Issuu on Google+

s plate bending ll ro 4 c li u ra d y H -bending machine with pre ulique Rouleuse hydra uage c croq Ă  4 rouleaux ave

Walzen Hydraulische 4 gung hine mit Anbie Rundbiegemasc


Automatic ejection sequence


4RH CN 8/4


t3PMMTNPWJNFOUTPOVQSJHIUNPUJPO t5SBOTMBUJPOTVSHVJEFTSFDUJMJHOFT t7FSTUFMMVOHBVGHFSBEMJOJHFO'ÊISVOHFO

t&MFDUSPOJDBMDPOUSPMPGSPMMTQBSBMMFMJTN t$POUSÃMF¹MFDUSPOJRVFEVQBSBMM¹MJTNFEFTSPVMFBVY t&MFLUSPOJTDIF4UFVFSVOHEFS1BSBMMFMJU´U

t3PMMTTVQQPSUTXJUIEPVCMFCFBSJOHT t4VQQPSUTEFTSPVMFBVYBWFDEPVCMF DPVTTJOFU t8BM[FOMBVGFOJOEPQQFMUFO-BHFSO

t)JHIQSFDJTJPOXJUI1-$BOEQSPQPSUJPOBM7BMWFT t)BVUFQS¹DJTJPOBWFD1-$FUTPVQBQFT QSPQPSUJPOOFMMFT t)PIF(FOBVJHLFJUNJU1-$VOE1SPQPSUJPOBMWFOUJMFO

4RH CN 50/


/7

4RH NC 10/3 Ejection

t1SPHSBNJOHBOEPQFSBUJOHTZTUFNTPGBVUPNBUJDCFOEJOHQSPDFTTBMMPX UPJODSFBTFUIFSFMJBCJMJUZPGFBDIDMJFOU CZVTJOHOVNFSJDBMDPOUSPMTPG JOUFSOBUJPOBMCSBOET t-FQMBOOJOHFUMBHFTUJPOEFTTZTUยผNFTBVUPNBUJRVFTEFSPVMBHFQFSNFUUFOU EBNยนMJPSFSMFGmDBDJUยนQPVSDIBRVFDMJFOU FOVUJMJTBOUEFTDPOUSรƒMFTOVNยนSJRVFT EFGBNFVTFTNBSRVFTJOUFSOBUJPOBMFT t%JF1SPHSBNNJFSVOHVOEEJF4UFVFSVOHEFSBVUPNBUJTDIFO#JFHFQSPHSBNNF FSMBVCFOCFTUF-FJTUVOHTGยดIJHLFJUVOE/VU[FOGรŠSKFEFO,VOEFOEVSDI 7FSXFOEVOHOVNFSJTDIFS4UFVFSVOHFOCFLBOOUFSJOUFSOBUJPOBMFS)FSTUFMMFS


4RH NC 35/4


4RH CN 12/5

t"WFSZHSFBUSBOHFPGBDDFTTPSJFTBMMPXBOBVUPNBUJDDPOUSPMPGGFFEJOHBOE FKFDUJPOPGXPSLQJFDFT TPUIFQMBUFSPMMTCFDPNFTBO'.4DFMMJOEFFE BWFSZ nFYJCMFDFMMBUWFSZIJHIQSPEVDUJWJUZ t6OFBNQMFHBNNFEBDDFTTPJSFTQFSNFUEFH¹SFSBVUPNBUJRVFNFOU MBMJNFOUBUJPOFUMBE¹DIBSHFEFTQJ¼DFTFOGBJTBOUEFWFOJSMBSPVMFVTFVOF W¹SJUBCMFDFMMVMF'.4 VOFDFMMVMFnFYJCMFµIBVUFQSPEVDUJWJU¹ t&JOF7JFM[BIMWPO;VCFIÄSFOFSNÄHMJDIUEJFBVUPNBUJTDIF4UFVFSVOHEFT#F VOE&OUMBEFOTEFS5FJMFVOEM´TTUEJF3VOECJFHFNBTDIJOF[VSFDIUFO'.4 ;FMMFXFSEFO nFYJCFMVOENJUIPIFS1SPEVLUJWJU´U


Technical data PREBENDING CAPACITY TYPE

4/1 4/2 4/3 4/4 4/5 6/3 8/3 10/3 12/3 15/3 17/3 20/3 25/3 30/3 35/3 40/3 50/3 6/4 8/4 10/4 12/4 15/4 17/4 20/4 25/4 30/4 35/4 40/4 50/4 6/5 8/5 10/5 12/5 15/5 17/5 20/5 25/5 30/5 35/5 40/5 50/5 6/7 8/7 10/7 12/7 15/7 17/7 20/7 25/7 30/7 35/7 40/7 50/7

USEFULL LENGHT

1050 1550 2050 2550 3100 2050 2050 2050 2050 2050 2050 2050 2050 2050 2050 2050 2050 2550 2550 2550 2550 2550 2550 2550 2550 2550 2550 2500 2550 3100 3100 3100 3100 3100 3100 3100 3100 3100 3100 3100 3100 4050 4050 4050 4050 4050 4050 4050 4050 4050 4050 4050 4050

ROLLS DIAMETER

BENDING CAPACITY

‘7RSUROO 1,2x 3x 5x 7KLFNQHVVPP

6 5 4 2 2,5 6 8 10 12 15 17 20 25 30 35 40 50 5 6 8 10 12 15 17 20 25 30 35 40 4 5 6 8 10 12 15 17 20 25 30 35 2 3 4 5 6 8 10 12 15 17 20 25

7 6 5 3 3 8 11 13 16 20 22 26 32 39 46 52 65 7 8 11 13 16 20 22 26 32 39 46 52 5 7 8 11 13 16 20 22 26 32 39 46 3 4 5 7 8 11 13 16 20 22 26 32

POWER

top. roll mm.

8 7 6 5 4 9 12 14 18 21 24 28 35 42 49 56 70 8 9 12 14 18 21 24 28 35 42 49 56 6 8 9 12 14 18 21 24 28 35 42 49 4 5 6 8 9 12 14 18 21 24 28 35

lateral roll mm.

10 170 145 9 170 145 8 170 145 6 170 145 5 170 145 11 220 190 15 240 210 18 270 240 23 300 260 26 320 280 30 360 320 35 390 350 44 420 370 53 460 410 61 500 440 70 550 490 88 600 540 10 220 190 11 240 210 15 270 240 18 300 260 23 320 280 26 360 320 30 390 350 35 420 370 44 460 410 53 500 440 61 550 490 70 600 540 8 220 190 10 240 210 11 270 240 15 300 260 18 320 280 23 360 320 26 390 350 30 420 370 35 460 410 44 500 440 53 550 490 61 600 540 5 220 190 6 240 210 8 270 240 10 300 260 11 320 280 15 360 320 18 390 350 23 420 370 26 460 410 30 500 440 35 550 490 44 600 540 %LJJHUVL]HRIPDFKLQHRQUHTXHVW

KW

2,2 2,2 2,2 2,2 2,2 5,5 5,5 7,5 11 15 18,5 18,5 22 22 30 37 55 5,5 5,5 7,5 11 15 18,5 18,5 22 22 30 37 55 5,5 5,5 7,5 11 15 18,5 18,5 22 22 30 37 55 5,5 5,5 7,5 11 15 18,5 18,5 22 22 30 37 55

OVERALL DIMENSIONS L x W x H. mm.

2550 x 950 x 1100 3050 x 950 x 1100 3550 x 950 x 1100 4050 x 950 x 1100 4600 x 950 x 1100 3600 x 1350 x 1200 3600 x 1400 x 1250 3900 x 1600 x 1550 4100 x 1750 x 1550 4100 x 1800 x 1600 4300 x 2000 x 1900 4300 x 2050 x 1900 4600 x 2400 x 2100 4700 x 2500 x 2200 4900 x 2800 x 2500 5100 x 3200 x 2900 5800 x 3400 x 3100 4100 x 1350 x 1200 4100 x 1400 x 1250 4400 x 1600 x 1550 4600 x 1750 x 1550 4600 x 1800 x 1600 4800 x 2000 x 1900 4800 x 2050 x 1900 5100 x 2400 x 2100 5200 x 2500 x 2200 5400 x 2800 x 2500 5600 x 3200 x 2900 6300 x 3400 x 3100 4650 x 1350 x 1200 4650 x 1400 x 1250 4950 x 1600 x 1550 5150 x 1750 x 1550 5150 x 1800 x 1600 5350 x 2000 x 1900 5350 x 2050 x 1900 5650 x 2400 x 2100 5750 x 2500 x 2200 6000 x 2800 x 2500 6200 x 3200 x 2900 6850 x 3400 x 3100 5600 x 1350 x 1200 5900 x 1400 x 1250 5900 x 1600 x 1550 6100 x 1750 x 1550 6100 x 1800 x 1600 6300 x 2000 x 1900 6300 x 2050 x 1900 6600 x 2400 x 2100 6700 x 2500 x 2200 6900 x 2800 x 2500 7100 x 3200 x 2900 7800 x 3400 x 3100

WEIGHT tons.

1,7 2,0 2,3 2,6 2,9 4,5 5,1 7 10 10,7 13,5 13,9 20,4 21,4 27 35 45 5,1 5,9 8 11,2 12 15,5 15,9 22,9 24,3 30,5 39 50 5,7 6,7 9 12,4 13,3 17,4 17,8 25,3 27,2 34 43 55 6,8 8 10,7 14,8 15,9 21,3 21,7 30,1 33 41 51 65

&DSDFLWLHVQRWPHQWLRQHGLQDERYHGDWDWDEOHDUHDYDLODEOHRQUHTXHVW Minimum diameter obtainable = 1,2 x top roll diameter at max width and max thickness allowed on machine. &DSDFLWLHVUHODWHGWRVWHHOTXDOLW\)(67 5 NJPP56 NJPP

$OOVSHFLӾFDWLRQVDERYHDUHVXEMHFWWRYDULDWLRQZLWKRXWQRWLFH

2013 - VERGA arti grafiche - 039.2011320

Ø min. = 1,2 Rs


4 valjčni stroji za okroglenje pločevine