Issuu on Google+

Kilkenny Reporter

WEDNESDAY FEBRUARY 26 2014

%.'#4$4#%'5+' 241/16+10

i>˜-Ì° i˜Ì>]ˆŽi˜˜Þ

(4''%1057.6#6+10 a 1(( 9+6*  6 ,9 č- " /  č9°

(TGGYJKVGPKPI (TGGRCVKGPVFXF (TGGTGVCKPGTU +PVGTGUVHTGGETGFKV

-č/1, č9 £-/En/ č, 

%#..7510



T: 056 7795051 E: sales@kilkennyreporter.ie


Kilkenny Reporter

WEDNESDAY FEBRUARY 26 2014

T: 056 7795051 E: sales@kilkennyreporter.ie

TIME TO SUPPORT A SUPER SINGING SON OF OUR CITY

» Page 24

Politics: ‘Party whips are the wrecking balls of democracy’ » P61 FANTASTIC FENNELLY: Our Captain Fantastic, sharpshooter and ‘Man of the Match’ leaves a Tipp ‘posse’ trailing at Nowlan Park. Pic: Donal Foley » See Pages 76, 77&78 SINGING SENSATION: Meet Jordan Butler » Page 24


4 | NEWS

KILKENNY REPORTER 26 2 2014

Coping with the loss of a beloved husband By Dr Eddie Murphy Clinical Psychologist 7+(NZDVJUHDWIXQDQGWKHUH ZDVJUHDWHQHUJ\DPRQJDOOWKH SDUWLFLSDQWV  7KH JUDQG ¿QDOH ZDV D JUHDW H[WUDYDJDQ]D DV OHDGHUVUHYHDOHGWKHLQQHUGLYDV 7KH ZHHNO\ ZHLJKWLQV DUH RYHUWKHOLJKWVDQGFDPHUDVDUH JRQH $OO WKH OHDGHUV ORRN DQG IHHOIDQWDVWLF :KHQ ZH ¿UVW PHW -HQQLIHU VKH KDG PDVVLYH KHDUW ULVN KLV WRU\ KHU FKROHVWHURO ZDV  D VPRNHUKDGLUULWDEOHERZHOV\Q GURPHDQGDQRQH[HUFLVHU 6KH LV D QRQ VPRNHU FKROHV WHURO LV QRZ  DQG HQMR\V H[HUFLVH  6KH KDV FKDQJHG KHU IXWXUH  2Q WRS RI WKLV -HQQLIHU ZDVWU\LQJWRFRSHZLWKWKHSUR IRXQGORVVRIKHUKXVEDQG1RHO 7KLVLVZKHUHWKHWUXHWUDQVIRU PDWLRQKDVEHHQPDGH6KHKDV PDQDJHGWRNHHSWKHPHPRULHV DQG WKH ORVV DQG LQWHJUDWH WKLV ORVVDQGJLYHKHUVHOIWKHSHUPLV VLRQ WR RSHQ D QHZ FKDSWHU LQ KHUOLIH -HQQLIHUVKRZVXVWKDWWKHRQO\ ZD\WRJHWWKURXJKJULHILVWRJR

DOOWKHZD\LQDQGWKHRQO\ZD\ WRJHWSDVWJULHILVWRJRWKURXJK LW 7RXJKH[WHULRU 0DUFKDVFRPHDORQJZD\RQ 2SHUDWLRQ 7UDQVIRUPDWLRQ +H KDV PDQ\ OD\HUV +H SXWV RQ D WRXJKH[WHULRUEXWXQGHUQHDWKLV DYXOQHUDELOLW\DQGZDUPWK +HOHDUQHGWRSXWRQWKLVWRXJK H[WHULRUDVDFRSLQJPHFKDQLVP WR EDWWOHG VRPH GHPRQV IURP HDUO\ OLIH VFKRRO H[SHULHQFHV +H H[SHULHQFHG GLVWUHVV ZKHQ KHWKRXJKWKHZDVEHLQJMXGJHG DVDIDLOXUH 0DUF KDG D WHQGHQF\ IRU H[ WUHPHV :LWK 0DUF ZH IRFXVHG RQ KLP EHLQJ LQ WKH SUHVHQW DZDUH RI HPRWLRQDO WUDSGRRUV EHLQJMXGJHG 0DUFZDVDWKLV EHVWZKHQKHZDVFHQWUHGFRQ QHFWHGDQGEDODQFHG+HKDVD JRRGKHDUWDQGGHHSFRUHDQGLV JURXQGHGDQGKDSS\ 6DUDK KDV OEV   FDORULHV   ELJ PDFV 6KH KDV HPEUDFHGWKH PRWWRRIRQH IDPLO\RQHPHDODQGLVHQFRXU DJLQJ KHU IDPLO\ WRZDUGV D KHDOWKLHUIXWXUH$OOWKHH[SHUWV KDYH VHHQ D WUDQVIRUPDWLRQ LQ 6DUDK 6KHLVDFWHGOLNHZLWKDOO WKHZRUULHVRIWKHZRUOGRQKHU VKRXOGHUV )RU 6DUDK VR PXFK KDVKDSSHQHGWRKHUSDUWLFXODUO\ WKHWUDXPDWLFORVVRIKHULQIDQW /LYHZLWKKDSSLQHVV 6KH IHOW VKH FRXOGQ¶W EH KDS S\ RU VKRZ KDSSLQHVV DV VKH

WKRXJKW VKH KDG WR VKRZ WKDW VKH ZDV JULHYLQJ DIWHU VXFK D SURIRXQG ORVV 6KH KDV JLYHQ KHUVHOISHUPLVVLRQWRJRRQDQG OLYHKHUOLIHZLWKKDSSLQHVV 6DUDK OHDUQHG DFFHSWDQFH 7KLV LV D SURIRXQG FKDQJH :H FHOHEUDWHDQGDSSODXG 'HLUGUH¶V WUDQVIRUPDWLRQ KDV EHHQIDQWDVWLF6KHKDVUHSODFHG SRRUHDWLQJKDELWVDQGQRH[HU FLVH KDELWV WR OLIHORQJ KHDOWK\ KDELWV 6KHVWDUWHGZRUNLQJDWFDU LQJIRURWKHUV6KHQHYHUVRXJKW WR EH LQ WKH OLPHOLJKW VKH ZDV DOZD\VWKHUHIRURWKHUV'HLUGUH OHDUQHG WKDW LW¶V RN WR EH WKHUH IRU\RXUVHOI +HU FRQ¿GHQFH DQG VHOI HVWHHP KDYH VRDUHG , DP GHOLJKWHG IRU 'HLUGUH ZKR KDV WDXJKW XV WKDW PRWLYDWLRQ JHWV \RX VWDUWHG ZKLOH JRRG KDELWV NHHSLWJRLQJ 7R TXRWH 'HLUGUH  ³, IRXQG P\VHOIDQGLW¶VDORYHO\IHHOLQJ ZRXOGQ¶W LW EH JUHDW LI ZH DOO FRXOG¿QGWKDW"´ 6LREKDQ LQLWLDOO\ VWUXJJOHG ZLWK MXJJOLQJ DOO KHU UROHV PRWKHU ZLIH VLVWHU GDXJKWHU ZRUNHUDQGOHDUQHU :KHQ ZH ¿UVW PHW KHU VKH ZDV UHDOO\ XQGHU SUHVVXUH DQG XVHG ZLQH QLJKWO\ WR GXOO WKH SUHVVXUHDQGPDNHKHUHPRWLRQ DOOLIHPDQDJHDEOH :RUNLQJPRWKHUV 6KHLVDQLQVSLUDWLRQIRUZRUN LQJ PRWKHUV DQG VKH LV QRZ

ZRUNLQJVPDUWHUDQGUDWKHUWKDQ ZRUNLQJKDUGHU 6LREKDQ KDV VKRZQ WKDW IRRG SODQQLQJ LV FHQWUDO WR PDLQWDLQLQJ KHU ZHLJKW  :KDW KDVHPHUJHGLVKHUJUHDWSHUVRQ DOLW\ HYHU\WKLQJ LV LQ EDODQFH DQG KHU YLEUDQF\ LV VKLQLQJ WKURXJK 3DXGLH VWDUWHG 2SHUDWLRQ 7UDQVIRUPDWLRQZLWKDORWRIGH PRQV GHSUHVVHG DQJU\ ELQJH GULQNLQJ ZLWKGUDZQ GLVFRQ QHFWHGGLVLOOXVLRQHGDQGVDG +HKDVWXUQHGKLVOLIHDURXQG OLWHUDOO\ )LUVWO\ KH LV QRW GH SUHVVHG :LWK KHDOWK\ HDWLQJ DQGH[HUFLVLQJUHJXODUO\3DXGLH KDV GLWFKHG KLV GHSUHVVLRQ +H LVQRZYLEUDQWDQGKDSS\ +H FDQ GR ZHOO ZKHQ KH LV ¿JKWLQJ DQG EDWWOLQJ  3DXGLH¶V FKDOOHQJH LV WR PDQDJH WKLQJV ZKHQ WKLQJV DUH JRLQJ ZHOO DQG ZKHQ WKH VSRWOLJKW LV QRW WKHUH +LV $FKLOOHV KHHO LV ZKHQ KH IHHOV KH LV QRW D ZLQQHU$W WLPHVKHIHHOVDORVHU:LQQLQJ LVKDYLQJDVWUXFWXUHDQGHQJDJ LQJ HYHU\GD\ ZLWK IDPLO\ DQG IULHQGV 3DXGLH KDV FRQQHFWHG ZLWK KLPVHOIKLVIDPLO\DQGFRPPX QLW\  6WHDG\ DV LW JRHV 3DXGLH <RXKDYHVKRZQXVWKDW\RXFDQ FKDQJH DW DQ\ DJH 7KLV FKDP SLRQVKLS LV IRU OLIH QRW QLQH PRQWKV 2K E\ WKH ZD\ WKH\ DOO VKHG ORDGVRISRXQGVDQGLQFKHV

Ann leads a charge for free water JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

/$%285 7' $QQ 3KHODQ LV FKDPSLRQLQJ WKH FDXVH RI ORFDO IDPLOLHV DV ZDWHU FKDUJHV ORRP ODUJH 6KH KDV UHSHDWHG D FDOO IRU HY HU\FXVWRPHURI,ULVK:DWHUWREH JLYHQ D IUHH ZDWHU DOORZDQFH LQ DGYDQFHRIFKDUJHV

³,KDYHUDLVHGWKLVLVVXHLQ'iLO (LUHDQQ,IHHOLWLVLPSHUDWLYHWKDW ZKHQZHDUHDVNHGWRSD\IRURXU ZDWHU WKHUH PXVW EH DQ DIIRUG DELOLW\IDFWRUEXLOWLQ´WKH*UDLJ QDPDQDJKZRPDQVDLGDVVKHOHG WKHFKDUJHWRSRXUFRPPRQVHQVH RQDQRWKHUWD[IRUDOUHDG\VWUXJ JOLQJSHRSOH³2WKHUXWLOLW\FRP SDQLHVOLNHWKH(6%KDYHDIUHH DOORZDQFH RU XQLWV IRU SHRSOH

Family champion: Ann Phelan DQG,IHHOWKDW,ULVK:DWHUPXVWGR OLNHZLVH´$QQWROG7KH5HSRUWHU ³7KHUHFDQEHQRµRQHVL]H¿WV DOO¶ DSSURDFK WR WKLV LVVXH (DFK RIXVLVGLIIHUHQWDQGHDFKRIXV KDVGLIIHUHQWFLUFXPVWDQFHV7KLV PXVWEHWDNHQLQWRDFFRXQW ³7KHUH DUH ODUJH IDPLOLHV ZLWK PDQ\ FKLOGUHQ WKHUH DUH VLQJOH SHRSOHOLYLQJDORQHWKHUHDUHWKH HOGHUO\ DQG WKHUH DUH WKRVH ZLWK GLVDELOLWLHV ³,ULVK :DWHU VKRXOG LQWURGXFH DIUHHSHUVRQDODOORZDQFHIRUHY HU\RQHOLDEOHIRUZDWHUFKDUJHV,W ZRXOGZRUNLQDZD\ZKHUHHDFK SHUVRQZRXOGKDYHDFHLOLQJOHYHO RIXVDJHXQGHUZKLFKWKH\ZRXOG QRW EH OLDEOH IRU DQ\ SD\PHQW 7KLVZRXOGQRWRQO\EHDIDLUV\V WHP DQG ZRXOG HQFRXUDJH VPDUW XVHRIRXUZDWHUVXSSOLHV¶ $QQVDLG,ULVK:DWHUVKRXOGUXQ HGXFDWLRQSURJUDPPHVWRHQFRXU DJHSHRSOHWRFRQVHUYHZDWHUDQG WR UHDOLVH ZKDW D SUHFLRXV FRP PRGLW\LWLV ³7KLV FRXOG EH GRQH LQLWLDOO\ WKURXJK VFKRROV DQG FROOHJHV ,W ZRXOG HQFRXUDJH ZDWHU KDUYHVW LQJDQGWKHVHFRQGDU\XVHRIZD WHU´VKHDGGHG


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 5


6 | NEWS

KILKENNY REPORTER 26 2 2014

Beauty and the beast in waters and wild By Jimmy Rhatigan 72'$< ZH KLJKOLJKW WKH ZD WHUV DQG WKH ZLOG EHDXW\ DQG EHDVWIHDWXUHVRIDQXQGHUEHOO\ RIURPDQFHSHUKDSVDIWHU6WRUP 'DUZLQ :H IRFXV RQ RXU EHORYHG OR FDOULYHUZKHUHRWWHUVGHOLJKWDW EDWK DQG IHHGLQJ WLPH DV WKHLU KXPDQ IULHQGV FXUVH XQZHO FRPHÃ&#x20AC;RRGV 7KDQNV WR WKH NHHQ H\H DQG H[FHOOHQW SKRWRJUDSK\ RI ORFDO PDQ-RKQ5HDG\ZHVKRZDQRW WHUDWVZLPLQWKHDQJU\ZDWHUV RI WKH 5LYHU 1RUH DW %HQQHWWV EULGJH 7KH PHPEHU RI WKH ZHDVHO IDPLO\ PD\ EH UHOD[LQJ DIWHU ¿VKLQJ SHUKDSV IRU KLV RU KHU VXSSHU RU VLPSO\ JLYLQJ XV WKH PHVVDJHWKDWHYHQWKHEDGWLPHV FDQEHJRRG :H WDNH LQ WKH JURXQGV RI .LONHQQ\&DVWOHD3DUDGLVHQRW ORVW WR RXU SHRSOH ZKHUH WUHHV RI ZKDW ZH PLJKW ORRVHO\ FDOO SHQVLRQ DJH UHFRUG WKH KLVWRU\ RI RXU FLW\ EXW XQIRUWXQDWHO\ GRQ¶W KDYH WKH ZKHUHZLWKDO WR SDVVLWRQWRXVPHUHPRUWDOV 5DPEOLQJHGXFDWRU 2QH VXFK WUHH D YLFWLP RI GHDGO\ 'DUZLQ PRYHG D UDP EOLQJ HGXFDWRU WR SXW SHQ WR SDSHU WR UHFRUG LQ SRHWU\ WKH GHPLVH RI DQ HOHJDQW LQKDELW DQW RI RXU FDVWOH SDUN D UHOD[ LQJDQGSHDFHIXOSDUFHORIXUEDQ

&KDLQVDZ5RDU

WXUIWKDWQRZSOD\VKRVWWRORFDO DQGYLVLWRUDQGZDVRQFHDSOD\ JURXQGIRUWKHSULYLOHJHG ,W LV D SRHP RI EHDXW\ H[FHO OHQWO\ ZULWWHQ D ¿WWLQJ HSLWDSK

PD\EHWRWKHFORVXUHRIDEUDQFK RI¿FH $ PDMHVWLF LQDQLPDWH IULHQG KDV SDVVHG D SDO RI EHDXW\ WKDW ZRXOGQ¶W ZDUUDQW HYHQ DQ

XQPDUNHG JUDYH EXW LV QRZ UH FRUGHG LQ KLVWRU\ WKDQNV WR WKH NLQGKHDUWRIDORFDOWHDFKHUDQG D OLWWOH FRUQHU RI D QHZVSDSHU FRXUWHV\RIWKH)RXUWK(VWDWH

7ZRKXQGUHG\HDUVLWVWRRG WKHUH 7U\LQJWRSURVSHUJURZ DQGWKULYH 7ZRKRXUVZDVDOOLWWRRN WRIDOO 1RZD\LWFRXOGVXUYLYH 7ZRKXQGUHG\HDUVLWVWRRG WKHUH 1REOHPDMHVWLFSURXG %XWZKHQ'DUZLQURDUHGLW FUXPEOHG 8QVHHQXQKHDUGDQG ERZHG

7KHFKDLQVDZQRZLWURDUV KHUH 7KHPXOFKHUJULQGVLWVFRUH 7ZRKXQGUHG\HDUVLWVWRRG WKHUH $QGQRZLWLVQRPRUH Â&#x2039;)UDQN0F.HQQD )HEUXDU\ 7KLVSRHPZDVZULWWHQLQ WKHZDNHRI6WRUP'DUZLQ ZKLFKXSURRWHGWKRXVDQGV RIWUHHV


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 7


8 | NEWS

KILKENNY REPORTER 26 2 2014

Time for a walk with JP /2&$/ VLQJHU DQG VRQJZULWHU -3 5\DQ ZLOO RI¿FLDOO\ UHOHDVH KLVVHFRQGDOEXPHQWLWOHGµ7DNH $:DON:LWK0H¶RQWKLV)ULGD\ LQ7KH6HW7KHDWUH.LONHQQ\DW SP &OLYH%DUQHVRQHRI,UHODQG¶V ¿QHVWODSVOLGHDQGDFRXVWLFJXL WDULVWV ZLOO EH DDPRQJ WKH VSH FLDOJXHVWV 5HFRUGHG LQ 1DVKYLOOH µ7DNH $ :DON :LWK 0H¶ IHDWXUHV WRS 1DVKYLOOH VHVVLRQ SOD\HUV VXFK DV 6(6$& DZDUGZLQQLQJ PX VLFLDQ DQG SURGXFHU 7KRPP -XW] DQG *UDPP\ DZDUGZLQ QLQJEDVVLVW0DUN)DLQ ³,W ZDV D WKULOO WR FROODERUDWH ZLWK VRPH RI 1DVKYLOOH¶V ¿Q HVWPXVLFLDQVRQWKLVUHZDUGLQJ PXVLFDOMRXUQH\DQG,ORRNIRU ZDUG WR VKDULQJ WKH HQG UHVXOW LQ7KH6HW7KHDWUH-3WROG7KH 5HSRUWHU 7HOODVWRU\ ³,¶P DOZD\V GUDZQ WR VRQJV WKDW WHOO D VWRU\ DQG WKLV DOEXP ZDV D JUDGXDO SURFHVV GHYHO RSLQJ RYHU WLPH RXW RI YDU\ LQJ VWRULHV 7KH VKRZ ZLOO EH DQLQWLPDWHHYHQWZKLFK,KRSH SHRSOHZLOOHQMR\´VDLG-3 )RUPHU +RW 3UHVV PXVLF MRXUQDOLVW -DFNLH +D\GHQ KDV GHVFULEHG WKH WLWOH WUDFNV DV KDYLQJ ³WKH DXWKHQWLFLW\ RI D JHQXLQH 1DVKYLOOH WUDFN ZLWK -3 5\DQ¶V VWDPS RI LQGLYLGXDOLW\ RQ ZKDW LV DQ HYRFDWLYH DQG LQIHFWLRXV VRQJ

JP tinkles the ivories ZLWKGHOLFLRXVKDUPRQLHV 7LFNHWV IRU WKH ODXQFK HYHQW FRVW ¼ DQG DUH DYDLODEOH GL UHFWO\IURPWKHER[RI¿FH-3¶V

QHZ DOEXP LV DYDLODEOH IRU GRZQORDGIURPDOOUHSXWDEOHRQ OLQHGRZQORDGVWRUHVRUMSU\DQ PXVLFFRP

Local debut for Belfast DJ %(/)$67'-DQGSURGXFHU'D YLG+ROPHVPDNHVKLV.LONHQQ\ GHEXW RQ $SULO  DW WKH 6HW 7KHDWUH 'DYLG¶V QHZ SURMHFW LV 8Q ORYHG D FROODERUDWLRQ ZLWK .HHIXV*UHHQDQG-DGH9LQFHQW 7DNLQJ LQVSLUDWLRQ IURP FODVVLF 'LVQH\ ¿OPV 5D\PRQG 6FRWW WKH 6KDQJUL /DV WKH %%& 5D GLRSKRQLF :RUNVKRS DQG -DFN 1LW]VFKH WKH EDQG LV ¿QLVKLQJ WKHLU¿UVWDOEXPLQ/RV$QJHOHV ,QUHFHQW\HDUV'DYLG¶VZRUN IRU¿OPKDVÃ&#x20AC;RXULVKHG+LVVXF FHVVIXO SDUWQHUVKLS ZLWK GLUHF WRU 6WHYHQ 6RGHUEHUJK ZDV GH YHORSHG RQ ¿OPV 2XW RI 6LJKW   DQG 2FHDQ¶V    DQG WKLV KDV FRQWLQXHG WKURXJK

3DQFDNH4XL] LQ&OHHUH¶V%DU 7+(5(LVJRRGLQWHUHVWLQ D3DQFDNH4XL]WREHKHOG DW&OHHUH¶V%DU3DUOLDPHQW 6WUHHW.LONHQQ\RQ6KURYH 7XHVGD\0DUFKSP 4XL]PDVWHULV(DPRQQ&RUFR UDQ 7KHTXL]LVWRKHOSZLWKRQJR LQJKRVSLWDOFRVWVIRUDORFDO IDPLO\7HDPRIIRXUFRVWV¼ DQGLQGLYLGXDOVZLOOEHFDWHUHG IRU 7KDQNVKDVJRQHWRNLQG VSRQVRUVLQFOXGLQJ&OHHUH¶V %DU7KH/DXQGU\%DVNHWDQG DXFWLRQHHU)UDQ*ULQFHOO7KH RUJDQLVHUVZLOOEHJUDWHIXOIRU VXSSRUW

David Holmes VHTXHOV2FHDQ¶VDQG *RRG9LEUDWLRQV :LWK ORQJWLPH FROODERUD

WRU 6WHYH +LOWRQ 'DYLG DOVR ZRUNHGWRFUHDWHWKHDFFODLPHG VRXQGWUDFNHYRNLQJWKHG\VWRSL DQQHDUIXWXUHZRUOGRI0LFKDHO :LQWHUERWWRP¶V&RGH 'DYLG¶V ODWHVW ¿OP SURMHFW LV *RRG 9LEUDWLRQV WKH VWRU\ RI 7HUUL +RROH\ %HOIDVW¶V SXQN JRGIDWKHU DQG WKH *RRG 9LEUD WLRQV 5HFRUG 6KRS VHW LQ WKH KHDUWRIWKHSXQNURFNVFHQHRI V%HOIDVW  7LFNHWV ¼ LQFOXGLQJ ERRNLQJIHH KDYHJRQHRQVDOH 7LFNHWV IURP 5ROOHUFRDVWHU 5H FRUGV.LONHQQ\ /DQJWRQ +RXVH +RWHO .LONHQ Q\   ZZZVHWLH KWWSZZZVHWLH!DQG(QWHU WDLQPHQWLHµ


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 9


10 | NEWS

KILKENNY REPORTER 26 2 2014

Itâ&#x20AC;&#x2122;s a joke: Young gun lashes parties By Jimmy Rhatigan

From left, Shane Murphy KBowl, Liz Nolan Castlecomer Discovery Park, Roisin McQuillan Rothe House and Gardens and Dermot Gaynor The Watershed.

Childâ&#x20AC;&#x2122;s play: School tours are big hit )285 SRSXODU ORFDO WRXULVW DW WUDFWLRQV DUH SURYLQJ WR EH WRS RI WKH FODVV LQ DQ H[FLWLQJ QHZ LQLWLDWLYH DLPHG DW VFKRRO FKLO GUHQ &DVWOHFRPHU 'LVFRYHU\ 3DUN .%RZO 5RWKH +RXVH DQG *DU GHQ DQG WKH :DWHUVKHG KDYH UHFHLYHG IXOO PDUNV IRU FRP LQJ WRJHWKHU WR RIIHU SXSLOV DQ XQIRUJHWWDEOH RQHGD\ FXOWXUDO KHULWDJH DGYHQWXUH VSRUWV DQG ¿WQHVVH[SHULHQFHDPHPRUDEOH IXQRXWLQJ 7KHSURMHFWLVDQHZDQGSUR DFWLYH DSSURDFK WR JDLQLQJ D JUHDWHU VKDUH RI EXVLQHVV IURP WKH VFKRRO WRXUV PDUNHW DQG D JUHDWH[DPSOHRIKRZDFWLYLWLHV FDQZRUNWRJHWKHU $ OHDÃ&#x20AC;HW SURYLGLQJ LQIRUPD

WLRQ DERXW WKH DWWUDFWLRQV KDV EHHQ SRVWHG WR  SULPDU\ VFKRROV LQ WKH 6RXWK (DVW DQG VXUURXQGV LQFOXGLQJ /DRLV 'XEOLQ&RUN:LFNORZ.LOGDUH DQG7LSSHUDU\ 7KH LQLWLDWLYH HYROYHG IURP D .LONHQQ\ 7RXULVP 1HWZRUNLQJ HYHQW0DXUD+LFNH\.LONHQQ\ 7RXULVP 2I¿FHU VDLG LW LV JUHDW WR VHH EXVLQHVVHV ZRUNLQJ WR JHWKHU ³:HDOZD\VHQFRXUDJHLWQRZ PRUH WKDQ HYHU DQG ZH DUH GH OLJKWHGWRVXSSRUWWKLVLQLWLDWLYH WKURXJK RXU ZHEVLWH DQG VRFLDO PHGLDFKDQQHOV´ %RRNLQJV DUH EULVN DQG 0V +LFNH\VDLGWKHUHLVDKXJHSR WHQWLDOIURPWKHVFKRROVPDUNHW ³,QVWHDG RI YLVLWLQJ RQO\ RQH

DWWUDFWLRQ LQ .LONHQQ\ WKH VFKRROVDUHHQFRXUDJHGWRVSHQG WKHGD\LQWKHUHJLRQ:LWKWKHVH IRXU JUHDW SODFHV FKLOGUHQ KDYH LWDOODGYHQWXUHIXQH[HUFLVH FXOWXUHDQGOHDUQLQJ´ $WWUDFWLQJ WKH VFKRROV¶ PDUNHWKDVSRWHQWLDOWRSURYLGH D VLJQL¿FDQW ERRVW WR WKH ORFDO HFRQRP\ DV PDQ\ VWXGHQWV UH WXUQ ZLWK WKHLU IDPLOLHV ZKLFK LQ WXUQ EHQH¿WV WKH ZLGHU KRV SLWDOLW\ VHFWRU DQG ERRVWV ORFDO HPSOR\PHQW .LONHQQ\ KDV ZRQ PDQ\ DZDUGVLQWKHODVW\HDULQFOXGLQJ µ7RXULVP 7RZQ RI ¶ µ,UH ODQG¶V7LGLHVW /DUJH7RZQ¶ DQG (XURSH¶Vµ)ULHQGOLHVW&LW\¶ )XUWKHU LQIRUPDWLRQ  ZZZ NLONHQQ\WRXULVPLH

$<281*FDQGLGDWHZKRLVWR UXQIRU)LDQQD)iLOLQ.LONHQQ\ &LW\:HVWKDVODVKHGRXWDWORFDO SROLWLFDOSDUWLHVRYHUWKHLUDSSDU HQWUHOXFWDQFHWRSXW\RXQJSHR SOHIRUZDUGIRU0D\HOHFWLRQV +HVDLGWKLVZDVVDGDQGZRU U\LQJ IRU WKH IXWXUH RI RXU 5H SXEOLF DV LW XQGHUPLQHG WKH SRWHQWLDO WR KDYH DQ\ UHDO DQG PHDQLQJIXOSROLWLFDOUHIRUP ³$IWHU DOO ZH DUH UHO\LQJ RQ WKH VDPH SROLWLFLDQV ZKR KDYH LJQRUHG SROLWLFDO UHIRUP IRU GH FDGHVWREULQJDERXWWKHUHIRUP 3XWSODLQO\LW¶VDMRNH:HPXVW UHIUHVKWKHV\VWHPEHIRUHZHVWDUW WKHSURFHVVRIUHIRUP´KHVDLG 3DWULFN0F.HHDJHGVDLG KH ZDV GLVDSSRLQWHG WRR WKDW PRUH IHPDOH FDQGLGDWHV ZHUH QRWFKRVHQ +H VDLG WKLV KLJKOLJKWHG WKH REYLRXV JHQGHU LPEDODQFH RQ ORFDOHOHFWLRQWLFNHWV $FFRUGLQJ WR 3DWULFN PXFK PRUH QHHGHG WR EH GRQH WR LQ YROYH\RXQJSHRSOHLQSROLWLFV SDUWLFXODUO\ZRPHQ )LQJHURIEODPH +LV SRLQWHG WKH ¿QJHU RI EODPHDWZKDWKHFDOOHGWKHSR

Patrick McKee OLWLFDOHVWDEOLVKPHQW ³7KHSULPDU\EODPHOLHVZLWK RXU SROLWLFDO HVWDEOLVKPHQW 7KH\KDYHQRWVXFFHHGHGLQHQ VXULQJ RXU YLHZV DQG FRQFHUQV DUHKHDUG´KHVDLG ³3ROLWLFDO DSDWK\ DPRQJVW RXU \RXWK LV JLYHQ DV D UHDVRQ ZK\\RXQJSHRSOHGRQ¶WJHWLQ YROYHGLQSROLWLFV7KLVLVZLWK RXWIRXQGDWLRQ ³7KH WUXWK LV WKDW LQYROYH PHQW LQ \RXWK SROLWLFV RQ WKLUG OHYHO FDPSXVHV DFURVV

WKHFRXQWU\LVPDVVLYH ³3ROLWLFDO\RXWKZLQJVKDYHHQ MR\HGDUHQDLVVDQFH%XWDVVRRQ DV \RXQJ SHRSOH OHDYH FROOHJH WKH\KDYHQRZKHUHWRJR0DQ\ ZRXOGPDNHIDQWDVWLFFDQGLGDWHV EXWWKH\GRQ¶WJHWDFKDQFH´ 3DWULFNKDVXUJHG\RXQJSHR SOH WR PDNH WKHLU YRLFHV KHDUG LQWKHORFDOHOHFWLRQV ³:H FDQ QR ORQJHU VLW RQ WKH VLGHOLQHV DQG OHW RWKHUV GHFLGH KRZ RXU FRXQW\ LV UXQ´ KH DGGHG


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 11


12 | NEWS

KILKENNY REPORTER 26 2 2014

War and Peace Park spark verbal spat By Jimmy Rhatigan $9(5%$/VSDWKDVEURNHQRXW DIWHU ZKDW PLJKW EH WHUPHG D :DUDQG3HDFH3DUNLVVXH )ROORZLQJWKHWRSSOLQJRIIRXU /LPH 7UHHV LQ WKH FLW\¶V 3HDFH 3DUNPHPEHUVRIWKHFDPSDLJQ WR &RPSOHWH .LONHQQ\¶V 5LQJ 5RDG DVNHG ZK\ WKH &RXQW\ &RXQFLO KDG LVVXHG RQH VWDWH PHQW WR HOHFWHG PHPEHUV DQG DQRWKHUWRWKHSXEOLF 7KHFDPSDLJQHUVKDGPRXQWHG SURWHVWSLFNHWVDWWKHVSRWRIWKH WUHHIHOOLQJYRLFLQJDQGZULWLQJ WKHLU REMHFWLRQV WR WKH UHPRYDO RI ZKDW WKH\ GHVFULEHG DV IRXU EHDXWLIXO/LPH7UHHV 7KH JURXS VD\ WKDW RQ )ULGD\ PRUQLQJWKH'LUHFWRURI6HUYLFHV RI.LONHQQ\&RXQW\&RXQFLO-RKQ 0XOKROODQGLVVXHGDVWDWHPHQWWR FRXQFLOORUV VWDWLQJ WKDW WKH IRXU WUHHVHDUPDUNHGIRUGHVWUXFWLRQWR PDNHZD\IRUWKH&HQWUDO$FFHVV 6FKHPH &$6  VXIIHUHG VWRUP GDPDJH DQG WKDW WKLV KDG QHFHV VLWDWHGWKHLUGHVWUXFWLRQ %XWWKHJURXSSRLQWVRXWWKH &RXQFLOWKHQLVVXHGDVWDWHPHQW RQ )ULGD\ HYHQLQJ VWDWLQJ WKDW VWRUP GDPDJH ZDV QRW WKH UHD VRQIRUWKHWUHHIHOOLQJEXWWKDW WKHFRXQFLOKDGDOZD\VLQWHQGHG RQFXWWLQJGRZQWKHWUHHVEHIRUH WKH QHVWLQJ VHDVRQ EHJLQV LQ 0DUFK ³7KLV ZDV D F\QLFDO DQG RS SRUWXQLVWLFPRYHE\WKHFRXQFLO DQG LW LQVXOWV WKH FRPPXQLW\¶V

Trees are felled LQWHOOLJHQFH WR FODLP WKDW WKH WUHHV ZHUH IHOOHG EHFDXVH RI VWRUP GDPDJH´ JURXS PHPEHU *HQL0XUSK\DFFXVHG ³7KH RXWFRPH RI WKH FXUUHQW DUFKDHRORJLFDO LQYHVWLJDWLRQV DW 9LFDU 6WUHHW PD\ QHFHVVLWDWH DFKDQJHRIURXWHIRUWKH&$6 WKHUHIRUH LW LV RXWUDJHRXV WKDW WKH FRXQFLO VKRXOG JR IHOOLQJ EHDXWLIXO \HDU ROG /LPH 7UHHV´VKHDGGHG 7KH HDUO\ VWDWHPHQW VHQW WR 0D\RU 0DUWLQ %UHWW DQG FRXQ FLOORUV VDLG WKDW WKH WUHHV KDG EHHQ HDUPDUNHG IRU UHPRYDO WR IDFLOLWDWHWKHFRQVWUXFWLRQRIWKH QHZEULGJHEXWRQLQVSHFWLRQLW ZDVQRWHGWKDWKDGDOVRVXIIHUHG VRPHVWRUPGDPDJH

7KH HPDLO HPLVVDU\ VDLG IRXU QHZ³VHPLPDWXUHWUHHVE\ZD\ RIFRPSHQVDWRU\SODQWLQJDUHWR EHSURYLGHGLQWKHYLFLQLW\´ %XW D IHZ KRXUV ODWHU WKH FRXQFLO VWDWHPHQW RQ LWV ZHE

War years in Callan &$//$1+HULWDJH 6RFLHW\KDVRUJDQLVHGDQLO OXVWUDWHGOHFWXUH&DOODQ DQG:DUDWWKH )ULDU\0LOO6WUHHW&DOODQ IRU7XHVGD\0DUFKDW SP 7KHVSHDNHULVWKHZHOO NQRZQDQGDFFODLPHG0LOL

Peaceful protestors VLWH VDLG LW ZDV QRW WKH FDVH ³7KHIHOOLQJRIIRXUWUHHVLVD WKDW WKH WUHHV ZHUH WDNHQ GRZQ ODZIXODQGDSSURYHGDFWLRQDQG EHFDXVHRIVWRUPGDPDJH³7KLV ZDV VDQFWLRQHG RQFH VWDWXWRU\ LV LQFLGHQWDO DQG LV LPPDWHULDO SODQQLQJDSSURYDOZDVUHFHLYHG WRWKHUHPRYDORIWKHWUHHV´WKH LQ UHVSHFW RI WKH .&$6 LQ 'H VWDWHPHQWVDLG FHPEHU7KH(QYLURQPHQW WDU\KLVWRULDQ /LHXWHQDQW/DUU\6FDOODQ -DPHV6WHSKHQV%DUUDFNV .LONHQQ\ 7KLVOHFWXUHZLOOGHDO ZLWKZKDWZDVRQHRI WKHPRVWWXUEXOHQWSHULRGV LQQRWDORQH&DOODQ¶VEXW ,UHODQG¶VKLVWRU\$OODUH ZHOFRPH

World War 1 Memorial $SXEOLFPHHWLQJKDVEHHQ DUUDQJHGIRU:HGQHVGD\ 0DUFKSPLQWKH)ULDU\ 0LOO6WUHHW&DOODQWRFRQ VLGHUWKHQDWXUHDQGORFDWLRQ RIDVXLWDEOHPHPRULDOWR WKRVHIURPWKH&DOODQDUHD ZKRWRRNSDUWLQWKH*UHDW :DU  

Pics: Martin Doheny ,PSDFW6WDWHPHQWIRUWKH.&$6 GHDOV IXOO\ ZLWK WKH UHPRYDO RI WKH WUHHV DQG WKH PLWLJDWLRQ PHDVXUHV WKDW PXVW EH SXW LQ SODFH´ WKDW VWDWHPHQW FRQWLQ XHG ,Q D OHWWHU WR 7KH 5HSRUWHU 'HFODQ 0XUSK\ FKDLU RI WKH .LONHQQ\ $VVRFLDWLRQ RI $Q 7DLVFH KDG VDLG WKH DVVRFLDWLRQ ZDV RXWUDJHG DW WKH WKHQ LP PLQHQW IHOOLQJ RI WKH EHDXWLIXO PDWXUHWUHHVLQWKHH3HDFH3DUN ³'HVSLWHWKHSHUPLVVLRQE\$Q %RUG3OHDQDODWRWKH(,6 WKH&$6KDVQRW\HWFOHDUHGDOO SODQQLQJKXUGOHVDVWKHLVVXHRI WKHPHGLHYDOIDEULFLQWKH9LFDU 6WUHHW KRXVHV KDV QRW EHHQ ¿ QDOLVHG´

13*/54*(/"(&

-69(33@6<97905; :0.5(.,5,,+:

(/LIYVU)\ZPULZZ7HYR2PSRLUU` ;LSLWOVUL! 'RPSRLUU`WYPU[ ZHSLZ'RPSRLUU`WYPU[JVT^^^RPSRLUU`WYPU[JVT


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 13


14 | NEWS

KILKENNY REPORTER 26 2 2014

In the Oireachtas

By Tim Ryan Oireachtas Correspondent

Family centre of great pride

Adult learning day in Newpark Close 1(:3$5. &ORVH )DPLO\ 5HVRXUFH &HQWUH LQ DVVRFLD WLRQ ZLWK $217$6 WKH ,ULVK 1DWLRQDO $GXOW /HDUQLQJ 2UJDQLVDWLRQ ZLOO KRVW DQ RSHQ PRUQLQJ FHQWUHG RQ $GXOW /HDUQLQJ RQ )ULGD\ )HEUXDU\  IURP DP WR SP 'HPRQVWUDWLRQV DQG DGYLFH ZLOOEHDYDLODEOHRQJDUGHQLQJ FRPSXWHUVDQGFRRNHU\ 3URIHVVLRQDO VHUYLFH SURYLG HUV IURP WKH 9(& -REV¶ &OXE .LONHQQ\ /HDGHU 3DUWQHUVKLS

DQG2UPRQGH&ROOHJHZLOOVXS SO\LQIRUPDWLRQRQDYDULHW\RI HGXFDWLRQDQGZRUNUHODWHGRS SRUWXQLWLHV ,I\RXKDYHDERRN\RX¶GOLNH WRVZDSEULQJLWDORQJDQG\RX FDQ DYDLO RI D ERRN H[FKDQJH VFKHPHZKLFKZLOOEHLQRSHUD WLRQRQWKHPRUQLQJ 7KLVLVDQLGHDORSSRUWXQLW\WR PDNH FKDQJHV ZKLFK ZLOO KDYH D SRVLWLYH LPSDFW RQ \RXU OLIH :K\QRWJLYHLWDWU\"&RPSOL PHQWDU\OLJKWUHIUHVKPHQWVZLOO EHDYDLODEOH

7+( ODUJHVW QXPEHU RI FRP SODLQWV WKH ODUJHVW QXPEHU RI ZKLVWOHEORZHUV DQG WKH ODUJHVW QXPEHURIWKRVHZKRKDYHJHQ HUDOO\ H[SUHVVHG FRQFHUQ FRPH ZLWKLQ WKH 6WDWH¶V RUJDQLVDWLRQ 'HSXW\ -RKQ 0F*XLQQHVV WROG WKH'iLO 6SHDNLQJ RQ D QHZ 3URWHFW HG 'LVFORVXUHV %LOO KH VDLG WKURXJKWKH\HDUVDQGGLIIHUHQW *RYHUQPHQWVZHKDYHIDLOHGWR SURWHFWWKHSHRSOH ³3URWHFWLQJ WKH SHRSOH LV WKH EDVLF MRE RI DQ\ JRYHUQPHQW DQG ZH KDYH IDLOHG PLVHUDEO\´ KH VDLG ³,Q IDFW RXU PDQDJH PHQW RI FRPSODLQWV DQG ZKLV WOHEORZHUV KDV EHHQ VORSS\ ,W KDV VKRZQ FRPSOHWH GLVUHJDUG IRU WKHLU ULJKWV ,W KDV VKRZQ FRPSOHWHGLVUHJDUGIRUWKHFRP SODLQV WKH\ PDNH HYHQ WKRXJK LWLVLQWKHLQWHUHVWRIWKH6WDWH´ ³7KHSHUVRQZKRLQJRRGIDLWK FRPHVIRUZDUGZLWKDFRPSODLQW LVRIWHQWKHRQHZKRZLOOHQGXS EHLQJWKHYLFWLP´KHVDLG ³7KH SHUVRQ¶V KHDOWK ZLOO EH EURNHQ7KHLUMREZLOOSUREDEO\

ILHOGV Fields Jewellers Kilkenny have been open in MacDonagh Junction for 7 years now and are constantly updating our brands and stock to ensure that we remain one of the leading jewellers in our area. In 2013 we introduced new brands such as Michael Kors and Kenneth Cole Watches and Mi Moneda Chains and Discs. Already in 2014 we have extended our Mi Moneda range to include Rings, Long Chains and Bracelets. We have also introduced Marc by Marc

Jacobs Watches and in June we are extending our Michael Kors range to include Jewellery. We also have our own in house brands such as Satisfashion, Angelique, Jacques Esteve and Apassionata. We have our new full range of Communion and Confirmation medals and gifts in store. Sign up for the Fields Priviledge Card in store, you can shop online at our website www.fields.ie or you can find us on facebook.

â&#x20AC;&#x2DC;We have failed to protect our peopleâ&#x20AC;&#x2122; EH JRQH7KH\ ZLOO QRW EH DEOH WRVHUYHDQ\PRUH $SSDOOLQJVLWXDWLRQ ³7KDWLVWKHKLVWRU\RIWKLVLI RQH ORRNV EDFN RQ LW 7KH\ DUH WKH RQHV ZKR KDYH WULHG WR GR WKH 6WDWH VRPH VHUYLFH ,W LV DQ DSSDOOLQJVLWXDWLRQ´ ,Q DQ\ %LOO OLNH WKLV 'HSXW\ 0F*XLQQHVV VDLG WKHUH LV D QHHG WR ORRN DW WKH LVVXHV WKDW WKH6WDWHKDVIDFHGRYHUWKHSDVW IHZ\HDUVSDUWLFXODUO\LQUHFHQW WLPHV ³7KHUH DUH GLIIHUHQW W\SHV RI ZKLVWOHEORZHU 7KHUH LV WKH ZKLVWOHEORZHU DERXW WKH MRE 7KHUH LV VRPHRQH ZKR FRPHV IRUZDUG RXW RI WKH H[SHULHQFH LQGHDOLQJZLWKWKH6WDWHDQGLV ZLOOLQJ WR SXW KLV RU KHU H[SH ULHQFHVLQWKHSXEOLFGRPDLQVR WKH6WDWHFDQOHDUQIURPWKHPLV WDNHVDQGWKHUHLVDQHHGIRUWKH 6WDWHWRUHVSRQGLQDVXSSRUWLYH ZD\ WKDW SURWHFWV WKDW SHUVRQ¶V SRVLWLRQLQOLIHMRERUFUHGLELO LW\ LQ WHUPV RI KRZ KH RU VKH SXWIRUZDUGWKHFRPSODLQWLQWKH ¿UVWSODFH´

Oâ&#x20AC;&#x2122;Neill seeks urgent beef debate $1 85*(17 GHEDWH RQ WKH

Deputy John McGuinness

Senator Pat Oâ&#x20AC;&#x2122;Neill

EHHILQGXVWU\ZDVVRXJKWLQWKH 6HDQDGE\.LONHQQ\6HQDWRU3DW 2¶1HLOOZKRVDLGWKHLQGXVWU\LV LQFULVLV ³,W WDNHV IRXU WR VL[ ZHHNV IRU IDUPHUV WR JHW DQLPDOV LQWR IDFWRULHV DW ZKDW LV D YHU\ GH SUHVVHGSULFH´KHVDLG ³2Q WKH EHVW DGYLFH WKH\ KDG UHFHLYHG DERXW )RRG +DUYHVW  IDUPHUV HVSHFLDOO\ GDLU\ IDUPHUVZHUHDVNHGWRSURGXFH EXOO EHHI $URXQG  PLOOLRQ DQLPDOV DUH WR EH VODXJKWHUHG WKLV \HDU LQ ,UHODQG ZKLFK LV DURXQG  D ZHHN )DFWR ULHV DUH QRW DEOH WR FRSH ZLWK WKRVH QXPEHUV DV ZH GR QRW KDYHWKHPDUNHWV

³8QIRUWXQDWHO\ RYHU WKH QH[W IRXU \HDUV ZH DUH JRLQJ WR VHH D ULVH RI  FDWWOH WR EH VODXJKWHUHG HYHQ WKRXJK ZH GR QRW KDYH WKH PDUNHWV :H KDYH VHHQ WKH KHDGOLQHV DERXW QHZ PDUNHWV LQ /LE\D /HEDQRQ DQG -DSDQ DV ZHOO DV WKH *XOI 6WDWHV UHRSHQLQJ IRU ,ULVK EHHI EXW ZKDW DUH %RUG %LDRUWKHIDFWRULHVGRLQJ"7KH\ GRQRWVHHPWREHVRXUFLQJWKHVH PDUNHWV WKDW DUH QRZ RSHQ WR XV´ 6HQDWRU 2¶1HLOO VDLG IDUPHUV DUH QRW JRLQJ WR VWD\ LQ EHHI SURGXFWLRQ DW WKH FXUUHQW SULFH VRWKHUHZDVDQHHGWRKDYHDQ XUJHQWGHEDWHLQWKH+RXVH


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 15


16 | NEWS

KILKENNY REPORTER 26 2 2014

Brown is beautiful for community Bridge Over Troubled Waters 7+( %HQQHWWVEULGJH &RPPX QLW\ +DOO /WG KDV QRZ UHFHLYHG ¼LQ%URZQ(QYHORSHGR QDWLRQV 7KDQNV WR DOO ZKR FRQWULE XWHG7KHWRWDOFRQWLQXHVWRULVH DV FRQWULEXWLRQV Ã&#x20AC;RZ LQ IURP SHRSOHZKRGLGQ¶WJHWDURXQGWR GRQDWLQJEHIRUH&KULVWPDV 7KHUHQRYDWLRQSURMHFWLVJRLQJ ZHOOZLWKKHDWLQJDQGSOXPELQJ ZRUN FRPSOHWHG  7KH NLWFKHQ KDV MXVW EHHQ LQVWDOOHG DQG H[ WHUQDO SDLQWLQJ ZLOO FRPPHQFH RQFHWKHZHDWKHULPSURYHV

 ([WHUQDO JURXQG ZRUNV DUH SURJUHVVLQJ ZHOO DQG HOHFWULFDO ZRUNV DUH DOPRVW FRPSOHWHG 7KHSURMHFWLVUXQQLQJWRVFKHG XOH LQ VSLWH RI GLI¿FXOW ZHDWKHU IRUWKHFRQVWUXFWLRQWHDP 7KHEXLOGHUKDVUHTXHVWHGWKDW ORFDO UHVLGHQWV EH PDGH DZDUH RIWKHGDQJHUVRIHQWHULQJDFRQ VWUXFWLRQVLWHDQGDVNVWKDWSHR SOH UHIUDLQ IURP JRLQJ RQWR WKH VLWHZKLOHZRUNLVRQJRLQJ $OO HQTXLULHV UHJDUGLQJ WKH ZRUNV VKRXOG EH GLUHFWHG WR WKH KDOOFRPPLWWHH

Anti-Austerity Alliance prepares to fight /2&$/ HOHFWLRQV FDQGLGDWH &RQRU 0DF/LDP KDV WROG 7KH 5HSRUWHU WKDW 7KH $QWL $XVWHULW\ $OOLDQFH LV QRZ UHJLVWHUHG DV D SROLWLFDO RU JDQLVDWLRQDQGWKHQDPHZLOO DSSHDU EHVLGH FDQGLGDWHV¶ QDPHVRQWKHEDOORWSDSHUV LQ0D\ ³7KLV LV D LV YHU\ ZHOFRPH GHYHORSPHQW ,QGHSHQGHQWV DQG PDYHULFNV DUH DOO ZHOO DQGJRRGEXWWKHUHLVDQHHG IRUDQDWLRQDODOWHUQDWLYHDQG IRUXQLW\DURXQGDJUHHGDLPV WREHHIIHFWLYH´VDLG&RQRU ³,W LV YHU\ VLJQL¿FDQW WKDW WKH $$$ KDV EURXJKW WR JHWKHU H[SHULHQFHG DQG QHZ FDQGLGDWHV ,I ZH ZDQW UHDO FKDQJHWKHQRUGLQDU\SHRSOH KDYHWRVWHSIRUZDUGDQGUH

SODFHWKHKDFNVIURPWKHHV WDEOLVKPHQWSDUWLHV 2UGLQDU\ZRUNHUV ³7KDWLVZKDWLVKDSSHQLQJ ZLWKWKH$$$PRVWRIZKRP DUHRUGLQDU\ZRUNHUVRUXQ HPSOR\HG SHRSOH DQG ¿UVW WLPHFDQGLGDWHV´ &RQRU VDLG $$$ FRXQFLO ORUV ZLOO QRW YRWH IRU FXWV LQ FRXQFLOVHUYLFHVIRUDXVWHULW\ EXGJHWV RU WDNH SDUW LQ MXQ NHWV7KH\ZRQ¶WPDNHGHDOV RQ WKH FRXQFLO ZLWK WKH SDU WLHV LPSOHPHQWLQJ FXWV WKH EDQN EDLORXW DQG DXVWHULW\ RYHU WKH ODVW VL[ \HDUV ³:H ZLOOEHDSULQFLSOHGIRUFHRQ WKH FRXQFLOV DQG ZLOO DVVLVW FRPPXQLWLHV LQ GHIHQGLQJ VHUYLFHV ¿JKWLQJ FXWV DQG QHZFKDUJHV´KHDGGHG Conor Macliam

,7 ,6 SHUKDSV DSW WKDW (OYLV VKRXOG EH VHW WR YLVLW WKH JRRG SHRSOH RI WKH YLOODJH RI %HQ QHWWVEULGJHIROORZLQJWKHUHFHQW VWRUPDQGÃ&#x20AC;RRGV )RU DPRQJ (OYLV¶V EULOOLDQW UHFRUGLQJ UHSHUWRLUH LV µ%ULGJH 2YHU 7URXEOHG :DWHUV¶ DQG QRGRXEWWKHQXPEHUZLOOJHWD EODVW DW D IXQGUDLVLQJ HYHQLQJ IRU WKH ORFDO 7LG\ 7RZQV LQ 7KH &RUQHU +RXVH %DU RQ 0DUFK (OYLVPDNHVDZHOFRPHUHWXUQ WR WKH YLOODJH DQG WLFNHWV ¼ FDQ EH ERXJKW IURP DQ\ RI WKH 7LG\7RZQVFRPPLWWHH 3OHDVHEX\DWLFNHWHYHQLI\RX FDQ¶WDWWHQGLVWKHDVN7KHUHLV DVXSHUGRRUSUL]HRIDKDPSHU RI Ã&#x20AC;RZHUV IURP )ORZHU 3RZHU *DUGHQ &HQWUH 'XEOLQ 5RDG .LONHQQ\ 7KH 7LG\ 7RZQV KDYH PDQ\ SODQV IRU  $ ODQGVFDSLQJ SURMHFW KDV EHHQ GUDZQ XS IRU WKHYLOODJHWRWDNHDGYDQWDJHRI WKH.LONHQQ\&RXQW\&RXQFLO¶V RIIHURIWUHHV $Q 7DLVFH 1DWLRQDO 6SULQJ &OHDQZLOOEHKHOGLQWKHYLOODJH RQ 0DUFK  µ7KH *UHHQ 'RJ :DONHUV¶ &DPSDLJQ¶ KDV EHHQ ODXQFKHG 7KH GRJ SRRK LQ WKH YLOODJH KDVEHHQKLJKOLJKWHGLQDUHFHQW VXUYH\ DV D ELJ SUREOHP <RX FDQMRLQWKHFDPSDLJQE\FOLFN LQJRQWKLVOLQNDQG\RXZLOOJHW D FRPSOLPHQWDU\ JUHHQ GRJ ZDONHU¶VDUPEDQGDQGDµGRJJLH ERQH¶SRRSEDJGLVSHQVHU

Elvis Presley <RXU FRQWDFW LV KWWSZZZ NLONHQQ\FRFRLHHQJ6HUYLFHV (QYLURQPHQW/LWWHU*UHHQ'RJ :DONHU2QOLQHKWPO $ELJHGXFDWLRQSODQRQELGL YHUVLW\LVLQSURJUHVVDQGD7LG\

7RZQV ZHEVLWH LV XQGHU FRQ VWUXFWLRQ WKDQNV WR $FH &RP SXWHUVDQG.LHUDQ'DYLQ 9ROXQWHHUV ZLOO EH RXW SDLQW LQJDQGSODQWLQJDVWKHZHDWKHU LPSURYHV


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 17


18 | NEWS

KILKENNY REPORTER 26 2 2014

Community John stands for election -2+1 %85.( ZKR OLYHV ZLWK KLV ZLIH -RVHSKLQH DW 7XUN VWRZQ)LGGRZQZLOOEHDQ,Q GHSHQGHQWFDQGLGDWHIRUWKHOR FDOHOHFWLRQVLQ0D\ :KHQ-RKQD:DWHUIRUGPDQ ZHQWWROLYHWR3LOWRZQLQ KHZDVDIRXQGHUPHPEHURIWKH 6RXWK.LONHQQ\+RW5RG&OXE +HMRLQHGPDQ\YROXQWDU\DQG SDULVKJURXSVDQGRUJDQLVDWLRQV WR KHOS GHYHORS WKH SDULVK RI 7HPSOHRUXPDQGVXUURXQGV -RKQKDVEHHQDJUHDWFRPPX QLW\ZRUNHUIRU\HDUVDQGKH LV QRZ LQYROYHG LQ PDQ\ ORFDO JURXSV LQFOXGLQJ EHLQJ FKDLU PDQRIWKH3LOWRZQ&RPPXQLW\ &HQWUH DQG  FKDLU RI WKH 6RXWK .LONHQQ\FRPPXQLW\JURXSV +H LV DOVR D PHPEHU RI WKH /HDGHU %RDUG WKH 3ROLFLQJ %RDUG 3LOWRZQ 'HYHORSPHQW $XWKRULW\DQGLVFKDLURIWKH3LO WRZQ$OORWPHQWVZKLFKZRQWKH $OO,UHODQGDZDUGODVW\HDU +H LV FKDLUPDQ RI 3LOWRZQ 6QRRNHU FOXE 6SRUWV¶ &RXQFLO 63&.LONHQQ\&RXQW\&RXQFLO +HKDVZRUNHGWLUHOHVVO\WRKHOS EXLOGWKHSDULVKRI7HPSOHRUXP $JRRGUHVSRQVH +H KDV KHOSHG WR GHYHORS ,YHUN 6KRZ 3LOWRZQ &RPPX QLW\&HQWUHDQGKDVVSHQWVRPH \HDUV QHJRWLDWLQJ DORQJ ZLWK (DPRQQ0HDGHWRKDYHDIRRW SDWKIURP3LOWRZQWR)LGGRZQ <HDUV DJR WKHUH ZDV D SDWK

Mark McGrath

John Burke ZKLFKZDVXVHGE\WKRVHZDON LQJ WR WKH &KXUFK RI ,UHODQG &KXUFK DQG JRLQJ WR )LGGRZQ 5DLOZD\6WDWLRQDOVRDSDWKRQ 7RZHU5RDG $ IHZ RI KLV SURMHFWV LQFOXGH WKH IRRWSDWK IURP WKH ,YHUN 6KRZVQGDSDWKIURP7RP7HQ Q\VRQ¶VSUHPLVHVWRWKH3LOWRZQ )&JURXQGV &RPSOHWHG WRR ZDV SXE OLF OLJKWLQJ IURP WKH QDWLRQDO VFKRRO WR WKH *$$ VSRUWV¿HOG +LV ODWHVW SURMHFW LV IRU D SOD\ JURXQGIRU3LOWRZQ9LOODJH -RKQ KRSHV WR JHW D JRRG UH VSRQVH RQ SROOLQJ GD\ +H LV QRZ GRLQJ DERXW  GD\V RI YROXQWDU\ZRUNUHSUHVHQWLQJRQ ORFDOJURXSVLQFOXGLQJWKH6WUD WHJLF3ROLF\&RPPLWWHHIRUZDUG SODQQLQJ DQG GHYHORSPHQW DW .LONHQQ\&RXQW\&RXQFLO

Our Uke Orchestra is recruiting 7+(µ8NHQ¶G¶:DOO2UFKHVWUD¶ LV ORRNLQJ IRU QHZ PHPEHUV EHJLQQHUVDQGWKRVHZLWKH[SH ULHQFHRQRWKHULQVWUXPHQWV 7KH SURMHFW ZDV LQDXJXUDWHG ODVW 2FWREHU E\ .LONHQQ\ JXL WDULVW 0DUN $QWKRQ\ 0F*UDWK DQG RIIHUV WXLWLRQ RQ XNXOHOH IRUSOD\HUVRIDOOOHYHOVDVZHOO DV WKH RSSRUWXQLW\ WR SOD\ LQ

.LONHQQ\¶V XNXOHOH RUFKHVWUD ZKLFK ZLOO FXOPLQDWH LQ D FRQ FHUWSHUIRUPDQFHDWWKH+ROHLQ WKH:DOOLQ-XQH 7KHXNXOHOHKDVKDGDWUHPHQ GRXV UHVXUJHQFH LQ SRSXODULW\ LQ UHFHQW WLPHV H[HPSOL¿HG E\ JURXSVVXFKDVµ7KH8NHOHOH2U FKHVWUDRI*UHDW%ULWDLQ¶DQGWKH µ:HVW&RUN8NHOHOH2UFKHVWUD

³7KH XNHOHOH LV SUREDEO\ WKH PRVWDFFHVVLEOHDIIRUGDEOHDQG µIXQ¶LQVWUXPHQWVRIDOODQGFDQ EH HDVLO\ OHDUQHG E\ FRPSOHWH EHJLQQHUV RU E\ WKRVH ZLWK H[ SHULHQFH RI RWKHU LQVWUXPHQWV´ 0DUNH[SODLQV ,QWKH7KXUVGD\VHVVLRQV0DUN ZLOO WHDFK VRQJ DFFRPSDQL PHQWV DQG LQVWUXPHQWDO WHFK

QLTXHVDQGFRPELQHVEHJLQQHUV DQG PRUH DGYDQFHG SOD\HUV LQ WKHµ8NHLQWKH:DOO2UFKHVWUD¶ SHUIRUPLQJ PXVLF LQ D UDQJH RIPXVLFDOVW\OHVRQWKHLQVWUX PHQW $Q\ERG\ LQWHUHVWHG VKRXOG FRQWDFW0DUN± 7HO  RU PDUNDQ WKRQ\PFJUDWKFRP


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 19


&

Opinion Comment We must fight for our post offices

Itâ&#x20AC;&#x2122;s time to get rid of the party whip

7

+(5(LVDÃ&#x20AC;LFNHURIOLJKWDWWKH HQGRIZKDWIRU\HDUVKDVEHHQ D YHU\ GDUN WXQQHO 7KH SDUW\ ZKLS V\VWHP WKDW DQWLWKHVLV RI GHPRFUDF\LVXQGHUWKUHDW 7KHUHLVKRSHWKDWWKHSROLWLFDO µVKHHS¶IRUVRORQJFRUUDOOHGE\ WKRVH ZKR ZRXOG VLW FRPIRUW DEO\XQGHUWKHXPEUHOODRIµGLFWDWRUVKLS¶FRXOGEH JLYHQWKHLUIUHHGRP $PDQRIFRXUDJHDQGFRQYLFWLRQDGHFHQWPDQ ZKRVSHDNVKLVPLQGDQGLVQRWDIUDLGWRKDYHKLV NQXFNOHV UDSSHG RU KLV EDFNVLGH NLFNHG PD\ EH DERXWWROHDG,ULVKSROLWLFVRUDWOHDVWDVHFWLRQRI LWRXWRIWKHGDUNDJHV

â&#x20AC;&#x153;

WE CAN ALMOST HEAR THE HEARTY APPLAUSE BY SENSIBLE, HONOURABLE AND HONEST PEOPLE AROUND OUR COUNTRY AS THEY DELIVER A COLLECTIVE VOTE OF APPROVAL

3HWHU 0DWKHZV DQ DIIDEOH KXPDQ EHLQJ ZKR ZDVHMHFWHGIURP)LQH*DHOIRUYRWLQJDJDLQVWWKH SDUW\ RQ DERUWLRQ LV FDOOLQJ IRU D UHIHUHQGXP WR DEROLVKWKHSDUW\ZKLSV\VWHP :HFDQDOPRVWKHDUWKHKHDUW\DSSODXVHE\VHQ VLEOH KRQRXUDEOH DQG KRQHVW SHRSOH DURXQG RXU FRXQWU\ DV WKH\ GHOLYHU D FROOHFWLYH YRWH RI DS SURYDO 3HWHU KDV WDEOHG OHJLVODWLRQ ZKLFK LI SDVVHG ZRXOGOHDGWRDUHIHUHQGXPWKDWFRXOGJLYH7'V WKHULJKWWRIUHHGRPRIFRQVFLHQFH +LVFDOOLVIRU,UHODQGWRIROORZLQWKHSROLWLFDO IRRWVWHSVRI*HUPDQ\DFRXQWU\LQZKLFKSROLWL FLDQVDUHDOORZHGWRYRWHDFFRUGLQJWRWKHLUFRQ VFLHQFHUDWKHUWKDQEHLQJVKHSKHUGHGLQWROLQHDQG

$

JIMMY RHATIGAN WROGWRYRWHDSDUWLFXODUZD\µRUHOVH¶ 6RPHLQRXUORFDOFRQVWLWXHQF\PD\QRWEHIDPLO LDUZLWKWKHVDLG3HWHUEXWZHKDYHDIHHOLQJWKDW WKH\ ZLOO EH VHHLQJ DQG KHDULQJ IURP KLP PRUH RIWHQQRZWKDWKHLVOHDGLQJZKDWZHUHVSHFWIXO O\ FDOO D EDWWOH IRU IUHHGRP D ¿JKW WR WKURZ RII VKDFNOHVDQGÃ&#x20AC;LQJWKHPLQWRWKHGXVWELQRIWLPH 3HWHULVD7'IRU'XEOLQ6RXWK¿UVWHOHFWHGLQ DV)*DQG/DERXUZHUHVZHSWLQWRSRZHUE\ DQDQJU\HOHFWRUDWHGHWHUPLQHGWREXU\)LDQQD)iLO DQGWKHLUDOOLHV+HZDVWXUIHGRXWE\)*OHDGHU VKLSLQEHFDXVHKHUHIXVHGWRGRZKDWKHZDV WROG ,Q VKRUW KH VKRZHG WKDW KH KDG D PLQG RI KLV RZQDQGWKDWLVDWUDLWWKDWLVQRWDOZD\VDSSUHFL DWHGE\SROLWLFDOOHDGHUVSDUWLFXODUO\ZHDNRQHV 7KHUH ZLOO EH WKRVH ZKR KDYH HQMR\HG 3HWHU¶V FRQWULEXWLRQDVDUHJXODUSDQHOOLVWRQ7RQLJKWZLWK 9LQFHQW%URZQHRQ799LHZHUVPD\QRWDOZD\V DJUHHZLWKKLVXWWHUDQFHVEXWKHLVDPDQZKRLVQRW DIUDLGWRRSHQKLVPRXWKRUWKDQNIXOO\KLVHDUV ,QUHFHQWWLPHVDQH[FHOOHQWSURJUDPPHKDVRI WHQEHHQOLYHQHGXSE\EULOOLDQWDQGDWWLPHVOLJKW KHDUWHG H[FKDQJHV EHWZHHQ 3HWHU DQG 9LQFHQW %RWKFDQWKURZDQGWDNHSXQFKHV 1RZWKDW3HWHUKDV¿UHGWKH¿UVWVKRWVLQDZDUWR GRDZD\ZLWKWKHZKLSV\VWHPLWZLOOEHLQWHUHVW LQJ WR VHH KRZ PDQ\ SROLWLFLDQV DUH SUHSDUHG WR EDFNKLP 7KHSRVVLELOLW\LVWKDWWKHUHZLOOEHSUHVVXUHRQ WKHSROLWLFDOIHQFHDVVRPHKHGJHWKHLUEHWVZDLW LQJWRVHHZKLFKZD\WKHFRRNLHFUXPEOHV 2XUJUHDWZLVKLVWKDWµDZKLSRUQRZKLS¶UHI HUHQGXPRSSRUWXQLW\ZLOOEHJLYHQWRRXUSHRSOH 6XFK DQ HYHQW PD\ FDXVH D IHZ VOHHSOHVV QLJKWV IRUDOOSDUW\OHDGHUVDV)LDQQD)iLO)LQH*DHO/D ERXUDQG6LQQ)pLQDOORSHUDWHZKLSV\VWHPV :LOO WKH KHDG KRQFKRV FLUFOH WKH ZDJRQV ZDJ WKHLU ¿QJHUV DQG WHOO XV WKDW LW ZRXOG EH LPSRVVL EOHWRJRYHUQSURSHUO\ZLWKRXWWKHZKLS"7KDWLVD GLVWLQFWSRVVLELOLW\%XWWKHUHLVWKHSUREDELOLW\WKDW WKH\ZLOOZDLWWRVHHZKDWZD\WKHZLQGEORZVDQG WKHQKLWFKWKHLUZDJRQVWRDSDUWLFXODUSRLQWRIYLHZ 7KH ZKLS V\VWHP LV QRW RQO\ DQ DIIURQW WR WKH SHRSOH RI RXU FRXQWU\ ,W LV DOVR GLVUHVSHFWIXO WR RXUHOHFWHGUHSUHVHQWDWLYHVZKRDIWHUDOODUHYRWHG LQVRWKDWWKH\FDQEULQJWKHZDQWVDQGWKHQHHGV RIWKHLUORFDOFRQVWLWXHQWVWRWKHGHFLVLRQWDEOH 6R ZKDW LV WKH SRLQW RI HOHFWLQJ SHRSOH LI WKH\ DUHEHLQJWROGZKDWZD\WRYRWHUDWKHUWKDQDVNHG ZKDWZD\WKH\ZDQWWRFDVWWKHLUYRWHV" 3HWHU0DWKHZVPD\QRWEHDKRXVHKROGQDPHLQ RXU FRXQWU\ WRGD\ %XW LI KLV SODXVLEOH HIIRUWV WR KRLVWWKHÃ&#x20AC;DJRIGHPRFUDF\RYHU'iLOeLUHDQQEHDU IUXLWWKHQZHEHOLHYHKHZLOOHQMR\WKHWKDQNVDQG UHVSHFWRIDPDMRULW\RIRXUSHRSOHDQGZLOOHYHQ WXDOO\ OHDYH D ZRQGHUIXO OHJDF\ D OHJDF\ ZKLFK KLVGHVFHQGDQWVFDQDOZD\VFKHULVKZLWKSULGH 2YHUWKHFRPLQJPRQWKVWKHUHZLOOQRGRXEWEH DIRFXVRQKRZRXUORFDOSROLWLFLDQVYLHZDQ\DW WHPSWWRGURSWKHZKLS7KDWPD\EHTXLWHLQWHU HVWLQJ

â&#x20AC;&#x153;

POST OFFICES HAVE ALWAYS BEEN MEET AND GREET CENTRES WHERE PEOPLE FOUND OUT WHO WAS ILL, WHO PASSED AN EXAM OR WHO EMIGRATED. ALL HUMAN LIFE WAS THERE

1<$77(037WRFORVHGRZQ ORFDOSRVWRI¿FHVDQGJLYHWKH EXON RI WKHLU EXVLQHVVHV WR EDQNVVKRXOGEHEORZQRXWRI WKHZDWHU 2XUFRPPXQLWLHVKDYHWDN HQ HQRXJK KDUGVKLS *DUGD 6WDWLRQV KDYH EHHQ FORVHG OHDYLQJSHRSOHZLWKRXWWKHIULHQGO\IDFHRIDPDQ RU ZRPDQ ZKR ZDV FROORTXLDOO\ UHIHUUHG WR DV µRXU*XDUG¶ :H ZHUH DVVXUHG WKDW SROLFLQJ ZRXOG EH EHWWHU WKDQHYHUHYHQWKRXJKVWDWLRQVZHUHEROWHGXSDQG WKRVHZKRUHWLUHGZHUHQRWUHSODFHG :HZLOOQRGRXEWEHWROGWKDWVKXWWLQJSRVWRI ¿FHVZLOODOVREHJRRGIRUXVDQGLQGHHGIRUOR\DO ZRUNHUV ZKR ZLOO ORVH WKHLU MREV :KDW NLQG RI IRROVGR*RYHUQPHQWWDNHXVIRU" $ORQJZLWKORFDOSXEVDQG*DUGD6WDWLRQVRXU SRVW RI¿FHV SDUWLFXODUO\ WKRVH LQ UXUDO ,UHODQG KDYHEHHQWKHIXOFUXPRIFRPPXQLWLHVWKHVRFLDO KHDUW RI D SDULVK D SODFH RI EXVLQHVV D KXUOLQJ FKDWHYHQDQDWWHUDERXWµWKHZHDWKHU¶ 3RVW RI¿FHV KDYH DOZD\V EHHQ PHHW DQG JUHHW FHQWUHVZKHUHSHRSOHIRXQGRXWZKRZDVLOOZKR SDVVHGDQH[DPRUZKRHPLJUDWHG$OOKXPDQOLIH ZDVWKHUH 3XEV VRFLDO FHQWUHV IRU PDQ\ DUH QRZ RXW RI ERXQGV EHFDXVH RI GULQN GULYLQJ UHJXODWLRQV EURXJKWLQWRVDYHOLYHVEXWZLWKQRDOWHUQDWLYHIRU WKRVHZKRVHZHHNO\WUHDWZDVDIHZSLQWVZLWKWKH ODGVRUODVVLHV *DUGD6WDWLRQVDUHEDGO\PLVVHG7KH\ZHUHWKH HVVHQFHRIORFDOVHFXULW\SODFHVZKHUHDIDPLO\LQ GLVWUHVVZRXOGEHJXDUDQWHHGDIULHQGO\HDU 3DUWRIDZRQGHUIXOWULQLW\QRZIDFHVWKHD[H 7KHSRVWRI¿FHLVXQGHU¿UHDVSODQVDUHWRGLYHUW VRFLDOZHOIDUHEXVLQHVVIURPWKHWULHGDQGWUXVWHG WRWKHEDWWHUHGZRUOGRIEDQNLQJ 7KDW LV VR VDG ,I SURFHHGHG ZLWK LW ZLOO PDQ JOHDQRWKHUJUHDWEDVWLRQRIGHFHQF\REOLWHUDWHD ZDUP YHQXH ZKHUH SDULVKLRQHUV PHHW D UHDVRQ WRµJRWRWRZQ¶WRZQSHUKDSVEHLQJDPHUHKDP OHW ZLWK D SDULVK FKXUFK D VWUXJJOLQJ SXE DQG D ERDUGHGXS*DUGD6WDWLRQ 7KRVH JLYHQ WKH MRE RI SODQQLQJ WKH ,UHODQG RI WRPRUURZ DUH FUHDWLQJ DQ DOPLJKW\ PHVV FDULQJ QRWDKRRWIRUORFDOIDPLOLHVHQVXULQJRQO\WKDWUX UDO,UHODQGGRZQWKHURDGZLOOEHDGHVRODWHSODFH DUHOLFRIROGGHFHQF\GRWWHGZLWKYDFDQWFRXQWU\ KRPHV <RXQJVWHUV ZKR VFDWWHUHG DURXQG WKH ZRUOG ZKHQDXVWHULW\VWUXFNZLOOKDYHIRQGPHPRULHVRI KRPH7KH\ PD\ UHWXUQ WR ZKHUH WKH\ SOD\HGDV FKLOGUHQ %\WKHQUXUDO,UHODQGFRXOGEHDGHVRODWHJUDYH \DUGDSODFHRISLOJULPDJHIRUHPLJUDQWFKLOGUHQ DQG WKHLU FKLOGUHQ ZHDWKHUEHDWHQ DQG XQNHSW IDPLO\KRPHV¿HOGVRIUDJZRUWWKLVWOHDQGGRFN QR[LRXVZHHGVVPRWKHULQJSORWVWKDWRQFHSURYLG HGYHJHWDEOHVWRIHHGKXQJU\FKLOGUHQ 9LVLWRUVPD\VKHGDWHDUVD\DVLOHQWSUD\HUDQG SHUKDSVQHYHUUHWXUQWRDELUWKSODFHWKDWZDVRQFH DWKULYLQJFRPPXQLW\EXWLVQRZDZDVWHODQGZLWK QRQHHGIRUD*DUGD6WDWLRQSXERUSRVWRI¿FH 3ROLWLFLDQVZLOODFFXVHXVRIH[DJJHUDWLQJ :HORVWWKHEDWWOHWRNHHS*DUGD6WDWLRQVDQGWR NHHS FRPPXQLW\ SXEV DOLYH 1RZ FRPHV D ZDU ZKLFKLIORVWPD\OHDGWRYLOODJHQDPHSODWHVEHLQJ WRUQGRZQDQGUHSODFHGZLWKVLJQDJHZLWKDKDU URZLQJPHVVDJHµ&ORVHGIRUEXVLQHVV¶ :HFULWLFLVHGWKHFORVXUHRI*DUGD6WDWLRQVDQG ODPHQWHGWKHGHDWKRISXEV :HUHZHH[DJJHUDWLQJWKHQWRR"


ADVERTISEMENT | 21

26 2 2014 KILKENNY REPORTER

›’œ‘ȱŠ’˜—Š•ȱž The Irish National Stud is one of our country’s best locations for a celebration as well as just for a day out; it is an angelic stretch of land that enriches all who enter and leaves nothing to dbe desired. Founded in 1901 by Coloonel Hall Walker, the e location has been n e the home of some of the best thor-oughbred horses of the world; including Minoru, named after the designer of the Stud’s famous Japanese Garden, who took King Edward VII of England to victory in the 1909 derby. Along with its reputation as a breeding facility, the Irish National Stud is home to the divine, transcendent beauty of the aforementioned Japanese

Gardens. The garden was an attempt to depict the ‘Life of Man’ and is something worth being experienced by all. As well as this there is also St. Fiachra’s Garden and the Horse Museum to keep you yo entertained for the entire day. The location is perfect for communions and confirmations and also wedd dings and any o other celebrattion you could h have need of. A Along with the ou outdoor facilitie ties the Irish natio tional Stud also ha a restaurant, has children’s play area, gift shop, guided tours and an area for picnics; it is perfect for an entire family.


22 | NEWS

KILKENNY REPORTER 26 2 2014

Club House kitchen reopens after fire 7+( &/8% +RXVH +R WHO RQ .LONHQQ\¶V 3DWULFN 6WUHHW KDV UHRSHQHG IRU IXOO IRRG VHUYLFH WKLV ZHHN IRO ORZLQJ D ¿UH LQ WKH KRWHO¶V NLWFKHQV RQ )ULGD\ -DQXDU\ ODVW 1RWHG DV RQH RI .LONHQ Q\¶V ¿QHVW HDWHULHV WKLV LV D ZHOFRPH UHWXUQ IRU WKH PDQ\ OR\DO FXVWRPHUV ZKR IUHTXHQW WKH KRWHO¶V EDU DQG UHVWDXUDQW IRU LWV ZRQGHUIXO WUDGLWLRQDOVW\OHIRRGDQGLWV IDPRXVVWHDNV ³:HDUHGHOLJKWHGWRKDYH RXU NLWFKHQ DQG UHVWDXUDQW EDFNRSHQDQGZHDUHORRN LQJ IRUZDUG WR JHWWLQJ EDFN

WR EXVLQHVV´ *HQHUDO 0DQ DJHU ,DQ %UHQQDQ WROG 7KH 5HSRUWHU ³2XU NLWFKHQ LV WKH KHDUW RI WKH KRWHO DQG ZDV VRUHO\ PLVVHGZKLOHLWZDVFORVHG %HWWHUWKDQHYHU ³+RZHYHU ZH DUH QRZ EDFN EHWWHU WKDQ HYHU DQG DUHORRNLQJIRUZDUGWRZHO FRPLQJEDFNRXUPDQ\OR\DO VXSSRUWHUVDQGQHZFXVWRP HUVWRR :H DUH KXJHO\ JUDWHIXO WR DOO WKH SHRSOH RI .LONHQQ\ IRUWKHVXSSRUWVKRZQWRXV GXULQJWKLVUHFHQWHYHQW´ .LONHQQ\¶V WUXH 9LQWDJH +RWHO WKH &OXE +RXVH KDV

EHHQ SDUW RI WKH IDEULF RI FLW\DQGFRXQW\IRURYHU \HDUV 6LQFHSXUFKDVLQJWKHKRWHO RYHU\HDUVDJR-LP%UHQ QDQ DORQJ ZLWK KLV OR\DO KHDGFKHI7LP&OLIIRUGKDV EXLOW D UHSXWDWLRQ IRU ¿QH IRRG WKDW VWLOO VWDQGV WRGD\ DQG ZLOO KRSHIXOO\ UHPDLQ IRUPDQ\\HDUVWRFRPH 7KH KRWHO¶V NLWFKHQV UH RSHQHGRQ0RQGD\ Right: Jim and Ian Brennan, on left, with loyal staff at the Club House Hotel

Itâ&#x20AC;&#x2122;s advice time for farmers &,//Ã&#x2039;1)$50$GYLVRU\*URXS 6SULQJ  ,QIRUPDWLRQ 6HULHV ZLOO EH DW &LOOtQ +LOO .LONHQQ\ )HEUXDU\  'ROPHQ +RWHO &DUORZ 0DUFK  DQG WKH %UDQ GRQ +RXVH +RWHO 1HZ 5RVV RQ 0DUFK  0HHWLQJV VWDUW DW SP 7KHUH ZLOO EH D &$3 5HIRUP 8SGDWH RQ KRZ  GHFLVLRQV RQ WKH 6)3 PLJKW LQÃ&#x20AC;XHQFH HQ WLWOHPHQWVIURP¶ &RYHUHG ZLOO EH HQWLWOHPHQW YDOXHV JUHHQLQJ FURS GLYHUVL ¿FDWLRQ HFRORJLFDO IRFXV DUHDV DQGIRUHVWU\ 6SHDNHUV 'HSDUWPHQW RI$JUL FXOWXUHDQG,ULVK)DUPHUV-RXUQDO

µ5HFRPPHQGDWLRQV IRU  LPSOLFDWLRQV IRU  3UDFWLFDOLVVXHVWREHUHVROYHG  6SHDNHU &LOOtQ )DUP $GYLVRU\ *URXS 1HZ 1LWUDWHV 5HJXODWLRQV ZLOO EH FRYHUHG &KDQJHV DQQRXQFHG LQWKHLU,PSDFWRQIDUPHUV 6SHDNHU'HSDUWPHQWRI$JULFXO WXUH 2SWLPLVLQJ 1XWULHQW ,QSXWV )HUWLOLVHU SODQQLQJ IRU  6SHDNHU &LOOtQ )DUP $GYLVRU\ *URXS $,%GLVFXVVHVRXWORRNIRU6HF WRU 6SHDNHUV $,% $JUL $GYLV HUV (DPRQQ 2¶5HLOO\ DQG /LDP 3KHODQ

Noel ready to stand as independent member /2&$/DFWLYLVW1RHO*:DOVKLV WRVWDQGDVDQLQGHSHQGHQWLQWKH 0D\ORFDOHOHFWLRQV %RUQLQ)U$OEHUW3ODFH.LONHQ Q\KHLVDPHPEHURIDIDPLO\RI WHQER\VDQGWKUHHJLUOV +H QRZ OLYHV DW 1HZSDUN

&ORVH .LONHQQ\ &LW\ ZKHUH KLV PRWKHUVWLOOOLYHVDORQJZLWKRWK HUPHPEHUVRIKLVIDPLO\ +H ZDV HGXFDWHG DW WKH 'H /D 6DOOH .LONHQQ\ 9RFDWLRQDO 6FKRRO6W.LHUDQ¶V&ROOHJHDQG WKHQ XQLYHUVLW\ +H LV D IRUPHU

$ <281* ORFDO IDPLO\ LV VHW WR ERXQFH LQWR D QHZ EXVLQHVV YHQWXUH *HUU\ &DUUROO KLV ZLIH DQG WZR FKLOGUHQ ZLOO UXQ WKH HQ WHUSULVHIURPWKHLUKRPHRQWKH 7XOODURDQ 5RDG RQ WKH SHULSK HU\RI.LONHQQ\&LW\ 7KH SURMHFW LV FDOOHG %XVL

Family business for children

UHVLGHQW RI 6W -RVHSK¶V 2USKDQ DJH RQ WKH :DWHUIRUG 5RDG +H LV D NHHQ *$$ DQG UXJE\ VXS SRUWHU ,QDVWDWHPHQW1RHOOLVWVP\U LDG LVVXHV ZKLFK KH KRSHV WR ¿JKW RQ EHKDOI RI WKH SHRSOH RI

QHVV%RXQFLQJDQGDVWKHQDPH VXJJHVWV LW VSHFLDOLVHV LQ WKH KLUH RI ERXQF\ FDVWOHV FRPELV DQGREVWDFOHVFRXUVHV ,W ZLOO FDWHU IRU FKLOGUHQ XSWRWKHDJHRI7KHLQWHQ

WLRQLVWRFRYHUFRXQWLHV.LONHQ Q\/DRLV7LSSHUDU\DQG:DWHU IRUG *HUU\ VD\V DOO HTXLSPHQW LV IXOO\LQVXUHGDQGDOOLQÃ&#x20AC;DWDEOHV FRPH ZLWK UDLQ FRYHUV DQG

7HDPVRIIRXUFRVW¼

0DUFKSPLQWKH5LVLQJ 6XQ0XOOLQDYDW $OO SURFHHGV ZLOO JR WR WKH QHZFRPPXQLW\FHQWUHLQ0XO OLQDYDW 7LFNHWV ¼ LQFOXGLQJ GRRU SUL]H DUH RQ VDOH LQ OR FDO VKRSV DQG RXWOHWV DQG IURP FRPPXQLW\YROXQWHHUV

.LONHQQ\ +H KDV FDPSDLJQHG ORFDOO\ DJDLQVW WKH KRXVHKROG FKDUJH 1RHO GHVFULEHV KLPVHOI DV D ¿JKWHUDNLQWRDGRJZLWKDERQH DQGZRQ¶WOHWJRXQWLODQLVVXHLV UHVROYHG VDIHW\PDWV7KHVHUYLFHZLOOEH DYDLODEOHHYHU\GD\RIWKH\HDU DQG ZLOO VSHFLDOLVH LQ FRPPX QLW\HYHQWVFRQ¿UPDWLRQVFRP PXQLRQV IHVWLYDOV IXQ GD\V ZHGGLQJV VXPPHU FDPSV DQG EDUEHFXHV 7KH KRWOLQH WR FKLOGUHQ¶V HQ WHUWDLQPHQWLV

In South Kilkenny with The Reporter Tax rebate eases burden on parish 7+(3$5,6+RI.LOPDFRZFDQ UHFODLP D UHEDWH RQ WD[SD\HUV GRQDWLRQVRI¼RUPRUHLQD WD[\HDU 'XHWRDFKDQJHLQWURGXFHGLQ ODVW 2FWREHU¶V %XGJHW WKH SDU LVKFDQDOVRFODLPDUHEDWHIURP VHOIDVVHVVHG WD[SD\HUV DV ZHOO DV3$<(FRQWULEXWRUV 7KLVUHEDWHLVDJUHDWVRXUFHRI LQFRPHWRWKHSDULVKDQG¼ ZDVUHFHLYHGIURPWKH5HYHQXH &RPPLVVLRQHUVLQ ([LVWLQJ PHPEHUV RI WKH VFKHPHZLOOEHFRQWDFWHGVKRUW O\   $Q\RQH ZKR ZRXOG OLNH WR MRLQ LQ WKH VFKHPH VKRXOG FRQWDFW )U %ULDQ )O\QQ DW  

Money rolls in 7KH ,ULVK :KHHOFKDLU $VVR FLDWLRQ KDV DFNQRZOHGJHG WKH JHQHURVLW\ RI SHRSOH LQ WKHLU VXSSRUW IRU UHFHQW FKXUFK JDWH FROOHFWLRQ  7KH DPRXQW FRO OHFWHGZDV¼

South Showdown 7HQ ER[HUV UHSUHVHQWLQJ .LOPDFRZ+XUOLQJDQG)RRWEDOO &OXE ZLOO WDNH SDUW LQ D VHULHV RIERXWVDJDLQVWUHSUHVHQWDWLYHV RI 6OLHYHUXH *$$ &OXE LQ WKH &RPPXQLW\ &HQWUH LQ .LOPD FRZ SP RQ 6DWXUGD\ 0DUFK    $GPLVVLRQ LV ¼ DQG WLFNHWV DUH DYDLODEOH IURP PHPEHUVRIWKHFOXEV¶FRPPLW WHHV7KHUHZLOOEHDVXSHUYLVHG

OLFHQVHGEDU 7KH FOXE LV VHHNLQJ VSRQVRUV IRU WKH QLJKW )XOO VSRQVRUVKLS RI D ER[HU FRVWV ¼ DQG WKH EHQH¿WV LQFOXGH WKH VSRQVRU¶V QDPH RQ WKH ER[HU¶V VLQJOHW LQFOXVLRQ LQ WKH PDWFK SUR JUDPPH PHQWLRQ E\ WKH FRP SHUH WZR PDWFK WLFNHWV ZLWK UHVHUYHG VHDWLQJ DQG UHIUHVK PHQWV&RQWDFW6KDQH*DXOHDW IRUIXOOGHWDLOV

Soccer Club .LOPDFRZ%RKV 7KH8VVKRZHGQRVLJQWKDW WKH HQIRUFHG OD\RII DIIHFWHG WKHPLQDQ\ZD\ZLWKWKLVJUHDW SHUIRUPDQFH 3DGG\5HJDQOHGWKHZD\ZLWK D VXSHUE KDWWULFN -RVK )HQ WRQ DGGHG WZR 6HDQ 'RZOLQJ -DPHV)RRWDQG*HRUJH2¶6KHD VFRUHGWKHRWKHUJRDOV .LOPDFRZ (YDQ :DOVK *HRUJH 2¶6KHD 1LFN .OHLMQ &DOXP 5HJDQ 3DGG\ 5HJDQ -RVK )HQWRQ -DPHV )RRW 6DP 'XJJDQ 6HDQ 'RZOLQJ $GDP 7KRPSVRQ 7DGKJ &RQQROO\ 'RQQFKD:DOVK 3LOWRZQ.LOPDFRZ 7KLV ZDV D JRRG DOO URXQG GLVSOD\ E\ WKH 8V 7R UHWXUQ IURP 3LOWRZQ ZLWK WKUHH SRLQWV DQGDFOHDQVKHHWLVDOZD\VZHO FRPH*UHDWFUHGLWLVGXHWRWKH ODGV IRU D EDWWOLQJ SHUIRUPDQFH LQQDVW\FRQGLWLRQV 6NLSSHU 'DUUDJK 0F'RQDOG OHGZLWKWKH¿UVWJRDOIROORZLQJ JUHDW SOD\ IURP %ULDQ 2¶0DUD DQG 'HDQ 6FXOO\ 7KH VHFRQG JRDO ZDV D VFUHDPHU D YROOH\

IURP 3iGUDLJ 'HPSVH\ IROORZ LQJDFRUQHUE\%ULDQ2¶0DUD .LOPDFRZ '\ODQ 0RRUH &RQRU /\RQV 3DWULFN 'ROODUG 3iGUDLJ'HODKXQW\7RP&RVWHO OR3iGUDLJ'HPSVH\7RP%XW OHU%ULDQ2¶0DUD'HDQ6FXOO\ 'DUUDJK 0F'RQDOG FDSWDLQ  5RELQ 'DYLV 6XEV 5RU\ /H KDQH .LHUDQ :DOOLV 6HDQ %ODQFK¿HOG .LOPDFRZ%DOO\GXII $ YHU\ JRRG GLVSOD\ IURP WKH 8V JDYH WKHP WKH SRLQWV DJDLQVW %DOO\GXII 'DOH &DUUROO 0RUURZVFRUHGWZLFH7KHRWKHU JRDOZDVVFRUHGE\-DFN:KHO WRQ 7KH ODGV VKRXOG KDYH VFRUHG PRUH EXW WKH SRLQWV ZHUH VH FXUHG .LOPDFRZ -DNH +DUQH\ )LQWDQ /HHFK 2LVtQ 2¶'Z\HU 'DYLG &RVWHOOR &RUPDF 6XI ¿Q'DOH&DUUROO0RUURZ5\DQ &URNH -DFN :KHOWRQ 5RU\ /HHFK 6WHSKHQ 0XOODOO\ (YDQ 'XJJDQ 6XE &ROP 'RODQ &UDLJ0F$XOLIIH

Table quiz $WDEOHTXL]LQDLGRIWKHFOXE ZLOOEHKHOGRQ0RQGD\0DUFK LQWKH)R[¶V'HQ7KHFOXEDS SHDOVWRDOOWKHSOD\HUVRQWKH'L YLVLRQ%VTXDGSDUHQWVRIWKH FOXE¶VUHJLVWHUHGVFKRROER\V¶ SOD\HUVIULHQGVFROOHDJXHVDQG SHRSOH RI .LOPDFRZ WRVXSSRUW RQHRIWKHEHVWFOXEVLQWKHSDU LVKRI.LOPDFRZ 7KH FOXE LV DOVR ORRNLQJ IRU SUL]HV IRU WKH UDIÃ&#x20AC;H $OO GRQD WLRQV ZLOO EH YHU\ ZHOFRPH

Fixtures $VVHVVPHQW WHVWV IRU VHFRQG DU\ VFKRROV DUH RQ 6DWXUGD\ VR WKH WLPHV RI WKH ¿[WXUHV KDYH EHHQFKDQJHG 7KH 8V WUDYHO WR SOD\ 6W 3DXO¶VLQDYLWDOPDWFKWKDWKDV D  NLFN RII7KH 8V DUH DZD\WR6W6DYLRXU¶VSP 7KH 8V DUH DW KRPH WR &DU ULFNSP 7KH SUL]H IXQG LQ WKH -RNHU -DFNSRW UXQ E\ WKH VRFFHU FOXE LV¼7LFNHWVIRUWKH0RQGD\ GUDZ DUH ¼ DYDLODEOH DW UHWDLO RXWOHWV DQG FRPPLWWHH PHP EHUV

Mains rehab  :RUN LV ZHOO XQGHUZD\ ZLWK WKH UHSODFHPHQW RI WKH PDLQV SLSH DORQJ IURP WKH 3XPS DW 1DUDEDQHWR8OOLG%ULGJH 7KH ZRUN LV OLNHO\ WR WDNH DW OHDVWDQRWKHUWZRZHHNV0R WRULVWV DUH DVNHG WR EH PLQGIXO RI WKH ZRUNV  'LYHUVLRQV PD\ EH UHTXLUHG DQG VLJQDJH WR WKLV HIIHFWZLOOEHHUHFWHG 7KLV ZRUN LV SDUW RI D ¼P SURMHFW WR UHSODFH SLSHV ZKLFK DUH PRVW SURQH WR OHDNDJHV DURXQG WKH FRXQW\   2WKHU SLSHV ZLOO EH UHSODFHG IURP %DOOLQDERO\ WR &ORJJD DW 7\ EURXJKQH\ DQG DW 6WDWLRQ 5RDG LQ7KRPDVWRZQ

Celeb chefs &HOHEULW\ FKHIV (GZDUG +D\GHQ DQG $QQH 1HDU\ KROG DFRRNHU\IXQGUDLVLQJHYHQWRQ

Ferrybank Library $Q\EXGGLQJDUWLVWVRXWWKHUH" 7KH OLEUDU\ KDV DQ H[KLELWLRQ RI EDWLN DQG KDQGSDLQWHG VLON VFDUYHV RQ GLVSOD\ E\ YLVXDO DUWLVW 0DLUHDG +RORKDQ ,I \RX ZRXOG OLNH WR ERRN VSDFH WR H[KLELW \RXU ZRUN SOHDVH PDNH FRQWDFW 6SDFH LV DYDLODEOH IUHH RIFKDUJH

Connecting Generations 7KHUHDUHDOLPLWHGQXPEHURI SODFHV DYDLODEOH RQ WKLV FRXUVH ZKLFKLVDVHZLQJDQGFUDIWSURM HFW LQYROYLQJ FKLOGUHQ SDUHQWV JXDUGLDQVDQGJUDQGSDUHQWV ,QWHUHVWHG IDPLOLHV VKRXOG JHW LQ WRXFK :RUNVKRSV ZLOO EH KHOGRQ:HGQHVGD\DIWHUQRRQV SP VWDUWLQJ )HEUXDU\ 

Adult Learnersâ&#x20AC;&#x2122; Festival  7RGD\ :HGQHVGD\ )HEUXDU\ µ+HDOWK\/LIHVW\OHV¶±DQLQ WURGXFWLRQ WR +HDOWKFDUH FRXUV HV GHDOLQJ ZLWK IRRG QXWULWLRQ VWUHVVSP 7KXUVGD\ )HEUXDU\  µ/DXJKWHU <RJD¶ ± IUHH VHVVLRQ WR UHOD[ DQG HQMR\ ZHDU FRP

IRUWDEOHFORWKLQJ SP )ULGD\ )HEUXDU\  µ7DN LQJ 6WRFN DQG $JHLQJ ZLWK &RQ¿GHQFH¶ DQ LQIRUPDWLRQ VHVVLRQ ZLWK WKH +6( RQ SUR SRVHGFRXUVHVIRUWKHRYHUV DP 6DPHGD\µ8VLQJ1HZ7HFK QRORJLHV¶±DIUHHDGYLFHVHUYLFH IURPSP,I\RXKDYH TXHVWLRQVDERXWXVLQJ\RXUPR ELOH SKRQH ,SDG ODSWRS MXVW GURSLQDQGWDONWR1LDOO (QTXLULHV SOHDVH FDOO   RU HPDLO IHUU\EDQN# NLONHQQ\OLEUDU\LH

Graveyard restoration  $ PRVW LQWHUHVWLQJ WDON ZDV JLYHQ E\ &RLOtQ 2¶'ULVFHRLO DUFKDHRORJLVW LQ WKH FRPPX QLW\ FHQWUH .LOPDFRZ RQ WKH UHVWRUDWLRQ DQG PDLQWHQDQFH RI JUDYH\DUGV 3HRSOH IURP )HU U\EDQN 'DQHVIRUW (QQLVQDJ 6OLHYHUXH DQG .LOPDFRZ ZHUH JLYHQ XVHIXO LQIRUPDWLRQ DERXW KRZ WR JR DERXW WKLV ZRUN DQG WKHUH ZDV JRRG LQWHUDFWLRQ WKURXJKRXWWKHPRUQLQJVHVVLRQ $YLVLWZDVPDGHWRWKHJUDYH \DUGLQWKH/RZHU6WUHHWZKHUH SUDFWLFDOPHDVXUHVFRXOGEHFDU ULHGRXWLQWKLVDQGRWKHUJUDYH \DUGVWRHQKDQFHWKHUHWDLQWKHLU ULFKKHULWDJHYDOXH .LOPDFRZ/RWWR 7KH ZLQQLQJ QXPEHUV LQ ODVW ZHHN¶VORWWRZHUHDQG    7KHUH ZHUH WKUHH PDWFK WKUHH ZLQQHUV -DFNSRW IRU 7KXUVGD\LV¼


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 23


24 | NEWS

KILKENNY REPORTER 26 2 2014

Jordan Butler: Young talent with a super voice

CBS lad: The student prince of singing

Reporter readers to support our teen singing sensation JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

+(,6DWHHQLQDWKRXVDQG+HLV EDWWOLQJIRUKLVVKDUHRI¼ $QG KH FRXOG HYHQWXDOO\ EH D PDQLQDPLOOLRQ $W WKH WHQGHU DJH RI  /RXJKER\.LONHQQ\VLQJHU-RU GDQ%XWOHULVDOUHDG\DVHQVDWLRQ RIVWDJHDQGVWUHHW $ WDOHQWHG \RXQJVWHU D VXSHU VLQJHU DQG EXGGLQJ JXLWDULVW -RUGDQ KDV ZRQ WKH KHDUWV DQG PLQGV RI WHHQV WKLUW\ VRPH WKLQJVDQGVHQLRUV +H KDV DOUHDG\ ZRQ P\ULDG DZDUGVIRUKLVVWURQJHDUSOHDV LQJYRLFHDQGQRZZLWKWKHKHOS RI5HSRUWHUUHDGHUVWKH-DPHV¶V 6WUHHW6HFRQGDU\6FKRROVWXGHQW FDQFDWDSXOWWRQDWLRQDODQGHYHQ

LQWHUQDWLRQDOIDPH )URP D EDQG RI ULVLQJ VWDUV -RUGDQ KDV UHDFKHG WKH VHPL ¿QDOV RI WKH /H &UXQFK $SSOH RI0\(\HVRQJFRQWHVWLQFRQ MXQFWLRQZLWK7RGD\)0 +HLVGRLQJEULOOLDQWO\KDYLQJ EHHQ VHOHFWHG DV RQH RI WKH  VHPL¿QDOLVWVIURPDOPRVW KRSHIXOV $QG KH LV H\HLQJ D ¼SUL]HIXQG ,QVWDQWKLW 6LQJLQJ 6RPH 1LJKWV RULJL QDOO\E\)XQ-RUGDQZDVDQLQ VWDQW KLW VR PXFK VR WKDW KH LV GRLQJ EULOOLDQWO\ LQ WKH RQOLQH SXEOLF YRWLQJ EHIRUH WKH JUDQG ¿QDO RQ 0DUFK  LQ WKH 6XJDU &OXE'XEOLQ 7R YRWH IRU -RUGDQ VLPSO\ JR WRWRZZZRXLWROHFUXQFKFRP -RUGDQLV\RXQJHVWVRQRI$QQH

Jordan delights stage and street audiences

DQG1RHO%XWOHURI/RXJKER\RQ WKH SHULSKHU\ RI .LONHQQ\ &LW\ +LV VLEOLQJV DUH 6HDQ .HOO\ *ODVJRZ'HEELH.HOO\.LONHQ Q\5\DQDQG'\ODQ%XWOHU +LV HDUO\ HGXFDWLRQ ZDV DW 6W 3DWULFN¶V'H/D6DOOH6FKRROLQ .LONHQQ\ &LW\ DQG KH LV QRZ D QG \HDU VWXGHQW DW .LONHQQ\ &%6 )RU WKH UHFRUG KH FUHGLWV KLV HDUO\ VXFFHVV LQ HQWHUWDLQPHQW WRWHDFKHU0DQG\'RZOLQJDW6W 3DWULFN¶VDQGWRKLVSUHVHQWPX VLF WHDFKHU DW WKH &%6 0DULDQ 0DQQLQJ -RUGDQ ORYHV PXVLF DQG VRQJ DQG ORQJV WR EH D SURIHV VLRQDO HQWHUWDLQHU ³, ZRXOG ORYHDFDUHHULQPXVLF,KDYHP\ KHDUW VHW RQ WKDW´ -RUGDQ WROG 7KH5HSRUWHU

)LUVWDOEXP +HKDVDOUHDG\UHOHDVHGDQ(3 KLV¿UVWDOEXPFDOOHG7KH%HJLQ QLQJSURGXFHGE\WDOHQWHGORFDO PXVLF PDQ -HG 3DUOH DQG DOVR KDV D VLQJOH :KHQ , ZDV <RXU 0DQDJDLQZLWKWKHKHOSRI-HG +HKDVUHDFKHGWKHVHPL¿QDOV RI WKH 7HHQ 6WDUV $OO,UHODQG 6LQJLQJFRPSHWLWLRQIRU\RXQJ VWHUVDJHGWR 7KDW FRPSHWLWLRQ KDV QRZ EHHQ ZKLWWOHG GRZQ WR  KRSHIXOV DQG WKH QH[W ELJ QLJKW LVLQWKH:HVWJURYH+RWHO&ODQH RQ 0DUFK  ZKHQ -RUGDQ ZLOO VLQJWRKLVKHDUW¶VFRQWHQWKRS LQJWRUHDFKWKHODVW +H ZRQ WKH 7KRPDV 0RRUH FRPSHWLWLRQ DW WKH :DWHUJDWH 7KHDWUH.LONHQQ\WZR\HDUVDJR DQGZDVWKLUGLQWKH6WDUVLQ<RXU

(\HV DW /DQJWRQ¶V -RKQ 6WUHHW $QGKHZRQDVHFRQGSUL]HLQWKH .LONHQQ\0XVLF$ZDUGV -RUGDQLVYHU\SURXGRIKLVOR FDO DFKLHYHPHQWV EXW SHUKDSV WKH SHUIRUPDQFH WKDW KH WUHD VXUHV PRVW ZDV QRW D FRPSHWL WLRQDWDOOEXWDQRSSRUWXQLW\WR VLQJIRUKLVVFKRRO )DPLO\VXSSRUW 7KDWZDVWZR\HDUVDJRZKHQ KHZDVDVNHGWRVLQJ$PKUiQQD %K¿DQQ RXU 1DWLRQDO $QWKHP DWDKXUOLQJJDPHLQ6W3DWULFN¶V %DOO\UDJJHW*$$JURXQGV 2FFDVLRQ ZDV D IXQGUDLVLQJ 8KXUOLQJFKDOOHQJHEHWZHHQ .LONHQQ\ DQG 7LSSHUDU\ LQ VXSSRUW RI D QHZ &%6 KXUOLQJ SLWFKDWWKHUHDURIWKH&%63UL PDU\ 6FKRRO 6WHSKHQV 6WUHHW .LONHQQ\

-RUGDQDSSUHFLDWHVWKHVXSSRUW KHUHFHLYHVIURPKLVIDPLO\KLV VFKRRODQGKLVIULHQGV+HORYHV EXVNLQJ DQG WKDQNV WR KLV GDG 1RHO LW LV D FDVH RI KDYH FDU ZLOO WUDYHO DV -RUGDQ ZLQV QHZ DGPLUHUVRQWKHVWUHHWVRI:DWHU IRUGDQG'XEOLQDQGDWIHVWLYDOV DURXQGWKHFRXQWU\ +H ORYHV WR HQWHUWDLQ LQ .LONHQQ\ &LW\ WRR ZKHUH KH KDV ZRQ PDQ\ \RXQJ IDQV DV WKH WHHQV RI RXU FLW\ HPEUDFH D WDOHQWHG \RXQJVWHUV ZKR WKH\ EHOLHYH ZLOO JUDFH WKH LQWHUQD WLRQDO VWDJH DQG SURYH WR EH D PDQLQDPLOOLRQ

Hotline to vote for Jordan www.ouitolecrunch.com


NEWS | 25

26 2 2014 KILKENNY REPORTER

In The Watergate Theatre

Blackmail and murder .$7+$1'KHUHOGHUO\ IDWKHU.HPSOLYHLQDKRXVH RQWKHRXWVNLUWVRIDUXEELVK GXPS7KHLUGUDEH[LVWHQFH LVLQWHUUXSWHGE\WKHDUULYDO RIDQHZORGJHUWKHHQLJPDW LF0U6ORDQH 3URYRFDWLYHDQGVH[XDOO\ DPELJXRXV6ORDQHVRRQKDV ERWK.DWKDQGKHUEURWKHU (GFRPSHWLQJIRUKLV IDYRXUV%XWDOOLVQRWDVLW VHHPV %HKLQG6ORDQH¶VQRQFKDODQW GHPHDQRXUOLHVDFDOFXODWLQJ SV\FKRSDWKZLWKDGDUNDQG VHFUHWLYHSDVW6HGXFWLRQ EODFNPDLODQGPXUGHUOLH ZDLWLQJLQWKHZLQJV 7KHVKRZLVRQ0DUFK DQGSP7LFNHWV¼¼

The Little or perhaps not so Little Rascals preparing diligently for the Chamber Music competition on March 4 at St Caniceâ&#x20AC;&#x2122;s NS, 4pm. From left, Sean Cullen, Sean Keenan, Mikey Raggett and, centre, Harry Shine. All are aged 9

The Dynamica quartet will take part in the Chamber Music competition. Included are Georgia Shine, Hannah Josef, Sophia Oâ&#x20AC;&#x2122;Shea and Katie Breen. The girls are U11

Music magic and a quartet of little rascals LORI COMERFORD 7+( WK $QQXDO .LONHQQ\ 0XVLF)HVWLYDOEHJLQVRQ7XHV GD\0DUFKDQGFRQWLQXHVIRU VL[GD\VXQWLO6XQGD\0DUFK 7KLV HYHQW SURYLGHV D VSHFLDO RSSRUWXQLW\IRUPXVLFORYHUVRI DOO DJHV WR VXSSRUW DQG HQMR\ OLYH SHUIRUPDQFHV DW YHQXHV WKURXJKRXWWKHFLW\ $PRQJ WKH FRPSHWLWRUV ZLOO EH WZR EULOOLDQW TXDUWHWV IURP 6W &DQLFH¶V &R(G 1DWLRQDO

6FKRRO LQ .LONHQQ\ 7KH /LWWOH 5DVFDOV DQG WKH '\QDPLFD 4XDUWHW %RWK JURXSV ZLOO WDNH SDUWLQWKH&KDPEHU0XVLFFRP SHWLWLRQ .QRZQ IRU LWV LQFOXVLYH DQG HQFRXUDJLQJ DWPRVSKHUH WKLV \HDU¶V IHVWLYDO ZLOO LQFRUSRUDWH  FRPSHWLWLRQV LQFOXGLQJ FKR UDO YRFDO SLDQR ZLQG EUDVV VWULQJVDQGFKDPEHUPXVLF 7KHKXJHSRSXODULW\DQGKLJK VWDQGDUG RI WKH YRFDO FRPSHWL WLRQV DORQH KDYH QHFHVVLWDWHG WKH DSSRLQWPHQW RI WZR DGMXGL

FDWRUV IRU WKH ¿UVW WLPH LQ WKH IHVWLYDO¶VKLVWRU\ ,WLVDOVRWKH¿UVW\HDUWKDWWKH IHVWLYDOKDVUXQRYHUVL[GD\V 7KLV LV DJDLQ GXH WR HYHU LQ FUHDVLQJ QXPEHUV RI FRPSHWL WRUV DQG WKH GHGLFDWLRQ RI WKH IHVWLYDO FRPPLWWHH DQG YRO XQWHHUV WR SURYLGH D YDOXDEOH RSSRUWXQLW\ IRU WKH PXVLFLDQV DQG YRFDOLVWV RI ,UHODQG WR SHU IRUPLQIURQWRIKLJKO\UHJDUGHG MXGJHV ,PSRUWDQWUROH $GMXGLFDWRUV &KRUDO 6HDPXV

&ULPPLQV9RFDO6HDPXV&ULP PLQV DQG /\QGD /HH 6WULQJV DQG &KDPEHU 0XVLF 9DQHVVD 6ZHHQH\  :LQG DQG %UDVV .HYLQ +DQD¿Q 3LDQR &RQRU /LQHKDQ 7KH JDOD FRQFHUW ZLOO EH VWDJHG DW WKH :DWHUJDWH 7KH DWUH RQ 0DUFK  ZKHUH WKH PDMRUDZDUGVIRUWKHPRVWRXW VWDQGLQJFRPSHWLWRUVZLOOEHDQ QRXQFHG $V DOZD\V WKH VXSSRUW RI WKH SXEOLFHQVXUHVWKHIHVWLYDO¶VVXF FHVVLQHQFRXUDJLQJWKHSURPLV

LQJ PXVLFLDQV DQG VLQJHUV ZKR WDNHSDUW 7KH IHVWLYDO¶V DXGLHQFHV RI IDPLO\ IULHQGV DQG PXVLF ORY HUVKDYHORQJKHOGDQLPSRUWDQW UROH LQ KHOSLQJ WR FUHDWH WKH HQMR\DEOH DQG DSSUHFLDWLYH DW PRVSKHUH7LFNHWVDUHDYDLODEOH RQWKHGRRURIDOOYHQXHVEHIRUH FRPSHWLWLRQV 7KHIHVWLYDOLQLQGHEWHGWRLWV VSRQVRUV 6W &DQLFH¶V &UHGLW 8QLRQ .LONHQQ\ %RURXJK &RXQFLO 0HXEOHV 6WDWH 6WUHHW %DQNRI,UHODQG


26 | NEWS

KILKENNY REPORTER 26 2 2014

Protecting our people, the new Renault Master

Rear view of new ambulance

Ambulance is key to permanent hall door! JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

(0(5*(1&<EHOOVZHUHULQJ LQJIRURXUORFDO2UGHURI0DOWD $PEXODQFH&RUSV ,W ZDV SHUKDSV LURQLF WKDW DV 2UGHURI0DOWD,UHODQGFHOHEUDW HG LWV WK ELUWKGD\ ODVW \HDU WKH ORFDO EUDQFK ZDV WHHWHULQJ EHWZHHQDURFNDQGDKDUGSODFH 7KH ORFDO XQLW IRXQG LWVHOI LQ D&DWFK:RXOGWKH\SODQWR EX\DSHUPDQHQWKRPHRUDQHZ DPEXODQFH"

%RWK ZHUH GHVSHUDWHO\ QHHG HG EXW SDXFLW\ ZDV D SUREOHP 7KHUH ZDV D PHUH ¼ LQ WKH FRIIHUV QRW HQRXJK WR EX\ DQDPEXODQFHRUDKRPHVZHHW KRPH ,WZDVWLPHIRUWRXJKGHFLVLRQV DQGVHQVLEOHWDON,WZDVDJUHHG WREX\RQHZLWKWKHKRSHRIXV LQJLWWRSXUFKDVHWKHRWKHU $VWKH2UGHU¶VPDLQVRXUFHRI IXQGLQJ FRPHV IURP SURYLGLQJ DPEXODQFHPHGLFFRYHUDWFRP PXQLW\DQGVSRUWLQJHYHQWVWKH DPEXODQFHJRWWKHQRG

$OLYHDQGNLFNLQJ %XW WKH LGHDO RI SURYLGLQJ D SHUPDQHQW KHDGTXDUWHUV IRU D ERG\ ZKLFK LV  WKLV \HDU UH PDLQVDOLYHDQGNLFNLQJ +RSH ZDV WKDW DQ DPEXODQFH FRXOG EH FREEOHG IURP D YDQ WKDW FRXOG EH FRQYHUWHG 7KDW ZDVDQRQUXQQHU7KHUHZDVQR IDLU\JRGPRWKHURUIDWKHU %XWWKHSHRSOHRIRXUFLW\DQG FRXQW\ DQVZHUHG DQ 626 FDOO 7KHUHZDVIDQWDVWLFVXSSRUWIRU FKXUFK JDWH FROOHFWLRQV GRQD WLRQV IURP DPEXODQFHFRYHUHG

Macra with John Buckley Clash of giants on Friday 7+( 0DFUD QD )HLUPH PHQ¶V FRXQW\ VRFFHU VHPL¿QDOV DQG ¿QDO DUH RQ WKLV )ULGD\ DW 2¶/RXJKOLQV *$$ VSRUWV FRP SOH[LQ.LONHQQ\&LW\6LJQLQLV IURPSPWRSP &XUUHQWQDWLRQDO FKDPSLRQV &DOODQ SOD\ FXUUHQW FRXQW\ FKDPSLRQV 0XOOLQDYDW LQ D FODVKRIJLDQWV &DOODQKDVWHDPVLQWKHVHPL ¿QDOV7KHLUVROHGDQJHULVFXU UHQW FRXQW\ FKDPSLRQV 0XO OLQDYDW &DOODQ KDYLQJ ZRQ WKH QDWLRQDOWLWOHLQ0XOOLQDYDW¶VDE VHQFHLVVXUHWRSURYLGHVWURQJ RSSRVLWLRQ ,Q WKH ZRPHQ¶V VHFWLRQ &DO ODQ DQG .LONHQQ\ &LW\ FODVK LQ URXQG WKUHH RI FRXQW\ VRF FHU 2Q DJJUHJDWH &DOODQ OHDG .LONHQQ\&LW\DIWHUWKH¿UVW WZR URXQGV :LWK WZR FODVKHV OHIW)ULGD\¶VJDPHSURPLVHVWR EHLQWULJXLQJDQGHQWHUWDLQLQJ

More of the same $IWHU UHFXSHUDWLQJ IURP )UL GD\¶VH[HUWLRQVDORQJFRPHWKH

YROOH\EDOO DQG EDVNHWEDOO ¿QDOV RQ6XQGD\ 1DWLRQDO YROOH\EDOO FKDPSL RQV &DOODQ ZLOO GHIHQG WKHLU FRXQW\ WLWOH 1HZO\ IRUPHG 1RUWK .LONHQQ\ VHH WKHLU ¿UVW FRPSHWLWLYH DFWLRQ VLQFH IRUP LQJDEDVNHWEDOOFOXE .LONHQQ\ &LW\ DQG &DOODQ DUH VXUH WR FODVK LQ WKH KLJKO\ FRPSHWLWLYHEDVNHWEDOO¿QDOVRQ 0DUFK  DW 6W &DQLFH¶V +DOO .LONHQQ\&LW\SP

Weekly activities 0DFUD FRQWLQXHV WR SURYLGH PHPEHUV ZLWK JUHDW RSSRUWXQL WLHVWRVWD\¿WDQGVRFLDOL]HRQD ZHHNO\EDVLV .LONHQQ\0DFUDSOD\EDGPLQ WRQ HYHU\ :HGQHVGD\ SP DW WKH:DWHUVKHG7KH\DUHORRN LQJIRUQHZSOD\HUVDQGHQFRXU DJHPHPEHUVDQGQRQPHPEHUV WRDWWHQG &DOODQ0DFUDFRQWLQXHWRSOD\ D FRPELQDWLRQ RI YROOH\EDOO VRFFHU DQG EDVNHWEDOO DW SP HYHU\ )ULGD\ DW 2¶/RXJKOLQV VSRUWVKDOOLQ.LONHQQ\&LW\ 0DFUD DOVR FRQWLQXH WR SOD\ VRFFHUDQGEDVNHWEDOODW6W&D

QLFH¶V +DOO DW SP RQ 0RQGD\ DQG 7KXUVGD\ QLJKWV $OO DUH ZHOFRP )RU IXUWKHU GHWDLOV SOHDVH FRQWDFW PH EXFNOH\MRKQ# JPDLOFRP

Recruitment drive $UH \RX LQWHUHVWHG LQ PDNLQJ QHZIULHQGV"$UH\RXLQWHUHVWHG LQVRFLDOL]LQJ$UH\RXLQWHUHVW HGLQSOD\LQJVRFFHUEDVNHWEDOO RUWDJUXJE\"  ,I \RXU DQVZHU LV µ\HV¶ WKHQ .LONHQQ\ &LW\ 0DFUD ZDQWV \RX 0DFUD DUH UHFUXLWLQJ QHZ PHPEHUVDQGDUHKRVWLQJDQLQ IRUPDWLRQ HYHQLQJ RQ 0DUFK  DWSPDWWKH2UFKDUG%DULQ .LONHQQ\&LW\ 0DFUD QD )HLUPH LV D QD WLRQDOVRFLDORUJDQLVDWLRQZLWK VL[ NH\ DUHDV RI DFWLYLW\ DJUL FXOWXUH VSRUW WUDYHO SXEOLF VSHDNLQJ SHUIRUPLQJ DUWV DQG FRPPXQLW\LQYROYHPHQW 7KHUH DUH ¿YH FOXEV LQ .LONHQQ\ 1RUWK .LONHQQ\ %DOO\UDJJHW &DVWOHFRPHU DQG &ORJK  .LONHQQ\ &LW\ &DO ODQ 0XOOLQDYDW DQG 6XLUVLGH 0RRQFRLQ 

HYHQWV SURYLVLRQ RI ¿UVW DLG FRXUVHDQGFKDULWDEOHGRQDWLRQV SRXUHGLQ ³2XU SHRSOH KDG VSRNHQ SXW WKHLU KDQGV LQWR WKHLU SRFNHWV DQG DV D UHVXOW RQH RI WZR NH\ DLPV KDV EHFRPH D UHDOLW\´ /LHXW+HDWKHU:RRGV2I¿FHU,Q &KDUJHWROG7KH5HSRUWHU ³:H DUH VR JUDWHIXO WR RXU SHRSOH (YHU\ FHQW FROOHFWHG DOO ¼ RI LW LV JRLQJ WR WKHSXUFKDVHRID5HQDXOW 0DVWHULQZKDWZHEHOLHYHLVDQ H[FHSWLRQDO GHDO RQ D YHKLFOH

WKDW VWLOO KDV D PRQWK 5H QDXOW :DUUDQW\ DQG D FRQYHU VLRQMREZKLFKDOVRFRPHVZLWK DPRQWKZDUUDQW\ ³7KLV DPEXODQFH VKRXOG VHUYH WKHSHRSOHRI.LONHQQ\IRUPDQ\ \HDUVDQGLVDYDLODEOHWRERRNIRU HYHQWV IURP WKH .LONHQQ\ 'XW\ 0DQDJHU$GMW 2OJD %UHQQDQ RQ  RU HPDLO NLONHQQ\ GXWLHV#RUGHURIPDOWDLH´ )XQGUDLVLQJ LV WR FRQWLQXH WKURXJKRXW WKLV \HDU VWDUWLQJ ZLWKDTXL]DW%UHZHU\&RUQHU 3DUOLDPHQW6WUHHWDWSPWRPRU

URZ 7KXUVGD\ DQG FRQWLQXLQJ ZLWK D 0DOWHVH 0DVTXHUDGH %DOO RQ 2FWREHU  LQ +RWHO .LONHQQ\ 7LFNHWV IRU WKH EDOO ¼ FDQ EHSXUFKDVHGIURPDQ\.LONHQQ\ XQLWPHPEHURUWKRXJKDVDYLQJV FOXEVHWXSE\WKH2UGHU¶VORFDO IXQGUDLVLQJ RI¿FHU DW RPDFNN IXQGUDLVLQJ#RXWORRNFRP 7KH NH\ KDV EHHQ WXUQHG WR VWDUWWKHXQLW¶VDPEXODQFH 9ROXQWHHUV DUH FRQ¿GHQW WKDW WKH\ZLOOHYHQWXDOO\WXUQWKHNH\ LQWKHLURZQKDOOGRRU

Son of our city passes away in Luton $.,/.(11<PDQKDVSDVVHG DZD\LQ/XWRQ(QJODQGVKRUWO\ DIWHUFHOHEUDWLQJKLVWKELUWK GD\ )URP 'RPLQLF 6WUHHW &\ULO &DUUROOZDVRQO\VRQRIWKHODWH *DUGDDQG0UV&DUUROO +H ZDV HGXFDWHG DW .LONHQQ\ &%6 DQG HPLJUDWHG WR /XWRQ LQ  DORQJ ZLWK IULHQGV KLV IULHQG $QG\ %XWOHU IURP .LONHQQ\&LW\ 7KH SDLU EHFDPH GHHSO\ LQ YROYHGLQWKH.LONHQQ\$VVRFLD WLRQ LQ /XWRQ &\ULO ZDV DW WKH ¿UVWDVVRFLDWLRQGDQFHLQ +HZDV SUHGHFHDVHG E\ KLV ZLIH %UHQGDQ 7KH FRXSOH KDG ¿YH FKLOGUHQ 0LFKDHO .HYLQ (LOHHQ6WHSKHQDQG/LDP $FWLYHWULQLW\ $QRWKHU.LONHQQ\ IULHQG 2V VRU\ 3DUN PDQ -RKQ 'XQQH MRLQHG &\ULO DQG $QG\ LQ WKH .LONHQQ\ $VVRFLDWLRQ DQG WKH WULQLW\ZHUHDFWLYHPHPEHUVIRU GHFDGHV  -RKQ DQG &\ULO KDG EHHQLQLQIDQWV¶VFKRROWRJHWKHU LQ.LONHQQ\ &\ULO MRLQHG 9DX[KDOO 0RWRUV DQGZDVSURPRWHGWRIRUHPDQD SRVLWLRQKHKHOGXQWLOKHUHWLUHG IURPWKHFRPSDQ\ +H PDGH ORWV RI  IULHQGV LQ KLV DGRSWHG /XWRQ DQG

Luton friends: Local man Cyril Carroll, second from left, pictured with fellow Kilkenny men in Luton in the late 1970s, from left, Davy Bergin, John Dunne and Andy Butler UHPDLQHG JRRG SDOV ZLWK PDQ\ LQ .LONHQQ\ LQFOXGLQJ )ULDU\ 6WUHHW EXWFKHU 3DGG\ .HQQD

&\ULO ZDV D GHGLFDWHG VXS SRUWHU RI .LONHQQ\ KXUOLQJ DQG RI /XWRQ 7RZQ )RRWEDOO &OXE +HZLOOEHEXULHGLQ/XWRQ


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 27


28 | NEWS

KILKENNY REPORTER 26 2 2014

Cash splash in clash of the ash JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

$3528'ORFDO*$$FOXELVVHW WRUHZDUGORFDOJXUXVZKRNQRZ WKHLU RQLRQV ZKHQ LW FRPHV WR *DHOLF*DPHV ,I\RXIDQF\\RXUVHOIDVDQµH[ SHUW¶RQVHQLRUDQGLQWHUPHGLDWH KXUOLQJ WKHQ *UDLJXH%DOO\FDO ODQ *$$ &OXE KDYH D FRPSHWL WLRQWKDWLVULJKWXS\RXUDOOH\ ,WZLOOEHDFDVHRI%RE¶V<RXU 8QFOH LI \RX FDQ IRUHFDVW WKH ZLQQHUV LQ D *$$ 6FRUHFDVW FRPSHWLWLRQ WKH *$$ YHUVLRQ RIWKHVRFFHUSRROVDVWKH%DO O\FDOODQ ER\V DQG JLUOV KDYH D ¼ SRW RI FDVK IRU SXQWHUV ZKRNQRZWKHLUKXUOLQJ &RVW RI WDNLQJ SDUW LV ¼ ZKLFK UHTXLUHV SDUWLFLSDQWV WR IRUHFDVWDZLQRUDGUDZLQDWR WDORIOHDJXHJDPHVDWVHQLRU DQGLQWHUPHGLDWHOHYHO 7KHIXQGUDLVHUVKRXOGJHQHU DWHJUHDWH[FLWHPHQWRQDQGRII WKH SLWFK DV WKH *UDLJXH%DOO\ FDOODQ OHDJXH WDEOHV ZLOO KLJK OLJKWWKRVHH\HLQJWKHELJSUL]HV /RFDOSDSHU $QG\RXFDQIROORZWKHOHDG HUV HYHU\ ZHHN LQ \RXU ORFDO QHZVSDSHU 7KH .LONHQQ\ 5H SRUWHU 7KLV LV WKH WKLUG \HDU RI D IXQGUDLVHU ZKLFK LV FDSWXULQJ WKH LPDJLQDWLRQ RI ORFDO IDQV ,Q WKH ¿UVW \HDU  WLFNHWV ZHUHVROG/DVW\HDUWKDW¿JXUH

MXPSHG WR  DQG WKLV \HDU WKHWDUJHWLVDZKRSSLQJ ³7KHUHLVJUHDWLQWHUHVWDPRQJ FOXEVDQGLQGLYLGXDOV´FRPPLW WHHPHPEHU0LOR+HQQHVV\WROG 7KH5HSRUWHU ³7KHUH LV JUHDW ULYDOU\ EH WZHHQKXUOLQJVXSSRUWHUVDVIDQV EDWWOHIRUWKUHHSRLQWVIRUDZLQ RU ¿YH IRU D GUDZ ,QWHUHVW LQ WKHJDPHVLVELJLQWHUHVWLQWKH GUDZLVJURZLQJDOOWKHWLPHDQG WKDWPHDQVZHOFRPHVXSSRUWIRU WKH  WHDPV LQ RXU FOXE :H KDYH WHDPV IURP 8 ULJKW XS WRLQWHUPHGLDWH´ *DPHVEHJLQRQWKHZHHNHQG RI$SULO  DQG  VR IRUHFDVW FDUGV PXVW EH UHWXUQHG WR WKH FOXE E\ $SULO  7KH FRPSHWL WLRQ LV FRQ¿QHG WR WKH OHDJXH VHFWLRQVRIERWKJUDGHV 6HOOLQJZHOO 'UDZ WLFNHWV DUH VHOOLQJ ZHOO DQGWKHUHDUHSODQVWRH[WHQGWKH VDOHV SLWFK WKLV \HDU WR LQFOXGH HYHU\FRUQHURIRXUFRXQW\ 7LFNHWVFDQEHSXUFKDVHGIURP FOXE FRPPLWWHH PHPEHUV 3DW +D\HV 7RP 0F*UDWK 'DYH 2¶1HLOO -RKQ +R\QH 0DXULFH 5RQDQ(LOHHQ+HDIH\DQG0LOR +HQQHVV\ $QGDORQJZLWKNHHSLQJWUDFN RI WRS VFRUHUV LQ 7KH 5HSRUWHU WKHUHLVDOVRDQRQOLQHIDFLOLW\DW JUDLJXHEDOO\FDOODQLH /DVW\HDU¶VZLQQHUZDV&RQD K\ 6KDPURFNV HQWKXVLDVW /LDP )O\QQ7KHSUL]HVWKLV\HDUDUH

A great team: Gerry Rafter, Rafter Dempseys, Friary Street, Kilkenny, main sponsor, Philomena Brennan, club secretary, Eileen Heafey, treasurer and Pat Hayes, chairman Pic Donal Foley ¼¼¼DQG ¼

7KH SURMHFW ZDV RI¿FLDOO\ ODXQFKHG DW 5DIWHU 'HPSVH\¶V

%DU)ULDU\6WUHHW.LONHQQ\RQ 6DWXUGD\ DIWHUQRRQ 7KH EDU LV

WKHRI¿FLDOVSRQVRURIWKH*UDL JXH%DOO\FDOODQ&OXE

:HZLOOQRWEHEHDWHQRQSULFH : :HZLOOQ Z EH S Buy Today & Get Bu B 6 Months FREE 224hr 44h Monitoring!* ; *»Z(WWS`

Family performance of The Ice Child, 7.30pm, Watergate Theatre this Saturday. Tickets: â&#x201A;¬10/Family of four â&#x201A;¬25; 056-77-61674. For children aged 8 and older. More information: www.barnstorm.ie Pictured are Ice Child fairies

24Hr Monitored Emergency Response Panic Alarms 7KHLGHDOVROXWLRQIRULQGHSHQGHQW VHFXUHOLYLQJ

3 Burglar Alarms 3 Fire Alarms 3 Fire Extinguishers

3 Panic Alarms 3 CCTV Systems 3 24hr Monitoring

3 Keyholding 3 Home Mindingg 3 Alarm Response

3 Static Guard 3 Mobile Patrols 3 Vehicle Tracking

Yearly Alarm Monitoring from as little as E120

(+VAT)

We can Monitor any type of alarm!

Distillery Road, Wexford 053 9170070 No.9 Ormonde Road, Kilkenny 056 7722999

The Kilkenny CBS senior debating team which remains unbeaten in competition this school term. In included are Kevin Brennan, David Oâ&#x20AC;&#x2122;Gorman, Alex Broderick, Chris Dunne and Jack Eustace, along with teacher Ger Oâ&#x20AC;&#x2122;Brien


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 29


30 | NEWS

KILKENNY REPORTER 26 2 2014

Big Bill: Mason or Maher? who knows? NED EGAN 5(3257(5 UHDGHU LI \RX PLVVHG WKH ¿UVW WZR SDUWV WKH\ UHIHUUHGWRWKHROGGD\VLQ(QJ ODQGDQGWRDP\VWHULRXV+HUFX OHDQ IHOORZ NQRZQ YDULRXVO\ DV µ6DUV¿HOG¶µ%LJ%LOO¶0DVRQRU µ%%¶0DKHU+HDQGDFURZGRI IHOORZUHYHOOHUVZHUHHQVFRQFHG LQWKH5HG/LRQ3XELQ6NHJQHVV DQGDWWKHHQGRIWKHQLJKWDIHZ ODGVJRWRYHUH[FLWHG 6RWKHORFDOZDOORSHUVFDOOHGLQ WR LQWHUYLHZ WKHP IRU WKHLU IUHH EHG DQG EUHDNIDVW 7KH XVXDO MRNHZDVPDGHRIFRXUVH³3DG G\\RXUFDULVZDLWLQJ´<HSWKH LQIDPRXVµ3DGG\:DJRQ¶ 7KH VHUJHDQW RQ FDVWLQJ KLV H\H URXQG WKH EDU VSLHG %LOO ± KDUG WR PLVV WKH 2O\PSLDQ IUDPH ³:HOO %%´ KH JR ZLWK D OHHU\ JULQ  ³KRZ¶UH WKH\ DOO GRZQ &DUGLII ZD\"´ 7R ZKLFK %LOO DQVZHUHG ZLWK D ODXJK  ³*UHDW7DII\±LI\HHYHUFRPH GRZQIRUPHKDYHWKHGRJVDQG WKHGDUELHV FXIIV KDQG\´ 7KH VHUJHDQW VFRZOHG DW WKDW EXW KXQJ DERXW +H VXSSHG DZKLOHDWDSLQWRIELWWHU:KLFK ZDV WKH IRUP WKHQ ± EHIRUH WKH 3& HHMLWV WXUQHG WKH ZRUOG XS VLGH GRZQ DQG MD[\ $IWHU D ZKLOHKHEHFNRQHGPHRYHU ³/RRN\RXQJODG´KHJR±³D ZRUGRIZDUQLQJGRQ¶WEHOLHYH DQ\WKLQJWKDWELJIHOODWHOOV\RX± KH¶VDFKDQFHU±DEDGHJJWDNH WKDWDVJRVSHO´ $:HOVK)XVLOLHU ³2K D\H´ VH] , ± ³,¶YH KHDUG HQRXJKJRVSHOWRODVWPHOLIHRXW IURPPHQLQEODFNDWKRPH$E E\VLQQLD´ VODQJRIWKHGD\IRU µ,¶OOEHVHHLQ¶\D¶ 7KH VHVVLRQ EURNH XS VKRUWO\ DIWHUZDUGV DQG %LOO¶V ROG SDO µ3XQFK¶ *DOODJKHU *DOODKHU ± QRWEORRG\*DOODJDUIRU*RG¶V VDNH  ± WDONLQJ RXW RI WKH VLGH RIKLVPRXWKDUUDQJHGWRPHHW PH RQ WKH 0RQGD\ QLJKW DQG µ¿OOPHLQ¶RQWKH0DVRQIDPLO\ 7KHQ ZH DOO OXUFKHG EHGZDUGV DWYDULRXVVORZVSHHGVDQGYHUWL FDODQJOHV 2QWKH0RQGD\QLJKW,VKRYHG XSWRWKHµ/LRQ¶FRXQWHUQRWWRR PDQ\LQWKHEDU,QFRPHV3XQFK ,VHWXSWKHSLQWVDQGZHVDW GRZQ LQ D FRUQHU 3XQFK JRW VWUDLJKW LQWR WKH µ%LJ %LOO¶ WDOH ± WROG PH WKDW WKH FRS VHUJHDQW KDGJRWRQWRKLPWRRRQHQLJKW ± µWU\LQ¶ WR JHW VRPH LQIR QR GRXEW¶7KH6DUJHZHQW³*DOOD JDU , NQRZ D ELW DERXW 0DVRQ ± RU ZKDWHYHU KH FDOOV KLPVHOI QRZ%\DIDLUROGFRLQFLGHQFH , ZDV DW 'XQNLUN ± DQG VR ZDV KH±,¶GVZHDUWRLW , GUDJJHG KLP RXW RI WKH VXUI MXVWRIIWKHEHDFKDQGLQWRDSLQ QDFH DQG WKHQ XS WKH QHWV LQWR DGHVWUR\HU+HZDVZHDULQJWKH XQLIRUPRID:HOVK)XVLOLHU%XW RQO\ RQH µ7DII\¶ RQ ERDUG ± D FRUSRUDO *ULI¿WKV  VHHPHG WR UHFRJQLVHKLP %DGO\VKRWXS ³*ULI¿WKV ZDV EDGO\ VKRW XS  DQG ORRNHG QRQH WRR SOHDVHG ZKHQKHVSLHGµVZHHW:LOOLDP¶ %XW ZLWK WKH -HUULHV VWUD¿QJ

Was this â&#x20AC;&#x2DC;Big Billâ&#x20AC;&#x2122;? VXEV OXUNLQJ DQG HYHU\RQH SXNLQJ DQG VFUHDPLQJ DQG G\ LQJ WKHUH  ZDV QR WLPH IRU TXHVWLRQV :KHQ WKH ERDW JRW LQWR 3RUWVPRXWK WKHUH ZDV QR VLJQ RI µ)XVLOLHU¶ 0DVRQ ± DV KH FDOOHG KLPVHOI  DQG *ULI¿WK ZDV XQFRQVFLRXV , ZHQW EDFN WR 'XQNLUN IRU DQRWKHU ORDG RI OLYLQJ DQG G\LQJ VROGLHUV DQG IRUJRWDOODERXWWKHLQFLGHQW%XW DIHZPRQWKVODWHU,ZDVFDOOHG XS WR WKH 5HJLPHQWDO +4 DQG DVNHG TXHVWLRQV DERXW WKH ELJ µ)XVLOLHU¶,¶GGUDJJHGRQERDUG 7XUQV RXW *ULI¿WKV µ¿QJHUHG¶ KLP ± UHFNRQHG KLV PDWHV KDG FDXJKW 0DVRQ LQ D :HKUPDFKW XQLIRUP7KHQ0DVRQJHWVRQWR WKHGHVWUR\HU±LQD:HOVK)XVLO LHUV EDWWOHGUHVV $QG KLV µFDS WRUV"¶ 1HYHU VHHQ DJDLQ7KH $UP\ZDVPRUHWKDQLQWHUHVWHG LQWKLVJHH]HU0DVRQ±QRWOHDVW ZK\ KH ZDV LQ D *HUPDQ XQL IRUP7KLVZDV'XQNLUN±QRWD EORRG\ )DQF\ 'UHVV %DOO , WHO O\D 7KH µWRS EUDVV¶ GLGQ¶W WHOO PH WKHLUWKRXJKWVDQGUHDVRQVMXVW DVNHGTXHVWLRQV ³2QH5HG&DS 0LOLWDU\3ROLFH ±03 2I¿FHUVKRZHGPHDSKR

Rupert Brooke

Destroyer at Dunkirk WR RI D FRUSRUDO´ FRQWLQXHG WKH VHUJHDQW ³, PXVW VD\ LW ORRNHG OLNHRXUP\VWHULRXVVTXDGGLH± EXW , FRXOGQ¶W EH WRWDOO\ VXUH ± WKHUH EHLQJ VR PXFK PXFN DQG EORRGDQGVPRNHDERXWWKDWGD\ $FWLQJWKHµWRXULVW¶ 6HHLQJWKDW,NQHZOLWWOHRIDQ\ KHOS WR WKHP ± WKH\ JDYH PH D FRS\RIWKHSKRWR±VDLGµLQIRUP XV LPPHGLDWHO\ LI \RX HYHU VHH KLP%RQ¶WDSSURDFKKLP±KH¶V DGDQJHURXVE G¶6R,JRW RQZLWKOLIHMRLQHGWKHµZDOORS HUV¶%XW,QHYHUIRUJRW'XQNLUN 7KHQ RQH QLJKW D ZKLOH DJR , FDOOHG LQWR WKLV KHUH 3XE ± DQG WKHUH ZDV WKH µ)XVLOLHU¶ ± DQG KHVWDQGLQJMXVWDIHZIHHWIURP PH,VDLGQRWKLQJNHSWWKHKHDG GRZQDQGVORSHGRXW ³,KDGDQHZODGDWWKHVWDWLRQ WDNH D IHZ SKRWRV QH[W QLJKW \¶NQRZ  DFWLQJ WKH µWRXULVW¶ :H H[SUHVVHG WKHP GRZQ WR WKH$UP\03V±EXWWKH\¶GORVW DOO LQWHUHVW , WKLQN WKDW SXWWLQJ DQ ,ULVKPDQ LQ WKH GRFN PDQ\ \HDUVDIWHUWKH:DU±LQZKLFKVR PDQ\EUDYH,ULVKJDYHWKHLUOLYHV ±ZRXOGKDYHUDLVHGWRRPXFKRI DVWLQN $QG WKH ODGV ZKR WKH\ UHFN

RQHG0DVRQKDGµGRQHLQ¶ZHUH µRQO\¶ VTXDGGLHV :KR DUH GLV SHQVDEOH $V ZHOO WKH ZULWHU NQRZV+DGWKH\EHHQRI¿FHUV" :HOOLWPLJKWKDYHEHHQGLIIHU HQW$Q\ZD\,ZDVWROGWRGURS WKHPDWWHU,WJDOOHGPH´ ³6RWKHUH\RXDUH&XOO\´VDLG 3XQFK ³WKDW¶V VRPH RI WKH OHJ HQGRI%LJ%LOO$VPXFKDV,¶P JRLQ¶WRWHOO\RXDQ\ZD\ 3RSSHGXSLQP\SRUULGJH %XWWKHODVWWKLQJWKHVHUJHDQW VDLG WR PH ZDV ± µ3XQFK  GLG \RXHYHUKHDURIDµ%LJ%LOO0D KHU¶"±DQGORRNHGPHLQWKHH\H DVKHDVNHGWKHTXHVWLRQ :RXOGQ¶W NQRZ KLP LI KH SRSSHG XS LQ PH SRUULGJH´ , EDUHIDFHG EDFN DW KLP ³6R WKHUH\RXKDYHLWDERXW%LJ%LOO &XOO\´ , GLGQ¶W PHQWLRQ %LOO¶V 5DLOZD\ 3DVV LQ WKH QDPH RI %LOO 0DKHU  WR KLP  MXVW LQ FDVH« 3XQFK WKHQ WROG PH ZKDW KH NQHZ RI 3DXO %LOO¶V EURWKHU ± ZKR¶G KDG D J\P LQ WKH (DVW (QG ³/ROD  DQ H[JLUOIULHQG RI -DFN 'R\OH ± WKH JUHDW ,ULVK KHDY\ZHLJKWFKDPSLRQDQGQR WRULRXVZRPDQLVHU± IDLUSOD\WR KLP±KDGVHWKHUERQQHWDW3DXO

+HVROGWKHJ\PDQGZHQWWRWKH 6WDWHVZLWKKHUDIWHUWZRµ,'RV¶ DWWKH5HJLVWU\2I¿FH7KH\UDQ DPRNELJWLPHDURXQGWKH%URQ[ ±KHEHLQJDKHDGFKXFNHURXW± VKHGRLQJKHUµ&DUPHQ0LUDQGD¶ VWDJH URXWLQH ± ZKLFK LQYROYHG GLVSHQVLQJZLWKDOOVXUSOXVFROG ZHDWKHUGXGV  DQG VFDPSHULQJ DERXW LQ DQ HQJDJLQJ VKDGH RI µDVVKHZDVERUQ¶ 7KH SROLFH QHYHU ERWKHUHG PXFK ± DV E\ WKH WLPH D GR]HQ RI WKHP KDG RYHUSRZHUHG3DXO±VKH¶GEHDOO µJDUPHQWHGRXW¶ PRVW PRGHVWO\ DQGUHDG\IRU)LIWK$YHQXH ,QGLDQ5RSH7ULFN ³7KDWURPDQFHFDPHWRDVXG GHQ HQG ZKHQ DQ ,QGLDQ 5RSH 7ULFN PDJLFLDQ PDGH /ROD GLV DSSHDU±ZLWKKLPVHOIRIFRXUVH  QRW LQWR D KLGGHQ WUDSGRRU RQ WKH VWDJH  EXW RQWR D WUDLQ WR IDUDZD\SODFHV3DXOFDPHEDFN WR(QJODQGDQGWKHODVW,KHDUG KH ZDV UXQQLQJ D VHFRQGKDQG ERRNVKRS LQ &KLVZLFN 7KDW¶V \HUORWQRZ&XOO\±NHHSLWTXLHW ±DQGJHWDIHZSLQWVLQ´ 6RWKHUHLWLV,ZDVRQO\DE\ VWDQGHUUHDOO\,OHIWWKHWRZQD IHZ PRQWKV ODWHU DQG ZHQW RII WR WKH 0LGGOH (DVW  DQG QHYHU

New York street where Lola danced

KHDUGRIRUVDZ%LOO0DVRQ0D KHU " RU3XQFKDJDLQ  $ ORW RI FRLQFLGHQFHV LQ WKH VWRU\ %XW ZRXOG D WDOH EH ZRU WK\RILWVQDPHZLWKRXWWKHP" 5HDGHU±JHW3DWULFN0DF*LOO¶V JUHDWERRNµ&KLOGUHQRIWKHGHDG HQG¶+HZDVRIDQHDUOLHUZDYH RIHPLJUDQWVWKDQ,±EXW\RX¶OO VHHWKDWP\VWRULHVDERXWµGULQN LQJDQGUXQQLQJDPRN¶DUHDIDLU UHÃ&#x20AC;HFWLRQRIERWKRXUWLPHV 7R ¿QLVK RQH YHUVH IURP D ORYHO\OLWWOHSRHPFDOOHGµ%HDX W\DQG%HDXW\¶ ,W ZDV D VROGLHUSRHW¶V GUHDP LQZRUGVDERXWFRPLQJKRPHWR KLVVZHHWKHDUWDIWHUWKHZDU +HQHYHUPDGHLW« :KHQ%HDXW\DQG%HDXW\PHHW $OOQDNHGIDLUWRIDLU 7KHHDUWKLVFU\LQJVZHHW $QGVFDWWHULQJEULJKWWKHDLU (GG\LQJ GL]]\LQJ FORVLQJ URXQG :LWK VRIW DQG GUXQNHQ ODXJK WHU 9HLOLQJDOOWKDWPD\EHIDOO $IWHUDIWHU   7KDQN \RX 5XSHUW %URRNH 0D\\RXUHVWLQSHDFH 1HG(JDQ0XOOLQDYDW ZZZNLONHQQ\DEXFRP


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 31


32 | ADVERTISEMENT

KILKENNY REPORTER 26 2 2014

@ P U E N I L MUSIC

N N I S R E L E KYT FRIDAY21STFEBRUARY

SATURDAY22ND FEBRUARY

Classics from 80’s & 90’s with

Roisin Dubh & DJs

LATE BAR

DJ Matchstick Men Live music by

The Acousticats

LATE BAR

SUNDAY23RDFEBRUARY

Tomas Jackman


/LIH67</(

26 2 2014 KILKENNY REPORTER

newfilms

HER In Her, Spike Jonze’s virtual reality romcom, set a decade or so in the future, Joaquin Phoenix appears before us as Theodore Twombly, a beefcake in nerd’s clothing. He works at a bespoke letterwriting company, crafting letters full of earnest feelings on behalf of buyers who have lost the art of expressing themselves. His look combines a Tom Selleck moustache with a boxy red jacket and oddly high waisted flannel slacks, and he carries about him a faint air of awkward creepiness, mitigated by rare flashes of spectacular dimples. Theodore is lonely. He has been separated from his wife, Catherine (Rooney Mara), for a year now, but is still dragging his feet on signing the divorce papers. In his head, he gets cinematic flashbacks to the golden-hued good times. He lies awake in bed, hooking up with other lonely people for phone sex that is more erratic than erotic: one promising chat stalls on the female stranger’s breathless plea to “choke me with a dead cat”. The world that Theodore is in seems full of faulty personal connections that suddenly go dead, so he customises one of his own: a sophisticated artificial intelligence, known as an “Operating System” or “OS”, designed to

listen, understand and evolve along with you. His OS arrives with a throaty, husky voice (Scarlett Johansson’s) and calls itself “Samantha”, although its physical presence is confined to an earpiece and smartphone. Before long, Theodore’s Eeyore-ish mood is perceptibly lifting, Samantha is spontaneously composing cascading piano music to convey the beauty of their time together, and the fact that his “girlfriend” doesn’t have a body becomes one of those little quirks a guy is prepared to overlook in someone spectacular. There are interesting philosophical questions at the heart of Jonze’s film. Does “humanity” reside in physicality or self-awareness? Where is fidelity located, in a love affair devoid of sex? I know, too, that the film was supposed gradually to trade creepy for cute, as the chemistry between a sorrowfully sex-obsessed loner and his tiny computer slowly attains the radiant vulnerability of a fully-fledged romance. But the dial never quite shifts. For a start, much of the stuff that is supposed to make the characters charmingly unique feels rather mediocre. Theodore writes terrible letters, stuffed with vague generic cliché. (It’s even worse when he gets specific: his

hired epistles to one woman keep harking fondly back to her “little crooked tooth” which he noticed in a photograph, a motif which – used too often - would probably be enough to get her lover the elbow.) Unlike Theodore, I never fell for Samantha: despite the seductive pulling-power of Johannson’s voice, she seemed distinctly bossy and manipulative, constantly probing his emails and taking executive decisions on his life without asking. The scene in which they have “sex” without contact – with Samantha squealing “I can feel you inside me!” from the smartphone – was one that, were I an OS myself, I would pay to have wiped from my hard drive. The film is far from a trial to watch, though. It has an original premise, some funny lines (Theodore’s man-child plea: “I can’t even prioritise between video games and internet porn”) and a gorgeous set that twinkles and glows in all the right places. The trouble is, Theodore and Samantha – on their lengthy, emotional “learning journey” – talk so much about their evolving feelings that I began to think I should collect a therapist’s fee after the credits. And strangely, by the end, I myself scarcely felt a thing.


34 | NEWS

KILKENNY REPORTER 26 2 2014

COUNTDOWN TO /($)/(76 DUH EHLQJ GURSSHG WKURXJKRXUOHWWHUER[HVDQGWKH FDQGLGDWHVDUHRQWKHFDPSDLJQ WUDLO6RRQWKHSRVWHUVZLOOEHXS DQG RXU SROLWLFDO KRSHIXOV ZLOO WDNHWRWKHDLUZDYHV 7KH5HSRUWHUKDVEHHQ¿QGLQJ RXWDERXWWKHUXQQHUVDQGULGHUV IRUWKH.LONHQQ\&RXQW\&RXQ FLOORFDOHOHFWLRQV .HHS DQ H\H RQ WKHVH SDJHV DV ZH¶OO EH SUR¿OLQJ WKH FDQGL GDWHVLQ\RXUDUHDDKHDGRIWKH ELJHYHQW When are the local elections? /RFDO HOHFWLRQV ZLOO EH KHOG RQ 0D\  9RWLQJ WDNHV SODFHEHWZHHQDPDQGSP What changes can we expect under The Local Government Reform Act 2014? 7KH /RFDO *RYHUQPHQW 5H IRUP$FWEHFDPHODZRQVLJQD WXUHE\WKH3UHVLGHQW0LFKDHO' +LJJLQV RQ -DQXDU\   $ QXPEHU RI UHIRUPV DUH EH LQJ PDGH WR ORFDO JRYHUQPHQW

VWUXFWXUHV,Q.LONHQQ\WKHERU RXJK FRXQFLO ZLOO EH VFUDSSHG ,QVWHDGWKHORFDODXWKRULW\ZLOO EHPHUJHGZLWK.LONHQQ\&RXQ W\ &RXQFLO 7KH 0D\RU ZLOO EH HOHFWHGE\WKHVHYHQFLW\EDVHG PHPEHUV RI WKH &RXQW\ &RXQ FLO $URXQGWKHFRXQWU\WKHUHZLOO EHFKDQJHVWRORFDOJRYHUQPHQW VWUXFWXUHVXQGHUWKHDFW$WRWDO RIWRZQFRXQFLOVZLOOEHUH SODFHG 7KH QXPEHU RI FRXQFLOORUV DURXQG WKH FRXQWU\ ZLOO EH VODVKHG E\ PRUH WKDQ RU IURPWR 7KHERXQGDULHVDUHWRFKDQJH LQ.LONHQQ\XQGHUWKHQHZODZ 7KH FRQVWLWXHQF\ ZLOO QRZ EH GLYLGHGLQWRIRXUHOHFWRUDODUHDV 7KHVHZLOOEHDVIROORZV  &DVWOHFRPHU $WWDQDJK %DOOHHQ %DOOLQDPDUD %DOO\ EHDJK %DOO\FDOODQ %DOO\FRQUD %DOO\UDJJHW%DXQPRUH&DVWOH FRPHU &ORJK &ORJKDULQND

&ORPDQWDJK &RROFUDKHHQ )UHVKIRUG *DOPR\ *ODVKDUH *RUHVEULGJH *RZUDQ -RKQ VWRZQ .LONLHUDQ .LOPD FDU .LOPDQDJK /LVGRZQH\ 0RQHHQURH0RWKHOO0XFNDOHH 2GDJK 3DXOVWRZQ 5DWKEHDJK 5DWKFRROH 5DWKHDO\ 6KDQNLOO 7LVFRI¿Q 7XEEULGEULWWDLQ 7XO ODURDQDQG8UOLQJIRUG .LONHQQ\&LW\±(DVW%DO O\KDOH %DOO\YRRO %HQQHWWV EULGJH %UDPEOHVWRZQ &DVWOH EDQQ\&ODUD&RROKLOO'XQEHOO 'XQPRUH )DPPD )UHDJKDQD *UDLJXHQDPDQDJK ,QLVWLRJH -HUSRLQW &KXUFK .LOIDQH .LONHQQ\1R8UEDQWKDWSDUW RI .LONHQQ\ 5XUDO HOHFWRUDO GL YLVLRQRQWKHHDVWHUQVLGHRIWKH ULYHU1RUH.LOWRUFDQ.QRFNWR SKHU3OHEHUVWRZQ3RZHUVWRZQ 7KH 5RZHU 7KRPDVWRZQ 7XO ODKHULQ 8OODUG DQG :RROHQ JUDQJH  .LONHQQ\ &LW\ ± :HVW

%XUQFKXUFK &DOODQ 5XUDO &DOODQ 8UEDQ &RRODJKPRUH 'DQHVIRUW 'XQDPDJJDQ (DUO VWRZQ(QQLVQDJ*UDQJH.HOOV .LONHQQ\1R8UEDQWKDWSDUW RIWKH.LONHQQ\5XUDOHOHFWRUDO GLYLVLRQ RQ WKH ZHVWHUQ VLGH RI WKH ULYHU 1RUH 0DOODUGVWRZQ 2XWUDWK 6FRWVERURXJK 6W &D QLFH 6WRQ\IRUG DQG7XOODJKDQ EURJXH  3LOWRZQ $JKDYLOOHU $JOLVK %DOOLQFUHD %RRO\JODVV %URZQVIRUG &DVWOHJDQQRQ 'XQNLWW '\VDUWPRRQ )DUQRJH )LGGRZQ -HUSRLQW :HVW .LO

EHDFRQ .LOEULGH .LOFROXPE .LOFXOOLKHHQ.LONHDV\.LOODK\ .LOODPHU\ .LOPDJDQQ\ .LO PDNHYRJH/LVWHUOLQ0XFNDOHH 3LOOWRZQ 3ROOURQH 3RUWQDVFXO O\ 5DWKSDWULFN 5RVEHUFRQ 5X UDO 5RVVLQDQ 6KDQERJK 7HP SOHRUXP7XEEULG7XOODKRXJKW 8OOLGDQG:KLWHFKXUFK Who can vote in the local elections? (YHU\RQH DJHG  \HDUV RU ROGHU LV HQWLWOHG WR YRWH LQ WKH ORFDO HOHFWLRQV KRZHYHU RQO\ ,ULVKDQG(XURSHDQFLWL]HQVFDQ YRWHLQWKH(XURSHDQHOHFWLRQV

How many people are registered to vote? 7KHUH DUH  PLOOLRQ /R FDO *RYHUQPHQW DQG (XURSHDQ HOHFWRUVRQWKHUHJLVWHU How can I register to vote? ,I \RX DUH QRW UHJLVWHUHG WR YRWH DOUHDG\ \RX ZLOO QHHG WR ¿OORXWDQDSSOLFDWLRQIRUPDQG UHWXUQLWWR\RXUORFDODXWKRULW\ QR ODWHU WKDQ $SULO   <RX FDQ GRZQORDG DQ DSSOLFD WLRQ IRUP WR UHJLVWHU RU GRXEOH FKHFN WR VHH LI \RX DUH UHJLV WHUHG E\ ORJJLQJ RQWR ZZZ FKHFNWKHUHJLVWHULH

TALK TO THE REPORTER: We want your feedback. Contact us by emailing kilkennypolitics@gmail.com or leave a note into the office on The Butterslip. Weâ&#x20AC;&#x2122;re happy to ask candidates difficult questions on your behalf.


NEWS | 35

26 2 2014 KILKENNY REPORTER

LOCAL ELECTIONS MAY 2014 Take Two: This week we put two experienced councillors in the spotlight. Cllrs Cora Long (FF) and John Brennan (FG) will be campaigning to retain their seats on Kilkenny County Council this May.

Tell me more about... Cora Long Age?  Party? )LDQQD)DLO What is your idea of perfect happiness? .QRZLQJWKDWDOOP\IDP LO\DQGIULHQGVDUHKHDOWK\ DQGKDSS\ What is your greatest fear? *HWWLQJEXULHGDOLYH What is the trait you most deplore in yourself? ,¶PDOZD\VLQFOLQHGWREH UXVKLQJDWWKHODVWPLQXWH %HLQJODWHLVWKHWUDLW,KDWH WKHPRVWLQP\VHOI What is the trait you most deplore in others? 1RWEHLQJWKHPVHOYHVDQG WU\LQJWREHZKDWWKH\¶UH QRW Which living person do you most admire? 0\PRWKHUZRXOGKDYH EHHQEXWVKH¶VSDVVHG DZD\0DU\&RIIH\7KH

OLYLQJSHUVRQ,PRVW DGPLUHLV0DU\0F$OHHVH ,WKRXJKWVKHZDVEULOOLDQW DWZKDWVKHGLG,PHWKHU RQDFRXSOHRIRFFDVLRQV DQG\RX¶GDOZD\VIHHO\RX ZHUHLPSRUWDQWWRKHU (YHU\ERG\IHOWJRRGLQKHU FRPSDQ\6KH¶VDORYHO\ ZRPDQDQGDUHDOIDPLO\ ZRPDQWRR What is your greatest extravagance? ,OLNHDOLWWOHÃ&#x20AC;XWWHURQWKH KRUVHV What is your current state of mind? :RUULHG,¶PWKLQNLQJ DERXWWKHORFDOHOHFWLRQV EXW,¶PDUHDOO\SRVLWLYH SHUVRQVR,WKLQNZKDWZLOO EHZLOOEH On what occasion do you lie? ,GRQ¶WOLHUHDOO\<RXJHW FDXJKWRXWLQDOLH:KHQ \RXWHOODOLH\RXIRUJHW ZKDW\RXVD\,WROGOLWWOH ZKLWHOLHVWRWKHNLGVZKHQ WKH\ZHUHVPDOO,GHWHVW OLHV

What do you most dislike about your appearance? ,¶GOLNHWREHWKLQQHU When and where were you happiest? :KHQWKHFKLOGUHQZHUH VPDOODQGP\KXVEDQGZDV LQJRRGKHDOWK Which talent would you most like to have? 7RSOD\DQLQVWUXPHQW DQGKDYHDJRRGVLQJLQJ YRLFHOLNHP\QLHFH$P\ 2¶'ULVFROO If you could change one thing about yourself, what would it be? 7REHPRUHSDWLHQWDQGWR KDYHPRUHWLPHIRUP\VHOI What do you consider your greatest achievement? 0\WKUHHFKLOGUHQ3DXO 'DYLGDQG0DU\DQGP\ IRXUJUDQGFKLOGUHQ What is your motto? 0\JODVVLVDOZD\VKDOI IXOO,ILW¶VIRU\RXLWZRQ¶W SDVV\RXLVDQRWKHU,OLNH

Tell me more about... John Brennan Age?  Party? )LQH*DHO What is your idea of perfect happiness? (QMR\LQJDSLQWDIWHUDKDUG ZHHN¶VZRUN What is your greatest fear? *URZLQJROG

On what occasion do you lie? :KHQ,¶PEHLQJHFRQRPLFDO ZLWKWKHWUXWK'HSHQGVRQ ZKDWWKHRFFDVLRQLV What do you most dislike about your appearance? 0\KHLJKW,¶GOLNHWREHWDOOHU When and where were you happiest? :KHQP\WZRFKLOGUHQ'DQLHO DQG6DUDKZHUHERUQ

What is the trait you most deplore in yourself? ,PSDWLHQFH

Which talent would you most like to have? ,¶PKDSS\HQRXJKZLWKWKH WDOHQWV,KDYH

What is the trait you most deplore in others? 3HRSOHWDONLQJEHKLQGRWKHU SHRSOH¶VEDFNV

If you could change one thing about yourself, what would it be? 7REHDQRQVPRNHU

Which living person do you most admire? 0\ZLIH&DWKHULQHVKH¶VD JUHDWVXSSRUW What is your greatest extravagance? 6PRNLQJFLJDUHWWHV What is your current state of mind? 5HOD[HG

What do you consider your greatest achievement? 7KH¿UVWRQHZDVZKHQ, ZDV¿UVWHOHFWHGWR.LONHQQ\ &RXQW\&RXQFLOLQ7KH VHFRQGRQHZDVZKHQ,EHFDPH FKDLUPDQLQ What is your motto? 7REHSRVLWLYHLQOLIHDQGWRWU\ WRKHOSDQGHQFRXUDJHDVPDQ\ SHRSOHDVSRVVLEOH


/LIH67</(

26 2 2014 KILKENNY REPORTER

&$6(<·6&/$66,&6

Max Casey takes a look at the best of music, film and literature

),/0 7KUHH&RORXUV:KLWH 

White is a very different movie from last week’s Blue, it’s hard to believe they had the same director and are part of the same trilogy. Blue’s sparseness of dialogue is gone, as is its morose atmosphere; White often flirts with comedy and absurdity instead; it’s zany where its predecessor was airy, it’s the odd one out of the trilogy. White is the only one with a male protagonist and it moves the majority of the plot from France to Poland and the film discusses both countries at length. Each of these three movies dissects a piece of the famous French Motto ‘Liberty, Equality, Fraternity’ and White lands with the middle one, Equality. The film tells the story of Karol, a Polish immigrant who is divorced in the first scene of the film because of his impotency. Homesick and homeless; Karol busks in the tunnels of the Paris Metro with a comb until he finds another immigrant who is returning to Poland. Unfortunately Karol does not have a passport and as such, he elects to get to Poland by hiding in his suitcase. Scenes

like this sound like something from a comedy but the entire tone of White is so straight-faced that many find these two elements working together confounding. The film criticizes the high capitalism of Poland following the fall of the USSR; many times throughout you hear the phrase: ‘These days you can buy anything’ and how Karol faces homelessness and impotency in France but wild, unparalleled success in Poland is symbolic of that country’s rise out of impoverishment in the early 90’s. The white in this film is overpowering: The sky is constantly white, the world is full of snow, Karol’s dreams are primarily white and the bust he steals in Paris that comes to represent his wife is bleach white. None of these films have any actors you’re likely to recognise but they all put in great jobs and play their parts marvellously. White can be a difficult film to enjoy due to how different and zany it is compared to the other two films in the trilogy, but it is a fantastic work that is worth seeing.

%22.

$/%80 $QLPDO&ROOHFWLYH6XQJ7RQJV 

(UQHVW+HPLQJZD\$0RYHDEOH)HDVW  3W

Animal Collective is a band whose discography can roughly be split into three; pre Sung Tongs, Post Sung Tongs, and Sung Tongs. They were one of the most interesting and prolific rock band of the 00’s and have one of the best discographies in recent years, they broke into the mainstream with 2009’s Merriweather Post Pavilion but it was 2004’s Sung Tongs that paved the way for that to take place. The band’s first few albums were psychedelic, cacophonic and very raw; they’re difficult albums to get into but reward in spades if you are willing to put in the effort. From 2005’s Feels onwards they were still experimental and psychedelic but more structured and often with heavy, dense production. Sung Tongs is probably the biggest anomaly of the band’s discography; a psychedelic folk album that existed somewhere between these two states. It’s more structured and pop influenced than 2003’s Here Comes the Indian but there’s also a 12 minute ambient track stuck right in the middle of it. Like their debut, the album only has two of the usual four members on it and is almost entirely acoustic guitar, drums

Ernest Hemingway’s A Moveable has more the feel of a series of anecdotes than a story in any sense; each chapter tells of a different, unconnected experience that Hemingway had in the five years of the book’s time frame and none can be said to be part of any over-arching plot. Paris in the 1920’s was home to what has become known as The Lost Generation due to a phrase overheard by Gertrude Stein; a collection of artists, most of whom had served in the first world war, who had been inflected with a more cynical and detached view of the world that favoured nihilism and alcohol abuse. The Lost Generation were

and voice modulation; it’s the only album in their discography with this structure. Animal Collective has always been a pop band at heart, their songs are full of catchy melodies and hooks but every other element is experimental and alien to pop music. Their debut Spirit They’ve Gone, Spirit They’ve Vanished coupled pop with harsh noise and a minimalist, spacey aesthetic, their latest album buried melodies in this dense, psychedelic jungle of sounds and noises; the instrumentation of Sung Tongs is sparse compared to those albums so the hooks are much more discernable, the difference is structural. Animal Collective songs tend not to deviate too far from the

verse-chorus-verse structure to some extent but often interject it with lengthy and constantly changing sections between each part. Take the opening song, the phenomenal Leaf House, the song amounts to 2:43 but the only parts that could be considered verses and choruses last for a little over one minute; the rest is these different melodies, often very short that consistently come in and out of the song, it’s like an early Faust piece. Most of the songs are structured like this and it always feels completely natural, like the songs couldn’t have gone in any other direction. The absolute highlight of the album is Winters Love, a beautiful work that perfectly captures this sense of nostalgia and childlike wonderment; it’s this sort of sincerity that I believe has led Animal Collective to be such a widely acclaimed band. Sung Tongs is magical and dreamy and one of the band’s best albums; there is truly nothing like it.

also characterised by a disillusionment with the prewar morals and values that created the First World War. The majority of these writers resided in Paris and were most often acquaintances of each other. Along with Hemingway writers featured in A Moveable Feast include James Joyce, F. Scott Fitzgerald, Ford Madox Ford, Gertrude Stein and Ezra Pound along with dozens of others. In this book Hemingway documents his experiences living poor in Paris, writing for sustenance, and meeting and discussing with the best of the city’s writers; it’s an eclectic work that covers so many characters and locations

in its barely 120 pages and does so in a way that is often scathing of his fellow writers. Hemingway states in the opening letter that you may approach this work as a piece of fiction if it pleases you and it can sometimes feel that it is more fanciful than factual. Hemingway and his wife are always portrayed as loving and caring and quiet while his contemporaries are lashed with criticism of their appearances, writing and opinions that dissent those of Hemingway. This isn’t as much a criticism as it is an observation, Hemingway was a famously vain man and could be considered an unreliable narrator.


Eimear Ni Bhraonain 6WUDLJKW7DON

6

< 6 7 ( 0 6 V R P H W L P H V IDLO ,QQRFHQW S H R S O H VXIIHU EUXWDO FRQVHTXHQFHV ZKHQ WKLV KDSSHQV , ZDV OXFN\ HQRXJK WR WDNH SDUW LQ D QHZ VHULHV IRU 7* FDOOHG µeDJyLU¶ WKDW H[DPLQHV LQIDPRXV FDVHV RI LQMXVWLFH IURPWKHSRLQWRIYLHZRIWKRVH LQYROYHG 7KH VHULHV KLJKOLJKWV WKH JUX HOOLQJ¿JKWIRUMXVWLFHRIVL[LQ GLYLGXDOV6RPHKDYHORVWORYHG RQHV VRPH ZHUH IRUFHG WR ÀHH WKH FRXQWU\ ZKLOH RWKHUV VSHQW WLPHLQSULVRQ$OORIWKHPGHV SHUDWHO\ ZDQWHG WR FOHDU WKHLU QDPHDQGDFKLHYHMXVWLFH 7KH VHFRQG SURJUDPPH LQ WKH VHULHV ZKLFK DLUV WRPRUURZ QLJKW ORRNV DW WKH FDVH RI LQID PRXV'RQHJDOQLJKWFOXERZQHU )UDQN6KRUWW 6KRUWWDPDUULHGIDWKHURI¿YH ZDVZURQJO\FRQYLFWHGLQ RIDOORZLQJWKHVDOHRIGUXJVDW KLV SUHPLVHV 7KH 3RLQW ,QQ LQ 4XLJOH\¶V3RLQW&R'RQHJDO ,Q 2FWREHU  0U 6KRUWW ZDV DZDUGHG ¼P LQ GDP DJHV IRU WKH PLVFDUULDJH RI MXVWLFH KH VXIIHUHG DQG JUDQWHG VXEVWDQWLDO OHJDO FRVWV7KH 6X SUHPH&RXUWGRXEOHGKLVDZDUG WRPRUHWKDQ¼PDIWHUDQDS SHDO 7KH IDFWV RI )UDQN 6KRUWW¶V FDVHDUHGHHSO\GLVWXUELQJ7KH\ UHPLQG XV RI KRZ YXOQHUDEOH FLWL]HQVDUHDJDLQVWFRUUXSWLRQ ,W DOO VWDUWHG IRU )UDQN 6KRUWW ZKHQKLV3RLQW,QQSUHPLVHVZDV FORVHGIRUUHQRYDWLRQVDIWHUWKH GHDWKRIKLVEURWKHU7KHQLJKW FOXE UHRSHQHG LQ $SULO  $OPRVW LPPHGLDWHO\ 6KRUWW DO OHJHGKHZDVWKHYLFWLPRIJDUGD KDUDVVPHQW 2I¿FHUV WXUQHG

The Fight for Justice XS DQG LQVSHFWHG WKH SUHPLVHV UHJXODUO\ WHOOLQJ 6KRUWW WR ³JHW \RXUKRXVHLQRUGHU´7KH\HYHQ VHWXSURDGEORFNVDQGVHDUFKHG SXQWHUV RQ WKHLU ZD\ LQWR WKH 3RLQW,QQ $WWKHWLPHJDUGDLZHUHGHDO LQJ ZLWK WKH SUREOHP RI GUXJ GHDOHUV SDUWLFXODUO\ IURP WKH 1RUWK 6KRUWW KLPVHOI UHYHDOHG WKHUH ZDV DQ LQIHVWDWLRQ RI LO OHJDO GUXJV LQ WKH 1RUWK DW WKH WLPH HFVWDV\ LQ SDUWLFXODU ³:RPHQ ZHUH EULQJLQJ WKH GUXJV LQ WKHLU XQGHUZHDU VR KRZFRXOGZHVWRSWKDW"´ 6KRUWWPHWZLWKJDUGDLLQ-XQH  DQG DJUHHG WR KHOS WKHP E\DOORZLQJXQGHUFRYHURI¿FHUV LQWRKLVSUHPLVHV +RZHYHU VRRQ 6KRUWW IHOW KLV SUHPLVHVZHUHEHLQJVFUXWLQL]HG DQGVXEMHFWHGWRUHSHDWHGUDLGV +HFRPSODLQHGWRWKHORFDO*DU GD6XSHULQWHQGHQWWKH0LQLVWHU IRU-XVWLFHDQGWKH*DUGD&RP SODLQWV%RDUG ,Q WKH HDUO\ KRXUV RI $XJXVW JDUGDLUDLGHGWKH3RLQW

,QQDQGDUUHVWHGDURXQGSHR SOH ,Q 6HSWHPEHU  6KRUWW¶V DSSOLFDWLRQV IRU WKH UHQHZDO RI OLTXRU GDQFLQJ DQG UHVWDXUDQW OLFHQFHVZHUHGHQLHG6KRUWWDS SHDOHG ,Q 2FWREHU JDUGDL FKDUJHG )UDQN 6KRUWW ZLWK PXOWLSOH DO OHJHGRIIHQFHVLQFOXGLQJDOORZ LQJKLVSUHPLVHVWREHXVHGIRU WKHVDOHRIGUXJV +LV FDVH FDPH EHIRUH WKH 'LVWULFW &RXUW DQG 6KRUWW ZDV RIIHUHG D ³VHPLGHDO´ ,I KH SOHDGHG JXLOW\ WR RQH FKDUJH WKH PDWWHU ZRXOG EH GHDOW ZLWK E\ D ¿QH 6KRUWW WXUQHG WKLV GRZQDQGFRQWLQXHGWRPDLQWDLQ KLV LQQRFHQFH +H DVNHG WR EH WULHGE\DMXU\EHIRUHWKH&LUFXLW &RXUW $%RRNRI(YLGHQFHZDVHYHQ WXDOO\ SURGXFHG EXW WKH FDVH DJDLQVW 6KRUWW WXUQHG RXW WR EH YHU\ ZHDN 7KH HYLGHQFH IURP JDUGDL HVWDEOLVKHG WKDW GUXJ GHDOLQJ ZDV WDNLQJ SODFH DW WKH QLJKWFOXEEXWLWGLGQRWHVWDEOLVK

THE FACTS OF FRANK SHORTT’S CASE ARE DEEPLY DISTURBING. THEY REMIND US OF HOW VULNERABLE CITIZENS ARE AGAINST CORRUPTION

WKDW WKH RZQHU )UDQN 6KRUWW ZDV LQYROYHG LQ DQ\ ZD\ 2I¿FHUV LQYROYHG LQ WKH FDVH PDGHVXSSOHPHQWDU\VWDWHPHQWV WR WKHLU RULJLQDO VWDWHPHQWV ZLWK WKH KHOS RI ,QVSHFWRU .HYLQ /HQQRQ 7KH FDVH SUR FHHGHG EXW WKH ¿UVW WULDO FRO ODSVHG GXH WR SUHMXGLFLDO UH SRUWLQJ LQ WKH QHZVSDSHUV7KH VHFRQG WULDO FRPPHQFHG LQ )HEUXDU\  DQG ODVWHG HLJKW GD\V )UDQN 6KRUWW ZDV FRQYLFWHG LQ WKH 'XEOLQ &LUFXLW &ULPLQDO &RXUWRQ)HEUXDU\ +H VHUYHG WLPH LQ 0RXQWMR\ 3ULVRQDQG&DVWOHUHD3ULVRQ+LV KHDOWK GHWHULRUDWHG DQG ZKHQ KH ZDV UHOHDVHG LQ$SULO  KLVOLIHZDVLQWDWWHUV 7KH3RLQW,QQKDGEHHQEXUQHG GRZQ DQG VROG RII DIWHU HQWHU LQJ UHFHLYHUVKLS ZKLOH KH ZDV LQ SULVRQ +H UHFHLYHG QRWKLQJ IURPWKHVDOH $IWHU KLV UHOHDVH IURP MDLO 6KRUWW LQVWLJDWHG SURFHHGLQJV IRUDPDOLFLRXVLQMXU\FODLPDI WHU WKH GHVWUXFWLRQ RI WKH 3RLQW ,QQ+HKDGGLI¿FXOW\LQJHWWLQJ WKHUHTXLUHGSDSHUZRUNIURPWKH &KLHI6XSHULQWHQGHQW 7KHQ LQ  WKH WKHQ ZLIH RIRQHRIWKHJDUGDLLQYROYHGLQ 6KRUWW¶V FDVH 6KHHQDJK 0DF 0DKRQ WROG WKH LQTXLU\ LQWR WKH 'RQHJDO JDUGD VFDQGDO WKDW KHU KXVEDQG 1RHO 0DF0DKRQ KDGFRQIHVVHGWRSHUMXU\LQWKDW FDVH 1RHO0DF0DKRQFRQIHVVHGWR SHUMXU\EXWWKHPHPRUDQGXPRQ ZKLFKWKLVZDVUHFRUGHGZDVORVW E\JDUGDLXQWLO6KRUWW¶VFDVHZDV EURXJKWWRWKH&RXUWRI&ULPLQDO

$SSHDODVKHDWWHPSWHGWRKDYH KLVFRQYLFWLRQTXDVKHG 2Q 2FWREHU   0U 6KRUWW ZDV DZDUGHG ¼P LQ

´

GDPDJHV IRU WKH PLVFDUULDJH RI MXVWLFH KH VXIIHUHG E\ WKH +LJK &RXUW7KLVZDVWKHQPRUHWKDQ GRXEOHGE\WKH6XSUHPH&RXUW ,Q-XO\WKH&RXUWRI&ULP LQDO$SSHDO GHFODUHG KLV FDVH D PLVFDUULDJHRIMXVWLFH 6KRUWW¶VFDVHZLOOEHWHOHYLVHG RQ 7*¶V  µeDJyLU¶ WKLV 7KXUV GD\ )HEUXDU\ DWSP

It’s a second chance at life If you’ve experienced a personal setback, long-term illness or have a disability, a National Learning Network course will give you the confidence and skills to open up new opportunities for employment and fulfilment. Find out more at: NLN Kilkenny 056 7797500 | kilkenny@nln.ie nln.ie facebook.com/NLNIreland

µ


/LIH67</(

BY MAX CASEY

TOP TEN

1 2 3 4 5

26 2 2014 KILKENNY REPORTER

Business of the week Kudeta Kudeta is a new Asian bistro that has just opened up on John Street and is fast turning into one of our city’s best locations. The food culture of Kilkenny is one healthy and thriving and Kudeta’s blending of cultural dishes from all

across Asia as well as its extensive wine bar and live music on Friday evenings make the restaurant one of the most exciting new developments in the Kilkenny culinary experience. Kudeta has already received massive acclaim for its chic

decor, casual, relaxed atmosphere and most importantly its menu; and along with this the restaurant also offers a fantastic take away and delivery service. There really is no parallel to Kudeta; I highly recommend it.

DVD of the week The Hunger Games: Catching Fire Certainly an improvement on last year’s somewhat mediocre The Hunger Games, Catching Fire is a bigger, better written and better directed version of its predecessor and is a much better film because of it. The Hunger Games is a series of films for young adults based on the

books of the same name by Suzanne Collins. They follow Katniss Everdeen (Jennifer Lawrence) a young woman living in her version of Airstrip 1 when she is drafted into the Hunger Games, a series of yearly battles that pit two teenagers from each of the twelve districts into a battle to the death. After

winning the previous year’s games, Katniss is once again made to fight the games but this time she is against an all-star team of previous winners from all the districts. Everything in the film just works so much better than it did previously and Catching Fire is a superior film in almost every way.

Show of the week The Ice Child The Ice Child is a new Irish fairy tale that is being shown in the Watergate Theatre from the tomorrow the 27th February until 1st March. The play is suitable for anyone 8+ and is about a

child made of ice, he is lost and alone because he can’t be touched for fear of melting and must live without even having a hug. The show was penned recently by Irish Writer Mike Kenny

and is definitely worth seeing; in its simplest sense it’s about a child growing up differently and is extremely heartfelt. Tickets are €10 each or €25 for a family of four.

Audio of the week Fiio E11 Amplifier The E11 amplifier packs almost the same punch as its E10 predecessor but with a reduced price and more importantly, the ability to be used portably. Fiio has always made fantastic amplifiers for headphones and the E11 is one of the best you could possibly get for under €80, it’s worth considering amplifiers do

more than make your music louder, it creates a sound fuller richer, and with infinitely more detail that would be available on your standard setup. Every good pair of headphones needs a good amplifier and the E11 is a perfect purchase for anyone looking for one on the cheaper end of the spectrum.

TV of the week The Americans Season 2 The Americans has as good a television premise as you could hope for and does so much with that premise that the show has easily become one of my favourite currently running. The Americans is set in 1980’s America and features a marriage of two Soviet spies as its main characters. The two have

two kids and are trying to survive in a time when the Union is on its last legs. The husband wants to try and stay in the US as an American while the wife eventually wants to return to Russia; the cast of characters isn’t large but the series manages to sprawl to a large degree, it’s definitely worth seeing.


/LIH67</(

26 2 2014 KILKENNY REPORTER

Metal Gear Solid V If there ever was a AAA game series that could be considered auteur it’s Metal Gear Solid. What started out as a simple stealth game for Japanese computers in the 80’s somehow morphed into this epic saga about giant cow robots, haunted ligaments and cyber-aids that people still somehow

take seriously. The games for the most part have you running back over a large area completing objectives, fighting ridiculous boss battles and sitting through cutscenes that sometimes pass the hour mark. The games somehow manage to be both silly and heartfelt and can create some extremely powerful

relatively linear progression of previous games. It looks like it will be a worthy addition to the series and you can rest assured that it will at least be better than 4.

moments; the series unquestionably hits a peak on Metal Gear Solid 3 but the fifth game is starting to look promising, with an emphasis in adding free roaming as opposed to the

App of the week Gneo Gneo is the most expensive app I have ever recommended, costing €8.99 on the app store but there truly is no better app for organization and task managing than Gneo and if you buy it then you’ll recover that initial investment in spades. There really is no great genius to Gneo,

it simply takes the base organization features of the phone, improves and expands upon them all in every way, and puts all into the same place with this simple and easy-to-use interface. I recommend Gneo to anyone who is looking to organize their work lives better.

Film of the week The Momentums Men February tends to be a dire month for film releases but here in The Momentums Men we have a pretty good historical thriller/comedy that is worth the viewing. The film is about the Momentums, a team of army personnel in World War 2 tasked with finding and saving pieces of German art and culture that were being destroyed by

the Nazis. For many people the biggest draw will be the cast; George Clooney (who also directed the film), Matt Damon, Bill Murray, John Goodman and Cate Blanchett all feature in this film and they all do great jobs in their roles. The film won’t be winning any awards for historical accuracy but it’s a fun adventure while you’re watching it.

Song of the week Chvrches- Do I Wanna Know? Chvrches cover of Arctic Monkeys hit 2013 song Do I Wanna Know? changes a haunting, desert melody into this mysterious, synth driven song that initially sounds almost nothing like the original. The cover was performed on Triple J’s Like a Version segment and has amassed almost half a million views so far on Youtube. The Chvrches

Album of the Week St Vincent- St Vincent The first thing that you will probably notice about St. Vincent’s new album is just how each song is almost completely different from the one previous. First you have Rattlesnake with this minimalist, kraftwerk-y rhythm going, the guitar and drums in Birth in Reverse gives it more the feel of a traditional pop

song, and then Prince Johnny is ethereal and epic; those are just the first three tracks but every song on this album has this level of diversity. St. Vincent is a triumph, it succeeds in reinventing the artists sound and making a fresh sound that is one of the best albums of the year so far.

version has more the feel of a traditional love song, especially in the chorus, though the singing of Mayberry gives the song a more elegant quality compared to the original. Is it better? It’s different and the two songs are difficult to compare; either way it’s definitely worth giving a listen.

Top ten

6 7 8 9 10

Game of the week


/LIH67</(

26 2 2013 KILKENNY REPORTER

CROSSWORDS All of the clues relate to Catchwords. Can you find the words then fit them correctly into the grid?

Bold, courageous, independent, enthusiastic, fun-loving and fascinating Aries. Your ruling planet is Mars, your best day of the week is Tuesday and red is your colour. With Uranus moving through your sign (until 2017), others will surely be magnetised by your presence and captivated by your antics. Persistent, appreciative, dependable, practical and creative Taurus: Your ruling planet is Venus, your best day of the week is Friday and your best colour, green. With Pluto moving through another of the Earth signs, Capricorn, until 2024, your expertise is set to grow and consolidate in the coming years. Funny, versatile, talkative, fast-thinking and sophisticated Gemini: Your ruling planet is Mercury, your best day of the week is Wednesday and your best colours are spring-like, yellow and lilac. Jupiter is in your sign until late June 2013 broadening your world. Sensitive, nurturing, careful, imaginative and encouraging Cancer: Your ruling ‘planet’ is the Moon, your best day of the week is Monday and your best colours are blue and silver. Jupiter arrives in your sign in late June 2013 ushering in a period of extraordinary growth and opportunity. Instinctive, warm, creative, extravagant and delightful Leo Your ruling ‘planet’ is the Sun, your best day of the week is Sunday and your best colours are gold, yellow and orange. With Uranus moving through another of the Fire signs until 2017, your life journey is set to include adventures bringing increased contact with new cultures. Nimble, versatile, analytical, constructive, meticulous and often mimicallygifted Virgo. Your ruling planet is Mercury, your best day of the week is Wednesday and your colours are Earthy greens and browns. With Neptune now in your opposite sign of Pisces, the need to find perfection is strong. Charming, elegant, stylish, romantic and merger-making Libra Your ruling planet is Venus, your best day of the week is Friday and your colours are gentle hues of blues, pinks and violets. Pluto’s passage through Capricorn until 2024 is shaking your very foundations.

Down

Across

1. Fairy ___ (7) 2. Names and ___ (9) 3. A ___ peg in a round hole (6) 4. Up and ___ (4) 5. ___ park (3) 6. The ___ of Capri (4) 8. Bits and ___ (6) 13. Sons and ___ (9) 14. A ___ fight (6) 17. Imports and ____ (7) 18. ___ enemy No 1 (6) 19. Over the ___ (4) 22. The ___ test (4) 24. Golfing term, ___ off (3)

1. The four ___ (7) 4. A ___ of cards (4) 7. Lucky ___ (3) 9. Onwards and ___ (7) 10. As cold as ___ (3) 11. I’m all ___ (4) 12. Living on the ___ (4) 15. Brother and ___ (6) 16. ___ skating (6) 19. Hit and ___ (4) 20. Like a ___ in a china shop (4) 21. ___, skip and jump (3) 23. ___ illusion (7) 25. Tales of ___ (3) 26. ___ by example (4) 27. Rich as ___ (7)

Down

Across

1. The ___ Conquest, 1066 (6) 2. ___ over adversity (7) 3. A ___ peg in a round hole (6) 4. The Catcher in the ___ (3) 5. ___ sailing (5) 6. Sights and ___ (6) 7. The ___ of Alcatraz (4,3) 9. Take ___ action (7) 12. ___ pink (7) 13. The ___ of justice (6) 14. ___ in the act (6) 15. Salt and ___ (6) 17. ___ brothers (5) 19. Mr and ___ (3)

1. United ___ (7) 4. Learn the ___ (5) 7. ___ force (5) 8. Secret ___ (7) 9. Wined and ___ (5) 10. Variations on a ___ (5) 11. Heaven and ___ (5) 16. ___ fever (5) 18. The finished ___ (7) 19. ___ wand (5) 20. Both ___ of the argument (5) 21. ___ and lightning (7)

38==/($16:(56RQ3DJH

SUDOKU

Mesmerising, insightful, determined, resourceful and focused Scorpio Your ruling planets are Mars and Pluto, your best day of the week is Tuesday and your colours deep, deep red and black. Saturn is moving through your sign until late 2014. View this as a long period of self-investment. Sparks could fly: possibly because you’re trying to travel too fast. Awareness of extra freedom could prompt you to do something different. It could be that news from far away raises the prospect of financial change. It might also be that someone younger would like you to react quickly to events. Don’t for a moment assume that because things seem to be running well, that things will stay that way. The unexpected is set to knock you off your axis midweek. True, this could be domestic-related. Whatever, your schedule could go awry. Quirky, determined, logical, eccentric and freedom-loving Aquarius. Your ruling planets are Saturn and Uranus. Your best day of the week is Saturday and your best colours are electric or deep, rich blue and anything metallic. You might also decide to move home. Intuitive, sensitive, big-picture thinking, kind and thoughtful Pisces. Your ruling planets are Jupiter and Neptune. Your best day of the week is Thursday and your best colours are those of the sea: blue, green, lavender and silver. Slow moving Neptune is in your sign through to 2024 enhancing your aptitude for healing.


Michael Wolsey +RZ,VHHLW

Sport is the loser when fans arenâ&#x20AC;&#x2122;t on the team 7

RP )LQQH\ ZKR GLHGODVWZHHNZDV DUJXDEO\ WKH ¿QHVW IRRWEDOOHU (QJODQG KDVHYHUSURGXFHG KH ZDV FHUWDLQO\ DPRQJ WKH PRVW FHOHEUDWHG +H SOD\HGIRU3UHVWRQZKHUHKHDOVR ZRUNHGDVDSOXPEHU 3OD\HUV ZHUH IXVV\ DERXW WKHLU ERRWV ZKLFK WKH\ ERXJKW WKHPVHOYHV )LQQH\ NHSW KLV DW KRPH 2Q PDWFK GD\V KH ZRXOG ZD[ WKHP FKHFN WKH VWXGV VWULQJ WKH ODFHV WRJHWKHU DQGZDONWRWKHJURXQGZLWKWKH ERRWV GDQJOLQJ URXQG KLV QHFN 1HLJKERXUV DQG IULHQGV ZRXOG JUHHWKLPZLWKJRRGZLVKHVDQG WDFWLFDOWLSV 7KLVVRUWRIFORVHQHVVEHWZHHQ SOD\HUV DQG VXSSRUWHUV ZDV FRPPRQ DOPRVW HYHU\ZKHUH IURPWKHUHODWLYHPLQQRZVRIWKH /HDJXHRI,UHODQGWRDOOEXWWKH ELJJHVW(QJOLVKFOXEVµ5HODWLYH¶ LVWKHRSHUDWLYHZRUGKHUHIRULQ WKHODWHVDQG¿IWLHVZKHQ )LQQH\ZDVDWKLVSHDN/HDJXH RI,UHODQGFOXEVFRXOGKROGWKHLU RZQ ZLWK DOO EXW WKH EHVW VLGHV IURP DFURVV WKH ZDWHU DQG 3UHVWRQZHUHQHYHURQHRIWKRVH 7KH VDPH HDV\ IDPLOLDULW\ EHWZHHQ WKRVH ZKR SOD\HG DQG WKRVH ZKR ZDWFKHG WKHP SOD\ ZRXOG KDYH RSHUDWHG DW :ROYHUKDPSWRQ ZKHUH 6WDQ &XOOLVEXLOWWKHPRVWIRUPLGDEOH WHDPRIWKHVDW%ODFNSRRO ZKHUH 6WDQOH\ 0DWWKHZV OLNH )LQQH\ PDGH KLV YHU\ RUGLQDU\ WHDPPDWHVORRNOLNHVWDUVDQG DW 6XQGHUODQG ZKHUH WKH JUHDW &KDUOLH+XUOH\ZDVNLQJ ,W ZDV HTXDOO\ WKH QRUP DW %RKHPLDQV RU 6KDPURFN 5RYHUV,WLVYDOLGWRPHQWLRQWKH ,ULVK FOXEV EHFDXVH WKH\ ZHUH SDUW RI D ZLGHU VRFFHU IDPLO\ VKDULQJ VWDQGDUGV YDOXHV DQG DVSLUDWLRQV %RKV SOD\HG DW D

â&#x20AC;&#x153;

IRU ,ULVK WHDPV DQG VPDOO FOXEV HYHU\ZKHUHZKRFDQQRWSRVVLEO\ KRSH WR FRPSHWH 7KH\ DUH QR ORQJHU SDUW RI D ZLGHU IRRWEDOO IDPLO\7KHIDPLO\LVJRQH 7RR ODWH IRU VRFFHU , IHDU %XW ZH PXVW WDNH FDUH WKDW WKH LQIHFWLRQ GRHV QRW VSUHDG WR *DHOLF VSRUWV 3OD\HUV ZKR IROORZ WKH *$$ FRGHV UHPDLQ E\ DQG ODUJH DV URRWHG WR WKHLU FRPPXQLWLHV DV )LQQH\ ZDV WR KLVQHLJKERXUVLQ3UHVWRQ 7KH NH\ WR WKLV OLHV LQ WKH DPDWHXU VWUXFWXUH RI WKH *$$ ZKLFK VWDUWV ZLWK WKH FOXE DQG EXLOGV XS 7KHUH LV PRUH JODPRXULQWKHELJFRXQW\JDPHV EXW WKH IRXQGDWLRQV RI KXUOLQJ DQGIRRWEDOODUHVWLOO¿UPO\¿[HG

VWDGLXP WKDW ZDV EHWWHU WKDQ 3UHVWRQ¶V DQG WKH +RRSV¶  SDUW WLPH SURIHVVLRQDOV ZHUH DOPRVW DV ZHOO RII DV WKH IXOOWLPHUV RI :ROYHV DQG %ODFNSRRO ZKRVH LQFRPH ZDV SHJJHG E\ )$ UXOH WRDPD[LPXPRIÂ&#x2026;DZHHN )LQQH\ SOD\HG IRU WKLV ZDJH RU OHVV WKURXJK PXFK RI KLV FDUHHU&RQWUDU\WRZKDWLVRIWHQ UHSRUWHGLWZDVDEHWWHULQFRPH WKDQ PRVW 3UHVWRQ VXSSRUWHUV FRXOGKDYHKRSHGIRU±WKHNLQG RI VDODU\ HDUQHG E\ VD\ D *3 RU D ORFDO EDQN PDQDJHU %XW LW ZDV ZLWKLQ WKH JHQHUDO ZDJH DPELWRIWKHRUGLQDU\VXSSRUWHUV DQGVLQFHDIRRWEDOOHU¶VHDUQLQJ GD\VZHUHVKRUWOLYHGLWHQVXUHG WKDW IDQV DQG SOD\HUV VKDUHG D FRPPRQOLIHVW\OH 1RZDGD\V WKH\ FRXOG QRW EH IXUWKHU DSDUW  (YHQ DQ DYHUDJH 3UHPLHU /HDJXH SOD\HU ZKR PD\ VSHQG PRUH WLPH RQ WKH EHQFK WKDQ RQ WKH SLWFK ZLOO HDUQ PRUH LQ D ZHHN WKHQ PRVW

RI WKRVH ZKR VXSSRUW KLV WHDP FDQKRSHWRPDNHLQD\HDU7RS SOD\HUV ZLOO EH SDLG PRUH IRU D VLQJOH JDPH WKDQ VRPH RI WKH IDQVZLOOHDUQLQDOLIHWLPH ,Q 7RP )LQQH\¶V GD\ SOD\HUV ZHUH EDGO\ WUHDWHG +H VWDUWHG ZLWK 3UHVWRQ RQ D ZDJH RI Â&#x2026; D ZHHN ZKLFK ZDV UHGXFHG WR Â&#x2026; LQ WKH VXPPHU  :LWK RQH LQWHUHVWLQJH[FHSWLRQKHSOD\HG IRU D VLQJOH FOXE DOO KLV GD\V 5HPDUNDEOH OR\DOW\ , JXHVV %XWKHGLGQ¶WKDYHPXFKFKRLFH 7KHFOXESUDFWLFDOO\RZQHGKLP DQG VW\PLHG DQ RSSRUWXQLW\ IRU D ELJPRQH\ PRYH WR ,WDO\ E\ LPSRVLQJ D ULGLFXORXV WUDQVIHU IHH ,KDYHQRZLVKWRVHHDUHWXUQ WR VXFK SUDFWLFHV EXW HTXDOO\ , KDYHQRGRXEWWKDWWKHFHOHEULW\ WUHDWPHQW QRZ DFFRUGHG WR SURIHVVLRQDO IRRWEDOOHUV LV GHVWUR\LQJ WKH JDPH ,Q SDUWLFXODU WKLV ELJ PRQH\ PDGQHVVLVGHVWUR\LQJWKHJDPH

IN TOM FINNEYâ&#x20AC;&#x2122;S DAY PLAYERS WERE BADLY TREATED. HE STARTED WITH PRESTON ON A WAGE OF £12 A WEEK WHICH WAS REDUCED TO £10 IN THE SUMMER. WITH ONE INTERESTING EXCEPTION, HE PLAYED FOR A SINGLE CLUB ALL HIS DAYS.

DW SDULVK OHYHO 7KH VPDOOHVW FOXE LQ WKH ODQG KDV D FKDQFH RI VKDULQJ &URNH 3DUN JORU\ DQG LI WKH\ JHW WKHUH WKH SDUHQWV JUDQGSDUHQWV DXQWV XQFOHV FRXVLQV DQG DOO WKH QHLJKERXUV ZLOO EH DORQJ WR FKHHUWKHPRQ 7KH *$$ EHORQJV WR WKH SHRSOHZKRSOD\DQGVXSSRUWLWV JDPHVQRWWROLVWHGFRPSDQLHV QRWWR0LGGOH(DVWFRQVRUWLXPV QRW WR PHJD ULFK 5XVVLDQV 7KDW¶V D ZRQGHUIXO WKLQJ DQG WKH *$$ PXVW WDNH FDUH QHYHU WR ORVH LW ZKDWHYHU WKH SUHVVXUHV WR FRPSHWH ZLWK WKH ELJLQWHUQDWLRQDOVSRUWV 7RP )LQQH\¶V EHVW GD\V ZHUH EHIRUHP\WLPH%XW,GLGVHHKLP

SOD\,WZDVWKDWµRQHLQWHUHVWLQJ H[FHSWLRQ¶ , PHQWLRQHG ± LQ  ZKHQ )LQQH\ WKHQ DJHG ZDVFRD[HGRXWRIUHWLUHPHQW IRU RQH JDPH RQO\ IRU %HOIDVW FOXE 'LVWLOOHU\ DJDLQVW %HQ¿FD LQWKH(XURSHDQ&XS , ZDV D VWDUVWUXFN VFKRROER\ LQ WKH  FURZG WKDW ZDWFKHG WKH ,ULVK /HDJXH SDUW WLPHUVDFKLHYHDUHPDUNDEOH GUDZ DJDLQVW SUREDEO\ WKH EHVW WHDPLQ(XURSH ,W ZDV D PDJLFDO QLJKW , GRQ¶WWKLQNZHZLOOVHHLWVOLNHV DJDLQ $QG LW LV WKH SDPSHUHG PLOOLRQDLUHV RI VRFFHU IURP 0LODQWR0DGULGWR0DQFKHVWHU ZKR VKRXOG JHW WKH EODPH IRU WKDW


42 | ADVERTISEMENT

KILKENNY REPORTER 26 2 2014


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 43


44 | ADVERTISEMENT

KILKENNY REPORTER 26 2 2014


26 02 2013 KILKENNY REPORTER

ADVERTISEMENT | 49


50 | ADVERTISEMENT

KILKENNY REPORTER 26 2 2014


ADVERTISEMENT | 51

26 02 2014 KILKENNY REPORTER

)DOORQVSKDUPDF\LVDORFDOO\RZQHGDQGIDPLO\UXQSKDUPDF\  2857($0  x -LP)DOORQLVWKHRZQHUDQGSKDUPDFLVWKHKDVLQH[FHVVRI\HDUV  H[SHULHQFHDVDSKDUPDFLVWKHJUDGXDWHGIURP$VWRQ8QLYHUVLW\LQ  %LUPLQJKDP(QJODQG-LPLVRULJLQDOO\IURP:HVWPHDWKDQGKHKDV  OLYHGLQ.LOPRJDQQ\&RXQW\.LONHQQ\IRUWKHSDVW\HDUV3ULRUWR  RSHQLQJ)DOORQVSKDUPDF\KHZDVHPSOR\HGE\VHYHUDOODUJHSKDUPDF\  FKDLQVDQGGHFLGHGWRRSHQKLVRZQEXVLQHVVDVKHIHOWKHFRXOGRIIHUD  PRUHSHUVRQDOVHUYLFHWRKLVSDWLHQWV x %UHQGD0RUULVWKHTXDOLILHGDVVLVWDQW3KDUPDFLVWKDVZRUNHGLQSKDUPDF\ RQ-RKQ6WUHHWIRUPRUHWKDQ\HDUVVKHLVIURP/HLJKOLQEULGJH&R &DUORZ x 0LFKHOOH1XJHQWD.LONHQQ\QDWLYHLVDSKDUPDF\FRXQWHUDVVLVWDQWDQG LVLQWUDLQLQJWREHFRPHDSKDUPDF\WHFKQLFLDQ0LFKHOOHKDVDOPRVW \HDUVH[SHULHQFHLQUHWDLO x %UHQGD0LFKHOOHDQG-LPDUHIXOOWUDLQHGLQRYHUWKHFRXQWHUPHGLFLQHVLI \RXKDYHDFRXJKFROGRUDQ\RWKHUDLOPHQWDVNWKHPWRGLDJQRVH\RXU LOOVDQGVXJJHVWWKHLGHDOUHPHG\  2856(59,&(6  x 'LVSHQVHDOOSUHVFULSWLRQVLQFOXGLQJ*06PHGLFDOFDUG/RQJ7HUP,OO QHVV'UXJ3D\PHQW6FKHPHDQGDQ\RWKHUSUHVFULSWLRQVLVVXHGE\\RXU GRFWRUFOLQLFRUKRVSLWDO x 3ULYDWHFRQVXOWDWLRQDUHD x +HDOWKFKHFNVLQFOXGLQJEORRGSUHVVXUHPRQLWRULQJFKROHVWHUROOHYHOVDQG ZHLJKWPDQDJHPHQW x :HHNO\DQGPRQWKO\PHGLFDWLRQSDFNV x )UHHSDUNLQJ x /DUJHSULQWODEHOVDQGHDV\RSHQPHGLFDWLRQFRQWDLQHUV  x )UHH3UHVFULSWLRQFROOHFWLRQDQGGHOLYHU\VHUYLFH x )UHH+HDULQJ7HVWV x ,QVWDQWGLJLWDOSKRWRV  )/89$&&,1$7,216(59,&(   )OXYDFFLQDWLRQVHUYLFH)UHHRIFKDUJHIRUWKRVHDJHGRYHU\HDUVZLWK  D*06PHGLFDOFDUGDVPDOOIHHLVFKDUJHGWRRWKHUSDWLHQWV  35,&(0$7&+   )DOORQVSKDUPDF\ZLOORIIHU\RXWKHPRVWFRVWHIIHFWLYHPHGLFDWLRQSULFHV  DYDLODEOH,I\RXILQGDQLWHPFKHDSHUHOVHZKHUH)DOORQVSKDUPDF\RIIHUV  DSULFHPDWFKJXDUDQWHH  )5((3$5.,1*  7KHSKDUPDF\LVRSHQ0RQGD\WR6DWXUGD\DPWRSP :K\QRWHPDLOID[RUSKRQHWKURXJK\RXUSUHVFULSWLRQIRUTXLFNFROOHFWLRQ" &DOO  DQGVSHDNWR-LP%UHQGDRU0LFKHOOH )D[   (PDLOMLP#IDOORQVSKDUPDF\LH

6RPHRIRXUFXUUHQWRIIHUV $TXDIUHVK:KLWHQLQJWRRWKSDVWHPO     +HDGDQGVKRXOGHUVFODVVLFFOHDQVKDPSRRPO   3KDUPDWRQ&DSVXOHVSDFN    553¼ 3KDUPDWRQ&DSVXOHVSDFN    553¼ 0LOWRQ6WHULOLVLQJOLTXLGPO       6LPSOHDQWLEDFWHULDOKDQGZDVKPO  553¼ 9DVHOLQH3HWUROHXP-HOO\PO    RII 

)DOORQVSULFH¼ )DOORQVSULFH¼ )DOORQVSULFH¼ )DOORQVSULFH¼ )DOORQVSULFH¼ )DOORQV3ULFH¼ )DOORQVSULFH¼

2QO\ ¼


52 | ADVERTISEMENT

KILKENNY REPORTER 26 02 2013


26 02 2013 KILKENNY REPORTER

ADVERTISEMENT | 53


54 | ADVERTISEMENT

KILKENNY REPORTER 26 2 2014


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 55


56 | ADVERTISEMENT

KILKENNY REPORTER 26 2 2014

AT FAITHLEGG HOUSE HOTEL & GOLF RESORT

Winter € Golf Offer includes round of golf on our championship 18 hole course followed by steak sandwich and homemade chips

30 Golf and Meal

Offer valid to end of March, T&C’s apply.

Telephone Golf Shop: 051 380587 or 380592 E-mail: golf@fhh.ie www.FaithleggGolfClub.com


26 2 2014 KILKENNY REPORTER

ADVERTISEMENT | 57


58 | ADVERTISEMENT

KILKENNY REPORTER 26 2 2014

%ORZGU\%RXWLTXH

/RXLVH'HODQH\ Boutiques have a habit of complicating a procedure that should be something so simple but the new Blowdry Boutique has set out to change that. This unassuming new business located in the Pennyfeather Lane is the perfect place for anyone looking for a good nails job that is fast and convenient without any loss of quality. When you enter Blowdry Boutique you are guaranteed to be out again within half an hour with two weeks perfect match nails. Appointments are unnecessary, as are products; Blowdry Boutique

is about the service not the accessories and it is undoubtedly the best at what it does. This new venture is being headed by local Louise Delaney, a woman long passionate about the world of boutiques and has troves of experience in the field; she is dedicated to a quality job, you will never leave disappointed. The Blowdry Boutique is one of Kilkennyâ&#x20AC;&#x2122;s best new businesses and is the best place for a quick and convenient nails or hair service in the city; walk in whenever convenient and you will never want to leave.


NEWS | 59

26 2 2014 KILKENNY REPORTER

)5$1¶6*$5'(1,1*&2/801

Above and below centre: Scenic views of Donegal, the second best beach in the world...and itâ&#x20AC;&#x2122;s located in Donegal!

People have gardens in rockeries! By Frances Theloke :(17 83 WR 'RQHJDO ODVW ZHHNIRUPLGWHUP-HHSHUV\RX ZRXOGQ¶WEHSODQQLQJPDQ\JDU GHQVXSWKHUH%R\LVLWGHVRODWH DQGVDYDJH 8QIRUJLYLQJ WRR , ZRXOG LPDJLQH 6RPH RI XV DVSLUH WR KDYLQJ URFNHULHV LQ RXU JDU GHQV«,Q'RQHJDO,WKLQNWKH\ DVSLUH WR KDYH JDUGHQV LQ WKHLU URFNHULHV +XJH JUHDW ERXOGHUV VWXFN ULJKWLQWKHFHQWUHRIWKHJDUGHQ ,WKLQN\RX¶GQHHGVRPHRIWKRVH JX\VIURPWKHS\UDPLGVWRVKLIW WKHPWKH\ZHUHVRHQRUPRXV $Q\KRZDPD]LQJVFHQHU\EXW LVRODWLRQ RQ D VFDOH ZH FDQQRW HQYLVDJH GRZQ VRXWK 7KHUH ZDVDOVRDSRLJQDQF\DERXWWKH HQWLUH FRXQWU\VLGH (YHU\ZKHUH \RX WXUQHG WKHUH ZHUH UXLQHG FRWWDJHV VRPHWLPHV DORQH VRPHWLPHVKXGGOHGLQKDPOHWV <RX FRXOG MXVW LPDJLQH KRZ KDUGWKHIDPLQHKLWLQWKHVHGHV RODWHDUHDVDQGWKHRQO\RSWLRQ ZDVWRGLHRULI\RXZHUHOXFN\ HQRXJKHPLJUDWHWR$PHULFD :H WUDYHOOHG WR ,QLVKRZHQ 3HQLQVXOD ULJKW XS WR 0DOLQ KHDG«WKH WRS RI WKH ZRUOG :HOO,UHODQGDWOHDVW 3RLJQDQWSRHP 7KHUHWRRWKHUHZDVDSRLJQDQW SRHPIURPDQHPLJUHH¶VVLVWHU ZKRVH ODVW VLJKW RI KHU EURWKHU KDG EHHQ KLV $PHULFDQ±ERXQG VKLS URXQGLQJ WKH FRUQHU DW 0DOLQ +HDG SUREDEO\ QHYHU WR EH VHHQ DJDLQ LQ KLV RU KHU OLIHWLPH $Q\KRZ WKH YLHZV DUH EUHDWKWDNLQJ DQG WKH SHRSOH LQ 'RQHJDO DUH VR VZHHW«XQ

OLNH VRPH RWKHU  WRXULVW\ VSRWV LQ,UHODQGWKH\JHQXLQHO\VHHP WR DSSUHFLDWH WRXULVWV DQG ZKDW WKH\FDQEULQJWRWKHLUDUHD :H VWD\HG LQ DQ DPD]LQJ 5HFWRU\ % % LQ 5DPHOWRQ« :KDW DQ H[SHULHQFH )UHZLQ +RXVH UXQ E\ .LONHQQ\ H[ SDW 5HJLQD *LEVRQ 7R VD\ , ZDQ GHUHG DURXQG KHU KRXVH WULS SLQJRYHUP\FKLQZRXOGEHDQ XQGHUVWDWHPHQW +HU KXVEDQG 7KRPDV LV DQ DYLG FROOHFWRU RI DQWLTXHVDQGTXLUN\REMHFWVDQG WKHFRXSOHKDYHGHFRUDWHGWKHLU SURSHUW\ LQ WKH PRVW DPD]LQJ IDVKLRQ +RVSLWDOLW\ ZDV VHFRQG WR QRQH $Q\KRZ 5HJLQD ZRXOG VD\ WKDW RI DOO WKH SODFHV LQ ,UHODQGWRYLVLW'RQHJDOVHHPV WR VXIIHU PRVW LQ WHUPV RI ODFN RIWRXULVWV 6ZHOWHULQJHYHU\ZKHUH 7KHSHUFHSWLRQLVWKDW'RQHJDO LVVRRRRIDUDZD\\RX¶GQHHGWR SODQ \RXU WULS PRQWKV PRQWKV LQDGYDQFH1RWWRPHQWLRQWKH GLUHZHDWKHUZDUQLQJV :HOO VKH¶V QRW MRNLQJ DERXW WKDW:HOLVWHQHGLQWHQWO\WRWKH ZHDWKHU IRUHFDVWV WKH SUHYLRXV ZHHN ZRQGHULQJ ZKDW NLW WR EULQJ $W ¿UVW LQ ZHUH WKH VQRZ FKDLQVFORVHO\IROORZHGE\WKH VQRZ ERRWV DQG WKH DQWLVNLG VOLSRQ\RNHV$OOWKHVNLVZHUH JRQHWRWKH:LQWHU2O\PSLFVLQ 6RFKL RWKHUZLVH WKH\¶G KDYH EHHQ LQ WRR 7KHQ ZH KDG WR LQFOXGHWKHWKLFNZRROOLHVWKHU PDOXQGHUZHDUGRXEOHSDLUVRI VRFNV 7KH FDU NHSW VFUDSLQJ LWV XQ GHUFDUULDJH RII WKH JURXQG ZH KDG VR PXFK SURWHFWLYH JHDU LQ LW ,¶OO QHYHU OLVWHQ WR *HUU\ )OHPLQJ DJDLQ 7KH ZHDWKHU QHYHU GLSSHG EHORZ  GHJUHHV DQG ZH ZHUH VZHOWHULQJ HYHU\ ZKHUH ZH ZHQW 0RVW RI WKH VWXII LQ WKH FDU QHYHU VDZ WKH OLJKWRIGD\ 7KH RQO\ SUREOHP ZLWK JR LQJDWWKLVWLPHRI\HDULVHYHU\ SODFHZDVFORVHG

'ULQNPRUHZLQH :H FRXOGQ¶W JHW D FXS RI FRI IHHDQ\ZKHUH,KDGZLWKGUDZDOV DIWHU¿YHGD\VZLWKQRFRIIHHVR WKHUH ZDV QRWKLQJ IRU LW EXW WR GULQN PRUH ZLQH , WKLQN , PD\ ERRN P\VHOI LQWR WKH $LVKOLQJ

Frewin House

&HQWUHIRUDZHHNWRWU\WRGHWR[ µ2Q D SRLQW RI LQWHUHVW«IRU WKRVH RI \RX ZKR ZDWFK WKH %%&VKRZµ(JJKHDGV¶"'R\RX NQRZWKH,ULVKFKDSRQLW3DGG\ *LEVRQ" <HV 5HJLQD¶V EURWKHU ZKR KDV ZRQ %UDLQ RI %ULWDLQ

:KRZDQWVWREHD0LOOLRQDLUH" $QG0DVWHUPLQG 0\SLFWXUHVKRZV3DGG\ZLWK 5HJLQD DQG 7RP VHFRQGO\ ZLWK -RKQ +XPSKULHV TXL] PDVWHU RI µ0DVWHUPLQG¶ DQG ODVWO\ ZLWK &KULV 7DUUHQW DIWHU

ZLQQLQJ µ:KR ZDQWV WR EH D 0LOOLRQDLUH"¶ ,W¶VQLFHWRNQRZVRPHRIWKHVH FRQWHVWDQWVDUHDFWXDOO\UHDO )UDQ FDQ EH FRQWDFWHG RQ WKHORNHI#JPDLOFRP IRU FRP PHQWVRUTXHULHV

Paddy Gibson winning all those shows


60 | MOTORS

KILKENNY REPORTER 26 2 2014


NEWS | 61

26 2 2014 KILKENNY REPORTER

‘Party whips are the wrecking balls of our own democracy’ JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

3(7(50DWKHZVDSDVWSXSLORI )LQH*DHOZLOOKDYHD.LONHQQ\ DOO\ZKHQKHJRHVWRZDUDJDLQVW WKHSDUW\ZKLSV\VWHP ³*HQHUDOO\ VSHDNLQJ 3HWHU DQG , DUH RQ WKH VDPH ZDYH OHQJWKZLWKDIHZPLQRUGLIIHU HQFHVRIRSLQLRQ´'HSXW\-RKQ 0F*XLQQHVV D IRUPHU 0LQLVWHU RI 6WDWH DW WKH 'HSDUWPHQW RI 7UDGH (QWHUSULVH DQG (PSOR\PHQWWROG7KH5HSRUWHU 3HWHU ZDV H[SHOOHG IURP WKH )LQH *DHO SDUOLDPHQWDU\ SDUW\ RQ-XO\ZKHQKHGH¿HG WKHSDUW\ZKLSE\YRWLQJDJDLQVW WKH µ3URWHFWLRQ RI OLIH 'XULQJ 3UHJQDQF\%LOO¶ ³, KDYH FRQWLQXRXVO\ FULWL FLVHG WKH ZKLS V\VWHP RYHU WKH \HDUV LW FUHDWHV D KHUG PHQWDO LW\LWLVDQDIIURQWWRGHPRFUDF\ DQG WUHDWV EDFNEHQFKHUV ZLWK FRQWHPSW ³, XQGHUVWDQG WKHUH KDV WR EH VRPH VRUW RI XQLIRUPLW\ DW %XGJHWDQGRWKHUVXFKWLPHV%XW PRVWRIWKHWLPHDZKLSV\VWHPLV XVHG WR HQVXUH WKDW WKH PDMRULW\ LVFRQWUROOHGE\DWLQ\PLQRULW\ 'LVJXVWLQJWUHDWPHQW ³,QGLYLGXDOSDUW\PHPEHUVUH FHLYHZKDW,FDQRQO\GHVFULEHDV GLVJXVWLQJWUHDWPHQWDVWKH\DUH

URXQGHG XS WROG ZKDW ZD\ WR YRWH DQG GDUH QRW UHEHO IRU IHDU RI H[ SXOVLRQ IURP DSDUW\ ³7KLV V\V WHP LV QRW RQO\ D Z U H F N L Q J EDOO RI GH P R F U D F \  LW LV DOVR D WZR ¿QJHUHG VDOXWH WR WKH SHRSOH RI RXU FRXQWU\ WR WKH S H R S O H

FRXQWULHV RQO\ ZKHQ LW VXLWV XV 'RLQJDZD\ZLWKDFRQWLQX RXV ZKLS V\VWHP ZRXOG OHDG WR JUHDWHU GHEDWH ZRXOG PHDQ D PRUH ULJRURXV V\VWHP DQG RXU SHRSOH ZRXOG EH EHWWHU UHSUHVHQWHG DW 'iLOOHYHO &KRNHXVDOO ³, EHOLHYH WKDW KDYLQJ D V\VWHP ZKHUH WKHUH LV D RQH ¿W IRU DOO LV XQKHDOWK\ DQG XQGHPRFUDWLF DQG ZLOO HYHQWXDOO\ FKRNH XV DOO

John McGuinness ZKR HOHFW SDUWLFXODU SROLWLFLDQV WRUHSUHVHQWWKHPDW*RYHUQPHQW RU 2SSRVLWLRQ OHYHO QRW WR EH SDUWRIDJURXSWKDWLVSXVKHGDQG VKRYHG DQG WROG ZKHQ WR ERZ DQGJHQXÀHFW´-RKQFRQWLQXHG ³3HRSOH VKRXOG EH DOORZHG WR YRWHZLWKWKHLUFRQVFLHQFHVWKDW LVZKDWKDSSHQVLQPRVWGHPRF UDFLHV EXW ZH KDYH D KDELW RI TXRWLQJ WKH ZRUNLQJV RI RWKHU

GHFLGHGDWSROLWLFDOOHY HO DQG WKHQ WKH KHUG DND WKH EDFNEHQFK HUV LV ZKLSSHG LQWRVKDSH ³$ GLVVHQWHU RU FRQWUDULDQ PD\ QRW DOZD\V VXLW WKRVH ZKR FUDFN WKHZKLSEXWWKRVH SDUWLFXODU YLHZV FRXOG EH LQYDOXDEOH IRU WKH IXWXUH RI RXU FRXQWU\´ 'HSXW\ -RKQ VDLG KHZDVQRWSRLQW LQJ WKH ¿Q

VKRZ UHVSHFW IRU WKRVH ZKR YRWHG IRU WKHP UDWKHU WKDQ GHJUDG LQJWKHLURZQSRVL WLRQVE\IROORZLQJ WKHKHUG´ +H DFFXVHV WKH * R Y H U Q P H Q W ¶V ( F R Q R P L F &RXQFLO RI EHLQJ DQ XQKHDOWK\ GLF WDWRUVKLS SDUWLFX ODUO\ DW WLPHV ZKHQ WKH KLHUDUFK\ GHFLGH WR UDLOURDG D %LOO WKURXJK WKH 'DLO +HVD\VWKLVQRZ KDSSHQ

Peter Mathews ³$ ZKLS V\VWHP UXOHV RXW GLV VHQWLQJ YRLFHV WKH ZKLS UXOHV 7KLV OHDGV WR ÀDZHG OHJLVOD WLRQ DQG WR D D SRRU GHPRFUDF\ LQ WHUPV RI WKH SROLWLFDO SDUW\ V\VWHP ³7KHUH LV D ELJ GLIIHUHQFH EH WZHHQSDUOLDPHQWDU\GHPRFUDF\ DQGSDUOLDPHQWDU\SDUW\GHPRF UDF\2XU6WDWHLVUXQE\DVPDOO QXPEHURISHRSOH(YHU\WKLQJLV

JHU RI EODPH DW DQ\ RQH SROLWL FDOSDUW\ZKHQODVKLQJWKHZKLS V\VWHP ³, DP LQFOXGLQJ DOO WKH SDUWLHV)LQH*DHO/DERXU6LQQ )pLQDQG)LDQQD)iLORIZKLFK, DPDOLIHWLPHPHPEHU 5DLOURDGD%LOO ³%DFNEHQFKHUV ZLOO KDYH WR VKRZ FRXUDJH VWDQG XS IRU WKHPVHOYHV DQG GHPDQG WKHLU ULJKWVZLQEDFNWKHLUYRLFHVDQG

LQJSUDFWLFDOO\HYHU\ZHHN$QG KH DFFXVHV ZKDW KH GXEV WKH µ%LJ )RXU¶ RI EXOO\LQJ WKURXJK %LOOVZLWKRXWDQ\GHEDWH ³2QFH WKH GLFWDWRUV PDNH D GHFLVLRQ WKLV LV IRUFHG RQ WKH SDUOLDPHQWDU\ SDUW\ WKH ZKLSV WDNH LW IURP WKHUH WKH %LOO LV JXLOORWLQHG 2Q WKRVH RFFDVLRQV DPDMRULW\RISHRSOHLQWKH'iLO SDUWLFXODUO\ D ELJ QXPEHU RI

Pins and needles in the hand

By Tomás Ryan 3,16$1'QHHGOHVLQWRWKH KDQGFRXSOHGZLWKUDQGRPDFK\ SDLQLQWRWKHVKRXOGHUEODGHDQG DORQJWKHDUPDUHV\PSWRPVRI QHUYHFRPSUHVVLRQ +RZHYHUWKHSUREOHPGRHV QRWDOZD\VRULJLQDWHLQWKHQHFN RUFHUYLFDOVSLQHDVLWLVNQRZQ DV 7KHVHSDUWLFXODUV\PSWRPV FDQLQIDFWFRPHIURP QHUYHLUULWDWLRQLQWKHXSSHU WKRUDFLFVSLQHZKLFKORFDWHG EHWZHHQWKHVKRXOGHUEODGHVD FRQGLWLRQWKDWLVNQRZQDV7 V\QGURPH 7RGD\,ZLOOGLVFXVVD FRPPRQFDVHRIDSHUVRQZLWK PLGGOHVKRXOGHUEODGHSDLQDQG SLQVDQGQHHGOHVLQWRWKHKDQG 6LJQVDQGV\PSWRPVRID SDWLHQWZLWKPLGGOHVKRXOGHU

EODGHSDLQDQSLQVDQGQHHGOHV LQWRWKHKDQG l2QJRLQJSLQVDQGQHHGOHV LQWRDOORIWKH¿QJHUVRIWKHOHIW RUULJKWKDQG l +DVJUDGXDOO\ZRUVHQHG LQQDWXUHRYHUDQXPEHURI PRQWKV l ([WUHPHVRUHQHVVLQWKHPLG VKRXOGHUEODGHUHJLRQDORQJWKH VSLQHZKHQWRXFKHG l 6KDUS3DLQLQWRWKHULJKW HOERZZKHQWKH7YHUWHEUDH EHWZHHQXSSHUVKRXOGHUEODGHV LVFRPSUHVVHGE\WKH3K\VLFDO WKHUDSLVW l )RUZDUGEHQGLQJRIWKHQHFN FDXVHVVKDUSSDLQLQWRVKRXOGHU UHIHUULQJWRWKHZULVW l 3LQVDQGQHHGOHVLQWRWKH KDQGDJJUDYDWHGE\FRPELQJ RIWKHKDLURUDQ\RYHUKHDG DFWLYLW\ l 3LQVDQGQHHGOHVDQGVKDUS SDLQZDVUHOLHYHGE\YLJRURXVO\ µVKDNLQJRXWWKHKDQG¶ 6RZKDW¶VFDXVLQJWKH VKRXOGHUEODGHSDLQ SLQVDQG QHHGOHVLQWRWKHKDQG" ,QWKLVH[DPSOHEHFDXVHRI WKHH[WUHPHORFDOWHQGHUQHVVDW WKH7YHUWHEUDHEHWZHHQWKH VKRXOGHUEODGHVWKHWKRUDFLF VSLQHFDQEHFRQVLGHUHGDVWKH RULJLQRIWKLVFRQGLWLRQ7KH DXWRQRPLFQHUYHVZKLFK

/DERXU DQG )LQH *DHO GHSXWLHV DUH VLPSO\ XVHG DV SDZQV LQ D GLVJUDFHIXOJDPHRISROLWLFV 6WUDLJKWMDFNHW ³:KDWWKHµ%LJ)RXU¶DUHVD\ LQJLVWKDWPRVWSROLWLFLDQVKDYH QRWKLQJ WR RIIHU DQG KDYH QR LQWHOOLJHQFH ,I VRPHRQH EUHDNV UDQN RIIHUV D GLIIHUHQW RSLQLRQ WKH µRIIHQGHU¶ ZLOO EH SXVKHG WR WKH PDUJLQV RU WXUIHG RXW RI D SDUW\ WKHUHE\ EHLQJ GLVFRQ QHFWHG IURP D GLSORPDWLF SUR FHVV ZKLFK WKH HOHFWRUDWH YRWHG KLPRUKHULQWR ³&KDQJHVKDYHWREHPDGH7KH µ%LJ )RXU¶ 0LFKDHO 1RRQDQ %UHQGDQ +RZOLQ (QGD .HQQ\ DQG (DPRQ *LOPRUH WKUHH WHDFKHUV DQG D WUDGH XQLRQ UHS UHVHQWDWLYHZLWKQREDFNJURXQG LQ MRE FUHDWLRQ QR EDFNJURXQG LQ EXVLQHVV FDQQRW EH DOORZHG WRUXOHWKHURRVW,IGLFWDWRUVKLS LVDOORZHGWRFRQWLQXHWKHQRXU FRXQWU\ ZLOO QHYHU PDNH DQ\ SURJUHVV DQG RXU SHRSOH ZLOO FRQWLQXHWRVXIIHU ³:KHQ , DP HOHFWHG WR UHS UHVHQW WKH SHRSOH RI &DUORZ .LONHQQ\ LQ 'iLO eLUHDQQ WKHUH LV QR FRQGLWLRQ LQFOXGHG WKDW , VKRXOG OHDYH P\ EUDLQV RXWVLGH /HLQVWHU+RXVHDQGWKDW,VKRXOG EH SXW LQWR D SROLWLFDO VWUDLJKW MDFNHW LQVLGH WKH JDWHV´ -RKQ FRQFOXGHG

SDUWO\RULJLQDWHIURPWKH WKRUDFLFVSLQHWUDQVPLW QHUYHLPSXOVHVIURPWKHEUDLQ DQGVSLQDOFRUGWRWKHRUJDQV RIWKHERG\,UULWDWLRQRIWKHVH QHUYHURRWVEHWZHHQ77 YHUWHEUDLVFODVVL¿HGDVD7 V\QGURPHDFRQGLWLRQWKDWFDQ EULQJDERXW3LQV QHHGOHVLQWR WKHKDQG 7UHDWPHQW :KHQWKH3K\VLFDO7KHUDSLVW H[DPLQHVKLVKHU¿QGLQJVKH RUVKHPXVWLGHQWLI\WKHFRUUHFW WRROVIRUWUHDWPHQW:KHQ WUHDWLQJDSDWLHQWZLWKWKHVH V\PSWRPV,KDYHIRXQGJUHDW EHQH¿WIURPXVLQJJUDGHG PDQXDOWUDFWLRQIROORZLQJ FHUYLFDOURWDWLRQWRWKHSDLQIUHH VLGHRIWKHQHFN 0DQXDOFHQWUDOLVLQJ PRELOLVLQJLVKHOSIXODOVRLQ ODWHUVWDJHVIRUUHOLHIRIPLGGOH VFDSXODSDLQ7KURXJKRXWWKH WUHDWPHQWSURFHVVV\PSWRPVRI QHFNSDLQZKHQEHQGLQJSLQV QHHGOHVLQKDQGZKHQSODFHG EHKLQGKHDGDQGHOERZSDLQ ZKHQFRPSUHVVLQJ7YHUWHEUDH DUHFRQWLQXDOO\DVVHVVHGIRU LPSURYHPHQW 7RPiV5\DQLVD5HJLVWHUHG 3K\VLFDO7KHUDSLVWZLWK7KH ,ULVK$VVRFLDWLRQRI3K\VLFDO 7KHUDS\ 0,$37 DQGLV EDVHGLQ&ORQPHO&RQWDFW  (PDLOTXHULHVWRLQIR#WLSS SK\LVFDOWKHUDS\LH


62 | MOTORS

KILKENNY REPORTER 26 2 2014


NEWS | 63

26 2 2014 KILKENNY REPORTER

Sean Nós singer Iarla Ó Lionaird with Mayor Martin Brett, Annmarie Hogan and Dervla Ó Connor

Local trad musicians at the launch

TradFest: A brilliant dress rehearsal $ )8// KRXVH EULOOLDQW PXVLF DQGVRQJHQVXUHGWKDWWKHODXQFK RIRXUVHFRQG.LONHQQ\7UDG)HVW DW3DULV7H[DVZDVDVXSHUGUHVV UHKHDUVDOIRUWKHUHDOWKLQJ 7UDGIHVW &RPPLWWHH &KDLU 0DOFROP1RRQDQVDLGWKHUHZDV DOUHDG\DJUHDWEX]]DVRXUFLW\¶V ¿UVWIHVWLYDORIWKH\HDUEHFNRQV  7KH IHVWLYDO KDV DWWUDFWHG WKH ELJJHVWQDPHVRQWKHWUDGVFHQH +HUHRYHU6W3DWULFN¶V:HHNHQG ZLOO EH .LOD 'HUYLVK 'RQDO /XQQ\ %HJLQLVK $QG\ ,UYLQH (GHO)R[DQG7KH9RLFH6TXDG ³'XH WR WKH VXFFHVV ODVW \HDU WRS FODVV PXVLFLDQV GHOLJKWHG WR EH LQYLWHG WR WDNH SDUW ZLWK VRPHFXWWLQJVKRUW(XURSHDQDQG 86 WRXUV WR SOD\ IRU WKH SHRSOH RI .LONHQQ\ DQG RXU FLW\¶V YLVL WRUV´7UDG)HVWPDQDJHU0DULDQ )ODQQHU\WROG7KH5HSRUWHU ³,W LV VLJQL¿FDQW WKDW ZH FDQ WKDQNV WR WKH JHQHURXV VXSSRUW RI RXU VSRQVRUV EULQJ ZRUOG FODVVWUDGLWLRQDOPXVLFLDQVKHUH :HWKDQNRXUVSRQVRUVIRUWKHLU JUHDWVXSSRUW´ $ZDUGVWLPH 7UDG)HVW KDV EHHQ QRPLQDWHG

Martin and Irene Coughlan

IRUDQDZDUGIRUEHVWµ*DWKHULQJ )HVWLYDO¶ E\ WKH ,ULVK +RWHOV¶ )HGHUDWLRQ7KHUHZLOOEHDZDUGV LQVSRUWVDUWVDQGFXOWXUHIDPL O\IHVWLYDOVDQGLQQRYDWLRQHDFK ZLQQHUZLOOUHFHLYHDEXUVDU\RI ¼ &KDLU RI .LONHQQ\ 7RXULVP &ROLQ$KHUQ VDLG WKH\ ZHUH GH OLJKWHG WKDW 7KH ,ULVK +RWHOV¶ )HGHUDWLRQ ZDV UHFRJQLVLQJ WKH VXFFHVVRI*DWKHULQJHYHQWV 7KHUHZDVDQDZDUGODVWZHHN IRU 7UDGIHVW¶V (GHO )R[ DQG 1HLOO %\UQH 7KHLU DOEXP µ7KH 6XQQ\ %DQNV¶ ZRQ7UDGFRQQHFW 7UDGLWLRQDO $OEXP RI WKH <HDU $FFRUGLQJWR7UDGFRQQHFW LW ZDV UHOHDVHG HDUO\ LQ  $FFRPSDQLPHQW ZDV E\ &DRLPKLQÏ)HDUJKDLORQJXLWDU DQG5LFKLH/\RQVRQERGKUiQ (GHO )R[ 1HLOO %\UQH DQG &DRLPKtQ SHUIRUP KHUH RQ 0DUFK  SP &OHHUH¶V 7KHDWUH +DUU\ %UDGOH\ QRPLQDWHG ODVW ZHHN DV µ,ULVK 7UDGLWLRQDO 0XVLFLDQ RI WKH \HDU¶ 7* *UDGDP&HRLO±WKH2VFDUV RI7UDGLWLRQDO0XVLF ZLOOJLYH

)OXWH DQG 8LOHDQQ 3LSH PDVWHU FODVVHVIRU7UDG)HVW 2WKHU7UDGIHVWKLJKOLJKWV &KLOGUHQ¶V FUDIW ZRUNVKRS LQ VSLUHG E\ WKH ¿OP µ7KH 6HFUHW RI .HOOV¶ )XLQQHDPK D IW GLDPHWHU GUXP GHVLJQHG DQG EXLOW E\ DUWLVW %RXQFH +RS RQ WKH WK &HQWXU\ *ROGHQ *DOORSHU¶V &DURXVHO &DUWRRQ 6DORRQ $QLPDWLRQ ZRUNVKRS .LODVXSSRUWHGE\)ULDU\6WUHHW &UHZ )HVWLYDO 3DUDGH 3OD]D SP 0DUFK  5HQRZQHG ,ULVK WUDG PXVLF JURXSV   OLYH LQ FRQFHUW LQ WKH 6HW 7KHDWUH 3iGUDLJ 5\QQH 6\OYDLQ %DURX DQG 'yQDO /XQQ\ :RUNVKRSV LQWUDGPXVLFLQVWUXPHQWVVLQJ LQJDQGGDQFLQJ :KLOHPXFKRIWKHDFWLRQZLOO EH LQ .LONHQQ\ &DVWOH 3DUN RQ 6W 3DWULFN¶V 'D\ DQG PXVLF ZRUNVKRSV RQ 6DWXUGD\ DQG 6XQGD\ LQ .LONHQQ\ &DVWOH¶V 3DUDGH 7RZHU ORFDO YLQWQHUV KRVW D µ7UDG7UDLO¶ VKRZFDVLQJ WKHEHVWRIORFDOPXVLFDOWDOHQW 7LFNHWV5ROOHUFRDVWHU5HFRUGV 6W .LHUDQ 6WUHHW .LONHQQ\ 

Bríd and Fred Malzard, Stoneyford

Fiona Coughlan,Trish Duffe and Cathy Hogan

Pics: Martin Doheny


64 | MOTORS

KILKENNY REPORTER 26 2 2014


NEWS | 65

26 2 2014 KILKENNY REPORTER

Kids of courage are wide awake JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

:+(1 ,7 FRPHV WR IXQGUDLV LQJWKH\RXQJSHRSOHRI1RUWK .LONHQQ\DUHZLGHDZDNH 7KHUHLVQRZD\\RXZLOO¿QG WKHP VOHHSLQJ RQ WKH MRE ZKHQ WKHUH LV D JRRG FDXVH WR EH FKDPSLRQHG /DVW )ULGD\ FKLOGUHQ IURP WKH0LOO<RXWK3URMHFWDWWDFKHG WR WKH 0LOO )DPLO\ 5HVRXUFH &HQWUH LQ 8UOLQJIRUG VWD\HG DZDNH IRU  KRXUV WR UDLVH IXQGV IRU WKHLU DQQXDO $SULO WULS 7KH KRXU PDUDWKRQ 6WD\ $ZDNH ZLOO KHOS WR SD\ IRU D KROLGD\ EUHDN IRU WKH FKLOGUHQ DW &RXUWRZQ $GYHQWXUH DQG

/HLVXUH &HQWUH LQ :H[IRUG ZKHUH WKH ER\V DQG JLUOV ZLOO HQMR\ DFWLYLWLHV IURP ODVHU WDJ WR DUFKHU\ ZDOO FOLPELQJ WR VZLPPLQJ 7KH 6WD\ $ZDNH VWDUWHG DW SP RQ )ULGD\ DQG FRQWLQXHG XQWLOSPRQ6DWXUGD\7RNHHS WKHPVHOYHV RFFXSLHG WKH FKLO GUHQSOD\HGJDPHVDQGDOVRUH OD[HGE\ZDWFKLQJ'9'V *HQHURXVSHRSOH .LGVRIFRXUDJHZKRFRPSOHW HGWKHWHVWRIHQGXUDQFHDQGFRO OHFWHG VSRQVRUVKLS ZHUH $GDP :DOVK .\OH :HEVWHU 6KDQH /HDK\ 3DGUDLJ 2¶&RQQRU .DWLH0F/RXJKOLQ.DWLH5\DQ .HOO\DQQ 5\DQ +D\OH\ 0DKHU -HVVLH /HDK\ 6KDXQD ,YHUV /DXUD &OHHUH (ULFD .HDO\

.DVVLD%HOOH 0F1DPDUD7XOO\ $P\4XLQQDQG0HJDQ&OHHUH -XQLRU OHDGHUV ZKR KHOSHG ZHUH 6KDQQRQ 2¶&RQQRU .D\O\Q 6WDSOHWRQ DQG 'DQLHOOH 0DUWLQ 9ROXQWHHU OHDGHUV ZHUH 6XH &R[ 6KDQH %XUNH -RDQ ,YHUV 7KHUHVH 2¶&RQQRU 6KHOO\ 1HDU\DQG0DUJDUHW0F&DUWK\ 7KDQNVKDVJRQHWRWKHJHQHU RXV SHRSOH ZKR VXSSRUWHG WKH FKLOGUHQ ZLWK VSHFLDO DSSUH FLDWLRQ WR$WLOOD DQG VWDII IURP 7KH:LVKLQJ:HOOLQ8UOLQJIRUG ZKR GRQDWHG SL]]DV FKLSV DQG GLSV 7KHKRXUSURMHFWZDVYRWHG DQ RXWVWDQGLQJ VXFFHVV DV FKLO GUHQDQGDGXOWVKDGORWVRIIXQ DQGSOHQW\RIODXJKWHU

Gallant participants: Left back, Shane Leahy, Erica Kealy, Kyle Webster, Shauna Ivers, Atilla of the Wishing Well, Megan Cleere, Shannon Oâ&#x20AC;&#x2122;Connor, Kellyann Ryan, Katie Ryan. Front, Laura Cleere, Adam Walsh, Katie McLoughlin, Jessie Leahy, Padraig Oâ&#x20AC;&#x2122;Connor, Kassia-Belle McNamara-Tully, Hayley Maher, Amy Quinn


66 | MOTORS

KILKENNY REPORTER 26 2 2014


MOTORS | 67

26 2 2014 KILKENNY REPORTER

2014 2014 2014 2014 2014 2014 2014 2014 2014 2013 2013 2013 2012 2012 2011 2011 2011 2010 2010 2010 2010 2010 2009 2008 2008 2008 2007 2007 2007 2006 2006 2006 2006 2005 2005 2004 2004 2004 2004 2003 2003 2003 2003 2002 2002

Seat Seat Seat Seat Seat Seat Seat Seat Seat Seat Seat Seat Seat Seat Seat Seat Ford Hyundai Vw Seat Vw Seat Seat Seat Seat Toyota Opel Seat Seat Vw Mini Seat Seat Seat Renault Vw Renault Opel Peugeot Toyota Vw Hyundai Renault Peugeot Seat

Alhambra Altea XL Leon Leon Toledo Toledo Ibiza Ibiza Mii Toledo Ibiza ST Ibiza Ibiza SE Ibiza SE Exeo SE Ibiza ST Fiesta IX35 Passat Leon Polo Diesel Cordoba (choice) Ibiza Cordoba Diesel (choice) Cordoba Yaris Zafira 7 Seater Cordoba Diesel Cordoba Polo One ‘7’ Model Cordoba Diesel Toledo Ibiza Megane Golf Scenic Vectra 206 Landcruiser COMMERCIAL 4X4 Passat Santa Fe COMMERCIAL 4X4 Megane Diesel 106 Leon

2.0 Tdi 1.6 Tdi 1.6 1.2 Tsi 1.6 Tdi 1.2 Tsi 1.2 1.2 1.0 Lt 1.6 Tdi 1.2 Tdi 1.2 Tdi 1.2 Tdi 1.2 2.0 Tdi 1.2 Tdi 1.25 1.7 1.6 Tdi 1.9 Tdi 1.6 Tdi 1.2 1.2 1.4 Tdi 1.2 1.0 Lt 1.9 1.4 Tdi 1.4 1.4 Tdi 1.6 1.4 Tdi 1.9 Tdi 1.2 1.4 1.4 1.4 2.0 Lt 1.1 3.0 D4D 1.9 Tdi 2.0 Crdi 1.5 Dci 1.1 1.4

Diesel Diesel Diesel Petrol Diesel Petrol Diesel Petrol Petrol Diesel Diesel Diesel Diesel Petrol Diesel Diesel Petrol Diesel Diesel Diesel Diesel Petrol Petrol Diesel Petrol Petrol Diesel Diesel Petrol Diesel Petrol Diesel Diesel Petrol Petrol Petrol Petrol Diesel Petrol Diesel Diesel Diesel Diesel Petrol Petrol

€39,500 €23,065 €21,805 €19,785 €20,150 €17,860 €17,725 €14,135 €10,595 €17,500 €14,950 €14,950 €12,950 €11,950 €14,950 €11,500 €10,750 €16,950 €15,500 POA €10,950 €7,950 POA €8,500 POA €7,500 €7,950 €6,950 €5,950 €6,950 €5,950 €5,950 €5,250 POA €3,250 POA €2,950 €2,950 POA €7,500 €4,250 €3,950 €2,950 POA €2,300

€6,583 €3,844 €3,634 €3,297 €3,358 €2,976 €2,954 €2,365 €1,766 €2,917 €2,492 €2,492 €2,158 €1,992 €2,492 €1,917 €1,791 €2,825 €2,583

€135 €79 €74 €67 €68 €61 €60 €48 €35 €62 €53 €53 €46 €42 €53 €42 €43 €67 €61

€1,825 €1,325

€49 €35

€1,416

€47

€1,250 €1,325 €1,158 €992

€37 €49 €43 €37


68 | NEWS

KILKENNY REPORTER 26 2 2014

In Castlecomer with Chubby Brennan

Blast from the past...

Reconstructing the Old Rectory, owned by the Church of Ireland were Joe McNulty RIP, Mick Sherwood RIP, Eamon Fitzgerald, Mal Tynan Snr and Jnr and the late Willie Coogan, former owner of The Avalon Inn. The rectory is now home to Joe and Julie Coogan

Panto DVD is great value at â&#x201A;Ź10 THE DVD of Deenside Players pantomime â&#x20AC;&#x2DC;Show White and the Seven Dwarfsâ&#x20AC;&#x2122; is now on sale at Maherâ&#x20AC;&#x2122;s Shop, Kilkenny Street. It is great value at â&#x201A;Ź10.

Lottos Golf â&#x201A;Ź8,400; GAA â&#x201A;Ź2,600,

Historic day On the Feast of Our Lady the

ďŹ nal repayment on the parish loan for church renovations was paid. A sum of â&#x201A;Ź16,442.77 was paid and the loan is now cleared. Thanks went to all who showed great commitment to the project which started in February 2004.

Eucharistic Ministers Additional people are need

for this ministry in the parish. Further details from co-ordinator Mrs Margaret Rothwell, Firoda 4441412.

Carers needed Home Instead Senior Care is the largest non medical homecare provided in Ireland. Compassionate, dependable

caregivers are urgently required to visit seniors in their own homes, providing professional care and enhancing lives. The following areas need to be covered: Castlecomer and Ballyragget. Further information from Lorraine at 0567800508 or lorraine.kelly@ hisc.ie

Cheltenham The local GAA clubâ&#x20AC;&#x2122;s main development fundraiser has been launched. The Fantasy Cheltenham competition is now up and running and Erinâ&#x20AC;&#x2122;s Own club officials are appealing to all members, parents and their families to get behind it.

The website www.fantasycheltenham.ie is  updated  and contains the 2014 brochure. Get in contact with all clubs where possible to get on board in this club fundraiser; email; fantasycheltenham.ie phone 087-2299555; website www. fantasycheltenham.ie.

$QHOHPHQWRIKDSSLQHVVÂą5HYLHZRI)LQGLQJ<RXU(OHPHQWE\.HQ5RELQVRQ

By Edel Rooney 7+( (OHPHQW Âą +RZ )LQGLQJ <RXU 3DVVLRQ &KDQJHV (YHU\WKLQJ EHFDPH DQ LQWHU QDWLRQDO EHVW VHOOHU IRU .HQ 5RELQVRQ LQ  $ OHDGLQJ YRLFH LQ WKH DUHD RI GHYHORS LQJ FUHDWLYLW\ LQ HGXFDWLRQ 5RELQVRQÂśVLVDERRNDERXWWDO HQW LQVSLUDWLRQ DQG JHWWLQJ WKH PRVWIURPRXUVHOYHV 7KH ÂľHOHPHQWÂś KH LGHQWLÂżHV LV

WKHSRLQWZKHUHDSHUVRQÂśVQDWX UDO WDOHQW PHHWV WKHLU SHUVRQDO SDVVLRQ D SRLQW DW ZKLFK JUHDW SRWHQWLDO LV XQORFNHG DQG JUHDW HQHUJ\LVJHQHUDWHGDQGWKHIRU PXOD IRU KDSSLQHVV FOLFNV LQWR SODFH ,Q WKH ERRN 5RELQVRQ LQ WHUYLHZV JUHDW DFKLHYHUV VXFK DV 3DXO 0F&DUWQH\ 0HJ 5\DQ 0DWW *URHQLQJ 5LFKDUG )H\QPDQ DQG RWKHUV H[SORULQJ KRZ WKHVH SHRSOH IRXQG WKHLU HOHPHQWV DQG LGHQWLI\LQJ WKH FRQGLWLRQV ZH PXVW FUHDWH WR ÂżQGRXUV 6WDQGRXWJLIW ,Q PDQ\ ZD\V WKH ERRN ZDV DOVRDSDHDQWRWHDFKLQJDQGWR WKH JUHDW WHDFKHUV ZKR FUHDWH

DQ HQYLURQPHQW IRU DFKLHYH PHQW E\ DOORZLQJ VWXGHQWV WR QDWXUDOO\ GLVFRYHU WKHLU SDV VLRQV Âą DV ZHOO DV VWUHVVLQJ WKH QHHGWREXLOGHGXFDWLRQV\VWHPV DURXQG WKHVH WHDFKHUV DQG WKHLU RZQJLIWV ,IWKHUHZDVVRPHFULWLFLVPRI WKHERRNLWZDVWKHODFNRISUDF WLFDO VROXWLRQV IRU SHRSOH ODFN LQJDQREYLRXVVWDQGRXWJLIW )LQGLQJ<RXU(OHPHQWÂą+RZ 7R 'LVFRYHU <RXU 7DOHQWV DQG 3DVVLRQV DQG 7UDQVIRUP <RXU /LIH DWWHPSWV WR H[SDQG RQ WKH RULJLQDO ERRN WR VWHS WKH UHDGHU WKURXJK WKH WDOHQW LGHQ WLÂżFDWLRQSURFHVVYLDDVHULHVRI WRROVH[HUFLVHVWHFKQLTXHVDQG UHVRXUFHV

$ZNZDUGTXHVWLRQV ,WDVNVWKHDZNZDUGTXHVWLRQV ZKDWLI,DPMXVWQRJRRGDWWKH WKLQJ,ORYHZKDWLI,FDQQHYHU PDNH D OLYLQJ IURP WKH WKLQJ , ORYHZKDWLI,ÂżQGP\WDOHQWEXW MXVWGRQÂśWHQMR\LW" )RUSDUHQWVDQGWHDFKHUVWKHUH LVDIXUWKHUJXLGHRQLGHQWLI\LQJ FKLOGUHQÂśV WDOHQWV DQG KHOSLQJ WKHPÂżQGWKHDFWLYLWLHVWKH\ZLOO ORYHGRLQJ 5RELQVRQ ZULWHV LQ DQ HDV\ JRLQJ KXPRURXV VW\OH Âą GUDZ LQJ RQ SOHQW\ RI LQVSLUDWLRQDO TXRWHV DQG DQHFGRWHV $V ZLWK DOOERRNVLQWKHVHOIKHOSJHQUH VRPH UHDGHUV ZLOO JHW PRUH IURP LW WKDQ RWKHUV VLQFH DOO D ERRN OLNH WKLV FDQ GR LV SUR

YLGH D IUDPHZRUN WR KHOS WKH UHDGHU H[SORUH WKHPVHOYHV $V IUDPHZRUNV JR WKLV LVQRWDEDGVWDUWLQJSRLQW :LOO \RX EH LQ \RXU HOH PHQW DIWHU UHDGLQJ LW" <RXÂśOO KDYH WR ÂżQG WKDW RXWIRU\RXUVHOI )RU PRUH ERRN UHYLHZV DQG WR NHHS XSWRGDWH ZLWK WKH ODWHVW OLWHUDU\ QHZVEHFRPHDPHPEHU RIWKH%RUG*iLV(QHUJ\ RQOLQH ERRN FOXE ERU GJDLVHQHUJ\ERRNFOXELH ZKHUH \RXÂśOO ÂżQG JUHDW UHFRPPHQGDWLRQV IRU KRXUV RI HQWHUWDLQPHQW LQDJRRGERRN


NEWS | 69

26 2 2014 KILKENNY REPORTER

Fia Devoy with Bella the Little Owl

Naimh Ready with Lola the Barn Owl

Jack Lynch with the American Kestrel

Let us preyâ&#x20AC;¦ JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

7+(<$5( EHDXWLIXO WKH\ DUH VHOIVXI¿FLHQWDQGWKH\DUHORYHG E\ DXGLHQFHV \RXQJ DQG \RXQJ DWKHDUW %DUQ 2ZOV .HVWUHOV +DZNV DUH )DOFRQV DOO ELUGV RI SUH\ KXQWIRUWKHLURZQGLQQHUV7KH\ DUHDOOPHDWHDWHUVXQOLNHPRVW RWKHU ELUGV ZKR OLNH WR GLQH RQ FURSVDQGVHHGV 7KH\KDYHGLIIHUHQWIRRGSUHI HUHQFHV 6RPH OLNH PLFH DQG UDWV2WKHUVJRIRUFURZVPDJ SLHVDQGSLJHRQV$QGWKHUHDUH WKRVHZKROLNHUDEELWIRUOXQFK 7KH ELUGV DUH LQKDELWDQWV RI &DVWOH)DOFRQU\IRXQGHGE\OR

FDO IULHQGV 0DUWLQ 'RKHQ\ DQG 0DUN +D\HV 6RPH ZHUH KDQG UHDUHG$OO DUH SUHWW\ VDIH ZLWK SHRSOH DQG OLNH KXPDQ FRP SDQ\ ,Q WXUQ VFKRRO FKLOGUHQ LQ SDUWLFXODU DQG PDQ\ DGXOWV DUH IDVFLQDWHG E\ WKH FRORXUIXO KXQWHUV $FROOHFWLRQRIELUGVRISUH\ ZDVRQVKRZDW1HZSDUN+RWHO .LONHQQ\RQ6XQGD\ 0RELOH)DOFRQU\ 7KHELUGVDWWUDFWHGDJRRGDX GLHQFHRIORFDOVDQGYLVLWRUVDQG ¿WWHGLQZHOOZLWKWKHKRWHO¶VH[ FHOOHQWPHQDJHULHRIHPXVSLJ OHWVDQGJRDWV 7KH RZQHUV GHVFULEH WKHLU ELUG FROOHFWLRQ DV D 0RELOH )DOFRQU\ 7KH ELUGV DUH UHJX

Triona Lynch with Ben the Harris Hawk

ODUV DW 1HZSDUN +RWHO DQG WKH\ DUH DOVR EURXJKW WR ORFDO VFKRROV ZKHUH FKLOGUHQ ORYH WR YLHZWKHPDQGOHDUQDERXWWKHLU KDELWV 7KHUHLVDOZD\VDELJGHPDQG IRUWKHELUGVKRZDQG0DUNDQG 0DUWLQ DUH SURXG WR VKRZ RII WKHLU IHDWKHUHG IULHQGV ZKLFK DUHXVXDOO\DVNHGEDFNDVHFRQG WKLUGDQGHYHQPRUHWLPHV ³<RXQJ SHRSOH LQ SDUWLFXODU ORYH WR EH SKRWRJUDSKHG ZLWK WKH ELUGV´ 0DUWLQ 'RKHQ\ WROG 7KH5HSRUWHU³:HHQMR\VKRZ LQJ WKHP RII SDUWLFXODUO\ ZKHQ ZHJHWKDSS\DQGVDWLV¿HGDXGL HQFHVDQGWKDWLVSUDFWLFDOO\HY HU\WLPHZHEULQJWKHELUGVWRD KRWHORUVFKRRO´

Castle Falconryâ&#x20AC;&#x2122;s Mark Hayes and Martin Doheny

Conor Groarke with Wizo the Gyr/Saker Falcon


Fashion

Sales Advisor :HKDYHDYDFDQF\IRUD

6DOHV$GYLVRU 3DUW7LPH

7KHVXFFHVVIXOFDQGLGDWHZLOOKDYHDQLQWHUHVW LQIDVKLRQDQGVWURQJFXVWRPHUVHUYLFHVNLOOV 3UHYLRXVVDOHVH[SHULHQFHLVDQDGYDQWDJH :HRIIHUDIULHQGO\ZRUNLQJHQYLURQPHQW ZLWKIOH[LEOHKRXUVLIUHTXLUHG ,QWHUHVWHGDSSOLFDQWVSOHDVHDSSO\LQZULWLQJWR 7KH6WRUH0DQDJHU:+*RRG/WG  +LJK6WUHHW.LONHQQ\ RU (PDLO\RXUDSSOLFDWLRQWRLQIR#JRRGVLH RU 'URSLQDQGDVNWRVSHDNWRWKH0DQDJHU DW5HFHSWLRQRQWKHQG)ORRU


SPORT/NEWS | 71

26 2 2014 KILKENNY REPORTER

Home draw boosts cup dream for fighting Freshford Town SOCCER with

JIMMY RHATIGAN JRHATIGAN@GMAIL.COM

/22.,1*IRUZDUGUDWKHUWKDQ EDFN LV FHUWDLQO\ PRUH H[FLW LQJWRGD\DV.LONHQQ\SUHSDUHV WRWDNHRQZKDWLVSUREDEO\WKH VWURQJHVW OHDJXH LQ WKH FRXQWU\ DQG D SURXG SDULVK FOXE JHWV UHDG\ IRU ZKDW ZLOO EH WKH ELJ JHVW GD\ LQ WKH KLVWRU\ RI WKH FOXE <HV WKHUH ZHUH VRPH H[FLW LQJJDPHVDWWKHZHHNHQGZLWK

WKH PRVW QRWDEOH UHVXOWV EH LQJ 3UHPLHU 'LYLVLRQ ZLQV IRU )UHHERRWHUV DQG 7KRPDVWRZQ 8QLWHG %XW WKH FRPLQJ ¿[WXUHV DUH FHUWDLQO\WKHPRVWPRXWKZDWHU LQJIRUVRPHWLPH 7KHUHVKRXOGEHJRRGLQWHUHVW LQWKHYLVLWRIWKH$WKOHWLF8QLRQ /HDJXH WR 'HUGLPXV RQ WKLV 6XQGD\ SP ZKHQ PDQDJHU 2OOLH :DOVK¶V .LONHQQ\ DQG 'LVWULFW /HDJXH WHDP LPSURY LQJ DOO WKH WLPH ZLOO ¿QG RXW KRZIDUWKH\KDYHSURJUHVVHG %XWWKHJDPHWKDWVKRXOGUHDOO\ FDSWXUHWKHLPDJLQDWLRQLVDSRV VLEOHPLG0DUFK/HLQVWHU-XQLRU &XS KRPH ¿[WXUH IRU -DPHV

)DUUHOO¶V 'LYLVLRQ  )UHVKIRUG 7RZQZKRKDYHKDGVRPHPDU YHOORXVZLQVWKLVVHDVRQ 7KH1RUWK.LONHQQ\FOXEZLOO EDUULQJ WRWDO FROODSVH VKRUWO\ FOLQFK WKH 'LYLVLRQ  /HDJXH DQGSURPRWLRQWR'LYLVLRQ $ORWRIUHVSHFW 7KDW ZLOO EH JRRG UHDVRQ WR FHOHEUDWH EXW WKH FOXE¶V PRVW PHPRUDEOH JDPHV WR GDWH KDYH EHHQ LQ WKH )$, -XQLRU &XS ZKHUH WKH\ HYHQWXDOO\ IHOO WR KROGHUV6KHULII<& 7KDW ZDV WKH GD\ D GUHDP GLHGEXWLQGHIHDWWKH7RZQKDG ZRQ PDQ\ IULHQGV DQG HDUQHG DORWRIUHVSHFWIRUWKHLUVRFFHU FOXE

$QRWKHU GUHDP SHUKDSV D PRUH UHDOLVWLF RQH LV VWLOO YHU\ PXFK DOLYH DQG FRXOG WDNH DQ RWKHUVWHSWRZDUGVSRVVLEOHSUR YLQFLDO JORU\ ZKHQ )UHVKIRUG WDNH RQ WKH ZLQQHUV RI *OHEH 1RUWK DQG 3RVWDO 8QLWHG LQ WKH TXDUWHU¿QDO RI WKH /HLQVWHU -XQLRU&XS 7KHELJSOXVLVWKDW)UHVKIRUG DUHDWKRPHWRWKHZLQQHUVLQD PDWFK WKDW FRXOG FDWDSXOW WKHP WR WKH VHPL¿QDOV RI WKH FXS D PHUHNLFNRIDEDOODZD\IURPD FRYHWHGSODFHLQWKH¿QDO 1RGDWHKDV\HWEHHQ¿QDOLVHG IRU WKH TXDUWHU¿QDO DOWKRXJK WKH SRVVLELOLW\ LV WKDW LW ZLOO EH LQWKHPLGGOHRI0DUFKDV*OHEH

DQG 3RVWDO DUH GRZQ WR SOD\ WKHLUODVWJDPHRQ0DUFK WKH¿UVW6XQGD\LQ/HQW $KXJHJDPH ³$KRPHJDPHLVDKXJHSOXV IRU XV´ -DPHV )DUUHOO WROG 7KH 5HSRUWHU³,WZLOOJLYHXVDJRRG FKDQFH , GRQ¶W NQRZ DQ\WKLQJ DERXW *OHEH RU 3RVWDO DW WKLV MXQFWXUH EXW , ZLOO HYHQWXDOO\ NQRZ TXLWH D ORW DV , LQWHQG WR JR WR WKH JDPH ZKLFK ZLOO VHH RQH RI WKHP KLULQJ FRDFKHV WR )UHVKIRUG´ $W WKH ZHHNHQG JRDOV E\ 'DPLHQ5DJJHWW$DURQ0ROOR\ 'HVVLH +D\HV DQG *HU +D\HV KHOSHG )UHHERRWHUV µ$¶ WR D  ZLQ RYHU VWUXJJOLQJ )RUW

5DQJHUV DQG VWUHQJWKHQHG WKHLU FKDQFHV RI ZLQQLQJ WKH 6W &DQLFH¶V &UHGLW 8QLRQ 3UHPLHU /HDJXH $OVRWKHUHZLWKDELJVKRXWDUH 7KRPDVWRZQ 8QLWHG ZKR KDG DQH[FHOOHQWDZD\ZLQRYHU (YHUJUHHQµ%¶ ,Q WKH 6KLHOG 1HZSDUN KDG D FRQYLQFLQJ  KRPH ZLQ RYHU WKH /LRQV RI 'XUURZ WKH JRDOV FRPLQJIURP7RQ\'HODQH\   6WHSKHQ 'DZVRQ DQG 0LFKDHO &RPHUIRUG ,Q 'LYLVLRQ  LW ZDV EXVLQHVV DV XVXDO IRU )UHVKIRUG DV WKH\ EHDWD\RXQJ(YHUJUHHQµ&¶ ZLWK JRDOV E\ 0LFKDHO )DUUHOO DQG3KLOLS5XVVHOOZKRKLWWZR

Youths, junior, schoolboys and women’s fixtures 6DWXUGD\0DUFK <RXWKV'LYLVLRQ SP

%ULGJH8QLWHGY&ORYHU 8QLWHG2UPRQGHYLOODY (YHUJUHHQµ$¶ 'LYLVLRQ SP

)RUW5DQJHUVY1HZSDUN 8QLWHG7KRPDVWRZQY'HHQ &HOWLF 6XQGD\0DUFK 'LYLVLRQ DP

&ORYHUµ$¶Y'HHQ&HOWLFµ$¶ )UHHERRWHUVµ%¶Y1HZSDUNµ%¶ 7XOODURDQY6WRQH\IRUG8QLWHG 6RXWKHQG8QLWHGY6SD8QLWHG (DPRQQ0DKHU&RDFK+LUH

'LYLVLRQ 6W$QQH¶VY%ULGJH8QLWHG µ%¶DP)UHVKIRUG7RZQY %URRNYLOOHSP 'XLVNH*ODVV'LYLVLRQ DPXQOHVVVWDWHG

(DVW(QGµ%¶Y&DVWOHZDUUHQ %URRNYLOOHµ%¶Y/LRQV 1HZSDUNµ&¶Y7KRPDVWRZQ µ&¶SP )$,2VFDU7UD\QRU7URSK\ .LONHQQ\/HDJXHY$WKOHWLF 8QLRQ/HDJXH'XEOLQ 'HUGLPXVSP /DGLHV'LYLVLRQ 1HZSDUNY3DXOVWRZQDP

%DOODFROODY&ORYHU8QLWHG SP :RPHQ¶V6KLHOG )UHVKIRUG7RZQY/LRQV DP(DVW(QGY7XOODURDQ SP

Schoolboys’ )ULGD\)HEUXDU\ 8%DUQDYLOOH3ULQW )UHHERRWHUVµ%¶Y(YHUJUHHQ 7RZQSP 6DWXUGD\0DUFK 8%DUQDYLOOH3ULQW SP XQOHVVVWDWHG

)UHHERRWHUVµ$¶Y(YHUJUHHQ

8QLWHG7KRPDVWRZQ 8QLWHGY)UHHERRWHUVµ&¶ %ULGJH%OXHVY%ULGJH<HOORZV DP&ORYHUµ$¶Y'HHQ&HOWLF 5HGVSPS&ORYHUµ%¶Y'HHQ &HOWLF%ODFNV6WRQH\IRUG Y3DXOVWRZQQRRQ (YHUJUHHQ&LW\Y)RUW5DQJHUV +LJKYLHZ$WKOHWLFY(YHUJUHHQ $WKOHWLF 8*ODQELD'LYLVLRQ 7KRPDVWRZQY)RUW 5DQJHUVSP(YHUJUHHQµ$¶Y (DVW(QG 'LYLVLRQ XQOHVVVWDWHG

1HZSDUNY+LJKYLHZ $WKOHWLF3DXOVWRZQY )UHHERRWHUVµ%¶(YHUJUHHQ &LW\Y/LRQV 8µ%ULGJH3DUWV'LYLVLRQ XQOHVVVWDWHG

7KRPDVWRZQY)RUW5DQJHUV DP'HHQ&HOWLFY(YHUJUHHQ µ$¶)UHHERRWHUVµ$¶Y 6RXWKHQGSP/LRQVY(DVW (QG 'LYLVLRQ +LJKYLHZ$WKOHWLFY 3DXOVWRZQSP%URRNYLOOH Y&DOODQ)UHHERRWHUVµ%¶

Kilkenny CBS Lottery

Weekend soccer results 3UHPLHU'LYLVLRQ )UHHERRWHUVµ$¶)RUW 5DQJHUV(YHUJUHHQµ&¶ 7KRPDVWRZQµ$¶ 'LYLVLRQ 6WRQH\IRUG8QLWHG )UHHERRWHUVµ%¶&DOODQ 8QLWHG6RXWKHQG8QLWHG 'LYLVLRQ (YHUJUHHQµ&¶)UHVKIRUG 7RZQ%ULGJH8QLWHGµ%¶ 7KRPDVWRZQµ%¶

1XPEHUV ¼0DL*URJDQ 7UR\VZRRG¼-RVLH 7UD\QRUFR%LQJR ¼'HEELH1XJHQW &XIIHVJUDQJH(PLO\&R\QH FR%LQJR(OHDQRU&DQWZHOO FR%LQJRSURPRWHUV¶SUL]H 0DUN0DKRQ\&%63ULPDU\ 1H[WGUDZ)HEUXDU\ MDFNSRW¼

'LYLVLRQ 7KRPDVWRZQµ&¶(DVW(QG µ%¶&DVWOHZDUUHQ1HZSDUN µ&¶6W-RKQ¶V%DOODFROOD 3DW0DKHU6KLHOG 1HZSDUN/LRQV <RXWKV'LYLVLRQ &ORYHU2UPRQGHYLOOD 5LFR¶VRI*RZUDQ:RPHQ¶V 'LYLVLRQ (DVWHQG%ULGJH8QLWHG

CBS night out

Callan on the run &$//$18QLWHGVRFFHU FOXEKROGDUXQDQGZDONRQ (DVWHU6XQGD\$SULOLQ DLGRIWKHLUVFKRROER\VDQG JLUOVVHFWLRQ 7KHHYHQWZKLFKVWDUWVDW

SPZLOOKDYHFKLSWLPLQJ (QWU\IHHLV¼WKHUHZLOOEH FDWHJRU\SUL]HVDQGWKHUDFH ZDONZLOOEHIXOO\PDUVKDOOHG )RULQIRUPDWLRQJRWRKWWS FDOODQXQLWHGPRRQIUXLWFRP

Y%ULGJH8QLWHGSP &ORYHUY(YHUJUHHQµ%¶DP 87&7\UHV'LYLVLRQ DPXQOHVVVWDWHG

6SDY'HHQ&HOWLF (YHUJUHHQµ$¶Y(YHUJUHHQµ%¶ )UHHERRWHUVµ$¶ 3DXOVWRZQ2UPRQGHYLOOD Y/LRQV+LJKYLHZ$WKOHWLFY &ORYHU 8.'/0DFURQ*LUOV¶ /HDJXH XQOHVVVWDWHG

1HZSDUNY/LRQVQRRQ (YHUJUHHQY)UHHERRWHUV 7KRPDVWRZQY(DVW(QG

Brian Lynch with Rico at a birds of prey exhibition in Newpark Hotel

Peter and his daughter Molly Lynch with Bella the Little Barn Owl

7+(&%66HFRQGDU\6FKRRO 3DUHQWV¶&RXQFLOSUHVHQW &HyO&DLQWDJXV&UDLFLQ7KH 3HPEURNH+RWHORQ)ULGD\ )HEUXDU\SP$OOSUR FHHGVJRWRWKH&%6=DPELD ,PPHUVLRQSURMHFW 7KHHYHQWZLOOIHDWXUHWKH &%6&KRLUMD]]EDQGDQGORFDO PXVLFLDQV7LFNHWV¼IURP RU DWWKHGRRU


72 | NEWS

KILKENNY REPORTER 26 2 2014

Good health with The Reporter

Your choice: Manly or strong or maybe graceful and elegant? By Trish Hayden 63(1' $ IHZ PLQXWHV LQ WKH J\P DQG \RX¶OO EH VXUH WR VHH RQH RI WKRVH KRW J\P JX\V GRLQJ SOHQW\ RI VTXDWV EXW VKRXOG WKH\ EH GRLQJ SOLHV LQVWHDG  %RWK DUH H[FHOOHQW DQG UHJX ODUO\ DSSHDU RQ OLVWV OLNH µ7RS 7HQ7LSV IRU D7LJKW7XVK¶  RU µ'R  <RX :DQW /RQJ /HDQ /HJV"¶ DV LI \RX GLGQ¶W EXW ZKDWLVWKHGLIIHUHQFHDQGLVRQH EHWWHUWKDQWKHRWKHU"  7HFKQLFDOO\ D VTXDW LV ZKHUH WKH XSSHU ERG\ LV DW WKH VDPH DQJOH DV WKH VKLQV ZKHQ VTXDWWLQJIHHWKLSGLVWDQFHDSDUW ZKLOHNHHSLQJDQDWXUDOFXUYHLQ \RXU VSLQH QHLWKHU H[FHVVLYHO\ FXUYLQJQRUÀDWWHQLQJWKHORZHU EDFN 7KH VTXDW FDQ EH DV GHHS DV

SUHIHUUHGXQWLOWKLJKVDUHSDUDO OHOZLWKWKHÀRRUDOWKRXJKGHHS VTXDWV DUH FRQWURYHUVLDO LQ WKH J\P ZRUOG 3DUWLFXODU DWWHQWLRQ VKRXOG EH SDLG WR NHHSLQJ WKH NQHHLQOLQHZLWKWKHVHFRQGWRH 7KDWPD\VHHPDELWH[DFWEXW HQVXUHVRSWLPDOWUDFNLQJIRUWKH NQHHV %XFNOHFDQFDXVHLQMXU\  7R SHUIRUP D SOLp \RX FDQ VWDQG ZLWK \RXU OHJV VKRXOGHU ZLGWK DSDUW LQ WKLV LQVWDQFH 7XUQ \RXU KLSV RXW URWDWLQJ IURP WKH KLSV WR RSHQ WKH IHHW RXWWRWKHVLGH 7LJKWHQ \RXU DEGRPLQDOV WR NHHS \RXU WRUVR XSULJKW DV \RX EHQG\RXUNQHHV /RZHU \RXU WRUVR GLUHFW O\ GRZQ DQG PDNLQJ VXUH DJDLQ WKDW WKH NQHHV VWD\ LQ OLQH ZLWK WKH WRHV  .QHHV WKDW

Plie releve

EXFNOH LQ FDQ FDXVH LQMXU\ RYHU WLPH VR \RX VKRXOG FUHDWHDQDUURZHUDQJOHZLWKWKH IHHW %RWK H[HUFLVHV FRQWULEXWH WR RYHUDOO WRQLQJ DQG VWUHQJWKHQ LQJRIWKHORZHUERG\DQGZRUN WKH JOXWH UHJLRQ WXVK LI \RX OLNH  KLSV WKLJKV KDPVWULQJV DQGFDOYHV 3OLHV ZLOO DOVR WRQH WKH LQQHU WKLJKV DQG OHDG WR LQ FUHDVHG KLS ÀH[LELOLW\ :H XVH ERWK H[HUFLVHV LQ 7RWDO %DUUH FODVVHV RIWHQ FRPLQJ XS RQ WKH WRHV FDOOHG UHOHYH LQ WKH SOLp WR ZRUN WKH OHJV IXUWKHU HQJDJH WKH FDOYHV DQG VWUHQJWKHQ WKH DQNOHV DQG IHHW DQGLPSURYHEDODQFH7KHSOLp DOVR UHTXLUHV VWURQJ WXPP\ HQJDJHPHQW WR NHHS WKH WRUVR XSULJKW

$VOLJKWHGJH 7KH SOLp KDV D VOLJKW HGJH RQ WKHVTXDWEXWLILW¶VVRJRRGIRU \RX ZK\ KDVQ¶W LW FDXJKW RQ LQWKHJ\P7KHUHLVRQHRWKHU FUXFLDO GLIIHUHQFH«RQH ORRNV PDQO\DQGVWURQJDQGWKHRWKHU JUDFHIXO DQG HOHJDQW DQG PRVW PHQ JR IRU WKH IRUPHU  %RWK DUH D FRUH HOHPHQW RI WKH7RWDO %DUUHFODVV 5HPHPEHU WKDW SOLHV DQG VTXDWV ZRUN GLIIHUHQW PXVFOHV LQ\RXUOHJVVR\RXZLOOEHQH¿W IURP GRLQJ ERWK LQ WKH VDPH ZRUNRXWZRUNLQJPRUHPXVFOH JURXSVRQ\RXUOHJV $ PDMRU EHQH¿W IURP DOO WKLV HIIRUW LV EXLOGLQJ PXVFOH DQG PXVFOH PDVV EXUQV IDW HYHQ ZKHQ\RX¶UHQRWZRUNLQJRXW  7ULVK +D\GHQ <RJD7R*R ZLOO VWDUWLQJ QHZ FRXUVHV LQ 7RWDO%DUUHLQ7KH:DWHUVKHG /\UDWK (VWDWH +RWHO &DVWOHFRPHUDQG&DOODQLQWKH FRPLQJZHHNV 1HZ <RJD WHUP DOVR VWDUWLQJ LQ WKHVH YHQXHV  )RU GHWDLOV RIFODVVHVSKRQH FKHFN RXW P\ DGYHUWLVHPHQW LQ WKLV SDSHU RU )DFHERRN <RJD7R*RZLWK7ULVK+D\GHQ

Have you depression or are you simply depressed?

By Angela Morrissey 3(23/( VRPHWLPHV VD\ WKH\ KDYH GHSUHVVLRQ DQG ZH EH JLQ WR SRQGHU ZKDW KDV JRQH ZURQJLQWKHLUOLYHVWRFDXVHWKLV FRQGLWLRQ ,WLVQDWXUDODVZHJRWKURXJK OLIH WR IHHO RYHUZKHOPHG E\ JULHIRUE\VWUHVVIXOHYHQWVEXW ZHQHHGWRJHWEDFNRQRXUIHHW DJDLQ 5HVHDUFKKDVVKRZQWKDWHYHQ

DIWHU VXIIHULQJ D VHULRXV SK\VL FDO GLVDELOLW\ LW LV SRVVLEOH IRU SHRSOH WR UHJDLQ WKHLU IRUPHU OHYHORIKDSSLQHVVDOEHLWGRLQJ GLIIHUHQWWKLQJV ,QVWHDG RI FRPLQJ WR WHUPV ZLWK ZKDWHYHU GLI¿FXOW\ ZH DUHIDFHGZLWKZHFDQÀRXQGHU DURXQGKHOSOHVV\VWXFNLQDGH SUHVVLRQ WKDW VHHPV WR KDYH D PLQGRILWVRZQ 'HSUHVVLRQ LV D VWURQJ HPR WLRQDQGFDQHYHQWXDOO\RZQXV DQG GLVDEOH RXU DELOLW\ WR VRUW RXUVHOYHVRXWLQWKHORQJWHUP $GHSUHVVHGSHUVRQPD\WKLQN LQ D EODFN DQG ZKLWH IDVKLRQ +HVKHLVOLNHO\WRWKLQNµVRDQG VRGLGQRWVPLOHRUVD\KHOORWR PHKHGRHVQ¶WOLNHPHDQ\PRUH RU , PXVW KDYH LQVXOWHG KLP ZKHQ,VDZKLPODVW¶LQVWHDGRI

WKLQNLQJ µSHUKDSV KH GLGQ¶W VHH PH¶ $JUHDWPDQ\SHRSOHJHWRYHU WKH VWLFN\ SDWFKHV RI IHHOLQJV RI QHJDWLYLW\ DQG GHSUHVVLRQ WKHPVHOYHVDQGJHWRQZLWKWKHLU OLYHV ZKHQ WKH SDLQ RI WKH ORVV VXEVLGHV 6HHNKHOS ,I VXFK D VLWXDWLRQ GRHV QRW UHFWLI\LWVHOIZLWKLQDFRXSOHRI PRQWKV RU VR LW LV LPSRUWDQW WR VHHNSURIHVVLRQDOKHOS 7KHRSSRUWXQLW\WRGLVFXVVLQD FRQ¿GHQWLDOVHWWLQJZKDWLVWURX EOLQJ \RX ZLWK DQ HPSKDWHWLF XQGHUVWDQGLQJ SHUVRQ ZKR FDQ SURYLGH \RX ZLWK WKH WRROV IRU KHDOWK\ FKDQJH LV DQ LPPHGL DWH DGYDQWDJH LQ UHGXFLQJ \RXU VWUHVVIXODQGSDLQIXOWKRXJKWV 7KH+XPDQ*LYHQVPHWKRGLV

DWKHUDS\ZKLFKLVEDVHGRQWKH VLPSOHLGHDWKDWWKHUDS\DOZD\V ZRUNV EHVW ZKHQ LW RSHUDWHV QRWIURPDQHPRWLRQDOO\IUR]HQ LGHRORJLFDOVWDQGSRLQWEXWIURP D UHDO XQGHUVWDQGLQJ RI ZKDW LW LVWREHDKXPDQEHLQJ 7R EH HIIHFWLYH D +XPDQ *LYHQVWKHUDSLVWKDVWREHDZDUH QRWRQO\RIWKHEDVLFSK\VLFDODQG HPRWLRQDO QHHGV SURJUDPPHG LQWRXVE\RXUJHQHVEXWDOVRRI WKH QDWXUH RI WKH UHVRXUFHV HQ GRZHG WR XV WR JHW WKRVH QHHGV PHWLQWKHHQYLURQPHQW 7KHVH QHHGV DQG UHVRXUFHV WRJHWKHU FRPSULVH RXU ³KXPDQ JLYHQV´DQGDUHWKHZD\HDFKRI XVIXO¿OOVRXUJHQHWLFSRWHQWLDO :KHQQHHGVDUHPHWZHOOWKH\ SURYLGH SXUSRVH DFKLHYHPHQW DQGXQGHUVWDQGLQJDQGWKXVSUR

PRWHPHQWDOKHDOWKZKHQXVHG ZURQJO\WKH\FDXVHPLVHU\DQG GHSUHVVLRQ (PRWLRQDOQHHGV 2XU HPRWLRQDO QHHGV LQFOXGH VHFXULW\ D VHQVH RI DXWRQRP\ DQGFRQWUROEHLQJSDUWRIDZLG HUFRPPXQLW\WKHQHHGWRJLYH DQG UHFHLYH DWWHQWLRQ IULHQG VKLSIXQORYHLQWLPDF\DVHQVH RIVWDWXVWKHQHHGIRUPHDQLQJ ±EHLQJVWUHWFKHGDQGDVHQVHRI DFKLHYHPHQW 7KH UHVRXUFHV QDWXUH JDYH XV WR JHW WKHVH QHHGV PHW LQ EDO DQFHDUH$ORQJWHUPPHPRU\ LPDJLQDWLRQ WKH DELOLW\ WR XQ GHUVWDQGWKHZRUOGWKURXJKPHW DSKRU WKH DELOLW\ IRU FRPSOH[ SDWWHUQPDWFKLQJRXUREVHUYLQJ VHOI ZLWK WKH DELOLW\ WR HPSKD WKLVH DQG FRQQHFW ZLWK RWKHUV

DQG D UDWLRQDO PLQG WR FKHFN RXUHPRWLRQVDOORIWKLVFRXSOHG ZLWKDGUHDPLQJEUDLQ 7KHVH QHHGV DQG UHVRXUFHV WRJHWKHUDUHRXUKXPDQJLYHQV QDWXUH¶V JHQHWLF HQGRZPHQW WR XV  7KH\ DUH KDQGHG GRZQ WKURXJKWKHJHQHUDWLRQVWKURXJK RXU JHQHV DQG DXWRPDWLFDOO\ VHHN WKHLU IX¿OOPHQW LQ WKH HQYLURQPHQW ,W LV WKH TXDOLW\ RI WKH ZD\ WKRVH QHHGV DUH PHW WKDW GHWHU PLQHV WKH SK\VLFDO PHQWDO DQG PRUDOKHDOWKRIDQLQGLYLGXDO $QJHODLVDTXDOL¿HG+XPDQ *LYHQV WKHUDSLVWFRXQVHOORU OLIH FRDFK DQG D JUDGXDWH RI 1RWWLQJKDP 7UHQW 8QLYHUVLW\ 6KH FDQ EH FRQWDFWHG DW   RU DW DQJHODODZFXV# HLUFRPQHW

By Ellen Roche  (BSc Nutr Sci, PG Dip Dietetics), Consultant Dietitian & Clinical Nutritionist Member Irish Nutrition  & Dietetic Institute , Nutri Vive Nutrition Clinic, 49 John Street, Kilkenny. Mobile: +353 (87) 680 2248. Email: info@nutrivive.ie

Money saving tips and eating healthy – Part 2 ,1 /$67 ZHHN¶V QXWULWLRQ DU WLFOHWKHULVLQJFRVWRIIRRGZDV GLVFXVVHG DQG , KDG SURYLGHG VRPHWLSVWRKHOSVDYHPRQH\LQ UHODWLRQWREUHDNIDVWRSWLRQVDQG FKRRVLQJPHDWDQG¿VK 7RGD\,IRFXVRQZD\VWRFXW WKH FRVW RI WKH ZHHNO\ JURFHU\ EXGJHW E\ EHLQJ PRUH VDYY\ ZLWKLWHPVVXFKDVVRXSVVDXF HVIUXLWYHJHWDEOHVDQGKHDOWK\ IDWV Soups and Sauces +RPHPDGH VRXSV DQG VDXFHV DUH PXFK PRUH HFRQRPLFDO DQG KHDOWKLHU DV WKH\ FRQWDLQ OHVV VDOWDQGDUHZLWKRXWDUWL¿FLDOÀD YRXUVFRORXULQJV 0DNH \RXU RZQ XVLQJ YHJHWD

EOHVZKLFKDUHFORVHWRWKHLUXVH E\GDWHLQWKHIULGJH8VHKRPH PDGHYHJHWDEOHVRXSDVDQRFFD VLRQDO UHSODFHPHQW IRU JUDY\ RU ZKLWHVDXFH 6RXSPL[HVDUHDJUHDWZD\RI EXPSLQJXSWKHSURWHLQDQG¿EUH FRQWHQW RI D VRXS ± FRQWDLQLQJ SHDUO EDUOH\ OHQWLOV SHDV 7KH\ FDQEHSXUFKDVHGLQPRVWGHOLFD WHVVHQVDQGVXSHUPDUNHWV 6LPSO\ SODFH WKH PL[ LQWR D VDXFHSDQ RI ZDWHU ERLO IRU  PLQXWHV WKHQ OHDYH RYHUQLJKW WR VRIWHQDQGDEVRUEWKHZDWHU$GG WRZDUGV WKH HQG RI SUHSDULQJ VRXSDQGKHDWWKURXJK 0DNHKRPHPDGHSDVWDVDXFHV XVLQJWLQWRPDWRHVRQLRQJDUOLF DQGIUHVKKHUEVIURPWKHJDUGHQ RUSXUHHKHUEWXEHV

Freeze well +RPHPDGHFXUU\VDXFHUDWKHU WKDQMDUVRUSDFNHWVRIVDXFHDUH HDVLO\ SUHSDUHG \RX QHHG FXUU\ SDVWHVRPHWXPHULFRQLRQJDU OLF JLQJHU FRFRQXW PLON WLQQHG WRPDWRHVDQGQDWXUDO\RJXUW /DUJHU EDWFKHV RI FXUU\ VDXFH IUHH]H YHU\ ZHOO  7XPHULF KDV EHHQVKRZQWRLQKLELWWKHH[SUHV VLRQRIDVSHFL¿FJHQHWKDW¶VEH OLHYHGWROHDGWRWKHGHYHORSPHQW DQGSURJUHVVLRQRIEUHDVWFDQFHU 6R\D VDXFH LV JUHDW IRU ZRN VW\OH RU VWLU IU\ GLVKHV LQVWHDG RIEX\LQJWKHSDFNHWSRXFKHVRI VDXFHVDGGIUHVKJLQJHURUOHP RQJUDVVIRUHQKDQFLQJWKHÀDYRXU WKHVHODVWIRUDJHVLQWKHIULGJH  +HDOWK\ HDWLQJ RQ D EXGJHW VKRXOG QRW EH GXOO DQG ERULQJ

%\DGGLQJVRPHKHUEVRUVSLFHV LWFDQUHDOO\OLIWWKHWDVWHWH[WXUH DQGRYHUDOOÀDYRXURIWKHGLVK Cooking oil 5DSHVHHG RLO LV RIWHQ WKH VDPH SULFH DV VXQÀRZHU RU ROLYH RLO 5DSHVHHG RLO FRQWDLQV  WLPHV PRUH SRO\XQVDWXUDWHG IDW RPH JDWKDQROLYHRLO WKHUHIRUHH[ FHOOHQWIRUNHHSLQJWKHEORRGWKLQ SUHYHQWLQJEORRGFORWVKHDUWGLV HDVHJRRGIRUWKRVHZLWKLUUHJX ODUKHDUWEHDWDQGH[HUWVDQDQWL LQÀDPPDWRU\HIIHFWRQWKHERG\ 5DSHVHHGDOVRQDWXUDOO\FRQWDLQV D VPDOO DPRXQW RI SODQW VWHUROV ZKLFK KHOS WR ORZHU FKROHVWHURO ,QYHVW LQ D QRQVWLFN SDQ« WKLV ZLOOKHOS\RXXVHOHVVRLO Fruit and veg )UR]HQYHJDUHDOPRVWDVQXWUL

WLRXVDVIUHVKYHJ%X\IUHVKIUXLW VXFKDVUDVSEHUULHVEODFNEHUULHV EODFNFXUUDQWV GLUHFW IURP IUXLW IDUPV GXULQJ WKH VXPPHU DQG IUHH]HWKHQXVHDOO\HDUURXQG OESXQQHWVRIIUR]HQEHUULHVXVX DOO\UHWDLOVDW¼SHUSXQQHW 1LFH ZLWK \RJXUW RU LQFOXGHG LQDKRPHPDGHGHVVHUW$ODUJH 8. VWXG\ LQYROYLQJ \RXQJHU ZRPHQ IRXQG WKDW FRQVXPLQJ EHUU\ W\SH IUXLW WKUHH WLPHV SHU ZHHN UHGXFHG WKH FKDQFHV RI \RXQJZRPHQJHWWLQJDKHDUWDW WDFNE\DZKRSSLQJ ,I EX\LQJ WLQQHG IUXLW EX\ WKH YHUVLRQ ZKLFK LV WLQQHG LQ LWV RZQ RU QDWXUDO MXLFH UDWKHU WKDQ V\UXS %X\YHJHWDEOHVZKLFKDUHFXU UHQWO\LQVHDVRQFDUURWVDQGNDOH

DUH YHU\ IUHVK RQ WKH VKHOYHV DW WKH PRPHQW   6DYR\ FDEEDJH DQGOHHNVDUHFRPLQJLQWRVHDVRQ DOVR &RPPXQLW\*DUGHQ6FKHPHV &KHFNLIWKHUHDUHDQ\FRPPX QLW\ JDUGHQ VFKHPHV ORFDOO\ RU WU\JURZ\RXURZQYHJDWKRPH KWWSZZZJL\LQWHUQDWLRQDORUJ JL\BJURXSV &RQVLGHULQYHVWLQJLQDVHFRQG IUHH]HULI\RXKDYHWKHURRPHV SHFLDOO\IRUODUJHUIDPLOLHVXVH IXOIRUGHOD\LQJVSRLODJHRIIUXLW YHJ SRWDWRHV DQG IRU EX\LQJ IRRGVLQEXONRUIRRGVRQVSHFLDO RIIHUWRIUHH]HDWKRPH )RUIXUWKHULQIRUPDWLRQFRQWDFW WKH FOLQLF   7XQH LQWRVHH(OOHQRQWKH7RGD\6KRZ RQ57(7HOHYLVLRQRQ7XHVGD\ DIWHUQRRQV  :HGQHVGD\ PRUQ LQJV IRU WKH ODWHVW LQ QXWULWLRQ DGYLFH


CLASSIFIED | 73

26 2 2014 KILKENNY REPORTER

*'766'45.+2 +.-'00; $33/,$1&(6(59,&(6 5HSDLUV DQG 6HUYLFLQJ WR (/ $SSOLDQFHV 5HILWWLQJ DQG ,Q VWDOOLQJVHUYLFHDYDLODEOH*RRG XVHG DSSOLDQFHV LQ VWRFN /DWH QLJKWFDOORXWVRQ)ULGD\V2YHU  \HDUV H[SHULHQFH 5\DQÂśV 3DWULFN6W.LONHQQ\&DOO 

)8(/6

Good Quality Firewood for sale. Soft wood & hard wood. Contact 086 2523531. +286(+2/'6(59,&(6

%DOOURRPDQG6RFLDO'DQFH OHVVRQV6WDUWLQJ:HGWK -DQXDU\SPSP1HZSDUN +RWHO4XDOLILHGWHDFKHU WXLWLRQLQ:DOW]4XLFNVWHS )R[WURW-LYHDQG&KD&KD &KDHWF&RQWDFW0DU\ 

72/(7

7KH 0LUDFOH3UD\HU

5RRPV DYDLODEOH WR 5HQW LQ &LW\ &HQWUH DSDUWPHQW 3KRQH  5RRP WR /HW 0DVWHU 'RXEOH %HGURRP (QVXLWH $OO 0RG &RQV &RQWDFW E\ HPDLO NLP EHU#\DKRRFRP

'HDU KHDUW RI -HVXV LQ WKH SDVW , KDYH DVNHG PDQ\ IDYRXUV 7KLV WLPH , DVN \RXWKLVVSHFLDORQH PHQ WLRQ IDYRXU  7DNH LW GHDU KHDUWRI-HVXVDQGSODFHLW ZLWKLQ \RXU KHDUW ZKHUH \RXUIDWKHUVHHVLW7KHQLQ KLVPHUFLIXOH\HVLWZLOOEH FRPH\RXURZQIDYRXUQRW PLQH$PHQ

9(+,&/(6:$17(' %281&<&$67/( %RUQ  %RXQFLQJ &DVWOHV IRU DOO RFFDVLRQV )XOO\ ,QVXUHG &KHFN ZZZERUQERXQFLQJ FRP RU ILQG XV RQ )DFHERRN 3KRQH*HU &+,01(<6:((3 $ .LONHQQ\ %DVHG &KLPQH\ 6ZHHS6DIHFKLPQH\DQGFOHDQ VHUYLFH JXDUDQWHHG 6WRYH FRRNHUV DQG RSHQ ILUHV &URZ JXDUGV DQG FRZOV ILWWHG &DOO 3DW '(17$/ .LHUDQ &DPSLRQ &OLQLFDO 'HQWDO 7HFKQLFLDQ  QHZ SUL YDWH GHQWXUHV QRZ ILWWHG GLUHFW DW FOLQLF  :DWHUJDWH .LO NHQQ\ 0RQ)UL DPSP 6DW DPSP  $IWHU KRXUV (PHUJHQF\   /DQJWRQV 'HQWXUH &OLQLF 0(',&$/ &$5'6$&&(37 ('&XVWRPPDGHGHQWXUHVUH SDLUVDQGUHOLQHV&RQWDFW *UHHQVKLOO.LONHQQ\ )$50,1* :DQWHGIRU/LYH([SRUW)ULH VLDQ %XOO &DOYHV :HHNO\ &RO OHFWLRQ 3D\PHQW RQ WKH GD\ &RQWDFW  RU  

3(5621$/

James Fitzpatrick Approved Technician Oil Cooker Service Ex factory engineer 22 years experience (087) 7987477 $OO \RXU XQZDQWHG %ULFD %UDFERRNVIXUQLWXUHJHQHUDO KRXVHVKHGFRQWHQWVFOHDUHGRXW FRPSOHWHO\IUHHRIFKDUJH)UHH XS YDOXDEOH OLYLQJ  VWRUDJH VSDFH :H SURYLGH D IDVW UHOL DEOH  KLJKO\ UHFRPPHQGHG VHUYLFH&RQWDFW

,QFUHDVH IDPLO\ LQFRPH IOH[ LEOHKRXUVZLWKQRGRRUWRGRRU FDWDORJXH GURSV :RUN IURP KRPH FDOO *HUDOGLQH RU /XNH RQ :RUGVRI/LIH &RPHWRPH$OO\RXZKR ODERXU$QGDUHKHDY\ODGHQ DQG,ZLOOJLYH\RX5HVW 0DWWY 6SLULWXDO+HOSOLQH 

All Cars vehicles wanted cars , van's , 4 x4 and trucks Old cars + Nct Failures Top Cash price paid everything considered Ger Mulhall Kilkenny 056 7762508 or 087 2593006

3(76

6(37,&7$1.6

.LONHQQ\5RFN0XVLF6FKRRO OHVVRQV IRU JXLWDU NH\V GUXPV SOD\LQJLQDURFNEDQG&DOO RUYLVLWZZZNLO NHQQ\URFNFRP SULYDWHOHVVRQV DOVRDYDLODEOH  8NXOHOH&ODVVHVDW7KH+ROH,Q 7KH :DOO %HJLQQHUV,PSURY HUV $OVR DGXOW JXLWDU FODVVHV FRPPHQFLQJ VKRUWO\ &RQWDFW 

6HSWLF 7DQNV HPSWLHG GUDLQV FOHDUHGOLFHQVHGZDVWHGLVSRV DO &DOO  RU   6(59,&(6$9$,/$%/( $OO 7LOLQJ DQG 7LPEHU )ORRUV 5HSDLU6HUYLFH 6KRZHUGRRU LQVWDOODWLRQ)UHHTXRWHDQGGH VLJQ 7HO  ZZZ GDYHNHOO\WLOLQJLH 3ODVWHUHU$YDLODEOH:DOOV([ WHQVLRQVDQG+RXVHV(VWLPDWHV )5((&RQWDFW &ORWKHVOLQHV *DOYDQLVHG GRXEOH DQG VLQJOH SROH WR ZDOO OLQHV DOVR ZDOO PRXQWHG IROGDZD\FORWKHVOLQHVLGHDOIRU VPDOO DUHDV $OO OLQHV VXSSOLHG DQG ILWWHG &DOO 'HQQLV 6FXOO\  DQ\WLPH

%RRN.HHSLQJ 6HUYLFHV DYDLO DEOH WR 6ROH 7UDGHUV )DUPHUV DQG /DQGORUGV &RQWDFW  

6D\WKLVSUD\HUWKUHHWLPHV IRU WKUHH GD\V DQG \RXU IDYRXU ZLOO EH JUDQWHG 1HYHUEHHQNQRZQWRIDLO 0XVW SURPLVH SXEOLFDWLRQ RISUD\HU%0

BOOK YOUR CLASSIFIEDS AD FOR NEXT WEEK TEL: 056 7795051

.LONHQQ\ 'RJ7UDLQLQJ  GRJ DJLOLW\REHGLHQFHFODVVHVSXS S\VRFLDOL]DWLRQSULYDWHFRQVXO WDWLRQV DQG DGYLFH RQ SHW FDUH &RQWDFW %LOO\ RQ   RU0DU\RQ

086,&

BOOK YOUR CLASSIFIEDS AD FOR NEXT WEEK TEL: 056 7795051

CARS WANTED

.LONHQQ\ &RXQW\&RXQFLO We John and Nichola Nolan hereby intend to apply to Kilkenny County Council for planning permission to construct a new single storey extension to the side of the existing house and all associated site and ancillary work. All works to take place at No. 08 Beechlawns, Newpark Upper, Kilkenny. The planning application may be inspected, or purchased at a fee not exceeding the reasonable cost of making a copy, at the offices of the Planning Department, Kilkenny County Council, County Hall, John Street, Kilkenny, during itâ&#x20AC;&#x2122;s public opening hours 9a.m. - 1.00p.m. and 2.00p.m. - 4.00p.m. Monday to Friday, and a submission or observation in relation to the application may be made to the Planning Authority in writing on payment of the prescribed fee (â&#x201A;Ź20.00) within the period of 5 weeks beginning on the date of receipt by the Authority of the planning application. The Planning Authority may grant permission subject to or without conditions, or may refuse to grant permission.

.LONHQQ\ %RURXJK&RXQFLO

I, James Moylan, hereby apply to Kilkenny County Council for full planning permission to erect a dairy cubicle house including slatted slurry storage tanks, milking parlour, dairy, drafting area, plant room, ancillary concrete works and the demolition of existing farm buildings at Caherleske, Callan, Co. Kilkenny. The planning application may be inspected or purchased at a fee not exceeding the reasonable cost of making a copy at the offices of the Planning Department, Kilkenny County Council, County Hall, John Street, Kilkenny, during its public opening hours 9am â&#x20AC;&#x201C; 1pm and 2pm â&#x20AC;&#x201C; 4pm, Monday to Friday and a submission or observation in relation to the application may be made to the Planning Authority in writing on payment of the fee prescribed fee (â&#x201A;Ź20.00) within the period of 5 weeks beginning on the date of receipt by the Authority of the planning application. The Planning Authority may grant permission subject to or without conditions, or may refuse to grant permission.

We, Originate â&#x20AC;&#x201C; New Thinking For Business Ltd. hereby intend to apply to Kilkenny Borough Council for change of use planning permission from office / banking hall to casual dining restaurant & cafĂŠ bar and baked goods retail section along with associated signage (to Friary Street) at the Former Bank of Scotland / ESB premises on Friary Street (and Pennyfeather Lane to Rear), Kilkenny. This building is located within the City Centre Architectural Conservation Area. The planning application may be inspected, or purchased at a fee not exceeding the reasonable cost of making a copy, at the offices of the Planning Department, Kilkenny County Council, County Hall, John Street, Kilkenny, during its public opening hours 9 a.m.- 1.00 p.m. and 2.00 p.m. â&#x20AC;&#x201C; 4.00 p.m. Monday to Friday, and a submission or observation in relation to the application may be made to the Planning Authority in writing on payment of the prescribed fee (â&#x201A;Ź20.00) within the period of 5 weeks beginning on the date of receipt by the Authority of the planning application. The Planning Authority may grant permission subject to or without conditions, or may refuse to grant permission.

Signed: James Moylan

Signed: Brian Dunlop Architects

.LONHQQ\ &RXQW\&RXQFLO


74 | CLASSIFIED

KILKENNY REPORTER 26 2 2014


26 2 2014 KILKENNY REPORTER

CLASSIFIED | 75


76 | SPORT

KILKENNY REPORTER 26 2 2014

Hurling hurricane as super 7-5HLG¶VXQGRXEWHGVNLOODQG DFFXUDF\ ZDV YHU\ HYLGHQW DQG KLVXQGHUVWDQGLQJZLWKKLVFOXE PHQLVXQFDQQ\ +HQU\ 6KHIÀLQ FRQWLQXHV WR GLVSOD\ XQGRXEWHG OHDGHUVKLS +LV FRPSRVXUH ZKHQ VFRULQJ .LONHQQ\¶V VHFRQG JRDO EHIRUH KDOI WLPH KDG DOO WKH KDOOPDUNV RIDPDVWHUFUDIWVPDQ %ULDQ &RG\ VDLG KH ZDQWHG WR LPSURYH WKH .LONHQQ\ VTXDG RYHUWKHGXUDWLRQRIWKLVOHDJXH FDPSDLJQ ,WLVKDSSHQLQJIDVWHUWKDQIDQV DQWLFLSDWHG   $OO VL[ WHDPV LQ 'LYLVLRQ $ KDYH WZR SRLQWV DIWHU WZR JDPHV .LONHQQ\ DUH VHFRQG SODFH RQ VFRULQJ GLIIHUHQFH .LONHQQ\ ZLOO SOD\ OHDG HUV *DOZD\ LQ URXQG WKUHH LQ 1RZODQ3DUNRQ6XQGD\ZHHN

Kilkenny 5-20, Tipperary 5-14 PAT TREACY *$/()25&(ZLQGVULSSHGWKH URRIRIIWKHROGVWDQGLQ1RZODQ 3DUNODVWZHHN 7KHQ  D ZKLUOZLQG VWDUW E\ 7LSSHUDU\LQWKHRSHQLQJKDOIDO PRVWGHUDLOHG.LONHQQ\LQURXQG WZR RI WKH $OOLDQ] +XUOLQJ /HDJXHRQ6XQGD\ %XW D KXUOLQJ KXUULFDQH E\ .LONHQQ\LQWKH¿QDOPLQXWHV ZRQWKH¿UVWEUDFHRISRLQWVIRU WKH GHIHQGLQJ FKDPSLRQV LQ D IDQWDVWLF JDPH WKDW \LHOGHG   ZLWK RQO\  SRLQWV FRPLQJ IURPSODFHGEDOOV ,W ZDV D KHURLF JDPH D PDV WHUFODVVLQKXUOLQJVNLOOVZKLFK ULYDOOHGDQ\WRSFODVVEDVNHWEDOO JDPHIRUUDFNLQJXSWKHVFRUHV .LONHQQ\ DQG 7LSSHUDU\ NHHS RQ JLYLQJ 7KUHH PHHWLQJV LQ  PRQWKV WKUHH RXWVWDQGLQJ FRQWHVWV (QGHDYRXU EUDYHU\ FKDUDF WHU DQG VSRUWVPDQVKLS ZDV GLV SOD\HG LQ EXFNHWIXOV E\ ERWK WHDPVRQHDFKRFFDVLRQ 6XQGD\ ZDV WKH ODWHVW LQVWDO PHQWLQDKXUOLQJULYDOU\WKDWKDV EHHQRQJRLQJIRURYHUDFHQWXU\ 7LSS ULSSHG WKH .LONHQQ\ UHDU JXDUG DSDUW DV WKH\ VKRW IRXU JRDOV WKUHH LQ WKH RSHQLQJ  PLQXWHV  WKURXJK 6pDPXV &DOOLQDQ  1RHO0F*UDWKDQG -DVRQ)RUGH *UHHQÀDJV .LONHQQ\ ZHUH XQIRUWXQDWH QRWWRKDYHKDGDFRXSOHRIWKHLU RZQ LQ WKRVH HDUO\ VWDJHV EH IRUH µ0DQ RI WKH 0DWFK¶ &ROLQ )HQQHOO\ DQG +HQU\ 6KHIÀLQ UDLVHGJUHHQÀDJV 7LSSHUDU\ ZHUH WZR JRDOV DKHDGE\KDOIWLPHWR 7KUHHRIWKH.LONHQQ\GHIHQFH ZRXOGQ¶W VHH DFWLRQ LQ WKH VHF RQGKDOI:LOOLH3KHODQ7RPP\ :DOVK DQG %ULDQ +RJDQZHUH FDOOHG DVKRUH DQG UHSODFHG E\ 3DXO 0XUSK\ &LOOLDQ %XFNOH\ DQG5LFKDUG+RJDQ *UHDWHU ZRUNUDWH DOO RYHU WKH ¿HOGDQGDWLJKWHQLQJXSLQGH

CBS and Kieran’s reach final

Tussle time: Padraig Walsh and Paddy Murphy (T) locked in battle IHQFHUHVWULFWHG7LSSPHQWR LQWKHVHFRQGPLQXWHV &ROLQ )HQQHOO\ FXW ORRVH LQ DWWDFN DQG KHOSHG KLPVHOI WR WZR PRUH JRDOV DQG D VWULQJ RI SRLQWVDV7LSSHUDU\ZLOWHGXQGHU FRQVWDQWSUHVVXUH 7KHJDPHKXQJLQWKHEDODQFH ZLWK¿YHPLQXWHVWRJRWR 7KHPRPHQWXPZDVZLWK .LONHQQ\ 6HDPXV &DOOLQDQ KDG KLV DW WHPSW DW JRDO VPRWKHUHG DQG FOHDUHG +HQU\ 6KHIÀLQ ÀLFNHG WKH VOLRWDU EDFNZDUGV EHWZHHQ KLV OHJV WR &ROLQ )HQQHOO\ ZKR JRW ERWWOHG XS QHDU WKH HQG OLQH7- 5HLG SUHYHQWHG WKH EDOO IURPEHLQJFOHDUHG .LFNHGWRWKHQHW 0DUN .HOO\ JDLQHG SRVVHV VLRQ EXUVW SDVW WKUHH GHIHQG HUVDQGNLFNHGWRWKHQHW&ROLQ )HQQHOO\ SRLQWHG IROORZLQJ D JUHDWSDVVIURP5LFKDUG+RJDQ

Brian Kennedy eludes Brendan Maher

DQGWKH'DQHVIRUWPDQIROORZHG ZLWK WZR XQEHOLHYDEOH SRLQWV IURPPLG¿HOG ,W ZDV JORULRXV VWXII 7KH .LONHQQ\ IDQV GLGQ¶W ZDQW WKH JDPHWRHQG 7KH &DWV ZRQ E\ VL[ SRLQWV KDYLQJWUDLOHGE\ODWHLQWKH ¿UVWKDOI ,W¶V KDUG WR IDXOW JRDONHHSHU 'DYLG +HULW\ IRU DQ\ RI WKH JRDOV $OO WKH VKRWV ZHUH KLW IURPLQVLGHWKHPHWUHOLQH +H GDVKHG IURP KLV OLQH WR SUHYHQWDQRWKHUJRDOIURP1RHO 0F*UDWKLQWKH¿UVWKDOI%ULDQ .HQQHG\ FRQWLQXHV WR JURZ LQ VWDWXUH DW FRUQHU EDFN -RH\ +ROGHQZDVRXWVWDQGLQJDWZLQJ EDFN +LV FRPSRVXUH RQ WKH EDOO DQG KLV GHOLYHULHV RXW RI GH IHQFH ZHUH LPSUHVVLYH &LOOLDQ %XFNOH\¶V GLVSOD\ DW ZLQJ EDFN ZDV HIIHFWLYH +H¶V OLNHO\

WR EH VHHQ WKHUH DJDLQ LQ WKLV FDPSDLJQ ,Q WKH WZR OHDJXH JDPHV /HVWHU5\DQKDVVHHQDORWRIDF WLRQDVDFHQWUHEDFN7KDW¶VWZR DWKOHWLF PLG¿HOGHUV ZLWK SDFH SOD\LQJLQWKHKDOIEDFNOLQH 3DXO 0XUSK\¶V LQWURGXFWLRQ WRGHIHQFHKDGDFDOPLQJHIIHFW RQ WKH UHDUJXDUG +LV FOXEPDWH 5LFKDUG +RJDQ VORWWHG VHDP OHVVO\LQWRPLG¿HOG *UHDWYLVLRQ +H VKRZHG JUHDW YLVLRQ DQG SLFNHGRIIWZRRXWVWDQGLQJORQJ UDQJHSRLQWV 3iGUDLJ :DOVK ZDV LPSUHV VLYHLQPLG¿HOG$QRWKHUZRUN PDQOLNH SHUIRUPDQFH ZLWK D ORQJUDQJHSRLQWWRHQKDQFHKLV HIIRUW :DOWHU:DOVKGHVWUR\HG0LFN\ &DKLOO RQH RI WKH EHVW FRUQHU EDFNV LQ WKH JDPH 7KH WRZHU LQJ 7XOORJKHU 5RVEHUFRQ FOXE

PDQ EDJJHG ¿YH SRLQWV IURP SOD\ DQG KH ZDV VFRULQJ ZKHQ .LONHQQ\ZHUHRQWKHEDFNIRRW LQWKDWRSHQLQJKDOI -RKQ -RH )DUUHOO ODLG RQ .LONHQQ\¶V VHFRQG JRDOVFRUHG E\ +HQU\ 6KHIÀLQ DQG LI WKH 7KRPDVWRZQ PDQ FDQ ¿QG KLV RZQVFRULQJWRXFKKHZLOOSXVK KDUGIRUDVWDUWLQJSODFH 0DUN .HOO\ PDGH DQ LPSUHV VLRQ DW IXOO IRUZDUG DQG FRQ MXUHG XS D JUHDW ¿IWK JRDO7KH 2¶/RXJKOLQ*DHOVPDQLVVKRZ LQJVLJQVWKDWKHLVOHDUQLQJHY HU\GD\KHSXOOVRQDMHUVH\ 7KH %DOO\KDOH PHQ LQ DWWDFN&ROLQ )HQQHOO\ +HQU\ 6KHIÀLQ DQG 7- 5HLG ZHUH RXWVWDQGLQJ )HQQHOO\ LV UHYHOOLQJ LQ DOO WKHDFWLRQWKDWSOD\LQJDWFHQWUH IRUZDUG EULQJV +LV SDFH DQG SRZHUDUHJLYLQJWKHWHDPPDQ DJHPHQWDJUHDWRSWLRQ

Henry Shefflin shoulder-to-shoulder with Shane McGrath

.,/.(11< &%6 FDPH JRRG LQ WKH FORVLQJ VWDJHV RI WKHLU /HLQVWHU VHPL¿QDO FODVK ZLWK *RRG&RXQVHO1HZ5RVVRXW VFRULQJ WKHLU RSSRQHQWV E\  WR  WR VHFXUH D  WR  ZLQ 7KH &%6 SOD\HG LQWR WKH VWURQJZLQGLQWKHRSHQLQJKDOI DQG ZHQW LQ DW KDOI WLPH OHYHO  HDFK 3DGG\ 'HHJDQ DQ FKRULQJDVROLGGHIHQVLYHXQLWDW FHQWUHEDFN $Q HDUO\ VHFRQG KDOI JRDO IURP 2¶/RXJKOLQ *DHOV FOXE PDQ 5REELH %XFNOH\ JDYH WKH ZLQQHUV WKH LQLWLDWLYH DQG WKH\ ZHQWRQWRZLQE\VL[SRLQWV 'LFNVERUR¶V $QGUHZ *DIIQH\ ZDV WKHLU FKLHI PDUNVPDQ ZLWK  SRLQWV I  5REELH %XFNOH\ KLW  ZKLOH 1LDOO 0XOOLQVVKRWIURPPLG¿HOG 6W .LHUDQ¶V &ROOHJH WRRN IXOO DGYDQWDJH RI WKH JDOH IRUFH ZLQG LQ WKH ¿UVW KDOI DQG OHG  WRDWKDOIWLPHDJDLQVW &ROiLVWH (RLQ 'XEOLQ LQ WKH RWKHU VHPL ¿QDO 7KH .LONHQQ\ VFKRRO ZHQW RQ WR RXWVFRUH WKH 'XEVE\WRLQWKHVHF RQGKDOIWRUXQRXWFRPIRUWDEOH ZLQQHUVWR $Q HDUO\ JRDO IURP


SPORT | 77

26 2 2014 KILKENNY REPORTER

heroes storm to victory %HQQHWWVEULGJH¶V 6pDQ 0RUULVVH\ DQG ZLWK WKH GHDGO\ DFFXUDWH 5REELH 'RQQHOO\ SLO LQJ RQ WKH SRLQWV WKH ER\V LQ WKH EODFN DQG ZKLWH KRRSV QHYHU ORRNHG LQ GDQJHU RI ORV LQJ $ VHFRQG JRDO VFRUHG E\ 'RQQHOO\LQWKHVHFRQGKDOISXW 6W.LHUDQ¶VRXWRIVLJKW $Q LPSUHVVLYH KDOI EDFN OLQH RI'DUUHQ0XOOHQ-DPHV0DKHU DQG /LDP .HRJKDQ ZDV WKH ODXQFKLQJSDGIRUWKLVZLQZLWK .HYLQ %ODQFK¿HOG DQG -DVRQ %\UQHGRPLQDQWLQPLG¿HOG 7KRPDVWRZQ¶V 5REELH 'RQQHOO\VFRUHG I 6pDQ 0RUULVVH\ 6W .LHUDQ¶V PHHW .LONHQQ\ &%6 LQ WKH /HLQVWHU ¿QDO QH[W ZHHN

6KHOO\ )DUUHOO ZDV LQYROYHG LQERWKJRDOVDQGWRUPHQWHGWKH *DOZD\GHIHQFHWKURXJKRXW 7KH VHFRQG KDOI ZDV HYHQ HQRXJK ZLWK WKH .LONHQQ\ KDOI EDFN OLQH RI 0DLUpDG 3RZHU (GZLQD .HDQH DQG (ODLQH $\OZDUGLQRXWVWDQGLQJIRUP *DOZD\ OLQHG RXW ZLWK VHYHQ RIWKHLU$OO,UHODQGWHDP

Senior camogie team win .,/.(11< VHQLRU FDPRJLH WHDP WUDYHOOHG WR %DOOLQDVORH DQGGHVHUYHGO\FDPHDZD\ZLWK WKHOHDJXHSRLQWVZLQQLQJ WRDJDLQVW$OOUHODQGFKDP SLRQV*DOZD\ /RRNLQJ VKDUS DQG GHWHU PLQHG WKH YLVLWRUV OHG  WR  DW KDOI WLPH ZLWK JRDOV IURP$RLIH1HDU\DQG0LFKHOOH 4XLOW\

Ace GAA photographer Donal Foley Pics: Donal Foley A Tipperary Lone Ranger has no wriggle room

Kilkenny captain Lester Ryan, Tipp captain Brendan Maher and referee Diarmuid Kirwin, Cork before the throw-in

Kilkenny squad is showing real promise

GAA Results $OOLDQ]+XUOLQJ/HDJXH .LONHQQ\7LSSHUDU\ --.DYDQDJK DQG6RQV6HQLRU)/ .LOPRJDQQ\&ODUD 5DLO\DUG6W3DWULFN¶V --.DYDQDJKDQG6RQV

,QWHUPHGLDWH)/ %DOO\KDOH6KDPURFNV 7KRPDVWRZQ --.DYDQDJKDQG6RQV -XQLRU)/ 'DQHVIRUW*UDLJXH %DOO\FDOODQ

0XFNDOHH &DUULJHHQ :LQGJDS0XFNDOHH *UDLJQDPDQDJK 7XOORJKHU5RVEHUFRQ .LONHQQ\&LWURsQ&HQWUH 0LQRU)/

.LOPDFRZ0XOOLQDYDW 'XJJDQ6WHHO8)/ /LVGRZQH\0RRQFRLQ 2¶/RXJKOLQ*DHOV-DPHV 6WHSKHQV *UDLJXH%DOO\FDOODQ 0XOOLQDYDW

3LOWRZQ&DUULFNVKRFN %DOO\KDOH6KDPURFNV6W )LDFUH¶V *OHQPRUH 6W0DUWLQ¶V 2¶/RXJKOLQ*DHOV 'LFNVERUR

/HLQVWHU3RVW3ULPDU\ 6FKRROV¶6+µ$¶ &RUQ8t'K~LOO6HPL)LQDOV 6W.LHUDQ¶V&ROOHJH &ROiLVWH(RLQ .LONHQQ\&%6 *RRG&RXQVHO&ROOHJH


78 | SPORT

KILKENNY REPORTER 26 2 2014

The Kilkenny defence stands ďŹ rm

A clean but sporting battle

TJ Reid and Michael Cahill in close combat

Willie Phelan (K) in control

No roof on stand but brave souls cared less

Pics: Donal Foley


SPORT | 79

26 2 2014 KILKENNY REPORTER

Golf Notes Callan Drive In Martin Maher and Kathleen Phelan (Captains 2014) would like to invite you all to their offical drive in next Saturday morning. The registration for the competition to follow will take place at 11am before Martin and Kathleen hit the ceremonial opening shots of 2014 to declare the golf season officially underway. There follows a mixed scramble event which all are invited to take part in which is always wonderfully supported. So members from all parts of the club please come along and enjoy the offical opening of the 2014 in a wonderful social atmosphere. O Dwyer Golf Stores Open Singles On Wednesday the 5th of March Callans open singles series gets underway. Over the past few years the open singles has proved massively popular. The Series is a huge source of interest and revenue for the club which enjoys brilliant support from members and visitors alike. The course is in beautiful condition for so early in the season and all are looking forward to all comers who can enjoy the course and catering facilities throughout the coming months. The hugely popular early bird option for non members (10e before 12 noon for a fourball or 12.50e for visitors not part of a visiting fourball) applies. This year there is a meal option as part of the early bird deal with golf, soup and sandwiches for 20e. Last year the first winner was Paul Norris who in March was the first name in the hat for the annual playoff and thousands of shots later John Hession from Mount Juliet was proudly crowned winner of the overall competition after a hotly contested finale. This year promises more of the same and hopefully as enjoyable competition throughout our long season.The Winter League has been extended to allow for the inclement weather. The final date will be decided over the coming days.

Singles Sean Walzer returned to form with a win in this weekends competition. Sean won by a shot from Sean Brett with Tom Kenny in third. It was a very difficult weekend for golf but hopefully the drive in and the incoming Spring will signal more golf friendly conditions. There are wonderful offers for membership (new and lapsed members) this year while there are finance options available for existing members also. Contact the office on 056-7725136 for all queries and speak to Margaret.

Mens Results Sunday 22nd Feb 1 S Walzer 2 S Brett 3 T Kenny

Ladies Results

Diary

Feb 18th 1 K O Neill 27 2 M O Brien 24 3 C Henriques 24 Callan Golf Club Lotto Results Week 48 No Winner €30 each Michael Slattery, Margaret Scully, & Margaret Hickey. Sellers: Kathleen Phelan & John Cahill Next Week’s Jackpot €2750

Saturday 1st and Sunday 2nd March offers an 18 hole mens open singles. Visitors and members are welcome to participate.

Castlecomer The golfing year was ushered in with rousing welcome on Sunday with the joint Captain’s drive in. Captain Gerry Dunne, recovering from illness, arrived with Lady Captain Ita Madigan to crowds delighted to take part in the celebration and opening competition. Despite overcast clouds, rain held off during the drive in and the following competition. With a shot-gun start, players convened afterwards to enjoy the delicious food provided by and sponsored by Eddie, the golf club’s chef and bar manager. Many thanks for his support and gratefully received nourishment. Everybody was welcomed in fine fashion by the two Captains and with warm wishes for an enjoyable and successful year of golf. The standard of good golf was evident in the club by the great scoring achieved in the nine hole scramble. For many, steady birdies and pars weren’t enough to feature among the winners. The winning team of Michael Brennan, John Brennan, Tony Carr and Mai McEvoy played terrific golf. A great eagle chance prepared by the team effort was pinned down with a massive putt by Michael Brennan on the twelfth. With a winning net score of 25 they pipped the team of Michael Daly, John Dowling, Betty Byrne and Helen Dunne by just ¼ of a point. Although Captain Gerry Dunne was recuperating and unable to play fully in the competition, his wife Helen, as part of that second place team and former lady captain herself, kept the Dunne banner flying high. In third place were Murty Coonan, John Dooley, Donie Walsh and Theresa Manning with a score of 27. The day was great fun and full of goodwill and good cheer. Everyone in the club is looking forward to the many upcoming golfing events and supporting Captain Gerry and Lady Captain Ita, both of whom are deemed to be wonderful ambassadors for the club. Committed to be there in sickness and in health, with mutual support and good wishes between all, it was marvellous to see Captain Gerry and Lady Captain Ita celebrate recovery, new beginnings and happy days for everyone.

Ladies Preparations are underway for the selection of teams for the upcoming inter-club competitions. The Minor cup, Challenge and Intermediate have their first round in April and the team member scouts are on high alert. There is plenty of opportunity for players to be out there, improving and practicing and generally becoming noticed for their good golf. Coming up next weekend is the high and low ladies competition and the spring league for ladies. Draws for both will take place on Friday, 28th and times noted on the web-site for players to check for the high and low. Names for the competitions can be placed on the notice board sheets in the club house. With the upsurge in new lady members and fresh enthusiasm in all to play the course under the new layout, it is reasonable to have high hopes for interesting and enjoyable participation in interclub matches for the ladies. Following the very successful ‘tester’ experience for ladies promoted by Honoria Fogarty in 2013, the new lady members now in the club are very welcome. Any others who may be wondering if golf is the gift they might have missed in their life, should contact the club immediately. There are officers of the club dedicated to involvement with beginners to help them find their golfing legs and the joy of the golf experience. Very few who try it can turn away from it forever. It’s like chocolate or anything deliciously tasty. Once tried, it’s hard to stay away from it when you know it’s there on offer, because it just feels so good. Go on, try it out for yourself or encourage those who never tried it yet. You’ll probably like it and so might they.

Lotto There was no winner of the jackpot on Monday 17th February. The numbers drawn were 2, 5, 7, 17. The jackpot now stands at €8,400 and is an enticing amount to be won for just a €2 flutter. Tickets are available from the club house, members and local retail outlets. There’s only one way to win. Be in. Buy that ticket to give yourself the chance to wonder just what €8,400 might do for you. If you win it, you can do it.

Deals and offers A reminder that there are great deals to be had in Castlecomer Golf club for visitors, groups and Societies. Golf only , €19.00 Golf and Buggy, €25.00 (PPS Buggy) Golf, Tea & Scone on arrival, Main Course Meal €29.00

Golf, Tea & Scone on arrival, Main Course Meal, Buggy €35.00 (PPS Buggy) Golf, Breakfast Bap and Tea/ Coffee on arrival, Main Course Meal, Buggy €39.00 (PPS Buggy) Plus; €100.00 Voucher off your next outing in Castlecomer (20 Members or more playing on the day) €50.00 Voucher off your next outing in Castlecomer (10-20 Members playing on the day) There are great deals for membership available also with savings of €100 on full membership when linking in with an existing member. Great value options for limited membership are also available for beginners and those tasting and testing their ability and committment. For full details check www. castlecomergolf.ie or phone 056 4441139. Or call a friend or someone known to you who is a member of the club and any of those would be delighted to take your call of interest with great welcome.

Gowran Captains Drive In to Office A large number of members turned up for the first major event of the year at the traditional driving-in ceremony on Sunday last 23rd February. Captains Declan Davis and Deirdre McCabe took to the 1st tee shortly after lunch a little nervously but confident of a good strike-off. They enjoyed favourable drives hopefully leading to a great years’ golf ahead. The drive-in was followed by a 3 person scramble with a shotgun start at 12.30 p.m. Paul Whelan, Mick Bolger and John O’Driscoll took top spot , 2nd place was taken by Richie Lowry, Peter O’Shea and Eileen Tobin, while 3rd place went to John Moore, Pat Roche and J.J. Ryan. An enjoyable social evening took place after the golf.

Spring League The Spring League continued last week with another round of qualifiers. Gowran Park member Denis Ryan (12) took the leading spot with a great score of 43 points well ahead of the remaining two qualifiers Tom Attride (6) Borris and Joe Lannon (13) Gowran Park with 38 points each. Remaining qualifiers continue every Thursday and Friday through to 27th March.

Seniors Open Days Gowran Park hosts a Seniors Open Singles day on Tuesday next 4th March with a timesheet in operation – telephone 056 7726699. Entry Fee - Visitors €15.00 Members €5.00. Ladies Results - 11 Hole Stableford - 19th February, 2014 1st Rachel Dick (22) 25pts 2nd Eileen Walsh (19) 24pts Well done to the Winter League winners team, Ger Hickey, Catherine O’Driscoll, Eileen Walsh and Mary Harding, captained by Ann Mullins winning by 1 point with a total of 414 points.

Lady members are reminded of the fun 11 hole Scramble Wednesday 26th February draw at 10.30 a.m. for a shotgun start at 11 a.m. Prizegiving after the golf. Golden Golfers - 11 Hole Champagne Scramble 21st February, 2014 1st Tony Dooley (13), Pat Nolan (23), Kerri Bolger (27) 62.0 nett 2nd Mick Dillon (11), John O’Driscoll (20), Kate Hennessy (10) 59.0 nett Junior Golf – Thursday 20th February 2014 1st Ciaran Whelan (9) 38 points 2nd Conor Cleere (28) 34 points

Fixtures Spring Series (Open Singles) Thursday 27th and Friday 28th February Members 18 Hole Competition Saturday 1st March/Sunday 2nd March Seniors Open Singles Tuesday 4th March Visitors €15 Open Fourball Sunday 9th March Visitors €20

Kilkenny MEMBERSHIP RENEWAL & FEES Members are reminded he 28th February is final date for payment of annual subscriptions.

GOLF WINTER SPECIAL Golf Winter Special available Monday to Friday until 31st March 2014. Green Fee plus hot plate of the day and Tea/Coffee for €35.

SNOOKER SINGLES The second round of the snooker singles was due for completion by February 24th, any outstanding matches please complete as soon as possible.

BRIDGE LESSONS Bridge will continue playing on Monday night March 3rd at 7.45pm.

RESULTS No competitions at week end as the course was closed while the clean up from the storm took place.

LADIES NEWS Ladies Fixtures

Anyone wishing to help out please give your name to anyone on the Junior committee or else drop your details to kilkennyjuniorgolf@gmail.com

FIXTURES Monday February 24th, Course Closed Tuesday February 25th, Course Closed Wednesday February 26th, Course Closed Thursday February 27th, Course Closed Friday February 28th, Course Closed Saturday March 1st, Course Closed Sunday March 2nd, Course Closed Monday March 3rd Course Closed Tuesday March 4th, Course Closed

Mountain View Storm Damage The atrocious storm recently saw over 70 trees knocked and debris strewn throughout the course. Many of the trees were uprooted while more were broken in two. Others had large limbs broken off or are bent over perilously close to falling over completely. There was also some damage done to the roof of the clubhouse. The course is open for play thanks to the hard work of greenkeeper Edward Power along the help of some members who are busy with the cleanup. Until the cleanup is completed any player who’s stance or swing is impeded by uprooted trees or piles of branches may take relief of two club lengths.

Open Spring Series Due to the poor weather conditions over the past number weeks only two competitions of the Open Spring Series were completed. Jim Dunne (MV) was the qualifier from week 2 with 39Pts and last week Gary Ryan (MV) qualified with 38Pts. This competition continues for the next seven weeks with the grand final on Saturday 19th April.

Spring League

No competition Thursday 27th February as course closed. Castlecomer Golf Club has invited our Seniors to join them on Wednesday February 26th if they wish. Please check in by 10am in Castlecomer.

Members are reminded that this year’s Spring League commences on March 23rd and promises to be a close run contest with a new and unique competition format. Teams will comprise of four players and there will be four rounds run over four consecutive weekends. Contact the clubhouse for competition details. Entry fee will be €80 per team.

SENIOR LADIES

Diary

No Competition on Tuesday Feb 25th on Tuesday March 4th.

SENIOR MEN

No Competition Thursday 27th February as course closed.

JUNIOR/JUVENILE The Juvenile section are looking for volunteer’s to help out with Saturday morning coaching which will start back in mid Spring.

Sunday Mar 2nd Week 6 Open Series (Single Stableford) Mon Mar 3nd - Sun Mar 9th Week 5 Open Series (Single Stableford) Tuesday Mar 4th MV Seniors Competition Wednesday Mar 5th Ladies 18 Hole Competition.


80 | ADVERTISEMENT

KILKENNY REPORTER 26 2 2014


Kilkennyreporter02262014