVPHWLF/LQHLQFRUSRUDQXQWUDWDPLHQWRDGHOJD]DQWH HKLGUDWDQWHH[FOXVLYRœ'ŔTXHWHD\XGDU£DHOLPLQDUODFHOXOLWLV\ SLHOGHQDUDQMD6XVHFUHWRUDGLFDHQVXŵEUDHVSHFLDO(PDQDpTXH RIUHFHXQDWHUPRUUHJXODFLµQ\PLFURFLUFXODFLµQVDQJX¯QHD7UDV VXXVRGXUDQWHXQDVKRUDVGLDULDVGXUDQWHG¯DVDFRPSD³DGR GHHMHUFLFLRI¯VLFR\XQDGLHWDHTXLOLEUDGDWHD\XGDU£DWRQLŵFDU\ HVFXOSLUWXŵJXUD$GHP£VSURSRUFLRQDQXQFRQVWDQWHPLFURPDVDMH 'TXHVXPDGRDVXEDVHFRVP«WLFDGHFDIH¯QD\PDQWHFDGHNDULW« FRQWULEX\HDVXDFFLµQDGHOJD]DQWHKLGUDWDQWH\H[IROLDQWH(OLJHWX SUHQGD\DSURYHFKDQXHVWUDSURPRFLµQHVSHFLDOREWHQGU£VXQ GHGHVFXHQWRHQODVHJXQGDXQLGDGGHFXDOTXLHUSURGXFWRRWDOOD

7RGRVORVPRGHORVGLVSRQLEOHVHQWDOODV 6  0  \/   Combinación adelgazante Gastos de envío reductora Emana®,

Shorty Shape adelgazante Emana®,

Visón, Rf: GE-979.110.00848.XXX Negro, Rf: GE-979.110.00855.XXX

Beige, Rf: GE-979.110.00533.XXX Negro, Rf: GE-979.110.00541.XXX

39

,90€

TOP VENTAS

5,90€

39

,90€

Gastos de envío

5,90€

Legging adelgazante Push Up Emana®,

39

,90€

Gastos de envío

5,90€

Negro, Rf: GE-979.110.00525.XXX Azul, Rf: GE-979.110.00871.XXX Gris, Rf: GE-979.110.00889.XXX Marrón, Rf: GE-979.110.00897.XXX

VER VÍDEO latiendaencasa.es

Muévete como siempre, tonifica como nunca 6XGDUHVXQDGHODVIRUPDVP£VI£FLOHVSDUDWRQLŵFDU\GDUOHPHMRU WH[WXUD\ŵUPH]DDWXSLHO<DKRUDSXHGHVPD[LPL]DUWXVUHVXOWDGRV FRQ+RW6KDSHUV8QRVSDQWDORQHVFRQIHFFLRQDGRVFRQ1HRWH[TXH DXPHQWDHOFDORUFRUSRUDODOFRQWDFWRFRQWXSLHOD\XGDQGRDSRWHQFLDU ODVXGRUDFLµQKDVWDYHFHVP£VTXHFRQRWUDSUHQGDSHURFRQXQ P¯QLPRHVIXHU]R3RGU£VXWLOL]DUORVPLHQWUDVKDFHVHMHUFLFLRSDUDPHMRUDU WXVUHVXOWDGRVWHDSRUWDU£PD\RUŵUPH]D\WRQLŵFDFLµQHQJO¼WHRV\ PXVORVDGHP£VGHD\XGDUDUHGXFLUHODEGRPHQODFLQWXUD\ODFHOXOLWLV 3HURWDPEL«QSRGU£VXVDUORPLHQWUDVKDFHVWXVDFWLYLGDGHVGLDULDV\D TXHWHD\XGDDHOLPLQDUP£VWR[LQDVGHPDQHUDQDWXUDO(VXQDSUHQGD FµPRGD\ŶH[LEOHTXHSRGU£VOOHYDUVLHPSUHTXHTXLHUDV$SURYHFKD HVWDRIHUWD\FRQV¯JXHORDOPHMRUSUHFLR\HQODVHJXQGDXQLGDG REWHQGU£VXQGHGHVFXHQWRc3UX«EDORV\PHMRUDWXVUHVXOWDGRV Pantalones Hot Shapers, 59,95€ Gastos de envío

49,95€

5,90€

Rf: GE-979.252.00186.XXX

2ª UNIDAD 30% DE DESCUENTO 40

VER VÍDEO latiendaencasa.es

latiendaencasa.es es exclusividad

'LVSRQLEOHHQWDOODV 6  0  /  ;/   &RQVXOWDODVWDEODVGHHMHUFLFLRV HQQXHVWURFDQDOGH<RX7XEH

2ª UNIDAD 30% DE DESCUENTO


La faja moldeadora que te ayuda a reducir la celulitis

TOP VENTAS

7HJXVWDU¯DWHQHUXQDIDMDPROGHDGRUDTXHDODYH]TXHHVWLOL]D\ SHUŵODWXVLOXHWDWHDFWLYDHOFXHUSRWRQLŵFDODSLHO\UHGXFHODFHOXOLWLV" &RQODIDMDPROGHDGRUD6OHQFHUDGLVIUXWDU£VGHWRGRVHVRVEHQHŵFLRV DODYH]3DUDHPSH]DUFXEUHGHVGHODSDUWHLQIHULRUGHOSHFKRKDVWD ODVURGLOODVORTXHWHSHUPLWLU£PROGHDUGHVGHHODEGRPHQKDVWD ORVJO¼WHRV6XWHMLGRFRPSXHVWRSRUELRFHU£PLFDDEVRUEHHOFDORU FRUSRUDODWUDY«VGHODHQHUJ¯DLQIUDUURMDORTXHDFWLYDODFLUFXODFLµQ GHOFXHUSR\KDFHTXHSURGX]FDVP£VFDORUD\XG£QGRWHDWRQLŵFDU HOFXHUSRUHGXFLUODFHOXOLWLV\ODJUDVDORFDOL]DGD&RPRUHVXOWDGR WHQGU£VXQDŵJXUDP£VŵUPH\HVWLOL]DGDVHU£FRPRVLSHUGLHVHVGRV WDOODVDOLQVWDQWH&RQXQXVRFRQWLQXDGRYHU£VFµPRPHMRUDWXŵJXUD UHDO]DVORVPXVORV\JO¼WHRVDODYH]TXHTXHPDVJUDVD<WRGRVLQ WHQHUTXHKDFHUQDGDcVRORSRQL«QGRWHODIDMDPROGHDGRUD6OHQFHUD Faja moldeadora Slencera,

39,95€

Gastos de envío

5,90€

Rf: GE-979.110.00905.XXX

'LVSRQLEOHHQWDOODV 0  /  ;/  ;;/   5HDOL]DGDHQELRFHU£PLFDFRQPLOHVGH SDUW¯FXODVGHWXUPDOLQDDEVRUEHHOFDORU\ HVWLPXODODFLUFXODFLµQD\XGDQGRDTXHPDU JUDVD\DUHGXFLUODSLHOGHQDUDQMD

+ info en

902 10 30 10 / latiendaencasa.es

41


El secreto estĂĄ en la suela  7HJXVWDUÂŻDWHQHUXQDV]DSDWLOODVTXHPLPDVHQWXVSLHV"/D VROXFLÂľQVRQODV]DSDWLOODV5HOD[*HO6XVHFUHWRHVWÂŁHQVX VXHODFRQQÂźFOHRGHHVSXPDJHOTXHDPRUWLJXDQHOLPSDFWR GHOFDPLQDU\HYLWDTXHODVDUWLFXODFLRQHVVXIUDQ7HRIUHFHUÂŁQ PÂŁ[LPDFRPRGLGDG\FRQIRUW\DTXHDOLYLDODSUHVLÂľQHQORVSLHV SLHUQDV\]RQDOXPEDU&RQVHJXLUÂŁVDGHPÂŁVXQDPD\RUVXSHUĹľFLH GHDSR\R\UHODMDFLÂľQORTXHWHSURSRUFLRQDXQDSRVWXUD FRUSRUDOPÂŁVDGHFXDGD\EHQHĹľFLRVDSDUDWXFXHUSR3ÂŻGHODV DKRUD\OOÂŤYDWHXQLGDGHVGHODPLVPDWDOODRGLIHUHQWHDXQ SUHFLRÂźQLFRĹ&#x17E; Zapatillas Relax Gel, LlĂŠvate 2 por solo

39

,95â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-979.030.00061.XXX

'LVSRQLEOHHQWDOODV       \  

BENEFICIOS: â&#x20AC;˘ Reducen el impacto en las articulaciones â&#x20AC;˘ Absorben la presiĂłn en los pies y en las rodillas â&#x20AC;˘ Relajan la zona lumbar â&#x20AC;˘ Ayudan a aliviar el dolor â&#x20AC;˘ Ayudan a mejorar la postura corporal

VER VĂ?DEO latiendaencasa.es

Descanso para tus piernas /RVFDOFHWLQHVGHFRPSUHVLÂľQ'HVFDQVD3OXVVRQODVROXFLÂľQSDUD UHGXFLUORVSUREOHPDVGHFLUFXODFLÂľQHQODSLHUQDV6XLQQRYDGRUD FRQIHFFLÂľQDSRUWDGLIHUHQWHV]RQDVGHFRPSUHVLÂľQJUDGXDOGHVGH DEDMRKDFLDDUULEDPHMRUDQGR\DFWLYDQGRHOULHJRVDQJXÂŻQHRHQ SLHVWRELOORV\SDQWRUULOODV'LVIUXWDUÂŁVGHVXHIHFWRWHUDSÂŤXWLFR \DQWLLQĹśDPDWRULRGXUDQWHWRGRHOGÂŻD$GHPÂŁVWDPELÂŤQD\XGDQ DSUHYHQLUODVWHPLGDVYDULFHVGHPDQHUDFÂľPRGD\VHJXUD $SURYHFKDHVWDRIHUWD\OOÂŤYDWHSDUHVGHFDOFHWLQHVGHODWDOOD\ FRORUTXHHOLMDVSRUVRORĹ&#x17E; Pack 3 pares de Calcetines Descansa Plus + REGALO Crema para pies Descansa Plus,

39

,95â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-979.008.90001.XXX

2Âş PACK 50% DE DESCUENTO

'LVSRQLEOHHQWDOODV     \   &RORUD]XO'HQLPVROR GLVSRQLEOHHQWDOODV\

REGALO Crema hidratante y tonificante Descansa Plus (100 mL)

COMPONENTES: â&#x20AC;˘ AlgodĂłn: 60% â&#x20AC;˘ ElastĂłmero/Lycra: 22% â&#x20AC;˘ Poliamida: 15% â&#x20AC;˘ ElastĂĄn: 3%

42

Total satisfacciĂłn Si no quedas satisfecho te devolvemos el dinero


NUEVO

Un centro de masaje con el diseño más moderno

&UHDHQFDVDHVHHVSDFLRTXHQHFHVLWDVSDUDGHVFDQVDU\UHODMDUWHFRQHVWHVLOOµQ&DSUL7HFQRYLWDE\%+8QGLVH³R YDQJXDUGLVWD\PRGHUQRUHDOL]DGRHQV¯PLOSLHOFRQEDUQL]SURWHFWRUFRQEXWDFDJLUDWRULD|UHVSDOGRUHFOLQDEOH \£QJXORGHSLHUQDVUHJXODEOHFRQHOTXHSRGU£VGLVIUXWDUGHXQDJUDGDEOHPDVDMHHQFXDOTXLHUPRPHQWR6XVLVWHPD GHPDVDMH7DSSLQJTXHVLPXODHOJROSHWHRGHXQDVPDQRV£JLOHV\H[SHUWDVD\XGDDLQFUHPHQWDUODFLUFXODFLµQGH R[¯JHQRHQHORUJDQLVPRDGHP£VGHDOLYLDU\UHODMDUORVP¼VFXORVGHWRGRHOFXHUSR&RQVXPDQGRGHFRQWURO LQWHJUDGRVHQFLOORHLQWXLWLYRSRGU£VVHOHFFLRQDUODLQWHQVLGDG\HOWLHPSRGHOPDVDMH\ODV]RQDVTXHTXLHUHV WUDEDMDUDOPLVPRWLHPSRRGHIRUPDLQGHSHQGLHQWHHVSDOGD]RQDOXPEDURSLHUQDV<SDUDDXPHQWDUORV EHQHŵFLRVGHOPDVDMHSRGU£VFRPELQDUORFRQVX7KHUPDO0DVVDJLQJ6\VWHPXQPDVDMHFRQFDORUHQOD]RQD OXPEDU&RPRGLGDG\UHOD[SDUDXQPHUHFLGRGHVFDQVRDKRUDFRQODPHMRUŵQDQFLDFLµQŞDOPHV  6,1,17(5(6(6KDVWDHOGHPD\R Sillón masaje Tecnovita by BH M111 Capri 790€

640€

6RORKDVWD 32€/mes** 20 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIÓN EXCLUSIVA

Rf: 24-979.084.M111C

AHORRA 150€

0DQGRGHFRQWUROLQWHJUDGRHQHOUHSRVDEUD]RV 0HGLGDV $[+[) SRVLFLµQYHUWLFDO[[FP H[WHQGLGR[[FP3HVRNJ

Un masaje en cualquier parte

NUEVO

(VWHFROFKµQGHPDVDMH-RFFDHVXQDVROXFLµQHFRQµPLFD\U£SLGD SDUDGLVIUXWDUVLHPSUHTXHTXLHUDVGHXQDDJUDGDEOHVHQVDFLµQ UHODMDQWH6XOLJHUH]D\YHUVDWLOLGDGWHSHUPLWLU£DGDSWDUORDOVRI£RDOD FDPD\DWUDY«VGHVXPDQGRSRGU£VVHOHFFLRQDUOD]RQDHOPRGRGH PDVDMHODIXQFLµQFDORU\ODLQWHQVLGDGTXHP£VWHDSHWHFHHQFDGD PRPHQWR

([SHULPHQWDXQDVHQVDFLµQGHGHVFDQVR\ELHQHVWDUFRQHVWH LQQRYDGRUVSDSDUDSLHVFRQPDVDMHSRUEXUEXMDVSRUYLEUDFLµQ \FDORULQIUDUURMR&DOLHQWDHODJXDGHVGH|&D|&SDUDTXH VHOHFFLRQHVODWHPSHUDWXUDP£VDJUDGDEOH\WDPEL«QLQWHJUDXQRV URGLOORVGHPDVDMHSDUDODSDUWHLQWHUQDGHORVSLHVFRQORTXH FRQVHJXLU£VXQFXLGDGRFRPSOHWR<SDUDWRWDOFRPRGLGDGSXHGHV SURJUDPDUVXWHPSRUL]DGRUKDVWDPLQXWRV'LVIUXWDGHOPDVDMHP£V UHFRQIRUWDQWH

Colchón masaje Jocca 6163,

59€

Rf: GE-979.077.02746

Spa para pies Medisana FS 885,

Gastos de envío

5,90€

0HGLGDV $[/ [FP

Un spa 3 en 1 para cuidar tus pies

Ver vídeo en

latiendaencasa.es

CARACTERÍSTICAS TÉCNICAS: • 10 Motores • 5 Modos de masaje • 3 Niveles de intensidad • Función calor

89,90€

Rf: 11-979.077.FS885

0HGLGDV $[+[)  [[FP 3RWHQFLD:

(QODSDQWDOODVH PXHVWUDQHOWLHPSR\ ODWHPSHUDWXUDGHODJXD )LQDQFLDFLµQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJO«V()&6$2SHUDFLµQVXMHWDDODDSUREDFLµQ GHVX&RPLW«GH&U«GLWR0HQVXDOLGDGP¯QLPDŞ*DVWRVGHHQY¯RLQFOXLGRVHQODFXRWD Ş  6LQLQWHUHVHV7$(7,1,QWHUHVHVVXEYHQFLRQDGRVSRU(O&RUWH,QJO«V6$

+ info en

902 10 30 10 / latiendaencasa.es

43


Preciso y fiable por solo 29,90â&#x201A;Ź (VWHSUÂŁFWLFRWHQVLÂľPHWURGHEUD]RHFRPHGWHRIUHFHUÂŁ XQGLDJQÂľVWLFRSUHFLVR\DXWRPÂŁWLFRGHWXSUHVLÂľQDUWHULDO SXOVR\GHWHFFLÂľQGHDUULWPLDVDWUDYÂŤVGHODVPHGLFLRQHV \HVWÂŁQGDUHVGHOD2UJDQL]DFLÂľQ0XQGLDOGHOD6DOXG 'LVSRQHGHHVSDFLRVGHPHPRULDSDUDXVXDULRV\ WHPRVWUDUÂŁORVUHVXOWDGRVHQVXSDQWDOODSRUFÂľGLJRVGH FRORUHV$GHPÂŁVLQFOX\HXQSUÂŁFWLFRHVWXFKHSDUDJXDUGDUOR &RQVLJXH\DWXWHQVLÂľPHWURSRUVRORĹ&#x17E;

TOP VENTAS

TensiĂłmetro de brazo ecomed BU 90E,

29

,90â&#x201A;Ź

VER VĂ?DEO latiendaencasa.es

ÂĄCuida tu lĂ­nea y tu corazĂłn!

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-979.077.05285

$OLPHQWDFLÂľQ3LODV

$SURYHFKDWRGDVODVKRUDVGHOGÂŻDSDUDKDFHU HMHUFLFLRFRQ+DSS\OHJVXQDVROXFLÂľQGHJLPQDVLD SDVLYDTXHPXHYHODVSLHUQDVPLHQWUDVSHUPDQHFHV VHQWDGRUHDOL]DQGRXQVXDYHPDVDMH(VSHUIHFWRSDUDODV SHUVRQDVPD\RUHVSDUDDTXHOORVTXHSDVDQPXFKDVKRUDV HQODRĹľFLQDRLQFOXVRSDUDORVWUDWDPLHQWRVGHUHKDELOLWDFLÂľQ (OPRYLPLHQWRDOWHUQRGH+DSS\OHJVUHDFWLYDODFLUFXODFLÂľQ VDQJXÂŻQHDGHVGHODVSLHUQDVKDVWDHOFRUD]ÂľQ\D\XGDD IRUWDOHFHUORVPÂźVFXORVGHODVSLHUQDVDVÂŻFRPRHOLPLQDUOD LQĹśDPDFLÂľQHQURGLOODV\WRELOORV8QDSDUDWRPÂŤGLFDPHQWH SUREDGR\UHFRPHQGDGRSRUHVSHFLDOLVWDVHQVDOXG FDUGLRYDVFXODUTXHGLQDPL]DHOFRUD]ÂľQPDQWHQLÂŤQGROR VDQR$GHPÂŁVGHFXLGDUWXVDOXGWDPELÂŤQWHD\XGDUÂŁD SHUGHUSHVR 3RVLFLÂľQ FRUUHFWD SDUDOD PHGLFLÂľQ

CARACTERĂ?STICAS TĂ&#x2030;CNICAS: â&#x20AC;˘ Motor silencioso â&#x20AC;˘ 3 velocidades â&#x20AC;˘ Mando a distancia â&#x20AC;˘ Patas delanteras regulables en altura â&#x20AC;˘ ConexiĂłn a red con transformador (7,5/9/12 V) â&#x20AC;˘ Medidas (A x H x F): 32 x 8 x 44 cm â&#x20AC;˘ Peso: 5,8 kg

MĂĄquina de andar sentado HappylegsÂŽ + REGALO Tarjeta Regalo 30â&#x201A;Ź 6RORKDVWD

299â&#x201A;Ź

30,66â&#x201A;Ź /mes*

11 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 337,26â&#x201A;Ź

Rf: 11-979.263.00548

Mejora el flujo sanguĂ­neo de forma natural, sin esfuerzo ni contraindicaciones

Tu pulso bajo control &RQWURODWXSXOVRFRQHVWHSUÂŁFWLFRSXOVLR[ÂŻPHWURGH%HXUHU8Q SHTXHÂłR\OLJHURGLVSRVLWLYRTXHWHSHUPLWLUÂŁFRQRFHUODVDWXUDFLÂľQ DUWHULDOGHR[ÂŻJHQR\ODVSXOVDFLRQHVDOLQVWDQWH\GHIRUPDVHQFLOOD 0X\SUÂŁFWLFRSDUDSHUVRQDVFRQLQVXĹľFLHQFLDFDUGÂŻDFDHQIHUPHGDGHV SXOPRQDUHVRSDUDDTXHOODVTXHSUDFWLFDQGHSRUWHVGHDOWXUDFRPR PRQWDÂłLVPRHVTXÂŻ\DYLDFLÂľQ3DUDPD\RUFRPRGLGDGLQFOX\HXQ HVWXFKHFRQFRUUHD\FLQWXUÂľQ/DPHMRUSUHYHQFLÂľQSDUDWXGÂŻDDGÂŻD DKRUDDOPHMRUSUHFLR PulsioxĂ­metro Beurer PO-30,

59â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-979.263.01710

$OLPHQWDFLÂľQ3LODV$$$ 0HGLGDV $[+[) [[FP

44

Ver vĂ­deo en

latiendaencasa.es

PodrĂĄs recoger tu pedido en Consulta este servicio a tu operadora o en latiendaencasa.es

por solo 1â&#x201A;Ź


TOP VENTAS

Vuelve a oĂ­r bien /RVSUREOHPDVGHDXGLFLÂľQWHSXHGHQOLPLWDUHQWX GÂŻDDGÂŻD(VWHDPSOLĹľFDGRUGHVRQLGRV%HXUHUWH SHUPLWLUÂŁDPSOLĹľFDUHOYROXPHQGHWRGRVORVVRQLGRV LQWHULRUHV\H[WHULRUHV KDVWDG%\FRQXQDIUHFXHQFLDGH D+] \VHDGDSWDDGLVWLQWRVWDPDÂłRV\DTXHLQFOX\H WDSRQHVGHGLIHUHQWHVPHGLGDV AmpliďŹ cador de sonidos Beurer HA-20,

19

,90â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-979.263.01769

0HGLGDV $[+[) [[FP $OLPHQWDFLÂľQ3LOD/5 LQFOXLGDRWUDGHUHFDPELR 

Ver vĂ­deo en

latiendaencasa.es

OFERTA EXCLUSIVA REGALO Tarjeta Regalo 30â&#x201A;Ź

30â&#x201A;Ź Solo hasta 31-05-14

Hidrata y suaviza con un masaje de parafina

NUEVO

5HDOL]DXQWUDWDPLHQWRHĹľFD]\VDOXGDEOHSDUDWXSLHOFRQXQDJUDGDEOH PDVDMHGHSDUDĹľQD8QPÂŤWRGRSHUIHFWRSDUDPDQRVSLHV\FRGRVTXH SURPXHYHODDEVRUFLÂľQGHQXWULHQWHV\ODKXPHGDGDGHPÂŁVGHDFWLYDU ODFLUFXODFLÂľQ(OUHVXOWDGRVHUÂŁXQDSLHOPÂŁVVXDYHHKLGUDWDGDVLQ UXJRVLGDGHVQLJULHWDV,QFOX\HEROVLWDVGHFHUDGHSDUDĹľQDFRQDURPD QDUDQMD\EROVLWDVGHSOÂŁVWLFRSDUDHQYROYHU Masaje de paraďŹ na ELLE by Beurer MPE-70,

89â&#x201A;Ź

Rf: 11-077.516.83785

0HGLGDV $[+[) [[FP 3HVRNJ

La parafina promueve la absorciĂłn de nutrientes y activa la circulaciĂłn

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQ GHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1

+ info en

902 10 30 10 / latiendaencasa.es

45


Hogar NUEVO

Llega la nueva generaciĂłn de limpieza inteligente

6ROXFLRQDODOLPSLH]DGHWXKRJDUFRQ5RRPEDp/DQXHYDVHULHHVWÂŁGRWDGDGHODÂźOWLPDWHFQRORJÂŻDSDUDFRQVHJXLUVXHORVLPSHFDEOHV GHIRUPDWRWDOPHQWHDXWRPÂŁWLFD0LHQWUDVÂŤOOLPSLDĹ&#x2122;cWÂźSXHGHVGLVIUXWDUGHWXWLHPSROLEUH6XWHFQRORJÂŻDL$GDSWOHSHUPLWHFDOFXODUHO HVSDFLRPÂŁVGHYHFHVSRUVHJXQGRSDUDDVÂŻDGDSWDUVHDVXHQWRUQRGHODPDQHUDPÂŁVHĹľFLHQWHHPSOHDQGRPÂźOWLSOHVVHQVRUHV\PÂŁV GHFRPSRUWDPLHQWRVGLVWLQWRV$GHPÂŁVFXDQGRVHDSUR[LPDDSDUHGHV\PXHEOHVUHGXFHODYHORFLGDGSDUDUHGXFLUHOLPSDFWR(VWÂŁ HTXLSDGRFRQXQFDEH]DOGHOLPSLH]DPHMRUDGRSDUDUHFRJHUSROYRSHOR\DOÂŤUJHQRVGHWRGRWLSRGHVXHORV\DOIRPEUDVGHIRUPDPXFKR PÂŁVHĹľFD]<SDUDIDFLOLWDUODUHFRJLGDVXGHSÂľVLWR$HUR9DFUHWLUDODVXFLHGDGGHORVFHSLOORVUHSDUWLÂŤQGRODXQLIRUPHPHQWHHQXQGHSÂľVLWR GHPD\RUFDSDFLGDG8QDQXHYDJHQHUDFLÂľQGHURERWVDÂźQPÂŁVLQWHOLJHQWHVSDUDKDFHUWHODYLGDPÂŁVIÂŁFLO

Robot aspiraciĂłn Roomba 661 Black + REGALO Pack 3 ďŹ ltros y 3 cepillos laterales

529â&#x201A;Ź

45,65â&#x201A;Ź /mes***

12 cuotas SIN INTERESES TAE 3,17% TIN 0% Importe total adeudado 547,80â&#x201A;Ź

100% financiaciĂłn

o paga el 30-09-14 6RORKDVWD

Rf: 11-979.713.67608

3RWHQFLD: 0HGLGDV '[+ [FP 3HVRNJ

EXCLUSIVO

INCLUYE: â&#x20AC;˘ 1 DepĂłsito AeroVacâ&#x201E;˘ Serie â&#x20AC;˘ 1 Base de Carga Compact â&#x20AC;˘ 1 BaterĂ­a Recargable â&#x20AC;˘ 1 Pared Virtual Auto-On â&#x20AC;˘ 4 Filtros AeroVacâ&#x201E;˘ Extra â&#x20AC;˘ 1 Cepillo de Cerdas Extra â&#x20AC;˘ 1 Cepillo de goma extra â&#x20AC;˘ 2 Cepillos Laterales Extra â&#x20AC;˘ 2 Herramientas de limpieza

Aspira y da esplendor

'HVFXEUHODUHYROXFLÂľQGHODOLPSLH]DGH/HLIKHLWVXOLPSLDFULVWDOHVFÂľPRGRSUÂŁFWLFR\UÂŁSLGR/LPSLDVLQSURGXFLUIUDQMDVVLQJRWDV\HVWDQ HĹľFD]TXHFRQVHJXLUÂŁVXQRVFULVWDOHVEULOODQWHVGHXQDVRODSDVDGD$VSLUDWRGDHODJXDGHOODYDGR\UHFRJHHODJXDVXFLDHQHOGHSÂľVLWR &RQHOLQQRYDGRUVHQVRUFRQPRGRHVSHUDSDUDXQDGXUDFLÂľQH[WUDGHODEDWHUÂŻDWHSHUPLWLUÂŁOLPSLDUGXUDQWHPÂŁVWLHPSR2EWHQGUÂŁV UHVXOWDGRVDVRPEURVRV\WDPELÂŤQSRGUÂŁVOLPSLDUHOEDÂłREDOGRVDV\HVSHMRV<FRQVXVLVWHPDFOLFNV\VWHPSRGUÂŁVFRQHFWDUHODODUJDGRU LQFOXLGRSDUDOOHJDUDYHQWDQDVDOWDVYHQWDQDVLQFOLQDGDVRGHEXKDUGLOODV$GHPÂŁVHVWDRIHUWDWDPELÂŤQLQFOX\HXQSDÂłRGHPLFURĹľEUDSDUD HOLPLQDUODVXFLHGDG&RQVÂŻJXHORGXUDQWHHOPHVGHDEULOFRQXQGHVFXHQWRHVSHFLDOcSRUVRORĹ&#x17E;

Aspirador limpia cristales Leifheit + palo extensor + limpia cristales con funda lavable, 79â&#x201A;Ź

69â&#x201A;Ź

6RORKDVWD

Rf: 11-979.077.05483

+ 12% DTO

INCLUYE: â&#x20AC;˘ Aspirador limpia cristales â&#x20AC;˘ Palo extensor 43 cm â&#x20AC;˘ Limpia cristales con funda lavable

46

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQGHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1,QWHUHVHVVXEYHQFLRQDGRVSRU(O&RUWH,QJOÂŤV6$ )LQDQFLDFLÂľQVLQLQWHUHVHVKDVWDHQPHVHVRSDJDHOGH6HSWLHPEUHGH *DVWRVGHJHVWLÂľQĹľQDQFLDGRVĹ&#x17E;,QWHUHVHVVXEYHQFLRQDGRVSRU(O&RUWH,QJOÂŤV6$3RUFRPSUDVVXSHULRUHVDĹ&#x17E;'HODO(MHPSORV


Soluciones profesionales para tu hogar

NUEVO Potencia de aspiraciĂłn, eficacia del vapor

3ROWLSUHVHQWD/HFRDVSLUD,QWHOOLJHQW XQFRPSOHWRDVSLUDGRUĹ&#x17D;OLPSLDGRUDYDSRU FRQWRGRVORVDFFHVRULRVQHFHVDULRVSDUD OLPSLDUWRGRWLSRGHVXSHUĹľFLHVDOIRPEUDV SDUTXHWYLGULRVHVSHMRVFDPDVFRUWLQDV &XHQWDFRQODVPHMRUHVSUHVWDFLRQHV SURJUDPDVGHOLPSLH]D SUHVHOHFFLRQDGRVGLVSOD\GLJLWDO/&' UHWURLOXPLQDGRĹ&#x2122;<SDUDXQPDQHMR FÂľPRGRSRGUÂŁVFRQWURODUGHVGHVX HPSXÂłDGXUDWRGDVODVIXQFLRQHVc3ÂŁVDWHD ODOLPSLH]DPÂŁVFRPSOHWD Vaporetto Lecoaspira Polti Intelligent 2.0 700â&#x201A;Ź

59,90â&#x201A;Ź

/mes***

12 cuotas SIN INTERESES TAE 2,39% TIN 0% Importe total adeudado 718,80â&#x201A;Ź

100% financiaciĂłn

o paga el 30-09-14 6RORKDVWD Rf: 11-077.468.00387

NUEVO

Consigue una ropa impecable en pocos minutos

La fuerza del vapor en un tamaĂąo compacto

$SURYHFKDORVEHQHĹľFLRVGHOYDSRU\GHMDWX URSDLPSHFDEOHHQXQRVPLQXWRV/DSODQFKD 9DSRUHOOD)RUHYHUFXHQWDFRQXQVLVWHPDGH OOHQDGRSDUDDXWRQRPÂŻDGHWUDEDMRLOLPLWDGD UHJXODGRUGHOYDSRUKDVWDJPLQ\ XQDSUHVLÂľQGHEDU6XVSURJUDPDV SUHVHOHFFLRQDGRVUHJXODQODSUHVLÂľQGHO YDSRU\ODWHPSHUDWXUDGHSHQGLHQGRGHO WHMLGRTXHSODQFKDVDGHPÂŁVDKRUUDKDVWD XQGHFRQVXPRHOÂŤFWULFRFRQVX IXQFLÂľQ(&2

(VWHOLPSLDGRUDYDSRUFRPSDFWR GHVHQJUDVDOLPSLD\GHVLQIHFWD GHVLQFUXVWDQGRFXDOTXLHUWLSRGHVXFLHGDG GHIRUPDQDWXUDOVLQGHWHUJHQWHVTXÂŻPLFRV &RQXQDFDOGHUDGHDFHURLQR[LGDEOH XQDVDOLGDGHYDSRUGHJPLQ\XQD SRWHQFLDGH:WHVHUYLUÂŁSDUDOLPSLDU KDVWDODVPDQFKDVPÂŁVGXUDVWRGRGHIRUPD UÂŁSLGD\VHJXUD$GHPÂŁVLQFOX\HDFFHVRULR SDUDYHQWDQDV\HVSHMRVERTXLOODSDUD WDSLFHUÂŻDVFRUWLQDVHWFSXQWDFXUYDSDUD ULQFRQHV\PLQLFHSLOORVUHGRQGRV

Vaporella Forever Polti 1905 280â&#x201A;Ź

31

Vaporetto Polti 950,

129, 90â&#x201A;Ź

,42â&#x201A;Ź /mes*

10 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 314,20â&#x201A;Ź

Rf: 11-979.077.PO950

$OLPHQWDFLÂľQ5HG 0HGLGDV $[+[) [[FP 3HVRNJ 3RWHQFLD:

Rf: 11-077.471.55542

Polti te reembolsa 50â&#x201A;Ź con la compra de este aspirador. Condiciones de la promociĂłn en latiendaencasa.es Solo hasta 15-06-14

NUEVO

0HGLGDV $[+[)  [[FP 3HVRNJ

Ver vĂ­deo en INCLUYE: â&#x20AC;˘ Manguera â&#x20AC;˘ Tubos prolongadores â&#x20AC;˘ Cepillo multiusos + 3 chasis â&#x20AC;˘ Boquilla limpiacristales 130 y 200 mm â&#x20AC;˘ Accesorio 120° + cepillo + lanza vapor â&#x20AC;˘ 3 cepillos de colores para acc.120° â&#x20AC;˘ Boquilla pequeĂąa â&#x20AC;˘ Boquilla Lanza â&#x20AC;˘ Brocha aspiraciĂłn â&#x20AC;˘ Tubo telescĂłpico â&#x20AC;˘ Cepillo parquet â&#x20AC;˘ PaĂąo parquet â&#x20AC;˘ PaĂąo algodon y coďŹ a â&#x20AC;˘ Bolsa porta accesorios â&#x20AC;˘ Cepillo limpieza depĂłsito â&#x20AC;˘ Botella antigoteo

Polti te reembolsa 30â&#x201A;Ź con la compra de esta central de planchado. Condiciones de la promociĂłn en latiendaencasa.es Solo hasta 15-06-14

GHĹľQDQFLDFLÂľQGHFRPSUDV,PSRUWHĹ&#x17E;DSOD]DPLHQWRDPHVHVVLQLQWHUHVHV 7,17$(JDVWRVGHJHVWLÂľQĹ&#x17E;LPSRUWHWRWDODGHXGDGRĹ&#x17E;,PSRUWHĹ&#x17E;DSOD]DPLHQWR DPHVHVVLQLQWHUHVHV7,17$(JDVWRVGHJHVWLÂľQĹ&#x17E;LPSRUWHWRWDODGHXGDGRĹ&#x17E;

latiendaencasa.es

INCLUYE: â&#x20AC;˘ EmpuĂąadura soft-touch con sistema de seguridad para niĂąos â&#x20AC;˘ Chasis limpiacristales â&#x20AC;˘ Punta curva para la limpieza de rincones â&#x20AC;˘ Cepillo grande â&#x20AC;˘ Mini cepillos redondos â&#x20AC;˘ Boquilla pequeĂąa con paĂąo de esponja para la limpieza de tapicerĂ­as, cortinas, cocinas,... â&#x20AC;˘ Bolsa porta Vaporetto y accesorios

+ info en

902 10 30 10 / latiendaencasa.es

47


EXCLUSIVO

No des puntada sin hilo

5HDOL]DWXVSURSLDVFRQIHFFLRQHVFRQFDOLGDGGHODIRUPDP£V VHQFLOODFRQHVWDP£TXLQDGHFRVHUOLJHUD\SRUW£WLO8QDP£TXLQD SHUIHFWDSDUDWRGRVORVKRJDUHVFRQVLVWHPDGHGREOHSXQWDGD SXQWDGDGHUHIXHU]R\SLHVDQWLGHVOL]DQWHVSDUDWUDEDMDUFRQWRWDO FRPRGLGDG&RQWLHQHFDQLOODV XQDEODQFDXQDQHJUD\GRV YDF¯DV XQDDJXMD\XQHQKHEUDGRU3RGU£VFRQHFWDUODDODFRUULHQWH HO«FWULFDRFRQSLODVSDUDOOHY£UWHODGRQGHTXLHUDV&RQV¯JXHODDO PHMRUSUHFLR\OO«YDWHGH5(*$/2XQFRVWXUHURFRQDFFHVRULRV

Ahorra en tus facturas sin limitar tu consumo

EXCLUSIVO

$KRUDHVSRVLEOHFRQQXHVWURH[FOXVLYRDKRUUDGRUGHHQHUJ¯D GH-RFFD8QGLVSRVLWLYRWHVWDGR\FHUWLŵFDGRTXHWHD\XGDU£D JDVWDUPHQRVDOPLVPRWLHPSRTXHSURWHJHU£WRGRVWXVDSDUDWRV HO«FWULFRVGHVREUHFDUJDV\VXELGDVGHWHQVLµQ(VHIHFWLYRFRQDLUHV DFRQGLFLRQDGRVODYDGRUDVWHOHYLVRUHVHTXLSRVGHP¼VLFDVROR WHQGU£VTXHFRQHFWDUORDODUHG\QRWHOOHYDU£VVRUSUHVDVHQOD IDFWXUD$SURYHFKDHVWDRIHUWD\OO«YDWHGRVXQLGDGHVSRUVRORŞ

Máquina de coser Jocca, + REGALO Costurero,

49,90€

39

,90€

Ahorrador de energía Jocca,

REGALO Costurero

6RORKDVWD

Rf: 11-979.047.00156

20% DTO

0HGLGDVP£TXLQDGHFRVHU $[+[)  [[FP 0HGLGDVFRVWXUHURDELHUWR [[FPFHUUDGR [[FP 3RWHQFLD9'& [$$9 

2x1Llévate 2 por solo

39€

35€

6RORKDVWD

Gastos de envío

5,90€

Rf: GE-979.713.56726

10% DTO

$OLPHQWDFLµQ5HG

&RQ«FWDORDODUHG \HPSLH]DDDKRUUDU

NUEVO

Tu casa, siempre fresca 5HIUHVFDHODPELHQWHFRQHVWHDLUHSRUW£WLO6DLYRG\GLVIUXWDGHODWHPSHUDWXUDP£VDJUDGDEOHHQ FXDOTXLHUKDELWDFLµQGHODPDQHUDP£VFµPRGD&RQXQGLVH³RFRPSDFWRSHURSRWHQWHFXHQWD FRQXQDFDSDFLGDGGHUHIULJHUDFLµQGHIULJK\XQDFDSDFLGDGGHGHVKXPLGLŵFDFLµQGH /KFDSD]GHHQIULDU£UHDVGHPHVSHUIHFWRSDUDFXDOTXLHUHVSDFLR,QFRUSRUD XQDSDQWDOOD/('\PDQGRDGLVWDQFLDSDUDPDQHMDUORFµPRGDPHQWHHQFXDOTXLHUVLWLR\SRGU£V WUDQVSRUWDUORVLQHVIXHU]R\DTXHWLHQHUXHGDVLQFRUSRUDGDV$GHP£VHVVLOHQFLRVRFDVLQRQRWDU£V TXHORHVW£VXWLOL]DQGR8QDVROXFLµQHIHFWLYD\U£SLGDSDUDTXHHVWHYHUDQRWHROYLGHVGHOFDORU

Aire acondicionado portátil Saivod SAP 813 299€

30,66€ /mes*

11 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 337,26€

Rf: 11-047.803.02495

CARACTERÍSTICAS TÉCNICAS: • Alimentación: Red • Área de aplicación: 9-12 m2 • Capacidad refrigeración: 2.000 frigorías • Caudal de aire: 380 m3 • Nivel sonido: 64 dB • Longitud del tubo: 1,5 m • Medidas (A x H x F): 32 x 73 x 36 cm • Peso: 20 kg

48

Cómodas mensualidades Tú eliges la forma de pago


El planchado más eficaz en cualquier dirección

NUEVO

(VWDSODQFKDGHYDSRUYHUWLFDO5RZHQWD WHIDFLOLWDU£HOSODQFKDGRHQWRGDWXURSD WUDMHVSDQWDORQHVFRUWLQDVV£EDQDVř FRQXQDSRWHQFLDGH:\XQD UHJXODFLµQGHYDSRUGHJPLQ HVFDSD]GHSURSRUFLRQDUYDSRUGH PDQHUDFRQWLQXDGDGXUDQWHPLQXWRV ,QFRUSRUDUXHGDVSDUDTXHSXHGDV WUDQVSRUWDUODDFXDOTXLHUKDELWDFLµQ\ HVLQFOLQDEOHSDUDPDQHMDUODFRQPD\RU FRPRGLGDG$GHP£VLQFOX\HXQFHSLOOR SDUDWHMLGRVDFFHVRULRVSDUDSOLHJXHV GHSDQWDOµQTXLWDSHOXVDV\SHUFKD SDUDWRGRWLSRGHSUHQGDV7RGRORTXH QHFHVLWDVSDUDXQRVUHVXOWDGRVLQFUH¯EOHV Plancha vertical Rowenta Steamer IS6200 + Cepillo para tejidos,

99

Rf: 11-077.471.55716

'HSµVLWRH[WUD¯EOH/ 3RWHQFLD: 9DSRUJPLQ

Más autonomía, más comodidad (ODVSLUDGRUVLQEROVD$LU)RUFH([WUHPH DKRUDWHGDP£V2EWHQGU£VP£VDXWRQRP¯D JUDFLDVDVXQXHYDEDWHU¯DGHOLWLRTXHHV KDVWDGRVYHFHVP£VGXUDGHUDTXHRWUDV EDWHU¯DVDXPHQWDQGRVXXVRHQPLQXWRV \FRPRHVLQDO£PEULFD\XOWUDOLJHUDSRGU£V PRYHUWHSRUWRGRVORVHVSDFLRVI£FLOPHQWH &RQPRWRUGHDOWDYHORFLGDGSRVLFLRQHV SDUDWRGRWLSRGHVXHORVERTXLOOD'HOWD 9LVLRQFRQOX]/('\XQQXHYRFHSLOOR3RZHU %UXVKGHDOWDYHORFLGDGH[WUD¯EOH\PX\I£FLO GHOLPSLDU<JUDFLDVDVXVLVWHPD$LU)RUFH &\FORQLF([WUHPHXOWUDHŵFLHQWHPDQWHQGU£V HOUHVXOWDGRGHDVSLUDFLµQ Aspirador Air Force Lithium Ion de Rowenta RH8871 249€

30,95€ /mes*

9 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 278,55€

Rf: 11-077.462.84459

3RWHQFLD9

REGALO

Aspirador de mano Extenso Cyclonic. Más información en latiendaencasa.es

INCLUYE: • Cepillo para tejidos • Accesorio para pliegues del pantalón • Quitapelusa

EXCLUSIVO

Disfruta de un aire fresco y saludable &UHDHOPHMRUDPELHQWHHQWXKRJDU FRQHVWHFOLPDWL]DGRU-RFFD8QDSDUDWR SHUIHFWRSDUDUHIUHVFDUWXKRJDUHVWH YHUDQRFRQXQGHSµVLWRGHOLWURV GHFDSDFLGDG\FRQWUHVIXQFLRQHV LQFRUSRUDGDVIU¯RKXPLGLŵFDGRU \SXULŵFDGRU$GHP£VGHHQIULDUOD KDELWDFLµQFRQVHJXLU£VXQDPELHQWH GHDLUHVDQR\VDOXGDEOHOLEUHGHSROYR \£FDURV8QDSDUDWROLJHUR\SRUW£WLO TXHSRGU£VOOHYDUDODKDELWDFLµQTXH GHVHHVFRQPDQGRDGLVWDQFLDSDUD PD\RUFRPRGLGDGYHORFLGDGHVGH DLUHSHVWD³DPµYLOSDUDGLULJLUHODLUH \PRGRU£IDJDUHFRPHQGDGRSDUDHO XVRQRFWXUQR(VWHYHUDQRFRQVLJXH ODPHMRUWHPSHUDWXUDGHODIRUPDP£V VHQFLOOD\DOPHMRUSUHFLR

Bioclimatizador Jocca 5893, 119€

99€

6RORKDVWD

Rf: 11-979.077.04528

+ DE 16% DTO

$OLPHQWDFLµQ5HG &DSDFLGDGGHGHSµVLWR/ 0HGLGDV $[+[)  [[FP 3HVRNJ 3RWHQFLD:

)LQDQFLDFLµQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJO«V()&6$2SHUDFLµQVXMHWDDODDSUREDFLµQ GHVX&RPLW«GH&U«GLWR0HQVXDOLGDGP¯QLPDŞ*DVWRVGHHQY¯RLQFOXLGRVHQODFXRWD Ş  &RQLQWHUHVHV7$(7,1 6LQLQWHUHVHV7$(7,1,QWHUHVHVVXEYHQFLRQDGRVSRU (O&RUWH,QJO«V6$

+ info en

902 10 30 10 / latiendaencasa.es

49


EXCLUSIVO

EXCLUSIVO

Para el aperitivo...

Corta con seguridad (VWHFXFKLOORORQFKHDGRUFRQSURWHFWRU UHJXODGRUWHSHUPLWLU£FRQWURODUHO JURVRUGHODVORQFKDVDODYH]TXH WHSURWHJHFRQWUDORVFRUWHV

$UJDOWHRIUHFHHVWHMDPµQFXUDGR(VWLUSH 6HUUDQDHQWHURVLQKXHVRHO¼QLFRI£FLOGH FRUWDUHQFDVD3URFHGHQWHGHMDPRQHV VHOHFFLRQDGRVSDUDREWHQHUHOPHMRUERXTXHW KDVLGRVRPHWLGRDXQSHULRGRGHFXUDFLµQGH PHVHVHQERGHJDV\VHFDGHURVQDWXUDOHV (TXLYDOHDXQDSLH]DFRQKXHVRGHNLORV SHURFRQODFRPRGLGDGGHTXHHVW£ WRWDOPHQWHGHVKXHVDGR$GHP£VLQFOX\H XQMDPRQHURGHPDGHUD

'LVSRQLEOH SDUDGLHVWURV\ SDUD]XUGRV

Argal TodoUnJamón + Jamonero,

59,90€

Rf: 11-979.183.02320

Y si solo quieres el jamón, llévatelo

Por

5HDOL]DGRHQ DFHURLQR[LGDEOH

49

,90€

Cuchillo jamonero El Loncheador,

Rf: 11-979.183.02460

49

,90€

Gastos de envío

5,90€

Diestros, Rf: GE-979.073.00988 Zurdos, Rf: GE-979.073.00996

Un afilado perfecto

EXCLUSIVO

NUEVO

¿Agua fría o del tiempo?

(VPX\LQFµPRGRFRUWDUORVDOLPHQWRVFRQXQFKXFKLOORVLQŵOR SRUHVRQRSXHGHIDOWDUHQWXFRFLQDHVWHDŵODGRUHO«FWULFRI£FLO GHXVDU\GHXQWDPD³RFRPSDFWRSDUDTXHQRRFXSHHVSDFLR ,QFRUSRUDXQFDEH]DOGHJX¯DRULHQWDEOHFRQGLVWLQWDVUDQXUDVSDUD DŵODUFXFKLOORVGHŵOROLVR\RQGXODGRWLMHUDV\GHVWRUQLOODGRUHV JUDQGHV\SHTXH³RV&RUWDU£VFRQSUHFLVLµQ\VLQHVIXHU]R

(OGLVSHQVDGRUGHDJXD-RFFDHV FµPRGROLPSLR\I£FLOGHUHOOHQDU FRQXQGHSµVLWRUHIULJHUDQWHGH/ FDSD]GHHQIULDUKDVWD|&3RGU£V XWLOL]DUVXGHSµVLWRRDFRSODUERWHOODV GHDJXDGHGLIHUHQWHVWDPD³RV,QFOX\H EDQGHMDUHFRJHJRWDVH[WUD¯EOH 7DPEL«QHVW£GLVSRQLEOHHQFRORU PRUDGRHOLJHHOWX\R

<VL\DWLHQHV XQGLVSHQVDGRU GHDJXD SXHGHVOOHYDUWH ¼QLFDPHQWHHO GHSµVLWRGH/

Afilador de cuchillos Jocca 5155,

19,90€

Gastos de envío

5,90€

Rf: GE-979.077.A5155

3RWHQFLD:

Depósito de agua Jocca,

24,90€

Rf: 11-979.078.00532

Dispensador de agua Jocca,

59€

Blanco, Rf: 11-078.345.09668 Morado, Rf: 11-979.078.00607

50

latiendaencasa.es es calidad

$ŵODWXVFXFKLOORV RGHVWRUQLOODGRUHV HQXQRVVHJXQGRV


NUEVO

Los cortes mĂĄs fĂĄciles y precisos

3DUDHVRVDOLPHQWRVGLIÂŻFLOHVGHFRUWDUD\ÂźGDWHFRQHVWHFXFKLOOR HOÂŤFWULFRPXOWLXVRV&RQXQSRWHQWHPRWRUGH:\FXFKLOODVGH DFHURLQR[LGDEOHSHUPLWHXQFRUWHSUHFLVR\SRWHQWHVLQHVIXHU]R 6RORWLHQHVTXHHOHJLUODFXFKLOODTXHQHFHVLWDVVHJÂźQQHFHVLWHV PÂŁVRPHQRVSRWHQFLD\SUHSDUDUÂŁVODFRPLGDPXFKRPÂŁVUÂŁSLGR \VLQHVIXHU]R$GHPÂŁVHVGHVPRQWDEOH\VHSXHGHOLPSLDUHQHO ODYDYDMLOODV Cuchillo elĂŠctrico Kenwood KN650, 40â&#x201A;Ź

35,90â&#x201A;Ź

NUEVO Tus comidas a la plancha, mĂĄs sanas y sabrosas

(ODERUDODVUHFHWDVPÂŁVGHOLFLRVDVDODSODQFKDFRQ HVWDSODQFKDGHDVDU1HZ<RUN5HDOL]DGDFRQXQD SODFDFHUÂŁPLFDWHSHUPLWLUÂŁFRFLQDUGHIRUPDPÂŁVVDQD VLQQHFHVLGDGGHDFHLWH\DSURYHFKDQGRWRGRVORVVDERUHV QDWXUDOHVGHORVDOLPHQWRV(VSHUIHFWDSDUDFRFLQDUHQFXDOTXLHU VLWLR\SDUDD\XGDUWHDFRFLQDULQFOX\HXQWHUPRVWDWRGHWHPSHUDWXUD UHJXODEOH&DOLGDG\FRPRGLGDGDKRUDDOPHMRUSUHFLR Plancha de asar Palson New York,

49,90â&#x201A;Ź

6RORKDVWD

Rf: 11-979.077.KN650

Rf: 11-979.077.NYORK

+ DE 11% DTO

6XSHUĹľFLHSODQFKD[FP

,QFOX\H FXFKLOOD HVSHFLDO SDUDFRUWDU DOLPHQWRV FRQJHODGRV

EXCLUSIVO

La mejor presentaciĂłn en tu mesa

3RQHQWXPHVDXQDVHQVDFLRQDOFXEHUWHUÂŻDGHSLH]DVUHDOL]DGD HQDFHURFRQODPÂŁ[LPDFDOLGDGHOPHMRUGLVHÂłRTXHWH RIUHFH6DQWD&ODUD&RQPPGHHVSHVRUHVODPHMRUHOHFFLÂľQ SDUDOXFLUWXPHVD$GHPÂŁVLQFOX\HXQPDOHWÂŻQSDUDTXHORWHQJDV WRGRSHUIHFWDPHQWHRUGHQDGR CuberterĂ­a 113 piezas Santa Clara Dandy, 300â&#x201A;Ź

150â&#x201A;Ź

Corta, ralla, trocea ÂĄen la mitad de tiempo! $KRUDSRGUÂŁVSUHSDUDUODVUHFHWDVPÂŁVHODERUDGDVUÂŁSLGDPHQWH \VLQQLQJÂźQHVIXHU]R1LFHU'LFHU3OXVFRUWDSLFD\WURFHDORV DOLPHQWRVPÂŁVYDULDGRV(VWÂŁGLVHÂłDGRFRQXQDVFXFKLOODVGHDFHUR LQR[LGDEOHGHGLVWLQWRVWDPDÂłRVTXHSHUPLWHQYDULRVWLSRVGH FRUWH&RQVRORSRQHUODSLH]DTXHTXLHUHVFRUWDU\SUHVLRQDUWRGR TXHGDGHQWURGHOUHFLSLHQWH\VLQHQVXFLDUQDGD,QFOX\HWRGRVORV DFFHVRULRVSDUDFRUWDUHQGDGRVHQWLUDVUHFWDQJXODUHVFRQJURVRU JDMRVFXDUWRVĹ&#x2122;LQĹľQLGDGGHSRVLELOLGDGHV$SURYHFKDHVWDRIHUWD H[FOXVLYD\OOÂŤYDWHORSRUVRORĹ&#x17E;c3ÂŻGHOR\D

6RORKDVWD

Rf: 11-074.101.32661

AHORRA 150â&#x201A;Ź

Nicer Dicer Plus + REGALO Libro de recetas,

39,90â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-979.077.04320 Gastos de envĂ­o

Por INCLUYE: â&#x20AC;˘ 12 Cuchillos chuleteros â&#x20AC;˘ 12 Tenedores de mesa â&#x20AC;˘ 12 Cucharas de mesa â&#x20AC;˘ 12 Cuchillos de postre â&#x20AC;˘ 12 Palas de pescado â&#x20AC;˘ 12 Tenedores de pescado â&#x20AC;˘ 12 Cucharas de cafĂŠ â&#x20AC;˘ 12 Cucharas de moka â&#x20AC;˘ 12 Tenedores de lunch â&#x20AC;˘ 1 Cazo para sopa â&#x20AC;˘ 1 CucharĂłn para legumbre â&#x20AC;˘ 1 Pala pudĂ­n â&#x20AC;˘ 1 Cuchillo para pescado â&#x20AC;˘ 1 Tenedor para pescado

20

â&#x201A;Ź

mĂĄs

- Pelador - Cuchilla triangular - Rallador - Aceite de oliva

5,90â&#x201A;Ź

Rf: GE-979.713.59746

Ver vĂ­deo en

latiendaencasa.es

+ info en

902 10 30 10 / latiendaencasa.es

51


Un dulce para el postreâ&#x20AC;Ś Cup Cake fĂĄcil: todo un maestro pastelero &XS&DNHIÂŁFLOHVXQKRUQRGHVREUHPHVDFRPSDFWR\ VHQFLOORTXHWHSHUPLWLUÂŁHODERUDUGHOLFLRVDVYDULHGDGHVGH SRVWUHV&RORFDODPDVDTXHTXLHUDVFLHUUDHO&XS&DNH IÂŁFLO\WXVGXOFHVUHFLÂŤQKRUQHDGRVHVWDUÂŁQOLVWRVHQPHQRV GHPLQXWRV Cup Cake fĂĄcil + Kit de accesorios,

39,95â&#x201A;Ź

Rf: 11-979.077.04767

VER VĂ?DEO latiendaencasa.es

2Âş UNIDAD 50% DE DESCUENTO

0HGLGDV $[+[) [[FP

EXCLUSIVO

INCLUYE: â&#x20AC;˘ 1 botella de plĂĄstico grande y 3 pequeĂąas para decorar â&#x20AC;˘ Kit de boquillas intercambiables de acero inoxidable â&#x20AC;˘ 1 manga pastelera con boquilla â&#x20AC;˘ 1 espĂĄtula â&#x20AC;˘ 100 cĂĄpsulas de papel â&#x20AC;˘ Libro de recetas

Mide y pesa con una sola jarra

8QDFFHVRULRSUÂŁFWLFRSDUDSUHSDUDUWXVUHFHWDVFRQSUHFLVLÂľQ 8QDMDUUDFRQEÂŁVFXODLQFRUSRUDGDTXHPLGHHOYROXPHQ\SHVR DOPLVPRWLHPSR\FRQXQDSDQWDOOD/&'SDUDYHUODLQIRUPDFLÂľQ GHODVPHGLFLRQHV/RPÂŁVUÂŁSLGR\FÂľPRGRSDUDWHQHUVLHPSUH ODPHGLGDMXVWD Jarra medidora Jocca,

19

,90â&#x201A;Ź

NUEVO

Un delicioso helado artesanal

&RQHVWDKHODGRUDSRGUÂŁVSUHSDUDUXQGHOLFLRVRKHODGRDODPDQHUD DUWHVDQDOSHURVLQKDFHUHVIXHU]RV\DTXHHVHOÂŤFWULFD6RORWLHQHV TXHFRORFDUHOUHFLSLHQWHGHDOXPLQLRFRQORVLQJUHGLHQWHVHQHO FHQWURGHODFXEHWDOOHQDUHOFXERGHPDGHUDFRQKLHOR\SURQWR WHQGUÂŁVXQGHOLFLRVRVKHODGRcOLVWRSDUDVHUYLU Heladora Nostalgia ICMW400,

89â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-979.073.00947

Rf: 11-077.431.63201

$OLPHQWDFLÂľQ3LOD9'& LQFOXLGD 

El sabor natural de un batido casero 6PRRWKLH0DNHUHVXQDEDWLGRUDGHYDVRFRQXQDFDSDFLGDGGHP/H[WUDUÂŁSLGD FDSD]GHWULWXUDU\OLFXDUFXDOTXLHUIUXWDRYHUGXUDSHUIHFWDSDUDSUHSDUDUGHOLFLRVRV]XPRV EDWLGRVSDSLOODVKHODGRVVDOVDVJUDQL]DGRV7DQIÂŁFLOFRPRPHWHUHQHOYDVRODVIUXWDVR DOLPHQWRVVHOHFFLRQDGRVFHUUDUOR\FRORFDUORHQSRVLFLÂľQYHUWLFDO,QFRUSRUDFXFKLOODVGH DFHURLQR[LGDEOH\WLHQHXQDVYHQWRVDVHQODEDVHSDUDĹľMDUORDODVXSHUĹľFLH&RQVLJXH DKRUDWX6PRRWKLH0DNHU\GH5(*$/2OOÂŤYDWHXQ9DVR-XPERGHP/ Smoothie Maker

+ REGALO vaso Jumbo 500 mL,

Por solo

REGALO

39

,95â&#x201A;Ź

Rojo, Rf: 11-979.077.05111 Verde, Rf: 11-979.077.05137 Blanco, Rf: 11-979.077.05129 Morado, Rf: 11-979.077.05145 Amarillo, Rf: 11-979.077.05152

2Âş UNIDAD 50% DE DESCUENTO

$OLPHQWDFLÂľQ5HG 0HGLGDV $[+[) [[FP 3RWHQFLD:

52

Vaso Jumbo 500 mL

INCLUYE: â&#x20AC;˘ Unidad Smoothie Maker â&#x20AC;˘ Vaso octogonal de 250 mL â&#x20AC;˘ Recipiente de limpieza â&#x20AC;˘ Libro de recetas â&#x20AC;˘ Tapa hermĂŠtica para beber

VER VĂ?DEO latiendaencasa.es

Total satisfacciĂłn Si no quedas satisfecho te devolvemos el dinero


y un cรณctel para la sobremesa NUEVO

Como un profesional

0H]FODEDWH\VLUYHORVPHMRUHVFยตFWHOHVFRPRXQSURIHVLRQDOFRQ HVWHVHWSDUDFยตFWHOUHDOL]DGRHQDFHURLQR[LGDEOH(VWยฃFRPSXHVWR SRUXQDFRFWHOHUDGHFXHUSRVFRQXQDFDSDFLGDGGHP/XQ FRODGRUGHJXVDQLOOR\XQYDVRPHGLGRUGHGRVFDSDFLGDGHV\ P/\XQDSLFDGRUDGHKLHORPDQXDO8QRVGLVHยณRVGHHVWLOR YLQWDJHSDUDVRUSUHQGHUDWXVLQYLWDGRV Set de cรณctel + picadora de hielo manual Jocca,

39,90โ‚ฌ

Rf: 11-979.713.67475

NUEVO

El secreto de un buen cรณctel

7UDVOยฃGDWHD%UDVLOSUHSDUDQGRXQDGHOLFLRVDFDLSLULQKDXQRGH ORVFยตFWHOHVPยฃVIDPRVRVGHOYHUDQRFRQHVWHFRPSOHWRVHW(VWยฃ FRPSXHVWRSRUYDVRVGHFULVWDOPHGLGRUGREOH XQDSDUWH GHF/\ODRWUDGHF/ \XQPD]RSDUDSLFDUGHDFHUR LQR[LGDEOH<VLWHDSHWHFHFXDOTXLHURWURFRPELQDGRFRQODUXOHWD &RFNWDLO0DVWHUSRGUยฃVFRQRFHUWRGRVORVLQJUHGLHQWHVFDQWLGDGHV \XWHQVLOLRVTXHQHFHVLWDVSDUDSUHSDUDUXQDJUDQYDULHGDGGH FยตFWHOHVLQWHUQDFLRQDOHV6RORWLHQHVTXHJLUDUODUXOHWD\HOHJLUTXยซ WHDSHWHFHWRPDUc/RVFยตFWHOHVQXQFDSDVDQGHPRGD

NUEVO

La preparaciรณn mรกs delicada

0H]FOD\EDWHORVLQJUHGLHQWHVQHFHVDULRVGHIRUPDIยฃFLO\UยฃSLGD FRQHVWDEDWLGRUD3DOVRQ8QDMDUUDGH/SDUDSUHSDUDUJUDQGHV FDQWLGDGHVTXHLQFRUSRUDXQSRWHQWHPRWRUWXUERGH: LQFRUSRUDXQPROLQLOORGHFULVWDOSDUDPROHUFDIยซ\HVSHFLDVMXQWRFRQ IXQFLยตQSLFDKLHOR&RQVยฏJXHODHQPD\RDXQSUHFLRHVSHFLDO Batidora de vaso Palson Lima, 69,90โ‚ฌ

59,90โ‚ฌ 6RORKDVWD

Set de Caipirinha Balvi,

64

โ‚ฌ

Rf: 11-979.077.1LIMA

+ DE 14% DTO

Rf: 11-102.350.00568

0HGLGDV $[+[)  [[FP 3HVRNJ

Ruleta Balvi Cocktail Master,

14โ‚ฌ

Gastos de envรญo

5,90โ‚ฌ

Rf: GE-102.350.00634

+ info en

902 10 30 10 / latiendaencasa.es

53


Disfruta del buen tiempo sin insectos con

Pest Reject

/DOOHJDGDGHOFDORU\HOEXHQWLHPSRSURYRFDXQDXPHQWRGHOQÂźPHURGHELFKRVHLQVHFWRV6LTXLHUHVSURWHJHUWHGHSLFDGXUDVPROHVWLDV\ GLVIUXWDUGHXQKRJDUVDQRHKLJLÂŤQLFR3HVW5HMHFWHVWXPHMRUDOLDGR8QDSDUDWRTXHXWLOL]DODDYDQ]DGDWHFQRORJÂŻDGHOHOHFWURPDJQHWLVPR \XOWUDVRQLGRSDUDUHSHOHUDODVUDWDVUDWRQHVHVFDUDEDMRVFXFDUDFKDVĹ&#x2122;2WURVDSDUDWRVWLHQHQXQDOFDQFHOLPLWDGRSHURFRQXQVROR3HVW 5HMHFWSXHGHVSURWHJHUXQDFDVDGHKDVWDP\VLQXWLOL]DUSURGXFWRVTXÂŻPLFRVQRFLYRVSDUDODVDOXG\SDUDHOPHGLRDPELHQWH8QD VROXFLÂľQHIHFWLYDSUREDGDHQPLOORQHVGHKRJDUHVHQWRGRHOPXQGRTXHDKRUDSXHGHVFRQVHJXLUHQXQDRIHUWDHVSHFLDOc3UXÂŤEDOR Ahuyentador Pest Reject (1 unidad), Por solo

29

, 90â&#x201A;Ź

Gastos de envĂ­o

5,90â&#x201A;Ź

Rf: GE-979.071.00370 LlĂŠvate 2 por solo

15 mĂĄs â&#x201A;Ź

ASĂ? DE FĂ CIL: SIN PILAS, SIN MANTENIMIENTO Pest Reject funciona con la electricidad de tu casa, trabaja las 24 horas, los 365 dĂ­as del aĂąo para protegerte a ti y a los tuyos, sin ningĂşn tipo de mantenimiento.

VER VĂ?DEO latiendaencasa.es

Rf: GE-071.373.01110

HIHFWLYR\ VHJXUR6LQSURGXFWRV TXÂŻPLFRVWÂľ[LFRVR YHQHQRVRVFRQWUD LQVHFWRVUDWRQHV\ FXFDUDFKDV

54

PodrĂĄs recoger tu pedido en Consulta este servicio a tu operadora o en latiendaencasa.es

por solo 1â&#x201A;Ź


Guarda tu ropa de temporada /OHJDHOEXHQWLHPSR\FRQÂŤOHOFDPELR GHYHVWLPHQWD6DFD\DWXURSDGHYHUDQR\ JXDUGDWRGRVWXVDEULJRVEXIDQGDVERWDV JRUURV\MHUVÂŤLVTXHQRYDVDQHFHVLWDUHQ ORVSUÂľ[LPRVPHVHV&RQHVWRVSUÂŁFWLFRV RUJDQL]DGRUHV\FDMDVGHRUGHQDFLÂľQSRGUÂŁV SURWHJHUWXURSDDODYH]TXHSRQHVRUGHQ HQORVDUPDULRV\FDMRQHV/DVVROXFLRQHVPÂŁV SUÂŁFWLFDVTXHDKRUDSXHGHVFRQVHJXLUDO PHMRUSUHFLR 1. Organizador de colgar poliĂŠster, 29,95â&#x201A;Ź

20

,95â&#x201A;Ź

6RORKDVWD

Rf: GE-595.247.00941 Rf: GE-595.247.00875

0HGLGDV $[+[)  [[FP

2. Set 2 bolsas ropa corta, 17,90â&#x201A;Ź

7

Rf: GE-595.247.00925 Rf: GE-595.247.00859

0HGLGDV $[+[)  [[FP

6. Caja poliĂŠster grande, 26,50â&#x201A;Ź

0HGLGDV $[/  [FP

0HGLGDV $[+[)  [[FP

3. Set 2 bolsas ropa larga, 21â&#x201A;Ź

7. Organizador de cajones, 16,95â&#x201A;Ź

6

,50â&#x201A;Ź

6RORKDVWD

Rf: GE-595.247.00917 Rf: GE-595.247.00842

14,80â&#x201A;Ź 6RORKDVWD

11,85â&#x201A;Ź

0HGLGDV $[/  [FP

0HGLGDV $[+[)  [[FP

4. Set 4 bolsas para zapatos, 15,80â&#x201A;Ź

8. Pongotodo lavadora, 24,95â&#x201A;Ź

4 5

8

6RORKDVWD

Rf: GE-595.247.00933 Rf: GE-595.247.00867

11â&#x201A;Ź

6RORKDVWD

17,50â&#x201A;Ź

0HGLGDV $[/  [FP

0HGLGDV $[+[)  [[FP

Rf: GE-979.713.67426 Rf: GE-979.713.67459

6

6RORKDVWD

18

Rf: GE-979.713.67400 Rf: GE-979.713.67434

3

15,40â&#x201A;Ź

6RORKDVWD

Rf: GE-979.713.67418 Rf: GE-979.713.67442

2

5. Caja poliĂŠster pequeĂąa, 21,95â&#x201A;Ź

12

,50â&#x201A;Ź

1

5

6RORKDVWD

Rf: GE-595.475.00328 Rf: GE-595.475.00310

OFERTAS EXCLUSIVAS HASTA 50% DTO Solo hasta 31-05-14 Armario mixto con maletero, 89,95â&#x201A;Ź

44,95â&#x201A;Ź 6RORKDVWD

'HWDOOHDSHUWXUDDUPDULR

Rf: GE-595.242.04944 Rf: GE-595.242.04951

0HGLGDV $[+[)  [[FP

Todos los productos de ĂŠsta pĂĄgina tienen gastos de envĂ­o reducidos

Gastos de envĂ­o

5,90â&#x201A;Ź

+ info en

902 10 30 10 / latiendaencasa.es

55


Descubre la manguera que se expande automáticamente 7HSUHVHQWDPRVODPDQJXHUDP£VFµPRGD\SU£FWLFD6WUHWFK+RVHVHH[SDQGHDXWRP£WLFDPHQWHDODEULUHOJULIRGHODJXDSRUHIHFWRGHOD SUHVLµQ\VHYDKDFLHQGRFDGDYH]P£VODUJDKDVWDWULSOLFDUVXWDPD³R<DOFHUUDUHOJULIRVHFRQWUDH\VHYDKDFLHQGRP£VSHTXH³DKDVWD UHFXSHUDUVXWDPD³RLQLFLDOUHGXFL«QGRVHHQXQRVVHJXQGRVSDUDTXHODSXHGDVJXDUGDUU£SLGD\FµPRGDPHQWH/DPDQJXHUD6WUHWFK +RVHHVPX\UHVLVWHQWHGXUDGHUD\QRVHHQUHGD(VW£FRPSXHVWDSRUGRVPDQJXHUDVXQDLQWHULRUH[SDQGLEOH\PX\UHVLVWHQWH\RWUD H[WHULRUIDEULFDGDFRQXQWHMLGRIXHUWH\GXUDGHUR(VW£GLVSRQLEOHHQYDULDVPHGLGDVLQFOXVRSXHGHVXQLUGRVPDQJXHUDVDOFDQ]DQGRXQ P£[LPRGHPGHORQJLWXG$SURYHFKD\OO«YDWHXQDVHJXQGDXQLGDGFRQXQGHGHVFXHQWR

2º UNIDAD 40% DE DESCUENTO

'HVFXHQWRDSOLFDGRVREUH ODXQLGDGGHPHQRULPSRUWH

Manguera Stretch Hose 8 m,

Gastos de envío

5,90€

39,90€ 49,90€ 59,90€

Rf: GE-979.071.00461.XX8

15 m,

Rf: GE-979.071.00461.X15

23 m,

Rf: GE-979.071.00461.X23

EXCLUSIVO

Ahorra tiempo y dinero

&RQODSLVWRODGHSXOYHUL]DFLµQGHSLQWXUDGH-RFFDFRQVHJXLU£VXQRV UHVXOWDGRVSHUIHFWRV\DKRUUDU£VWLHPSR\GLQHUR6RORWLHQHVTXH UHOOHQDUHOGHSµVLWRHQFHQGHUODP£TXLQD\DSUHWDUXQERWµQ(VPX\ OLJHUD\I£FLOGHXVDU\HVLGHDOSDUDSLQWDUWRGRWLSRGHPDWHULDOHV &RQVHJXLU£VROYLGDUWHSRUŵQGHURGLOORV\EURFKDV\ORVUHVXOWDGRV VHU£QSHUIHFWRVDKRUDDXQSUHFLRLQPHMRUDEOHVRORŞ

Aspira la ceniza en segundos 5HFRJHWRGDODVXFLHGDGGHIRUPDHŵFD]FRQHVWHDVSLUDGRU HO«FWULFRGHFHQL]DV8QDVSLUDGRUGHXQDJUDQSRWHQFLDGH: \FRQXQGHSµVLWRGH/GHFDSDFLGDGTXHWHSURSRUFLRQDU£ XQDODUJDDXWRQRP¯D7HSHUPLWLU£DVSLUDUJUDQGHVFDQWLGDGHVGH FHQL]DIU¯DGHODFKLPHQHDRODEDUEDFRD8QDIRUPDVHQFLOOD\ U£SLGDGHUHDOL]DUXQDOLPSLH]DFRPSOHWD$GHP£VGLVSRQHGHXQ ŵOWURH[WUD¯EOH\ODYDEOH(TX¯SDWHFRQOR¼OWLPRHQOLPSLH]DSDUDHO KRJDUDKRUDDXQSUHFLRPX\HVSHFLDO Aspirador de cenizas en frío 20 L, 69€

39,95€ 6RORKDVWD

Rf: 11-107.645.00335

+ DE 42% DTO

INCLUYE: • Manguera • Boquilla de aluminio • Filtro de aire HEPA

Pistola de pintura Jocca 1618, 69,90€

49,90€ 6RORKDVWD

Rf: 11-979.107.00703

+ DE 25% DTO 56

3LQWDWXFDVD GHODPDQHUD P£VFµPRGD

Recibe el pedido donde tú quieras Tú eliges el lugar de entrega


ROTORAZER: La sierra de los profesionales del bricolaje 'HVFXEUHHOPHMRUUHJDORSDUDORVDPDQWHVGHOEULFRODMH5RWRUD]HUHVXQDVLHUUD FLUFXODUGHPDQRYHUVÂŁWLOGXUDGHUDSRUWÂŁWLO\OLJHUDTXHWHSHUPLWLUÂŁUHDOL]DUWRGR WLSRGHFRUWHVGHPDQHUDSUHFLVD\PX\VHQFLOOD5RWRUD]HUHVXQDVLHUUDGH YDLYÂŤQFLUFXODUGHEDQGDGHFRUWHKÂźPHGR\GHDUFRcWRGRHQXQR7LHQHXQD SRWHQFLDGH:\USPHLQFOX\HWUHVGLVFRVGHFRUWHGLIHUHQWHV SDUDWUDEDMDUFRQWRGRWLSRGHPDWHULDOHV&RUWDHQKRUL]RQWDOYHUWLFDOHQ OÂŻQHDUHFWDHQIRUPDFXUYDHLQFOXVRKDFLDDUULED3RGUÂŁVUHDOL]DUFRUWHV VXSHUĹľFLDOHVPHGLDQRV\SURIXQGRVVLQGDÂłDUODVXSHUĹľFLHGHDSR\R <SDUDQROOHQDUWRGRHOVXHOR\ODURSDGHSROYRLQFRUSRUDXQ PDQJXLWRGHDVSLUDFLÂľQSDUDDVSLUDUDODPLVPDYH]TXHVHFRUWD $GHPÂŁVLQFOX\HGH5(*$/2XQVHWDGLFLRQDOGHGLVFRVGH FRUWH\XQPDOHWÂŻQSDUDWUDQVSRUWDUOR Sierra Rotorazer + Set 3 discos de corte + REGALO Set 3 discos adicionales + MaletĂ­n,

99â&#x201A;Ź

Rf: 11-979.713.58367

3HVRVLHUUDNJ

REGALO

MaletĂ­n y 3 discos de corte adicionales

3 DISCOS PARA TODO TIPO DE CORTES â&#x20AC;˘ 1 disco de sierra de acero especial para cortar aluminio â&#x20AC;˘ 1 disco de sierra con carburo de tungsteno, especial para madera â&#x20AC;˘ 1 disco de corte de diamante especial para baldosas y gres AdemĂĄs, Rotorazer corta: metal, azulejos, moqueta, placas de yeso, plĂĄstico, mĂĄrmol, piedraâ&#x20AC;Ś

NUEVO

Arregla tu jardĂ­n sin esfuerzo

3UHSDUDWXMDUGÂŻQSDUDHOEXHQWLHPSRFRQHVWHFRUWDFÂŤVSHGHOÂŤFWULFR TXHWHSHUPLWLUÂŁUHDOL]DUWXVWDUHDVGHMDUGLQHUÂŻDFRQPHQRVHVIXHU]R \PD\RUUDSLGH]&RQXQSRWHQWHPRWRU3RZHUGULYHGH: JDUDQWL]DFRUWHVĹľDEOHVLQFOXVRHQODVFRQGLFLRQHVPÂŁVGLIÂŻFLOHVH LQFRUSRUDXQLQQRYDGRUSHLQHSDUDFÂŤVSHGTXHFRUWDFHUFDGH PXURVWHUUHQRV\MDUGLQHV$GHPÂŁVHVOLJHUR\WLHQHXQGLVHÂłR HUJRQÂľPLFRSDUDPDQHMDUORFRQIDFLOLGDG&RQVÂŻJXHORHQHVWD RIHUWDFRQHO5(*$/2PÂŁVSUÂŁFWLFRXQFRUWDERUGHV(DV\7ULP TXHWHGDUÂŁUHVXOWDGRVPÂŁVSHUIHFWRVWRGDYÂŻD CortacĂŠsped Bosch Rotak 32 + REGALO Recortabordes EasyTrim,

99,95â&#x201A;Ź

Rf: 24-979.713.67541

$QFKRGHFRUWHFP &DSDFLGDGUHFRJHGRU/ &KDVLV$%6 0ÂŁ[LPRP 0HGLGDV $[+[) [[FP 3HVRNJ

REGALO

Recortabordes EasyTrim Potencia: 280 W (valorado en 29,95â&#x201A;Ź) Solo hasta el 31-05-14

+ info en

902 10 30 10 / latiendaencasa.es

57


Cenador cuadrado para conjuntos de jardĂ­n 249â&#x201A;Ź

35,57â&#x201A;Ź /mes**

7 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIĂ&#x201C;N EXCLUSIVA

Verde-MarrĂłn, Rf: 24-198.272.01104 Gris, Rf: 24-198.272.01096

0DWHULDO$OXPLQLR 0HGLGDV $[+[) [[FP 3HVRNJ

Set de jardĂ­n Groove mesa + 4 sillones 479â&#x201A;Ź

36,63â&#x201A;Ź /mes*

15 cuotas SIN ENTRADA TAE 0% TIN 0% Importe total adeudado 549,45â&#x201A;Ź

Rf: 24-198.102.00386

0DWHULDOPHVDVLOOÂľQ0HWDO)LEUDVLQWÂŤWLFD 0HGLGDVPHVD $[+[) [[FP 0HGLGDVVLOOÂľQ $[+[) [[FP 3HVRFRQMXQWRNJ

NUEVO$KRUDTXH OOHJDHOEXHQWLHPSR DSURYHFKDSDUD GLVIUXWDUDODLUHOLEUHGH ORVPHMRUHVPRPHQWRV 3DUDWXVFRPLGDV FHQDVDSHULWLYRV WHRIUHFHPRVXQD VHOHFFLÂľQGHPXHEOHV HVSHFLDOHVSDUDWX WHUUD]DRMDUGÂŻQFRQ ORVTXHFRPSDUWLUÂŁV FRQWXVLQYLWDGRV ODVPHMRUHVYHODGDV <SDUDGLVIUXWDUDO VROGHXQPRPHQWR GHGHVFDQVRQR WHSLHUGDVORV PXHEOHVPÂŁV RULJLQDOHVFÂľPRGRV \GHFRUDWLYRVc(VWH YHUDQRDSURYHFKDUÂŁV DOPÂŁ[LPRHOEXHQ WLHPSRWRGRVORVGÂŻDV

Set de jardĂ­n Tango mesa + 2 sillones 299â&#x201A;Ź

33,22â&#x201A;Ź /mes**

9 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIĂ&#x201C;N EXCLUSIVA

Rf: 24-198.102.00394

0DWHULDO)LEUDVLQWÂŤWLFD 0HGLGDVPHVD $[+[) [[FP 0HGLGDVVLOOD $[+[) [[FP

Set mesa velador Oxford + 2 sillones apilables,

127â&#x201A;Ź

Rf: 24-979.713.67509

0DWHULDOPHVDVLOOD+LHUUR0HWDO 0HGLGDVPHVD $[+ [FP 0HGLGDVVLOOD $[+[) [[FP 3HVRPHVDVLOODNJ

58

CĂłmodas mensualidades TĂş eliges la forma de pago


SillĂłn exterior Air Concept,

159,90â&#x201A;Ź

Rosa, Rf: 11-979.105.PUFRO Gris, Rf: 11-979.105.PUFGR Verde, Rf: 11-979.105.PUFVE

0HGLGDV '[+ [FP 3HVRNJ

Puf exterior Air Concept, Puf exterior XXL Air Concept,

169,90â&#x201A;Ź

Rosa, Rf: 11-979.105.ROSA1 Gris, Rf: 11-979.105.GRIS1 Verde, Rf: 11-979.105.VERDE

49,90â&#x201A;Ź

Rosa, Rf: 11-979.105.AIRRO Gris, Rf: 11-979.105.AIRGR Verde, Rf: 11-979.105.AIRVE

0HGLGDV '[+ [FP 3HVRNJ

0HGLGDV '[+ [FP 3HVRNJ

Columpio lĂĄgrima con cojĂ­n 299â&#x201A;Ź

33,22â&#x201A;Ź /mes**

9 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIĂ&#x201C;N EXCLUSIVA

Rf: 24-198.278.00202

0DWHULDO)LEUDVLQWÂŤWLFD 0HGLGDVPHVD $[+[)  [[FP 3HVRPÂŁ[XVXDULRNJ 3HVRNJ

Set mesa Oxford + 4 sillones apilables 255â&#x201A;Ź

31

,88â&#x201A;Ź /mes**

8 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIĂ&#x201C;N EXCLUSIVA

Rf: 24-979.713.67491

0DWHULDOPHVDVLOOÂľQ+LHUUR0HWDO 0HGLGDVPHVD $[+[) [[FP 0HGLGDVVLOOÂľQ $[+[) [[FP 3HVRPHVDVLOODNJ

Carro de servicio Galileo plegable,

89â&#x201A;Ź

Antracita, Rf: 11-198.287.00930 Blanco, Rf: 11-198.287.00922

0DWHULDO5HVLQD 0HGLGDVPHVD $[+[)  [[FP 3HVRNJ

)LQDQFLDFLÂľQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJOÂŤV()&6$2SHUDFLÂľQVXMHWDDODDSUREDFLÂľQ GHVX&RPLWÂŤGH&UÂŤGLWR0HQVXDOLGDGPÂŻQLPDĹ&#x17E;*DVWRVGHHQYÂŻRLQFOXLGRVHQODFXRWD Ĺ&#x17E;  &RQLQWHUHVHV7$(7,1 6LQLQWHUHVHV7$(7,1,QWHUHVHVVXEYHQFLRQDGRVSRU (O&RUWH,QJOÂŤV6$

+ info en

902 10 30 10 / latiendaencasa.es

59


Para dormir siempre como en casa

(QWXVYLDMHVH[FXUVLRQHVRSDUDWXYLYLHQGDGHYDFDFLRQHVGLVIUXWDGHXQGHVFDQVRDJUDGDEOH\UHSDUDGRULJXDOTXHVLHVWXYLHVHVHQFDVD &RQHVWDVGRVFDPDVSRUW£WLOHV KLQFKDEOH\SOHJDEOH WHQGU£VXQDVROXFLµQSU£FWLFD\FµPRGDSDUDGRUPLUELHQHQFXDOTXLHUVLWLR EXCLUSIVO

Una cama extra donde más lo necesites

(VWDFDPDSOHJDEOH-RFFDHVSHUIHFWDSDUDOOHYDUGRQGHP£VORQHFHVLWHV\DTXHVHSOLHJD\RFXSDSRFRHVSDFLR&XHQWDFRQXQFRQIRUWDEOH FROFKµQGHFHQW¯PHWURVUHDOL]DGRHQSROLXUHWDQR\XQDIXQGDUHDOL]DGDHQSROL«VWHU\SRVLFLRQHVHQODSDUWHGHODQWHUDTXHSXHGHV DMXVWDUSDUDOHHUYHUODWHOHYLVLµQ$GHP£VWDPEL«QWHVHUYLU£FRPRFDPDH[WUDVLWLHQHVLQYLWDGRVHQFDVD/DPHMRUVROXFLµQSDUDGLVIUXWDUGHXQ GHVFDQVRVLQOLPLWDFLRQHVGHHVSDFLRTXHSXHGHVHUWX\DDXQSUHFLRLQPHMRUDEOH 3RGU£VSOHJDUODHQ VHQFLOORVSDVRV SDUDJXDUGDUOD RFXSDQGRHO P¯QLPRHVSDFLR

Cama plegable Jocca 179€

33,13€ /mes*

6 cuotas SIN ENTRADA TAE 19,56% TIN 18% Importe total adeudado 198,78€

Rf: 11-979.086.01095

0HGLGDVDELHUWD $[+[)  [[FP FHUUDGD[[FP

SRVLFLRQHVHQ ODSDUWHGHODQWHUD TXHSXHGHVDMXVWDU SDUDOHHUYHUOD WHOHYLVµQHWF

EXCLUSIVO

: la cama hinchable perfecta

5HVWIRUPŠHVODFDPDSHUIHFWDSDUDHVDVHVFDSDGDVGHFDPSLQJYLDMHVGHŵQHVGHVHPDQDYLVLWDVLPSUHYLVWDVř7HSURSRUFLRQDU£WRGD ODFRPRGLGDG\ŵUPH]DGHXQDFDPDFRQYHQFLRQDOJUDFLDVDVXVGRVF£PDUDVGHDLUH\HVWDELOL]DGRUFHQWUDO6HLQŶDHQPLQXWRVFRQVX ERPEDHO«FWULFDFRQDGDSWDGRUHVTXHWDPEL«QSRGU£VXVDUFRQRWURVDUW¯FXORV\GLVSRQHGHXQDY£OYXODGHFRQWUROSDUDUHJXODUODŵUPH]D GHODFDPD\HVSDFLRHQWUHODVF£PDUDVSDUDFRORFDUODVV£EDQDV3¯GHORDKRUD\OO«YDWHGH5(*$/2RWUDFDPDLQGLYLGXDO\DOPRKDGDV Cama doble Restform™ + REGALO cama individual + REGALO 3 almohadas,

Por solo

79€

Rf: 11-979.713.40563

0HGLGDV $[+[)  [[FP

60

latiendaencasa.es es mucho más

REGALO

Cama individual Medidas (A x H x F): 99 x 37 x 188 cm y 3 almohadas Medidas (A x F): 55 x 35 cm


Ahora, tu colchón viscoelástico con masaje al mejor precio

EXCLUSIVO

&RQHOFROFKµQ(&2'(p'VHQWLU£VODVHQVDFLµQGHGRUPLU\GHVFDQVDUSO£FLGDPHQWH/DFRPELQDFLµQGHPDWHULDOYLVFRHO£VWLFR \WHMLGR'PDQWHQGU£ODFRUUHFWDDOLQHDFLµQGHODFROXPQD\HOFXHUSRGXUDQWHWRGRHOGHVFDQVRGLVPLQX\HQGRORVSXQWRVGH SUHVLµQ(OFROFKµQ(&2'(p'IDFLOLWDHOPRYLPLHQWRGHODLUHHPSOHDQGR QXHVWUDSURSLDLQHUFLDFXDQGRQRVJLUDPRVRFDPELDPRVGHSRVWXUD \VXWHMLGR'UHJXODHODLUHODKXPHGDG\ODKLJLHQHJUDFLDVDVX WUDWDPLHQWRDQWL£FDURVKLSRDOHUJ«QLFR\WUDQVSLUDEOH6XV FPGHPDWHULDOYLVFRHO£VWLFRGHDOWDGHQVLGDGDSRUWDQXQD LQFRPSDUDEOHVHQVDFLµQGHLQJUDYLGH]TXHIDFLOLWDHO GHVFDQVR(VWRVHWUDGXFHHQXQDPHMRUFLUFXODFLµQ GHODVDQJUH\HQXQDPHMRUFDOLGDGGHOVXH³R 5HFRPHQGDGRHVSHFLDOPHQWHSDUDSHUVRQDV FRQUHXPDWLVPRDUWULWLVHVFROLRVLV FLIRVLV\WRGRWLSRGHGROHQFLDV TXHUHTXLHUHQXQGHVFDQVR DGHFXDGR$SURYHFKDOD RIHUWDHVSHFLDOGHPD\R \HOLJHWXPRGHORFRQ XQGHVFXHQWR ¼QLFR

/mes**

13 cuotas SIN INTERESES TAE 0% TIN 0%

135 cm

34,90€

/mes**

15 cuotas SIN INTERESES TAE 0% TIN 0%

Rf: 11-979.086.01202

579€ 518,70€ 6RORKDVWD

789€ 673,50€ 6RORKDVWD

39,90€ /mes**

13 cuotas SIN INTERESES TAE 0% TIN 0%

Rf: 11-979.086.01194

6HOHFFLRQD FµPRGDPHQWHFRQ VXPDQGRHOPDVDMH TXHQHFHVLWDVHQ FDGDPRPHQWR

39,90€

Rf: 11-979.086.01186

150 cm

105 cm

90 cm

Colchón ECO-DE® 3D Masaje-calor 538,50€ 719€ 453,70€ 6RORKDVWD 598,50€ 6RORKDVWD

44,90€ /mes**

15 cuotas SIN INTERESES TAE 0% TIN 0%

Rf: 11-979.086.01210

FINANCIACIÓN EXCLUSIVA

AHORRA HASTA + DE 120€

Relájate con su exclusiva función masaje ,QFOX\HIXQFLµQPDVDMH\FDORU,QWHJUDKDVWDYLEURPRWRUHV GHDOWDWHFQRORJ¯DSDUDHOFXHOOR]RQDOXPEDUGRUVDO\SLHUQDV

Relax para tu espalda, descanso para tu cuerpo

EXCLUSIVO

'HVFXEUHHOGLVH³RP£VSU£FWLFRSDUDGLVIUXWDUGHXQPDVDMHUHODMDQWH\ HVWLPXODQWH(VWHUHSRVDHVSDOGDUHOD[VHDGDSWDSHUIHFWDPHQWHDFXDOTXLHU VLWLRHOVRI£ODFDPD&XHQWDFRQXQD]RQDGHPDVDMHDOWD\RWUDEDMD\GRV QLYHOHVVXDYHSDUDUHODMDUWHRIXHUWHSDUDGHVWHQVDUORVP¼VFXORV\IXQFLµQFDORU $GHP£VLQFRUSRUDXQDO£PSDUDGHOHFWXUDGLULJLEOHGRVEROVLOORVODWHUDOHVSDUD JXDUGDUWXVOLEURVRUHYLVWDV\VHPDQHMDI£FLOPHQWHGHVGHHOUHSRVDEUD]RV Reposa-espalda masaje Jocca, + REGALO Funda,

79€

69€

6RORKDVWD

Rf: 11-979.263.00779

+ DE 12% DTO

%UD]RVDEDWLEOHVSDUD PD\RUFRPRGLGDG EROVLOORVODWHUDOHV \PDQGRGHFRQWURO LQFRUSRUDGR )LQDQFLDFLµQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJO«V()&6$2SHUDFLµQVXMHWDDODDSUREDFLµQ GHVX&RPLW«GH&U«GLWR0HQVXDOLGDGP¯QLPDŞ*DVWRVGHHQY¯RLQFOXLGRVHQODFXRWD Ş  &RQLQWHUHVHV7$(7,1 6LQLQWHUHVHV7$(7,1,QWHUHVHVVXEYHQFLRQDGRVSRU (O&RUWH,QJO«V6$

+ info en

902 10 30 10 / latiendaencasa.es

61


Convierte cualquier asiento en el más cómodo con el cojín p

'XDOX[H

(OFRM¯Q'XDOX[HpHVXQFRM¯QLQWHOLJHQWHTXHKDFHP£VFµPRGR FXDOTXLHUDVLHQWR,QFRUSRUDXQDWHFQRORJ¯DUHYROXFLRQDULD XQDFRPELQDFLµQGHJHO\HVSXPDTXHSURSRUFLRQDXQDSR\R DGLFLRQDOSDUDKDFHUP£VFRQIRUWDEOHFXDOTXLHUFODVHGHDVLHQWR (VW£IDEULFDGRFRQGRVFDSDVGHHVSXPDGHDOWDGHQVLGDGTXH UHFXEUHQHOJHOFRQHIHFWRUHODMDQWHHQHOLQWHULRU(OJHOUHSDUWH XQLIRUPHPHQWHHOSHVRGHOFXHUSRSDUDHOLPLQDUODSUHVLµQ\ UHGXFLUVXHIHFWRHQORVP¼VFXORV\ODVDUWLFXODFLRQHV(VSHUIHFWR SDUDDTXHOORVTXHWHQJDQTXHSDVDUPXFKRWLHPSRVHQWDGRVHQ HOWUDEDMR\DTXHDGHP£VWHD\XGDU£DUHODMDUWH\DPHMRUDUOD FLUFXODFLµQGHODVSLHUQDV7HORSXHGHVOOHYDUDGRQGHTXLHUDV\ ODIXQGDHVODYDEOHHQODODYDGRUD1RSLHUGDVHVWDRSRUWXQLGDG OO«YDWHGRVFRMLQHV'XDOX[HpSRUVRORŞ

6XWH[WXUDSURSRUFLRQDXQDDJUDGDEOHFDOLGH]

Cojín con gel Dualuxe®, Llévate 2 por solo

49

,95€

Gastos de envío

5,90€

Rf: GE-979.086.01319

0HGLGDV $[+[) [[FP

(VOLJHUR\I£FLOGHWUDQVSRUWDU,GHDOSDUDUHODMDUWHLQGHSHQGLHQWHPHQWHGHGRQGHHVW«VVHQWDGR

VER VÍDEO latiendaencasa.es

62

Total satisfacción Si no quedas satisfecho te devolvemos el dinero


EXCLUSIVO

Lo mejor para tu descanso y bienestar

&RQVLJXHXQDVHQVDFLµQ¼QLFDGHELHQHVWDUHQWXFDVDFRQHVWRVPDJQ¯ŵFRVVLOORQHVGHPDVDMH(&2'(p 8QGLVH³RHOHJDQWHIDEULFDGRHQSLHOGHYDFXQRGHDOWDFDOLGDGFRQODWHUDOHV\SDUWHWUDVHUD SROLSLHOTXHWHSURSRUFLRQDU£WRWDOFRPRGLGDGDOPLVPRWLHPSRTXHGLVIUXWDU£VGHXQHVWXSHQGR PDVDMH3RGU£VUHODMDUWRGRWXFXHUSRFXHOORHVSDOGDUL³RQHV\SLHUQDVHOHJLUHQWUHQLYHOHVGH LQWHQVLGDGHLQFOXVRGLVIUXWDUGHXQWUDWDPLHQWRFRQFDORUOXPEDU(OLJHHOWX\RVLOOµQ(&2'(p5HOD[ TXHVHSXHGHLQFOLQDUHQSRVLFLµQKRUL]RQWDORJLUDUORKDVWD|EDODQFHDUOR\FRQWURODUORVGLVWLQWRV PDVDMHVFRQVXPDQGRDGLVWDQFLD<SDUDODVSHUVRQDVPD\RUHVRFRQSUREOHPDVGHPRYLOLGDG HOLJHHOVLOOµQ(&2'(p(OHYDGRUTXHWHD\XGDU£DOHYDQWDUWHGHIRUPDFµPRGDVLQD\XGD VLPSOHPHQWHSXOVDQGRVXPDQGRDGLVWDQFLD(OLJHWXPRGHOR\FRQV¯JXHORDKRUDFRQODPHMRU ŵQDQFLDFLµQ6,1,17(5(6(6\VRORKDVWDHOGHPD\RFRQXQDKRUURGHKDVWDŞ Sillón Elevador ECO-DE® 899€

OFERTAS EXCLUSIVAS AHORRA HASTA 200€

699€

6RORKDVWD 34,95€/mes** 20 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIÓN EXCLUSIVA

Rf: 24-979.171.06383

AHORRA 200€

Solo hasta 31-05-14

Sillón Relax ECO-DE® 599€

499€

6RORKDVWD 49,90€/mes** 10 cuotas SIN INTERESES TAE 0% TIN 0% FINANCIACIÓN EXCLUSIVA

Chocolate, Rf: 24-979.171.06367 Negro, Rf: 24-979.171.06375

AHORRA 100€

)LQDQFLDFLµQRIUHFLGDSRU)LQDQFLHUD(O&RUWH,QJO«V()&6$2SHUDFLµQVXMHWDDODDSUREDFLµQ GHVX&RPLW«GH&U«GLWR0HQVXDOLGDGP¯QLPDŞ*DVWRVGHHQY¯RLQFOXLGRVHQODFXRWD Ş  6LQLQWHUHVHV7$(7,1,QWHUHVHVVXEYHQFLRQDGRVSRU(O&RUWH,QJO«V6$

+ info en

902 10 30 10 / latiendaencasa.es

63


Un profesional en tu cocina Nuevo

Robot de cocina Multicooker Redmond M4500E,

129€

Rf: 11-077.430.10873

¿A quién no le gusta comer bien? Ahora, si no tienes tiempo para cocinar o necesitas una ayuda de un profesional, tu opción es el robot de cocina Multicooker de Redmond. Podrás hacer todo tipo de recetas: guisos, fritos, sopas, cocidos, verduras al vapor, arroz, postres… platos que gustan a toda la familia y que tardarás muy poco en preparar. Cuenta con un recipiente de 5 litros con revestimiento antiadherente que te permitirá realizar los platos más sabrosos para toda la familia. Podrás programar a qué hora quieres que empiece a cocinar, mantener la comida caliente hasta que llegues a casa e incluso recalentar los platos. Saborearás todas las recetas en su punto y con resultados exquisitos. Elige tu modelo: M4502, con 16 programas automáticos y 18 manuales o M4500E, con 10 programas automáticos. Ambos incluyen un libro con 100 recetas y una tabla calórica de los alimentos. ¡Disfrutar de la buena cocina nunca fue tan fácil! Robot de cocina Multicooker Redmond M4502E,

159€

Rf: 11-077.430.10881

Potencia M4502E: 860 W; M4500E: 700 W. Medidas (A x H x F) M4502E: 28 x 24 x 39 cm; M4500E: 28 x 38 x 23,5 cm. Peso M4502E: 3,8 kg; M500E: 3,6 kg.

latiendaencasa.es o por teléfono: 902 10 30 10

Los artículos de este catálogo se pueden adquirir en

Válido desde el 28/04/2014 hasta el 31/08/2014

Sintoniza y busca nuestro CANAL DE TELEVISIÓN 24 HORAS EN TDT

Síguenos en

y

Y recuerda, este catálogo te será muy útil para tus futuras compras. Consérvalo y podrás realizar tu pedido en cualquier momento. 064 LTC ESPECIAL MAYO.indd 64

24/04/14 19:53

Ltc  
Read more
Read more
Similar to
Popular now
Just for you