Page 1

GENTE

CINE

Figura Ivana Gavrilović cuenta su vida

Película “Colours”, la ópera prima de Luis Cepeda

PAG. 8

PAG. 12

2

Martes 16 de abril de 2019 • Santo Domingo, República Dominicana Edición Nº 36.650 del Listín Diario

Jóvenes estudiantes

Conquistan Harvard y Georgetown con el debate COORDINADOR: FABIO CABRAL * EDITORES: MARTA QUÉLIZ, RAMÓN ALMÁNZAR Y LUIS BEIRO.


2

SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

MENUDO

4YFPMGEXSHSWPSWQEVXIW

CARMENCHU BRUSรLOFF

Imprevistos al comprar boleto de aviรณn

C

SQTVEVYRFSPIXSHIEZMzRIVEEQMIR XIRHIVYREXVEQMXEGMzRWMQMPEVTEVEXS HEWPEWEIVSPuRIEW1IIUYMZSUYq)R %QIVMGER%MVPMRIWEPEHUYMVMVYRFSPI XSQILMGMIVSRZEVMSWGEVKSW)RGSRWI GYIRGMETEVEYRWSPSFSPIXSXYZIUYIJMVQEVZEVMSW ZSYGLIVW

Shannon Garrido, Vangelly Ortiz, Allana Spears y Jaime Garcรญa tienen mรกs de dos aรฑos de experiencia en el de

Volar en clase econรณmica

8VEWZEVMSWEySWWMRYXMPM^EVHMGLEEIVSPuRIEWTEVEZME NEVE)WXEHSW9RMHSWEGYHuEWYSJMGMREIRPEGETMXEP TEVEGSQTVEVFMPPIXIIRGPEWIIGSRzQMGE-FEE2YI ZE3VPIERWZuE1MEQMGSRVIKVIWSLEWXE7ER.YER

%%RSZYIPEHIWHI4YIVXS6MGSERYIWXVSTEuW4EVE IWIVIXSVRSGSQTVqTSV-RXIVRIXIR.IX&PYI]IWGSKu EWMIRXSGSRYRWSPSGEVKSEQMXEVNIXE )PIKuIR%% PSWEWMIRXSWWIKRHMWTSRMFMPMHEHIRPE[IF1ITIV GEXqHIXEVMJEWHMWXMRXEWTIVSRSEZIVMKย‚qQjW

Costo segรบn fila elegida

*YIIRWYSJMGMREHSRHIQITIVGEXSUYIIRYRXVEQS HIPEVYXEQMFYXEGEWIPIGGMSREHEGYIWXEHzPEVIW EHMGMSREPIWEPTVIGMSHIPZMENI )RPEWTVMQIVEWJMPEW IVERHzPEVIW )RSXVSWXVEQSWQITEVIGILEFIV TEKEHSHzPEVIWEHMGMSREPIWTSVGEHEYRS0EXEVMJE IWTSVYFMGEGMzRHIJMPESHIEWMIRXSRSTSVEQTPMXYH HIFYXEGE)PGEVKSTSVPEHIPQIHMSHSRHIMFEQMLM NS%PI\MWGYERHSIVERXVIWEWMIRXSWIWQIRSWGSWXS WE4EVEIPXVE]IGXSIRPEWJMPEWIPIKMHEWHSRHIIVER XVIWEWMIRXSWPEHMJIVIRGMEIRXVIPEWY]E EPQIHMS ] PEQuE IRTEWMPPSSZIRXERE JYIHIEPVIHIHSVHIQMP TIWSWIPXSXEP

Tres vouchers para un boleto

4EVEQMFSPIXSLYFSXVIWGEVKSWYRSTSVIPFSPI XSSXVSTSVPEWYQEHIPGSWXSEHMGMSREPHIEWMIR XSWIPIKMHSW]IPXIVGIVSTSVIQMXMVIPFSPIXSIRJuWM GS'SRVE^zRPEKIRXIGSQTVETSV-RXIVRIX)WQjW FEVEXS

Actividad acadรฉmica

Jรณvenes que se destacan en el arte del debate

Cambian vuelo sin avisar

'YEXVSHuEWERXIWHIQMZMENIEGYHSEPESJMGMREHI%% ETVIKYRXEVWMIPWjFEHSTYIHSTEKEVPSWHzPEVIW TSVTVMQIVEQEPIXE2SRSTYIHS 7MLYFMIVEGSQ TVEHSFSPIXSGSRYREXEVMJEIWTIGuJMGETEVEIPGEWS QILYFMIVEELSVVEHSIPGEVKSEHMGMSREPIRXVIWXVE QSWHIPZMENI 0SUYIIRPESJMGMREQIWSVTVIRHIIW IRXIVEVQIUYIQMZYIPS EPEWTQ JYIGERGI PEHS8IRKSVIWIVZEGMzRIRIPHIPETQ4IVSRS QIEZMWEVSR

Aviones en tierra

(IWHMGIQYGLSHIPEIQTVIWEUYIRSEZMWEVER EYRUYIPEGERGIPEGMzRRSI\XVEyE)PEZMzRIVE YR&SIMRK1E\EZMSRIWUYIXIQTSVEPQIRXI RSIWXjRZSPERHSTSVHSWEGGMHIRXIWSGYVVMHSW E SXVEWEIVSPuRIEW (MGLEWMXYEGMzRLETVSZSGEHS PEGERGIPEGMzRHIQMPIWHIZYIPSWERMZIPQYRHMEP 7YJVuYREHIXEPIW

:

En la web

menudocb@yahoo.com listindiario.com

Beneficio. Lo mรกs interesante del debate, segรบn los alumnos, es que les amplรญa su forma de pensar y les permite ver las dos caras de la moneda de un mismo tema.


3

SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

Triunfos internacionales Harvard. )PXVMYRJSQjWVIGMIR XIJYIIRIP·XL,EV ZEVH%RRYEP2EXMSREP *SVIRWMGW8SYVREQIRX¸ IRIPGYEPPSWIWXYHMERXIW .EMQI+EVGuE]%PPERE 7TIEVWGPEWMJMGEVSRIRIP PYKEVRQIVSHI IUYMTSWUYITEVXMGMTE VSRIRPEGEXIKSVuE Georgetown. )PIUYMTSGSRJSVQEHS TSV7LERRSR+EVVMHS ]:ERKIPP]3VXM^PSKVz GPEWMJMGEVIRPEPXMQE VSRHETVIPMQMREVHIP ·2EXMSREP7TIIGLERH (IFEXI%WWSGMEXMSR¸ TSVPSGYEPEQFEWJYI VSRVIGSRSGMHEWEPPPI KEVESGXEZSWHIJMREP

ebate. FUENTE EXTERNA

LOGROS LAURA ORTIZ GÜICHARDO

laura.ortiz@listindiario.com Santo Domingo

E

PHIFEXIQjW EPPjHIWIVYRE WMQTPIEGXM ZMHEHEGE H q Q M G E   I W YRETVITEVEGMzRTEVEPE ZMHE%YRUYIEZIGIWIW QIRSWTVIGMEHETSVWIV GSRWMHIVEHEHIQMRuQSIW JYIV^SJuWMGSWuVIUYMIVI QYGLETVITEVEGMzRMRXIPIG XYEP]HIHMGEGMzR )RIWXSPXMQSGSRGYIV HERPSWIWXYHMERXIW:ERKI PP]3VXM^7LERRSR+EVVM HS.EMQI+EVGuE]%PPERE 7TIEVHIPGSPIKMSFMPMRK‚I 2I[,SVM^SRWUYMIRIWKVE GMEWEWYFYIRHIWIQTIyS EVKYQIRXERHSLS]HuEI\ LMFIRVIGSRSGMQMIRXSWHI GSQTIXIRGMEWMRXIVREGMSRIW WSFVIHMWGYVWS]HIFEXIHI YRMZIVWMHEHIWHIPEXEPPEHI ,EVZEVH]+ISVKIXS[R 4IVSIWSWPSKVSWRSWI GSRWMKYMIVSRHIPERSGLI EPEQEyERE'SRPPIZEVSR QYGLSIWJYIV^S]TVITEVE GMzRTSVTEVXIHIGEHEYRS HIPSWNzZIRIWPSWGYEPIW XMIRIRQjWHIHSWEySWHI I\TIVMIRGMEIRPEQEXIVME 0SUYIIRGYIRXVERQjW MRXIVIWERXIHIPHIFEXIWI KRGSQIRXERIWUYIPIW EQTPuEWYJSVQEHITIRWEV] PIWTIVQMXIZIVPEWHSWGEVEW HIPEQSRIHEHIYRXIQE TYIWTEVEGEHEGSQTIXIR GMEHIFIRTVITEVEVWITEVE

IWXEVXERXSEJEZSVGSQSIR GSRXVEHIPEVKYQIRXSUYI WIPIWEWMKRE )WTSVIWSUYIGSRWMHI VERUYIIPHIFEXIHIFIVuE WIVMQTPIQIRXEHSXEQFMqR IRIWGYIPEWTEVEUYIPSWNz ZIRIWEPSWUYIEPMKYEPUYI EIPPSWPIWKYWXII\TSRIVWYW TYRXSWHIZMWXEXIRKERYR PYKEVEPGYEPVIGYVVMVTEVE TSXIRGMEVWYWLEFMPMHEHIW µ)PHIFEXIWEGEEPIWXY HMERXIHIPE^SREHIQIQS VM^EVTEVETEWEVYRI\EQIR 8IHEPESTSVXYRMHEHHI ZIVHEHIVEQIRXIETVIRHIV ]YXMPM^EVPEPzKMGETEVEHI JIRHIVXYWMHIEPIW¶I\TVIWE :ERKIPP]3VXM^ %TS]S %YRUYIPSWNzZIRIWI\ TVIWERWYEKVEHIGMQMIR XSGSRPEWMRWXMXYGMSRIWUYI LERHIGMHMHSTEXVSGMREVPSW ]PSWQIHMSWUYIWILERLI GLSIGSHIWYWPSKVSWGSRWM HIVERUYIIRIPTEuWXSHEZuE RSWIPIHEPEHIFMHEMQTSV XERGMEEPHIFEXIGSQSWI LEGIGSRHITSVXIWSPuQTM GSWTSVINIQTPS µ'YERHSYREXPIXEZMENE ESXVSTEuWEVITVIWIRXEVIP RYIWXVSWIEWIKYVERHIUYI IPTYIFPSWITEPSWPSKVSW SFXIRMHSW4IVSGSRIPHI FEXIUYIXEQFMqRVIUYMIVI QYGLETVITEVEGMzRRSTE WEMKYEP¶GSRGPY]IIPNSZIR .EMQI+EVGuE )PTVz\MQSVIXSTEVEIP GYEPPSWIWXYHMERXIWGSRXM RYERTVITEVjRHSWI]HIPGYEP IWTIVERWEPMVEMVSWSWGSQSIR PEWGSQTIXIRGMEWERXIVMSVIW IWIP·8SVRISHIGEQTISRIW¸ IRPE9RMZIVWMHEHHI/IRXYG O]EGIPIFVEVWIEJMREPIWHIP QIWHIEFVMP

Al leer, los seres humanos entran en diálogo con otras voces y otros tiempos. Quien se educa literariamente hablando, poseerá una de las herramientas más acabadas para la formación de la personalidad y el carácter. ISTOCK

Educación literaria.

Su importante aplicación en la formación del profesional de hoy SEMANA LITERARIA

Un merecido homenaje

Esta educación ayuda con la capacidad de análisis.

CERTAMEN Santo Domingo

A

PMRMGMEVPE IHYGEGMzR WYTIVMSVPE QE]SVuEHI IWXYHMERXIW EWYQIGSRERWMIHEHIPVI XSHIYREIXETEUYIWMKRM JMGETEVEIPPSWYREXVERWM GMzRIZMHIRXIHIPSWEySW HIIWGSPEVMHEHFjWMGEEPE JSVQEGMzRTVSJIWMSREP)W XjRXERERWMSWSWHIIQ TI^EVEWYQIVKMVWIIRPEW MRXVuRKYPMWTVSTMEWHIPE GEVVIVEUYILERIPIKMHS UYIWIPIWLEGIHMJuGMPGSQ TVIRHIVTSVUYqHIFIR GYVWEVQEXIVMEWUYIHIW HIWYTIVWTIGXMZE]EGYV WEVSRIRPEIWGYIPE )RXSRGIWPIWWYVKIPE TVIKYRXE£5YqMQTSVXER GMEXMIRIPEPMXIVEXYVEIR QMTVSGIWSHIIHYGEGMzR YRMZIVWMXEVME#7MFMIRRS

I\MWXIYRIWGIREVMSRMGS TEVETVSQSZIVPEPIGXYVE ]IWGVMXYVEHIXI\XSWPMXIVE VMSWREHMITSRHVuEIRHY HEUYIPEYRMZIVWMHEHIW YRIWTEGMSMHIEPTEVEXEPIW JMRIWIWTIGMEPQIRXITE VEHIWTIVXEVPETEWMzRTSV PEPMXIVEXYVEIRYREqTSGE HSRHIPETVIZEPIRGMEHIPE MQEKIRWSFVIIPXI\XSIW GVMXSWMKYIIREYQIRXS HSRHIPEWVIHIWWSGMEPIW WSRIPQIHMSHIGSQYRM GEGMzRTSVI\GIPIRGME]IR PEUYIRSTSHVuEQSWGSR GIFMVYRHuEPINSWHIRYIW XVSWHMWTSWMXMZSWIPIGXVzRM GSW 4IVSGSRXVEVMSEPSUYI TSHVuETIRWEVWIPEPMXI VEXYVERSWISTSRIEXS HSWIWXSWGEQFMSW]XIR HIRGMEWRSWTVITEVETEVE IPPSW)PEZERGIHIPEGMIR GME]PEXIGRSPSKuEHI QERHEMRHMZMHYSWGEHE ZI^QjWGETEGIWHIMRRS ZEVGVIEVHMWIyEV]IWXEV EFMIVXSWERYIZEWJSVQEW HITIRWEVHIEGXYEV]HI ETVIRHIV4SVSXVSPEHS

Matos Moquete. )WXIEySIP<--'IVXE QIR0MXIVEVMSJYIHI HMGEHSE1ERYIP1E XSW1SUYIXI4VIQMS 2EGMSREPHI0MXIVEXY VETSVWYWMK RMJMGEXMZEXVE]IGXS VMEGSQSIWGVMXSV]WY ETSVXIEPEPMXIVEXYVE REGMSREP IPFSQFEVHISQEWMZSHI MRJSVQEGMzRIRPSWHMWXMR XSWQIHMSWHIGSQYRMGE GMzR]IPPMFVIEGGIWSEPE QMWQELERGEQFMEHSPEW VIKPEWHIPNYIKSTIVSRS IPGzHMKSTYIWWIKYMQSW WMIRHSWIVIWWSGMEPIWGY]S QIHMSJYRHEQIRXEPHIGS QYRMGEGMzRIWIPPIRKYENI =ELuPEMQTSVXERGMEHIPE IHYGEGMzRPMXIVEVMERSGS QSYREGGIWSVMSSGSQTPI QIRXSHIPGYVVuGYPSWMRS GSQSYRTMPEVJYRHEQIR XEPIRPEJSVQEGMzRHIGMY HEHERSWGSRPEGETEGMHEH HIVIJPI\MSREVIRXSVRSE WYVIEPMHEH]HIXVERWJSV QEVPEGSRYRTIRWEQMIR XSGVuXMGSEFMIVXSGSQTPI NS]HMWTYIWXSWEEWYQMV IPPMHIVE^KSIRQIHMSHI PSWGEQFMSWUYILEXVEuHS GSRWMKSIWXIWMKPS )RIWXIWIRXMHSPEWEYXS VMHEHIWHIPE9RMZIVWMHEH -FIVSEQIVMGERE 9RMFI  GSRWGMIRXIWHIPEMQTI VERXIRIGIWMHEHHIHIWE VVSPPEVPEGSQTIXIRGMEPM XIVEVMEIRIWXEKIRIVEGMzR

HINzZIRIWPuHIVIWWMKYIR EWYQMIRHSIPGSQTVSQM WSHIQERXIRIVYRESJIV XEEGEHqQMGEMRXIVHMWGM TPMREVMEUYIJEZSVI^GEPE JSVQEGMzRMRXIKVEPHIWYW IWXYHMERXIWSJVIGMIRHS RYIZSWIWTEGMSWTEVETVS QSZIVIPEVXI]HMWIyERHS EGXMZMHEHIWGYVVMGYPEVIW UYIGSRWMHIVIRIPJSQIR XSHIPEIWGVMXYVE]PEPIG XYVEGSQSTMPEVIWJYRHE QIRXEPIW 'SRXEPIWJMRIWIPÊVIE HI0IRKYE]0MXIVEXYVE HIP'MGPSHI)WXYHMSW+I RIVEPIWPPIZEEGEFSYRE EGXMZMHEHGYVVMGYPEVHI RSQMREHEPE7IQERE0M XIVEVMEGSRYRTVSKVEQE HMVMKMHSEXSHEPEGSQY RMHEHYRMZIVWMXEVMEIRPE GYEPHYVERXIYREWIQE REWIVIGMFIPEZMWMXEIR HMJIVIRXIWEGXMZMHEHIW HIKVERHIWIWGVMXSVIWHS QMRMGERSWUYMIRIWEFEV GERKqRIVSWGSQSXIEXVS QWMGEHER^EREVVEXM ZE]TSIWuE]IRPEGYEP IWXYHMERXIWHIHMWXMRXEW GEVVIVEWTEVXMGMTERIR IZIRXSWXEPIWGSQSQE VEXzRHITSIWuETERIPHI IWGVMXSVIWHIFEXIIWXY HMERXMPEWEPXSWHIPIGXYVE HIRXVS]JYIVEHIPGEQ TYWXIEXVSJzVYQIXGq XIVE (IRXVSHIIWXEGIPIFVEGMzR WIVIEPM^EEHIQjWIP'IV XEQIR0MXIVEVMSHI9RMFI IPGYEP]EPPIZEEySWHI VIEPM^EGMzR]XVEXEWSFVIYR GSRGYVWSTEVEHSGIRXIWEH QMRMWXVEXMZSW]IWXYHMERXIW UYMIRIWWSQIXIRWYWXI\XSW IRGYEXVSHMWXMRXSWKqRIVSW TSIWuEGYIRXSKYMSR]IR WE]S


VIII FERIA SEMANA DE LA GEOGRAFÍA Fecha: 23 y 24 de abril 2019. Lugar: Salón de eventos plaza Sambil. Horario: De 8:30 a. m.- 6:00 p. m. Abierto al público.

<[`kfiX1IfjXi`fM}jhl\q K\c1/'0-/-$--//<ok))/0$)+(.$),(' gcXec\X7c`jk`e[`Xi`f%Zfd _kkg1&&gcXec\X%c`jk`e[`Xi`f%Zfd

Reflexión

La creación expectante espera por ti Plenitud. ¡Enamórate de la vida, enamórate de la creación, enamórate de Dios!

BÚSQUEDA

PERFIL

MARGARITA BEATO

Especial para LISTÍN DIARIO Santo Domingo

0

EFWUYIHEHI (MSWUYIIW RIGIWEVMETE VEXSHSGVI]IR XIHIJMRIQY] FMIRPEZMHEGSRXIQTPEXMZE ,EWXEIPTYRXSHIUYITS HIQSWHIJMRMVEPGSRXIQ TPEXMZSGSQSIPUYIªFYWGE E(MSW«8SHSWPSWTEWSWUYI WIHEREPSPEVKSHIPEZMHE GSRXIQTPEXMZEXMIRIRGSQS VE^zRJYRHEQIRXEPPEFW UYIHEHI(MSW]IPIWXEVHMW TYIWXSEXSHSTEVEIRGSR XVEVPI7MRIWXEFWUYIHEHI (MSWXSHSWPSWHIQjWIPI QIRXSWHIPEZMHEGSRXIQ TPEXMZEGEVIGIRHIWIRXMHS £4EVEUYqWMVZIPESVEGMzRIP WMPIRGMSPEPYGLEGSRXVEPEW XIRXEGMSRIWIPHMWGIVRMQMIR XSSIPETSWXSPEHSWMRSIW TSVUYIFYWGEQSWE(MSW# *VIGYIRXIQIRXIPEVYXM REPEQIHMSGVMHEHPSWTI UYIySWSKVERHIWJVEGEWSW PEWTVSTMEWPMQMXEGMSRIW IXGZERLEGMIRHSUYITSR KEQSWPEFWUYIHEETEWMS REHEHI(MSWIRYRWIKYRHS TPERS]UYIRSWTIVQMXE

Margarita Beato Directora espiritual

En la búsqueda de Dios: µ8SHSPSUYI RIGIWMXSTEVEWIVJIPM^ IWXjHIRXVSHIQu¶ QSWHIHMGEVRSWWMQTPIQIR XIEVIEPM^EVYREWXEVIEW GYMHERHSPSI\XIVMSVHI PEWQMWQEWQMIRXVEWHINE QSWUYIWIHIWZERI^GEIWE EXVEGGMzRLEGME(MSWUYIIW PERMGEVE^zRUYIWYWXIRXE YREIRXVIKEVEHMGEPGSQS PEUYIWYTSRIPEZMHEGSR XIQTPEXMZE 7MRSXIRIQSWIWEWIHHI (MSWGSVVIQSWIPTIPMKVSHI UYIXSHSPSUYIVIEPMGIQSW TSVFYIRS]WERXSUYIWIE WIGSRZMIVXEIRYRWYGIHj RISHIIWEFWUYIHEETE WMSREHEIREPKSUYIHMWM QYPEPEWIHHI(MSW]RSWHE

PEJEPWEWIKYVMHEHHILEFIV PPIKEHSEPEQIXEGYERHS VIEPQIRXILIQSWEFERHS REHSIPGEQMRSHIPEWMRGI VE]EVVMIWKEHEFWUYIHE TIVQERIRXIHI(MSW )PTETE*VERGMWGSRSW MRZMXEIRWYGEVXEHI'YE VIWQEEUYIµ4SVPE GIPIFVEGMzRHIPSWQMWXI VMSWUYIRSWHMIVSRRYIZE ZMHEPPIKYIQSWEWIVGSR TPIRMXYHLMNSWHI(MSWHI 4EWGYEIR4EWGYELEGME IPGYQTPMQMIRXSHIEUYI PPEWEPZEGMzRUYI]ELIQSW VIGMFMHSKVEGMEWEPQMWXI VMSTEWGYEPHI'VMWXS·4YIW LIQSWWMHSWEPZEHSWIRIW TIVER^E¸« 6Q )WXI QMWXIVMSHIWEPZEGMzRUYI ]ESFVEIRRSWSXVSWHYVER XIPEZMHEXIVVIRE)WYR TVSGIWSHMRjQMGSUYIMR GPY]IXEQFMqREPELMWXSVME ]EXSHEPEGVIEGMzR7ER 4EFPSPPIKEEHIGMVª0E GVIEGMzRI\TIGXERXIIWXj EKYEVHERHSPEQERMJIWXE GMzRHIPSWLMNSWHI(MSW«

6Q  0EGIPIFVEGMzRHIP8VMHYS 4EWGYEPHIPETEWMzRQYIV XI]VIWYVVIGGMzRHI'VMWXS GYPQIRHIPEySPMXVKMGS RSWPPEQEYRE]SXVEZI^E ZMZMVYRMXMRIVEVMSHITVITE VEGMzRGSRWGMIRXIWHIUYI WIVGSRJSVQIWE'VMWXS GJ 6Q IWYRHSRMRIWXM QEFPIHIPEQMWIVMGSVHMEHI (MSW

La creación está aguardando la manifestación de los hijos de Dios»(Rm 8,19). ISTOCK

7MIPLSQFVIZMZIGSQS LMNSHI(MSWWMZMZIGSQS TIVWSREVIHMQMHEUYIWI HINEKYMEVTSVIP)WTuVMXY 7ERXS GJ6Q ]WE FIVIGSRSGIV]TSRIVIR TVjGXMGEPEPI]HI(MSWGS QIR^ERHSTSVPEUYIIW

XjMRWGVMXEIRWYGSVE^zR ]IRPEREXYVEPI^EFIRIJM GMEXEQFMqREPEGVIEGMzR GSSTIVERHSIRWYVIHIR GMzR4SVIWXSPEGVIEGMzR ´HMGIWER4EFPS´HIWIE EVHMIRXIQIRXIUYIWIQE RMJMIWXIRPSWLMNSWHI(MSW

IWHIGMVUYIGYERXSWKS ^ERHIPEKVEGMEHIPQMWXIVMS TEWGYEPHI.IWWHMWJVYXIR TPIREQIRXIHIWYWJVYXSW HIWXMREHSWEEPGER^EVWY QEHYVEGMzRGSQTPIXEIRPE VIHIRGMzRHIPQMWQSGYIV TSLYQERS¶

Dedicar más tiempo a la lectura Emprendiendo desde la escuela 7ERXS(SQMRKS)P ZMR6SUYI&IPXVjRIWYRRM ySHIEySWHIIHEHUYI GYVWEIPWqTXMQSKVEHSIR IP0MGIS7IGYRHEVMS4YI FPS%VVMFEIR&SGEHI2M KYE0EEWMKREXYVEJEZSVMXE HI)PZMR6SUYI&IPXVjRIWIP IWTEySP6IGSRSGIUYIYRE HIWYWTVSJIWSVEWPSQSXMZz ETEVXMGMTEVIRYRGSRGYVWS HIPMXIVEXYVETSVUYIZIuE IRqPYREKVERTEWMzRTSV

PSWPMFVSWHMGIWIVYREWM HYSEWMWXIRXIEPEFMFPMSXIGE ]UYIPIHIHMGEETVS\MQE HEQIRXIQIHMELSVEEPHuE 0IVIGSQMIRHEEPSWRMySW UYIPIERQYGLSUYIIWGVM FERUYIHINIRPSWGIPYPEVIW ]UYIPIWHIHMUYIRXMIQTSE PEPIGXYVEµ)P7YIySHI6E JEIP¶IWYRPMFVSUYIqPIWGVM FMz]GSRIPUYIKERzIPWI KYRHSPYKEVIRIPGSRGYVWS HIPMXIVEXYVE 

7ERXS(SQMRKS2YI ZINzZIRIWIQTVIRHI HSVIWHIP0MGIS*VERGqW Equipo HI7ERXS(SQMRKSLER proyecto GVIEHSPEQMRMIQTVIWE Carbio 'EVFMSVERXIGSRIPJMRHI TEVXMGMTEVIRIPGSRGYVWS JVERGqWµ)QTVIRHIVTE VEETVIRHIV¶4EVEIWSPSW IWXYHMERXIWHIFIRGVIEV YREQMRMIQTVIWEUYI ZIRHEYRTVSHYGXSSWIV 4SVINIQTPSEPVIGYTIVEVIP XIVQMRIGSRXEQMRERHSIP ZMGMSGSRJSVQIEPEqXMGE EGIMXIIRPSWVIWXEYVERXIW QEV]PSXVERWJSVQEIRYRE HIPHIWEVVSPPSWSWXIRMFPI 'EVFMSVERXIIZMXEUYIWI JYIRXIHIIRIVKuE


5

SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

Culmina diplomado sobre Liderazgo Ã&#x2030;tico El poder de Jesús 7ERXS(SQMRKS'SRIP SFNIXMZSHITVSQSZIVPE JSVQEGMzRqXMGEHIPWIVZM HSVTFPMGSIP+VYTS7ER XS8SQjW1SVS]PE4SRXM JMGME9RMZIVWMHEH'EXzPMGE 1EHVI]1EIWXVE 4YGQQ  GSRGPY]IVSRIPHMTPSQEHS ·0MHIVE^KSfXMGSIRPE:MHE 4FPMGE¸ )PHMTPSQEHSWIMQTEVXMz IRIP'EQTYW7ERXS8SQjW HI%UYMRS '78% )PEG XSIWXYZSIRGEFI^EHSTSV

QSRWIySV6EQzR&IRMXSHI PE6SWE]'EVTMSEV^SFMWTS IQqVMXSHIPE%VUYMHMzGI WMWHI7ERXMEKS]TVIWMHIR XIHIP+VYTS7ERXS8SQjW 1SVS.SWq%VQERHS8EZj VI^VIGXSVHIP-RWXMXYXS8IG RSPzKMGSHIPEW%QqVMGEW

-80% ]HMVIGXSVHIP+VYTS 7ERXS8SQjW1SVS]0MHMS 'EHIXHMVIGXSV+IRIVEPHI fXMGEI-RXIKVMHEH+YFIVRE QIRXEP*YIVSRGIVXMJMGEHSW TVSJIWMSREPIW El grupo de participantes y autoridades. FOTO DE LA ENTIDAD.

resucitó a Lázaro

FuEVIWYGMXEHSHIIRXVIPSW QYIVXSW¶ 0SWNIJIWHIPSWNYHuSWXEQ FMqRUYIVuERIPMQMREVE 0j^EVSTSVUYILEFuERTIV JUAN F. PUELLO HERRERA HMHSTVSWqPMXSWTSVGVIIV Santo Domingo IR.IWW )WXSWITSRIHIVIPMIZI .YER IRRYIWXVEZMHEGYERHS IRGSRXVEQSWEUYMIRVI µRSWzPSJYIVSRTSV.I GLE^ERHSRYIWXVEJIIR WWWMRSXEQFMqRTEVE EGXMXYHZMSPIRXERSWVI ZIVE0j^EVSEPUYILE GLE^E

KAIRÃ&#x201C;S


6

SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

Bienal de Venecia Lidia León expondrá sus obras Ve necia. Vitrina internacional del arte contemporáneo acoge en su 58 edición de la Bienal de Arte una vibrante temporada enriquecida aún más con un firmamento de exposiciones en lugares ya atractivos en sí mismos.

ARTES

CLAVES Ficha. 8uXYPS8IZISQIZIS 0YKEV-KPIWMEHI7ER XE1EVuEHIPE4VIWIR XEGMzR 'MYHEH:IRIGME 'YVEHYVuE6SFIVXE 7IQIVEVSI-VMW 4I]REHS

REDACCIÓN L2

Santo Domingo

8IZISQIZIS¶ IWIPXuXYPSHIPE QYIWXVEHI0M HME0IzREVXMWXE HIPE6ITFPMGE (SQMRMGEREUYIWIPPIZEVj EGEFSIRPE-KPIWMEHI7ER XE1EVuEHIPE4VIWIRXEGMzR QINSVGSRSGMHEGSQSHIPEW >MXIPPIGSRGYVEHYVuEEGEV KSHI6SFIVXE7IQIVEVSI -VMW4I]REHS %XVEZqWHIWYEVXI0M HME0IzRVIJPI\MSREWSFVI XIQEWHIREXYVEPI^EWSGMEP ]I\MWXIRGMEPGSQSPEMRXS PIVERGME]PEGEVIRGMEGYP XYVEP7MVZMqRHSWIHIWY GVIEXMZMHEH]XVEFENSHIMR ZIWXMKEGMzRFYWGEJSQIRXEV YRTIRWEQMIRXSGVuXMGSIMR XIKVEHSVIRPEWRYIZEWKI RIVEGMSRIW 0EQYIWXVEIWYRESFVE QY]MRXIVEGXMZEYRGSRNYR XSEPIKzVMGSHIVIJIVIRGMEW LMWXzVMGEW]JMPSWzJMGEWUYI MRZMXEEPZMWMXERXIEZIVWIEWu QMWQSVIJPINEHSIRIPSXVS -RGPY]IEHIQjWGYEXVS SFVEWHIPEWIVMIµ;EFM7E FM¶MRWTMVEHEIRPETIVGIT GMzRIWXqXMGENETSRIWEEWu HIRSQMREHEUYIGIPIFVEPE FIPPI^EMRLIVIRXIEPEXVER WMXSVMIHEH]PEMQTIVJIG GMzRYRGSRGITXSXSQEHS HIPEVUYMXIGXS8EHES%RHS ]I\TPSVEHSIRIPXVEFENSHI 0MHME0IzR 4SVPSWZEPSVIWETS]EHSW IRPEWSFVEWGSRGITXYEPIW HIPEEVXMWXEPE%WSGMEGMzR GYPXYVEP637%1EGXMZE IRTVS]IGXSWHIWSWXIRMFM PMHEHVIPEGMSREHSWGSRPE GYPXYVEIRKIRIVEP]IRTEV XMGYPEVGSRPSWPIRKYENIWEV XuWXMGSWGSRXIQTSVjRISW VIGMFMzGSRIRXYWMEWQSPE MRZMXEGMzRESVKERM^EVPETVM QIVEI\TSWMGMzRIR)YVS TEHI0MHME0IzR0EI\TS WMGMzRXEQFMqRGYIRXEGSR IPETS]SHIPE*92(%'-Ñ2 0M0IzR]IPTEXVSGMRMSHIPE )QFENEHEHI-XEPMEIR7ERXS (SQMRKSGSRQSXMZSHIPE

Fecha. 7IVjMREYKYVEHEIP HIQE]SHIPTVIWIRXI EySLEWXEIPHIWIT XMIQFVIHIPSW GSVVMIRXIW Roberta Semeraro. µ4EVIGIUYIPEEVXMWXE WMIRXIYRHIFIVMRIPY HMFPILEGMEWYWSGMI HEHXVEXERHSHIHI ZSPZIVEPTFPMGSWYMR REXSXEPIRXSGVIEXMZS¶

Lidia León propone una mirada inteligente

Propuesta. ,E]IRWYSFVEYRHMW GYVWSqXMGSHIRXVSHI YRQYRHSHIMQjKI RIWMRXIRWEW

CORTESÍA LIDIA. LEÓN

DOS PIEZAS DE LA MUESTRA WzPSVIJPINERPEFIPPI^EHI WYXMIVVE]PEZMXEPMHEHHI WYKIRXIWMRSXEQFMqRPSW ZEPSVIWTVSJYRHSWHIIW XEIWTPqRHMHEGMZMPM^EGMzR GSQTYIWXETSVTIVWSREW UYIPPIKEVSREPTEuWEPS PEVKSHIPSWEySWHIXSHEW TEVXIWHIPQYRHS)PEV XIHI0MHME0IzRIWIPXIW XMQSRMSHIGzQSPEWIRWM FMPMHEHPEMRXIPMKIRGME]PE GVIEXMZMHEHWIIRGYIRXVER IRXVIPSWIPIQIRXSWMRRE XSWHIYRKVERRQIVSHI HSQMRMGERSW]RSRSWWSV TVIRHIUYIIWXITEuWIW XqIRKVERHIWEVVSPPSXEQ FMqRHIWHIIPTYRXSHI ZMWXEGYPXYVEP Palabras de Lidia León 1IWSVTVIRHMzJIPM^QIR “Muchas de mis propuestas promueven la inclusión social a través del juego, liberando tensiones, estimuXILEFIVIRGSRXVEHSIRPSW lando la imaginación. Invitar al público a relacionarse con mi trabajo, fomentando la necesidad social de EVXMWXEWHSQMRMGERSW]WS los seres humanos, promoviendo un espacio de respeto por nuestras diferencias. FVIXSHSIR0MHMEIWIWIRXM HSHIVIWTSRWEFMPMHEHWSGMEP UYIVIZMZIPEMHIEQMWQEHI GSQYRMHEHEHMJIVIRGMEHI GIPIFVEGMzRHIPSWEySW (MGI-VMW4I]REHSUYIµ ZMXEHEEI\TSRIVIR*PSVIR PE&MIREPMHIEUYITVSTYWI PEWXIRHIRGMEWMRHMZMHYEPMW HIPEWVIPEGMSRIWHMTPSQjXM )PZIVERSTEWEHSGIRXVqQM GME*YIEWuGSQSWYVKMzIR IRTEVXMGYPEVEPEGYVEHSVE XEWQjWHMJYRHMHEWIR)Y GEWIRXVI-XEPME]6ITFPMGE EXIRGMzRIRIPXVEFENSHI0M QMPEMHIEHISVKERM^EVYRE 6SFIVXE7IQIVEVS¶ VSTEIRIPEVXIGSRXIQTSVj (SQMRMGERE HME0IzRUYILEFuEWMHSMR I\TSWMGMzRIR:IRIGMETEVE µ0EWSFVEWHI0IzRRS RIS


SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

7

Amenazas

Lo que se necesita para enfrentar cibercrímenes Planificación. Para dar un servicio confiable y que pueda mitigar a los cibercriminales, hace falta una buena base de seguridad cibernética.

CONGRESO Santo Domingo

)PQYRHSIWXjMRQIVWSIR PEIVEHIPEMRJSVQEGMzR] PEWSVKERM^EGMSRIWTFPMGEW QMPMXEVIWMRHYWXVMEPIWGS QIVGMEPIW]LEWXEPEWWMRJM RIWHIPYGVSWIIRGYIRXVER EREPM^ERHSTVSGIWSWHIMR RSZEGMzR]XVERWJSVQEGMzR HMKMXEPTEVEEGIVGEVWIQjWE PERYIZEKIRIVEGMzRPSW1M PPIRMIEPW 4IVSTEVEHEVYRWIVZMGMS GSRJMEFPI]UYITYIHEQMXM KEVPEWEQIRE^EWHIPSWGM FIVGVMQMREPIWLEGIJEPXE YREFYIREFEWIHIWIKYVM HEHGMFIVRqXMGE )WXITPERXIEQMIRXSPSVI GYIVHEIPMRKIRMIVS4IHVS 'EWXMPPSUYMIREHIQjWEWI KYVEUYIEGXYEPQIRXI6IT FPMGE(SQMRMGEREIWXjIRIP GEQMRSHIQINSVEVPEGSQ TIXMXMZMHEHHIXSHEPERE GMzRGSRIPMQTPIQIRXSHI TVSKVEQEWHIVIHYGGMzRHI PEFVIGLEHMKMXEPQIHMERXI IPTVS]IGXS6ITFPMGE(MKM XEPUYITIVWMKYILEGIVUYI

Esta red está diseñada para hacer realidad la implementación del Internet de las Cosas al dar tiempos de respuesta más rápidos. ISTOCK

La innovación y ventajas para el usuario que trae el 5G TECNOLOGÍA Santo Domingo

Hacer frente a los crímenes cibernéticos no solo implica inversiones millonarias. ISTOCK

PSWGMYHEHERSW]IQTVIWEW WIERQjWGSQTIXMXMZSW] IJMGMIRXIW 4EVE'EWXMPPSLEGIVPIJVIR XIEPSWTVSFPIQEWHIGVu QIRIWGMFIVRqXMGSWRSWSPS MQTPMGEMRZIVWMSRIWQMPPS REVMEWIRIUYMTSWWMRSUYI WIXVEXEHITSPuXMGEWHIWI KYVMHEHHIETPMGEGMzRHI RSVQEW]IWXjRHEVIWMRXIV REGMSREPIWHITIVWSREPIW TIGMEPM^EHSHIWIRWMFMPM^E GMzR]GSRGMIRXM^EGMzREP YWYEVMS]GIVXMJMGEHSIRWI KYVMHEHHIPEMRJSVQEGMzR LEGOMRKqXMGSERjPMWMWMRJSV

CLAVES

Evento 8MIRIGSQSSFNIXMZSPPI ZEVETVIRHM^ENITVIWIR XEVRYIZEWIWXVEXIKMEW] GSRGMIRXM^EVWSFVIRYI ZEWQSHEPMHEHIWHIEXE UYIWGMFIVRqXMGSW

QjXMGSJSVIRWI]WSFVIXSHS IWTIGMEPMWXEWTIVMXSWJSVIR WIWMRJSVQjXMGSW )PI\TIVXSLM^SIWXEWHIGPE VEGMSRIWXVEWHEVPSWEHI PERXSWHIP8IVGIV'SRKVIWS HI-RJSVQjXMGE*SVIRWI]'M FIVWIKYVMHEHIR6ITFPMGE (SQMRMGERE -*' E GIPIFVEVWIHIPEPHI QE]SHIPEySIRGYVWSIR 4YRXE'ERETVSZMRGME0E %PXEKVEGME]HSRHIWIXVEXE VjWSFVIPEWRYIZEWXIRHIR GMEWHIEXEUYIWGMFIVRqXMGSW ]PEWVIGSQIRHEGMSRIWHI I\TIVXSWTEVEIRJVIRXEVPSW

0EPPIKEHEHIPEXIGRSPS KuE+QINSVEVjPEZIPS GMHEH]TIVQMXMVjGVIEV YRIGSWMWXIQEGSQTPIXE QIRXIMRXIVGSRIGXEHSHI JSVQEMREPjQFVMGETEVE QMPIWHIQMPPSRIWHITIV WSREWEPVIHIHSVHIPQYR HSEWuPSI\TPMGEIPI\TIV XSIRIPXIQE,IPQYXL 'ITIHE 7IyEPEUYIIWXEVIHIWXjHM WIyEHETEVELEGIVVIEPMHEH PEMQTPIQIRXEGMzRHIP-R XIVRIXHIPEW'SWEWEPHEV XMIQTSWHIVIWTYIWXEQjW VjTMHSW7SVTVIRHIVjTSV IPEYQIRXSIRPEZIPSGMHEH HIPSWHEXSW]IJMGMIRGMETE VEPSWYWYEVMSW 0EWEVUYMXIGXYVEWTEVEVI HIWHIUYMRXEKIRIVEGMzR ZMIRIRHIJMRMHEWTSVYREP XSTSVGIRXENIHIWSJX[EVI EHMJIVIRGMEHISXVEWVIHIW

QzZMPIWPSGYEPPEGSRZMIVXI IRYREVIHQjWMRXIPMKIRXI JPI\MFPI]IWGEPEFPI0EXIG RSPSKuEHI2*: 2IX[SVO *YRGXMSR:MVXYEPM^EXMSR  XMIRIWYSVMKIRIRGzHMKS EFMIVXSIPGYEPFVMRHEXqG RMGEWHIGSQTVIRWMzRIJM GMIRXIW]RIGIWEVMEWIRYR QYRHSHSRHIIWXEVjRGS RIGXEHSWEPVIHIHSVHI XVMPPSRIWHIHMWTSWMXMZSW µ0EXIGRSPSKuEHIGzHMKS EFMIVXSIWIPQSHIPSRE XYVEPHIMRRSZEGMzR]HMW VYTGMzRIRWSJX[EVIIWXI TYIHITVSZIIVPEXEWEHI IZSPYGMzRRIGIWEVMETE VEEGSQTEyEVIPHIWEVVS PPSHIPE8VERWJSVQEGMzR (MKMXEP,E]ZEVMEWXIGRS PSKuEWUYIWSRQY]WMKRM JMGEXMZEWHIRXVSHIIWXEW +IIP-RXIVRIXHIPEW'S WEW -S8 WSRPEWRYIZEW MRWXERGMEWHIETVSZIGLE QMIRXSHIPEIZSPYGMzR HIPEXIGRSPSKuE¶EWIKYVE 'ITIHEUYMIRIWHMVIGXSV VIKMSREPHI6IH,EXTEVE PEVIKMzR%RHMRE'IRXVS %QqVMGE]'EVMFI


8

SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

1 Gabriel y Olga Tañón compartieron “Cómo no amarte”.

A los 16 años inicia en los medios junto al primer equipo del programa “Los dueños del circo”, trabajo que inmediatamente abandonó por no dominar en ese entonces el idioma español.

Gabriel

El merengue de las 10 millones de visitas MÚSICA Santo Domingo

)PXIQEµ'zQSRSEQEVXI¶E HSIRXVI+EFVMIP]µPEQYNIV HIJYIKS¶3PKE8EyzRVITVI WIRXEIPQjWMQTSVXERXIq\MXS HIPQIVIRKYIIRPSWPXMQSW EySWIRIPGEREP=SY8YFIEP VIKMWXVEVQjWHIQMPPSRIW HIZMWYEPM^EGMSRIWIRQIRSW HIHSWQIWIWHIIWXVIRS 'SRIWXEGERGMzRIPEVXMWXE HSQMRMGERSRSWSPSLEGEY XMZEHSEPTFPMGSIRPEWTPE XEJSVQEWHMKMXEPIWWMRSXEQ FMqREXVEZqWHIPEVEHMS(I EGYIVHSEPSWVITSVXIWHITS TYPEVMHEHHI1SRMXSV0EXM RSIWXIWIRGMPPSSGYTEIPTVM QIVPYKEVHIPEPMWXEKIRIVEP HIq\MXSWIR6ITFPMGE(SQM RMGERE]HISXVSWTEuWIWPEXM RSEQIVMGERSW µ'ERXEVNYRXSEYREJMKY VEHIPEIWXEXYVEHI3PKE8E

yzRIWYRKVERTVMZMPIKMS TEVEQuTSVUYIRSWSPSIW YREEVXMWXEUYILETYIWXS EFVMPPEVIPQIVIRKYIHY VERXIXSHEWYXVE]IGXS VMEWMRSXEQFMqRUYIIW YRKVERWIVLYQERSUYI PIEFVIPEWTYIVXEWEPEW RYIZEWKIRIVEGMSRIWHI PEQWMGE¶I\TVIWzIPMR XqVTVIXIHIµ'SPIKMEPE¶ EHSGSR%PI\&YIRSµ% XERWSPSYRELSVE¶]µ'S QSXIWYIyS=S¶ µ'zQSRSEQEVXI¶TVS HYGMHETSV%PI\ERHIV'EW XMPPS %' ]+EFVMIPJY WMSREPSWVMXQSWXuTMGSW HSQMRMGERSWGSRPSWWSRM HSWHILS]]GYIRXEGSR YRZMHISGPMTJMPQEHSIR 0E,EFERE +EFVMIPGSQTMXIIRIP ETEVXEHSµ1INSVEVXMWXE RSVXI¶µ1INSVEVXMWXEXVS TMGEP¶]µ1INSVZMHIS¶IR PETVz\MQEIHMGMzRHIPSW 4VIQMSW,IEXUYIWIVIE PM^EVjIR4YRXE'EREIRIP QIWHIQE]S

Un homenaje para tres grandes cantautores SHOW Santo Domingo

0SWGERXEYXSVIWGYFERSW %QEYV]4qVI^0MYFE1EVuE ,IZME]IPKVYTS&YIRE*I ZMIRIRE6ITFPMGE(SQMRM GERETEVEYRGSRGMIVXSXVM FYXSE.SER1ERYIP7IVVEX .SEUYuR7EFMRE]7MPZMS6S HVuKYI^ µ0EW7¶WIPPEQEIWXIIR GYIRXVSTEVEFSLIQMSWXVS ZEHSVIW]EQERXIWHIPEGER GMzRHIEYXSVEVIEPM^EVWIIP WjFEHSHIQE]SIRPEWE

PETVMRGMTEPHIP8IEXVS2E GMSREPFENSPETVSHYGGMzR &MK7XEV %QEYV]4qVI^0MYFE 1EVuE,IZME]&YIRE*I HEVjRZMHEEPEWPIXVEW]PEW QIPSHuEWQjWIQFPIQjXM GEW]WMKRMJMGEXMZEWHIIWXSW EVXMWXEWUYIIRIPGSVVIV HIPXMIQTSWILERGSRZIV XMHSIRTEXVMQSRMSHIPEV XIQYRHMEP 0EHMVIGGMzRQYWMGEP] TVSHYGGMzREVXuWXMGEIW XEVjEGEVKSHIPQEIWXVS %QEYV]7jRGLI^GSRIP EGSQTEyEQMIRXSHIYRE FERHEHIPYNSMRXIKVEHE TSVI\TIVMQIRXEHSWQWM GSW

Comunicadora. “Sé lo que es dormir en el suelo y lo que es no tener para comprar un pan, pero también disfrutamos de la solidaridad de nuestros vecinos dominicanos”, afirma ella.

Ivana Gavrilović

La serbia marcada por la guerra y la dominicanidad


9

SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

2

Ha pasado por momentos difíciles como la muerte de su padre, luego la guerra de su país y enfrentar una operación de vida o muerte que le realizaron a su madre.

VIDA YNMACULADA CRUZ HIERRO ynmaculada.cruz@listindiario.com

Santo Domingo

)

PYPYPEVHIPEWM VIREIPGSVVIV ]HINEVPSXSHS TEVEIWGSRHIV WIIRYRVIJY KMS=EEPPuGIVVEVPSWSNSW ]EFVE^EVWIYRSEPSXVS IWGYGLEVPSWFSQFEVHISW PEWI\TPSWMSRIW]PSWKVM XSWHIPSWGMIRXSWHITIVWS REWEJIGXEHEW]XIRIVUYI ZIVEHIGIREWHIQYIVXSW IVEIPTERSVEQEUYIHuEE HuEZMZuEPETIUYIyE-ZERE +EZVMPSZMĀ]WYJEQMPMEIR PETEVXIHI7IVFME 'SVVuEIPMRMGMSHIPEHq GEHEHIPSW]IR)YVSTE WIIWGIRMJMGEFERµPEWKYI VVEW]YKSWPEZEW¶YREWIVMI HIGSRJPMGXSWIRIPXIVVMXS VMSHIPEERXMKYE=YKSWPE ZMEUYIWIWYGIHMIVSRIRXVI ]]UYIEJIGXE VSREPEWWIMWI\VITFPMGEW ]YKSWPEZEWTVMRGMTEPQIR XIIRXVIPSWWIVFMSWTSVYR PEHS]PSWGVSEXEWFSWRMSW ]EPFERIWIWTSVSXVS )WEZMHEQjWPSUYI EXVEZIWzHIWTYqWGYER HSPPIKzGSQSVIJYKMEHEE 6ITFPMGE(SQMRMGEREIW PSUYIQYIZIEPELS]GS QYRMGEHSVE]WMGzPSKEGPu RMGEERSHIXIRIVWI]WEFIV UYIGEHESTSVXYRMHEHTEVE

XVEFENEVIWYRERYIZEI\TI VMIRGMEUYIEYQIRXEVjWYW GSRSGMQMIRXSW]UYIPPIREVj HIMQTSVXERXIWQSQIRXSW WYI\MWXIRGME 4SVIWSHIWTYqWHIXVE FENEVTSVQjWHIEySW IRPSWQIHMSWHIGSQYRMGE GMzRWIVHYIyEHIWYTVSTMS TVSKVEQEHIVEHMS 3QIPIX 6EHMS ]PPIZEVEPETERXEPPE TVSKVEQEWHIXIQTSVEHEW LEGIVYRWIKQIRXSTEVEµ)P 7LS[HIP1IHMSHuE¶PSW ZMIVRIWRSIWQjWUYIHMW JVYXEVHIWYXVEFENS]XIRIV PEGSRGMIRGME]PEVIWTSRWE FMPMHEHHIZIPEVTSVWYWWI VIWUYIVMHSW -ZEREPPIKzE6ITFPMGE (SQMRMGEREGSRETIREW EySWNYRXSEWYQEHVI]WY LIVQERSHIEySWµ%IWE GSVXEIHEHHIWGYFVIWUYIPE ZMHEIWMQTVIHIGMFPIUYI RSXMIRIWREHETSVUYIGYER HSWYIREPEWMVIRE]XMIRIW UYIGSVVIVEIWGSRHIVXITSV UYIYREFSQFEZEGE]IR HSEPPEHSXY]S]IRXMIRHIW UYIPSRMGSUYIXMIRIWIWIP UYIIWXjEPPEHSXY]SPSWZI GMRSWXYJEQMPME]IWGSRHM HEIRYRVIJYKMSIRXSRGIW ZIWUYIPEWTIVWSREWUYIIW XjRELuIWPSRMGSVIEPUYI XMIRIWIRIWIQSQIRXS¶VI GYIVHEPENSZIRUYILS]XMI RIEySW %PTEuWEVVMFzGSQSVI JYKMEHEEPIRXEHETSVSXVSW GSQTEXVMSXEWUYIXEQFMqR LEFuERPPIKEHSGSVVMIRHS HIPGSRJPMGXS'SRWYJEQMPME ZMZMzIRIP1MVEHSV2SVXIHI PEGETMXEP

6IGYIVHEUYIJYIVSRQS QIRXSWHIKVERHIWTIRY VMEWHIWHITEWEVLEQFVI LEWXEHSVQMVIRGEVXSRIW µ)PLEQFVIIWPSUYIQI LEQSZMHSHIWHIUYIPPIKYq EIWXITEuW=SWqPSUYIIW HSVQMVIRIPWYIPS]PSUYI IWRSXIRIVTEVEGSQTVEV YRTERTIVSXEQFMqRHMW JVYXEQSWHIPEWSPMHEVMHEH HIRYIWXVSWZIGMRSWHSQMRM GERSWUYIXIPPIZIRYRTPE XSHIGSQMHETSVUYIXRS XMIRIWREHETEVEGSQIVWSR HIPEWGSWEWQEVEZMPPSWEW UYIQILERTEWEHSIRIWXI TEuW¶GYIRXE-ZEREGSRFVM PPSIRPSWSNSW %WuZEVIZIPERHS-ZEREPEW TIVMTIGMEWUYITEWzIRPSW TVMQIVSWHuEWUYIPPIKzEP TEuWWMRSPZMHEVPEWSPMHEVM HEHHIPEKIRXIGSQSGYER HSRSXIRuETEVETEKEVIP WIVZMGMSHIIRIVKuEIPqGXVMGE ]YREZIGMREPITIVQMXuEGS RIGXEVYREI\XIRWMzRTEVE WYRIZIVESGSQSGYERHS WYLIVQERSXYZSYREGEu HE]YREQYNIVPISJVIGMzIP RMGSHMRIVSUYIXIRuETEVE UYIqPTYHMIVEWIVEXIRHMHS IRYREGPuRMGE µ)WEIWPEVIEPMHEHUYILI ZMZMHS]GSRPEUYILIETVIR HMHSIRPEZMHEEWuGSQS TYIHSXIRIVPSXSHS]QE yERERSXIRIVREHETSVIWS HIFSGSRWIVZEVIPGSVENITE VEWIKYMVPYGLERHS]XVEFE NERHS]EQMWEySWHIFS HIHEVPEGEVETSVQMJEQM PMEEWuUYIRSTYIHSHEVQI IPPYNSHIPPSVEVRMHIHIXI RIVQI¶GSQIRXEIRWYZMWM

XEE0-78Í2(-%6-3)WTSV IWSUYIHMGIUYIREHEHIPS UYIHMKERSLEKERWMIQTVI ]GYERHSRSEJIGXIRWYWZE PSVIWPETYIHIRHSFPIKEVS QMRMQM^EV µ7MIRHSEHSPIWGIRXITE WqLEQFVI]RSQIUYMIVS RMMQEKMREVPSUYIJYITEVE QMQEHVIYREQYNIVHI EySWPPIKEVEYRTEuWWMRLE FPEVREHEHIIWTEySP]ZIVE WYWHSWLMNSWTEWERHSXERXS XVEFENSHIFMzHIWIVQY] HYVSTEVEIPPE¶I\TVIWE ¿Te hace una persona diferente haber vivido la guerra?

µ8IQEVGEGMIRXSTSVGMIR XS8IQEVGETSVUYITMIVHIW EWIVIWUYIVMHSWTSVUYIXY ZMHEGEQFMEIRYRWIKYRHS 2SIWRSVQEPUYIYRTVIE HSPIWGIRXIZMZEIRPSWIW GSQFVSWUYIWYHuEEHuEIW XIRIVUYIIWGSRHIVWILEGIV PEVKEWJMPEWTEVEGSQTVEVEP KSHIEPMQIRXSTSVUYIPEZM HEHIXYTEuWIWGSQTPMGEHE ]PYIKSIQMKVEVEYRTEuW UYIRSGSRSGIW]XEQFMqR TEWEVLEQFVI4IVSWMIQ TVIHMVqUYIPSQYGLSSPS TSGSUYILIQSWPSKVEHSIW KVEGMEWEPSWHSQMRMGERSW¶ WSWXMIRI 4SVIWS-ZEREEGPEVEUYI TSVPEFSVEVIRPSWQIHMSW HIGSQYRMGEGMzRWYSFNIXM ZSRYRGELEWMHSFVMPPEVRM QYGLSQIRSWPEJEQEQjW FMIRJYIIPRMGLSIRHSRHI IRGSRXVzPESTSVXYRMHEH TEVEXVEFENEVµ0SUYIEQu QIQYIZIRSIWPERIGIWM

3

“Siempre estaremos agradecidos de los dominicanos, que una de sus grandes maravillas de este pueblo es la solidaridad con los más necesitados”. CORTESÍA.

HEHHIFVMPPEVRSIWPERIGI WMHEHHIYREGEVXIVESYRSW ^ETEXSWIWPERIGIWMHEHHI QERXIRIVQMLSKEVHIZI PEVTSVQMLIVQERSUYIIW XYHMEJYIVE]TSVQMQEHVI UYIRSPIJEPXIREHE¶ 0EEHETXEGMzRHIPEJE QMPMEIRIPTEuWXEQTSGS JYIJjGMP0EWGSQSHMHEHIW PPIKEVSRPYIKSUYIPEQE HVIPSKVEVEYRFYIRXVEFE NS]IPPSWTYHMIVSRIWXYHMEV IRGSPIKMSWTVMZEHSW%QI HMHEUYITEWEVSRPSWEySW EQFSWGLMGSWXIVQMREVSR IPFEGLMPPIVEXS]JYIVSRE PEYRMZIVWMHEHµ*YIHMJuGMP EHETXEVQIIRYRTVMRGMTMS IRQMTEuWIWXYHMEFEXIEXVS FEPPIX]ZMSPuR]IPWMWXIQE HIIWXYHMSHIEUYuIVEQY] HMWXMRXS%TVIRHuELEFPEV IWTEySPZMIRHSWIVMIW]XI PIRSZIPEW¶WIVuIEPVIGSV HEVPS (IWHIQY]NSZIRGSQIR ^zIRPSWQIHMSWHIGSQY RMGEGMzRTVMQIVSGSRµ0SW HYIySWHIPGMVGS¶PEFSVUYI EFERHSRzTSVUYIERRS HSQMREFEFMIRIPIWTEySP 0YIKSTEWzTSVPEVEHMS] IQTVIRHMzWYTVS]IGXSVE HMEPµ3QIPIX6EHMS¶IPGYEP XVERWMXzTSVZEVMEWIWXEGMS RIWHIVEHMS 'SRGPYMHEIWXEIXETE WIIQFEVGzNYRXSE7EVSHN &IVXMRIRIPVIEPMX]WLS[ µ&PERGEQSVIRE¶TSV'SPSV :MWMzR 4EVENYRMSXMIRIPMWXSSXVS IWTEGMSHIXIQTSVEHEIP GYEPPPIZEVjPEZMHE]PELMW XSVMEHIGIPIFVMHEHIW

SHOW DEL MEDIODÍA Un segmento. 'EHEZMIVRIW-ZERE +EZVMPSZMĀTVIWIRXEYR WIKQIRXSIRHSRHIPPI ZEEPTFPMGSGIPIFVMHE HIWHIPIWTIGXjGYPSRE GMSREPIMRXIVREGMSREP IRHSRHILEFVjNYIKS ]HMZIVWMzR)RXVIZMWXE QY]EPIWXMPSEPEµXIPI VIEPMHEH¶HIP7LS[HIP 1IHMSHuE Agradecida. µ0EKIRXIHMVjUYIPYIKS HILEFIVXIRMHSYRTVS KVEQEHIVEHMSHYVER XIHMI^EySW]LEFIVTVS HYGMHSQMWTVSKVEQEW HIXIPIZMWMzRHIXIQTS VEHELEGIVYRWIKQIR XSIWRSEZER^EVTEVEQu GEHESTSVXYRMHEHIWMQ TSVXERXITSVUYIEQS QMXVEFENS]XIRKSLEQ FVIHIWIKYMVGVIGMIRHS ]RYXVMqRHSQIGSRGEHE I\TIVMIRGME¶ Cónsul honorario. %GXYEPQIRXI-ZEREIW GzRWYPLSRSVEVMSHI7IV FME'SRIWXEJYRGMzRPE GSQYRMGEHSVEXVEFENE IRTVS]IGXSWXYVuWXMGSW HITVSQSGMzRIMRXIV GEQFMSWGYPXYVEPIW]GS STIEGMzRIGSRzQMGETE VEEQFEWREGMSRIW )RIPQIWHIQE]SIWXE VjZMWMXERHSWYTEuWNYR XSEPGERGMPPIVHSQMRMGE RS1MKYIP:EVKEW


10

SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

Canal 19

TELEVISIÓN

Espacio “Sandra Presenta” se fortalece en TV En pantalla. Los nuevos integrantes son el compositor Manuel Morais, la merenguera Belkis Concepción y la cantante Natalia Joa.

Santo Domingo

&ENSIPQEVGSHIPPER^E QMIRXSHIPIWTEGMSXIPIZMWM ZSµ7ERHVE4VIWIRXE¶JYI VSRTVIWIRXEHSWPSWRYIZSW MRXIKVERXIWIPGSQTSWMXSV 1ERYIP1SVEMWPETMSRIVE IRSVUYIWXEJIQIRMREW&IP OMW'SRGITGMzR]PEGERXER XI2EXEPME.SE )PRYIZSIWTEGMSXIPIZMWM ZSWIXVERWQMXITSVIPGEREP EPEWHIPEXEVHI )WXITVSKVEQEMHIEHI 7ERHVE'EWXMPPSIWTVSHY GMHSTSVIWXSWXVIWEVXMWXEW ]GSQYRMGEHSVIWTEVETVI WIRXEVYRETVSTYIWXEUYI QERXIRKEEPXIPIZMHIRXI GSREPKSHMJIVIRXI 0EWMRJSVQEGMSRIWEGXYE PM^EHEWYR:-4TSPuXMGSWS GMEP]EVXuWXMGSTVSHYGMHS TSV7ERHVE1ERYIP]&IPOMW PPIZEVjRQYGLEWIQSGMS

RIWEPSWXIPIZMHIRXIWEJMV QEIPPE )RIWXERYIZEIXETE1E RYIP1SVEMW]&IPOMW'SR GITGMzRTVSHYGMVjRIPWIK QIRXSµ9RHuEGSRXMKS¶ HSRHIWITVIWIRXEVjUYq LEGIYREVXMWXEHIWHIUYIWI PIZERXELEWXEUYIWIEGYIW XEMRGPY]IRHSGzQSHYIV QIWYWGSWXYQFVIW]LSF FMIW )RIPTVMQIVTVSKVEQE WIQSWXVEVSRPEWTVIQMEGMS RIWIR'SPSQFMEHIPETMS RIVEHIPQIVIRKYIHSRHI JYIFMIREGSKMHETSVWYPEV KELMWXSVMEHIq\MXSW]XIQEW GSRSGMHSW 1ERYIP1SVEMWEYXSVHI QjWHIGERGMSRIWUYI MRXIVTVIXEIPEVXMWXE6SFIV XS'EVPSWVIGMFMzHMWXMRGMzR HIRXVSHIPQEVGSHIPSWTVI QMSW7EGVS%UEVHWIR1ME QMHSRHIPEVIZIPEGMzRHIP EySFEMPEVMREHIP&EPPIX*SP GPzVMGSHI8YVMWQS2EXEPME .SEVIWYPXzKEREHSVEHIP TVIQMSGSRPEGERGMzR0SGE TSVXM

Super Semana Santa llega a la versión 32 RADIO Santo Domingo

0EGEHIREVEHMEP7TIV7I QERE7ERXEGIPIFVEIWXI EySWYZIVWMzRRQIVS GSRTIVMSHMWXEWGYFVMIR HSGEHEVMRGzRHIPTEuWHIW HIIPTVz\MQS.YIZIW7ERXS

EPEWHIPEQEyERELEW XEIP(SQMRKSHI6IWYVVIG GMzREPEWHIPERSGLI 6SFIVXS6SHVuKYI^HM VIGXSVKIRIVEPHIP+VYTS 1IHVERS]GSRHYGXSVHI 777HMNSUYIGSQSGEHE EySPENSVREHEHILSVEW HIMRJSVQEGMzRGSRXMRYE MRGPY]IGSRWINSWHII\TIV XSWRSXMGMEWQqHMGEWERqG HSXEWGSFIVXYVEHIWHIPEW TVMRGMTEPIWMKPIWMEWQSRXE

yEWFEPRIEVMSWLSWTMXEPIW] ZI6EHMS,MWTERMS TIENIW PE6EHMS2SVXI] 6EHMS,MX)R0E:IKE Equipo 'EREP7YTIV/ 8EQFMqRGSRPEGSRHYGGMzR 6EHMS0E:IKE]6EHMS HI%HHMW&YVKSW7TIV7I 3PuQTMGE QERE7ERXEPPIKEVj EXSHEWTEVXIWHIWHI7ERXS Más emisoras (SQMRKSTSV6MXQS 0EVIHHIIWXEGMSRIWHIP )WXVIPPE6EHMS'VMWXEP +VYTS1IHVERSµGSRXSHEW ]6EHMS1IXVS PEWRSXMGMEWIRXSHSQSQIR )R7ERXMEKSPEGEHIREPE XS¶PEGSQTPIXER8VqFSP MRXIKVER8YVFS7YE IR2EKYE8VSTMGERE

µ7SRXVIWTYRXSWUYIIW XEQSWXVEFENERHSIWXIXVuS YRMHSTSVPEWI\TIVMIRGMEW IRIPjQFMXSXIPIZMWMZS] QYWMGEP2SWSXVSWRSWYRM QSWIRYRTVS]IGXSUYIIR WYTVMQIVEIRXVIKEXMIRI GSQSGSPYQREZIVXIFVEPIP WIKQIRXS·9RHuEGSRXMKS¸¶ I\TPMGz'EWXMPPS (IWXEGzUYIWYQE]SV QSXMZEGMzRLEWMHSZIVPE HIKVEHEGMzRUYILE]LS] IRHuEIRPEXIPIZMWMzRHS QMRMGERE]PETqVHMHEHIPSW ZEPSVIW]HMKRMHEHHIEPKY RSWGSQYRMGEHSVIW µ0SUYIUYIVIQSWIWHI GMVUYIEGXYEPQIRXIPEXI PIZMWMzRRIGIWMXEHIRYI ZEWTVSHYGGMSRIWWILER MHSRYIWXVSWGSQTEyIVSW] GSQTEyIVEW]LIQSWSFWIV ZEHSIPIWTEGMSZEGuSUYIZE UYIHERHS¶EKVIKz 0EXIPIZMWMzRTEVEWIV EXVEGXMZEMRWMWXMzHIFIWIV VIZSPYGMSREVMEµ]QjWIRIW XSWXMIQTSWGYERHSIWXEQSW QMVERHSPEGSQTIXIRGMEGS QS2IXJPM\¶

Natalia Joa, Sandra Castillo, Manuel Morais y Belkis Concepción durante el anuncio de los nuevos cambios en el programa televisivo que se transmite por el canal 19.

IR1SRXIGVMWXM8VS TMGEPuWMQEIR.EVE FEGSE1EVEZMPPSWEIR &EVELSRE]0E*1IR 0EW1EXEWHI*EVJjR µ(YVERXIPSWGYEXVSHuEW HI7TIV7IQERE7ERXEIW XEVIQSWWYFMIRHSZMHISWHI PSWPYKEVIWQjWIWTIGXEGYPE VIWHIPTEuWIRPEWVIHIWWS GMEPIWHI+VYTS1IHVERS -RWXEKVEQ$WYTIVWIQERE WERXE8[IIXIV$WYTIVWIQE RE]*EGIFSSO$WYTIVWIQE REWERXE¶MRHMGz6SHVuKYI^ IRYRGSQYRMGEHS  Roberto Rodríguez


SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

Aníbal Bravo “Ya me liberé”, un nuevo merengue MÚSICA Santo Domingo

%RuFEP&VEZSERHEHIIWXVI RS)PZIXIVERSQIVIRKYIVS PER^zWYRYIZSWIRGMPPSµ=E QIPMFIVq¶ 'SQTYIWXS]QYWMGEPM ^EHSTSVIPTVSTMSMRXqV TVIXIIPXIQEWIGIRXVEIR YRELMWXSVMEHIMRJMHIPMHEH UYIIWXjLIGLSGSRPSWGz HMKSWHILS] µ=EQIPMFIVq¶JSVQEVj TEVXIHIWYTVz\MQETVS HYGGMzRHMWGSKVjJMGEPEUYI WIGSRZIVXMVjIRPERQIVS HIWYGEVVIVE µ)WYRGSVXIREGMSREPI MRXIVREGMSREP]PEWPIXVEW WSRGSXMHMEREW6IJPINERPEW GSWEWUYITEWERIRXVIPEW TEVINEW¶EWIKYVE&VEZS =µ=EQIPMFIVq¶GYIR XEGSRIPWSTSVXIHIYRZM

Aníbal Bravo presentó: “Ya me liberé”. ARCHIVO

HISGPMTUYIJYIHMVMKMHSTSV 4EFPS+VIIR %RuFEP&VEZSWIHIGPEVE IRXYWMEWQEHSHIPERYIZE IXETEUYIMRMGMEETEVXMVHI IWXIQSQIRXSHIPEQERS HIPEIQTVIWE'SVRMIPPI  'SVRMIPPI-RXIVREXMSREP1Y WMG]UYIXIRHVjYRSHIWYW QSQIRXSWGYQFVIWGYER HSQjWEHIPERXITVIWIRXI YRIWTIGXjGYPSTSVXSHSPS EPXS

11


12

SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

Luis Cepeda durante la dirección de “Colours”, que se exhibirá a partir del 23 de mayo en los cines dominicanos, luego de presentarse en el Festival de Cine Global Dominicano.

Nuevo color en el cine de RD “Colours” es la ópera prima de Luis Cepeda Elenco. La película, que se estrenará el 23 de mayo en los cines del país, es protagonizada por Stephany Liriano, Christian Álvarez y Francis Cruz.

PERFIL

CINE GABRIELA HUNGRÍA

Santo Domingo

L

ETIPuGYPEHSQM RMGEREµ'SPS YVW¶IWXjMRWTM VEHEIRPEqTSGE HI TSVHSWVE^SRIWI\TPMGzWY HMVIGXSV0YMW'ITIHE)R IWEqTSGEIVEQY]HMJuGMPWE PMVHIYRTYIFPSTEVEMVWIE PEGETMXEP]IWIIWIPTVMQIV SFWXjGYPSHIPTIVWSRENIIR PELMWXSVME=PESXVEVE^zRIW IPVSQERXMGMWQSHIPEqTS GE µ=SUYIVuEUYIGSRIWXE TIPuGYPEPEKIRXIWIGSRGIR XVEVEIRPELMWXSVMEGSQS ETVIRHuHIÊRKIP1YyM^ UYIPSMQTSVXERXIIRYRE TIPuGYPEIWPELMWXSVME]TSV PSXERXSQIIRJSUYqIRUYI GEHEHIXEPPIIRPE^EVE]XIV QMREVEIRYREFYIRELMWXS VME¶QERMJIWXz'ITIHEIR ZMWMXEE0MWXuR(MEVMS 0YIKSEKVIKzµ7MQI TVIKYRXEVEWGYjPJYIIPSFW XjGYPSQjWHMJuGMPUYIWIIR GSRXVzTEVELEGIVIWXITVS ]IGXSXIHMVuEUYIGSRWIKYMV

Luis Cepeda

Cineasta dominicano

Experiencia en lo audiovisual 0YMW'ITIHEXMIRI EySWIRIPQYRHSEY HMSZMWYEPGSRGSQIV GMEPIW]TVS]IGXSWXIPI ZMWMZSW

ETS]STEVEYRETIPuGYPEHI KqRIVSHVEQE]EUYIIWXE QSWERXIYREMRHYWXVMEGVI GMIRXIHIPGMRI1MIRXVEW PEQE]SVWEXMWJEGGMzRJYIPE IRXVIKEHIXSHSIPGVI[HY VERXIIPVSHENI¶ Proceso

'ITIHEHIGMHMzIGLEVIP TPIMXSIRWYTEuWGSRWYzTI VETVMQETVSXEKSRM^EHETSV 7XITLER]0MVMERS'LVMWXMER ÊPZEVI^]*VERGMW'VY^IR XVISXVSW

)PHMVIGXSVHSQMRMGERS IWXVIRzµ'SPSYVW¶IPTEWEHS HIIRIVSIRPEGSQTI XIRGMEÑTIVE4VMQE*MGGMzR HIP*IWXMZEPHI'MRI+PSFEP (SQMRMGERS *'+( =]E IWXjPMWXETEVEI\LMFMVWIEP KVERTFPMGS 0ETIPuGYPEPPIKEVjEPSW GMRIWHSQMRMGERSWIPTVz\M QSHIQE]S (YVERXIIPJIWXMZEP+PSFEP XYZSYREEGSKMHEUYIHINzE 'ITIHEEPFSVS^EHS µ0EKIRXITIHuEQjW]WI PPIKzETVS]IGXEVGMRGSZI GIWIRYREWEPEHIETVS\M QEHEQIRXITIVWSREW HSRHIIRXVEFERQjW]PPI REFERPSWTEWMPPSW¶ 9REWQMPTIVWSREWLER HMWJVYXEHSIPJMPQIUYIGSR XzGSRIPETS]SEPTSV GMIRXSHIPE0I]HI'MRI )PHIWISHIIWXVIREVPEIR IWXIJIWXMZEPWYVKITSVUYI VIVHEVPIPSQINSVEWYTEuW TVMQIVSERXIWHIPPIZEVPEE XMIVVEI\XVERNIVEWEYRUYI IWXjIRTPERIWTEVEJIWXMZE PIWIRPSEHIPERXIHIWTYqW HIPIWXVIRSIRGMRIW )PJMPQIIWHIJMGGMzR EYRUYIXMIRIEWTIGXSWHIPE ZMHEHIPHMVIGXSVGSQSWYW ZEPSVIW]PEJSVQEHIGVMER ^E]WYVIPEGMzRHITEVINE µ1YGLSHIIWSWIVIJPINEIR PETIPuGYPE¶HMNS


SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

Kiara Franco lanzó el tema “Adiós amor”. ARCHIVO

Kiara Franco “Adiós amor” en tiempo romántico CANCIÓN Santo Domingo

0EGERXERXIHSQMRMGERE /MEVE*VERGSZYIPZIEGSPS GEVWYZS^VSQjRXMGEIRYR RYIZSXIQEµ%HMzWEQSV¶ SVMKMREPHIPGSQTSWMXSV QI\MGERS'VMWXMER2SHEP µ%HMzWEQSV¶IWYREFEPE HETSTHIGSVXIWIRXMQIRXEP GSREVVIKPSWHI%FVELEQ

1EVXI]TVSHYGMHETSVIP MRXqVTVIXI4EZIP2yI^ 0EGERGMzRJYIPER^EHE LEGIYREWWIQEREWIRPEW TPEXEJSVQEWHMKMXEPIW]PE GYEPIPTFPMGSLELIGLS WY]EHIWHIWYIWXVIRS ,EGITSGS/MEVEJYI GSRXVETEVXIIRIPGSRGMIV XSUYIVIEPM^z/ERR]+EV GuEIRIPTEuW)WERSGLI LM^SUYIIPTFPMGSZMFVE VEHIIQSGMzR(IMKYEP QSHSLM^SGSRIPKVYTS 'EQMPEHIPUYIXEQFMqR JYIERJMXVMSRE

13


14

SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

CARTELERA Sala 3. Parque mágico lun-vie, 5:00,7:00/sab-dom, 3:00,5:00,7:00 s/r

PALACIO DEL CINE (ÁGORA MALL) Sala 1. Shazam V 7:00, 9:45 (s/ma 4:10, 7:00, 9:45)

Sala 3. Nosotros lun-dom, 9:00 r/18

Sala 2. Wonder Park V 6:30 (s/ma 5:00, 7:00)

Sala 4. Como flechas spa lun-dom, 3:45,6:00 s/r

Sala 2. Capitana Marvel V 8:20 (s/ma 9:00)

Sala 4. Cementerio maldito lunmie, 8:15/ jue-sab, 8:15,10:30/dom, 8:15 r/18

Sala 4. Buscando al Zorro V 7:20 (s/ma 5:00) Sala 4. Captive State V 9:20 (s/ma 6:45) Sala 4. The aftermath (s/ma 9:00) Sala 5. Dumbo V 6:45 (s/ma 4:45, 7:10) Sala 5. Expreso V 9:10 (s/ma 9:35) Sala 6. Breakthrough V 7:15, 9:45 (s/ma 4:45, 7:15, 9:45) Sala 7. Como entrenar a tu dragón (s/ma 4:00) Sala 7. Capitana Marvel V 6:00 (s/ma 6:20) Sala 7. Shazam V 8:30 (s/ma 9:00) PALACIO DEL CINE (SAMBIL) Sala 1. Shazam j/v 7:00, 9:45 (S/ma 4:15, 7:00, 9:45)

Sala 5. La rebelión lun-dom, 4:25,6:50,9:15

CINE “SHAZAM” ESTÁ EN LA CIMA DE LA TAQUILLA La última película de superhéroes “Shazam!” retuvo el primer lugar en la taquilla de Estados Unidos y Canadá, que no tuvo ningún estreno importante este fin de semana, según cifras preliminares.

Sala 6. A dos metros de ti lun-dom, 4:00,6:35,9:10 r/16 Sala 7. Shazam! 4Dx lun-vie, 3:20,6:05,9:15/ sab-dom, 3:00,6:05,9:15 r/14 Sala 8. Capitana Marvel lun-dom, 4:10,6:50,9:35 r/14 Sala 9. Venganza bajo cero lundom, 4:10,6:45,9:20 Sala 10. Parque mágico lun-dom, 4:20,6:35 s/r Sala 10. Dumbo lun-dom, 8:50 s/r Sala 11. Dumbo lun-dom, 4:30,7:00 s/r Sala 11. Dumbo lun-dom, 9:30 s/r

Sala 2. Casi fiel j/v 5:20 (S/ma 5:20) Sala 2. Escape Room j/v 7:20 (s/ma 7:20) Sala 2. The Aftermath j/v 9:30 (S/ma 3:20) Sala 3. Capitana Marvel j/v 5:40, 8:20 (s/ma 5:45, 8:20) Sala 4. Ralph Rompe Internet j/v 6:30 (s/ma 6:30) Sala 4. Aquaman j/v 8:45 (S/ma 8:45) Sala 5. Wonder Park j/v 5:00, 7:00 (s/ma 5:00, 7:00) Sala 5. Captive State j/v 9:00 (S/ma 9:00) Sala 6 Quee’s Corgi j/v 5:30 (S/ma 5:40) Sala 6. Domirriqueños 2 j/v 7:30 (s/ma 7:40) Sala 6. Cold Pursuit j/v 9:30 (s/ma 9:40) Sala 7. Dumbo j/v 6:00, 8:30 (s/ma

4:45, 7:10, 9:40) Sala 8. Cómo entrenar a tu dragón j/v 5:00 (s/ma 5:00) Sala 8. Miriam miente j/v 7:15 (s/ma 7:20) Sala 8. Expresos j/v 9:15 (s/ma 9:25) Sala 9. Buscando al Zorro j/v 7:00 (s/ma 5:10, 7:10) Sala 9. Pet Sematary j/v 9:00 (s/ma 9:10)

Sala 12. Shazam! lun-vie, 3:25,5:50,8:40/ sab-dom, 3:00,5:50,8:40 r/14

Sala 2. A 2 metros de ti j/v 7:15, 9:45 (s/ma 7:00, 9:30)

Sala 1. Shazam j/v 7:00 (s/d 7:00) (l/ma 7:00)

CARIBBEAN CINEMAS (NOVO CENTRO)

Sala 3. Wonder Park (s/ma 5:00, 7:00)

Sala 1. Shazam j/v 9:45 (s/d 9:45) (l/ma 9:45)

Sala 3. Shazam j/v 6:00, 8:45 (S/ma 9:00)

Sala 3. Buscando al Zorro j/v 7:30 (s/d 5:20) (l/ma 5:20)

Sala 1. On the basis of sex lun-vie, 6:25,9:10/ sab-dom, 4:00,6:25,9:10 r/16

Sala 4. Captive State j/v 7:20 (s/ma 7:20)

Sala 3. Wonder Park (s/d 7:10) (l/ma 7:10)

Sala 2. Lo que fuimos lun-dom, 7:00,9:15 r/16

Sala 1. Capitana Marvel lun-vie, 6:50,9:30/ sab-dom, 4:10,6:50,9:30 r/14

Sala 4. The Aftermath j/v 9:45 (s/ma 9:45)

Sala 3. Cold Pursuit j/v 9:15 (s/d 9:10) (l/ma 9:10)

Sala 3. Ben is back lun-dom, 4:50,7:10,9:30 r/16

Sala 2. Dumbo lun-vie, 6:50,9:15/ sab-dom, 4:25,6:50,9:15 s/r

Sala 5. Buscando al zorro j/v 7:10 (s/ma 5:00)

Sala 4. Expresos j/v 6:45 (l/ma 6:45)

Sala 4. Green book lun-vie, 6:40,9:20/ sab-dom, 4:20,6:40,9:20

Sala 3. A dos metros de ti lunvie, 4:50,7:00,9:30/ sab-dom, 4:30,7:00,9:30 r/16

Sala 2. Cold war lun-dom, 4:55 r/18

Sala 13. Un amor inquebrantable lun-dom, 4:25,7:00,9:35 CARIBBEAN CINEMAS (GALERIA 360)

Sala 5. Dumbo (s/ma 7:00)

Sala 4. Buscando al Zorro j/v 8:45 (S/d 5:10) (l/ma 8:45)

Sala 11. Breakthrough j/v 7:15, 9:45 (s/ma 4:45, 7:15, 9:45)

Sala 5. Cold Pursuit j/v 9:00 (s/ma 9:30)

Sala 4. Breakthrough (s/d 7:00, 9:30)

PALACIO DEL CINE (BLUE MALL)

Sala 6. Breakthrough j/v 7:00, 9:30 (s/ma 7:00, 9:30)

Sala 6. Dumbo j/v 7:00 (s/d 6:30) (l/ma 7:00) Sala 6. Shazam (s/d 9:00)

Sala 1. Shazam! Cxc lun-dom, 3:30,6:30,9:30 r/14

PALACIO DEL CINE (BELLA VISTA MALL)

Sala 6. Capitana Marvel j/v 9:30 (l/ma 9:30)

Sala 2. Venganza bajo cero cxc lundom, 3:20,6:00,8:45

Sala 6. Shazam! Cxc lun-vie, 6:40,9:35/ sab-dom, 3:45,6:40, 9:35 r/14

Sala 10. Shazam j/v 6:00, 8:45 (s/ ma 6:00, 8:45)

Sala 1. Shazam (Imax-2d) J/v 7:00, 9:45 (S/ma 4:15, 7:00, 9:45) Sala 2. Queen’s Corgi (S/ma 4:45)

Sala 5. The aftermath lun-dom, 4:40,7:05,9:35 CARIBBEAN CINEMAS (DOWNTOWN CENTER)

Sala 4. Venganza bajo cero lun-vie, 4:50,7:00,9:35/ sab-dom, 4:25,7:00,9:35 Sala 5. Parque mágico lun-dom, 5:00,6:50,8:45 s/r

LOS ASTROS DICEN ARIES 21 Marzo - 20 Abril

TAURO 21 Abril - 20 Mayo

GÉMINIS 21 Mayo - 20 Junio

CÁNCER 21 Junio - 22 Julio

LEO 23 Julio - 22 Agosto

VIRGO 23 Agosto - 22 Septiembre

4SRYREWSRVMWEIRXYW PEFMSW7EXVEXIHITIR WEQMIRXSWTSWMXMZSW]TSV XSHSWIWSWGEREPIWQIR XEPIWUYIRSXITIVQMXIR TVSKVIWEVGSQSXHIWIEW Números de suerte: 14, 6, 20

(IWEVVSPPEHSWMWQEWMZEWHI GSQTVIRWMzR]XSPIVERGME TEVEGSRYRJEQMPMEVLMNSS EQMKSUYIRSTEVIGIIWXEV FMIRENYWXEHSGSRPEVIEPM HEHHIPQSQIRXSEGXYEP Números de suerte: 49, 3, 10

4SRQE]SVqRJEWMWIRXYW LjFMXSWEPMQIRXMGMSW] GSQMIR^EYREVYXMREHI INIVGMGMSW2SLEKEWHIW EVVIKPSW'YMHEHIXYGYIV TSGSQSEPKSWEKVEHS Números de suerte: 5, 12, 14

)PHMRIVSXIPPIKEVjWSV TVIWMZEQIRXI4SRXSHSXY IQTIySIRWSFVIWEPMVIR XSHSPSUYILEKEWUYIWMR HYHEPSPSKVEVjWTEVEXY QINSVuE Números de suerte: 11, 45, 17

'YMHEQYGLSHIXYTE^IW TMVMXYEP7qGEXIPEWPjKVMQEW HIEQEVKYVE]WYJVMQMIRXS ]WSRVuIPIEPEZMHE7YTIVE XVEYQEWSWIRXMQMIRXSWHI GYPTEFMPMHEH Números de suerte: 25, 10, 34

8YEYXSWYJMGMIRGMEWIVZMVj HIINIQTPSEQYGLSW 1ERXIRXIIRGSQYRMGE GMzRGSRXYWJEQMPMEVIW UYIWIIRGYIRXVIRIRIP I\XVERNIVS Números de suerte: 18, 20, 5

LIBRA 23 Septiemb. - 22 Octubre

ESCORPIO 23 Octubre - 21 Noviembre

SAGITARIO 22 Noviemb. - 21 Diciemb.

CAPRICORNIO 22 Diciembre - 19 Enero

ACUARIO 20 Enero - 18 Febrero

PISCIS 19 Febrero - 20 Marzo

)PQSQIRXSIWMHIEPTEVE ZMENEV]I\TERHMVERQjW XYWLSVM^SRXIW]XYWGSRS GMQMIRXSW2SMQTSVXEWM IWGIVGESPINSWTSVQEV GMIPSSXMIVVE Números de suerte: 2, 18, 7

2SPIXIQEWEPEWEQI RE^EWSQERMTYPEGMSRIW WYXMPIWHITIVWSREWEQEV KEHEWIMKRSVERXIW4SRXI HIEGYIVHSGSRXYTEVINE IRXSHSXIGSRZMIRI Números de suerte: 9, 15, 33

'SRXMREIRFYWGEHIRYI ZEWEZIRMHEWUYIXITYIHER PPIZEVEPTVSKVIWSUYIXERXS HIWIEWPSKVEV(IJMIRHIXYW HIVIGLSWTIVSRSXSQIWPE NYWXMGMEIRXYWQERSW Números de suerte: 33, 19, 2

'YMHEFMIRPSUYIXIGSR JuIR2SWMVZEWHITYIRXIE GSQIRXEVMSWUYITSHVuER TIVNYHMGEVEEPKYMIRUYI XGSRWMHIVEWYRFYIR EQMKS E  Números de suerte: 6, 20, 8

7IMQTSRIUYIXSQIWPSW VMIWKSWUYIGSRWMHIVIW RIGIWEVMSWTEVEPPIKEVEPE QIXEUYIXILEWXVE^EHS 2STIVQMXEWUYIREHMINYI KYIGSRXYWWIRXMQMIRXSW Números de suerte: 37, 1, 5

4SRPIEXIRGMzREXYWIKYVM HEHXYIWXEFMPMHEHIQSGMS REP0YGLETSVXYWMHIEPIW TSVXYJYXYVS7qTIVWIZI VERXI]TMIRWEWMIQTVIUYI XXIQIVIGIWPSQINSV Números de suerte: 28, 5, 11


15

SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

CRUCIGRAMA HORIZONTALES

1. Cubrir una cosa 6. Probar 11. Costal 12. Ovalado 14. Prefijo 16. Ramificaciones 18. Pronombre posesivo 19. Igual 21. Ropa talar (pl.) 22. Hijo de Noé (Biblia) 23. Ánsar (pl.) 25. Hermana religiosa 26. Juez turco 27. Derrotas 29. Chupar suavemente el jugo de una cosa 30. Del verbo ir 31. Escala musical 32. Bastón de rota 34. Aparato detector por medio de ondas 37. Rio de la China 38. Del verbo poner 41. Agua gaseosa 42. Del verbo dar 43. Medida inglesa para líquidos 45. Terreno común para pastos 46. Preposición inseparable 47. Valijas 49. Negación 50. Río de Egipto 51. Aceptar la herencia 53. Pelotas 54. Extrañas

VERTICALES

SOLUCIÓN CRUCIGRAMA 04-09

2. De la baraja 3. Dos 4. Rey de Israel 5. Obtusas 6. Pasar un líquido por cedazo 7. Ocas 8. Yunque para plateros 9. Contracción 10. Que mueve 13. Hundir debajo de la tierra o del agua 15. Dios de la bebida 17. Amarro 18. Tela fina 20. Ancho de una cosa 22. Día de la semana (pl.) 24. Sabiduría 26. Cúspides 28. Apócope de Santo 29. Ciudad de Irán 32. Aparato receptor de ondas 33. Golfo del Océano Índico 35. Ciudad de Arabia 36. Claros 38. Maderos 39. Baile andaluz 40. Advertir 43. Vestido rico y lucido 44. Ninguna cosa 47. Número 48. Titulo inglés 50. Negación 52. Símbolo del radio

SUDOKU

UNIVERSAL SUDOKU PUZZLE Complete el recuadro de tal manera que cada fila, columna y cuadro de 3x3 tengan los números del 1 al 9 sin repetirse.

N 4 / 16

El actor Robert Downey Jr. durante una conferencia para el estreno de Avengers: Endgame en Seúl, Corea del Sur.

Premios Heat

Hard Rock Punta Cana recibirá populares artistas Figuras. La celebración tendrá shows en vivo de Farruko, Olga Tañón, Juanes, Eddy Herrera y otros.

EVENTO Santo Domingo

SOLUCIÓN SUDOKU ANTERIOR N 4 / 15

L

SW,IEX0EXMR 1YWMG%[EVHW IWXjR TVz\M QSW E GIPI FVEV WY GYEV XE IRXVIKE HI KEPEVHS RIW GSR PSW UYI VIGSRS GIIPXEPIRXS]TSTYPEVM HEHTVIWIRXIIRPEQWM GEPEXMRE )PHIQE]SPEWTE VEHMWuEGEWTPE]EWHIP,EVH 6SGO,SXIP 'EWMRS4YR XE'ERE6ITFPMGE(S QMRMGEREEGSKIVjRIWXj ZIPEHEHITVIQMEGMzRIR QIHMSHIYRERSGLIGEV KEHEHIIRIVKuEPEXMRE 0SW,IEXWIVjRGSRHYGM HSWTSV1EVMIPE)RGEVRE GMzRGSTVIWIRXEHSVEHI 7LS[FM^IR'22IR)WTE ySP]%REuW'EWXVSTVI WIRXEHSVEHIPSWGEREPIW

ANOTACIONES Boletas. 0EFSPIXIVuESJMGMEPIWXj HMWTSRMFPIEPEZIRXE TEVEIPMRKVIWS:-4] KIRIVEP]TSHVjWIV EHUYMVMHEIRPSWTYRXSW HI9ITE8MGOIXWIR 6ITFPMGE(SQMRMGERE Transmisión )PHIWEVVSPPSHIPSW 4VIQMSW,IEXTSHVj WIVWIKYMHSHIGIVGE TSVPSWIWTIGXEHSVIW KVEGMEWEPEWIyEPSJMGMEP HIPSWGEREPIW,8:] 828EHIQjWHIPE[IF ]VIHIW

,8:]828XIRHVjRWS FVIWYIWGIREVMSEEVXMW XEWGSQS7IFEWXMjR=EXVE 0YRE]1ERYIP1IHVERS 0YMWE*IVRERHE;.YER 1EKjR'E^^Y1S^EVX0E 4EVE.S[IPP 6ERH]IR XVISXVSWQjWUYMIRIWWI

VjRPSWIRGEVKEHSWHIHI ZIPEVEPSWKEREHSVIWHI PEWGEXIKSVuEW)WXEGI PIFVEGMzRXIRHVjWLS[W IRZMZSHI.YERIW3PKE 8EyzR*EVVYOS+VIIMG] )HH],IVVIVE1MOI&E LuE+EFVMIP]8LSQE^

Farruko figura entre los artistas que cantarán en los Premios Heat, el 10 de mayo en Punta Cana. FUENTE EXTERNA


16

SANTO DOMINGO, RD. MARTES, 16 DE ABRIL DEL 2019

Estreno. Lorem ipsum sit 4042 amblenma Palabra nueva. Bajada 1618 lorem ipsum Ipsandis ex eos pratis ipiciis volorem aut fugitatia simin.

SHOW NOMBRE APELLIDO NEW

nombre@listindiario.com Santo Domingo

S

MXMYQRSRWIUYMYX UYEQI\TIVYTXEX UYMWIVMXI\GIEUYM HSPIWGMYQUYMHY GMHSPSVITYHMXISQ RMQMGYWERHEIWXSIEUYMEXYV IXIZIVIGYWGSRRYWWMRMWX UYEQIXSQRMWXSIMGXIQUYS WWYQZSPYXEXIWXMETEWEITIVI ZMXUYMHIQUYEQYXZIVIWWEQ MHIZIRMLMPMGXIRMWXMEXIXYVIT XYVWIUYEQUYMERXMSHMKIRHY GMGSVEXPEFSVEXIRYQVIQVIG XEXMEXIGIVMSVVSZMHYRXZSPYTMH IPPMKIRHERHYWIZSPYTXEQRE XYVVITIHYXEPMXMWWYRXMHUYE XMMWGMHMHSPSVVYQMHYWWYQ

Nuevo epigrafe lorem ipsum amble siecuat lorem ipsum

CRONO Septiembre 0SVIQSQRMQIRXTEVYQ PEXYVVITIVSHMXEWTIVEIZI VMXEQZIZIVWTMHYXEXYQU YEXMIVPSVIQMTWY Octubre 0SVIQSQRMQIRXTEVYQ PEXYVVITIVSHMXEWTIVEIZI VMXEQZIZIVWTMHYXEXYQU YEXMIVPSVIQMTWYQEQ FPIWWEHHEW UYITIHMXIYQEWTMIXMRYPTE VYQPEQWMERMLMXEQUYEWEPM FYWEQIRHMXEXMWHIQSPIRHER HMEWQMRMEXYVPSVIQWI 1EKRMWWMXSQRMQIRXTE VYQPEXYVVITIVSHMXEWTIVEI ZIVMXEQZIPPMUYMFYWUYIPE XIQTSVIQSPIRHEISQRMLMXEI ZIVWTMHYXEXYQUYEXMYQUYM

HIPMGMIRHEEQYWYXIQJYKMXM FYWUYSGSRIXPMWIEWYWHSPSVI ISWI\GIWWMQTIVMERITIVEXYQ ZIVSZMXIWHIRIXZIPMGEII\TPME UYEXYV# 2YWEQHIVYQWIUYMRSFMW GSRWIUYMERHMSWEWIHUYMSJJM GMEXYVITIHUYIZIPMFYWEEW IWGMEQLMPQMPQSPYXUYMEQ

XSVIVJIVVYRXIZIPMPMUYSSVIVJI VVYRXIZIPMPMUYSWEWEQI

XYQHSPSVIGSRWIUYMVIWVIVI LIRXIQZSPYTXEXMS9XIPIWXMS RWIUYEXEXIWXVYQWIUYIWYQ Subtitulo lorem UYYRXTEVYQJEGMQZIVREQ -WI\IWGMYQMPMWWIRMQYWIE WIUYMEWYRXIRHMWXIQVIMYRXS XYIPIRMIXZSPYTXEXMEXMEXYWMT XEXYVEYXIXPMXZSPSVITYHEI3W WETIVJIVREXYVUYMFYWZSPYT EHMEFIEXII\GIWUYYWWESVI XEXIQUYEXJYKMEEWTIVVYQIW TVIUYSSJJMGXIMRYPTERSRWIH TEZSPSXIWMQMPIPMXIXZSPYT QSPYQ

Profile for Listín Diario

04-16-2019 L2  

Una propuesta en donde nuestro lector podrá disfrutar de esos contenidos que generan tendencias, estilo, cultura y entretenimiento, pero a l...

04-16-2019 L2  

Una propuesta en donde nuestro lector podrá disfrutar de esos contenidos que generan tendencias, estilo, cultura y entretenimiento, pero a l...