Page 1

Cyan Magenta Yellow Black

The Equinox The student voice of Keene State College

VOL. 65, ISSUE #17

THURSDAY, FEB. 21, 2013

[ Keene-­Equinox.com ]

Human rights advocate speaks about technology ERIC WALKER

EQUINOX STAFF

PHOTO ILLUSTRATION BY EMILY FEDORKO / PHOTO EDITOR

Money and jobs keep students awake at night KARINA BARRIGA ALBRING

NEWS EDITOR While college is known to be a time to learn from mistakes, prepare academically and emotionally and get ready for the ‘real world’, many Keene State College students feel that they are already facing the challenges of a competitive, expensive, tough, ‘real world.’ Finding a job and future debt concerns were cited by 90 percent of 20 Keene State College students informally surveyed recently. “The job market situation in the U.S. is bad. We all want to get jobs,â€? junior Brett Mastrengelo said. He said many VWXGHQWV DUH FXUUHQWO\ Ă€QDQF-

ing college by themselves, so money issues are a huge deal. Junior Ellen Landsdale is part of this group. She mentioned she is paying for her education by herself. “I am really busy between classes and work. It is really hard,â€? Landsdale said. Similarly, in the survey 65 percent of the students idenWLĂ€HG HFRQRPLFV DV RQH RI WKH major problems facing the United States nowadays. Results from the survey showed that even before coming close to graduation, many students have to put up with economic issues that can turn out to be stressful and affect their schoolwork. KSC sophomore Nick

Martin said time management is crucial for students because, “Almost everyone has to arrange their schedules to be able to work and still complete their school work.� Junior Adam Foster said, “You need to do everything you can to ensure you have a good job after you graduate, so you can pay back for your education. College is becoming more expensive every day.� In fact, in 2009 a budget cut of 49 percent from state funding made Keene State College increase tuition for in-state students. According to KSC Interim President Jay Kahn, next fall the college tuition will increase in 2.8 percent for out-of-state

KSC students donated 69 blood pints MATT SCHWARTZ

EQUINOX STAFF

semester. She said she is impressed with the campus community and its willingness to get involved in community service projects. “The entire campus community always comes together for things such as the blood drive. The nice thing is that we don’t just have students show up. We also get a great deal of faculty, staff, and members of the Keene community who are excited to give blood,� Gagne Cloutier stated. Gagne Cloutier said that at this particular blood drive, 69 full pints of blood were donated to the American

The American Red Cross came to Keene State College on Monday for the spring semester blood drive. The KSC campus hosts the drive twice during the academic year. Many students, faculty, staff, and members of the Keene community came to the Mabel Brown Room from 1 p.m. to 6 p.m. on Feb. 11 not just to donate blood but to help the Red Cross. Senior Alex Rinaldi took time to donate blood. “I’ve donated earlier in the year and am back again today because it really helps people out,� Rinaldi said. Members of KSC’s community service group Circle K came to volunteer at the blood drive. They helped with registration and assisting those who had just given blood. Freshman and Circle K member Katherine Marren took time out of her day to volunteer at this event. “I feel that volunteering is a really important thing to do. I have also donated blood before and I think that it’s a really good cause,� Marren said. BRITTANY MURPHY / EQUINOX STAFF Coordinator of Community Ser- Students donated over 12 double vice at KSC Jessica Gagne Clout- red cells for the Red Cross. ier organizes the blood drive every

  BLOOD  DRIVE,  A3

Index >> Section A: Campus News....1-3 Opinions ............4-5 Student Life......6-10

Section B: A&E..................1-4 Nation/World..5-6 Sports.............7-10

students. However, he said a proposal from governor Maggie Hassan to the legislators may allow public colleges in N.H. to freeze in-state tuition. Reductions in college funding and increases in interest rate lead students to worry about the future. Foster stated, “I work and study at the same time because I want to graduate with the least amount of debt possible.� Foster’s behavior seems logical considering that, according to the Center for American Progress, student debt in America currently exceeds $1 trillion. The center’s website also states that two thirds of the

students who earn four-year bachelor degrees graduate with an average student loan debt of more than $25,000 and one in 10 borrowers owe more than $54,000. A survey compiled by U.S news in 2012 indicated that 68 percent of students in the United States have debt at graduation. Regarding student debt, Kahn said, “One of the college’s top concerns is to make sure that the students are completely aware of the cost of their education and that they fully understand the terms before they enroll or apply for a loan.� Kahn also mentioned that

  JOBS,  A2

With the proliferation of new technologies the world has seen in recent years, human rights activists are bestowed with an array of new and innovative tools to aid them in their efforts to hold violators accountable. Keene State College’s Holocaust and Genocide Awareness Club, Cohen Center for Holocaust and Genocide Studies and the Department of Holocaust and Genocide Studies sponsored a presentation by Amnesty International Advocate Kathryn R. Striffolino in the Mountain View Room of the student center Monday, Feb. 11. Striffolino, who attended Keene High School before studying Political Science and International Affairs at University of New Hampshire, currently serves on Amnesty International’s Crisis Prevention and Response Unit in Washington, D.C. Amnesty International, a global human rights organization, was started in 1961 by lawyer Peter Benenson, who wrote a piece titled “The Forgotten Prisonersâ€? in The Observer newspaper, urging readers to write letters on behalf of two Portuguese students who were jailed for raising their glasses in a toast to freedom. The article was reprinted in newspapers all over the world, a letter writing campaign titled “Appeal for Amnesty 1961â€? arose with support in over a dozen countries and Amnesty International was born. Over a half century later, Amnesty is operating on a global scale with the mission statement to investigate and expose abuses, educate and mobilize the public, and work to protect people wherever truth justice and freedom are denied. Striffolino, who has been with Amnesty for the past Ă€YH \HDUV EULHIHG WKH .HHQH 6WDWH &ROOHJH VWXGHQWV and faculty on the uses she and her organization have EHHQDEOHWRĂ€QGIRUWRGD\¡VWHFKQRORJ\LQWKHFRQWH[WRI human rights. “The possibilities are quite limitless at this point,â€? she said. Striffolino’s team has extensively used satellite LPDJHU\LQPRQLWRULQJHYHU\WKLQJIURPDUPHGFRQĂ LFW situations to housing rights violations and illegal evictions. In 2008 Amnesty launched the “Eyes on Darfur Project,â€? which using geospatial technologies allowed them to document particular human rights violations with hard evidence from space. Striffolino said they weren’t able to get much information about what was going on inside Darfur from traditional means, like people on the ground, because the government of Sudan didn’t want them there and the region’s geography was both masVLYHDQGH[WUHPHO\GLIĂ€FXOWWRWUXGJHWKURXJK7KLVSUHvented Amnesty from gaining enough information to launch advocacy campaigns. According to Striffolino, Amnesty collaborated with the American Association for the Advancement of Science with a grant from the Save Darfur Coalition, and used satellite imagery to identify 12 sites that were at high risk of attack. From there they created a regularly

  HUMAN  RIGHTS,  A2

Clearing out the myths that cloud Keene’s water supply SAM NORTON

A&E EDITOR If we are what we eat then we are what we drink. If it were 1992, before Keene’s Water Treatment Plant became operational, we would be copper. According to the city of Keene’s website, before the Water Treatment Plant went into effect in 1993, the public made complaints of a “metallic taste.� This metallic taste is attributed to the acidic nature of Keene’s water that would be corrosive to the copper water pipes in homes, according to the city’s website. As the water would pass through the pipes, it would dissolve bits of copper, giving it the metallic taste that the city of Keene was once accustomed to. However, this familiar metallic taste is recognized again by the city of Keene. According to Donna Hanscom, assistant public works director, the quality of the water, since the Water Treatment Plant has been operational, has been consistent throughout the years. However, Hanscom said that the city has recently received complaints about the water tasting like metal. “We have had some complaints recently that we are working on right now. Some people in the last three weeks have complained that they smell an unusual smell in their water. We are doing some work on that right now to figure out what is causing that,� Hanscom said, “We tested everything we thought—this is the first time we have had this problem in almost 20 years.� Benjamin Crowder, water treatment facility manager, said that the water was tested for Methylisoborneol (MIB) and Geosmin--while MIB

Top Headlines >>

EMILY FEDORKO / PHOTO EDITOR

Some students say they have detected a metal taste in the water on campus.

was not detected, Crowder said that Geosmin was detected. According to Microbac Laboratory Services’ website, Geosmin is an organic compound that is responsible for the earthy smell often associated with fresh-turned dirt. Geosmin and MIB are compounds that are produced by some species of cyanobacteria (blue-green algae) and actinobacteria (a group of gram positive bacteria). Crowder said that both MIB and Geosmin can cause odors. And the Microbac website reports that Geosmin

- Dirty water, water everywhere? : A4 - No love for Valentine’s Day : A10 - A dance of culture and of people : B1 - Spring sports have sprung : B10

follow us >>

facebook.com/kscequinox @kscequinox

and MIB have extremely low odor thresholds to humans. Crowder said that the amount of Geosmin that was detected is a very low concentration and is not harmful to the public. Dave Gordon of the New Hampshire Department of Environmental Services (NHDES), said “There can be some metals like iron and manganese in the water and if something is in there high enough then there could potentially be health

  WATER,  A3

Contact Us >> Newsroom: 358-2413 Executive Editor: 358-2414 Advertising/Business: 358-2401 Newsroom: Questions? Contact wcyr@keene-equinox.com or rglavey@ keene-equinox.com

Template 022308 JJP


Black NEWS / A2

CAMPUS SAFETY report  log

Week of: Feb. 10 Monday,  Feb.  11 12:25  a.m.  Spaulding  Gym:   Unicco  worker  called  claim-­ ing  there  was  a  strange  bag   outside  one  of  the  doors  of  the   gym. 1:22  a.m.  Owl’s  Nest  5:   Suspicious  motor  vehicle. 1:26  a.m.  Carle  Hall:   Intoxicated  subject.   1:37  a.m.  Carle  Hall:  Second   and  then  third  subject  found  in   residential  hall  intoxicated. 3:42  p.m.  Elliot  Hall:  Keene   Fire  Department  off  with   a  female  having  an  asthma   attack.  Campus  Safety  off  as   well.   4:05  p.m.  Rhodes  Hall:   Campus  Safety  received  a  call   from  a  professor  reporting  an   item  missing  from  his  office.   8:11  p.m.  Carle  Hall:  706   (marijuana). 10:10  p.m.  Butler  Court:   706  (marijuana). Tuesday,  Feb.  12 12:11  a.m.  Pondside  1:   Possession  of  drugs.   Wednesday,  Feb.  13 4:22  p.m.  Owl’s  Nest  9:  706   (marijuana)     5:47  p.m.  Bushnell   Apartments:  Report  of  a   barking  dog  in  room. 11:09  p.m.  Holloway  Hall:   706  (marijuana). Thursday,  Feb.  14 2:54  p.m.  Rhodes  Hall:  Odor   investigation.   4:25  p.m.  Rhodes  Hall:  Odor   investigation.   5:43  p.m.  Holloway  Hall:   Medical  emergency.   11:52  p.m.  Tisdale   Apartments:  Student  vomit-­ ing. Friday,  Feb.  15 10:22  a.m.  Appian  Way:   Blue  light  activation.  

THURSDAY, FEB. 21, 2013

[ Keene-­Equinox.com ]

Is Canvas the new Blackboard? BRIAN CLEMMENSON

EQUINOX STAFF For around a decade Blackboard has been the Learning Management System at KSC. However, during that time with Blackboard the Learning Managment System (LMS) industry has been changing dramatically. Given that, KSC is currently looking at an alternative LMS and it’s called Canvas. According to Jenny Darrow, director of Academic Technology, Canvas is currently a pilot program being used by certain students and faculty opposed to Blackboard. Currently, there are about 400 students enrolled in the program with 12 faculty members piloting the program for the spring semester. Darrow said, “It includes faculty from all three of the schools, two faculty members from each.â€? Darrow added, that a few IQL professors are using the technology as well as including adjunct faculty. The Mason Library is also included; staff members are members of Academic Steering Technology Committee. According to the KSC Academic Technology website, “Canvas integrates rich media into its core-students and faculty can create PHGLD FRQWHQW RQ WKH Ă \ ZLWKRXW KDYLQJ WR leave the Canvas environment.â€? It is also worth noting Canvas is available on iOS and Android devices, an option that is not available with Blackboard. In addition functions like the Speed Grader, feedback tools, and easy Peer Grading support reduce the amount of time faculty need to invest in routine tasks, freeing up time for other higherimpact endeavors. In addition Darrow stated, “It is very student-based, very student friendly.â€? Some of the features are that students can have a text message sent to their phone if they wanted to. Something else that Darrow promoted about Canvas was given a gold star rating from the National Federation for the Blind. Darrow added, “I think it’s very important for students and faculty who are using screen readers to be able to navigate their page.â€? According to the IT Department, this is DOVR WKH Ă€UVW WLPH WKDW .6& KDV GRQH DQ LQ depth look at other learning management systems. Even if the pilot is a success based on reviews the migration will not happen that quickly, according to Darrow. So far Darrow said she has gotten some feedback on the program and some faculty and students do in fact like the program.

+80$1 5,*+76 (Cont. from A1)

updated interactive platform to work as a “global neighborhood watch,� as she put it. The website also offered users links to send messages directly to the government of Sudan to inform them that people were well aware of what they were doing. Striffolino said Amnesty performed an impact assessment of the project and determined the website had a deterrent effect on attacks to those particular communities. “We were able to achieve I would say a measurable amount of human rights impact using these types of technologies without having unfettered physical access to the ground,� Striffolino said. “I would say this site and this project was really a game changer for the global human rights community.� Her team is currently using satellite technology to monitor and document abuses by the Assad Regime in Syria. “We really feel like as a part of our duty it’s our job to be telling the stories of those most affected by some of the most egregious crimes,� Striffolino said. Holocaust and Genocide Studies Professor Dr. James E. Waller

PHOTO ILLUSTRATION

“Canvas is visually appealing and it is pretty simple to use.� -­-­CELINE PERRON THEATER AND DANCE PROFESSOR

Celine Perron, a theatre and dance professor, said she really likes the program. Perron said, “It is visually appealing and it is pretty simple to use. The part that I like the most about it is the outcome section and assignment section. I think it works well.â€? Perron also uses Blackboard. Perron said WKDW ZKHQ %ODFNERDUG Ă€UVW FDPH WR FDPSXV WKDW VKH ZDV RQ WKH Ă€UVW WHDP WKDW WULHG LW Perron added, “The difference with Blackboard and Canvas is it feels like Canvas is

said with these technologies the world can no longer use a lack of information as an excuse for inaction. “So now the issue is going to be can we take that information and translate it into action,â€? Waller said. Although most of Striffolino’s work is technology oriented, she admitted the newest tools aren’t always the most effective ones. Late last year Amnesty heavily relied upon boots on the ground information gathering in the DRC (Democratic Republic of the Congo), where the M23, an armed rebel group, was attacking villages. She said the area was prone to thunderstorms and resulted in about 90 percent of the images they received from satellites being obscured by FORXGV +RZHYHU WKHLU Ă€HOG WHDP was able to physically gain access to most areas and ended up gathering a lot of rich documentation which helped them accurately tell the stories of the refugees. Striffolino said the types of data they’re collecting have been used in environmental court cases for years, but are now just starting to be utilized in human rights cases as well. She said Amnesty and other non-governmental organizations are training prosecutors on how to involve this type of evidence, particularly in international court. Striffolino said she wasn’t fully

PRUHĂ H[LEOHÂľ Perron said, “I had some enthusiastic responses.â€? Some of the students seemed to have knowledge of the program and Canvas wasn’t foreign to them, she added. If Perron had a choice to use a program she said, “I guess my gut reaction Canvas ‌ I’m enjoying it.â€? Senior Alisa Santangelo is using the program in her IQL class and said she likes the new program. “I like that it’s calendar based.

exposed to the work of Amnesty until she was looking for internships and was accepted by the organization fresh out of UNH. “That’s why I really want to get some momentum going for student groups both at Keene State [College] and at UNH in the next few months because I feel like so many students would be interested in the types of issues Amnesty campaigns for, and there’s plenty of action opportunities for them as well,� she said. Waller said he plans to meet with two or three students in the coming days who are interested in starting an Amnesty International chapter at KSC. He said the Holocaust and Genocide Awareness Club “has kind of stretched itself to try and cover a lot of human rights issues,� and if there were an Amnesty club as well, the Holocaust and Genocide Awareness Club could refocus its attention on raising awareness on cases of genocide. Holocaust and Genocide Awareness Club Treasurer Molly Palmer said the group will continue to bring events like Striffolino’s presentation to KSC, and plans to hold a Day of Silence for the people of Uganda sometime in April. Eric Walker can be contacted at ewalker@keene-equinox.com

Saturday,  Feb.  16.   12:53  a.m  Randall  Hall:     Odor  investigation.  Public  uri-­ nation.  Subject  ran  away.   3:25  a.m  Monadnock  Hall:     Odor  investigation.  Public  uri-­ nation.  Subject  ran  away.   8:25  a.m  Elliot  Hall:  Officer   checking  on  a  911  call  from  a   classroom.  Odor  investigation. Sunday,  Feb.  17 12:44  a.m.  Off  campus:   Assault  off  campus.  

BY EMILY FEDORKO / PHOTO EDITOR

Canvas is a current pilot program being used by certain faculty members opposed to Blackboard, used at KSC for the past ten years.

CONTRIBUTED PHOTO / COHEN CENTER FOR HOLOCAUST AND GENOCIDE STUDIES

Kathryn Striffolino from Amnesty International spoke at the Mountain View Room on Monday, Feb. 11.

The modules show what is coming up in their class in weeks ahead.â€? At the end of the program the students and faculty will be given a survey on whether or not they liked the program. Darrow said that it is going to be important that students JLYH GHWDLOV DQG VSHFLĂ€FV RQ WKH SURJUDP Darrow stated, “If you like it explain what you like and if dislike explain why and what you dislike. It might be a failure of Canvas or it might be a little coaching with the instructor to make things work better.â€? Feedback is going to be crucial as the contract with Blackboard is soon set to expire and the result of this pilot will help decide possibly what academic technology KSC will use going forward, Darrow said.

-2%6

(Cont. from A1)

around 90 percent of Keene State College students receive aid to help cover for their education expenses. However, many students have words like “tuitionâ€? and “debtâ€? tattooed on their brains. Like Foster, junior Scott Douglas said he is concerned about his student debt. Douglas said he is currently paying money back for student loans and will be paying back more when he graduates. “I have to keep up with the payments. It is very hard,â€? he said. $OOVXUYH\HGVHQLRUVVDLGĂ€QGing a stable job after college is an essential aspect and most younger students agreed that tuition costs are a priority issue in their lives. Freshman Kyla Jones said tuition is one of her major concerns since she has to work to cover her education expenses. Even though she hasn’t decided what major she wants to complete while in KSC, she said she knows she needs to earn money to pay for being here. Seniors Danielle Clark and Chris Ruble agreed that as they come closer and closer to graduation, they become more conFHUQHGDERXWĂ€QGLQJDMRE Jill Murphy, who graduated from Keene State College last year, said, “It is very scary to graduate nowadays and not have a job, especially after all the money you have spent to be able to come to college. It just doesn’t seem logical.â€? Clark explained students’ preoccupation comes along with how the media presents the economic situation of the Unites States. “All you hear is that unemployment is going up and that the country is in debt,â€? Clark said. According to the Bureau of Labor Statistics, unemployment in the U.S went up from 7.8 percent in December 2012 to 7.9 percent in January 2013. The Bureau stated that the current employment rate is higher than the averaged unemployment rate between 1948 and 2013, which marked 5.81 percent. Nevertheless, the most recent report from the department of Institutional Research in Keene

Brian Clemmenson can be contacted at bclemmenson@keene-equinox.com State College (2011) indicates that the job rate upon graduation is 87 percent. Different departments in Keene State College are constantly working to keep the statistics up and bring students good news regarding job opportunities and career projection. Maryann Lindberg, from the Alumni Center said her department works with different employers to build career networks for future KSC graduates. The Academic and Career $GYLVLQJ 2IĂ€FH $&$  LQ WKH FROlege has put on several initiatives to help the future graduates get rid of the pressure and be prepared to enter the professional Ă€HOG Academic and Career Advising Associate Director Kelly *UDKDP VDLG KHU RIĂ€FH WRJHWKHU with other departments in the college will be sponsoring three job fairs this semester. Graham said, “We run a workshop to help students make the best out of the fairs. Also, the staff offers one-on-one meetings to every student to help them work on their resumes, write cover letters, prepare for interviews.â€? Additionally, Graham noted the academic and career advising’s website has a link named “Job Wise,â€? where students can search for job opportunities as well as internship opportunities. Senior AJ Mucciano said it is crucial to present employers a good resume. Mucciano said as his graduDWLRQ GDWH JHWV FORVH KH Ă€QGV himself constantly updating his CV, building relationships in the SURIHVVLRQDO Ă€HOG DQG VHDUFKLQJ employer’s websites. He said he is worried about economics issues as minimal wage. Mucciano concluded saying, “Everything costs more every day. Minimal wage should increase too. I am a starving college student and I really need a job.â€? Karina Barriga Albring can be contacted at kbarriga@keene-equinox.com

Template 022308 JJP


Cyan Magenta Yellow Black THURSDAY, FEB. 21, 2013

NEWS / A3

[ Keene-­Equinox.com ]

STUDENT ASSEMBLY

%/22''5,9( (Cont. from A1)

Red Cross. In addition to the full pints, twelve double red cells were also donated. According to the American Red Cross, a double red cell donation is similar to a whole blood donation, except a special machine is used to allow one to safely donate two units of red blood cells during a donation while returning one’s plasma and platelets back. These red blood cells are the most frequently used blood component and are needed by almost every type of patient requiring transfusion. However, not everyone can donate blood. The American Red Cross has compiled a list of requirements one must meet before giving blood. Things such as age, weight, lifestyle, certain medical issues and even where one travels can prohibit a person from donating. The two most remarkable requirements are to be older than 17 years old (or 16 years old presenting a signed parental consent) and to weigh more than 110 pounds. According to newenglandblood.org, OHVV WKDQ ÀYH SHUFHQW RI WKH QDWLRQDO population gives blood supporting the other 95 percent. In addition, 1,400 pints of blood must be collected every working day in Maine, Massachusetts, New Hampshire and Vermont to meet patient needs. According to Jessica Gagne Cloutier, the goal is to donate 100 or more pints of blood for each drive.

Candidates for college president visiting this spring KARINA BARRIGA ALBRING

NEWS EDITOR - Former Student Body President and current member of the Presidential Search Committee Katelyn Williams announced the presidential candidates will be on campus before spring break. - Williams said the candidates will have meetings with certain groups of students, “an athlete, some from student government, a freshman, a sophomore,” however, she said there will not be open forums for the student body to attend. - Williams stated that “the candidates’ cover letters and resumes will be available in the library,” and will be accessible for all students.

BRITTANY MURPHY / EQUINOX STAFF Matt Schwartz can be contacted at mschwartz@keene-equinox.com KSC students donated blood for the American Red Cross on Monday, Feb. 11 in the Mabel Brown Room. The Community Service Office

organized the event.

:$7(5 (Cont. from A1)

effects, but there are drinking water standards for taste and odor which say that the water can have a metallic taste, but it’s not a health risk, it is an aesthetic taste.” Junior Molly Alderman-Person said that when she first arrived at Keene State College she thought the water tasted like metal. “I’m from New Jersey and the water tastes completely different here,” Alderman-Person said. The metallic taste of the water has prompted Alderman-Person to use Brita filters to help remove the taste. Crowder explained that because the water sits overnight in copper pipes, the water becomes stagnant. To avoid this, Crowder said that students should flush out their water in order to remove the metal taste. According to the 2012 Water Quality Report, the city of Keene water system had a routine water sample test positive for

Total Coliform in September of 2011. Total Coliform is the starting point for determining the biological quality of drinking water, according to the NHDES. This test is considered to be an indicator on whether or not there are disease organisms present in the water, the NHDES states. These organisms are found in soil and they do not involve a health risk, NHDES states. When traces of Total Coliform were found in Keene’s water system, the Water Quality Report states that a repeat sample was collected at the same location; however, no source of bacteria was detected. But according to a new rule that was implemented in December of 2009, if a water system possesses one positive Total Coliform test, the city must collect bacteria samples from all active sources including groundwater sources. However, according to the 2012 Water Quality Report, the city did

EMMA CONTIC / GRAPHICS EDITOR

not collect a bacteria sample from its active groundwater sources, which violates the sampling requirements. Each month, the city completes more than 70 bacteria tests at more than 30 sites around the city. Annually, the city tests a list of other possible contaminants in each of the water sources to ensure that no pollutants are present, according to the city of Keene’s website. Hanscom said that the city of Keene has two different water sources. “Most of our water comes from surface water—it’s a big reservoir up in Roxbury, [N.H.]” she said. However, in order to ensure that this water is safe for the public to drink, Hanscom said that they not only process the water through the city of Keene’s Water Treatment Plant, but the city is also required to follow the Environmental Protection Agency’s (EPA) regulations. “They regulate what you have to do to it before you can sell to people and they regulate what you have to remove from it and how clean it has to be,” Hanscom explained. Hanscom said that the first step in regulating the water is removing tannins. “Sometimes when you look at a lake or reservoir it has a little bit of color to it—almost like tea water— those are called tannins and they can give water taste and odor and they are a carbon-based material,” she said. According to watersystemscouncil. org, tannins are not a health problem, but rather an aesthetic problem. This natural organic material is a byproduct of nature’s fermentation process that causes the water to have a tangy or tart aftertaste. Hanscom said that in addition to removing tannins from the water supply, the city adds chlorine to the water. “Part of what we are required to do is add chlorine because there are also bacteria in surface water. It’s naturally occurring bacteria. Some of it can make you sick; some of it is bearable and won’t make you sick,” Hanscom stated. Hanscom explained that chlorine is an unstable compound and can chemically react with material that grows on the insides of the pipes that carry our water supply. As a result, more chlorine is added to the water

SOUNDOFF Eric Mealy Freshman Music

“It tastes really bad. It tastes like iron.”

Bryce Warren Junior Safety

“I don’t think it is bad. It’s just water.”

“The water is still safe to drink; we test it all the time for bacteria to assure that it is still safe for drinking.” -­-­DONNA HANSCOM ASSISTANT PUBLIC WORK DIRECTOR

plant to ensure that there is still chlorine in our water by the time it reaches the edges of the system. “That’s why some places are going to smell it more than others, because it spends more time in the system,” Hanscom said. Gordon said, “What usually happens is some of the chlorine reacts with small dips of plant matter and it forms chemicals called Trihalomethanes [THMS] and if they are high enough then they can have health effects but there is a drinking water standard for THM of 80 parts per billion and if it goes above that then they would have to notify the public.” Crowder said that the chlorine levels present in Keene’s water supply are low. At the college, the chlorine levels would be considered a one, and these levels can be as high as a four and still be safe for drinking, according to Crowder. However, the city of Keene not only received violations for Total Coliform, they also violated a drinking water standard in 2011. The water supply is routinely monitored for turbidity, which is the cloudiness of the water. In 2011, there were 4.22 Nephelometric Turbidity Units [NTU] detected the water. NTU is a measurement of clarity and an excess of 5 NTU is noticeable to the average person, according to the 2012 Water Quality Report. But the 2012 report attributes the amount of turbidity to soil runoff. The report states that treated water from the Water Treatment Plant filter was released into the clearwell tank at a rapid rate, which created a momentary breakthrough of particles, which sent the water to the online turbidity analyzer that recorded the exceeding amount of turbidity. But turbidity is considered to be an aesthetic rather than a health concern. Junior Kelly Marchione said that

she believes the water smells and tastes like chlorine on campus. Marchione stated that the quality of the water off campus was better in comparison to on campus. However, students living on campus will now have access to more sources from which they can get their water. According to Jim Carley, associate director of residential life and housing, new water fountains are now available in the residential buildings— thus far, Holloway and Butler Court all have the new water fountains— Pondside III, Carle Hall and Huntress are all in progress of receiving this new feature. Carley said that these new water fountains were installed as a way for the campus to be more sustainable, and were not installed due to complaints of the water quality. But these new water fountains possess more filters, which will improve the quality of the water that is provided to students, Carley said. Despite the violations in previous years’ Water Quality reports, Hanscom assures that the water in Keene is safe to drink. Crowder said that the Water Treatment Plant is aware of the problem and that they are taking the proper steps to solve it. Hanscom said, “The water is still safe to drink; we test it all the time for bacteria to assure that it is still safe for drinking.” Sam Norton can be contacted at snorton@keene-equinox.com To see Multimedia Director Kateland Ditting’s piece about the new fountains on campus visit www. keene-equinox.com To read more about the water in Keene, see the Equinox editorial on page A4

Assembly members approved the amount of $ 9,069.00 for alternative spring break trips. - Almost 100 students will travel to seven different locations to do social work over spring break. - The students will be working with homeless people, in hospitals, doing environmental clean up or working with animals. -A week long trip will cost participants $450 and a weekend trip will cost $75. - Jessica Gagne Cloutier, director of Community Services at KSC said that, “each student will be doing 30-40 hours of community service during the trip.” - Melinda Treadwell from WKH UHJLVWHU·V RIÀFH DQQRXQFHG a new registration system will be effective in March. - The system will intend to help students sequence better the courses they need to take and will make more seats available for students that imminently need to take certain courses. - Treadwell said, “We have to do a better job to help students decide what courses to take and when to take them. It is an institutional concern.” - The Ski and Snowboard club received $ 750 for a trip to Stratton Mountain. The organization originally requested $1,500. - Most of the Ski and Snowboard members are freshmen. Around 40 will be going on the trip. -The club will be traveling to Stratton Mountain on March 22. Karina Barriga Albring can be contacted at kbarriga@keene-equinox.com.

“What do  you  think  about  the  water  in   Keene?”  

Haley Erdbrink Freshman Undecided

“It tastes really bad. I prefer filtered water.”

Chris Kouroyen Sophomore Education and Psychology

“It is kind of disgusting, highly unfiltered.”

Compiled by: Kelsey  Gutzmann     Equinox  Staff

Melissa McGibney Freshman Criminal Justice

“‘I think it is good quality water. It seems clear.”

Template 022308 JJP


Opinions Black

229 Main Street Keene, N.H. 03435 wcyr@keene-equinox.com Circulation 2,500 Newsroom: 603-358-2413 Ads/Bus. Office: 603-358-2401 Executive Editor: 603-358-2414 Fax: 603-358-2407

OPINIONS / A4

Mission... The Equinox exists to promote the free flow of information, to protect the First Amendment, to stimulate high standards in the practice of journalism and to foster excellence amongst student journalists.

[Keene-­Equinox.com]

EDITORIAL

THURSDAY, FEB. 21, 2013

I need to drink this but I’m not sure if I want to

You turn the faucet on in your kitchen and in seconds you FDQVPHOOWKHFKORULQH2USHUKDSVWKHZDWHUĂ€OOV\RXUJODVV without making you feel like you’re at Spaulding Gymnasium swimming pool, but somehow has a metallic taste to it. This scenario is quite familiar to many off-campus and oncampus students at Keene State College. Whether or not your water smells like chlorine or has a metallic taste to it depends on where you live in Keene. And DOWKRXJK RIĂ€FLDOV IURP WKH .HHQH :DWHU 7UHDWPHQW 3ODQW have assured us that the water in Keene is safe to drink, we still wonder, ‘What’s with that taste and smell?’ The water that runs to Keene homes is nestled in a reservoir in Roxbury, N.H. Since surface water naturally breeds bacteria, chlorine is introduced to the water to make it clean enough for drinking. But while the water waits to be poured into your glass, more bacteria has the potential to grow in the copper pipes underground. Because of this, Associate Public Works Director Donna Hanscom said more chlorine is added to the water at the plant to make sure the water is safe by the time it reaches your sink. One side effect of this precaution is that the more the water stays in the system before someone drinks it, the more likely it is to taste a little metallic or smell like chlorine. 0DQ\RIIFDPSXVVWXGHQWVFKRRVHWREX\SRUWDEOHZDWHUĂ€Oters that can eliminate these displeasing side effects without too much cost. But why can’t this task be accomplished before it reaches Keene homes, and why didn’t this problem occur say, in the summer? Since the Water Treatment Plant has received so many complaints about Keene water quality in the past weeks, the Keene plant has sent off water samples to be tested since the Public Works team is stumped as to why the water has a more metallic-y taste or chlorine smell than it normally would from sitting in the reservoir. But remember this: Hanscom and her associates regularly test Keene water 70 times a month, and currently the water is safe to drink. We can continue to complain about the smell STAFF COMMENTARY or taste of our water, or we can do something about it. OnFDPSXVVWXGHQWVKDYHWKHRSWLRQWRĂ€OOXSWKHLUFXSRUZDWHU ERWWOHDWVHYHUDOĂ€OWHUHGZDWHUIRXQWDLQVWKDWFDQEHIRXQGLQ In a glass case on his bureau my father sports a DL-44 blaster, a limthe Zorn Dining Commons, the Spaulding Gymnasium, the ited edition replica of the weapon Han Solo used to dispatch Greedo from L.P. Young Student Center, and several residence halls. across a dusty cantina table in “Star Wars IV: A New Hope.â€? Tucked away 2IIFDPSXVVWXGHQWVFDQEX\KDQGKHOGZDWHUĂ€OWHUVVHOI LQKLVFORVHWDUHD-HGLUREHDQGDĂ€EHUJODVVOLJKWVDEHU,I\RXZHUHWRZDON Ă€OWHULQJZDWHUERWWOHVRUĂ€OOXSRQFDPSXV(LWKHUZD\WKHUH into my parent’s living room you might notice in the corner a little droid named R2-D2 who faithfully accompanied Luke Skywalker on all of his are ways to get the cleanest water in town without having to adventures. All of these things illustrate one simple fact: I never had a only drink water that smells like a pool. choice; I was always going to love Star Wars.

EMMA CONTIC / GRAPHICS EDITOR

Do not judge the new ‘Star Wars’ until it is fully armed and operational

To contact the Equinox, e-mail wcyr@keene-equinox.com RYAN GLAVEY Administrative Executive Editor WHITNEY CYR Managing Executive Editor

NEWS EDITOR

COPY EDITORS

Karina Barriga Albring

Jess Lulka Sonya Cheney

OPINIONS EDITOR Lindsey Arceci

MULTIMEDIA DIRECTOR

STUDENT LIFE EDITOR

Kateland Dittig

Julie Conlon

BUSINESS MANAGER

A&E EDITOR

Andrew Ogden

Sam Norton

WEBMASTER

SPORTS EDITOR Michelle Berthiaume

PHOTO EDITOR Emily Fedorko

Corey Austin

GRAPHICS EDITOR Emma Contic

SOCIAL MEDIA DIRECTOR Chelsey Puza

FACULTY ADVISER Rodger Martin, Journalism faculty (rmartin1@keene.edu) and Julio DelSesto, Journalism faculty (jdelsesto@keene.edu)

Ads Manager: Alicia Ferraiuolo (603-358-2401) Equinox Staff: Augustus Stahl, Brian Rabadeau, Kattey Ortiz, Zach Pearson, Ben Horowitz, Brittany Ballantyne, Morgan Markley, Victoria Ronan, Stephen Trinkwald, Rebecca Marsh, Matt Schwartz, Pam Bump, Rebecca Farr, 'HDQQD&DUXVR:HV6HUDĂ€QH$OOLVRQ%DNHU%ULDQ6FKQHH Dalton Charest, Lyndsay Krisel

Copyright Š 2012: All rights reserved Reproduction of The Equinox in whole or part in any form written, broadcast or electronic without written permission of The Equinox is prohibited. The Equinox is published each Thursday during the academic year by the editorial board of The Equinox, which is elected every spring by the members of the editorial board and acts as joint publisher of the paper. The Equinox serves as the voice of the students of Keene State College and does not necessarily reflect the opinions of the faculty, the staff and/or the administration. One copy of The Equinox is available free each week. Anyone removing papers in bulk will be prosecuted on theft charges to the fullest extent of the law. Inserting items into printed copies of The Equinox is considered theft of services and will result in prosecution.

Should we be worried that Lucas won’t be back in the director’s chair? We should be relieved. Everyone has their favorite movie but “Empire Strikes Backâ€? is most widely considered the best of the original trilogy, which Lucas didn’t direct, nor did he direct “Return of the Jedi.â€? Only for “A New Hopeâ€? was Lucas in the director’s chair but that was back when he had a studio reining him in. The man’s a creative genius but given total freedom who knows if we would have the Star Wars we know and love. J.J. Abrams has proven that he’s a more than capable director. He’s also I was born in 1989, just six years after Darth Vader drew his last raspy been given some impressive help in drafting the screenplay. Michael Arndt, breath and the Ewoks celebrated their victory on the second moon of Endor. the writer of “Toy Story 3,â€? and Lawrence Kasdan, the writer of “Empire “Return of the Jediâ€? was released into theaters in 1983, wrapping up an Strikes Back,â€? “Return of the Jedi,â€? and “Raiders of the Lost Ark.â€? If these unbelievable saga that started in 1977 with “A New Hope.â€? guys can’t concoct a quality Star Wars adventure then I don’t know who I know I’m not the only one who can tell this story. Thousands of people can. Maybe my optimism comes from my experience in Star Wars comic grew up loving Star Wars. Jedi has become a commonly written-in religion books. These are essentially detailed storyboards ranging from the further on surveys around the world. A recent petition to “Secure resources and exploits of beloved characters like Han and Chewie, to the adventures of funding, and begin construction of a Death Star by 2015â€? received 34,435 brand new characters. These stories are worth telling. signatures. The greatest thing George Lucas did with his life wasn’t the saga of pheThat’s why we all knew this day would come -- “Star Wars: Episode VII.â€? QRPHQDOVFLĂ€EORFNEXVWHUV,WZDVQ¡WWKHODFNOXVWHUSUHTXHOWULORJ\WKDWIROThe announcement has been met with a bevy of mixed reactions. Should lowed. It was the imagination to birth an entire universe. One centuries old, ZHEHZRUULHG"2YHUMR\HG"7HUULĂ€HG",I\RXDVNPHZHVKRXOGEHKRSHIXO spanning thousands of lightyears and hundreds of planets. A place full of And trust me, that isn’t the same thing as getting our hopes up. If those pre- FRQĂ LFWURPDQFHDQGDGYHQWXUH quels taught us anything, it’s not to get our hopes up. Do we need more Star Wars movies? No. Of course not. We have already Still, whether we liked the prequels or not, did they take away from the ridden alongside Luke Skywalker as he detonated the Death Star, learned RULJLQDO WULORJ\" 'HVSLWH WKHLU Ă DZV WKH SUHTXHOV KDYH JLYHQ XV D ULFKHU the truth about his father, and became a Jedi Knight. That will never change, sense of the backstory leading into “A New Hope.â€? and for me it will always be enough. We saw the Jedi fall and the Empire rise to power. We saw Anakin transBut the universe that George Lucas created will endure long after we form from a hero into the iconic villain we already knew and loved. The are gone. There will always be more Star Wars movies. If you ask me, that’s prequels only wasted the potential to tell those stories more effectively. nothing to complain about. Regardless of the prequels or any future installments, our original three Star Wars movies will still be there beckoning us back to the galaxy we all Zach Pearson can be contacted at fell in love with. zpearson@keene-equinox.com

Editorial Policy                   The  Equinox  is  a  designated  public  forum.  Student  editors  

have  full  editorial  control  over  the  entire  content  of  the  paper.     All  articles  and  opinion  pieces  are  assigned,  written  and  edited   by  students  without  prior  review  by  administrators,  faculty  or   staff.              The  Equinox  is  published  Thursdays  during  the  academic   year  with  dates  immediately  preceding  and  following  holidays   omitted.    The  advertising  deadline  is  5  p.m.  on  the  Friday   prior  to  publication.    The  Equinox  reserves  the  right  to  refuse   advertising  for  any  reason.    Advertising  is  not  accepted  until  it   appears  in  the  paper.              Letters  to  the  editor  must  be  written  exclusively  to  The   Equinox  and  are  due  by  noon  on  the  Friday  prior  to  publishing.     All  letters  must  include  name  and  phone  number  for  verification.     The  Equinox  reserves  the  right  to  edit  for  style  and  length,  and   refuse  any  letters  to  the  editor.    For  clarification  and  additional   information  on  any  above  policies  call  358-­2414.          The  Equinox  business  office  is  open  Monday-­Friday  from  11   a.m.  to  1:30  p.m.

Template 022308 JJP


Black THURSDAY, FEB. 21, 2013

[Keene-­Equinox.com]

STAFF COMMENTARY

OPINIONS / A5

Wrestling tapped out of Olympic ring The recent decision by the International Olympic Committee (IOC) is the last straw for this once loyal Olympic audience member. Earlier last week, it was announced that the sport of wrestling will be terminated from the Olympic Games starting in 2020 to make room for golf and rugby. Even if I had not wrestled in high school, I would still be spitting mad at the decision. When the OlymSLF*DPHVĂ€UVWDUULYHGRQWKHVFHQHLQ%&XQGHUD happy Greek sun, wrestling was there, highly regarded for its demonstration of strength. But sports of tradition and antiquity mean nothing to the IOC, which laughs at the notion of competition for the sake of competition. The spirit of athleticism, a once honored creed of the Olympics, has been dead for a long time and the IOC has been kicking its lifeless corpse ever since. )RUJHGLQWKHĂ DPHVRIFRPSHWLWLRQDQGSULGHWKH Olympics has been the ultimate spectacle of international contest. But I have to say the last Olympics was lame. I don’t recall seeing anything other than swimming and gymnastics. Sure, I could have gotten up at three in the morning to watch tae kwan do, but I am usually busy sleeping. What really bothered me was the celebrity status the athletes gained. Ryan Lochte, one of the best America had to offer in swimming, ended up on the red carpet at the premiere of movie events and roof-top pool parties with Prince

Harry. There was a time when all this commercialism and VHQVDWLRQDOL]LQJZDVDYRLGHGDVPXFKDVSRVVLEOHLQDQ attempt to keep the Olympics pure, untainted and as genuine as possible. In the 1932 games, Finnish long-distance runner Paavo Nurmi was rejected participation in the games because there were concerns about his status as an amateur, which challenged the rule that professionals were not allowed to compete. But since the advent of professionals in the Olympics, the integrity of the games has taken a nose dive. Any wrestler who has ever aspired for greatness has aspired to win a gold medal in the Olympics. The pinnacle of achievement in the world of wrestling is to win an Olympic medal. The same cannot be said for other sports. 7DNHEDVNHWEDOOIRULQVWDQFH'RQ¡WJHWPHZURQJ, am a ‘90s baby and I love the original dream team as much as the next guy, but ask any player in the NBA LIKHZRXOGUDWKHUKDYHDULQJRQKLVĂ€QJHURUDPHGDO around his neck and he will choose the former. Some of the greatest basketball players opt out of the Olympic run because who wants to spend an otherwise relaxing summer after a rigorous NBA season to go on and represent his or her country? And where is the excitement in basketball in the Olympics? The world over knows which country’s team is FRPLQJKRPHWRDWLFNHUWDSHSDUDGH 'RWKH\VWLOOKDYH

those?): The U.S. of A. Wrestling is a different story. If you look at the PHGDOVDFFXPXODWHGRYHUWKH\HDUV\RXZLOOÀQGWKDW WKHQDWLRQVZKRWDNHWRSSUL]HDUHH[WUHPHO\YDULHG In most cases, whatever particular weight class you H[DPLQH RYHU WKH ODVW VHYHUDO 2O\PSLFV \RX ZLOO ÀQG a diverse collection of nationalities that took a spot on the podium. I believe it has something to do with wrestling being ubiquitous, presiding in some form or fashion in almost every culture all over the world. Anyone can do wrestling. One doesn’t need any equipment except for maybe a mat, which even that is not always necessary. That is why wrestling is truly an underdog sport. There have been numerous stories of wide-eyed youths in bleak situations, who amid their down-andout life situation, wrestled their way to Olympic pride, acting as a fountain of inspiration for their fellow countrymen. Stories about going from third-world slums to basking in the glory of international respect are not all that uncommon. And who can forget the story of Rulon Gardner, the American home grown son who grew up on a Wyoming farm upsetting Aleksandr Karelin, the monster from Russia who many considered to be the greatest wrestler ever, going undefeated for 13 years, and not having been scored on in ten. It was the feel good story of the

2000 Olympics. What was even more perplexing about the IOC’s decision to end a sport so entwined with the history of the Olympics was the fact it kept sports that would have been much more of a practical choice to relinquish from the games. For the sake of time, I won’t even go on about pingSRQJFDQRHLQJND\DNLQJRUV\QFKURQL]HGVZLPPLQJ but I will mention the modern pentathlon, a sport whose popularity is limited to Europe, which, by the way, is the continent a handful of the members who constitute the executive committee of the IOC are from. 7REHDSHQWDWKORQDWKOHWH\RXPXVWEHSURÀFLHQWLQ pistol shooting, fencing, freestyle swimming, running and equestrian. Sounds to me like you must be pretty rich too since pistols, horses and fencing gear don’t come cheap. Wrestling was not the only sport I did in high school, but it was the only sport that gave me a totally unique brand of pride when I won a match. When one wins a match, it is purely an individual effort, and the credit, or the blame, can only rest at one person’s feet. It makes getting your hand raised by the referee so much sweeter at the end. For the sake of the athletes, I hope the IOC reconsiders its decision. Ben Horowitz can be contacted at bhorowitz@keene-equinox.com

STAFF COMMENTARY

It feels like the end of the world, but youâ&#x20AC;&#x2122;ll be fine ´*HWRXWÂľ+HUYRLFHDOPRVWTXLYHUVZKHQVKHVD\VLWDQG\RXUĂ&#x20AC;Qgers mimic her quake. You pick up your keys off the table, phone, wallet. You're numb. You didn't mean to. You move, hands automatically putting on your coat. Before you know it, you've already reached the door. Where were you going? As if she heard your thoughts, you hear the same shaking voice, â&#x20AC;&#x153;Stay with them. I don't care. Just not here.â&#x20AC;? Her voice cracks slightly, and she turns to the wall to hide it. It's over. You're sure to close the door softly. See, the thing is, you've only been dating for two months ... And this is the scene of your break up. How did it come to this? Your ex-girlfriend's lip quivering, your ex-boyfriend pacing around the room, furious. Everyone is taking things too seriously. Unless youâ&#x20AC;&#x2122;re sure that youâ&#x20AC;&#x2122;re going to spend the rest of your life with this person, you need to relax. Spending WLPHWRJHWKHULVĂ&#x20AC;QH,W¡VZKHQWKHUHODWLRQVKLSWXUQVWRDSROLFHVWDWHWKDW thereâ&#x20AC;&#x2122;s trouble. How many times have you seen one, two friends or a roommate, start dating? Now, think about how little you've seen them since they've started. Within a few days they were spending every weekend night together, a week later they're sleeping over during the week, even when one of them has an 8 a.m. You see less and less of them as they see more and more of HDFKRWKHU$QGKRQHVWO\"7KDW VRND\:H UHLQFROOHJH:H UHĂ&#x20AC;JXULQJRXW what we're doing with our lives and with whom we'll face all the challenges. So, you let your friends have fun. They're happy ... right? Then all of a sudden one of them is in your apartment telling you they want to end it. They never see friends anymore; it's always the relationship. They're miserable. And it's a messy break up. People pick sides, insults are Ă XQJOLNHĂ&#x20AC;UHEDOOVVLQJHLQJDQGVFRUFKLQJ<RXEHFRPHDQDPEDVVDGRUWR the ex, getting old sweatshirts and backpacks. How did this get so serious? When did the regulations start, the quota of time spent together? Okay, maybe they stay together. Maybe they make it to six months. They go to a fancy restaurant, buy each other much too expensive gifts. Then they go home, to the apartment all of you share and do it, right on your couch. Then after the tremors of ecstasy cease, naked under the comforter you accidentally left out, one whispers to the other â&#x20AC;&#x153;I love you.â&#x20AC;? They probably thought about this a very long time. But maybe not. This is the next step in a relationship. This is setting into the long haul. This is where most people, myself included, have found themselves at one point or another, asking the question, am I actually considering spending my life with this person? This is starting to get serious. This can affect someone for years. You have to know when itâ&#x20AC;&#x2122;s getting to be too much, because when it gets to that level, there isnâ&#x20AC;&#x2122;t really going back. Unless youâ&#x20AC;&#x2122;re sure of your convictions, taking things too seriously can ruin it all. When regulations are put into place, when you start acting like a married couple, things start to go wrong. :H UH LQ FROOHJH LI ZH Ă&#x20AC;QG RXU VRXO PDWHV DZHVRPH LI QRW ZHOO ZH have so many years to do so, it's okay. The instant we start taking it too seriously, pretending we're grown up and a mortgage is at stake, is when it all seems to fall apart. Augustus Stahl can be contacted at astahl@keene-equinox.com

PHOTO ILLUSTRATION BY: EMILY FEDORKO / PHOTO EDITOR

STAFF COMMENTARY

Libertarian: possibly the new Republican-Democrat lovechild When you hear the word Republican come up you might think of an image, as I do, of an old rich white dude whoâ&#x20AC;&#x2122;s really uptight and prudish about morality while having no problem bombing countries. But as I have discovered, there are not only people ZKR Ă&#x20AC;W WKDW GHVFULSWLRQ LQ WKH 'HPRFUDWLF SDUW\ EXW thereâ&#x20AC;&#x2122;s a breed of conservatism that could make the GOP more appealing to young voters. Libertarianism is becoming quite popular with many college students and community members, although the people who love it donâ&#x20AC;&#x2122;t know they do. 0DQ\RIP\IULHQGVWKDW,Ă&#x20AC;QGRXWDUH5HSXEOLFDQ subscribe to this view without even knowing. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m a VRFLDO'HPRFUDWDQGDĂ&#x20AC;VFDO5HSXEOLFDQÂľ,KHDUPDQ\ say. Libertarian would be a better word to sum up this ideal. Libertarians are in favor of little government in DOODVSHFWVRIOLIH'HPRFUDWVIDYRUWKLVLQVRFLDOSROLcies and Republicans favor it in the market. Most of the people who tell me that they are Republican subscribe to this view. :KHQ , Ă&#x20AC;UVW EHFDPH D SDUW RI WKH JURXS 6WXGHQWV IRU6HQVLEOH'UXJ3ROLF\,ZDVVKRFNHGWRĂ&#x20AC;QGRXWKRZ many people who opposed the drug war just as bitterly as I did hailed the elephantâ&#x20AC;&#x2122;s party. â&#x20AC;&#x153;How are you Republican?â&#x20AC;? I would ask seeing as how Nixon started the drug war in the â&#x20AC;&#x2DC;70s, escalating under Ronald Reagan. â&#x20AC;&#x153;Republicans love the drug war. I would think you

ZRXOGEHD'$5(ORYLQJPDULMXDQDKDWLQJF]DUWKDW would want to lock up drug users to protect â&#x20AC;&#x2DC;public morality.â&#x20AC;&#x2122;â&#x20AC;? They would tell me that they opposed large government and using federal taxes to arrest people for drugs is a waste of money and just another way for the government to get involved in our private lives. Many of my friends and members of our chapter here in Keene hold this view. Itâ&#x20AC;&#x2122;s the prevalent view through the current Free Keene movement. Right on, having a smaller government is a legitimate point and a topic worthy of debate. But the SUREOHPLVWKHWHUPVRIGHĂ&#x20AC;QLQJRQHVHOI,IHHOWKDWLI someone holds this view, then theyâ&#x20AC;&#x2122;re not Republican. Republicans, as stated before, believe in the free market but they want to tell you how to â&#x20AC;&#x153;morallyâ&#x20AC;? live your life, favor government wire-tapping, favor a larger military and continually try to mix religion with civic life, all things that Libertarians are vividly against. Most of my friends who say theyâ&#x20AC;&#x2122;re Republican EHOLHYH LQ OHJDOL]LQJ PDULMXDQD VWDQGRXW DJDLQVW police abuse, are not against gay marriage, and are pro-choice. This is not the manifesto of the current Republican party, which is why they have such a disconnection with the younger generation. 7KHQHZ\RXQJ5HSXEOLFDQVUHDOL]HWKDWWRSUHDFK

Most of my friends who say theyâ&#x20AC;&#x2122;re Republican believe in legalizing marijuana, stand-out against police abuse, are not against gay marriage, and are pro-choice. This is not the manifesto of the current Republican party, which is why they have such a disconnection with the younger generation. -­RABADEAU

limited government means to support it in all areas of life besides the business world. The new Republican is a Libertarian. Libertarians are creating much more of an appeal because they donâ&#x20AC;&#x2122;t hold the stuffed up views of the Santorums and Gingriches of the world. Ron Paul, one of the few Libertarian politicians that KHOGSXEOLFRIĂ&#x20AC;FHZDVRQHRIWKHPRVWSRSXODU5HSXElican candidates for president among our age group. Gary Johnson, the Libertarian candidate, gained a heavy following on Facebook and stole a lot of votes. I voted for Gary Johnson this year even though Iâ&#x20AC;&#x2122;m more to the left. Jill Stein, the green party candidate, wasnâ&#x20AC;&#x2122;t on the ballot in New Hampshire. Why does this matter? It matters because this could be a new breath for a Republican party, which is start-

ing to die out. The Libertarian party could be a party that supports policies and holds views that progressives gel with. It could devour the moderate vote if the god-fearing war hawks of the current party diminish. The Libertarian party could also steal the vote of liberals, who see Obama as a failure to the change he promised. The new Republican is a Libertarian and they could potentially dominate if they become the partyâ&#x20AC;&#x2122;s status quo. But for that to happen, the Reagan conservatives that control the party need to go. Brian Rabadeau can be contacted at brabadeau@keene-equiniox.com

Template 022308 JJP


Cyan Magenta Yellow Black THURSDAY, FEB. 21, 2013

[Keene-足Equinox.com]

STUDENT LIFE / A6

Template 022308 JJP


Cyan Magenta Yellow Black THURSDAY, FEB. 21, 2013

[Keene-足Equinox.com]

STUDENT LIFE / A7

Template 022308 JJP


Black STUDENT LIFE / A8

THURSDAY, FEB. 21, 2013

[Keene-­Equinox.com]

Home is where the heart is: back to Ireland

Erin Steinbrick, Ireland 6WXG\LQJDEURDGLVDRQFHLQDOLIHWLPHH[SHULHQFHXQOHVV\RXJHWWRGRLWWZLFH)RUWKRVH RI \RX WKDW GRQ¡W NQRZ PH ,¡P (ULQ D MXQLRU SV\FKRORJ\PDMRUDW.HHQH6WDWH&ROOHJH ,DPVWXG\LQJIRUP\VHFRQGVSULQJWHUPDW WKH8QLYHUVLW\RI/LPHULFNLQ,UHODQG <HV VHFRQG VSULQJ WHUP PHDQLQJ , VWXGLHGODVWVSULQJFDPHEDFNWR.HHQHIRUWKHIDOO DQG QRZ ,¡P ULJKW EDFN ZKHUH , ZDV ODVW \HDU VWXG\LQJ DZD\ FXUUHQWO\ VLWWLQJ LQ P\ DSDUWPHQWZULWLQJWKLVDUWLFOHRQDW\SLFDOUDLQ\GD\ LQ/LPHULFN 0\VLWXDWLRQLVDUDUHRQHDQGWHQGVWREULQJ DERXWDIHZTXHVWLRQV7KHWZRTXHVWLRQV,JHW DVNHG PRVW IUHTXHQWO\ DUH ´<RX¡UH DOORZHG WR study abroad twice?â&#x20AC;? and â&#x20AC;&#x153;Why study in the ERIN STEINBRICK / CONTRIBUTED PHOTO same place?â&#x20AC;? , VWLOO FDQ¡W UHDOO\ JLYH D SURSHU DQVZHU WR Junior Erin Steinbrick is studying abroad in Ireland for the second time in her college career at Keene State College. Steinbrick is attending the University of Limerick. HLWKHURIWKRVHTXHVWLRQV +RZHYHUWKHEHVW,FDQGRLVMXVWVD\VLPSO\ +RZHYHU RQH RI WKHLU ELJJHVW PDMRUV VWLOO medical school and medical student accommo,PDGHLWZRUN,ZDVQ¡WDIUDLGWRKDYHWRPRYH remains Irish music and dance. dation. WKLQJVDURXQGWRZRUNFUD]\DPRXQWVRIKRXUV ,KDYHĂ&#x20AC;YHKRXVHPDWHVWKLVWHUPĂ&#x20AC;YH,ULVK 2WKHUWKDQWKDW&DSSDYLOODLVVWLOOWKHEHVW DQGWRDFWXDOO\GURSRQHRIP\WZRPDMRUVWR VWXGHQWV DQG P\VHOI 2I WKRVH Ă&#x20AC;YH VWXGHQWV VWXGHQWDFFRPPRGDWLRQ ,QP\RSLQLRQ+RZ make it back to the place I felt I needed to be. IRXUDUHPXVLFDQGGDQFHPDMRUV7KLVRIFRXUVH FDQ \RX EHDW D VLQJOH ZLWK D GRXEOH EHG DQG 2ND\ , PD\ QRW KDYH EHHQ WKDW FRRO DERXW PHDQV DW DQ\ WLPH RI WKH GD\ D ÂśVHVVLRQ¡ PD\ \RXURZQEDWKURRP"  it, â&#x20AC;&#x153;incredibly stressedâ&#x20AC;? would probably best EUHDNRXWLQP\OLYLQJURRP 0\OHFWXUHVVWLOODYHUDJHDWOHDVWVWXGHQWV GHVFULEHPHWKLVSDVWIDOO1RQHWKHOHVV,NQHZ %DQMRV JXLWDUV DQG WKH WLQ ZKLVWOH FDQ EH DQG\HVWKHGULQNLQJDJHLVVWLOO ,QHHGHGWRPDNHLWEDFNKHUHUHJDUGOHVVRIWKH KHDUG LQ RXU VKDUHG VSDFH , RIWHQ JR LQ WDNH 0\ VWXG\ DEURDG  LV RQO\ MXVW VWDUWLQJ obstacles. D VHDW DQG MXVW OLVWHQ ORYLQJ HYHU\ PLQXWH RI WKUHHZHHNVLQZLWKWRJR +DYLQJWKDWIHHOLQJWKDWSXOOWRWKLVSODFHLW LW$IUHHVKRZRIYHU\ZHOOSOD\HGWUDGLWLRQDO This term I am excited to see some familiar ZDVQHYHUDTXHVWLRQRIZKHUH,ZDVVWXG\LQJ ,ULVKPXVLFDQG,ODXJKHYHU\WLPHWKH\DVNLI IDFHV DQG SODFHV DV ZHOO DV SODQQLQJ WULSV WR DJDLQLWZDV´+RZGR,JHWEDFNWR/LPHULFN"Âľ WKH\¡UHERWKHULQJPH KROLGD\ ZKHUH ,¡YH QHYHU EHHQ LQFOXGLQJ +RO8/LVDQDPD]LQJXQLYHUVLW\DQGLWLVVRGLI$QRWKHUTXHVWLRQ,JHWDVNHGLVPRVWO\IURP ODQG&URDWLDDQGSRVVLEO\%DUFHORQDOLYLQJLQ IHUHQWIURP.HHQH P\IHOORZLQWHUQDWLRQDODOXPQXVRIODVWVSULQJ (XURSHUHDOO\PDNHVLWHDV\WRJRWRVFKRRODOO 7KHUH DUH DERXW  VWXGHQWV ZKLFK â&#x20AC;&#x153;Is it really different?â&#x20AC;? week and take a quick weekend trip to a totally PDNHV IRU D ODUJH FDPSXV 7R ZDON IURP P\ %HLQJ KHUH IRU WKUHH ZHHNV DOUHDG\ , DP different world. DSDUWPHQWWRWKHJ\PLVMXVWDERXWDPLOH ZRUNLQJRQWKHEHVWZD\WRDQVZHUP\IULHQGV 7KHEHVWDGYLFH,FDQJLYHLVLIWKHUHLVVRPH6R LI \RX WKRXJKW WKH ZDON IURP 3RQGVLGH 6RWKLVLVZKDW,¡YHFRPHXSZLWK ZKHUH\RXUHDOO\ZDQWWRJRMXVWDVNDURXQG ,,WRWKHJ\PZDVEDG,¡PQRZZDONLQJDPLOH 7KH ELJJHVW GLIIHUHQFHV EHVLGHV EHLQJ VXU- WKH .HHQH 6WDWH &ROOHJH *(2 2IĂ&#x20AC;FH RU \RXU JRLQJIRUDZRUNRXWWKHQDPLOHKRPH URXQGHG E\ DOO QHZ SHRSOH WKDW ,¡YH IRXQG DGYLVRUWKDW¡VZKDWWKH\DUHWKHUHIRU 7KH8QLYHUVLW\RI/LPHULFNDOVRKDVDODUJH LQFOXGHWKHEXVLQWRWKHFLW\FKDQJHGIURPWKH <RXFDQ¡WEHDIUDLGWRDVNEHFDXVH\RXKDYH QXPEHU RI PDMRUV ZKLFK DUH PRVWO\ VFLHQFH Âś¡WRWKHÂś¡DQGWKHSULFHZHQWXSWR½ WRUHPHPEHUWKHZRUVWDQVZHU\RXFDQJHWLV based. WKDW¡V MXVW DERXW   LPPLJUDWLRQ GRXEOHG LWV QR2IFRXUVHLI\RXORRNDWP\VLWXDWLRQÂśQR¡LV 0DMRUVLQFOXGHHQJLQHHULQJVHFRQGDU\HGXSULFH DQG WKH FRQVWUXFWLRQ WKDW ZDV JRLQJ RQ only at best debatable. FDWLRQLQWKHVFLHQFHVVRFLDOVFLHQFHVHYHQIXOO ODVWVSULQJLVQRZĂ&#x20AC;QLVKHGPDNLQJXSWKHQHZ QXUVLQJGRFWRUDQGPLGZLIHU\SURJUDPV

21(%,//,21 (Cont. from A10)

ZKR FRRUGLQDWHG WKLV VSHFLĂ&#x20AC;F HYHQW within this week,â&#x20AC;? Rothmel said. Rothmel said he found out about WKLV HYHQW WKURXJK )DFHERRN DQG EURXJKWLWXSWRWKHJURXS0HQWRUVLQ 9LROHQFH 3URWHFWLRQ 093  D JURXS on campus that is an extension of the &RXQVHOLQJ&HQWHU ´:KDW , UHDOO\ ZDQW SHRSOH WR JHW RXWRIWKLVHYHQWLVDQLGHDRILQJHQHUDODFWLYLVPÂľ5RWKPHOVDLG ´,W >´2QH %LOOLRQ 5LVLQJÂľ@ SXWV LW >GRPHVWLF DQG JHQGHU YLROHQFH DZDUHQHVV@RXWWKHUHÂľVHQLRU.DWULQD %DXPJDUWQHUVDLG´,PHDQGDQFLQJ PDNLQJDUXFNXVPDNLQJDQRLVHMXVW draws attention to it.â&#x20AC;? %DXPJDUWQHU DQ LQWHUQ DW WKH 0RQDGQRFN &HQWHU IRU 9LROHQFH 3URtection, said that she hopes it makes people ask questions about why this HYHQWLVJRLQJRQDQGWRORRNIXUWKHU LQWRGRPHVWLFDQGJHQGHUYLROHQFH ´, UHDOO\ ORYH WKDW LW¡V XVLQJ GDQFLQJ UHDOO\ XVLQJ \RXU ERG\ DFFHSWLQJ \RXU ERG\ WDNLQJ XS WKH VSDFH around you and women need to take up the space around them,â&#x20AC;? %DXPJDUWQHUVDLG 2QWKH´2QH%LOOLRQ5LVLQJÂľZHEVLWHWKHUHLVLQIRUPDWLRQDQGYLGHRV WDNHQIURPSODFHVUDQJLQJIURP1HZ <RUN &LW\ 1< WR .KDUWRXP 6XGDQ and from the City of Joy in the DemRFUDWLF 5HSXEOLF RI &RQJR WR 1HZ Delhi, India. 7KLVZDVDJOREDOHYHQWWKDWWRRN SODFHRQ)HEWRUDLVHDZDUHQHVVRI GRPHVWLFVH[XDODQGJHQGHUYLROHQFH and to celebrate life. 7KH 0&93 FRYHUV WKH 0RQDGQRFNUHJLRQIRUGRPHVWLFDQGVH[XDO YLROHQFH 7KH VWDII SURYLGHV FRXQVHOLQJHPHUJHQF\VKHOWHUHGXFDWLRQRQ GRPHVWLF DQG VH[XDO YLROHQFH VXSSRUW JURXSV FRXUW DGYRFDFLHV DQG D KRXU FULVLV KHOSOLQH IRU DQ\RQH who needs it. Robin Christopherson, director of 0&93 DOVR DWWHQGHG WKH HYHQW 6KH said that she was â&#x20AC;&#x153;thrilledâ&#x20AC;? about ´2QH %LOOLRQ 5LVLQJÂľ FRPLQJ WR WKH .6& FDPSXV 6KH DOVR VDLG WKDW LW LV QLFH WR KDYH D ´FDWDO\VWÂľ 093  RQ campus, as well. ´, WKLQN WKDW LW¡V H[FHOOHQW 7KH WLPLQJ LV YHU\ LPSRUWDQW ULJKW QRZÂľ Christopherson said, â&#x20AC;&#x153;I think where ZH¡YH FRPH RII RI D SHULRG RI WLPH

WKDW KDV VHHPHG WKDW ZH¡YH WUDQVJUHVVHG EDFN LQWR WKH ÂśV DQG ÂśV idea of who women are in our society DQG JHQGHU VWHUHRW\SHV DQG D ORW RI P\WKVDERXWVH[XDOYLROHQFHDQGYLROHQFHDJDLQVWZRPHQÂľ $FFRUGLQJ WR VRSKRPRUH 6DUDK &URLWRUX´*HQGHUYLROHQFHLVDSHUYDVLYHLVVXHWKDWQHHGVWREHDGGUHVVHG in our country and has been sidelined all too often.â&#x20AC;? 6KH FRQWLQXHG ´(YHU\ERG\ knows somebody.â&#x20AC;? Croitoru was KDSS\ WR VHH WKH FDPSXV FRPLQJ WRJHWKHU WR KHOS UDLVH DZDUHQHVV IRU GRPHVWLFDQGJHQGHUYLROHQFH ´,W >´2QH %LOOLRQ 5LVLQJÂľ@ UDLVHV DZDUHQHVV DQG LW PDNHV LW YLVLEOH HYHQ LI LW¡V MXVW IRU D VKRUW SHULRG RI WLPHÂľ &URLWRUX VDLG 6KH FRQWLQued, â&#x20AC;&#x153;There were people who were ZDWFKLQJ SHRSOH ZKR VWRSSHG DQG took pictures with their phones so it PDNHVLWYLVLEOHDQGWDONHGDERXWÂľ $FFRUGLQJ WR 5RWKPHO ´7KHUH¡V D ORW EHLQJ GRQH >DERXW GRPHVWLF DQG JHQGHU YLROHQFH DZDUHQHVV@ HVSHFLDOO\ ZLWK 093 WKH &RXQVHOLQJ Center does a lot, the administraWLRQLVLQYHVWHGLQFKDQJLQJSROLFLHVÂľ &URLWRUXVDLGWKDWVKHĂ&#x20AC;QGVWKDWLWLV YHU\ HIIHFWLYH IRU 093 WR SURPRWH HYHQWV RQ 0\.6& \HW WKH\ DUH WKH RQO\SURJUDPRQFDPSXVWKDWVKHKDV heard about. â&#x20AC;&#x153;I still think that as a campus community I think that rape culture is more or less seen as not a non-issue,â&#x20AC;? Rothmel said. ´5LJKW QRZ WKHUH¡V URRP IRU LPSURYHPHQWEXW,WKLQN.HHQH6WDWH >&ROOHJH@ KDV UHDOO\ HPEUDFHG WKLVÂľ &KULVWRSKHUVRQ VDLG %DXPJDUWQHU VDLGWKDWHYHU\SHUVRQKDVWKHULJKWWR IHHOVDIHDQGWKDWWKHYLROHQFHDJDLQVW ZRPHQQHHGVWRVWRS´'RPHVWLFYLROHQFHVKRXOGQ¡WEHDFORVHGGRRUVLWXDtion. We need to talk about it. It needs WREHRXWLQWKHRSHQLIZH¡UHJRLQJWR HQGLWÂľ%DXPJDUWQHUVDLG â&#x20AC;&#x153;I want people to realize that womHQ¡VLVVXHVDUHQ¡WMXVWZRPHQ¡VLVVXHV LW¡VDKXPDQLVVXHLW¡VDSHRSOHLVVXHÂľ Rothmel said. &KULVWRSKHUVRQVDLG´,I\RXKDYH people who are committed, dedicated WR GR WKLV ZRUN WKDW¡V ZKDW¡V LPSRUWDQW,WKLQNLW>´2QH%LOOLRQ5LVLQJÂľ@ ZDVDJUHDWVWDUWÂľ Rebecca Marsh can be contacted at rmarsh@keene-equinox.com

Template 022308 JJP


Black THURSDAY, FEB. 21, 2013

STUDENT LIFE / A9

[Keene-­Equinox.com]

Snowstorm rallies students to party JULIE CONLON

STUDENT LIFE EDITOR STEVEN TRINKWALD

VICTORIA RONAN

EQUINOX STAFF

EQUINOX STAFF

:KHQ +XUULFDQH 6DQG\ Ă RRGHG .HHQH LQ 2FWREHU LW VHHPHG WKH EHHU Ă RZHG PRUH than rain for Keene State College students. The same can be said for snowstorm Nemo, but Nemo proved to be a bit quieter than Sandyâ&#x20AC;&#x2122;s whirlwind. Keene Police Departmentâ&#x20AC;&#x2122;s &ROOHJH /LDLVRQ 2IĂ&#x20AC;FHU .DWLH &RUEHWW VDLG the blizzard brought a pretty quiet weekend for her. Corbett said that the blizzard tamed the off-campus party scene in Keene for the weekend. â&#x20AC;&#x153;To be quite honest, I donâ&#x20AC;&#x2122;t think I had any calls for the college at all, all weekend. I was actually quite surprised. I think it was dead quiet. I was shocked because there was nothing,â&#x20AC;? Corbett said. Corbett said that while she had a pretty boring weekend dealing with off campus students, she thinks drinking may have picked up in the dorms. â&#x20AC;&#x153;You still see a couple of kids venture out. But for the most part everyone stays in their rooms. Iâ&#x20AC;&#x2122;m sure that the college sees a lot more parties in the dorm, but for off campus itâ&#x20AC;&#x2122;s a lot more tame,â&#x20AC;? Corbett said. Corbett said many students took the blizzard as an opportunity to get away from Keene. â&#x20AC;&#x153;I think a lot of the students went home. I saw a lot of them on Friday, and their parents picking them up,â&#x20AC;? Corbett said. Corbett said overall itâ&#x20AC;&#x2122;s been a pretty slow season for dealing with off-campus madness.â&#x20AC;&#x153;There hasnâ&#x20AC;&#x2122;t been that many parties recently because itâ&#x20AC;&#x2122;s the winterâ&#x20AC;Ś Itâ&#x20AC;&#x2122;s a lot quieter for me, which is nice,â&#x20AC;? Corbett said. For Keene State College students like junior Sam Murray, the weather had little affect on his social life. Murray said he typically drinks one night over the course of the weekend, and said that the blizzardâ&#x20AC;&#x2122;s arrival didnâ&#x20AC;&#x2122;t really change anything. Murray said he stayed inside and had some drinks with his friends, which he said he is a pretty ordinary weekend for him. Murray said most of his friends live pretty close, so nothing really changed socially. Murray said the biggest impact the blizzard has had is on his academic life. â&#x20AC;&#x153;I missed a couple of classes because

/29(+$7( (Cont. from A10)

lective hosted a full crowd for an evening of live entertainment. Guests decorated mugs and enjoyed musical performances and fresh fruit while listening to acts from peers such as real-life couple duo Courtney Thorpe and Brian Casey, and poet Shane Merritt. Junior Krista Sullivan, KSC Feminist Collective president, said she and her group were not against love; rather, â&#x20AC;&#x153;We provide a spectrum of love differences, different relationship styles, just kind of to create an alternative vibe at Keene State [College].â&#x20AC;? Sullivan said she thinks Valentineâ&#x20AC;&#x2122;s Day gets a â&#x20AC;&#x153;bad repâ&#x20AC;? because of how commercialized it has become. â&#x20AC;&#x153;It really makes you feel bad if you donâ&#x20AC;&#x2122;t have someone to love, which is totally ridiculous because there are a lot of people that should just say I love you everyday.â&#x20AC;? She continued, â&#x20AC;&#x153;This is kind of an alternative event to honor that and give everybody a chance to celebrate. Weâ&#x20AC;&#x2122;re anti-Valentineâ&#x20AC;&#x2122;s Day, not anti-love!â&#x20AC;? On the theme of spreading the love, Brandon Roy, a junior member of Active Minds, took it upon himself to give out free hugs in the Young Student Center. Roy said, â&#x20AC;&#x153;Originally we had paper hearts with chocolates that we were handing out to people and then those kind of went really quickly. People took really kindly to them. I was surprised. Spread

Cell phones still a â&#x20AC;&#x2DC;noâ&#x20AC;&#x2122; in the classroom

PHOTO ILLUSTRATION BY: EMILY FEDORKO / PHOTO EDITOR

teachers werenâ&#x20AC;&#x2122;t showing up, but other than One student, senior Chelsey Watson, said that not much,â&#x20AC;? Murray said. Murray said she drank more that weekend than a typithat additional free time could inspire other cal weekend. She explained, â&#x20AC;&#x153;I got snowed students to pick up the drinking. Sophomore in at a friendâ&#x20AC;&#x2122;s house, I drank more than I Annie McCaffrey said she has class on Fri- usually do. Because we were trapped, it was days, so the blizzard opened up more time like a camaraderie thing. We were all stuck for her to have some drinks with her friends. inside the house so we stayed in and drank McCaffrey said she typically drinks two or and played games all day.â&#x20AC;? Watson said she three times over the course of the weekend, thinks because there wasnâ&#x20AC;&#x2122;t much else to do, and that the blizzard didnâ&#x20AC;&#x2122;t slow that down. because of the snow, students drank. McCaffrey said the snowstorm didnâ&#x20AC;&#x2122;t â&#x20AC;&#x153;We had no other responsibility,â&#x20AC;? she said, cause her to drink any more than she would â&#x20AC;&#x153;I think people used that avenue to get drunk.â&#x20AC;? have on a typical weekend, but said she Senior Bobby Pettit said he and his friends thinks some students saw it as an opportu- drank during the day through the weekend. nity to step up their party game. â&#x20AC;&#x153;Yeah, they â&#x20AC;&#x153;We drank all day compared to other weekknow that there will be no school. Itâ&#x20AC;&#x2122;s just ends where we just drink at night. We didnâ&#x20AC;&#x2122;t an excuse to drink, because drinkers always really go out to the bars; we kind of just Ă&#x20AC;QG DQ H[FXVH WR GULQNÂľ 0F&DIIUH\ VDLG stayed in and drank.â&#x20AC;? Amanda Mills, a senior,

the love you know? Thatâ&#x20AC;&#x2122;s what weâ&#x20AC;&#x2122;re trying to do.â&#x20AC;? He added, â&#x20AC;&#x153;Then we have a free hugs sign and weâ&#x20AC;&#x2122;ve been going around and giving people free hugs because if you canâ&#x20AC;&#x2122;t spread love one way spread love another way.â&#x20AC;? Roy said he likes Valentineâ&#x20AC;&#x2122;s Day, â&#x20AC;&#x153;I think Valentineâ&#x20AC;&#x2122;s Day is a very fun day. Like even if youâ&#x20AC;&#x2122;re single itâ&#x20AC;&#x2122;s still a fun day, because everyone can get together and have a good time, get a few laughs in, free hugs.â&#x20AC;?

Roy also said the campus seemed to be in the Valentineâ&#x20AC;&#x2122;s Day spirit. â&#x20AC;&#x153;Thereâ&#x20AC;&#x2122;s a couple people who seem relatively solemn and buried into their phones. Other people, however, are very receptive, but the majority of the population is very happy I would have to say.â&#x20AC;? Sophomore Laura Heavey, vicepresident of the Fair Trade Club, said that the club helped people JHW LQ WKH VSLULW E\ VHOOLQJ Ă RZers, â&#x20AC;&#x153;Well basically we ordered

echoed her peers and said that with nothing better to do, she and her friends day drank. Mills said she drank during the day on Friday and Saturday, and said on Friday she and her friends went to Cobblestone Ale House around four in the afternoon and stayed through the night. Mills said she didnâ&#x20AC;&#x2122;t notice any special bar deals for the storm. â&#x20AC;&#x153;It was snowing pretty hard, we couldnâ&#x20AC;&#x2122;t even get out of our driveways--we didnâ&#x20AC;&#x2122;t have anything better to do. Basically, thatâ&#x20AC;&#x2122;s kind of sad!â&#x20AC;? Julie Conlon can be contacted at jconlon@keene-equinox.com Steven Trinkwald can be contacted at strinkwald@keene-equinox.com

HLJKWGR]HQĂ RZHUVIURP(FXDGRU and since itâ&#x20AC;&#x2122;s fair trade they were treated with organic materials and the farmers who produced them were treated fairly. They got paid the right amount of money and then they were shipped to us and we sold them for 2 dollars for one and 3 dollars for Ă&#x20AC;YH$QGZHVROGWKHPDOOZKLFK is great.â&#x20AC;? Heavey said that sheâ&#x20AC;&#x2122;s never had any dislike for the holiday, â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve never hated the holiday. I

know a lot of people hate it since they donâ&#x20AC;&#x2122;t have boyfriends but I just like seeing couples you know celebrate their love with each other. Iâ&#x20AC;&#x2122;ve never been one of those jealous types so I just like seeing the love.â&#x20AC;? Heavey shared what she thinks Valentineâ&#x20AC;&#x2122;s Day is about, â&#x20AC;&#x153;I think itâ&#x20AC;&#x2122;s just a day to recognize each other and just to appreciate it because I know every day you go through troubles and school work and everything, you donâ&#x20AC;&#x2122;t really have time to just sit there and appreciate each other so I think itâ&#x20AC;&#x2122;s just a day to take a break from the world and hangout.â&#x20AC;? Heavey said her favorite part of Valentineâ&#x20AC;&#x2122;s Day is, â&#x20AC;&#x153;Seeing couples walking around holding hands. One boy even just came over and ERXJKW D Ă RZHU IRU KLV JLUOIULHQG and walked away and gave a her kiss on the cheek, and it was just adorable.â&#x20AC;? ´0RVWO\ JX\V ERXJKW Ă RZHUV and they were scared they were going to buy the wrong ones for them and it is just the nervous happiness that I really like to see.â&#x20AC;? Whether this past Valentineâ&#x20AC;&#x2122;s Day was a day of roses and chocolates or just another Thursday, studentsâ&#x20AC;&#x2122; wallets and single ladiesâ&#x20AC;&#x2122; hearts can rest knowing this â&#x20AC;&#x153;holidayâ&#x20AC;? wonâ&#x20AC;&#x2122;t happen again for another year. Until then, St. Valentine. Julie Conlon can be contacted at jconlon@keene-equinox.com

EMILY FEDORKO / PHOTO EDITOR

Kyle Phaneuf plays guitar at the Feminist Collectiveâ&#x20AC;&#x2122;s â&#x20AC;&#x153;Anti-Valentineâ&#x20AC;&#x2122;s Dayâ&#x20AC;? event in the Night Owl Cafe Wednesday, Feb. 13, 2013.

7('7$/. (Cont. from A10)

Senior and KSC Pride treasurer Bryt Randlett said, â&#x20AC;&#x153;Keene is probably the most loving community that Iâ&#x20AC;&#x2122;ve met as far as LGBT communities.â&#x20AC;? Randlett later added that Pride was the Ă&#x20AC;UVW SODFH ZKHUH VKH FRXOG VWDWH KHU VH[XDO orientation and not be judged. Randlett said, â&#x20AC;&#x153;I said â&#x20AC;&#x2DC;bisexualâ&#x20AC;&#x2122;, and for WKHĂ&#x20AC;UVWWLPH,GLGQ¡WKHDUÂś6R\RX¡UHMXVWWKH drunk girl who makes out with everyone, right?â&#x20AC;&#x2122;â&#x20AC;? (YHQ WKRXJK .6& KDV D JUHDW DPRXQW RI DFFHSWDQFH (VFREHGR VKDUHG ´, KHDU D ORW of really negative language in my residence KDOOVDQGDFURVVFDPSXVÂľ(VFREHGRZHQWRQ to say, â&#x20AC;&#x153;I think we have a lot of work to do.â&#x20AC;? Junior and Pride Vice President Julia Rasku said, â&#x20AC;&#x153;I feel better about myself because Iâ&#x20AC;&#x2122;ve had this community to support me in my own growth.â&#x20AC;?

In his presentation, Granderson stated in most states, you can be kicked out of your DSDUWPHQW RU Ă&#x20AC;UHG IURP \RXU MRE MXVW IRU being gay, lesbian, bisexual, or transgender. â&#x20AC;&#x153;There is no protection from discrimination of LGBT people,â&#x20AC;? Granderson said. Although this is not an issue in New Hampshire, according to MacNeil we have our own national issues to worry about. New Hampshireâ&#x20AC;&#x2122;s Army National Guard &KLHI ZDUUDQW RIĂ&#x20AC;FHU &KDUOLH 0RUJDQ GLHG on Feb. 10. Morganâ&#x20AC;&#x2122;s wife did not receive the VDPH VXUYLYRU EHQHĂ&#x20AC;WV DV RWKHU LQGLYLGXDOV because her wife was homosexual. 5HĂ HFWLQJ RQ WKLV LVVXH 0DF1HLO addressed the LGBT community and said, â&#x20AC;&#x153;You guys have no idea how important you are. You have no idea how important you are to the equality battle, and believe me when I say itâ&#x20AC;&#x2122;s a battle.â&#x20AC;? MacNeil also pointed out the success that New Hampshire has had with the gay rights movement, bringing up passing the right for

Morgan Markley can be contacted at mmarkley@keene-equinox.com

â&#x20AC;&#x153;Keene is probably the most loving community that Iâ&#x20AC;&#x2122;ve met as far as LGBT communities.â&#x20AC;? -­BRYT RANDLETT KSC SENIOR

gay marriage. â&#x20AC;&#x153;Having lived for two years with the marriage equality movement and then success? I mean we were stunned, we were sobbing in our seats,â&#x20AC;? MacNeil said. Randlett commented on her future children, â&#x20AC;&#x153;I want them WR EH DV KDSS\ DV , DP ULJKW QRZ Ă&#x20AC;QGLQJ D community that has made me this comfortable for them to experience everything and never be held back.â&#x20AC;? Granderson said, â&#x20AC;&#x153;This story just keeps playing over and over and over again in our countryâ&#x20AC;&#x2122;s history.â&#x20AC;? He went on to explain, â&#x20AC;&#x153;There was a time in which people who were black didnâ&#x20AC;&#x2122;t have the same rights, people who

happened to be women didnâ&#x20AC;&#x2122;t have the same rights, couldnâ&#x20AC;&#x2122;t vote. There was a point in our history in which if you were considered GLVDEOHG HPSOR\HUV FRXOG Ă&#x20AC;UH \RXÂľ 0DFNeil ended the panel by inviting everyone to Light the Way to Justice on March 25 in Central Square. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s based on the fact that the Supreme Court on March 26 and 27 is hearing arguments about overturning DOMA (Defense of Marriage Act) and Proposition 8,â&#x20AC;? MacNeil said. Megan Grenier can be contacted at mgrenier@keene-equinox.com

There is no doubt technology is becoming a big part of everyday life all over the country, especially on college campuses. Keene State College students are part of this change. Wireless is now available in all KSC classrooms, according to Communication Professor Chitra Akkoor. â&#x20AC;&#x153;They think itâ&#x20AC;&#x2122;s enabling learning and I personally donâ&#x20AC;&#x2122;t think thatâ&#x20AC;&#x2122;s the case because I donâ&#x20AC;&#x2122;t think all faculty are there yet,â&#x20AC;? Akkoor said. Akkoor explained the wireless availability has a big impact on cellphone use in the classroom. She believes WKLVKDVMXVWKHOSHGVWXGHQWVĂ&#x20AC;QG another way to become distracted. According to Safety Studies Professor Jaime Ingalls, every teacher can decide upon their own cellphone policy. â&#x20AC;&#x153;An educatorâ&#x20AC;&#x2122;s classroom environment is sacred to them,â&#x20AC;? Ingalls explained. She said every teacher needs to make it clear to the students what the policy is because each classroom is different. She said she believes every teacher reacts differently to cellphones. â&#x20AC;&#x153;I try to use humor to bring out the point that itâ&#x20AC;&#x2122;s distracting behavior,â&#x20AC;? Ingalls explained. She says how she does not want to single students out directly. 3K\VLFDO (GXFDWLRQ 3URIHVVRU Donna Smyth said she asks her students to respect each other when discussing cellphones in the classroom â&#x20AC;&#x153;I will pull students aside privately if it becomes an ongoing problem,â&#x20AC;? Smyth said. According to Akkoor, it depends on the situation but she will usually bring attention to cellphones being used in class. â&#x20AC;&#x153;All students are adults, so I respect that and I donâ&#x20AC;&#x2122;t like to insult anyone directly so I just say it in a very general way.â&#x20AC;? She explained that she will allow students to leave the class to use their phones if itâ&#x20AC;&#x2122;s an emergency. Some students say they donâ&#x20AC;&#x2122;t use their cellphone in class that often because they donâ&#x20AC;&#x2122;t want all the attention on them. KSC sophomore Sarah Pohar said students do not like it when the professor confronts them in the middle of class. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s embarrassing and no one likes that,â&#x20AC;? Pohar stated. She said she would prefer the teacher waited until after class to confront the student. KSC sophomore Madisyn Ponn said she thinks professors give quizzes more often to ensure students are paying attention. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t want to think it affects my learning but it probably does,â&#x20AC;? Ponn said. Students who donâ&#x20AC;&#x2122;t use their cellphones in class sometimes feel cheated according WR(ULN+HQVHO.6&VRSKRPRUH â&#x20AC;&#x153;It doesnâ&#x20AC;&#x2122;t matter what the teachers says, itâ&#x20AC;&#x2122;s on the student to be self-motivated. If people want to check [their cellphones], they are going to,â&#x20AC;? Hensel said. He continued and said there is nothing the teacher can do to stop students using their cellphones. Not every professor would agree with Hensel. Ingalls said some of the blame can be placed among the professors too. â&#x20AC;&#x153;Part of it is our fault as the instructor â&#x20AC;Ś weâ&#x20AC;&#x2122;re not engaging you,â&#x20AC;? Ingalls explained. She said every teacher needs to capture the attention of their students in order for them to pay attention. Ponn said she doesnâ&#x20AC;&#x2122;t believe her cellphone use is affecting other students. â&#x20AC;&#x153;Unless itâ&#x20AC;&#x2122;s making noise I donâ&#x20AC;&#x2122;t think it affects other students.â&#x20AC;? Pohar agreed and said she thinks laptops are more distracting than cellphones. Pohar and Ponn both said they are guilty of using their cellphones in class regularly. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s hard to put the phone down,â&#x20AC;? Ponn said. Smyth said students donâ&#x20AC;&#x2122;t do it to purposely to disrespect the teacher. Smyth said,â&#x20AC;&#x153;They donâ&#x20AC;&#x2122;t mean any harm or disrespect. Itâ&#x20AC;&#x2122;s just part of their culture and who they are.â&#x20AC;? Victoria Ronan can be contacted at vronan@keene-equinox.com

Template 022308 JJP


Cyan Magenta Yellow Black

THURSDAY, FEB. 21, 2013

Student Life [Keene-­Equinox.com]

STUDENT LIFE / A10

s t n e d Stu

not so

â&#x20AC;&#x2DC;Keeneâ&#x20AC;&#x2122;

on February 14

JILL TAGUE / EQUINOX STAFF

Keene State College has a never ending love-hate relationship with Cupid JULIE CONLON

of February the fourteenth even being noted as a â&#x20AC;&#x153;holiday.â&#x20AC;? Liz Clark, the supervisor of mail services MORGAN MARKLEY on campus, said that KSC students seem to SENIOR REPORTER be happy when at the mailroom, â&#x20AC;&#x153;They tend to be excited here because they are always Valentineâ&#x20AC;&#x2122;s Day: A day of love, but for getting cards and packages from us.â&#x20AC;? many, a day of dread. A day to be spent with Clark added that the mailroom is not your special someone, or a day spent with slow during Valentineâ&#x20AC;&#x2122;s Day, â&#x20AC;&#x153;We actually a bottle of Jack. Valentineâ&#x20AC;&#x2122;s Day carries the have a Valentineâ&#x20AC;&#x2122;s week here. We get packreputation of being full of love and happi- ages throughout the week, not sure the exact ness, but it seems most Keene State College count, but anywhere from two to three hunstudents arenâ&#x20AC;&#x2122;t really that â&#x20AC;&#x2DC;Keeneâ&#x20AC;&#x2122; on the GUHGDGD\$QGWKHQZH¡OOJHWIUHVKĂ RZHUV holidayâ&#x20AC;&#x201D;in fact, some laugh at the thought even.â&#x20AC;?

STUDENT LIFE EDITOR

TED Talk reflects campus perspectives

Clark said that this is their busiest time of the year because, â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re not open during Christmas time, and thatâ&#x20AC;&#x2122;s another big package day.â&#x20AC;? Clark said she thinks Valentineâ&#x20AC;&#x2122;s Day is special because of its tradition. Krystal Bunnell, a sophomore, said she doesnâ&#x20AC;&#x2122;t consider Valentineâ&#x20AC;&#x2122;s Day a holiday. â&#x20AC;&#x153;I think itâ&#x20AC;&#x2122;s pretty stupid, but I have a ER\IULHQG,PHDQWKHĂ RZHUVDUHQLFHEXW he goes to a different school so it doesnâ&#x20AC;&#x2122;t really mean anything to me. I actually forgot it was Valentineâ&#x20AC;&#x2122;s Day,â&#x20AC;? Bunnell said. Bunnell added she doesnâ&#x20AC;&#x2122;t think Valentineâ&#x20AC;&#x2122;s Day plays a large role on campus, â&#x20AC;&#x153;I

think people talk about it a lot, but I donâ&#x20AC;&#x2122;t think people really care.â&#x20AC;? Keith Simpson, a freshman at KSC, said, â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t really have a preference on it [Valentineâ&#x20AC;&#x2122;s Day]. I could care less. Even if I had a girlfriend I wouldnâ&#x20AC;&#x2122;t even want to celebrate it that much so sorry for the girls that are looking for a guy that wants to celebrate it. Itâ&#x20AC;&#x2122;s just kind of a stupid holiday I think, I wouldnâ&#x20AC;&#x2122;t even consider it a holiday actually.â&#x20AC;? Simpson said that he used Twitter to Ă&#x20AC;QGRXWZKDWSHRSOH¡VIHHOLQJVDUHWRZDUGV the fourteenth. â&#x20AC;&#x153;Thereâ&#x20AC;&#x2122;s mixed emotions on Twitter right now and thatâ&#x20AC;&#x2122;s what Iâ&#x20AC;&#x2122;m going

by, people I follow on Twitter,â&#x20AC;? he said. Simpson added he considered Valentineâ&#x20AC;&#x2122;s Day more of a â&#x20AC;&#x153;girlâ&#x20AC;? holiday. â&#x20AC;&#x153;I would say girls like it [Valentineâ&#x20AC;&#x2122;s Day] more cause itâ&#x20AC;&#x2122;s an excuse for guys to be extra cute towards them, so they like the attention I guess is what Iâ&#x20AC;&#x2122;m trying to say.â&#x20AC;? Some on the KSC campus thought along the same line as Simpson and went as far as to host an â&#x20AC;&#x153;Anti-Valentineâ&#x20AC;&#x2122;s Dayâ&#x20AC;? event. On Wednesday, the day before the holiday, in the Night Owl CafĂŠ, the KSC Feminist Col-

  LOVE-­HATE,  A9

â&#x20AC;&#x2DC;ONE BILLIONâ&#x20AC;&#x2122; RISE AGAINST GENDER VIOLENCE

MEGAN GRENIER

EQUINOX STAFF The absurdity of a â&#x20AC;&#x2DC;gay lifestyleâ&#x20AC;&#x2122; and a â&#x20AC;&#x2DC;gay agendaâ&#x20AC;&#x2122; took center stage on Tuesday, Feb. 12 at the Night Owl CafĂŠ, with a TED Talks event starring LZ Granderson. The Keene State College Pride club held a panel directly after. LZ Granderson, an American journalist and sports commentator for CNN and ESPN, is an active voice in the gay and lesbian community. In 2009, Granderson won the Gay and Lesbian Alliance Against Defamation award for online journalism. Granderson began his presentation acknowledging the presence of hate and anger surrounding the â&#x20AC;&#x2DC;gay lifestyleâ&#x20AC;&#x2122; when he said there is, â&#x20AC;&#x153;A lot of frustration, a lot of fear about who I was and the gay lifestyle.â&#x20AC;? Granderson said when KHUHDOL]HGWKLVKDWHKHZDQWHGWRĂ&#x20AC;JXUHRXWZKDWLW was that he was doing to create this anger among so many people and to stop it. Granderson used a humorRXVWHFKQLTXHWKURXJKRXWKLVWDON´,Ă&#x20AC;JXUHGLI,PDGH it funny you wouldnâ&#x20AC;&#x2122;t be as threatened,â&#x20AC;? Granderson explained. Members of the KSC Pride club, KSC Residence Director Aaron Escobedo, and the Monadnock Regionâ&#x20AC;&#x2122;s AIDS Services Executive Director Susan MacNeil all shared their thoughts and experiences after the showing of Grandersonâ&#x20AC;&#x2122;s presentation.

  TED  TALK,  A9

EMILY FEDORKO / PHOTO EDITOR

Members of Mentor in Violence Protection and other Keene State College students participate in the worldwide event bringing attention to gender violence Thursday, Feb. 14, 2013.

Global activism reigns on campus when world-wide event comes to college REBECCA MARSH

EQUINOX STAFF The crowd gathers in front of the Putnam Science Center to hear sophomore Hersch Rothmel recite Eve Enslerâ&#x20AC;&#x2122;s monologue â&#x20AC;&#x153;Over It,â&#x20AC;? showing Enslerâ&#x20AC;&#x2122;s feelings towards domestic and gender violence. On Feb. 14, people from the Monadnock region and Keene State College came to the event called

â&#x20AC;&#x153;One Billion Risingâ&#x20AC;? to march up and down Appian Way. The event was put on by Rothmel to help spread awareness about domestic and gender violence. The march began on Oya Hill with the sound of drums, then soon moved up and back down Appian Way, through the L.P. Young Student Center, and ended in front of the Mason Library. According to Rothmel, â&#x20AC;&#x153;One Billion Risingâ&#x20AC;? went on all over the world on Feb. 14 to create better awareness of the cause. â&#x20AC;&#x153;We

are a small unit in this whole unit of global activism,â&#x20AC;? Rothmel said. Rothmel brought up the idea of bringing â&#x20AC;&#x153;One Billion Risingâ&#x20AC;? to KSC. He was part of the V-Day (V stands for vagina) team and thought that this would be a great event to tie the week together. â&#x20AC;&#x153;I was part of this team who was doing different things with the â&#x20AC;&#x2DC;Vagina Monologuesâ&#x20AC;&#x2122; and then I was the one

  ONE  BILLION,  A8

Template 022308 JJP


Cyan Magenta Yellow Black

Arts & Entertainment

THURSDAY, FEB. 21, 2013

A&E / B1

[Keene-­Equinox.com]

Culture, community and dance: An Alaskan story SAM NORTON

A&E EDITOR

IVAN SINGER / CONTRIBUTED PHOTO

On Feb. 13, the Redfern Arts Center and the Vermont Performance Lab joined forces to present the work of award-winning choreographer Emily Johnson.

Stories are what choreographer Emily Johnson knows bestâ&#x20AC;&#x201D;from King Solomon, bears, monsters and even laughterâ&#x20AC;&#x201D; these are what compose Johnsonâ&#x20AC;&#x2122;s childhood and culture. But on Feb. 13 in the Redfern Arts Center, Johnson found a way to combine culture, community and GDQFH LQWR D VWRU\ LQĂ XHQFHG E\ her Alaskan heritage. Johnson said when creating this SLHFH VKH VRXJKW WR GHĂ&#x20AC;QH DQG DWWDFK meaning to a sense of placeâ&#x20AC;&#x201D;where youâ&#x20AC;&#x2122;re born, where you are from, the home you have now and where you will be. In order to convey this notion, Johnson said that she and fellow dancer, Aretha Aoki, improvised for one another. â&#x20AC;&#x153;[Aoki] and I went outside in the rain, stood on the ground in the rain and danced for each other and imagined being in these other places,â&#x20AC;? Johnson said, â&#x20AC;&#x153;We tried to place our bodies, our minds, and our thoughts in those moments and places.â&#x20AC;? However, in order for the movements to convey a particular sense of meaning and to capture a particular memory, Johnson used dialogue and audience members to develop the performanceâ&#x20AC;&#x2122;s powerful meaning. â&#x20AC;&#x153;Thatâ&#x20AC;&#x2122;s the power that I really think is in the movement. It can be incredibly complex or it can be incredibly simple. The movement itself doesnâ&#x20AC;&#x2122;t have a particular meaning, but itâ&#x20AC;&#x2122;s with all of it together, with all the partsâ&#x20AC;&#x201D; you need the stories, you need the people coming up, you need these lanterns, and then you have something,â&#x20AC;? she said. However, Johnson and James Everest,

IHOORZGDQFHUDQGFUHDWRUVDZDQH[KLELWRIĂ&#x20AC;VKVNLQ work at a contemporary gallery in Alaska, which ultimately provided her with a sense of inspiration to create this performance. â&#x20AC;&#x153;I was walking on the beach during the Sockeye run and this thought or image of making objects that could be illuminated,â&#x20AC;? Johnson said. This was when the idea came to life. â&#x20AC;&#x153;It VWDUWHGZLWKWKHĂ&#x20AC;VKZRUNDQGTXHVWLRQVDERXW land and eternity. Fishing has been a part of my life forever and it comes up in my work in different ways through stories or images.â&#x20AC;? 0DQ\ FXOWXUHV KDYH Ă&#x20AC;VK VNLQ LQ WKHLU FXOWXUH because you can make waterproof clothing, shoes, and baskets and my teacher told me that once you know how to work with skin you can mold it into any form,â&#x20AC;? Johnson said. 7KHVH Ă&#x20AC;VK VNLQV ZKLFK ZHUH DOO KDQG VFXOSWHG into lanterns, were used during the performance not only as an image that represented Johnsonâ&#x20AC;&#x2122;s culture, but also as a way to create a sense of space. â&#x20AC;&#x153;Things are chosen for a reason and I hope that the stories themselves lead people on somewhat of a parallel connectory that the dance itself leads people on. The images are a path to your own ideas and memories and the stories trigger other memories or other thoughts,â&#x20AC;? Johnson said. William Seigh, professor of theatre and dance, said that the images present in Johnsonâ&#x20AC;&#x2122;s performance were not only beautiful, but they were also sensory. â&#x20AC;&#x153;I felt that I just spent time with a beautiful book of poetry and short stories,â&#x20AC;? Seigh said. Junior Emma Bass said that Johnsonâ&#x20AC;&#x2122;s concept of combining community, dance and storytelling into one performance was interesting.

  REDFERN,  B4

COMMENTARY

Predicting who will go home with the gold WHITNEY CYR

ZKROH IDFHV 1RZ WKDW %LQ /DGHQ LV NLOOHG DQG 0D\D¡V ´/LQFROQÂľ KDV DOO WKH KDOOPDUNV RI D 6SLHOEHUJGLUHFWHG MANAGING EXECUTIVE EDITOR ZRUN LV GRQH WKH PDMRU TXHVWLRQ LV ´1RZ ZKDW"Âľ %LJ- YHKLFOH7KHRWKHURSWLRQLQWKLVFDWHJRU\LV$QJ/HHIRU HORZ¡VGHIWGLUHFWLQJFRXSOHGZLWKDPD]LQJFLQHPDWRJ- WKHYLVXDOO\VXPSWXRXV´/LIHRI3LÂľ7KLVFRXOGEHRQH 7KLV \HDU¡V FURS RI Ă&#x20AC;OPV VKRZHG RII VRPH PDJQLĂ&#x20AC;- UDSK\PDNHVWKLVĂ&#x20AC;OPVWDQGRXWDPRQJVWWKHRWKHUV PDMRUXSVHWRIWKHQLJKWEXWP\EHWLV6SLHOEHUJ FHQW SHUIRUPDQFHV JUHDW VWRULHV IDQWDVWLF VFUHHQZULWLQJDQGVRPHDPD]LQJHGLWLQJPRUHVRWKDQODVW\HDU¡V Best Director 6KRXOG ZLQ .DWKU\Q %LJHORZ RU %HQ $IĂ HFN P\ EDWFKRI2VFDUZRUWK\Ă&#x20AC;OPV:KLOH´7KH$UWLVWÂľZDVD RZQ ZULWHLQ EDOORW  %LJHORZ¡V GLUHFWLQJ LV Ă DZOHVV LQ FULWLFGDUOLQJDQGDQDPD]LQJĂ&#x20AC;OPWKHUHVWRIWKHĂ&#x20AC;OPV :LOOZLQ6WHYHQ6SLHOEHUJIRU´/LQFROQÂľ7KLVLVRQH ´=HUR 'DUN 7KLUW\Âľ (YHQ LI %LJHORZ KDG EHHQ VQXEEHG LQ  QRPLQDWHG IRU 2VFDUV ODFNHG WKH ´7KH $UWLVW¡VÂľ RIWKHFORVHVWUDFHVVHHPLQJO\+RZHYHUWKHRGGWKLQJ $IĂ HFNGHVHUYHVWRZLQWKH2VFDUJROGIRU´$UJRÂľ%RWK OXVWHU DERXWWKLVFDWHJRU\LVWKDWWKHWZREHVWĂ&#x20AC;OPVRIWKH\HDU RIWKHPFUDIWHGDĂ&#x20AC;OPWKDWUHDFKHGDVXVSHQVHIXOFOLPD[ %HWZHHQ 6WHYHQ 6SLHOEHUJ¡V HSLF ´/LQFROQÂľ RQ RQH WKDW KDG WKH EHVW GLUHFWLRQ ´=HUR 'DUN 7KLUW\Âľ DQG DQG D VDWLVI\LQJ GHQRXHPHQW ZKLOH DOVR EHLQJ DEOH WR RI$PHULFD¡VIDYRULWHSUHVLGHQWV.DWKU\Q%LJHORZ¡V%LQ ´$UJRÂľ ZHUHQ¡W HYHQ QRPLQDWHG LQ WKLV FDWHJRU\ SURY- GLUHFW WKHLU DFWRUV DQG FRD[ WKH EHVW SHUIRUPDQFHV RXW /DGHQPDQKXQWĂ&#x20AC;OP´=HUR'DUN7KLUW\ÂľWKHVXUSULVLQJ LQJWREHXQEHOLHYDEOHVQXEV,ZRXOGKDYHORYHGWRVHH RI WKHP (LWKHU RI WKHVH WZR Ă&#x20AC;QH GLUHFWRUV FRXOG DQG VXFFHVV RI ´6LOYHU /LQLQJV 3OD\ERRNÂľ DQG WKH REYLRXV $IĂ HFN RU %LJHORZ WDNH KRPH WKH VWDWXHWWH ,Q PRVW RI VKRXOGZLQ2VFDUJROG IURQWUXQQHU %HQ $IĂ HFN¡V VXSHUEO\ PDGH ´$UJRÂľ WKLV WKH PDMRU GLUHFWRUV DZDUGV WKH 6$*V *ROGHQ *OREHV \HDU¡V Ă&#x20AC;OPV DUH DOO HTXDOO\ VWURQJ DQG DOO FRXOG HDVLO\ %$)7$V 'LUHFWRU¡V *XLOG  $IĂ HFN LV WKH IURQWUXQQHU Best Actor KDYHZRQWKHELJDZDUGVLILWZHUHQ¡WIRUWKHVWUHQJWKLQ 7KDWEHLQJVDLGWKHQH[WEHVWEHWLV6SLHOEHUJ2VFDUKDV WKLV \HDU¡V OLQH XS 7KH IROORZLQJ DUH P\ SHUVRQDO SUH- QHYHUEHHQVK\DERXWLWVHWHUQDOORYHIRU6SLHOEHUJDQG Âť  OSCAR  PREDICTIONS,  B2 GLFWLRQVIRUWKLV\HDU¡V2VFDUZLQQHUVDQGZKDWZLOOZLQ LQFRQWUDVWWRZKDW,WKRXJKWVKRXOGKDYHZRQUHVSHFWLYHO\:H¡OOVWDUWZLWK%HVW3LFWXUH Best Picture :LOO ZLQ 7KH FOHDU DQG REYLRXV ZLQQHU KHUH LV ´$UJRÂľ%HQ$IĂ HFN¡VĂ&#x20AC;OPFKURQLFOHVWKHWHQVH,UDQKRVWDJHFULVLVZKHQD&DQDGLDQGLSORPDWVKHOWHUHG$PHULFDQVZRUNLQJDWWKH86HPEDVV\GXULQJWKHHDUO\ÂśV LQ,UDQ$IĂ HFN¡VUROHDVGLUHFWRUDQGDFWRUKDVSURYHGWR EHKLJKO\HIIHFWLYHOLNHLQ¡V´7KH7RZQÂľDQG¡V ´*RQH %DE\ *RQHÂľ $W WKLV SRLQW LQ WKH 2VFDU VHDVRQ WKHUH LVQ¡W WRR PXFK RI D FRQWHVW ´$UJRÂľ KDV EDVLFDOO\ ZRQHYHU\PDMRUDZDUGSULRUWRWKH2VFDULQFOXGLQJWKH *ROGHQ*OREHV&ULWLFV&KRLFH$ZDUGV'LUHFWRUV*XLOG $ZDUGV DQG 6FUHHQ $FWRUV¡ *XLOG 7KH LQGXVWU\ KDV VSRNHQ´$UJRÂľZLOOWDNHKRPH2VFDUJROG 6KRXOG ZLQ :KLOH LWV WLPLQJ DQG HGLWLQJ ZDV PDVWHUIXOO\ GRQH LQ D ZD\ WKDW EXLOW XS WR D WHQVLRQĂ&#x20AC;OOHG FOLPD[LQP\RSLQLRQ´$UJRÂľZDVQRWWKHEHVWĂ&#x20AC;OPRI WKH\HDU,QVWHDG.DWKU\Q%LJHORZ¡V´=HUR'DUN7KLUW\Âľ GHVHUYHV WKH WRS SUL]H %LJHORZ¡V FLQHPDWRJUDSK\ DQG HGLWLQJ LV IDQWDVWLF ´=HUR 'DUN 7KLUW\Âľ FRYHUV WKH WHQ \HDUORQJ PDQKXQW IRU 2VDPD %LQ /DGHQ DQG XQGHUWDNHQ E\ RQH &,$ DJHQW 0D\D SOD\HG EHDXWLIXOO\ E\ -HVVLFD &KDVWDLQ 7KH HQRUPRXV HPRWLRQDO SRZHU WKH Ă&#x20AC;OPKROGVLVLQLWVĂ&#x20AC;QDOIUDPHZKHQDIWHU%LQ/DGHQLV NLOOHG0D\DERDUGVDSODQHIRUKRPHDIWHUWHQ\HDUVRI CLAIRE FOLGER / AP PHOTO VHDUFKLQJIRU$O4DHGD¡VOHDGHU6KHEHJLQVFU\LQJDQG This film image released by Warner Bros. Pictures shows Bryan Cranston, eft, as Jack Oâ&#x20AC;&#x2122;Donnell and Ben KHU GLOHPPD QRZ SDUDOOHOV WKH GLOHPPD WKH 86 DV D Affleck as Tony Mendez in â&#x20AC;&#x153;Argo,â&#x20AC;? a rescue thriller about the 1979 Iranian hostage crisis.

Laughter promised for Spring Weekend REBECCA FARR

EQUINOX STAFF 5HPHPEHU .HQDQ 7KRPSVRQ DV 3LHUUH (VFDUJRWLQ´$OO7KDWÂľ"/\LQJLQWKHEDWKWXEVRDNHGLQ VXGVJRZQHGE\D\HOORZUDLQFRDWKDWDQGVZLP Ă&#x20AC;QV %ODVW IURP WKH SDVW ULJKW" :HOO JHW UHDG\ EHFDXVH WKH FXUUHQW 6DWXUGD\ 1LJKW /LYH VWDU LV FRPLQJWR.HHQH6WDWH&ROOHJH$SULO$V.6& VWXGHQWVDQWLFLSDWH7KRPSVRQ¡VFRPHG\DFWWKH\ KDYHWKHLU6WXGHQW$FWLYLWLHV&RXQFLOWRWKDQN 6$&¡V (YHQW &RRUGLQDWRU VRSKRPRUH 5\DQ 0DKDQVDLG6SULQJ:HHNHQGKDVRIWHQJLYHQWKH LPSUHVVLRQWKDWWKHUH¡V´WKLVELJFRQFHUWDQGWKHQ QRWKLQJHOVHÂľVRKHVDLGWRWKHFRPPLWWHH´:K\ FDQ¡WZHWU\WRĂ&#x20AC;JKWIRUDQRWKHUELJHYHQW"Âľ :LWK FRXQWU\ DUWLVW &KULV <RXQJ DV $SULO ¡V 6SULQJ &RQFHUW HYHQW WKDW MXVW VR KDSSHQHG WR OHDYH 6$& ZLWK HQRXJK PRQH\ WR DIIRUG WKH IRUPHU*RRG%XUJHU´HPSOR\HHÂľ2WKHUSRWHQWLDO FRPHGLDQ QDPHV OLNH WKH ´à XII\Âľ *DEULHO ,JOHVLDV DQG HYHQ :D\QH %UDG\ Ă RDWHG DURXQG WKH HYHQWFRPPLWWHHEXWWKH\ZHUHWRUHPHPEHUWKDW WKHKLJKFRVWWRSD\WKHSHUIRUPHULVQRWWKHRQO\ H[SHQVH 'LUHFWRURI6WXGHQW,QYROYHPHQWDW.6&-HQQ )HUUHOO VDLG WKH EXGJHW PXVW DOVR LQFOXGH DJHQW IHHVSURGXFWLRQFRVWVVHFXULW\QHHGVWUDQVSRUWDWLRQDQGKRVSLWDOLW\IRUWKHFHOHEULW\JXHVWV6$&¡V EXGJHWLVGHWHUPLQHGD\HDUSULRUWRZKHQLWZLOO EHVSHQWDQGLVQHJRWLDWHGE\WKHLUH[SHFWDWLRQVRI HYHQWVWKURXJKRXWWKHXSFRPLQJ)DOODQG6SULQJ VHPHVWHUV ´7KHUH DUH EXGJHWV ZLWKLQ EXGJHWÂľ 0DKDQVDLG)HUUHOOVDLGVKHKHOSV6$&DVPXFK DV VKH FDQ ZLWK ZKDW VKH DOUHDG\ NQRZV RI WKH SULFHV DQG WKH\ ´EDOOSDUN DOO WKH SRVVLEOH DUHDVÂľ IURPWKHUH  ´(DUO\ RQ ZH VLW GRZQ DQG JR WKURXJK DQG FRQVLGHUZKDWDUHWKHFRVWVIRUWKHUHVWRIWKH\HDU" :HNQRZDSSUR[LPDWHO\ZKDWVRPHHYHQWVPLJKW FRVWVRZHVHHZKDWGRHVWKDWOHDYHXVDQGKRZ PXFKGRHVLWFRVWWRUHQWDJHQHUDWRUEHFDXVHWKH J\PQHHGV>RQH@WREHDEOHWRKDQGOHHYHU\WKLQJ ZHQHHGWRGRLQWKHUH7KDW¡VÂľ)HUUHOOVDLG :KHUH GR WKH DFWXDO GROODU ELOOV FRPH IURP" 7KH DQVZHU LV VWXGHQWV $PRQJ DOO RI WKH Ă&#x20AC;QH SULQWIHHVLQFOXGHGLQ.6&¡VWXLWLRQRQHRIWKHP JRHVWR6$&7KLV\HDUEHWZHHQHYHQWVOLNH)UHVKPDQ2ULHQWDWLRQ:HHN3DUHQW:HHNHQG:LQWHU :HHNHQG DQG VHYHUDO PRUH WKH SRW IRU 6SULQJ

  KENAN,  B2

Template 022308 JJP


Black A&E / B2

THURSDAY, FEB. 21, 2013

[Keene-­Equinox.com]

26&$535(',&7,216 (Cont. from B1)

Will win: Daniel Day-Lewis in â&#x20AC;&#x153;Lincoln.â&#x20AC;? Once again, this category has a clear frontrunner, while all the other nominees have quickly faded into the background. Day-Lewisâ&#x20AC;&#x2122;s performance in â&#x20AC;&#x153;Lincolnâ&#x20AC;? was a powerhouse example of method acting. Reportedly on set, Spielberg addressed Day-Lewis as â&#x20AC;&#x153;Mr. Presidentâ&#x20AC;? because he was so far ingrained in the character, from his natural charisma and grace, his sense of humor, his tendency to tell stories, and his ability to parcel out his anger only when necessary. Day-Lewis once again proves heâ&#x20AC;&#x2122;s one of the best actors of this generation because he always seems to wear his characters like a second skin. He becomes them in ways other actors canâ&#x20AC;&#x2122;t. Should win: Day-Lewis, by a landslide. Day-Lewis won the Best Actor Oscar in 2007 for his venomous portrayal of an oil tycoon in â&#x20AC;&#x153;There Will Be Bloodâ&#x20AC;? and he will win again for his role as one of Americaâ&#x20AC;&#x2122;s most EHORYHGKLVWRULFDOĂ&#x20AC;JXUHV Best Actress Will win: Jennifer Lawrence in â&#x20AC;&#x153;Silver Linings Playbook.â&#x20AC;? Lawrence has made a name for herself after gaining Oscar recognition for her performance in â&#x20AC;&#x153;Winterâ&#x20AC;&#x2122;s Boneâ&#x20AC;? and more recently for starring in the adaptation of the best-selling â&#x20AC;&#x153;Hunger Gamesâ&#x20AC;? series. Lawrence gives a dark and comedic turn in â&#x20AC;&#x153;Silver Linings Playbook,â&#x20AC;? opposite Bradley Cooper. The two play people dealing with some serious mental illnesses brought on by some serious tragedy in their lives. Lawrenceâ&#x20AC;&#x2122;s turn in â&#x20AC;&#x153;Silver Liningsâ&#x20AC;? never delves into a clichĂŠd romantic comedy stereotype, instead going well beyond that stigma and creating a realistic character with real feelings and believable unstable behavior.

JONATHAN OLLEY / AP PHOTO

This undated publicity film image provided by Columbia Pictures Industries, Inc. shows Jessica Chastain in â&#x20AC;&#x153;Zero Dark Thirty.â&#x20AC;?

Should win: As much as I love Jennifer Lawrence, I would have taken Jessica Chastain in â&#x20AC;&#x153;Zero Dark to pretend to be the nice, hospitable gentleman, mask- all, â&#x20AC;&#x153;Les Miserablesâ&#x20AC;? proved to be an overly bloated, Thirty.â&#x20AC;? Her nuanced performance, especially in the last ing an underlying menace. In â&#x20AC;&#x153;Django,â&#x20AC;? however, Waltz PHVVLO\GLUHFWHGĂ&#x20AC;OPE\7RP+RRSHU,¡PQHYHUDIDQ plays the menace to the hateful white slavemasters. RIWKH´2VFDUEDLWÂľĂ&#x20AC;OPVÂłWKRVHRQHVZKHUH\RX¡UHVXUH VFHQHZDVZKDWEUHDWKHGOLIHLQWRWKHĂ&#x20AC;OP the director has tried to check off every single stereoShould win: Christoph Waltz. While I would type that the Academy loves. Hooper managed to do Best Supporting Actor have made the argument that the best performances that successfully when he triumphed with â&#x20AC;&#x153;The Kingâ&#x20AC;&#x2122;s Will win: While this category is not as clear-cut in in â&#x20AC;&#x153;Django Unchainedâ&#x20AC;? were provided by Leonardo Speechâ&#x20AC;? in 2010, but he doesnâ&#x20AC;&#x2122;t pull it off here. Hathaitâ&#x20AC;&#x2122;s frontrunner, Christoph Waltz, fresh off his BAFTA 'L&DSULRSOD\LQJ&DOYLQ&DQGLHWKHSULYLOHJHGĂ DP- way will probably be the only one of â&#x20AC;&#x153;Les Miserablesâ&#x20AC;? win, is looking like the best bet in this category. Waltz boyant and terrifyingly violent plantation owner, or wins. Her performance, while good, seems more like has become an Oscar darling, with his win a few Samuel L. Jackson as the head house slave in â&#x20AC;&#x153;Django,â&#x20AC;? too much of an effort to be the crying, screaming, tragic years ago for playing Hans Landa in Quentin Taranti- neither were nominated. Of the rest of the nominees, wretch of Fantine. I like subtlety in acting, this wasnâ&#x20AC;&#x2122;t it. noâ&#x20AC;&#x2122;s â&#x20AC;&#x153;Inglourious Basterds.â&#x20AC;? Once again, Waltz paired Tommy Lee Jones, while good in â&#x20AC;&#x153;Lincolnâ&#x20AC;? doesnâ&#x20AC;&#x2122;t put Should win: Sally Field for â&#x20AC;&#x153;Lincoln.â&#x20AC;? I feel as up with Tarantino for â&#x20AC;&#x153;Django Unchainedâ&#x20AC;? playing a in his very best work. though this category doesnâ&#x20AC;&#x2122;t have as much depth as it German bounty hunter who helps the title character Best Supporting Actress had in previous years, even with the big names in the seek revenge on his white slavemasters while also colcategory, but Hathawayâ&#x20AC;&#x2122;s performance is just too much. lecting his bounty. Waltz turns in another great perforWill win: Anne Hathaway in â&#x20AC;&#x153;Les Miserables.â&#x20AC;? Over- I feel her acting is unauthentic in this role, whereas she mance. Waltz is great at playing roles that require him

Decoding the Putnamâ&#x20AC;&#x2122;s choice in films HOLLY SLOANE

EQUINOX STAFF )URP WKH Ă&#x20AC;OP SURGXFWLRQ PDMRUV to classes revolving around movies WKURXJK WKH DJHV LW LV QRW GLIĂ&#x20AC;FXOW WR Ă&#x20AC;QG WKH SUHVHQFH RI Ă&#x20AC;OP DQG FLQHPD at Keene State College. But often overlooked is the KSC Film Society, which not only shares a passion for this artform, but also runs a business. The Putnam Theatre, attached to the Redfern Arts Center, is where daily events DQGVKRZLQJVRIĂ&#x20AC;OPVDUHKHOG The movies that play at the RedIHUQ DUH QRW WKH ODWHVW ER[RIĂ&#x20AC;FH KLWV but rather classics shown usually on 35 PPĂ&#x20AC;OP7KHHQWUDQFHIHHLVRQO\IRU KSC students and $5 for general admis-

sion- yet attendance is a major problem. When asked about an average crowd at a movie showing, Caleb McCandless, a member of the Film Society, shook his head and laughed. â&#x20AC;&#x153;We had 15 people the other night! Thatâ&#x20AC;&#x2122;s a lot for us!â&#x20AC;? 3HWHU &RQGRQ D Ă&#x20AC;OP SURIHVVRU DW KSC, explained that since the coming of VHS there has been a substantial change in cinema. Rather than paying to have the full theater experience, home viewing has taken over. This SUREOHP LV LQWHQVLĂ&#x20AC;HG IXUWKHU E\ WKH new digital age. 7UXH Ă&#x20AC;OP LV GLIĂ&#x20AC;FXOW WR Ă&#x20AC;QG DV major corporations such as Universal and MGM only offer digital copies. The cost of upgrading the Putnam Theatre to digital is immense-within the tens of

KELSEY OSBORN / EQUINOX STAFF

thousands. The struggle for small theaters to stay alive is nationwide, affecting Keeneâ&#x20AC;&#x2122;s local Colonial Theatre as well. As a second-run theater, large studios do not fund the transfer to digital DVWKH\ZRXOGDOXFUDWLYHĂ&#x20AC;UVWUXQWKHaters. The Film Society is trying to keep WKH DUW RI WUXH FODVVLF Ă&#x20AC;OP DOLYH 7KH students in the club, including Jonathan Correia, Chris Ruble and Meghan %RXIIDUG KDQGSLFN WKH Ă&#x20AC;OPV WKDW DUH shown and are always looking for suggestions. In order to get the attention of students, the Film Society sets up the Ă&#x20AC;OPV LQ GLIIHUHQW WKHPHV 7KH ODWHVW theme for the Putnam is â&#x20AC;&#x153;Celebrations of Cinema,â&#x20AC;? which exhibits clasVLF Ă&#x20AC;OPV ZLWK LQFUHGLEOH YLVXDOV ´:H WU\ WR Ă&#x20AC;QG LQWHUHVWLQJ SRVWHUV WR SXW up. Maybe someone will think itâ&#x20AC;&#x2122;s cool,â&#x20AC;? %RXIIDUGVDLG7KHFKRLFHRIĂ&#x20AC;OPIRUWKH club is limited by price and availability. By renting from smaller corporations, the likes of Janus Films and Drafthouse Films, the selection is limited. The efforts of the Film Society do QRW VWRS ZLWK Ă&#x20AC;OP HLWKHU 7KH FOXE has additional events and shows. One interesting production is â&#x20AC;&#x153;The Greasy Hair Club,â&#x20AC;? which features the schoolâ&#x20AC;&#x2122;s improv group, Three Ways â&#x20AC;&#x2DC;til Sunday. At the showings, the comedy group basically heckles notoriously horrible Ă&#x20AC;OPV ´7KH *UHDV\ +DLU &OXEÂľ KDG D trial run last fall, which featured two screenings. The trials were successful and the Film Society is excited for the upcoming â&#x20AC;&#x153;Clubâ&#x20AC;? showings. On Feb. 21,

the group will be heckling â&#x20AC;&#x153;Sex MadQHVVÂľ D  H[SORLWDWLRQ Ă&#x20AC;OP ZKLFK shows the deadly effects of premarital sex. The following show will be â&#x20AC;&#x153;Reefer Madness,â&#x20AC;? 1936, which similarly shows the horrors of smoking marijuana; ironically, this will be shown on April 20. Last month, the showing of â&#x20AC;&#x153;MetropoOLVÂľ D VLOHQW Ă&#x20AC;OP DFFRPSDQLHG E\ WKH Alloy Orchestra, was a sell out and the Film Society hopes to recreate the success on Feb. 28 with its showing of ':*ULIĂ&#x20AC;WK¡V´:D\'RZQ(DVWÂľ   7KHĂ&#x20AC;OPZKLFKZDVFRQVHTXHQWO\VKRW locally in the dead of winter, will be accompanied by pianist Jeff Rapsist. The 7 p.m. show will be free to students. The experience the Film Society students receive is priceless and unique. â&#x20AC;&#x153;They learn how to run a theatre, and work a projector,â&#x20AC;? Condon said, â&#x20AC;&#x153;which is very valuable experience.â&#x20AC;? With the GHFOLQHRIĂ&#x20AC;OPDQGVPDOODUWKRXVHVLW is priceless for students to gain experience before the art is extinct. According to Condon, many of the club members are Critical Film Study majors and former students often work in archival or movie houses. This club is QRWFORVHGWRRQO\Ă&#x20AC;OPPDMRUVWKRXJK and any student is welcome to attend meetings on Wednesday night. The upcoming Monadnock International Film Festival, will be hosted at the Redferm on April 4-6.

was much more natural and electric in â&#x20AC;&#x153;Rachel Getting Marriedâ&#x20AC;? for which she received an Oscar nomination for back in 2008. Field has a great performance as Mrs. Lincoln, and I would have liked to see her get recognized for her work over Hathaway. 2VFDU QLJKW VKRXOGQ¡W EH Ă&#x20AC;OOHG ZLWK WRR PDQ\ VXUprises, but I would love to see an upset in Best Supporting Actress or for Best Picture. However, in a year with many categories stacked with major talent, any could have taken home the Academy Award. However, a few JROGHQSHUIRUPDQFHVDQGĂ&#x20AC;OPVZLOOFHUWDLQO\VKLQHRQ Oscar night, with my bet being â&#x20AC;&#x153;Argoâ&#x20AC;? coming out as the big winner. Whitney Cyr can be contacted at wcyr@keene-equinox.com

.(1$1 (Cont. from B1)

Weekend was left with enough to book the $50,000 country music performer and $25,000 Thompson. Once SACâ&#x20AC;&#x2122;s FRQFHUWFRPPLWWHHFRQĂ&#x20AC;UPHG<RXQJ0DKDQSXWWKHRIIHU in for Thompson and was granted the news of acceptance. However, after this major step, the process is ongoing. â&#x20AC;&#x153;This takes more than just my position,â&#x20AC;? Mahan said. â&#x20AC;&#x153;As events coordinator, my position is to research the artist, contact the agents and put in offers to get the contract. I also put in the request for the rooms, the tech requests, anything to make the show what it is, thatâ&#x20AC;&#x2122;s my job,â&#x20AC;? Mahan said. The hospitality coordinator is who books the hotels, plans the celebâ&#x20AC;&#x2122;s transportation and even buys food for the rider. A â&#x20AC;&#x153;riderâ&#x20AC;? in show business plans and assures that the superstar has anything and everything that he or she needs, as Mahan explained it. â&#x20AC;&#x153;Some people are very extreme, others are like, â&#x20AC;&#x2DC;I just need a microphone and a light.â&#x20AC;&#x2122; We didnâ&#x20AC;&#x2122;t even get a rider for him. We thought it was a mistake in the contract but itâ&#x20AC;&#x2122;s not. Kenan [Thompson] didnâ&#x20AC;&#x2122;t seem like he was fancy or anything from my end,â&#x20AC;? Mahan said. Junior Steve Aruilio said he â&#x20AC;&#x153;would probably go see him [Thompson], but Iâ&#x20AC;&#x2122;d rather have a better music act, like an up and coming rapper, than comedy.â&#x20AC;? However, both Ferrell and the Student Activities Council anticipate a potential sell-out event, therefore the comedy act will be in the Spaulding Gymnasium, which is capable of a 1,700 person capacity. As KSC students await Spring Weekend, itâ&#x20AC;&#x2122;s vital information (remember that sketch from â&#x20AC;&#x153;All Thatâ&#x20AC;??) to be aware that tickets to see Kenan Thompsonâ&#x20AC;&#x2122;s comedy act will go on sale April 1. In the words of Pierre Escargot, â&#x20AC;&#x153;My heart is full of crispy bacon!â&#x20AC;? For KSC students, he is might also be full of humor and laughs for a memorable performance.

Holly Sloane can be contacted at hsloane@ksc.keene.edu

THE BEAT OF THE WEEK

Rebecca Farr can be contacted at rfarr@keene-equinox.com

Compiled by: Taylor Adolphson / Equinox Staff

(YHU\ZHHNIRXUVWXGHQWVDUHDVNHGZKLFKVRQJWKH\DUHOLVWHQLQJWRFUHDWLQJWKLVZHHN¡VSOD\OLVW

Julia Gomberg Sophomore Communications

â&#x20AC;&#x153;Semi-Charmed Lifeâ&#x20AC;? Third-Eye Blind

Mike Staron Junior Geology

â&#x20AC;&#x153;Strawberry Fieldsâ&#x20AC;? The Beatles

Annie White Junior General Science Education

â&#x20AC;&#x153;Dead Seaâ&#x20AC;? The Lumineers

Mike Allen Junior Safety

â&#x20AC;&#x153;Lose My Breathâ&#x20AC;? 'HVWLQ\¡V&KLOG

Template 022308 JJP


Cyan Magenta Yellow Black THURSDAY, FEB. 21, 2013

A&E / B3

[Keene-­Equinox.com]

RECYCLEMANIA 2013

Superman not easily fooled by Joker

5V^[OYV\NO4HYJO[O2LLUL:[H[LPZPUHYLJ`JSPUNJVTWL[P[PVU^P[O JHTW\ZLZHJYVZZ[OLJV\U[Y`PUVYKLY[VWYVTV[L^HZ[LYLK\J[PVU

Weekly  Pledge

,]LY`4VUKH`H[HT!WTPU[OL:[\KLU[*LU[LY JVTL[HRLHWSLKNL[VKV`V\YWHY[HUKILLU[LYLK[V^PU[OH[ ^LLRÂťZWYPaL;OLTVYL`V\WSLKNL[OLTVYLJOHUJLZ`V\OH]L [V^PU

Electronic  Waste  Collection  Week  2/18  -  2/22 ,]LY`KH`HTWTPU[OL:[\KLU[*L[ULY^L^PSSIL JVSSLJ[PUNHU`LSLJ[YVUPJ^HZ[LMYVTZ[\KLU[ZMHJ\S[`HUKZ[HMM

Caught  Green  Handed  Week  2/25  -  3/1

.L[JH\NO[YLJ`JSPUNIL[^LLUJSHZZLZHUK^PUHNYLLUI\JR >LHUUV\UJLHSVJH[PVUL]LY`KH`Âś`V\ZOV^\WHUKYLJ`JSLÂś ^LYL^HYK`V\^P[OTVUL`

Office  Clean  Out  Competition  3/11  -  3/15 Mug  Shot  Week  3/18  -  3/22

*OLJRV\[2LLUL:[H[LÂťZÂş4VZ[>HU[LKÂťWOV[VZVMZ[\KLU[Z Z[HMMHUKMHJ\S[`PU3SV`KÂťZ

Clothing  Swap  and  Drive  3/25  -  3/27

:WYPUNJSLHU`V\YJSVZL[HUKIYPUN`V\Y\U^HU[LKJSV[OPUN[V[OL :[\KLU[*LU[LY>L^PSSJVSSLJ[JSV[OPUN4VUKH`HUK;\LZKH` HTÂśWTHUK>LKULZKH`HTÂśWT1VPU\ZPUH JSV[OPUNL_JOHUNLVU>LKULZKH`ÂśWT(U`JSV[OLZSLM[V]LY ^PSSILKVUH[LK[VSVJHSVYNHUPaH[PVUZ 96*2:9LJ`JSLPUN

^^^YLJ`JSLTHUPHJZVYN

'96*2:9LJ`JSPUN

YLJ`JSPUN'RLLULLK\

WES SERAFINE

EQUINOX STAFF Iâ&#x20AC;&#x2122;ve shared with you my vast knowledge of the comic book universe for this long, so itâ&#x20AC;&#x2122;s now time I share with you one of my single favorite comic book stories of all time: Action Comics #719. While not a particularly groundbreaking story, it is one of the Ă&#x20AC;UVWFRPLFV,HYHUUHDGDVZHOODVRQHRIWKHEHVWGHPonstrations of the relationships between three of DCâ&#x20AC;&#x2122;s most popular characters. As this review is already going to be quite long and most of you likely already know the stories of Batman, Superman and Joker, weâ&#x20AC;&#x2122;ll skip the background information this week and just get right to the fun. While cleaning her apartment one day, Lois Lane collapses and is rushed to the hospital. Apparently, a Ă&#x20AC;JXULQHRI-RNHUWKDWVKHKDGNHSWDVDVRXYHQLUIURP one of Supermanâ&#x20AC;&#x2122;s previous encounters with the clown prince of crime was coated with a toxic agent she had gradually absorbed over time and is killing KHU(QUDJHGE\KLVODFNRIIRUHVLJKW6XSHUPDQĂ LHV off in search of Joker, not knowing what heâ&#x20AC;&#x2122;ll do to him. He seeks the help of Batman but Bruce recognizes that Clark is not thinking clearly because of Loisâ&#x20AC;&#x2122;s situation and sends him on a wild goose chase while he confronts Joker in Arkham. Superman, not one to be so easily fooled, catches up to him and is ready to force Joker to give him the cure for Loisâ&#x20AC;&#x2122;s poison by any means necessary. Joker offers Superman an ultimatum. Apparently, the cure is actually the original poison combined with Jokerâ&#x20AC;&#x2122;s chemically altered DNA. In order to get it, Superman must inject the poison into Joker, killing him in the process. The idea here is that Joker would effectively destroy what Superman represents since he will have taken a life with his own hands. Both he and Lois would have to live with that on their conscience. Superman is ready to do it, but Batman tries to talk some sense into him and tell him not to play Jokerâ&#x20AC;&#x2122;s twisted game. Superman almost kills Batman but is ultimately convinced that letting Lois die is the right thing to GR $W WKH KRVSLWDO /RLV Ă DWOLQHV and Superman is wrought with grief but Batman reassures him that this is what she would have wanted. However, just as all hope

seems lost, Lois starts slowly returning to health. Batman exposits that the poison would have killed The Joker but probably would only take others to the brink and then right back, the â&#x20AC;&#x153;jokeâ&#x20AC;? being that Superman would have essentially killed The Joker for no reason. Thatâ&#x20AC;&#x2122;s right, Joker was willing to die just to screw with Superman. Clark and Lois have a touching reunion and we end with Joker laughing long into the night. As I said before, this issue goes a long way toward the development of the three central characters. Letâ&#x20AC;&#x2122;s start with Superman. This issue shows Superman at one of his most vulnerable points. In the comic he says, â&#x20AC;&#x153;I can crush mountains, melt steel, are you saying I canâ&#x20AC;&#x2122;t save one woman?â&#x20AC;? Itâ&#x20AC;&#x2122;s very rare that we see Superman feeling this powerless. It brings out a side of him that is not often seen. Most people I know who criticize Superman say that they donâ&#x20AC;&#x2122;t like him because heâ&#x20AC;&#x2122;s too powerful and therefore canâ&#x20AC;&#x2122;t be defeated. If you are of that mindset, I highly suggest you track down this issue. Superman may not be harmed by bullets, but that does not mean heâ&#x20AC;&#x2122;s invincible. It actually is very similar to how Legato destroyed Vashâ&#x20AC;&#x2122;s psyche in the anime â&#x20AC;&#x153;Trigunâ&#x20AC;? by dying by Vashâ&#x20AC;&#x2122;s own hand. Now on to Joker. Iâ&#x20AC;&#x2122;ve always thought of Joker as the epitome of human evil. No powers, no morals, no regrets and no mercy, just psychosis and boredom. Villains like Darkseid, who are arguably just as powerful as Superman, may be able to hurt him, but itâ&#x20AC;&#x2122;s the normal human who nearly destroys what he is. There is literally nothing Joker will not do in order to get what he wants, making him more dangerous than any other villain in the DCU. He has no regard for any life, not even his own. He is willing to give his own life just so he could pull a prank on Superman. 7KDW¡VDOHYHORIHYLOWKDWDOPRVWGHĂ&#x20AC;HVGHVFULSWLRQ Finally thereâ&#x20AC;&#x2122;s Batman. This comic does a great job of demonstrating the relationships he has with the other two. While not as much of a boy scout as Superman, he is more level headed and is sometimes needed to talk sense into his colleague. As for his relationship with Joker, thatâ&#x20AC;&#x2122;s a bit tougher to explain. Essentially, Joker is playing a game with Superman and Supes plays right into it, much to The Jokerâ&#x20AC;&#x2122;s amusement. However, Batman always defeats The Joker because he refuses to play The Jokerâ&#x20AC;&#x2122;s game, which is how heâ&#x20AC;&#x2122;s able to convince Superman to let him live; thus, Jokerâ&#x20AC;&#x2122;s obsession with him grows.

:HV6HUDĂ&#x20AC;QHFDQEHFRQWDFWHGDW ZVHUDĂ&#x20AC;QH#NHHQHHTXLQR[FRP

Shakespeareâ&#x20AC;&#x2122;s

The Tempest

February 27March 2, 2013 7:30 PM

adapted by PeggyRae Johnson

Main Stage Redfern Arts Center Keene State College

General Admission-$10 Senior Citizens and Youth Age 17 or younger-$8 KSC Students-$6

BOX OFFICE: 603-358-2168

Template 022308 JJP


Black A&E / B4

THURSDAY, FEB. 21, 2013

[Keene-­Equinox.com]

From past to present: exploring the Redfernâ&#x20AC;&#x2122;s history DEANNA CARUSO

EQUINOX STAFF Artists and performers at Keene State College can be thankful for former President Leo Redfern and his demand for making the college into a more cultural school and the creation of the Redfern Arts Center. KSC joined the University System of New Hampshire in 1963 as Keene State College, the public liberal arts college of New Hampshire. However, there was no designated area for these performers to perform. Back in the summer of 1969, Leo Redfern became President of KSC. Redfern had a feel for the value of intellectual exploration. Quoted by the book â&#x20AC;&#x153;Strivingâ&#x20AC;? by James G. Smart, a book on the history of Keene State College, â&#x20AC;&#x153;[Leo] Redfern was easy to approach, ready to listen and extremely democratic, Redfern deeply believed in the team spirit and the team effort.â&#x20AC;? According to the book, â&#x20AC;&#x153;Redfern was more willing to commit time and money to experimentation and innovation than any previous president had been. One of his great achievements, as far as he was concerned, was the Fine Arts Building and its location at Brickyard Pond.â&#x20AC;? Redfern wanted the campus to have more of a cultural atmosphere and that is when the start of the Fine Arts Building, which we now refer to as The Redfern Arts Center, process began. A handwritten State Statute Document found in the Mason Library Archives from the 1960s said, â&#x20AC;&#x153;Each said state college shall become a multipurpose college by expanding the current programs

to provide instruction in the liberal arts During the summer of 1978, a celebration DQGVFLHQFHVDQGGHGLFDWHGDSSOLHGĂ&#x20AC;HOGV was held on Keene campus in celebration is better pare the needs in its respective of the process moving forward. The new area of location.â&#x20AC;? It became apparent to governor, Meldrim Thomson signed the former President Redfern that the college bill willingly and proudly of 958,000 dolwas, â&#x20AC;&#x153;Severely handicapped in imple- lars more with the total cost of the plan at menting the statute without adequate  GROODUV 6KHSOH\ %XOĂ&#x20AC;QFK 5LFKIDFLOLWLHVIRUWKHĂ&#x20AC;QHDQGSHUIRUPLQJDUWVÂľ ardson and Abbot Architects of Boston, according to the State Statute Document. Mass. designed the building and it was In order to begin the process of creating constructed by MacMillin Corporation of DVSHFLĂ&#x20AC;FEXLOGLQJJHDUHGWRZDUGWKHDUWV Keene. the proposal had to pass through the govRodney Obien, assistant professor, said ernment. Yet Redfern encountered several that what was in the area before the Redroadblocks on his road to creating the arts fern was constructed was, â&#x20AC;&#x153;wet landâ&#x20AC;? and center. These issues included conservative that it was constructed over the course of state government, a tight economic situa- 1979 to 1980. Also in 1988, the Putnam Thetion in the state and a declined student atre was added to the Redfern Arts Center. population. Keene turned to the Alumni On May 21, 1988, KSC became only one Association, community leaders, theater- of seven colleges and universities in the goers, students, their parents, faculty and QDWLRQWRKDYHWKHFDSDFLW\WRVKRZĂ&#x20AC;OPV the Board of Trustees to join forces and, in the 70-millimeter gauge. The Keene. â&#x20AC;&#x153;Let out a big yell for help that would be edu website states, â&#x20AC;&#x153;The Redfern stage heard around the state, â&#x20AC;? the State Statute has hosted hundreds of amazing shows, Document stated. from internationally renowned artists to The people willing to help got on the emerging young talents to KSCâ&#x20AC;&#x2122;s own stuphone and wrote letters to their legisla- dent performers. Over the years, the Redtors to spread the word about the project. fern has expanded its outreach programs With all their work, the regionâ&#x20AC;&#x2122;s legisla- and community partnerships, becoming tors heard the cry for help, but there was an indispensable resource for the Keene a long way to go for the then 4 million community and beyond.â&#x20AC;? dollar project. Music major junior Scott Pires says, According to the State Statute Docu- â&#x20AC;&#x153;Having a designated spot just for the arts ment, â&#x20AC;&#x153;The N.H. house public works com- on campus really shows importance to mittee recommended 600,000 dollars for the arts majors and Iâ&#x20AC;&#x2122;m glad to be a part preliminary planning, land acquisition of a school who takes the arts seriously.â&#x20AC;? and utility extensions.â&#x20AC;? However, the Former President Leo Redfern would be government didnâ&#x20AC;&#x2122;t agree with the capital glad that his force for a more cultural budget. In 1978, 600,000 dollars had been school has paid off. allocated. The governor had let the project become a law without his signature; Deanna Caruso can be contacted at it was now going to cost 5,200,000 dollars. dcaruso@keene-equinox.com

COMMENTARY

More than just fantasy: book series rise to the top SAM NORTON

A&E EDITOR They all start with fantasy. Whether youâ&#x20AC;&#x2122;re fantasizing over an erotic character or youâ&#x20AC;&#x2122;re fantasizing about a different lifeâ&#x20AC;&#x201D;these types of fantasies have seduced a large audience. From â&#x20AC;&#x153;Fifty Shades of Grey,â&#x20AC;? to â&#x20AC;&#x153;The Hunger Games,â&#x20AC;? these best-selling series have attracted a widespread audience and made their way to the top of the charts. According to the article â&#x20AC;&#x153;Bestselling Book Series of All Time: â&#x20AC;&#x2DC;Narniaâ&#x20AC;&#x2122; to â&#x20AC;&#x2122;50 Shadesâ&#x20AC;&#x2122;â&#x20AC;? published in The Daily Beast, â&#x20AC;&#x153;The erotic â&#x20AC;&#x2DC;Fifty Shadesâ&#x20AC;&#x2122; trilogy is about to sell over 20 million copies in the U.S., and the explosive demand shows no sign of slowing down.â&#x20AC;? However, Shadesâ&#x20AC;&#x2122; 20 million copies does not compare to the 11 million copies that â&#x20AC;&#x153;Harry Potter and the 'HDWKO\ +DOORZV 3DUW Âľ VROG ZLWKLQ WKH Ă&#x20AC;UVW 34 hours. But what is it about series that attracts readers more than any other books? Series such as â&#x20AC;&#x153;Harry Potter,â&#x20AC;? â&#x20AC;&#x153;Twilight,â&#x20AC;? â&#x20AC;&#x153;Fifty Shades of Greyâ&#x20AC;? and â&#x20AC;&#x153;The Hunger Gamesâ&#x20AC;? arenâ&#x20AC;&#x2122;t read for their exceptional storytelling, or their grammarâ&#x20AC;&#x201D;rather, they are chosen because of their characters. As readers, we like WRĂ&#x20AC;QGDZD\WRUHODWHWRFKDUDFWHUVÂłLW¡VWKHHDViest way to make the book come to life. For some a relatable character is most importantâ&#x20AC;&#x201D;but what is so appealing about a girl who swallows any ounce of her dignity to be treated like an object by a masochistic and sadistic entrepreneur that is more interested in his sexual needs than her emotional needs? The answer is that these types of characters, no matter how erotic, become a fantasy that readers can latch onto. They begin to imagine their lives through characters such as Anastasia Steele, Christian Grey, Harry Potter, Bella Swan, Edward Cullen or even Katniss Everdeen. According to the New York Times article â&#x20AC;&#x153;A Good Mystery: Why We Read,â&#x20AC;? â&#x20AC;&#x153;The gestation of a true, committed reader is in some ways a magical process, shaped in part by external

SCHOLASTIC INC. / AP PHOTO

This book cover image released by Scholastic Inc., shows the cover for the U.S. trade paperback editions of J.K. Rowlingâ&#x20AC;&#x2122;s blockbuster â&#x20AC;&#x153;Harry Potterâ&#x20AC;? series.

forces but also by a spark within the imagination â&#x20AC;Ś But what makes that one book a trigger for continuous reading? For some, itâ&#x20AC;&#x2122;s the discovery that a bookâ&#x20AC;&#x2122;s character is like you, or thinks and feels like you.â&#x20AC;? But maybe series are more successful because of the possibilities. This generation has seen countless series make their debut on the big screenâ&#x20AC;&#x201D;Harry Potter, Bella Swan and Katniss Everdeen have all debuted on the big screen, with Christian Grey LQ WKH ZRUNV 7KHVH Ă&#x20AC;OPV WKDW FKURQLFOH WKHVH infamous series not only provide readers with a concrete idea, but also serve as another way

to escape into the fantasy world that authors J.K. Rowling, Stephanie Meyer and even E.L. James have created. The girls who read these books want nothing more than to be the heroines of these books, and as a result the boys of our generation now have to compete with Edward Cullen, Harry Potter, and even Christian Grey. These series of books are no longer the best-selling and most popular books of our generation; rather, their characters have become a sensation that fans not only want to emulate, but also characters they desperately want to be real. Authors such as Charles Dickens, Jane Austen and F. Scott Fitzgerald are ones who are no longer recognizable among our generation of readers todayâ&#x20AC;&#x201D;rather, their impact is overshadowed by the poorly written, fantasy driven, series of books that are most popular today. In 50 years, our generation will be remembered for â&#x20AC;&#x153;Twilightâ&#x20AC;? and â&#x20AC;&#x153;Fifty Shades of Grey.â&#x20AC;? Rather than growing and developing and composing unforgettable storylines that are unique in their own, we have traded classic works such as â&#x20AC;&#x153;The Great Gatsbyâ&#x20AC;? and â&#x20AC;&#x153;A Tale of Two Citiesâ&#x20AC;? for poorly written series that have only succeeded due to their fantasy nature. Someone once told me that writing is never originalâ&#x20AC;&#x201D;it is always mimicked and copiedâ&#x20AC;&#x201D;if that were true what we read would sound more like â&#x20AC;&#x153;It was the best of times, it was the worst of times, it was the age of wisdom, it was the age of foolishness, it was the epoch of belief, it was the epoch of incredulity, it was the season of Light, it was the season of Darkness, it was the spring of hope, it was the winter of despair, we had everything before us, we had nothing before us, we were all going direct to Heaven, we were all going direct the other way.â&#x20AC;? But our best-selling books have proven that itâ&#x20AC;&#x2122;s no longer about the age of wisdom, but the age of fantasyâ&#x20AC;&#x201D;heading in the other way.

EMMA CONTIC / GRAPHICS EDITOR

5(')(51 (Cont. from B1)

Bass said that all of the elements incorporated into the performance, enhanced the understanding of the audience members. â&#x20AC;&#x153;It made it easier for people to connect to her workâ&#x20AC;? â&#x20AC;&#x153;I always appreciate things more when theyâ&#x20AC;&#x2122;re personal, it makes me respect them more,â&#x20AC;? Bass said. However, even though the stories present in the performance were Johnsonâ&#x20AC;&#x2122;s personal stories, she invited audience members into the experience. But while Johnson created a per-

formance based on what she knew best, the images and the stories allowed for audience members to take the journey with her and realize the impact of space and place in the moment. Johnson said, â&#x20AC;&#x153;I used to think that dance couldnâ&#x20AC;&#x2122;t change the world, but I donâ&#x20AC;&#x2122;t think that anymore. I do think that a performance can open the world up and alter how we view the world and how we relate to each other and I strive in my work to do that.â&#x20AC;? Sam Norton can be contacted at snorton@keene-equinox.com

Sam Norton can be contacted at snorton@keene-equinox.com 

Template 022308 JJP


Black

Nation & World

NATION / B5

THURSDAY, FEB. 21, 2013

[Keene-­Equinox.com]

Gun raffles stoke debate after Conn. shooting LYNNE TUOHY

ASSOCIATED PRESS Police chiefs in New Hampshire wanted more money for their youth training program. A youth hockey team in North Dakota needed more ice time. Both saw giving away guns as the answer. From car dealerships to political parties to hockey teams to yes, even police chiefs, gun giveaways are an attractive way to make money or draw in customers. But in the wake of the deadly shooting rampage in a Connecticut elementary school, VXFK UDIĂ HV DUH GUDZLQJ FULWLFLVP DV WKH HDVHRIREWDLQLQJĂ&#x20AC;UHDUPVIXHOVJXQFRQWURO debates nationwide. The New Hampshire Association of &KLHIVRI3ROLFHLVUDIĂ LQJRIIDJXQHYHU\GD\ LQ 0D\ LQFOXGLQJ D 5XJHU $5VW\OH ULĂ H with 30-round magazine similar to the one used in the Sandy Hook Elementary School shooting that killed 20 children and six educators in December. The players in West Fargoâ&#x20AC;&#x2122;s Youth Hockey $VVRFLDWLRQZLOOUDIĂ HRIIJXQVDQGDQDOO terrain vehicle next month. Up for grabs are VKRWJXQVKDQGJXQVKXQWLQJULĂ HVDQGVHPL DXWRPDWLFULĂ HV Both were planned long before the shooting in Newtown invigorated calls for increased gun control. That didnâ&#x20AC;&#x2122;t stop critLFVIURPEODVWLQJWKHUDIĂ HVDVDWEHVWLQSRRU taste and, at worst, criminal. John Rosenthal, founder and director of the Massachusetts-based Stop Handgun VioOHQFH FDOOHG WKH FKLHIV¡ UDIĂ H ´LQVDQHÂľ DQG ´FULPLQDOO\LUUHVSRQVLEOHÂľ ´,QVWDWHVLQFOXGLQJ0DLQH1HZ+DPSshire and Vermont, the winner of this AR-15 can turn around the same day and sell it to DQ\RQHZLWKRXWDQ,'RUEDFNJURXQGFKHFNÂľ 5RVHQWKDO VDLG ´7KH\ VKRXOG FDQFHO WKHLU UDIĂ HDQGJLYHDZD\DQLFHPRXQWDLQELNHRU VQRZPRELOHÂľ Jonathan Lowy, director of the legal action program at the Brady Center to Prevent Gun Violence, said he knows of no state in which WKHUDIĂ HZRXOGEHLOOHJDO%XW´KDYLQJWKHVH JXQJLYHDZD\VDQGJXQUDIĂ HVFDQWULYLDOL]H WKHVHULRXVQHVVRIĂ&#x20AC;UHDUPVÂľ/RZ\VDLG

PHILIP KAMRASS / ASSOCIATED PRESS

In this Jan. 26, 2013, photo, guns are displayed on a table on display during the annual New York State Arms Collectors Association Albany Gun Show at the Empire State Plaza Convention Center, in Albany, N.Y.

,QDOHWWHUSRVWHGRQWKHFKLHIVDVVRFLDWLRQ website, Salem Police Chief Paul Donovan extended his sympathies to the families of those killed in Newtown but stressed it and RWKHUWUDJLFVKRRWLQJV´DUHFRQWUDU\WRODZIXO DQGUHVSRQVLEOHJXQRZQHUVKLS¾ Donovan, who did not respond to interYLHZ UHTXHVWV ZURWH WKDW WKH UDIà H¡V UXOHV require winners meet all applicable state and federal laws, including background checks. 7KH JRDO RI WKH UDIà H ³ WR UDLVH  WR offset the cost of the weeklong police cadet WUDLQLQJ DFDGHP\ ³ KDV DOUHDG\ EHHQ PHW

7KHUDIĂ HWLFNHWVDWDSLHFHVROGRXW last month. 7KUHH RI WKH JXQV EHLQJ UDIĂ HG RII DUH named on a list of weapons that would be prohibited under a proposed ban introduced by Sen. Dianne Feinstein, D-Calif., in the wake of the Sandy Hook rampage. That proposal would also ban ammunition magazines that hold more than 10 rounds. While the Newtown shooting has intenVLĂ&#x20AC;HGWKHFULWLFLVPRIWKHFKLHIV¡UDIĂ HRWKHU giveaways have had similarly inauspicious timing.

Flood insurance claims languish after Sandy DAVID B. CARUSO AND GEOFF MULVIHILL

ASSOCIATED PRESS Up and down the Atlantic coast, people are telling horror stories about how long it has taken to get an insurance check IRU Ă RRG GDPDJH FDXVHG E\ 6XSHUVWRUP 6DQG\ 1HDUO\  SHUFHQW DUH VWLOO ZDLWLQJ IRU WKH Ă&#x20AC;QDO VHWWOHPHQWV WKH\ GHVperately need to rebuild. 7KHGHOD\VKDYHSURPSWHGFULWLFLVPIURPRIĂ&#x20AC;FLDOVLQFOXGing New Jersey Gov. Chris Christie, who has blamed the ERWWOHQHFNVSDUWO\RQ´H[FHVVLYHSDSHUZRUNÂľUHTXLUHPHQWV RIWKH1DWLRQDO)ORRG,QVXUDQFH3URJUDP But federal data suggest that the speediness, or sluggishness, of the process may be linked to which insurance company is handling your claim. 7KUHH DQG D KDOI PRQWKV DIWHU WKH 2FW  VWRUP VRPH RI WKH SULYDWHVHFWRU FRPSDQLHV WKDW VHUYLFH Ă RRG LQVXUance policies for the government program have paid out on nearly all of their claims by now, while others have yet to hit the halfway mark. 6HOHFWLYH,QVXUDQFH&RRI$PHULFDD1HZ-HUVH\EDVHG FDUULHUKLWZLWKĂ RRGFODLPVDIWHUWKHVWRUPKDGEHHQ DEOHWRVHWWOHRQO\SHUFHQWRIWKRVHSROLFLHVDVRI0RQGD\ according to data collected by the Federal Emergency Management Agency. %\FRPSDULVRQ$OOVWDWH,QVXUDQFH&RKDGFORVHGSHUFHQW RI LWV  FODLPV SD\LQJ RXW VRPH  PLOOLRQ WR VWRUPYLFWLPV7KDW¡VIDUPRUHWKDQWKHPLOOLRQGLVWULEuted by Selective. Such disparities make a huge difference to struggling homeowners. $IWHU WKH Ă RRGZDWHUV UHFHGHG $OOVWDWH VHQW D SDUDGH of adjusters and a building engineer to Danny Gallagherâ&#x20AC;&#x2122;s KRPHRQ6WDWHQ,VODQGDVLQJOHIDPLO\UDQFKWKDWKDGEHHQ washed off its foundation. He received a check for the full YDOXHRIKLVSROLF\PLQXVKLVGHGXFWLEOHLQDURXQG a month. ´0\LQVXUDQFHFRPSDQ\GLGYHU\ZHOOE\PHÂľ*DOODJKHU said. Meanwhile, Anthony Cavallo said he waited two months EHIRUH DQ HQJLQHHU KLUHG E\ 6HOHFWLYH YLVLWHG KLV Ă RRGHG home in Union Beach, N.J., to make a crucial assessment

After a 2011 shooting rampage in Arizona wounded Rep. Gabrielle Giffords and killed six others, the county Republican Party rafĂ HGRIID*ORFNKDQGJXQWRUDLVHPRQH\IRU voter outreach. ,WVVORJDQZDV´+HOS3LPD*23JHWRXWWKH YRWHDQGPD\EHKHOS\RXUVHOIWRDQHZ*ORFNÂľ 7KHFRXQW\*23LQWHULPFKDLUPDQVDLGDWWKH time he didnâ&#x20AC;&#x2122;t think there was anything inappropriate about the promotion. Missouri state Rep. John McCaherty UDLVHGFDPSDLJQIXQGVODVW$XJXVWE\UDIĂ LQJ

Ailing Chavez returns to Venezuela FABIOLA SANCHEZ AND IAN JAMES

ASSOCIATED PRESS President Hugo Chavez returned to Venezuela early Monday after more than two months of treatment in Cuba following cancer surgery, his government said, triggering street celebrations by supporters who welcomed him home while he remained out of sight at Caracasâ&#x20AC;&#x2122; military hospital. Chavezâ&#x20AC;&#x2122;s return was announced in a series of three messages on his 7ZLWWHU DFFRXQW WKH Ă&#x20AC;UVW RI WKHP UHDGLQJ ´:H¡YH DUULYHG RQFH DJDLQ in our Venezuelan homeland. Thank you, my God!! Thank you, beloved nation!! We will continue our treatPHQWKHUHÂľ 7KH\ ZHUH WKH Ă&#x20AC;UVW PHVVDJHV WR appear on Chavezâ&#x20AC;&#x2122;s Twitter account since Nov. 1. ´,¡P FOLQJLQJ WR &KULVW DQG WUXVWLQJ LQ P\ GRFWRUV DQG QXUVHVÂľ another tweet on Chavezâ&#x20AC;&#x2122;s account VDLG ´2QZDUG WRZDUG YLFWRU\ always!! We will live and we will triXPSKÂľ Vice President Nicolas Maduro said on television that Chavez arrived at 2:30 a.m. and was taken to the Dr. Carlos Arvelo Military Hospital in Caracas, where he will continue his treatment. Chavezâ&#x20AC;&#x2122;s announced return to Caracas came less than three days after the government released the Ă&#x20AC;UVWSKRWRVRIWKHSUHVLGHQWLQPRUH than two months, showing him looking bloated and smiling alongside his daughters. The government didnâ&#x20AC;&#x2122;t release any additional images of Chavez upon his arrival in Caracas, and unanswered questions remain about where he stands LQDGLIĂ&#x20AC;FXOWDQGSURORQJHGVWUXJJOH with an undisclosed type of pelvic cancer. Chavez was re-elected to a new VL[\HDU WHUP LQ 2FWREHU DQG KLV inauguration, originally scheduled IRU -DQ  ZDV LQGHĂ&#x20AC;QLWHO\ SRVWponed by lawmakers in a decision that the Supreme Court upheld

  GUN  GIVEAWAY,  B6

  CHAVEZ,  B6

EU ministers reject arming Syrian rebels DON MELVIN AND GEIR MOULSON

ASSOCIATED PRESS European Union foreign ministers announced Monday that they were keeping current sanctions against Syria in place for three months, rejecting attempts to alter an embargo on the country so WKDW DUPV FRXOG EH IXQQHOHG WR UHEHOV Ă&#x20AC;JKWLQJ President Bashar Assad. However, in an apparent nod to the U.K, which had argued that the rebels should be exempted from the embargo, the ministers adopted a nonVSHFLĂ&#x20AC;F DPHQGPHQW ´VR DV WR SURYLGH JUHDWHU non-lethal support and technical assistance for WKHSURWHFWLRQRIFLYLOLDQVÂľ EU foreign policy chief Catherine Ashton said WKDW WKH PHDQLQJ RI WKDW ZRXOG EH GHĂ&#x20AC;QHG LQ meetings among the representatives of member countries to the union. She denied to reporters that the wording was a political fudge. Still, British Foreign Secretary William Hague appeared to claim victory, saying many countries had not even wanted to discuss changing the

embargo at a meeting in November. ´0RVWVWDWHVZHUHRSSRVHGWRDQ\DPHQGPHQW of the embargo and today we have amended it in a very important way, in a couple of very imporWDQWZD\VÂľ+DJXHVDLG He added that further amendments could be made three months from now, an indication that Britain might continue its push to arm the rebels. ´:HZLOOKDYHWRKDYHWKDWGHEDWHDWWKHWLPH DQG,WKLQNWKDWZLOOGHSHQGRQZKHWKHUDQ\SROLWical progress is now made in Syria and depend on the continued loss of life which continues on an DSSDOOLQJDQGXQDFFHSWDEOHVFDOHÂľ+DJXHVDLG Several EU foreign ministers said, in strong terms, that they opposed sending any more arms into the ravaged country. That view was supported Monday by a new report by a U.N.-appointed panel that said Syriaâ&#x20AC;&#x2122;s civil war is becoming increasingly sectarian and the behavior of both sides is growing more and more radicalized. The report urged the international community to curb the supply of weapons

  EU  MINISTERS,  B6

Fishingâ&#x20AC;&#x2122;s decline looms; will fish eaters notice? JAY LINDSAY

ASSOCIATED PRESS MARK LENNIHAN / ASSOCIATED PRESS

Beachfront homes damaged by Superstorm Sandy in the Breezy Point area of the Queens borough of New York are still in need of repair, Friday, Feb. 15, 2013.

over whether the house could be salvaged. He said he is still waiting for a copy of the engineerâ&#x20AC;&#x2122;s UHSRUWLILWZDVHYHUĂ&#x20AC;QLVKHGEXWODVWZHHNĂ&#x20AC;QDOO\UHFHLYHG D FKHFN LQ WKH PDLO PDUNHG ´IXOO DQG Ă&#x20AC;QDO SD\PHQWÂľ IRU  He said that is less than his policy limit and less than half of what it will cost to rebuild. ´, DP EH\RQG WKH KRUURU RI ORVLQJ HYHU\WKLQJ ZH RZQÂľ said Cavallo, who has been living with his wife and daughter in a trailer parked in their driveway while the insurance VWUXJJOHVSOD\RXW´7HDUWKHSLHFHRIFUDSGRZQDQGOHWPH PRYHRQZLWKP\OLIHÂľ Selective declined to make anyone available for an interYLHZEXWVDLGLQDZULWWHQVWDWHPHQWWKDW)(0$¡VGDWD´GRHV

  FLOOD  INSURANCE,  B6

+LV FLW\¡V EHVW Ă&#x20AC;VKLQJ GD\V are long past it, but lifelong Gloucester resident Ron Gilson still sees what once was when he drives past what remains. Thereâ&#x20AC;&#x2122;s the waterfront lot, litWHUHG ZLWK GLVFDUGHG Ă&#x20AC;VKLQJ nets and lobster pots, where vesVHOV LQ WKH IDPHG Ă&#x20AC;VKLQJ Ă HHW once docked. The clatter and grit of a top maritime machine shop downtown has been replaced E\ D EDQTXHW KDOO 2Q WKH VWDWH Ă&#x20AC;VK SLHU ZKHUH *LOVRQ EULHĂ \ parks, the sounds of year-round work have given way to the quiet whirr of his idling Prius. 7RWKH\HDUROGWKHGHFOLQH

of the industry has stolen jobs, community spirit and opportunity. And itâ&#x20AC;&#x2122;s not over, Gilson said. ´7KLV LV WKH ORZHVW SRLQWÂľ KH declared on a February day. ´7RPRUURZZLOOEHORZHUÂľ ,Q 0D\ 1HZ (QJODQG¡V Ă&#x20AC;VKermen will again see a cut to the QXPEHU RI Ă&#x20AC;VK WKH\ FDQ FDWFK this time so deeply that the historic industryâ&#x20AC;&#x2122;s existence is WKUHDWHQHG IURP 5KRGH ,VODQG to Maine. But as hard as the cuts DUH OLNHO\ WR KLW Ă&#x20AC;VKLQJ FRPPXnities, local seafood eaters may QRW QRWLFH DW DOO ,Q WKH UHJLRQ¡V markets, grocery stores and resWDXUDQWV LPSRUWHG Ă&#x20AC;VK GRPLnate, and the cuts make that less likely to change.

The cuts will shrink the FDWFKOLPLWSHUFHQWIRUFRGLQ the Gulf of Maine and 61 percent for cod in Georges Bank, off southeastern Massachusetts. Thatâ&#x20AC;&#x2122;s the worst of a series of reductions to the catch of botWRPGZHOOLQJ JURXQGĂ&#x20AC;VK VXFK DV KDGGRFN DQG Ă RXQGHU WKDW many fear could be fatal to the industry. ´7KH\¡UHJRLQJWRZLSHLWRXWÂľ VDLG *LOVRQ ´7KH RQO\ WKLQJ thatâ&#x20AC;&#x2122;s going to be the same is the RFHDQ\RX¡UHORRNLQJDWÂľ )RU Ă&#x20AC;VK FRQVXPHUV D VKDUS GURS LQ WKH ORFDO JURXQGĂ&#x20AC;VK catch may jar a select group of GLQHUVZKRVHHNĂ&#x20AC;VKFDXJKWWKDW day. But the cutâ&#x20AC;&#x2122;s effects may not

  FISHING  DECLINE,  B6

Template 022308 JJP


Cyan Magenta Yellow Black NATION / B6

THURSDAY, FEB. 21, 2013W

[Keene-­Equinox.com]

*,9( *,9($:$<

&+$9(= (Cont. from B5)

(Cont. from B5)

RIIDQ$5VHPLDXWRPDWLFULĂ HD month after a similar gun was used in the Aurora, Colo. movie theater shooting that killed 12 people and wounded 58. McCaherty didnâ&#x20AC;&#x2122;t return calls seeking comment. The owner of an Atlanta-area sporting goods store doesnâ&#x20AC;&#x2122;t understand the outrage. Last November, Jay Wallace offered anyone who brought their â&#x20AC;&#x153;I 9RWHGÂľVWLFNHUDUDIIOHWLFNHWWRZLQ a handgun or rifle from his store, Adventure Outdoors. When Georgiaâ&#x20AC;&#x2122;s secretary of state pointed out itâ&#x20AC;&#x2122;s a felony to offer gifts for votes, Wallace opened it up to anyone. Wallace said the whole thing had been resolved by the time a local state senator filed a complaint about the raffle with the state, setting off a barrage of publicity. â&#x20AC;&#x153;It was really unbelievable â&#x20AC;&#x201D; it PDGHLWDURXQGWKHZRUOGÂľKHWROG the Associated Press. â&#x20AC;&#x153;Thousands of people signed up for the raffle. :HZHUHUHDOO\JUDWHIXOWRKLPÂľ Wallace said he sees no problem with chiefs of police or anybody else raffling guns. ´,W¡VJRLQJWRDJRRGFDXVHÂľ:DOlace said. â&#x20AC;&#x153;People want a chance to win something that they want. (YHU\ERG\ZLQVÂľ Jack Kimball, chairman of Granite State Patriots and organizer of a rally outside the New Hampshire statehouse last month opposing gun control, said it angers him that people are using Sandy Hook and other tragic shootings to bash the New Hampshire chiefs. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s hysteria that doesnâ&#x20AC;&#x2122;t belong KHUHÂľVDLG.LPEDOO´7KH\VKRXOGQ¡W ZDYLHU7KH\VKRXOGKDYHWKHUDIIOHÂľ The gun raffle is the first held by the chiefs association and could be the last if Robert Sprague gets his way. The marketing consultant wrote Donovan 31 emails â&#x20AC;&#x201D; one for every gun being raffled â&#x20AC;&#x201D; before he finally heard back. Although he couldnâ&#x20AC;&#x2122;t stop this yearâ&#x20AC;&#x2122;s raffle, Sprague said Donovan seemed open to his offer of help to promote a different kind of fundraiser next year. â&#x20AC;&#x153;I feel weâ&#x20AC;&#x2122;ve made some progress, DQGWKDW¡VEHWWHUWKDQQRSURJUHVVÂľ Sprague said. â&#x20AC;&#x153;I just donâ&#x20AC;&#x2122;t think peace officers should be putting JXQVRQWKHVWUHHWVÂľ Sprague discussed his concerns on WNHN radio, which began its own fundraising campaign to try to raise $30,000 for the cadet academy so the association wouldnâ&#x20AC;&#x2122;t have to raffle the guns.

AP PHOTO/JULIO CORTEZ, FILE)

In this file photo of Jan. 23, 2013, Anthony Cavallo looks at the doorway to the room of his daughter Amy in Union Beach, N.J., where the family has been living in a trailer next to their home damaged by Superstorm Sandy because the house was uninhabitable as they awaited storm aid.

)/22' ,1685$1&( (Cont. from B5)

QRWWHOOWKHHQWLUHVWRU\Âľ ,W VDLG FHUWLĂ&#x20AC;HG DGMXVWHUV ZHUH LQ VKRUW supply and had extremely large workloads because of the massive number of claims. Many policyholders, the company said, also â&#x20AC;&#x153;do not XQGHUVWDQGWKHFRYHUDJHÂľDQGZHUHDSSHDOLQJ payments unnecessarily. So far, the National Flood Insurance Program has been hit with more than 138,000 claims related to Sandy. Companies participating in the program have collectively paid out $4.1 billion. Selective is handling more Sandy-related flood claims than any other company. The bulk of its customers are in hard-hit areas of New Jersey, where claims might be extra-complicated because of the severity of the damage. â&#x20AC;&#x153;Since Sandy, we have been working steadily WRTXLFNO\DQGDFFXUDWHO\KDQGOHFODLPVÂľVDLGD statement from the Branchville, N.J.-based company. â&#x20AC;&#x153;Many of our own employees, because we are headquartered in NJ and our largest regional office is in NJ, were impacted by the VWRUPDVZHOOÂľ Insurance companies have little incentive to delay payment of claims.

(80,1,67(56 (Cont. from B5)

DQGDQWLJRYHUQPHQWIRUFHVWRSDUWZLWKIRUHLJQĂ&#x20AC;JKWHUV A number of ministers said they were placing their hopes on the mediation efforts of Lakhdar Brahimi, the joint U.N.Arab League envoy to Syria. ´7KHUH LV QR VKRUWDJH RI DUPV LQ 6\ULDÂľ /X[HPERXUJLVK Foreign Minister Jean Asselborn said. â&#x20AC;&#x153;With more arms, WKHUHDUHPRUHNLOOHGPRUHDWURFLWLHVÂľ The U.N. says nearly 70,000 people have been killed in 6\ULD¡VFRQĂ LFWVLQFHWKHUHYROWDJDLQVW$VVDGEHJDQLQ0DUFK 2011. Despite the appalling violence, diplomatic efforts continue. Mouaz al-Khatib, the president of the opposition coalition, has said he would negotiate with representatives of Syriaâ&#x20AC;&#x2122;s governing party â&#x20AC;&#x201D; though not with Assad or members of his security services. Brahimi, the international envoy, says that offer â&#x20AC;&#x153;challenges the Syrian government to fulfill its often-repeated assertion that it is ready for dialogue and a peaceful settlePHQWÂľ The report released in Geneva on Monday by the U.N.appointed Independent International Commission of Inquiry on Syria made for alarming reading.

),6+,1*'(&/,1( (Cont. from B5)

ripple further than that. Just 9 percent of the seafood eaten in the United States is domestically caught, the federal government estimates. In New England, locally caught cod was just a slightly larger fraction of all cod eaten, 12 percent, DFFRUGLQJWRĂ&#x20AC;VKHULHVHFRQRPLVW-HQQ\6XQ of the Portland, Maine-based Gulf of Maine Research Institute. And she estimates that could drop to 4 percent after the coming cuts. Much of the imported cod is caught and frozen in Norway and cut in China, and thereâ&#x20AC;&#x2122;s plenty of it, Sun said. If the local cod FDWFK GLSV WR QHDU QRWKLQJ Ă&#x20AC;VK SURFHVVRUV ´FRXOGHDVLO\Ă&#x20AC;OOLQZLWKLPSRUWVÂľ6XQVDLG In fact, the biggest issue for one Maine seafood processing executive has been the perception that the New England industryâ&#x20AC;&#x2122;s WURXEOHVPHDQKHZRQ¡WKDYHĂ&#x20AC;VK But prices will likely change little after the cuts because substitutes are plentiful,

Under the rules of the National Flood Insurance Program, the federal government ultimately foots the bill for all claim payouts. Insurance companies make a commission selling policies and are allowed to keep a share of the annual premiums to cover administrative costs, but have none of their own capital at risk when claims are paid or denied. Insurers are paid a fee for processing claims, but they cannot collect until a claim is closed, meaning carriers that resolve things quickly get paid faster. Payments for approved claims are higher than they are for denials. A few companies have pushed hard for quicker closures. The USAA General Indemnity Co. has closed 83 percent of its relatively modest 3,261 Sandy flood claims, placing it second after Allstate in terms of the completion rate among companies handling a substantial number of storm claims. Travelers Group has closed a less-stellar 58 percent of its 18,215 claims, but it also advanced more than $223 million to customers whose settlements have yet to be finalized. When those partial payouts are taken into account, it ranks among the companies that have paid the most to customers, with a total distribution approaching $602 million. The Hartford Fire Insurance Co., according to FEMA, has closed a similar 56 percent of its 10,693 claims but has advanced much less in partial payments. So far, it has paid out just under $230 million, or an average of $23,588 per submitted

Discussing events since July, it said human rights abuses by anti-government groups did not â&#x20AC;&#x153;reach the intensity and scale of those committed by government forces and affiliDWHGPLOLWLDÂľ%XWLWVDLGUHEHOVKDYHFRQWLQXHGWRHQGDQJHU civilians by placing military targets in civilian areas. The commission, set up by the U.N. Human Rights Council, hasnâ&#x20AC;&#x2122;t been able to enter the country and said that â&#x20AC;&#x153;sigQLILFDQWO\OLPLWHGÂľLWVDELOLW\WRLQYHVWLJDWHDOODOOHJHGDEXVHV â&#x20AC;&#x201D; particularly those committed by armed anti-government groups. The report was based on 445 interviews with victims and witnesses. â&#x20AC;&#x153;The war has become colored by sectarianism, permeated by opportunistic criminality and aggravated by the presHQFHRIIRUHLJQILJKWHUVDQGH[WUHPLVWJURXSVÂľWKHSDQHOVDLG It said the number of foreigners fighting in the conflict KDVLQFUHDVHGEXWVWLOODFFRXQWVIRU´DVPDOOSURSRUWLRQÂľRI anti-government groups â&#x20AC;&#x201D; though it remains hard to assess with accuracy their numbers. Still â&#x20AC;&#x153;their expertise and experience in matter of IEDs and insurgency warfare have brought a substantial contribuWLRQWRWKHRSSRVLWLRQ¡VWDFWLFDOHIIHFWLYHQHVVÂľWKHUHSRUWVDLG It added that foreign fighters appear to come from countries in the Middle East, North Africa and Central Asia, â&#x20AC;&#x153;many IURP/LE\D7XQLVLD6DXGL$UDELD/HEDQRQ,UDTDQG(J\SWÂľ It urged anti-Assad groups to â&#x20AC;&#x153;detach themselves from

claim, not including those later closed without payment. That ranks it alongside Selective in terms of the least money advanced so far when divided by the total number of claims. By comparison, Allstateâ&#x20AC;&#x2122;s average payout per submitted claim is $50,845. Hartford spokesman Thomas Hambrick said he couldnâ&#x20AC;&#x2122;t discuss the companyâ&#x20AC;&#x2122;s handling of claims in detail, but added, â&#x20AC;&#x153;We take this work seriously and are working with FEMA to resolve flood claims from Storm Sandy as TXLFNO\DVSRVVLEOHÂľ Drawing comparisons between the companies isnâ&#x20AC;&#x2122;t entirely clear-cut. The statistics donâ&#x20AC;&#x2122;t take into account factors like a companyâ&#x20AC;&#x2122;s mix of business or level of exposure to the storm. It is possible for an insurer to have paid less money to customers to date simply because its policyholders suffered less damage, or had purchased less coverage. In a letter to New Jerseyâ&#x20AC;&#x2122;s congressional delegation this month, Gov. Christie blamed National Flood Insurance Program rules for leading to payment delays. He said the programâ&#x20AC;&#x2122;s paperwork requirements were â&#x20AC;&#x153;extraordinarily extensive, requiring up to 12 hours for an adjuster to complete a single proof of loss IRUPÂľ â&#x20AC;&#x153;Claimants whose houses have washed away are provided large and daunting forms requiring an itemization of each and every item lost as well as potentially requiring receipts and serial QXPEHUVIRULQGLYLGXDOLWHPVÂľKHVDLG

the foreign fighters, particularly extreme elements that fail to comply with international human rights and humanitarLDQODZÂľ The commission also found that the civil war â&#x20AC;&#x153;is becoming more militarized because of the proliferation of weapons DQG W\SHV RI ZHDSRQV XVHGÂľ ZLWK DUPV DQG DPPXQLWLRQ smuggled across Syriaâ&#x20AC;&#x2122;s borders to anti-government groups on an increasingly regular basis. It said government forces have increasingly used cluster PXQLWLRQV EXW WKHUH ZDV ´QR FUHGLEOH HYLGHQFHÂľ RI HLWKHU side using chemical weapons. Government forces and allied militia committed murder, WRUWXUH UDSH DQG HQJDJHG LQ ´HQIRUFHG GLVDSSHDUDQFHVÂľ among other violations of human rights and international law, the report found. Anti-government groups have committed war crimes including murder, torture and hostage-taking, it said. It accused both sides of using children in the conflict â&#x20AC;&#x201D; with government-affiliated militia using under-18s in fighting and children under 15 participating in hostilities in armed opposition groups. The panel also said it will submit a new, confidential list of Syrians suspected of committing crimes against humanity in the countryâ&#x20AC;&#x2122;s civil war to the U.N. high commissioner for human rights, Navi Pillay, next month.

said Chris Fream, senior sales executive at North Atlantic Inc., a processor in Portland, Maine. â&#x20AC;&#x153;The sky certainly isnâ&#x20AC;&#x2122;t falling because a) we knew it was coming and b) weâ&#x20AC;&#x2122;ve prepared for it and thereâ&#x20AC;&#x2122;s other species that are DURXQGÂľKHVDLG 7KH UHPDLQLQJ Ă&#x20AC;VKHUPHQ KDYH OLPLWHG RSWLRQV 7KH 1RUWKHDVW¡V JURXQGĂ&#x20AC;VK Ă HHW had 420 boats in 2011, a drop of 150 in just two years, and many of those who continue WRĂ&#x20AC;VKGRVREHFDXVHWKH\KDYHQRFKRLFH Scituate fisherman Frank Mirarchi noted wryly that, at 69, he has few employment options. The fishermen he cooperates with, pooling quota and resources, have discussed taking even more boats out of the water and trying to hang in with whatever they can catch. ´7KLVLVQRWDORQJWHUPVWUDWHJ\Âľ0LUDUchi said. â&#x20AC;&#x153;Something needs to happen before RUZHDOOJRGRZQWKHWXEHVÂľ The crew on Gloucester fisherman Richard Burgessâ&#x20AC;&#x2122;s two boats is family, and he CHARLES KRUPA / ASSOCIATED PRESS said he hasnâ&#x20AC;&#x2122;t considered selling out of the In this photo taken Wednesday, Feb. 13, 2013, Ron Gilson, a 79-year-old life Gloucester business. native, walks along the fish pier in Gloucester, Mass.

despite complaints by the opposition. Some speculated that with &KDYH] EDFN KH FRXOG Ă&#x20AC;QDOO\ EH sworn in. *RYHUQPHQW RIĂ&#x20AC;FLDOV GLGQ¡W address that possibility. Information Minister Ernesto Villegas broke into song on television early Friday, exclaiming: â&#x20AC;&#x153;Heâ&#x20AC;&#x2122;s EDFNKH¡VEDFNÂľ ´%UDYRÂľ 9LOOHJDV VDLG EHIRUH state television employees joined him in the studio clapping and celebrating. $ JLDQW LQĂ DWHG &KDYH] GROO was placed beside a corner of the National Assembly building. Villegas reiterated in an interview with Venezuelan broadcaster Union Radio that Chavez is going WKURXJK D ´GLIĂ&#x20AC;FXOW KDUG DQG FRPSOH[ÂľUHFRYHU\SURFHVVDQGWKDWKLV UHWXUQ GRHVQ¡W FKDQJH WKH ´GLIĂ&#x20AC;FXOW FLUFXPVWDQFHVKHKDVEHHQLQÂľ Villegas said that he hadnâ&#x20AC;&#x2122;t yet seen the president and that the government will provide updates about his condition â&#x20AC;&#x153;whether theyâ&#x20AC;&#x2122;re good RUWKH\¡UHEDGÂľ The vice president later presided over a televised Cabinet meeting at the presidential palace, though he didnâ&#x20AC;&#x2122;t offer additional details about Chavez. ´+HZLOOOLYHDQGKHZLOOWULXPSKÂľ Maduro said at the end of the meeting, while on television an image of Chavezâ&#x20AC;&#x2122;s face was superimposed on the oval-shaped table. Hundreds of Chavez supporters celebrated his return in downtown Caracas, chanting his name and holding photos of the president in Bolivar Plaza. A man holding a megaphone boomed: â&#x20AC;&#x153;Our comPDQGHUKDVUHWXUQHGÂľ Fireworks exploded in some parts of Caracas while the presidentâ&#x20AC;&#x2122;s followers celebrated. Dozens of supporters gathered outside the hospital, where a sign atop the building is adorned with a photo of Chavez. Holding photos of Chavez and wearing the red T-shirts of his socialist movement, WKH\ FKDQWHG ´+H¡V EDFNÂľ $V FDUV passed, drivers honked in support. ´,ZDQWWRVHHP\SUHVLGHQWÂľVDLG Alicia Morroy, a seamstress who stood outside the hospital on the verge of tears. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve missed him a lot because Chavez is the spirit of the SRRUÂľ Six hospital employees who were asked about the president said they hadnâ&#x20AC;&#x2122;t seen him. Yusmeli Teran, a waitress who serves food to patients, told The Associated Press that the area where Chavez was EHLQJ WUHDWHG RQ WKH WK Ă RRU LV D restricted area guarded by police and soldiers. â&#x20AC;&#x153;No one has seen him DWDOOÂľVKHVDLG Chavezâ&#x20AC;&#x2122;s precise condition and the sort of cancer treatments he is undergoing remain a mystery, and speculation has grown recently that he may not be able to stay on as president. 'U &DUORV &DVWUR VFLHQWLĂ&#x20AC;F director of the Colombian League Against Cancer in Bogota, Colombia, said that given the governmentâ&#x20AC;&#x2122;s accounts that Chavez is undergoing ´FRPSOH[Âľ WUHDWPHQW KH WKLQNV KH likely will have to step down. â&#x20AC;&#x153;Unfortunately, the cancer he has isnâ&#x20AC;&#x2122;t going to go away, and heâ&#x20AC;&#x2122;s returning to continue his battle. But I think heâ&#x20AC;&#x2122;s conscious that he LVQ¡W JRLQJ WR ZLQ KLV Ă&#x20AC;JKW DJDLQVW cancer, as much as heâ&#x20AC;&#x2122;d like to win LWÂľ&DVWURWROGWKH$3LQDWHOHSKRQH interview. Based on the governmentâ&#x20AC;&#x2122;s accounts, doctors must have performed a tracheotomy on Chavez, cutting an opening in his windpipe to facilitate breathing, according to Dr. Jose Silva, a pulmonary specialist and president of the Venezuela Pulmonology Society. Silva said he thinks Chavez is breathing with the help of a ventilator through a tube attached to his windpipe. Patients with breathing problems often require a tracheotomy to avoid damage to the vocal chords when a ventilator is used for an extended period. The Venezuelan Constitution says that if a president dies or steps down, a new vote must be called and held within 30 days. Chavez raised that possibility before he left for Cuba in December by saying that if necessary, Maduro should run in a new vote to replace him. Chavezâ&#x20AC;&#x2122;s return could be used to give a boost to his would-be successor and gain time to â&#x20AC;&#x153;consolidate his DOWHUQDWLYH OHDGHUÂľ DKHDG RI D SRVsible new presidential vote this year, said Luis Vicente Leon, a Venezuelan pollster and political analyst.

Template 022308 JJP


Cyan Magenta Yellow Black THURSDAY, FEB. 21, 2013

6,*+766(7 (Cont. from B10)

7KLV XSFRPLQJ VHDVRQ LQ DGGL WLRQ WR WKH YDUVLW\ SURJUDP WKH 2ZOV SODQ WR KDYH D MXQLRU YDUVLW\ VTXDG WR KHOS EXLOG IRU WKH IXWXUH ´6RPHRIWKRVHJX\V>IUHVKPDQ@ZLOO KDYH WKH RSSRUWXQLW\ WR SOD\ DQG KHOSXVRXWULJKWDZD\µ+RZHVDLG ´6RPH RI WKH JX\V PD\ EH D \HDU DZD\µ $FFRUGLQJ WR +RZH WKH -9 WHDP LV H[SHFWHG WR SOD\  WR  JDPHV WKLVVHDVRQ´:LWKVRPHRIWKHIUHVK PHQ WKDW ZH EURXJKW LQ LQVWHDG RI KDYLQJ WKHP VLW DURXQG DQG ZDWFK  JDPHV WKLV \HDU WKH\ ZLOO KDYH DQRSSRUWXQLW\WRSOD\µ+RZHVDLG ´7KH\ KDYH WKH RSSRUWXQLW\ QRW WR MXVWSUDFWLFHEXWSOD\DQGJHWEHWWHU WKDWZD\µ )RUWXQDWHO\ IRU WKH 2ZOV WKHUH DUH VRPH NH\ UHWXUQHUV RQ WKLV \HDU·V VTXDG ZLWK VLJKWV VHW RQ UHWXUQLQJWRWKH1&$$WRXUQDPHQW -XQLRU ULJKWKDQGHG SLWFKHU 6KDZQ (JDQLVFRPLQJRIIRIDVROLGVHDVRQ RQWKHPRXQGSRVWLQJDHDUQHG UXQDYHUDJHLQDSSHDUDQFHV (JDQVDLGWKDWWKH\RXQJHUSOD\ HUV QHHG WR ÀOO WKRVH YDFDQW VSRWV EXW DV D WHDP WKH\ QHHG WR SOD\ WRJHWKHUWRZLQ´([SHFWDWLRQVDVD WHDP DUH WR ZLQ DV PDQ\ JDPHV DV SRVVLEOHDQGPDNHLWEDFNWRUHJLRQ DO·Vµ (JDQ VDLG ´8OWLPDWHO\ ZH·G

OLNHWRPDNHLWWR:LVFRQVLQWRWKDW FKDPSLRQVKLSµ .HHQH 6WDWH &ROOHJH ZHOFRPHV EDFNMXQLRULQÀHOGHU1LFN9LWD9LWD KLWDWWKHSODWHODVWVHDVRQDQG VWDUWHGJDPHVIRUWKH2ZOV´:H ORVW D ORW RI SRZHU KLWWHUV  >/DUU\@ /RQJR >3HWHU@ %XUJLR >(ULN@ %HUJ VWURPEXWZH·OOKDYHDJRRGWHDPµ 9LWD VDLG ´:H·YH JRW D ORW RI QHZ \RXQJ WDOHQW WKDW FDQ FRPH LQ DQG EHHIIHFWLYHULJKWDZD\µ 2WKHU NH\ UHWXUQHUV IRU WKH 2ZOV LQFOXGH /LWWOH (DVW &RQIHU HQFH $OO6WDU LQÀHOGHU *UHJ %DWHV ZKR KLW  ODVW VHDVRQ DQG OHG WKH WHDP LQ KLWV DQG UXQV VFRUHG $OVR VHQLRU VWDUWLQJ SLWFKHU &KULV &UXWFKHU ZLOO UHWXUQ RQ WKH KLOO IRU WKH2ZOV.HHQHLVH[SHFWHGWRKDYH IXOO\ UHKDELOLWDWHG VHQLRUV (ULF 3HU UDXOW6SHQFHU+XWFKLQVRQDQG.\OH 8QGHUZRRG LQ WKH WKURZLQJ URWD WLRQDVZHOO +LVWRULFDOO\ WKH 2ZOV FRPSHWH DJDLQVW SRZHUKRXVH SURJUDPV LQ WKH 1RUWKHDVW UHJLRQ ERWK LQ DQG RXW RI FRQIHUHQFH .HHQH ÀQLVKHG  LQ WKH /LWWOH (DVW &RQIHUHQFH ODVW VHDVRQ DQG ZDV VHOHFWHG WLHG IRU VHFRQG ZLWK (DVWHUQ &RQQHFWL FXW6WDWH8QLYHUVLW\LQWKH/(&SUH VHDVRQ FRDFKHV· SROO 8QLYHUVLW\ RI 6RXWKHUQ 0DLQH UHFHLYHG WKH WRS UDQNLQJ IRU WKH VHYHQWK WLPH VLQFH  /DVW \HDU .6& SOD\HG D GLI ÀFXOW UHJLRQDO VFKHGXOH LQFOXGLQJ

D SDLU RI JDPHV DJDLQVW 'LYLVLRQ ,,, UXQQHUXS :KHDWRQ &ROOHJH LQ 0DVV 7KH 2ZOV ZHUH DEOH WR VDO YDJH D VHDVRQ VSOLW ZLWK WKH /\RQV DIWHU ZLQQLQJ LQ VWHOODU IDVKLRQ DW KRPHODWHODVWVHDVRQ&RDFK+RZH SUHSDUHV KLV SURJUDP \HDULQ DQG \HDURXW ZLWK GLIÀFXOW VFKHGXOHG FRPSHWLWLRQ ´$ERXW VL[ \HDUV DJR , UHDOO\ VWDUWHG JRLQJ WR WKH WHDPV ZKRPDGHLWWRUHJLRQDOVDQGVWDUWHG DGGLQJWKHPWRRXUVFKHGXOHµ +RZH VDLG ´.QRZLQJ WKH TXDO LW\DQGGHSWKRIWKH/LWWOH(DVW>&RQ IHUHQFH@ZDQWLQJWRSOD\WKHEHVWRXW RIWKHFRQIHUHQFHKHOSVWKHVWUHQJWK RIVFKHGXOHLQWKHFRQIHUHQFH,W·VDOO GRQH REYLRXVO\ IRU WKH EHWWHU RI XV EXWWKHFRQIHUHQFHDVZHOOµ 7KH 2ZOV ZLOO SUDFWLFH LQGRRUV XQWLO WKH\ KDYH FDSDELOLWLHV WR JHW RXWVLGH .HHQH ZLOO RSHQ WKHLU DQQXDO VHDVRQ RQ /RQJ ,VODQG 1< ZKHQWKH\SOD\IRXUJDPHVLQWKUHH GD\VVWDUWLQJ0DUFK6KRUWO\DIWHU WKH2ZOVZLOOWUDYHOIXUWKHUVRXWKWR :LQWHU+DYHQ)ODZKHUHWKH\SOD\  JDPHV LQ HLJKW GD\V ´,·G OLNH WR JHWULGRIWKUHHIHHWRIVQRZDQGJHW EDFN RXWVLGHµ +RZH VDLG ´:H·UH ORRNLQJ IRUZDUG WR /RQJ ,VODQG LI WKH\·YH GXJ RXW E\ WKHQ )ORULGD DIWHUWKDWDQGJHWWLQ·LW>WKHVHDVRQ@ JRLQJµ CHRIS PALERMO / FILE PHOTO

Brian Schnee can be contacted at KSC senior Greg Bates makes the throw to first base during a game against Plymouth State University on bschnee@keene-equinox.com April 10, 2012 at the Owl Athletic Complex.

Little East preseason poll: softball ranked no. 2

KOBY DUNKLING / FILE PHOTO

The 2012 KSC softball team huddles before a double header against Western Connecticut State University on April 4, 2012 at the Owl Athletic Complex.

RANK

TEAM

TOTAL POINTS

2012 RECORD 2012 LEC RECORD

EASTERN CONN. STATE UNIVERSITY

62

44-3

14-0

2

KEENE STATE COLLEGE

52

28-12-1

10-4

3

PLYMOUTH STATE UNIVERSITY

44

21-21

7-7

4

WESTERN CONN. STATE UNIVERSITY

42

30-15

7-7

5

RHODE ISLAND COLLEGE

35

19-18

10-4

6

UNIVERSITY OF MASS-BOSTON

27

17-21

3-11

7

UNIVERSITY OF MASS-DARTMOUTH

17

12-28

3-11

8

UNIVERSITY OF SOUTHERN MAINE

9

4-36

2-12

1

SPORTS / B7

[Keene-­Equinox.com]

0-75,%87( (Cont. from B10)

James is better than Michael Jordan? 7KH ÀUVW WKLQJ , ZRXOG OLNH WR EULQJ XS LV WKDW 0LFKDHO -RUGDQ FDQ SXW DQ 1%$ FKDPSLRQVKLS ULQJ RQ HYHU\ VLQJOH RQH RI WKH ÀQJHUV RQ KLV ULJKW KDQG +H FDQ HYHQ SXW D ULQJ RQ RQH RI WKH ÀQJHUV RQ KLV OHIWKDQG /H%URQ -DPHV KDV 21( 5,1* +H KDV ZRQ 21( &+$03,216+,3 0LFKDHO -RUGDQ KDV ZRQ HYHU\ VLQJOHFKDPSLRQVKLSVHULHVWKDWKHSOD\HGLQ/H%URQ -DPHVLVRQHIRUWKUHH 6HFRQGO\ZK\LV.REH%U\DQWQRWLQWKH´JUHDWHVW RIDOOWLPHµGHEDWH"6XUHKH·VDORXV\WHDPPDWHDWEHVW %XWKHLVWKHRQO\SOD\HULQWKH1%$WKDWFDQFXUUHQWO\ EHFRPSDUHGWRWKHJUHDW0LFKDHO-RUGDQ :LWK ÀYH FKDPSLRQVKLS ULQJV  WULSV WR WKH $OO 6WDUJDPHDQGWZR1%$ÀQDOV093DZDUGVGHFRUDW LQJ KLV WURSK\ FDELQHW , WKLQN KH·V D PRUH VXLWDEOH FDQGLGDWHIRUWKH´ZKR·VEHWWHUWKDQ0LFKDHO-RUGDQ"µ GHEDWH &KDPSLRQVKLSV KDYH WR EH WKH WUXH PHDVXUH RI D SOD\HU·V WDOHQWV ,W·V QRW OLNH URRNLHV FRPH LQWR WKH OHDJXH DQG VD\ ´, ZDQW WR VFRUH PRUH SRLQWV WKDQ 0LFKDHO -RUGDQµ RU ´, ZDQW WR OHDG WKH OHDJXH LQ SRLQWVSHUJDPHµ

7KHVHDWKOHWHVFRPHLQWRWKHOHDJXHDQGWKH\VD\´, ZDQWWRZLQDVPDQ\1%$FKDPSLRQVKLSVDV0LFKDHO -RUGDQµ (YHQ0LFKDHO-RUGDQDJUHHV$FFRUGLQJWRDQDUWL FOH RQ /$7LPHVFRP KH VDLG ´ÀYH EHDWV RQH HYHU\ WLPH,ORRNDWLWµ$QGKH·VULJKW6XUH/H%URQPD\DGG PRUHULQJVWRKLVÀQJHUVEHIRUHKLVFDUHHUHQGV $QG,DPFHUWDLQO\QRWVD\LQJWKDWKHKDVQRFKDQFH LQGRLQJVR%XWXQWLOKHGRHVOHW·VSOHDVHMXVWSXWWKLV GHEDWHWRUHVW0\VDQLW\LVLQMHRSDUG\KHUHIRONV Michelle Berthiaume can be contacted at mberthiaume@keene-equinox.com

MOST NBA CHAMPIONSHIPS BILL RUSSELL

11

SAM JONES

10

JOHN HAVLICEK

8

TOM HEINSOHN

8

K.C. JONES

8

TOM SANDERS

8

ROBERT HORRY

7

JAMES LOSCUTOFF

7

1(:/22.648$' (Cont. from B10)

D QDPH RQH VKRXOG JHW IDPLOLDU ZLWK DV VKH ORRNV WR EH WKH FOHDUFXW QXPEHU RQH VWDUWHU 6KH SXWV H[FHO OHQWVSLQRQWKHEDOODQGIHDWXUHVDQDUUD\RISLWFKHV LQFOXGLQJDIDVWEDOOFKDQJHXSVSOLWWHUVFUHZEDOODQG DULVHEDOO &ULVSVDLGDERXWKHUILUVW\HDU´,NQRZWKDW,DP SUREDEO\JRLQJWRJHWDGHFHQWDPRXQWRISLWFKLQJWLPH LQEHFDXVHWKH\JUDGXDWHGIRXUSLWFKHUV,WKLQNLWZLOO EHIXQµ &RDFK%HDFKDGGHG´(YHU\ERG\·VJRWQHZSLWFKHUV DQGWKHRQO\RQHWKDWHYHU\ERG\NQRZVDERXWLVKHUH &ULVSLVDUHDOO\TXDOLW\SLWFKHU,H[SHFWKHUWREHDQ LPSDFWSOD\HULPPHGLDWHO\µ +HFRQWLQXHG´7KHIRXUSLWFKHUVZHKDYHQRZDUH DOO ILUVW\HDU SLWFKHUV $OWKRXJK WKH SURPLVH LV JRRG DQG , OLNH WKH ZD\ WKH\·UH ZRUNLQJ ZH KDYHQ·W VHHQ WKHPLQDFROOHJHJDPH\HWµ 7KH RIIHQVH RQ WKH RWKHU KDQG KDV OHVV TXHVWLRQ PDUNVFRPLQJLQDVWKHWRSWKUHHKLWWHUVIURPODVW\HDU -HVVLFD)ORUHQ]D1LFROH'XSXLVDQG6DPDQWKD1LWVR DOOUHWXUQ 1LWVRILQLVKHGODVW\HDUZLWKDEDWWLQJDYHUDJH DQGVDLGVKHEDVLFDOO\SOD\HGDOOODVWVHDVRQKXUWZLWK D WRUQ ODEUXP LQ KHU VKRXOGHU PDNLQJ KHU QXPEHUV WKDWPXFKPRUHLPSUHVVLYH ´,KDGVXUJHU\RQLWLQ$XJXVWVR,·PVWLOOUHFRYHU LQJ IURP LWµ 1LWVR VDLG ´, ZDQW EHWWHU QXPEHUV WKLV \HDUIRUVXUH,MXVWOLNHWRJRXSWKHUHOLNH,DPJRLQJ WRFUXVKLWVR,JRXSZLWKFRQILGHQFHDQGWKDW·VZKHQ ,GRWKHEHVWµ )ORUHQ]D DQG 'XSXLV ZKR ERWK VSRUWHG WUHPHQ GRXV UHFRUGV ODVW VHDVRQ DUH WKH WHDP FDSWDLQV ZKR ZLOOEHLQFKDUJHRIILOOLQJWKHOHDGHUVKLSUROH

-9%$6(%$// (Cont. from B10)

7KH DPRXQW RI XSSHUFODVVPHQ WKDWDOUHDG\KDYHPDMRUUROHVRQWKH WHDPGRHVQ·WOHDYHDORWRIURRPIRU QHZSOD\HUVWRJHWJDPHH[SHULHQFH DQGWKH-9WHDPZLOOSURYLGHWKDW 7KH 2ZOV DUHQ·W WKH RQO\ RQHV ZKR VHH WKH DGYDQWDJHV LQ D -9 WHDP )HOORZ /LWWOH (DVW &RQIHU HQFH WHDPV 8QLYHUVLW\ RI 6RXWK HUQ0DLQHDQG(DVWHUQ&RQQHFWLFXW 6WDWH 8QLYHUVLW\ DOVR KDYH VXFFHVV IXO-9SURJUDPV +RZHVHHVLWDVDULVNIUHHPRYH VD\LQJ WKHUH DUH ¶]HUR· GLVDGYDQ WDJHVWRDGGLQJWKHWHDP7KHSOD\ HUV VHHP WR IHHO WKDW ZD\ DV ZHOO :KHQ DVNHG LI KH ZDV ZRUULHG DERXW EHLQJ GHPRWHG PLGVHDVRQ IUHVKPDQFDWFKHU,DQ6FKRRQPDNHU

&RDFK%HDFKVDLG´,·PQRWSXWWLQJDQ\SUHVVXUHRQ WKHP7KH\ZLOOSXWSUHVVXUHRQWKHPVHOYHV>7KHSOD\ HUV@DUHSUHWW\DVWXWHDVWRZKDWQHHGVWREHGRQHKHUHµ 1LWVRDGGHG´:HKDYHYHU\HQFRXUDJLQJVHQLRUV,I WKH\WKLQN\RXDUHGRLQJVRPHWKLQJZURQJWKH\ZLOO KHOS\RXIL[LWµ 3DUWRIWKHUHDVRQWKH.6&VRIWEDOOWHDPKDVEXLOW VXFKDVWURQJSURJUDPLVWKDWWKHUHDUHQRH[FXVHVWR EHPDGHZKHWKHULW·VD\RXQJWHDPRUDYHWHUDQVDYY\ RQH ´,·P H[SHFWLQJ YHU\ KLJK UHVXOWV , UHFUXLW TXDOLW\ DWKOHWHV DQG , H[SHFW WKHP WR FRPH LQ KHUH DQG SHU IRUPµ%HDFKVDLGDVKHSRLQWHGWRWKHZDOORIIRUPHU SOD\HUV´0DQ\RIWKHVHSHRSOHSHUIRUPHGIURPWKHLU IUHVKPDQ\HDURQ7KH\MXVWVWHSSHGULJKWLQDQGRII ZHZHQWµ %HDFK ZLOO KDYH D JRRG LGHD RI ZKDW WKLV WHDP LV PDGHRIIURPWKHYHU\EHJLQQLQJDVWKHWKHLUVSULQJ EUHDNWULSWR)ORULGDZLOOEHQRFDNHZDON 7KH\ ZLOO WUDYHO GRZQ WR &OHUPRQW )OD IURP 0DUFKZKHUHWKH\ZLOOIDFHRIIDJDLQVWDQXPEHU RI WHDPV LQFOXGLQJ 53, 6LPPRQV 5LSRQ %RZGRLQ 6DOYH5HJLQDDQG681<3ODWWVEXUJK ´<RXNQRZWKHODVWIHZ\HDUV,KDGDQDWWLWXGHDERXW P\ WHDP DQ\ERG\ DQ\WLPH DQ\ZKHUH DQG , PHDQ WKUHH (&$& FKDPSLRQVKLSV DQG D UXQQHUV XS LQ WKH 1&$$·V WKDW DSSOLHV WR WKHP WKH\ UHSUHVHQWHG WKDW DWWLWXGHµ%HDFKVDLG +HDGGHG´,GRQ·WWKLQN,ZDQWWRVWLFNWKHIUHVK PHQZLWKWKDWDWWLWXGHULJKWRIIWKHEDWEXW,DOVRGRQ·W WKLQN WKDW , ORVH P\ DWWLWXGH DERXW VWHSSLQJ XS DQG SOD\LQJDQ\ERG\µ :LWK WKH VHDVRQ ULJKW DURXQG WKH FRUQHU GRQ·W H[SHFW\RXWKWRKROGWKLVWHDPEDFN Jay McAree can be contacted at jmcaree@keene-equinox.com

VDLG ´,·P QRW EHFDXVH LI ,·P VWUXJ JOLQJ , ZRXOG ZDQW WR JR GRZQ WR -9 DQG JHW PRUH DW EDWV VR , FDQ ZRUNRQP\VWXIIGRZQWKHUHµ 7KH SOD\HUV DUH H[SHFWLQJ RQO\ JRRG WKLQJV RXW RI WKH QHZ WHDP %HLQJ DEOH WR WHOO UHFUXLWV WKH\·OO KDYH DQ RSSRUWXQLW\ WR SOD\ WKHLU ÀUVW\HDUGRHVQ·WKXUWHLWKHU 7KH WHDP ZLOO EH FRDFKHG E\ -HII 3HONH\ .\OH 0RULOO DQG 7LP 7KLHVLQJ DOO RI ZKRP DUH IRUPHU SOD\HUV JUDGXDWLQJ IURP .6& ODVW \HDU0RVWRIWKHVSHFLÀFVDUHVWLOO EHLQJZRUNHGRXW$VNHGKRZHDFK URVWHU ZDV FRPLQJ +RZH VDLG HYHU\SOD\HUZDVRQERWKWHDPVIRU QRZ7KHVFKHGXOHLVVWLOOQRWFRP SOHWHG HLWKHU DV RQO\ D IHZ /(& WHDPVKDYHD-9VTXDG %XW &RDFK +RZH WKLQNV HYHU\ WKLQJ ZLOO IDOO LQWR SODFH DV WKH VHDVRQ SURJUHVVHV :KHQ DVNHG

KRZ KLV SOD\HUV ZLOO GHDO ZLWK LW +RZH GRHVQ·W SUHWHQG WR NQRZ DOO WKHDQVZHUV ´+RQHVWO\,WKLQNWKDW·V\HWWREH GHWHUPLQHG WKH SOD\HUV NQRZ WKH VLWXDWLRQ VR WKH\·UH RXW KHUH FRP SHWLQJWU\LQJWRJHWWKRVHVSRWVDQG ZH·OO VHH KRZ LW SOD\V RXWµ +RZH VDLG $WOHDVWWKHWHDPKDVWLPH7KH 2ZOVRSHQWKHLUVHDVRQRQ0DUFK DJDLQVW6W-RVHSK·V8QLYHUVLW\ 7KH\PD\QRWNQRZH[DFWO\KRZ WKLVH[SHULPHQWZLOOZRUNRXWEXW WKH ERWWRP OLQH LV WKDW LI WKH WHDP ORVHV VWDUWHUV WKURXJK WKH FRXUVH RIWKHORQJVHDVRQWKH\NQRZWKH\ FDQ FRQÀGHQWO\ FDOO RQ D EDFN XS ZKR·VSUHSDUHGIRUWKHJDPH Zach Winn can be contacted at zwinn@keene-equinox.com

Lakers’ flamboyant owner, dies at 80 GREG BEACHAM

ASSOCIATED PRESS -HUU\ %XVV EXLOW D JOLWWHU LQJ OLIH DW WKH LQWHUVHFWLRQ RI VSRUWVDQG+ROO\ZRRG $IWHU JURZLQJ XS LQ SRY HUW\ LQ :\RPLQJ KH HDUQHG VXFFHVV LQ DFDGHPLD DHUR VSDFH DQG UHDO HVWDWH EHIRUH GLVFRYHULQJ KLV IDYRULWH YRFD WLRQ ZKHQ KH ERXJKW WKH /RV $QJHOHV/DNHUVLQ :KLOH %XVV ZURWH WKH FKHFNV DQG IRVWHUHG SDUWQHU VKLSVZLWKWZRJHQHUDWLRQVRI EDVNHWEDOO JUHDWV WKH /DNHUV ZRQ1%$WLWOHVDQGEHFDPH DJODPRURXVJOREDOEUDQG :LWKDVFLHQWLVW·VDQDO\WLFDO VNLOOVDSOD\ER\·VÁDLUDEXVL QHVVPDQ·V PRQH\PDNLQJ VDYY\ DQG D GLHKDUG KRRSV IDQ·V KHDUW %XVV IDVKLRQHG WKH /DNHUV LQWR D UHPDUNDEOH VSRUWV HQWLW\ 7KH\ EHFDPH

D QLJKWO\ KDSSHQLQJ RIWHQ GHÀQHG E\ MXVW RQH ZRUG FRLQHGE\%XVV6KRZWLPH ´+LV LPSDFW LV IHOW ZRUOG ZLGHµVDLG.REH%U\DQWZKR KDV VSHQW QHDUO\ KDOI KLV OLIH ZRUNLQJIRU%XVV %XVVZKRVKHSKHUGHGKLV 1%$ WHDP IURP WKH 6KRZ WLPH G\QDVW\ RI WKH V WR WKH FXUUHQW %U\DQW HUD ZKLOH EHFRPLQJ RQH RI WKH PRVW LPSRUWDQW DQG VXFFHVVIXO RZQHUV LQ SUR VSRUWV GLHG 0RQGD\+HZDV ´7KLQN DERXW WKH LPSDFW WKDWKH·VKDGRQWKHJDPHDQG WKH GHFLVLRQV KH·V PDGH DQG WKH EUDQG RI EDVNHWEDOO KH EURXJKW KHUH ZLWK 6KRZWLPH DQG WKH LPSDFW WKDW KDG RQ WKHVSRUWDVDZKROHµ%U\DQW VDLGDIHZGD\VDJR ´7KRVHYLEUDWLRQVZHUHIHOW WR D NLG DOO WKH ZD\ LQ ,WDO\µ %U\DQWVDLG

GENE PUSKAR / AP PHOTO

In this May 17, 1980 file photo, Los Angeles Lakers Earvin “Magic” Johnson hugs team owner Jerry Buss in the locker room after they won the 1980 NBA championship.

Template 022308 JJP


Black SPORTS / B8

THURSDAY, FEB. 21, 2013

[Keene-­Equinox.com]

+,*+(;3(&7$7,216 (Cont. from B10)

joined the team her sophomore year and according to her teammates, she will be a key part to this yearâ&#x20AC;&#x2122;s team. Fellow senior Lauren Brown said, â&#x20AC;&#x153;Kristen has a good voice on the field and thatâ&#x20AC;&#x2122;s really important.â&#x20AC;? Curry added, â&#x20AC;&#x153;Kristen Schmidt looks like she is going to do good things on defense for us this year. Eliza Witherbee and Lauren Brown are back and they were our two leading attackers so they will be big.â&#x20AC;? Lauren Brown returns to the Lady Owls after a spectacular junior season, leading the team in goals scored with 53. Brown was sixth in the Little East Conference for goals per game, averaging 2.9. She was also named second team All-LEC, along with Nicole Curry. Although the team is looking to maintain the same success as last season, Brown said that they are still trying new things. â&#x20AC;&#x153;We are making new plays, trying new defensive line-ups. We want to be the team to beat,â&#x20AC;? Brown said. Along with Lauren Brown, junior Eliza Witherbee returns to the Owls attack, also hoping to maintain some of the success she had last year. Witherbee was the leading point scorer for the Owls with 46 goals and 16 assists. Witherbee said her teammates and her are looking to get another Little East Conference title. â&#x20AC;&#x153;We need to keep up what weâ&#x20AC;&#x2122;ve been doing. We need to mesh well, especially because we have a lot of new attackers. We need to be able to connect quickly,â&#x20AC;? Witherbee said. According to Witherbee, junior goaltender Erin Taylor will also be a crucial returner this season. â&#x20AC;&#x153;She [Taylor] has another year with us but even over these past two seasons, sheâ&#x20AC;&#x2122;s improved a lot.â&#x20AC;? Taylor was third in the Little East Conference last season for save percentage (.521) while playing 18 games. The Owls started outdoor practice on Jan. 28 at the Owl Athletic Complex. They are one of two spring teams that have already taken to the outdoor fields, the other being

21(/$67 6+27 (Cont. from B10)

to win the meet and I think in the outdoor season itâ&#x20AC;&#x2122;s a realistic goal to say that they can compete and they can win that championship, which would be fantastic for our program,â&#x20AC;? Napolitano said. In terms of the menâ&#x20AC;&#x2122;s team, Coach Napolitano expects huge things out of two-time All-American Glenn Guilmette, who finished fourth in the javelin at last yearâ&#x20AC;&#x2122;s National Championships. Guilmette, now a senior, has been a dominant force within the LEC since his freshman year. He said a lot of his hard work throughout the years leads up to this season and hopefully he can accomplish his pursuit of a national title.

the menâ&#x20AC;&#x2122;s lacrosse team. Nicole Curry said, â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s very cold when the sun goes down. The turf literally turns into an ice skating rink. But it benefits us because itâ&#x20AC;&#x2122;s so different breathing in the outside air and using the full size field we have.â&#x20AC;? Lauren Brown added that the team has only practiced inside once since Jan. 28. She said, â&#x20AC;&#x153;It was tough after the storm [Nemo] hit. There was one or two days where we were trying to figure out what to do.â&#x20AC;? The Owls hope to warm up with a Spring Break trip to West Palm Beach, Fla. where they will play RPI and St. Lawrence University on March 11. Lauren Brown, Eliza Witherbee and Nicole Curry agreed that the Spring Break trip will be a big test for the Owls. Witherbee said, â&#x20AC;&#x153;Thatâ&#x20AC;&#x2122;s when we really start to mesh as a team and get to know each other.â&#x20AC;? Curry added, â&#x20AC;&#x153;We know everything about each other after Spring Break.â&#x20AC;? Last season, the Owls split their trip to West Palm Beach, Fla. They dropped their first game to Brockport State, 16-10. But won the second game, 20-11, over Mount Saint Mary College of New York. Integrating the freshmen into the Owls close knit squad will be a challenge the team hopes to overcome on Spring Break, according to Lauren Brown. But Brown added that she sees significant promise in freshman, Kailtin Nolan. Nolan hails from Mahopac, N.Y. According to MaxPreps.com, in her senior season at Mahopac High School, Nolan had 32 goals and 15 assists. Nicole Curry said, â&#x20AC;&#x153;Kaitlin plays high attack and she can put the ball in the back of the net. In fall ball and preseason, sheâ&#x20AC;&#x2122;s been doing real well. Hopefully that will continue into the season.â&#x20AC;? Nolan and her freshmen counterparts will be put to the test, along with the rest of the Owls, when they open their season against Springfield College at home on Monday, March 4 at 4 p.m. CHRIS PALERMO / FILE PHOTO

Michelle Berthiaume can be contacted at mberthiaume@keene-equinox.com

â&#x20AC;&#x153;Hopefully Iâ&#x20AC;&#x2122;ll have more of an advantage over the juniors and the sophomores Iâ&#x20AC;&#x2122;ll be competing against,â&#x20AC;? Guilmette said. â&#x20AC;&#x153;I have more experience than them but you never know whatâ&#x20AC;&#x2122;s going to happen. Sometimes you just have a great throw and thatâ&#x20AC;&#x2122;s how it is with javelin, unfortunately.â&#x20AC;? After breaking former Owl Dan Colinaâ&#x20AC;&#x2122;s school record last year, Guilmette said he hopes to break his own record at 70 meters (230 feet). â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s just a mark thatâ&#x20AC;&#x2122;s been seamed into my head from my previous thrower Dan Colina, who used to throw for Keene State [College],â&#x20AC;? Guilmette said. Coach Napolitano had his own thoughts on Guilmetteâ&#x20AC;&#x2122;s final season. â&#x20AC;&#x153;Essentially every track meet he goes to, I expect him to win and not just distance wise but also with the strongest technique and I think that thatâ&#x20AC;&#x2122;s something he can accomplish,â&#x20AC;?

Napolitano said. â&#x20AC;&#x153;Obviously we want to go out to nationals and we want him to be successful again. If you look back at his career, heâ&#x20AC;&#x2122;s been in a Keene State [College] uniform for three years, heâ&#x20AC;&#x2122;s qualified for Nationals three times, heâ&#x20AC;&#x2122;s been All-American twice and heâ&#x20AC;&#x2122;s just as hungry his senior year as he was last year so I expect him to improve.â&#x20AC;? High expectations donâ&#x20AC;&#x2122;t just stop at Guilmette. Head Track Coach, Pete Thomas has led both programs for the last three decades. He said he thinks a lot of his athletes will be competing this season for something larger than theyâ&#x20AC;&#x2122;ve ever accomplished in the past. But the indoor season is still his primary focus. â&#x20AC;&#x153;As we finish indoors weâ&#x20AC;&#x2122;re still looking at Janel Haggerty and Maggie Fitter making it to Nationals as well as perhaps a relay team,â&#x20AC;?

KSC sophomore Julie Trombetta drives past defenders during a game against Westfield State University on March 24, 2012 at the Owl Athletic Complex.

Thomas said. â&#x20AC;&#x153;Fitter competed outdoors last year in Nationals. She wants to go beyond competing and gather an All-American award. The other runners are really looking to improve their marks and qualify for deeper into the season,â&#x20AC;? Thomas added. Thomas said Janel Haggerty is an athlete whoâ&#x20AC;&#x2122;s been looking for a National title run for the last couple of years as a multi-event athlete and will continue to pursue that outdoors. Haggerty competes in the pentathlon and the heptathlon, participating in the long jump, high jump, the 110 hurdles, the 200, the 800, shot put, and the javelin. â&#x20AC;&#x153;I felt I had a pretty good season with the pentathlon,â&#x20AC;? Haggerty said. â&#x20AC;&#x153;I did another one also two years ago so I feel like I have a little bit of experience and I kind of had a season to get used to it, see how things go

and what kind of training it takes and everything. Iâ&#x20AC;&#x2122;ve been going out of my way doing whatever I can to make sure Iâ&#x20AC;&#x2122;m just as good if not better than my competition.â&#x20AC;? Haggerty said the weather is really the only concern and difference from outdoor to indoor track. Another difference is the javelin is not an indoor event, but the training stays pretty much the same. Thomas said other than his seniors, there are some underclassmen heâ&#x20AC;&#x2122;ll be expecting to make an impact out on the track this coming season. These athletes include Samantha Goldsmith, Ben Keach and Lauren Markoe. Napolitano said thereâ&#x20AC;&#x2122;s a lot of potential from everywhere on the team but making a prediction right now is difficult. â&#x20AC;&#x153;Would I like to have a bunch of kids go out to Nationals? Absolutely,â&#x20AC;? Napolitano said. â&#x20AC;&#x153;I think I have a few kids on the team that can

make that jump but the question is will they make that jump and thatâ&#x20AC;&#x2122;s going to take a lot of hard work and a lot of dedication.â&#x20AC;? The 2013 spring outdoor season is expected to be one of the most competitive and exciting seasons to date for both Owl programs and Guilmette was able to put those expectations for the season simply. â&#x20AC;&#x153;I know thereâ&#x20AC;&#x2122;s a lot of good throwers and good runners on the team now,â&#x20AC;? Guilmette said. â&#x20AC;&#x153;Hopefully weâ&#x20AC;&#x2122;ll all have a good season and theyâ&#x20AC;&#x2122;ll have a good season and weâ&#x20AC;&#x2122;ll be there putting the Keene State [College] name out there.â&#x20AC;? Keep your eyes on the sky as the KSC Owls will be planning to make a rise in the Little East this coming spring. Dalton Charest can be contacted at dcharest@keene-equinox.com

Griner reaches 3,000 points as Baylor beats UConn DOUG FEINBERG

ASSOCIATED PRESS Brittney Griner and top-ranked Baylor withstood WKHLUĂ&#x20AC;UVWVHULRXVFKDOOHQJHLQWZRPRQWKV&RDFK.LP Mulkey hopes it will prepare them for the important games ahead. â&#x20AC;&#x153;This was a great game for womenâ&#x20AC;&#x2122;s basketball,â&#x20AC;? Mulkey said Monday night after her teamâ&#x20AC;&#x2122;s 76-70 victory over No. 3 Connecticut. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s not going to be a game that we get on the plane and celebrate we just beat UConn. It gave us a gauge of what to expect. It will help improve (UConn) and help improve my team.â&#x20AC;? After building a seven-point lead in the second half, Connecticut had no answer for Griner. Then again, few teams have during her stellar college career. The All-America center scored 21 of her 25 points after halftime, including the 3,000th of her career, to help extend Baylorâ&#x20AC;&#x2122;s winning streak to 23 games. She became the eighth womenâ&#x20AC;&#x2122;s player in Division I history

than a potential Big East blowout. â&#x20AC;&#x153;Playing a game like this with a month before the NCAA tournament, I canâ&#x20AC;&#x2122;t think of anything better to do at this point of the season,â&#x20AC;? he said. â&#x20AC;&#x153;Absolutely itâ&#x20AC;&#x2122;s going to help. Thereâ&#x20AC;&#x2122;s no way it canâ&#x20AC;&#x2122;t help you.â&#x20AC;? Baylor (25-1) went 40-0 last season en route to the schoolâ&#x20AC;&#x2122;s second national championship, and its only loss this season came in Hawaii against Stanford in November. Griner and her talented teammates hadnâ&#x20AC;&#x2122;t really been challenged since, with no opponent coming within single digits. But when UConn built a seven-point lead in the second half, the Lady Bears were ready. JESSICA HILL / AP PHOTO â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s always good to give yourself a gauge of what Brittney Griner, left, is pressured by Connecticutâ&#x20AC;&#x2122;s you need to work on,â&#x20AC;? Baylor coach Kim Mulkey said. Stefanie Dolson during the first half of an NCAA college basketball game on Monday, Feb. 18, 2013. â&#x20AC;&#x153;I told them at halftime, itâ&#x20AC;&#x2122;s been a long time since weâ&#x20AC;&#x2122;ve had to execute on offense. Weâ&#x20AC;&#x2122;re so athletic and so good to reach the milestone, doing it on two free throws with and so talented, we just go play basketball. But against 1:05 left. good teams who play great defensively, you must exeDespite the loss, Huskies coach Geno Auriemma cute. And we needed to do some things better in the thought the game was a lot more valuable to his team

second half.â&#x20AC;? Griner and fellow preseason All-American Odyssey 6LPV KDG D WRXJK Ă&#x20AC;UVW KDOI FRPELQLQJ WR JR  IRU  IURPWKHĂ&#x20AC;HOG7KH\UHVSRQGHGDIWHUKDOIWLPHWKRXJK â&#x20AC;&#x153;Just got more aggressive,â&#x20AC;? Griner said. â&#x20AC;&#x153;Coach told me I need to be more aggressive in the paint, go to the goal, so thatâ&#x20AC;&#x2122;s what I did.â&#x20AC;? Baylor, which has already clinched the Big 12 regular-season title, led 54-53 midway through the second half before Griner took over. She scored seven points during a quick burst, and her putback made it 67-61 with 5 minutes left. UConn (24-2) rallied behind Kaleena MosquedaLewis to cut it to 67-65, but Griner answered with a putback. Then she hit the two milestone free throws 1:30 later to make it 73-67, all but sealing the win. Griner had missed key free throws down the stretch when she was a sophomore and her team lost at Connecticut by one point.

Keene State College athletic team records and schedule Womenâ&#x20AC;&#x2122;s Basketball OVERALL

CONF.

HOME

9-16 3-11 1 2 Total

Keene State College 31 24 East Conn.

22 45

AWAY (neutral) STREAK

5-8 3-8 (1-0) Lost 3

at Eastern Connecticut Box score

Menâ&#x20AC;&#x2122;s and womenâ&#x20AC;&#x2122;s track and field

55 67

vs. Rhode Island College Box score

1

2

Total

RIC

32

33

Keene State College

15

33

65 48

LEC Womenâ&#x20AC;&#x2122;s Basketball top 6 1.

Southern Maine

2. 3.

13-1

Western Connecticut

10-4

UMass-Dartmouth

8-6

4. 5.

Eastern Connecticut

8-6

Rhode Island College

7.

8-6

KEENE STATE COLLEGE

3-11

New England Division III Championships Name

Janel Haggerty

Event 55m hurdles

Time 8.51

Place 4th

Menâ&#x20AC;&#x2122;s Basketball OVERALL

CONF.

HOME

15-10

9-5

6-6

Maggie Fitter

800m

2:17.67

2nd

Chris Plankey

800m

1:58.06

11th

Shot put

14.44m

7th

Box score

1

2

1 mile

4:13.83

2nd

Keene State College

31

53

Weight throw

12.95m

16th

Eastern Conn.

39

32

Ben Keach Ryan Widzgowski

Whitney Cyr

Menâ&#x20AC;&#x2122;s and womenâ&#x20AC;&#x2122;s swimming and diving Husky Invitational

at Eastern Connecticut Total 84 93

AWAY (neutral) STREAK

9-3 Lost 2

vs. Rhode Island College Box score

1

2

Total

RIC

36

50

86

Keene State College

30

34

64

LEC Menâ&#x20AC;&#x2122;s Basketball top 6 1.

Rhode Island College

13-1

2. 3.

Eastern Connecticut

12-2

KEENE STATE COLLEGE

9-5

Southern Maine

8-6

UMass-Boston

6-8

Plymouth State

3-11

Name

Event

Time

Diana Pimer

200 breast

2:21.82

Place 1st

Cole Hogg

500 free

Bri Laliberte

100 free

4:38.96 1:00.94

1st 4th

Jared Hyde

50 free

21.32

2nd

James Black

100 free

46.90

1st

4. 5.

Julie Trodden

1650 free

17:30.15

1st

6.

Template 022308 JJP


Black THURSDAY, FEB. 21, 2013

SPORTS / B9

[Keene-­Equinox.com]

Girlfriendâ&#x20AC;&#x2122;s mom: Why did he do this? GERALD IMRAY

ASSOCIATED PRESS

CHRIS PALERMO / FILE PHOTO

KSC senior Ian Hart looks for a teammate to pass to during a game against Plymouth State University on May 3, 2012 at the Owl Athletic Complex.

%,77(57$67( (Cont. from B10)

on everyoneâ&#x20AC;&#x2122;s mind. People are working hard knowing whatâ&#x20AC;&#x2122;s at stake. But that game is a ways down the road. One game at a time,â&#x20AC;? Theriault said. Theriault said that there are many games this season that matter. â&#x20AC;&#x153;We are playing Bowdoin College [and] Union College, who is usually top 15 in the country. We just scrimmaged SNHU, who is Division II. We try and play some of the big boys in our out of conference games because those are the ones that get us ready for the playoffs,â&#x20AC;? he said. On top of a tough out-of-conference schedule, the Owls will also take a trip to San Diego, Calif. for Spring Break. There, they will face off against Swarthmore College of Penn. and Whittier College of Calif. Entering his thirteenth season as the head coach of WKH2ZOV&RDFK7KHULDXOWVDLGKHFHUWDLQO\IHHOVFRQĂ&#x20AC;dent that this yearâ&#x20AC;&#x2122;s squad can do some big things. â&#x20AC;&#x153;We KDYH VRPH NH\ UHWXUQHUV WKDW DUH GHĂ&#x20AC;QLWHO\ LQ D OHDGership role. I think those guys, combined with a nice recruiting class put us in good shape.â&#x20AC;? One of those key returners is senior captain, Taylor Jette. Jette led the team last season in goals (46) and was second on the team for assists (25). He led the LEC in goals per game with 2.88. Jette was also named to the $OO/(&Ă&#x20AC;UVWWHDP Jette said, â&#x20AC;&#x153;I am just hoping to be the senior leader that I had when I was a freshman. I want to guide the freshmen to play the way Keene State lacrosse has always played. I just hope I can also put the goals away that I need to.â&#x20AC;? 7KHULDXOW VDLG KH LV YHU\ FRQĂ&#x20AC;GHQW LQ -HWWH¡V DELOLW\ to lead this team to victory this season. â&#x20AC;&#x153;Heâ&#x20AC;&#x2122;s someone that I can always talk to. Heâ&#x20AC;&#x2122;s a very approachable, likeable kid. Heâ&#x20AC;&#x2122;s doing everything he needs to do. He understands that itâ&#x20AC;&#x2122;s not just about him. Heâ&#x20AC;&#x2122;s looking at the bigger picture of the whole team,â&#x20AC;? Coach Theriault said. One thing Jette doesnâ&#x20AC;&#x2122;t think will be an issue for this yearâ&#x20AC;&#x2122;s team is unity. â&#x20AC;&#x153;We are like a family out there. It helps us work harder. We want to work just as hard for the guy standing next to us as we do for ourselves,â&#x20AC;? Jette said. With a strong returning core that includes nine seniors, and a lot of depth according to Coach Theriault,

WKHWHDPDOVRKRSHVWRĂ&#x20AC;QGDSODFHIRUVRPHQHZPHPbers. One of those players being junior transfer, Curt 6HUDĂ&#x20AC;QL 6HUDĂ&#x20AC;QL WUDQVIHUUHG IURP :HVWHUQ 1HZ (QJland College last year. As a new member of the Owls, 6HUDĂ&#x20AC;QLVDLGKHKRSHVWRPDNHDQLQVWDQWLPSDFWZLWK KLVKHDY\VKRWIURPWKHULJKWVLGHRIWKHĂ&#x20AC;HOG â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m the rock on the right side with Taylor Jette and Kevin Carey on the left. They do a lot of pick and roll, two man games to draw the defense to them. Then they FDQGLVKWRPHDQG,FDQĂ&#x20AC;QLVKWKHSOD\Âľ6HUDĂ&#x20AC;QLVDLG 6HUDĂ&#x20AC;QLDGGHGWKDWWKH.6&ODFURVVHSURJUDPLVDORW more relaxed than WNECâ&#x20AC;&#x2122;s lacrosse program. â&#x20AC;&#x153;EveryRQHKHUHLVKDSS\WREHRQWKHĂ&#x20AC;HOG7KHUHZDVVXFKD pressure to perform high at WNEC and get a starting spot. Kids were telling on each other for doing stuff wrong. There was so much animosity,â&#x20AC;? he said. Another player that has opened the eyes of Taylor Jette and Coach Theriault is freshman, Tyler McKelvie. McKelvie hails from Acton, Mass. At Acton-Boxborough High School, he netted 46 goals during his senior season, according to BostonGlobe.com. Coach Theriault said that he canâ&#x20AC;&#x2122;t even tell that Tyler McKelvie is a freshman. â&#x20AC;&#x153;Heâ&#x20AC;&#x2122;s a left-handed attackman thatâ&#x20AC;&#x2122;s doing a fabulous job. He is playing like a returner. You will see a lot of great things from him,â&#x20AC;? Theriault said. McKelvie will join that strong core of returners that includes Kevin Carey (sophomore), Taylor Wicke (senior), Billy Ries (senior), Ian Hart (senior), Ryan Hart (sophomore), Tommy Todd (senior), Taylor Jette (senior) and JT Galloway (senior). Concerning his nine seniors, Coach Theriault said, â&#x20AC;&#x153;I tell them this every day. This is your one and only senior year. Iâ&#x20AC;&#x2122;ll be here next year and the year after that. But for them, they have to be self-motivated because this is something theyâ&#x20AC;&#x2122;ll talk about for the rest of their lives.â&#x20AC;? Those nine seniors, along with the rest of the Owls will have a tough road ahead of them as their season opener is just around the corner. On Feb. 27, the Owls open the season at home against Bates College at 4 p.m. But one date that most every Owl is looking forward to is April 6, 2013: the day they face off against Eastern &RQQHFWLFXW6WDWH8QLYHUVLW\IRUWKHĂ&#x20AC;UVWWLPHVLQFHWKH LEC championship.

The family of Oscar Pistoriusâ&#x20AC;&#x2122; slain girlfriend wants answers, her mother told a Johannesburg newspaper, as South Africans braced to hear why prosecutors believe a national hero murdered the model who was shot multiple times. June Steenkamp, Reeva Steenkampâ&#x20AC;&#x2122;s mother, told The Times in a front page interview published Monday: â&#x20AC;&#x153;Why? Why my little girl? Why did this happen? Why did he do this?â&#x20AC;? â&#x20AC;&#x153;Just like that she is gone,â&#x20AC;? the newspaper quoted her as saying in what it described as an emotional telephone interview. â&#x20AC;&#x153;In the blink of an eye and a single breath, the most beautiful person who ever lived is no longer here.â&#x20AC;? Pistorius, who remains in custody in a red-brick, one-story police station in Pretoria, is set to return to court Tuesday for the start of KLV EDLO KHDULQJ ,W ZLOO EH WKH Ă&#x20AC;UVW RSSRUWXQLW\ IRU WKH SURVHFXWLRQ to describe evidence police gathered against the 26-year-old doubleamputee runner and the reasons why he was charged with murder. Prosecutors allege the killing was premeditated. Pistoriusâ&#x20AC;&#x2122; family denies he committed murder though they have QRWDGGUHVVHGZKHWKHUKHVKRWKHU:KHQZRUGĂ&#x20AC;UVWHPHUJHGDERXWWKH killing there was speculation in the local media that Steenkamp had been mistaken for an intruder in Pistoriusâ&#x20AC;&#x2122; home. Police have said that was not something they were considering. In an email to The Associated Press on Monday, Pistoriusâ&#x20AC;&#x2122; longtime track coach â&#x20AC;&#x201D; who was yet to comment â&#x20AC;&#x201D; said he believes the killing was an accident. â&#x20AC;&#x153;I pray that we can all, in time, come through this challenging situation following the accident and I am looking forward to the day I can get my boy back on the track,â&#x20AC;? Ampie Louw wrote in his statement. â&#x20AC;&#x153;I am still in shock following the heart-breaking events that occurred last week and my thoughts and prayers are with both of the families involved.â&#x20AC;? Pistoriusâ&#x20AC;&#x2122; top sponsor, Nike, said in a brief statement to the AP on Monday that it â&#x20AC;&#x153;has no plans for Oscar Pistorius in upcoming campaigns.â&#x20AC;? They declined to give any further information. While Pistorius goes to court, Steenkampâ&#x20AC;&#x2122;s funeral will also be held Tuesday in her hometown of Port Elizabeth on South Africaâ&#x20AC;&#x2122;s southern coast, her family said. It is to be a private ceremony at a local crematorium, closed to the public and media. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re just taking things one day at a time,â&#x20AC;? Reeva Steenkampâ&#x20AC;&#x2122;s brother Adam Steenkamp said outside the family home. â&#x20AC;&#x153;But at the moment itâ&#x20AC;&#x2122;s family coming together and the one person who would be the strongest, who held us all together, is unfortunately not here anymore â&#x20AC;&#x201D; and thatâ&#x20AC;&#x2122;s my sister.â&#x20AC;? A 29-year-old blonde model, law graduate and reality TV contestant, Reeva Steenkamp died last week of multiple gunshot wounds inside Pistoriusâ&#x20AC;&#x2122; upscale house in a gated community in the eastern suburbs of the capital, Pretoria. Police said they arrived in the predawn hours of Thursday â&#x20AC;&#x201D; ValHQWLQH¡V 'D\ Âł WR Ă&#x20AC;QG SDUDPHGLFV WU\LQJ WR UHYLYH 6WHHQNDPS DQG said that she had been shot four times. A 9 mm pistol was recovered from the scene. Pistorius was arrested and charged with murder the same day. 3URVHFXWRUVVDLGLQ3LVWRULXV¡Ă&#x20AC;UVWFRXUWDSSHDUDQFH)ULGD\WKDWWKH\ would pursue a more serious premeditated murder charge against the 2O\PSLDQDQGZRUOG¡VPRVWKLJKSURĂ&#x20AC;OHGLVDEOHGDWKOHWH

RYAN GLAVEY

ADMINISTRATIVE EXECUTIVE EDITOR As the top performer for the KSC Menâ&#x20AC;&#x2122;s Track and Field team this past week, this weekâ&#x20AC;&#x2122;s Athlete of the Week is Ryan Widzgowski. :LG]JRZVNL Ă&#x20AC;QLVKHG VHFRQG in the one mile run at the Division III New England Championship, which was held at Bates College in Maine. 7KHMXQLRUĂ&#x20AC;QLVKHGZLWKDWLPH of 4:13.83, just .6 seconds behind Bowdoin Collegeâ&#x20AC;&#x2122;s Horowitz, Coby. He is currently ranked fourteenth among Division III runners in the one mile. Only the top 15 DIII runners will get a ticket to the NCAA Division III National Championships. Widzgowski has to hope his time is good enough to hold off WKH UHVW RI WKH SDFN Ă&#x20AC;JKWLQJ IRU a spot at nationals. He was also named the Little East Conference Track Athlete of the Week. --7KLV ZHHN¡V Ă&#x20AC;UVW UXQQHUXS is Josh Tuller of the KSC Menâ&#x20AC;&#x2122;s Swimming and Diving Team. As the sole diver representing the Owls at the New England Swimming and Diving Championships, Tully made quite the splash. +HWRRNKRPHĂ&#x20AC;UVWSODFHLQWKH three-meter dive and placed third in the one-meter dive event. 7XOOHU¡VWRSĂ&#x20AC;QLVKHVLQWKHĂ&#x20AC;QDO two events helped KSC bring KRPH Ă&#x20AC;UVW SODFH LQ WKH RYHUDOO team standings at the Championships. --The second runner-up this week is Julie Trodden of the KSC Womenâ&#x20AC;&#x2122;s swimming and diving team. Trodden won the 1650-yard freestyle swim at the Huskie Invitational, held at the University of Connecticut. 7URGGHQZDVWKHĂ&#x20AC;UVWWRWRXFK WKH ZDOO ZLWK D Ă&#x20AC;QDO WLPH RI 17:30.15. Ryan Glavey can be contacted at rglavey@keene-equinox.com

Michelle Berthiaume can be contacted at mberthiaume@keene-equinox.com

/FABÄ&#x201E;QEBÄ&#x201E; FQVÄ&#x201E;"UMOBPPÄ&#x201E;QEFPÄ&#x201E;TFKQBOÄ&#x201E;QLÄ&#x201E;PQ>VÄ&#x201E;T>OJÂżÄ&#x201E;



6WRSVDWRQFDPSXVORFDWLRQV

2IIFDPSXVVWRSV

Student Center y Fiske Lot y Library

Target y Dickâ&#x20AC;&#x2122;s Sporting Goods y i-â&#x20AC;?Party

Visitors Lot y Winchester Lot

WalMart y Shawâ&#x20AC;&#x2122;s y Olympia Sports

Butler Court y Art Center

Burger King and more!





&LW\([SUHVVUXQVDPSPy&DPSXV&RPPXQLW\6KXWWOHUXQVDPSPy021)5,

All  City  Express  vehicles  are  ADA  accessible  and  are  equipped  with  easy  to  use  bike  racks.   For  more  information  call  ,  or  visit  our  website   at  FLW\H[SUHVVRUJfor  a  complete  schedule.  

:H Template 022308 JJP


Cyan Magenta Yellow Black

Sports

SPORTS / B10

THURSDAY, FEB. 21, 2013

[Keene-­Equinox.com]

BRIAN SCHNEE

MICHELLE BERTHIAUME

DALTON CHAREST

MICHELLE BERTHIAUME

JAY MCAREE

EQUINOX STAFF

SPORTS EDITOR

EQUINOX STAFF

SPORTS EDITOR

EQUINOX STAFF

Major League pitchers and catchers reported to Spring Training this past week throughout the country, which can only mean that baseball season is right around the corner. Winter Storm â&#x20AC;&#x2DC;Nemoâ&#x20AC;&#x2122; didnâ&#x20AC;&#x2122;t scare away Keene State College baseball players as they too have begun training for their 2013 campaign. The Owls look forward to another successful season DIWHU Ă&#x20AC;QLVKing with a 32-15 record and earning a berth in the NCAA Division III Regional tournament in 2012. However, KSC will have their work cut out for them this upcoming season after losing nearly ten players to graduation. Owls skipper, Ken Howe is set for his twenty-seventh season as head coach. Howe said he isnâ&#x20AC;&#x2122;t worried about losing such a core group of players from last season. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s hard to replace guys ULJKW DZD\ EXW ZH Ă&#x20AC;OO WKRVH spots with 30 other guys,â&#x20AC;? Howe said. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re very excited about our freshman class that weâ&#x20AC;&#x2122;ve brought in. Weâ&#x20AC;&#x2122;re going to need to rely on some of the younger kids who are good, but how are they going to make that jump to the college level and that much quicker of a game.â&#x20AC;?

´7KHUHLVGHĂ&#x20AC;QLWHO\DELWWHUWDVWH in everyoneâ&#x20AC;&#x2122;s mouth and I can feel it,â&#x20AC;? Keene State College junior &XUWLV 6HUDĂ&#x20AC;QL VDLG 6HUDĂ&#x20AC;QL LV D new member of the KSC menâ&#x20AC;&#x2122;s lacrosse team. And that bitter taste lingers in the mouths of his teammates because of a 13-10 loss to Eastern Connecticut State University in the Little East Conference championship game last season. â&#x20AC;&#x153;I wasnâ&#x20AC;&#x2122;t even here and I can feel it. Every practice, coach says â&#x20AC;&#x2DC;remember that gameâ&#x20AC;&#x2122; right before we do VSULQWVÂľ 6HUDĂ&#x20AC;QL said. T h e Owls hope to redeem that loss in the L E C champ i o n ship with another successful season but Coach Mark Theriault said that there is a lot of lacrosse left before the team will even meet rival, Eastern Connecticut again. â&#x20AC;&#x153;No one likes to lose in the c hampionsh ip game. That constant reminder is

Come spring time, a resurgence of new energy will fill the air for most college students with the anxious excitement of finally enjoying the sunâ&#x20AC;&#x2122;s rays outside after a cold and bitter winter. In regards to the Keene State College menâ&#x20AC;&#x2122;s and womenâ&#x20AC;&#x2122;s track and field teams, optimism is blooming for the 2013 season. For some individual athletes, the potential of a National Championship is looming ever so closely. After a long indoor season that began all the way back in midOctober, both KSC track and field teams have been anticipating the beginning of the outdoor season. In the Little East Conference indoor championships, the Lady Owls team finished in second place. The team was only four points behind the University of Southern Maine from capturing their first ever title in the programâ&#x20AC;&#x2122;s history with 168 points. USM, who had 172 points, has dominated the conference for the last two decades winning 13 consecutive New England Alliance titles at the LEC meet. The menâ&#x20AC;&#x2122;s team finished in a respectable third place at the LEC Championships as USM conquered again. Both teams have established a confidence after the indoor season according to their coaches. Throwing Coach John Napolitano said that the teams are both in a good position coming into the spring, more specifically the womenâ&#x20AC;&#x2122;s team. â&#x20AC;&#x153;I think now that they have a little taste of what it would take

The Keene State College Womenâ&#x20AC;&#x2122;s Lacrosse Team has some high expectations to live up to with the 2013 season right around the corner. Although their season ended at the first round of the NCAA tournament, with a 19-1 loss to Amherst College, the Owls did clinch their third Little East Conference title in four years. T h e O w l s defeated We st er n Connecticut State University, 13-7, in the LEC championship last season. But after graduating three seniors, including Sammi Benson (25 goals, 24 assists last season), the Owls are looking to fill those gaps with players old and new alike. The team also lost Sarah Valacer on defense. But senior captain Nicole Curry said that the Owls defense looks the strongest so far this season. Curry has been a member of two Little East Conference championship teams now. Curry said, â&#x20AC;&#x153;We have a couple of new defenders who are loud and big and thatâ&#x20AC;&#x2122;s going to help us a lot.â&#x20AC;? Adding to a young, loud backfield is senior Kristen Schmidt. Schmidt

In 2009, Keene State College softball head coach, Charlie Beach crafted a young, talented team that included nine freshmen and finished out the year by winning the ECAC Division III New England Championship. In 2013, his job looks eerily the same after losing eleven players from last yearâ&#x20AC;&#x2122;s squad. Coach Beach will lead a roster full of young athletes, including seven freshmen. While thereâ&#x20AC;&#x2122;s a certain comparison there, this yearâ&#x20AC;&#x2122;s story hasnâ&#x20AC;&#x2122;t been written yet. â&#x20AC;&#x153;In this situation, we jokingly say youâ&#x20AC;&#x2122;re going to find out how well you can coach,â&#x20AC;? Beach said. â&#x20AC;&#x153;In the other situation is how well you can drive the van. When you have experience coming back you can just keep them under control and hold it on the road.â&#x20AC;? With only eight returning players, the most noticeable changes will show up in the pitching staff as the team looks to replace nearly all their starters from a year ago. Freshman Mariah Crisp, who attended Portsmouth High School in Portsmouth, N.H., is

  SIGHTS  SET,  B7

  BITTER  TASTE,  B9

  ONE  LAST  SHOT,  B8

  HIGH  EXPECTATIONS,  B8

  NEW  LOOK  SQUAD,  B7

PHOTOS BY: CHRIS PALERMO / FILE PHOTO

One true fanâ&#x20AC;&#x2122;s tribute to Michael Jordan New JV Michael Jordan. His Airness. Air Jordan. MJ. Despite the countless hours spent debating on Sportscenter, he is the best player to ever play the game of basketball. Entering the league in 1984, Jordan played almost his entire career in a Chicago Bulls uniform. Some of the best memories of my childhood include watching him absolutely dominate the National Basketball Association, soaring through the air with no one to stop him. He is a six-time NBA champion, winning in stunning fashion with two 3-peats (1991-1993 and 19961998), a 14-time all-star and a twotime Olympic Gold medalist. His accolades tell his story. According to Sportscenter, Jordan is also one of seven players in the history of basketball to win an NCAA title, an NBA title and a gold medal in his career. His career statistics paint a vivid picture of the god that he was: 30.1 points per game, 6.2 rebounds per game, 5.3 assists per game. Jordan changed the game forever. The image of him legitimately

Ă \LQJ WKURXJK WKH DLU WDNLQJ RII from the foul line in the 1988 Slam Dunk Contest is something any true basketball fan can picture at any given time of day. He was a legend. Another statistic that mind boggles me about Michael Jordan is a strange one. According to the ESPN Uncyclopedia, Air Jordan has been featured on the cover of 46 different magazines. Some of these magazines he has been featured on the cover of multiple times. The magazine titles that have featured His Airness include: Newsweek, Sports Illustrated, Slam Magazine, WWF Magazine, TV Guide, Digital Diner, Time, Menâ&#x20AC;&#x2122;s Fitness and many, many more. This may be a strange statistic to judge oneâ&#x20AC;&#x2122;s popularity on. But letâ&#x20AC;&#x2122;s just think about that stat for a second. Forty-six times his face has been plastered on the cover of a magazine. And while doing my research, I FRXOGQ¡W HYHQ Ă&#x20AC;QG RXW KRZ PDQ\ times he has been featured on the cover of Sports Illustrated. For someone who has accomplished so much in his career, I highly doubt he counts the number of times heâ&#x20AC;&#x2122;s seen his face at a newsstand. But for a sports fan that appreciates the strange statistics of sports, WKLVLVRQHWKDW,Ă&#x20AC;QGSUHWW\LQGLFDtive of his popularity. 0- FHOHEUDWHG KLV Ă&#x20AC;IWLHWK ELUWKday on Feb. 17, 2013. Prior to, the anchors at Sportscenter spent

baseball at KSC ZACH WINN

EQUINOX STAFF

TAYLOR CRONQUIST / EQUINOX STAFF

countless hours debating who was better at the game of basketball: Michael Jordan or LeBron James. Anyone who follows me on Twitter would already know how much I absolutely despise this conversation. Lucky for me, I get to air

my grievances on another public forum. Although I am quite certain that no one reads my column aside from those that are forced to, at least I donâ&#x20AC;&#x2122;t feel like I am talking endlessly to a â&#x20AC;&#x153;Twittersphereâ&#x20AC;? that

isnâ&#x20AC;&#x2122;t listening. I live for good sports debates. Anyone who knows me is well aware of that. But the fact that this â&#x20AC;&#x153;debateâ&#x20AC;? is even still going on just angers me beyond belief. How can one argue that LeBron

  MJ  TRIBUTE,  B7

The Keene State College baseball team is experimenting with a junior YDUVLW\WHDPWKLVVHDVRQIRUWKHĂ&#x20AC;UVW time in ten years. â&#x20AC;&#x153;I think itâ&#x20AC;&#x2122;s going to give [students] an opportunity to get better RQWKHĂ&#x20AC;HOGMXVWH[SHULHQFLQJJDPH situations,â&#x20AC;? Head Varsity Coach Ken Howe said. â&#x20AC;&#x153;And we backed up a big senior class last year with another big one this year so a lot of these guys will be gone soon and it gives the other ones a chance to still compete.â&#x20AC;? Howe, who was an assistant coach back when KSC last had a JV team, said the program stopped serving its purpose when they discontinued it in 2003. Howe explained that a strong recruiting class led to mostly upperclassmen occupying the JV spots, meaning the team wasnâ&#x20AC;&#x2122;t developing any talent. â&#x20AC;&#x153;[The JV team] is a building program not a hanging-on program,â&#x20AC;? Howe said. But things have changed since WKHQ DQG QRZ WKH 2ZOV Ă&#x20AC;QG WKHPselves with a roster featuring seven seniors and nine juniors, both high Ă&#x20AC;JXUHV

  JV  BASEBALL,  B7

Template 022308 JJP

The Equinox 2.20.13  

Volume 65 Issue 17

Read more
Read more
Similar to
Popular now
Just for you