Page 1

UNIVERSIDAD AUTÓNOMA DE CIUDAD JUÁREZ DEPARTAMENTO QUÍMICO-BIOLÓGICAS QUÍMICA COMPUTACIONAL KESIA MARELI HERNANDEZ MEJIA

Chain K, Crystal Structure Of The Complex Between Thrombin And The Central "e" Region Of Fibrin PDB: 2A45_K GenPept Identical Proteins Graphics >pdb|2A45|K Chain K, Crystal Structure of The Complex Between Thrombin And The Central "e" Region Of Fibrin GHRPLDKKREEAPSLRPAPPPISGGGYRARPAKAAATQKKVERKAPDAGGCLHADPDLGVLCPTGCQLQE ALLQQERPIRNSVDELNNNVE

actin, cytoplasmic 1 [Gallus gallus] NCBI Reference Sequence: NP_990849.1 GenPept Identical Proteins Graphics >NP_990849.1 actin, cytoplasmic 1 [Gallus gallus] MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP IEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVL SLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVR DIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFN SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS TFQQMWISKQEYDESGPSIVHRKCF

collagen type IV alpha 1, isoform B [Drosophila melanogaster] NCBI Reference Sequence: NP_723045.1 GenPept Identical Proteins Graphics >NP_723045.1 collagen type IV alpha 1, isoform B [Drosophila melanogaster] MLPFWKRLLYAAVIAGALVGADAQFWKTAGTAGSIQDSVKHYNRNEPKFPIDDSYDIVDSAGVARGDLPP KNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPG LHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYA KGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGE PASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGS


TGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGL NGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLP GYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDM GIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTG LPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGN DGTPGRAGRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQT GMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNG QPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEK GDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRG PAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGL DGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDG INGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGE TGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGD RGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAG EPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGL QGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEP GQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAIGLIGQKG EPGAPAPAALDYLTGILITRHSQSETVPACSAGHTELWTGYSLLYVDGNDYAHNQDLGSPGSCVPRFSTL PVLSCGQNNVCNYASRNDKTFWLTTNAAIPMMPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPN GWEGLWIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQP FERPQQQTIKAGERQSHVSRCQVCMKNSS

albumin, partial [Rana catesbeiana] GenBank: AAA63473.1 GenPept Identical Proteins Graphics >AAA63473.1 albumin, partial [Rana catesbeiana] KCRIIREFPDIVFKGLTLVQVSQKFGKAGFEDVKKVTEEIVHLNEDCCKGDAVECMMERMEATDHICEAK DKLSSKLADCCAKSILERTPCLLALPNDESDLSKELKNYYEDERVCENYKKDKLLFLAHFTHDYARSHQE SSPQSCLRVSKGFEGLLEKCCASENHAECLKQAPILLEAALKEIEELRKQNCGALQLLGFRDYNIQLLFR YFFKMPQVTAPTLVELAGRMTKVAVYCCGLAENKQQTCAEEKLDILLGEMCEKEKHTFVNDNVRHCCVDS YANRRKCFTDLQRYPNYVAPKWDESKLHFNEDLCKGSEDDQIKKKLEVLVEYMKMKPDCGPEKLKEVVEA FRKIDIKCCAAEDHQKCFDDEKAGLLQIIEAH

glutenin [Triticum aestivum] GenBank: CAA27052.1 GenPept Identical Proteins Graphics >CAA27052.1 glutenin [Triticum aestivum] MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVMDQQLRDISPECHPVVVSPVA GQYEQQIVVPKGGSFYPGETTPPQQLQQRIFWGIPALLKRYYPSVTSPQQVSYYPGQASPQRPGQGQQPG QGQQSGQGQQGYYPTSPQQPGQWQQPEQGQPGYYPTSPQQPGQLQQPAQGQQPGQGQQGRQPGQGQPGYY PTSSQLQPGQLQQPAQGQQGQQPGQGQQGQQPGQGQQPGQGQQGQQPGQGQQPGQGQQGQQLGQGQQGYY


PTSLQQSGQGQPGYYPTSLQQLGQGQSGYYPTSPQQPGQGQQPGQLQQPAQGQQPEQGQQGQQPGQGQQG QQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPGQGQQGQQVGQGQQAQQPGQGQQPG QGQPGYYPTSPLQSGQGQPGYYLTSPQQSGQGQQPGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQ GQQPGQGQPGYYPTSPQQSGQGQQPGQWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQQPGQGQQPGQL QQPAQGQQGQQLAQGQQGQQPAQVQQGQQPAQGQQGQQLGQGQQGQQPGQGQQPAQGQQGQQPGQGQQGQ QPGQGQQPGQGQPWYYPTSPQESGQGQQPGQWQQPGQWQQPGQGQPGYYLTSPLQLGQGQQGYYPTSLQQ PGQGQQPGQWQQSGQGQHGYYPTSPQLSGQGQRPGQWLQPGQGQQGYYPTSPQQSGQGQQLGQWLQPGQG QQGYYPTSLQQTGQGQQSGQGQQGYYSSYHVSVEHQAASLKVAKAQQLAAQLPAMCRLEGGDALSASQ

insulin precursor [Aplysia californica] NCBI Reference Sequence: NP_001191615.1 GenPept Identical Proteins Graphics >NP_001191615.1 insulin precursor [Aplysia californica] MSKFLLQSHSANACLLTLLLTLASNLDISLANFEHSCNGYMRPHPRGLCGEDLHVIISNLCSSLGGNRRF LAKYMVKRDTENVNDKLRGILLNKKEAFSYLTKREASGSITCECCFNQCRIFELAQYCRLPDHFFSRISR TGRSNSGHAQLEDNFS

RecName: Full=Lipase; AltName: Full=RDL; AltName: Full=Triacylglycerol lipase; Short=ROL; Flags: Precursor UniProtKB/Swiss-Prot: P61872.1 GenPept Identical Proteins Graphics >sp|P61872.1|LIP_RHIOR RecName: Full=Lipase; AltName: Full=RDL; AltName: Full=Triacylglycerol lipase; Short=ROL; Flags: Precursor MVSFISISQGVSLCLLVSSMMLGSSAVPVSGKSGSSNTAVSASDNAALPPLISSRCAPPSNKGSKSDLQA EPYNMQKNTEWYESHGGNLTSIGKRDDNLVGGMTLDLPSDAPPISLSSSTNSASDGGKVVAATTAQIQEF TKYAGIAATAYCRSVVPGNKWDCVQCQKWVPDGKIITTFTSLLSDTNGYVLRSDKQKTIYLVFRGTNSFR SAITDIVFNFSDYKPVKGAKVHAGFLSSYEQVVNDYFPVVQEQLTAHPTYKVIVTGHSLGGAQALLAGMD LYQREPRLSPKNLSIFTVGGPRVGNPTFAYYVESTGIPFQRTVHKRDIVPHVPPQSFGFLHPGVESWIKS GTSNVQICTSEIETKDCSNSIVPFTSILDHLSYFDINEGSCL

hemoglobin [Pseudoterranova decipiens] GenBank: AAA29796.1 GenPept Identical Proteins Graphics >AAA29796.1 hemoglobin [Pseudoterranova decipiens] MHSSIVLATVLFVAIASASKTRELCMKSLEHAKVGTSKEAKQDGIDLYKHMFEHYPAMKKYFKHRENYTP ADVQKDPFFIKQGQNILLACHVLCATYDDRETFDAYVGELMARHERDHVKVPNDVWNHFWEHFIEFLGSK TTLDEPTKHAWQEIGKEFSHEISHHGRHSVRDHCMNSLEYIAIGDKEHQKQNGIDLYKHMFEHYPHMRKA FKGRENFTKEDVQKDAFFVNKDTRFCWPFVCCDSSYDDEPTFDYFVDALMDRHIKDDIHLPQEQWHEFWK LFAEYLNEKSHQHLTEAEKHAWSTIGEDFAHEADKHAKAEKDHHEGEHKEEHH


gamma (plasmid) [Bacillus subtilis] GenBank: SCV75051.1 GenPept Identical Proteins Graphics >SCV75051.1 gamma (plasmid) [Bacillus subtilis] MSTVILAEKPSQALAYAQAFNQSDKKDGYFEIKDPLFTDETFITFGFGHLVELAEPGNYDEKWQNWKLES LPIFPDRYDFEVAKDKGKQFKIVAELLKKANTIIVATDSDREGENIAWSIIHKANAFSKDKTFKRLWINS LEKDVIRSGFQNLQPGMNYYPFYQEAQTRQIADWLIGMNASPLYTLNLQQKGVQGTFSLGRVQTPTLYLI FQRQEAIENFKKEPFFEVEASIKVNQGSFKGVLSPTQRFKTQEELLAFVSSKQAKIGNQEGRITDVQTKE KKTNSPSLFSLSSLQSKVNQLYKATASQTLKAMQGLYEAKLLSYPRTDTPFITENEFAYLKANFGKYSGF LGLDLEMVQTEPRKRYVDGSKVQEHHAIIPTKQVPTESALAKMDDLQRKIYALVVKTTVAMFLPDYLYEE TKIQTKVADLLFQSIGKTPKQEGWKILFKQQNKEEKEDVQTLPLVIIGEHAEVDVKSAEKETQPPKAFTE GTLLTAMKTAGKTIDDEEAQKILKDTEGIGTEATRASIIEALKQKEYIQVIKNKLVVTEKGKLLCQAVES QHLLTSAEMTAKWETYLKKIGKREGNQENFITNIKKFIVHLLEAVPTDIEKLNFSDYQEQKEKEAEKSIV GKCPKCGNNIVLKKSFYGCSNYPECKFTLAEHFRKKKLTKTNVKELLEGKETLVKGIKNKEKKSYNAVVK IGEKGYIDFISFSK

amylase [[Clostridium] stercorarium subsp. stercorarium DSM 8532] GenBank: AGI38213.1 GenPept Identical Proteins Graphics >AGI38213.1 amylase [[Clostridium] stercorarium subsp. stercorarium DSM 8532] MGYVFDENGIEAVICGFHKNPHEILGMHTQGDETAICAYIPNAKHIEVVFYKSGLSYEMDKKDDRGFFTV IIPGRPENSMYKFKVTDHTGHRFETYDPYSFLPTISDYDLYLFNEGTHHRIYEKLGAHIRNINGVSGVSF CVWAPEAKRVSVVGDFNQWDGRRHQMRMLGSSGVWEIFIPGLVKNDIYKYEIKTPFDEIYLKADPYAFYA EKPPKTASKVYDLHNYEWHDEQWMKQREKESTFDKPLNIYEVHLGSWMQQPDPDPESETGFKPLSYRQLA EKLVPYVKEMGYTHIELLPVMEHPYDGSWGYQITGYYAVTARYGIPEDFKYFIDTCHQNGIGVILDWVPV HFPKDGHGLARFDGTACYEHEHPLLGEHHQWGTHIFNFSRNEVRSFLISNAIYWFDIFHVDGLRVDAVAF MLYLDYCRNDGEWIPNRYGGRENLDAIEFLKQLNCAVYKYFPNVLMIAEDSTAWPMVTRPVHVGGLGFSH KWNMGWMNDFLRYMSMDPIYRKYHHNLITFSFMYAWSENFILVLSHDEVVHGKCSLLNKMPGDYWQKFAG LRAALGYFIGHPGKKLLFMGGEFGQFIEWKYKESLDWHLLSYPMHEKLHRYVRELNNLYLNEPALYEVDF HYDGFEWIDCNDTENSIVSFIRKGKDWRDMLIFVCNFTPVTHENYRIGAPFYTYYEEVFNSDREKYGGSN VINAGKIHSENIPYHHRPYSLVLRIPPLATIILRPDLKNFR


NCBI Su nombre completo es centro nacional para la información biotecnológica es una base de datos donde tiene herramientas muy útiles donde se pueden analizar las secuencias de ADN, ARN y proteínas y toda la información de biología molecular.

Nucleótido Se unen para formar cadenas uniéndose entre ellos por enlaces covalentes en un lado esta el fosfato y del otro el del azúcar. También sirven para formar el ADN de los polímeros del acido nucleico y del ARN. Ya que el nucleótido esta formado por tres moléculas que es una base nitrogenada, un azúcar de cinco carbonosos y de un fosfato. Dogma central de la biología molecular Este dogma tiene tres procesos que lleva acabo tanto por los ácidos nucleicos, ARN y ADN. Una de ellas es la replicación, transcripción y traducción. Donde el ADN se copia para conseguir una molécula de RNA, cuando se tiene la molécula de RNA se codifica para conseguir una secuencia de aminoácidos de un polipéptido, que eso sería la traducción. Gen En el gen se almacena información que se hereda, ya que es un segmento de ADN que es codificada por una proteína. Esto quiere decir que el gen contiene información para la producción de una proteína que tiene como función en una célula en el organismo.

Secuencia y definiciones  
Secuencia y definiciones  
Advertisement