Page 1

O MELHOR DO CINE INDEPENDENTE NO RIO

AZIZ AHMED

M A R C I A

Porto do Rio se moderniza A-4

O Centro Cultural Banco do Brasil apresenta, até 22 de março, a 11º Mostra do Filme Livre. Os cariocas poderão assistir aos 180 filmes selecionados e outros 50 convidados com o que há de mais ousado na produção audiovisual independente nacional. As exibições são gratuitas, com retirada de senhas uma hora antes de cada sessão. C-1

BRASIL S/A

Jogos de guerra A-5

ENTRELINHAS

Roberta Medina (foto) irá lançar livro sobre o Rock in Rio em Portugal.

A política ferve A-6

BRASÍLIA/DF

P E L T I E R

Com a benção de Temer A-7

Cariocas ajudam argentinos a criar sua primeira escola de samba. A-14

Jornal do Commercio R$ 2,50

FUNDADO EM 1º DE OUTUBRO DE 1827 - ANO CLXXXV - Nº102

BRASIL

WWW.JORNALDOCOMMERCIO.COM.BR

PAPEL ÚLTIMO TRIMESTRE GARANTE KLABIN Graças a um quarto trimestre brilhante, a Klabin fechou 2011 com desempenho acima do esperado pelo mercado, com a última linha do balanço no azul, totalizando R$ 183 milhões. Apenas nos últimos três meses do ano, a companhia de papel registrou lucro líquido de R$ 122 milhões, frente a desempenho ruim no trimestre imediatamente anterior, quando sofreu prejuízo de R$ 243 milhões. O setor enfrentou um ano difícil, em virtude da crise da dívida em países europeus e da valorização do dólar frente ao real. B-3

SEXTA-FEIRA E FIM DE SEMANA, 2, 3 E 4 DE MARÇO DE 2012

Brasil saca mais medidas contra ‘tsunami financeira’ na guerra cambial REUTERS/UESLEI MARCELINO

A presidente Dilma Rousseff assegurou que o Brasil tem cartas na manga para enfrentar a chamada guerra cambial e que mais medidas poderão ser adotadas, além das mudanças no Imposto sobre Operações de Crédito, Câmbio e Seguros (IOF). Dilma classificou a injeção de trilhões de dólares na economia mundial feita pelos países ricos como uma "tsunami financeira". Para reforçar o arsenal que o governo está montando na tentativa de conter a excessiva entrada de dólares no País, na noite desta quinta-feira o Banco Central impôs limites a financiamentos de vendas externas, alcançando a modalidade de pagamento antecipado de exportações, que tinha prazo ilimitado sem taxação e, agora, passa a contar com esse benefício apenas nas operações de prazos de até 360 dias. Sobre as que ultrapassarem esse prazo recairá alíquota de 6% de IOF. A-2

AÇÕES IBOVESPA PERTO DOS 67 MIL PONTOS Com cenário positivo no exterior – sobretudo em relação à Europa, onde os mercados trabalharam mais otimistas após a operação de liquidez do Banco Central na véspera –, a Bovespa ficou à vontade para um dia de ganhos expressivos e ao melhor fechamento desde 26 de abril do ano passado. O Ibovespa fechou em alta de 1,52%, aos 66.809,80 pontos. Operadores reportaram que investidores estrangeiros foram às compras na sessão desta quinta-feira, após embolsar parte dos ganhos em fevereiro. B-1

SEGUROS APOIO À REFORMA NO SETOR PÚBLICO Os seguradores reunidos em torno da Federação Nacional de Previdência Complementar e Vida (Fenaprevi) apoiam a reforma da previdência dos servidores públicos federal, mas temem o uso político dos recursos das fundações, bem como as pressões políticas sobre a definição das regras punitivas às transgressões. Diretor-executivo da entidade, Luiz Peregrino defende ainda a possibilidade de o servidor transferir suas reservas para o setor privado, na compra de planos de renda vitalícia. A-8

FÁBIO COSTA/JCOM/D.A PRESS

Leme firme em lanchas e iates Os pesados aportes de grandes estaleiros internacionais do segmento de lanchas e iates de luxo no Brasil são, para o diretor-presidente da revendedora de barcos YachtBrasil, Geovanni Luigi, um dos indicativos de que o cenário para este mercado no País é o de multiplicação acelerada de negócios. Sinal de bons ventos, diz, é a escolha do Rio de Janeiro para sediar a 5ª edição da Yachting Gala, evento que a tradicional fabricante italiana Azimut Benetti realiza neste sábado e neste domingo, na Ilha Fiscal e no Iate Clube. Os apaixonados por iates e lanchas poderão fazer test drive em vários modelos. A-4

Está aberta a temporada de caça a insiders e adeptos de outras práticas ilícitas no mercado de capitais. A Comissão de Valores Mobiliários (CVM) começou a operar um sis-

tema de filtro que promete dar à autarquia mais munição para a investigação e combate dessas condutas. Batizado de Eagle, o software foi encomendado à empresa italiana SIA

em dezembro de 2010. A perspectiva era de que entrasse em operação em meados do ano passado, mas o corte no orçamento do regulador feito pelo governo federal acabou atra-

FA X : ( 2 1 ) 2 5 1 6 - 5 4 9 5

assinaturas@jcom.com.br

estar derretendo, o que prejudica as exportações, esse é o melhor desempenho mensal desde fevereiro de 2009, quando a balança comercial teve superávit de US$ 1,8 bilhão. As vendas externas, mais uma vez, aumentaram em decorrência da expansão de embarques de produtos básicos, com destaque para soja em grão, algodão em bruto e minério de cobre. Já nas importações, o crescimento foi puxado por bens de capital, notadamente máquinas industriais. A-3

sando o cronograma do projeto. Baseado em algorítimos, o Eagle vai permitir ao xerife do mercado o acompanhamento, em tempo real, da negociação de ações, debêntures e de-

rivativos na BM&FBovespa e na Cetip. Os dados coletados serão armazenados e cruzados com outras informações, tais como notícias e relatórios de análise de instituições. B-2

PABLO PINHEIRO /DIVULGAÇÃO

BM&F descarta partilhar clearing antes de 2014

Avanço em eólica

E ATENDIMENTO AO LEITOR

0800-0224080

Revertendo resultado negativo observado em janeiro, a balança comercial brasileira registrou superávit de US$ 1,715 bilhão em fevereiro, valor 43,6% superior ao registrado em igual mês do ano passado, segundo dados divulgados nesta quinta-feira pelo Ministério do Desenvolvimento, Indústria e Comércio Exterior (MDIC). O saldo positivo é resultado das exportações de US$ 18,028 bilhões e importações de US$ 16,313 bilhões. Apesar de a cotação do dólar

Eagle, da CVM, vai caçar insiders

I N D I C A D O R E S

A S S I N AT U R A S

Balança comercial registra superávit de US$ 1,715 bi

Com a inauguração, pela Bioenergy, dos parques eólicos de Miassaba 2 e Aratuá 1, em Guamaré (RN), nesta quinta-feira, o Brasil deu mais um passo importante rumo à energia limpa: Miassaba 2 é o primeiro do País a ter toda a sua produção vendida no mercado livre, diretamente para a Cemig, em contrato com duração de 20 anos. “Colocar um parque eólico para fornecer energia no mercado livre era considerado heresia, mas agora estamos começando a ver eólicas mais baratas que hidrelétricas”, diz o presidente da Bioenergy, Sérgio Marques. B-3

A BM&FBovespa não pretende vender tão cedo serviços de clearing a eventuais companhias que queiram disputar com ela o mercado doméstico. "Estamos num processo de integração de clearings e de um novo modelo de risco, que vai terminar em 2014", disse o diretor financeiro e de Relações com Investidores da bolsa

paulista, Eduardo Guardia. "Não tem o menor sentido parar o que estamos fazendo para conectar outras bolsas", complementou. Nos últimos meses, analistas têm mostrado preocupação com uma possível guerra de preços oriunda da entrada de novos players, o que efetaria as margens da BM&FBovespa. B-4

Consumidor americano volta a fechar o bolso. B-8


cyan magenta amarelo preto

ECONOMIA A-2

EDITORES // MARIO RUSSO

PEDRO ARGEMIRO

Jornal do Commercio

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

CONJUNTURA - Em duro discurso, presidente se queixa de países ricos por injeções bilionárias, classifica como inconsequentes essas políticas monetárias e diz que liquidez excessiva traz reflexos perversos, sobretudo aos países em crescimento

Dilma critica ‘tsunami financeira’

A

presidente Dilma Rousseff assegurou que o Brasil tem cartas na manga para enfrentar a guerra cambial e que novas medidas poderão ser adotadas além das mudanças no Imposto sobre Operações de Crédito, Câmbio e Seguros (IOF) que passaram a valer a partir de quinta-feira. Dilma classificou a injeção de trilhões de dólares na economia feita pelos países ricos como uma “tsunami financeira”. A crítica veio após o anúncio do Banco Central Europeu (BCE), na última quarta-feira, do empréstimo de 529 bilhões de euros a 800 bancos do continente. O objetivo da autoridade monetária é incentivar o crédito, reduzir o risco de calote dos países mergulhados na crise e conter a recessão. Com isso, os recursos despejados pelo BCE chegaram a 1 trilhão de euros em pouco mais de dois meses, o que provocou forte valorização do real neste período. Dilma acusou os países desenvolvidos de praticarem uma política monetária “absolutamente inconsequente” sob o ponto de vista dos efeitos gerados nos mercados internacionais. “Nós teremos de criar outros instrumentos de combate aos processos que vão ser desencadeados com US$ 4,7 trilhões (volume despejado na economia desde 2008)”, declarou a presidente ressaltando que a injeção desses recursos traz consequência as perversas, sobretudo aos países em crescimento.

“Nós sabemos que, hoje, as condições de concorrência são adversas. Não porque a indústria brasileira não seja produtiva, não porque o trabalhador brasileiro não seja produtivo, mas porque tem uma guerra cambial que cria condições desiguais”, emendou. O discurso da presidente deixou claro que o governo vai fazer de tudo para conter a avalanche de capital estrangeiro no Brasil. A preocupação é com o excesso de recursos em circulação nos países desenvolvidos, que passaram a imprimir moeda como arma para combater a crise, com efeitos colaterais para a economia mundial. Depois de cair no mercado, a procura por rentabilidade tende a fazer com que boa parte desse dinheiro vá parar nos países emergentes, criando ondas de liquidez. Prova disso é que o dólar chegou a ser cotado abaixo de R$ 1,70 nesta semana, patamar que o governo entende como prejudicial para as exportações e para a indústria nacional. Não à toa, o Fundo Monetário Internacional (FMI) chegou a dizer que o Brasil precisa fazer alguma coisa urgente para conter esse movimento. Apesar do discurso defensivo, por hora, as medidas do governo surtiram pouco efeito. O dólar continua em um patamar perigoso e fechou o dia ontem cotado a R$ 1,71. A esperança é que a mudança no IOF, que passa a cobrar 6% sobre captações no exterior com prazo superior a três anos, ajude a coibir a entrada de capital especulativo no País, mas os analistas temem

GUSTAVO HENRIQUE BRAGA

REUTERS/UESLEI MARCELINO

DILMA ROUSSEFF

Nós sabemos que, hoje, as condições de concorrência são adversas. Não porque a indústria brasileira não seja produtiva, não porque o trabalhador brasileiro não seja produtivo, mas porque tem uma guerra cambial que cria condições desiguais.”

que a medida ainda é insuficiente para alcançar resultados satisfatórios. “Mexer nos impostos para atacar uma questão cambial não é uma medida muito eficiente”, avaliou Rubbens Velloza, especialista em tributação. Velloza explicou que a legislação permite ao governo estabelecer um IOF de até 25%. “As mudanças no IOF podem ser aplicadas imediatamente, ao contrário dos demais impostos, os quais qualquer mudança só passa a valer no ano se-

guinte”, complementou. SINDICALISTAS. Sindicalistas aproveitaram a chance de estar ao lado da presidente Dilma Rousseff na quinta-feira para derramar uma coleção de reivindicações do setor e atacar o que chamaram de desindustrialização do País diante de importações crescentes de produtos manufaturados. Como de hábito, atacaram as taxas de juro e o câmbio, já que o real valorizado torna as importações mais competitivas

frente à produção nacional. Num inflado discurso, o presidente da Força Sindical, deputado Paulo Pereira da Silva (PDT-SP), foi direto ao pedir a Dilma ações mais eficazes para proteger a indústria nacional. “É muito violenta a desindustrialização. É muito rápida, e nós estamos dando pouca resposta para isso. As empresas estão quebrando, e o setor industrial está tendo demissão”, disse ele, durante a assinatura de compromisso com construtoras e sindicatos

para melhorar as condições de trabalho no setor da construção civil. Outras demandas incluíram baixar juros, que já vêm em trajetória de queda, e rever o fator previdenciário. “Precisamos baixar juro, mexer no câmbio... Tem coisas que nós precisamos que a senhora aja rápido”, disse o deputado. Entre brincadeiras com a cor da roupa de Dilma, as críticas foram ouvidas pela presidente em uma cerimônia encarada pelo Planalto como uma celebração. O acordo assinado foi fruto de negociações iniciadas depois da crise nos canteiros de obras das usinas hidrelétricas do Rio Madeira, em 2011. Mesmo as queixas sendo tradicionais nos setores sindicais – que havia poucos anos reclamavam do baixo valor do salário mínimo ou os arrochos monetários consequentes das demandas do Fundo Monetário Internacional (FMI) –, a pauta expressa nos discursos sindicalistas foi sinal do pouco acesso que as lideranças do setor têm à presidente. O porta-voz do Planalto no tema é o ministro Gilberto Carvalho (Secretaria Geral). Após a cerimônia, os sindicalistas reconheceram que são recebidos menos pela presidente do que gostariam e do que eram pelo antecessor, Luiz Inácio Lula da Silva. Dilma respondeu às demandas. Citou números de desemprego, “o menor da história”, disse que desde 2003 o salário mínimo teve aumento real de 66% e afirmou que seu compromisso é com desenvolvimento sustentável e distribuição de riqueza. (Com agência Reuter)

Governo volta a recorrer ao IOF no câmbio Preocupado com a perda de empregos e de competitividade na economia brasileira devido o derretimento do dólar, o governo decidiu intervir pesadamente no mercado, porém, fracassou. Na quinta-feira, publicou decreto que impõe Imposto sobre Operações de Crédito, Câmbio e Seguros (IOF) de 6% para empréstimos feitos no exterior com prazo de até três anos. Antes, esse pedágio era cobrado apenas nas operações com vencimento em dois anos. O Banco Central também fez sua parte na tentativa de conter a queda da moeda e em duas ocasiões comprou dólares no mercado à vista, entretanto foi ignorado juntamente com a nova tributação e a divisa norte-americana fechou em queda de 0,47%, cotada a R$ 1,712. No ano, a moeda acumula queda de 8,38%. Na prática, o IOF tenta evitar que bancos e empresas tomem empréstimos no exterior e tragam esses recursos para o Brasil, o que, quando ocorre em excesso, derruba a cotação do dólar. No mercado financeiro, a medida foi avaliada como praticamente inócua pelos operadores. Segundo eles, serviu apenas para minimizar a velocidade de queda visto que a divisa continuou a cair, porém em ritmo mais moderado comparado a outras moedas. Tanto o ministro da Fazenda, Guido Mantega, quanto a presidente Dilma Rousseff foram a público explicar a decisão e avisar que ainda tem mais por vir. "Quando o real se valoriza, diminui a nossa competitividade. As exportações brasileiras ficam mais caras e os produtos

ELZA FIÚZA/ABR

CRISTIANE BONFANTI,VICTOR MARTINS E ROSANA HESSEL

GUIDO MANTEGA

MINISTRO DA FAZENDA

Quando o real se valoriza, diminui a nossa competitividade. As exportações brasileiras ficam mais caras e os produtos importados, mais baratos, numa competição desleal com as empresas brasileiras."

importados, mais baratos, numa competição desleal com as empresas brasileiras", afirmou o ministro. Ele ressaltou ainda que o governo não assistirá impassível a essa guerra cambial. “O Banco Central tem comprado dólares em leilões diários e, como está havendo uma tomada de crédito lá fora em grande escala pelas empresas brasileiras, estamos penalizando quando esse crédito for de curto prazo”, justificou. Para os empréstimos a serem liquidados num prazo acima de três anos, a alíquota continua zero. Segundo analistas, o novo IOF teve pouco impacto no mercado devido o excesso de recursos disponíveis. Apenas entre 2008 e 2012, os quatro maiores bancos centrais do globo despejaram US$ 5,3 bilhões no mundo. Além disso, no Brasil, os investidores já faziam

operações com vencimento acima de três anos e sofreram pouco com a mudança nas regras. “Não é difícil conseguir levantar dinheiro lá fora por mais de três anos para aplicar aqui”, observa Felipe Chad, sócio da corretora DX Investimento. “Essa medida de hoje não teve tanto efeito, mas é um alerta do governo dizendo que está presente e disposto a atuar”, afirmou. Márcio Cardoso, sócio-diretor da Título Corretora compartilha da visão de Chad. “O governo não tem muito o que fazer além de reduzir os juros básicos da economia e enxugar gelo tirando dólares do mercado”, ponderou. Enquanto anunciava a nova regra, o ministro da Fazenda explicou que, hoje, a alternativa encontrada pelos países desenvolvidos para enfrentar a crise é implementar uma política monetária expansiva, com redução

de juros e aumento na oferta de empréstimos, o que significa mais dinheiro em circulação pelo mundo. O Banco Central Europeu (BCE), apenas na última quarta-feira, injetou 529,5 bilhões de euros no sistema financeiro da zona do euro. O problema, disse o ministro, é que, na hora de aplicar esses recursos, o setor financeiro procura os países emergentes. “Por que escolhem o Brasil? Porque ele é um dos países que dá mais solidez, mais segurança”, ressaltou. TAXAS DE JUROS. Jason Vieira, economista da corretora Cruzeiro do Sul, destaca ainda mais um fator de atração dos emergentes, segundo ele, o mais determinante: taxas de juros elevadas – no caso do Brasil, uma das maiores taxas nominais do globo e o maior juro real. “Por isso vale muito a pena investir

no Brasil, o retorno é excelente”, disse. “A missão do governo é complicada, além do capital especulativo, o País recebe um fluxo monstruoso de balança comercial e investimento estrangeiro direto, além das captações cada vez mais expressivas feitas por empresas brasileiras no exterior”, argumentou. O medo do governo, na avaliação de especialistas, é da desindustrialização. O setor produtivo reclama constantemente de que perdeu competitividade com a queda do dólar e, em alguns setores ,já se anuncia demissões e encerramento da produção nacional de determinados itens. Com o dólar abaixo de R$ 1,80, ficou mais interessante para o consumidor e para o comércio importar do que adquirir produtos domésticos. Segundo dados da Associação Brasileira da Indústria Química

(Abiquim), desde 1990, 447 produtos deixaram de fabricados no Brasil, uma pequena parte por ter saído de linha e outra devido as importações. Na opinião de José Luis Oreiro, professor de Economia da Universidade de Brasília (UnB), o governo precisa fazer mais. “É mais um remédio de curto prazo. Enquanto o País tiver taxas de juros tão altas, os bancos vão continuar captando lá fora, a juros de 1% na Europa e de 0,25% nos EUA, e emprestando aqui a 10,5%”, afirmou. O professor defendeu a volta de um mecanismo para controlar o câmbio de forma mais firme, a exemplo do que era feito no governo Fernando Henrique Cardoso, com o sistema de bandas cambiais – com tetos máximo e mínimo. Além de estender o prazo da cobrança do IOF, o governo zerou o tributo para os chamados Brazilian Depositary Receipts (BDRs). Eles são papéis emitidos no Brasil, mas referentes a ações de empresas estrangeiras negociadas na Bolsa de Valores de São Paulo. Até agora, a alíquota cobrada sobre esses certificados era de 6% na entrada dos recursos. Nesse caso, a medida busca estimular a aplicação de recursos na bolsa de valores. O ministro garantiu que o governo continuará tomando medidas para conter a entrada de dólares , mas afirmou que o governo não cogita taxar recursos destinados ao mercado acionário ou o voltado para o setor produtivo, chamado de Investimento Estrangeiro Direto (IED). “Não fizemos isso até agora e não pretendemos fazer. É saudável que haja investimento estrangeiro direto no Brasil. Ele gera emprego e paga impostos”, destacou.


cyan magenta amarelo preto

ECONOMIA

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio A-3

BALANÇA COMERCIAL - Saldo positivo em fevereiro é resultado de exportações de US$ 18,028 bilhões e importações de US$ 16,313 bilhões, o melhor resultado mensal desde fevereiro de 2009

Superávit de US$ 1,715 bi

■ PREVIDÊNCIA

Déficit cai 5,8% ante janeiro de 2011 DA AGÊNCIA ESTADO

DA REDAÇÃO

A

balança comercial brasileira registrou superávit de US$ 1,715 bilhão em fevereiro, valor 43,6% superior ao registrado em fevereiro de 2011, segundo dados divulgados na quintafeira pelo Ministério do Desenvolvimento, Indústria e Comércio Exterior (MDIC). O saldo positivo é resultado das exportações de US$ 18,028 bilhões e importações de US$ 16,313 bilhões. Esse é o melhor resultado mensal desde fevereiro de 2009, quando a balança comercial teve superávit de US$ 1,8 bilhão. A média diária de embarques externos de fevereiro foi US$ 948,8 milhões. Nas compras internas, a média diária registrada ficou em US$ 858,6 milhões. Quando comparado a igual período de 2011, os embarques externos aumentaram 13,4% e as importações avançaram 10,5%. Em janeiro, nas quatro semanas do mês, a balança comercial registrou déficit. Já em fevereiro, foi registrado o primeiro superávit comercial do ano. No acumulado do ano, as exportações somam US$ 34,169

PERSPECTIVAS

Meta para este ano aumenta 3,1% DA AGÊNCIA BRASIL

O secretário executivo do Ministério do Desenvolvimento, Indústria e Comércio Exterior (MDIC), Alessandro Teixeira, anunciou na quinta-feira a meta do governo para exportações em 2012. A estimativa para o ano é US$ 264 bilhões, valor 3,1% superior à estimativa de vendas externas no ano passado, que foi US$ 257 bilhões. Teixeira destacou ainda que o valor

bilhões e as importações, U$S 33,746 bilhões, com saldo positivo de US$ 423 milhões. XXXX. Na comparação com fevereiro do ano passado, as exportações melhoraram por conta do aumento de vendas de produtos básicos (36,6%), de semimanufaturados (25,29%) e de manufaturados (18%). No caso dos produtos básicos, os destaques foram soja em grão, algodão em bru-

pode ser revisado de acordo com o desempenho das exportações. Além disso, o atual momento de instabilidade econômica exigiu “cautela” por parte do governo na definição da meta. “Hoje conseguimos ter visão mais clara do que está acontecendo na economia europeia e na americana. A meta podia ser mais ambiciosa sim, mas não posso afirmar se vai aumentar por conta da falta de clareza da economia da União Europeia’, disse.

to e minério de cobre. Nos semimanufaturados, o aumento ocorreu, principalmente, por conta dos embarques externos de ferro/aço (98,8%), ferro fundido (48%) e ouro semimanufaturado (38,1%). Do lado das importações, utilizando a mesma base de comparação, houve aumento, pela média diária, em quatro categorias: bens de capital (18,6%), bens de consumo (14,2%), matérias-primas e in-

Apesar do quadro crítico no cenário internacional, o momento de recuperação na economia norte-americana, aliado ao aumento das exportações de produtos manufaturados, permitiu que a meta de exportações continuasse em ritmo crescente.“A recuperação dos Estados Unidos, economicamente, é muito importante, mas já notamos recuperação da economia. Mas a União Europeia ainda tem ponto de interrogação, o que faz com que sejamos mais cautelosos”, finalizou.

termediários (7,3%) e combustíveis e lubrificantes (4,1%). No caso dos bens de capital, os destaques foram para máquinas industriais e aparelhos para escritórios. Já para bens de consumo, o aumento foi puxado pela compra de produtos alimentícios, farmacêuticos, vestuário, bebidas, entre outros. Nos dois primeiros meses de 2012, os Estados Unidos foram o principal destino das

exportações brasileiras, somando US$ 4,6 bilhões. Na sequência, aparecem a China e a Argentina, que atingiram US$ 4 bilhões e US$ 3,1 bilhões, respectivamente. No caso das importações, o principal fornecedor foi a China, que exportou US$ 2,641 bilhões em produtos ao Brasil, seguida pelos Estados Unidos (US$ 2,368 bilhões) e pela Alemanha (US$ 1,124 bilhão). (Com agências)

Commodities pesam, diz Abracex DA AGÊNCIA ESTADO

O saldo positivo da balança comercial de US$ 1,715 bilhão em fevereiro, divulgado pelo Ministério do Desenvolvimento, Indústria e Comércio Exterior (MDIC) em fevereiro é bom e chega até a surpreender, considerandose o fato de que, em janeiro, a balança teve déficit de US$ 1,291 bilhão.

A avaliação é do presidente da Associação Brasileira de Comércio Exterior (Abracex), Primo Roberto Segatto. O problema do resultado, de acordo com Segatto, é que ele se dá, em grande parte, com base nas vendas de produtos básicos, de commodities. “Olhe para os dados desta balança comercial de fevereiro e você verá que tem muito pouco de produtos manufa-

■ ICMS DIFERENCIADO

A chamada “guerra dos portos” beneficia a indústria nacional, dizem importadores brasileiros, ao contrário dos argumentos de 36 associações empresariais e cinco confederações de trabalhadores que, na terçafeira, foram a Brasília pressionar o Senado a aprovar a Resolução 72/2010, projeto que pretende acabar com a cobrança pelos estados de ICMS diferenciado sobre produtos importados. Medidas protecionistas prejudicam o trabalhador brasileiro”, afirma o porta-voz dos importadores, Ivan Ramalho, exsecretário-executivo do Ministério do Desenvolvimento, Indústria e Comércio Exterior e presidente da Associação Brasileira de Comércio Exterior (Abece). Ramalho esteve na quintafeira no Senado para defender esse ponto de vista. O presidente da Abece, entidade que reúne 25 tradings, pretendia argumentar aos parlamentares que a importação não é a vilã da indústria, já que aumenta a competitividade da produção nacional ao agregar tecnologia e insumos mais baratos ao produto final brasileiro. Em defesa dessa tese, ele apresenta números: dois terços das importações do País são compostos por equipamentos e insumos para a indústria. Na contramão dos argumentos da Abece, o grupo formado por entidades empresariais como Confederação Nacional da Indústria (CNI) e Federação das Indústrias do Estado de São Paulo (Fiesp), e centrais sindicais, como a Central Única dos

último ano o dólar caiu 8%. E para o exportador isso significa prejuízo”, diz Segatto. Na avaliação do executivo da Abracex, não há muito o que se comemorar quando o bom resultado da balança é puxado por commodities porque, por serem básicos, este produtos só deixam de ser demandados quando as economias estão em crise. No ano passado, o PIB dos

Ministério de Minas e Energia

Importadores: ‘guerra dos portos’ é benéfica DA AGÊNCIA ESTADO

turados no resultado”, diz o presidente da Abracex. Ele admite que, mesmo esperando uma melhora nas exportações das commodities em fevereiro, sua previsão era de um saldo equilibrado, com resultado positivo em torno de US$ 100 milhões. “Digo que o superávit de fevereiro se deve mais às vendas de commodities do que de outros produtos porque neste

Trabalhadores (CUT) e a Força Sindical, se reuniram com o presidente do Senado, José Sarney (PMDB-AP), para pressionar os parlamentares a aprovar a Resolução 72, que uniformiza a alíquota do Imposto sobre Circulação de Mercadorias e Prestação de Serviços (ICMS) nas operações interestaduais com bens e mercadorias importadas. Segundo eles, benefícios concedidos por alguns estados estimulam a entrada de mercadorias estrangeiras no Brasil. O grupo colocou em jornais na quinta-feira um anúncio em que defende seus argumentos. “A redução de ICMS na importação já impediu o Brasil de criar 771 mil empregos desde 2010. E o PIB (Produto Interno Bruto) deixou de crescer R$ 18,9 bilhões”, afirma, no texto. DESINDUSTRIALIZAÇÃO. Ramalho discorda da reclamação do movimento de empresários e trabalhadores de que as importações levam o Brasil à desindustrialização e à perda de empregos. Os empresários e sindicalistas que foram terça-feira ao Senado pedir a aprovação da Resolução 72 alegam que os produtos importados estão tomando mercado da indústria nacional e provocando o fechamento de empresas e postos de trabalho. O presidente da Abece, no entanto, cita dados da Secretaria de Comércio Exterior (Secex) mostrando que no ano passado 17,72% das importações corresponderam a bens de consumo, enquanto matérias-primas, produtos intermediários e bens de capital somaram 66,29%.

AUDITORIA AMBIENTAL FURNAS CENTRAIS ELÉTRICAS S/A torna público que entregou ao Instituto Estadual do Ambiente – INEA, em 03/02/2012, Relatório de Auditoria Ambiental do ano de 2011 referente à produção de energia em usina termoelétrica com capacidade de geração de 600MW, denominada UTE Santa Cruz e informa que este estará à disposição para consulta na Rua Real Grandeza, 219 Bloco B, sala 510 - Botafogo no Município do Rio de Janeiro, no período de 01/03/2012 a 30/03/2012, no horário das 09h30 às 16 horas. Informa, ainda, que o referido relatório também estará disponível para consulta na biblioteca do INEA, na Rua Fonseca Teles nº 121, no horário das 9h30 às 16h30.

Ministério de Minas e Energia

Estados Unidos cresceu 3%, o que justifica o consumo maior destes produtos. “O que eu acho é que o governo poderia aproveitar este momento de dólar baixo para renovar o parque industrial brasileiro para poder agregar mais valores às nossas commodities. A idade média das máquinas da indústr ia brasileira é de 18 anos”, lamenta Segatto.

O déficit de R$ 3,005 bilhões na Previdência Social em janeiro foi influenciado pelo aumento de 6,3% das despesas com pagamento de benefícios na comparação com idêntico mês de 2011. Em janeiro, essas despesas somaram R$ 22,603 bilhões ante R$ 21,271 bilhões pagos um ano antes. A arrecadação do primeiro mês do ano, no entanto, apresentou crescimento ainda maior. O governo obteve R$ 19,597 bilhões em receitas previdenciárias, elevação de 8,4% ante janeiro de 2011 (R$ 18,079 bilhões). Por conta disso, o resultado da Previdência em janeiro ficou 5,8% menor do que o verificado em igual mês do ano passado, quando registrou saldo negativo de R$ 3,192 bilhões. A arrecadação líquida da Previdência Social em janeiro deste ano foi a melhor de toda a série histórica para meses de janeiro, segundo o Ministério da Previdência Social. Na comparação com janeiro do ano passado, houve aumento de 8,4% na arrecadação, passando de R$ 18 bilhões para R$ 19,6 bilhões. A atual série histórica da Previdência tem início em 2001. Conforme nota divulgada à imprensa, o resultado positivo pode ser atribuído a três componentes: crescimento econômico acima da média internacional, formalização do mercado de trabalho e redução da sonegação. O aumento das receitas previdenciárias colaborou para que o governo registrasse em janeiro a maior arrecadação de sua história, um total de R$ 102,579 bilhões.

Ministério de Minas e Energia

AVISO DE LICITAÇÃO PE.DAQ.G.0033.2012 1. Furnas Centrais Elétricas S.A. torna público que realizará Pregão Eletrônico para contratação do Fornecimento de Reatores 800 kV, monofásicos, para SE Foz do Iguaçu, SE Tijuco Preto, SE Itaberá e SE Ivaiporã. 2. Obtenção do Edital: O Edital está disponível a partir desta data, no sítio do Banco do Brasil (N° Licitação 412448), que também poderá ser acessado pelo sítio de FURNAS (www.furnas.com.br - opção Fornecedores/Pregão Eletrônico). 3.2XWUDVLQIRUPDo}HVQR'LiULR2¿FLDOGD8QLmRGRGLD 02/03/2012. Departamento de Aquisição

Ministério de Minas e Energia

AVISO DE ALTERAÇÃO

AUDITORIA AMBIENTAL

CO.DAQ.G.0003.2012

FURNAS CENTRAIS ELÉTRICAS S/A torna público que entregou ao Instituto Estadual do Ambiente – INEA, em 03/02/2012, Relatório de Auditoria Ambiental do ano de 2011 referente geração de energia elétrica a partir de turbinas e geradores a vapor operados pela queima de gás natural na Usina Termelétrica de Campos e informa que este estará à disposição para consulta na Rua Real Grandeza, 219 Bloco B, sala 510 - Botafogo no Município do Rio de Janeiro, no período de 01/03/2012 a 30/03/2012, no horário das 09h30 às 16 horas.

1. FURNAS Centrais Elétricas S.A. torna pública a alteração da data para entrega da Documentação de Habilitação e das Propostas relativa à Licitação nº CO.DAQ.G.0003.2012 , para o dia 05/04/2012 às 10 horas. 3. Ficam mantidas as demais condições do Aviso de Licitação publicado no 'LiULR2¿FLDOGD8QLmRGRGLD 06/02/2012. Departamento de Aquisição

PRAINHA SOCIEDADE AGRO-INDUSTRIAL S/A CNPJ n° 33.050.238/0001-80 - NIRE n° 33.3.0012194-3 Ata de Assembléia Geral Extraordinária realizada em 24 de novembro de 2011: Data, Hora e Local: 24 de Novembro de 2011, às 11hs na sede social da sociedade, na Av. Presidente Vargas, n° 583 – 9° andar, Centro, Rio de Janeiro, Estado do Rio de Janeiro. Convocação: Edital de convocação publicado no Diário Ocial do Estado do Rio de Janeiro e Jornal do Comércio nas edições dos dias 16, 17 e 18 de outubro de 2011. Presenças: Presentes acionistas representando 52,4% do capital votante da companhia constituindo, portanto, quorum legal para instalação e deliberação das matérias constantes da ordem do dia, conforme assinaturas apostas no Livro de Presença de Acionistas. Mesa: Presidente: Luis Fernando Junqueira Borges; Secretário: Pedro Francisco de Assis das Chagas. Ordem do Dia e Deliberações Aprovadas por Unanimidade: 1. Apreciação e aprovação, sem qualquer ressalva ou emenda das Demonstrações Financeiras Intermediárias (Balanço Intermediário e respectiva Demonstração de Resultados) levantadas em 30/09/2011. 2. Deliberação da absorção do prejuízo acumulado com o lucro apurado nas demonstrações nanceiras intermediárias levantadas em 30/09/2011. 3. Aprovação da distribuição de dividendos a seus acionistas no valor de R$ 1.800.000,00 (Um milhão e oitocentos mil reais) na proporção de sua participação no capital social, com base na reserva de lucros remanescente em 30/09/2011, após a compensação dos prejuízos acumulados. Encerramento, Lavratura, Aprovação e Assinatura da Ata: Nada mais havendo a ser tratado, foi a presente ata lavrada, lida, conferida e por todos assinada. Rio de Janeiro, 24 de novembro de 2011. Sr. Luís Fernando Junqueira Borges – Presidente; Sr. Pedro Francisco de Assis das Chagas – Secretário. Acionistas: Fernando Cavalcante - Espólio (por Luís Fernando Junqueira Borges), Restelo Empreendimentos e Participações Ltda. (por Mauro Guimarães de Souza Matta), Luiz Felipe Rocha Martins da Mota, Luís Fernando Junqueira Borges e Jean Correa dos Reis (por Luís Fernando Junqueira Borges). Junta Comercial do Estado do Rio de Janeiro. Prainha Sociedade Agro - Industrial S.A.. Certico o deferimento em 28/11/2011, e o registro sob o número e data abaixo. 00002262561 – Data: 28/11/2011. Valéria G. M. Serra – Secretária Geral.

Informa, ainda, que o referido relatório também estará disponível para consulta na biblioteca do INEA, na Rua Fonseca Teles nº 121, no horário das 9h30 às 16h30.


cyan magenta amarelo preto

A-4

ECONOMIA

Jornal do Commercio

LAZER - Investimentos em larga escala e escolha do Rio para sediar a quinta edição da Yachting Gala são indicativos de que o cenário é positivo para o setor

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

CONFIDENCIAL AZIZ AHMED

s pesados investimentos que grandes estaleiros internacionais do segmento de lanchas e iates de luxo estão aportando no Brasil são, para o diretor- presidente da revendedora de barcos YachtBrasil, Geovanni Luigi, um dos indicativos de que o cenário para este mercado no País é positivo. Na visão do executivo, outro sinal de que bons ventos devem sustentar a multiplicação dos negócios é a escolha do Rio de Janeiro para sediar a 5ª edição da Yachting Gala, evento que será realizado pela tradicional fabricante italiana Azimut Benetti sábado e domingo na Ilha Fiscal e no Iate Clube. Na ocasião, que marcará a estréia do Brasil como sede do evento, aficionados pelos luxuosos barcos da companhia poderão fazer test drive nos cerca de dez modelos que serão expostos. “O mercado local está bem

aquecido, como reflexo dos últimos dez anos de prosperidade econômica do País”, observa Luigi. O executivo ressalta que, graças ao ambiente favorável, a companhia tem crescido a taxas anuais de 25% há três anos. “A meta para 2012 é aumentar o percentual para 32%”, aponta. Com o cumprimento da projeção, a empresa espera fechar o quadriênio 2009-2012 com receita de R$ 1 bilhão. Segundo ele, a companhia comercializa anualmente de 300 a 400 barcos, entre novos e usados. Luigi esclarece que o faturamento estipulado não será obtido necessariamente por meio de um aumento vigoroso do volume de vendas. “Este mercado não é medido pela quantidade de transações, mas sim pelo valor agregado dos produtos vendidos”, afirma, ressaltando que o preço dos modelos negociados pela companhia vai de US$ 100 mil a US$ 30 milhões. O executivo salienta que o mercado brasileiro de crédito tem conseguido acomodar a expansão do segmento de iates

■ CRÉDITO

■ FEVEREIRO

Ritmo de concessões deve cair

Venda de veículos recua 9%, para 249,5 mil unidades

DA AGÊNCIA ESTADO

DA REDAÇÃO

O Indicador de Perspectiva do Crédito ao Consumidor, calculado pela Serasa Experian, chegou a 101,2 pontos em janeiro, com queda de 0,4% em relação a dezembro, quando estava em 101,5. Esse é o quarto recuo consecutivo do indicador, o que mostra que as concessões de crédito aos consumidores deverão continuar crescendo em 2012, porém num ritmo mais lento que o de 2011. Pontuação acima dos 100 pontos indica aumento na concessão. Segundo a Serasa Experian, apesar dos estímulos monetários e fiscais adotados pelo governo para o crédito e o consumo, a desaceleração da expansão do crédito se deve ao nível ainda elevado da inadimplência. O indicador busca antever em que ciclo o crédito estará em um horizonte de seis meses.

As vendas de automóveis, comerciais leves, caminhões e ônibus totalizaram 249,5 mil unidades em fevereiro, o que significa queda de 9% em relação a igual período do ano passado, segundo dados divulgados nesta quinta-feira pela Federação Nacional da Distribuição de Veículos Automotores (Fenabrave). Em relação a janeiro o recuo foi de 7%. De acordo com a Fenabrave, separadamente as vendas de automóveis e comerciais leves somaram 235,9 mil unidades em fevereiro, o que representa queda de 8,85% em relação a igual período do ano passado. Já os emplacamentos de caminhões e ônibus, no mesmo período, mostraram recuo de 11,12% na comparação anual. A entidade manteve as perspectivas de crescimento para 2012. Para os segmentos de automóveis e comerciais leves, espera-se aumento de 4,5% nos emplacamentos comparado a

MARIA CAROLINA FERREIRA

O

e lanchas. De acordo com ele, bancos brasileiros operaram linhas de empréstimo para a compra de barcos, que funcionam de maneira semelhante aos programas de financiamento para aquisição de automóveis. “Um é tão simples quanto o outro”, garante. Luigi diz ainda que o mercado local está bem estruturado para oferecer assistência técnica aos compradores. Considerando apenas a rede da YachtBRasil, ele lembra que dos 23 escritórios da companhia, 12 são especializados na prestação de serviços de manutenção. PESCA OCEÂNICA. Apesar do amplo portfólio de valores e modelos da revendedora, o executivo afirma que os brasileiros têm predileção por barcos de médio porte, ou seja, aqueles de 30 pés a 50 pés (o que corresponderia a 9,1 metros e 16,7 metros, respectivamente). Além dos iates do grupo Azimut Benetti, lista que também inclui a marca Atlantis, a YachtBrasil comercializa

2011, enquanto caminhões deverão mostrar evolução de 9,6%. Para ônibus, a estimativa é de crescimento de 14,3%. Os dados divulgados pela Fenabrave mostram que a Fiat liderou, com 22,5%, o ranking de participação nas vendas de automóveis nos primeiros dois meses do ano. A Volkswagen aparece na segunda posição, com 22,28%, seguida da General Motors (GM), com 21,10%. A Ford, com 9,12% das vendas, e a Renault, com 7,01%, aparecem na sequência. Considerando-se apenas o mês de fevereiro, o ranking de vendas de automóveis está dividido da seguinte forma: Fiat (23,45%), Volkswagen (23,14%), General Motors (18,44%), Ford (9,59%) e Renault (7,09%). No segmento de comerciais leves, a Fiat também lidera o ranking, com 20,7% de participação nos primeiros dois meses do ano, seguida pela Volkswagen, com 15,22%, e pela GM, com fatia de 10,35%. Em fevereiro, o ranking se mantém

modelos das linhas Sea Ray e Cabo Yatch (embarcações para pesca oceânica), fabricados pelo estaleiro norte-americano Brunswick. De olho no potencial do mercado náutico brasileiro, ambas as companhias estão construindo fábricas no Sul do País. A Brunswick está montando uma planta em Joinville (SC), que deverá entrar em operação em meados de 2013. Já a Azimut está aportando R$ 200 milhões na construção de um complexo fabril em Itajaí (SC). A previsão é de que a estrutura, cuja capacidade de produção anual será de 100 mil unidades, seja inaugurada também no ano que vem. A unidade deverá substituir a instalação provisória, localizada na mesma cidade, a partir da qual a empresa começou a atuar no Brasil em 2010. No mercado desde 2005, a Yacht Brasil também possui escritório em Miami (Estados Unidos) e atua no Uruguai e na Argentina, onde pretende abrir uma filial ainda este ano.

com Fiat (23,68%), Volkswagen (14,58%) e GM (9,04%). MÉXICO. O México espera obter na próxima semana um acordo com o Brasil sobre as renegociações do acordo automotivo, que se complicou com as exigências brasileiras de adotar cotas de importação. O secretário de Economia do México, Bruno Ferrari, afirmou nesta quinta-feira que seu país está disposto a renegociar sob “termos de reciprocidade”. O México, que não quer perder um importante mercado de automóveis e peças, havia aceitado na quarta-feira outras demandas do Brasil: uma revisão do conteúdo de origem de exportações e a inclusão de veículos pesados no acordo de livre comércio, segundo informaram fontes brasileiras. Ferrari, porém, evitou comentar quando foi questionado sobre o tema das cotas que o Brasil considera condição não negociável para preservar o acordo. (Com agências)

■ CONSUMO

Apas: venda de ovos de Páscoa deve crescer 10% Líder em Medicina Preventiva no Brasil

Você já realizou seu check-up médico em 2012 ? Coloque mais vida em sua saúde. Visite nosso site: www.medriocheck-up.com.br Rua Lauro Muller, 116 – 34º andar Torre do Rio Sul – Botafogo – RJ Tel: (21) 2546-3000 agenda@medrio.com.br

Funcionamos também aos sábados

DA AGÊNCIA ESTADO

As vendas de ovos de chocolate devem crescer 10% em termos reais, já descontada a inflação, na Páscoa deste ano em relação a 2011, segundo levantamento divulgado na quinta-feira pela Associação Paulista de Supermercados (Apas). O crescimento das vendas deve ser puxado, principalmente, pelos consumidores da classe C, que nos últimos anos vêm ampliando seu poder de compra. A Apas ressaltou que a proximidade da Páscoa já se reflete nos preços do produto. De acordo com o índice de preços nos supermercados, medido pela associação, nos últimos 12 meses o preço do chocolate registrou queda de 4,23%. No entanto, em janeiro, o indicador apresentou alta de 0,63%. A expectativa é por aumento nos preços do produto conforme a data se aproxime, diz a entidade. A estimativa de fornecedores consultados pela Apas é de que

os preços fiquem, em média, 9% mais caros este ano em relação ao ano passado. Além de chocolates, outros itens devem ganhar representatividade na área de vendas dos supermercados nesta Páscoa. Entre eles, os pescados em geral, com maior volume de vendas de bacalhau, de sardinha e de pescada branca. Entre os acompanhamentos, o destaque deve ficar por conta dos vinhos e dos azeites, com expectativa de crescimento de 9% nas vendas. CONTRATAÇÕES. Para esta Páscoa, levantamento do Instituto de Pesquisa Manager , prevê um aumento de 2% no total de contratações temporárias em relação ao ano passado. No total, devem ser admitidas, temporariamente, 71,5 mil pessoas no País para atuarem na indústria e no varejo este ano, segundo o estudo. No ano passado, foram contratados 70,1 mil trabalhadores temporários, dos quais 25% foram efetivados.

Porto do Rio se moderniza O presidente da Companhia Docas do Rio de Janeiro (CDRJ), Jorge Mello, disse à coluna que a estatal federal vive um bom momento, porque foi afinal quitada uma das mais importantes dívidas da companhia, referente à compra de equipamentos da extinta Portobrás, destinados a outros portos. Embora Itaguaí seja mais moderno e de maior potencial, os olhos de Mello, no momento, se concentram no velho porto do Rio. Diz que a dragagem já foi concluída e, com isso, os dois terminais de contêineres – dos grupos Libra e Multiterminais – em breve poderão passar de navios de 4 mil para até 7 mil contêineres. Isso, mesmo antes da grande ampliação dos terminais já autorizada e que incluirá investimentos de R$ 1 bilhão: os gastos serão dos particulares e, em compensação, o governo ampliará o prazo de concessão. Revela Mello que o novo calado do porto do Rio sofrerá atraso por um motivo aleatório. Para homologar a nova profundidade, a Capitania dos Portos, além do relatório oficial, exigiu dados brutos de sondagem. A empresa que realizou o trabalho alega que tais dados sumiram dos computadores e, portanto, parte deles terá de ser refeita, causando atraso, embora não significativo. A profundidade é de 15 metros e, como garantia, será aprovado calado para 14 metros. A Libra fará extensão de cais, enquanto a Multiterminais irá usar sua própria área de operações ro-ro e, em troca, será construído um edifício para armazenar os carros, o que já está aprovado pelas autoridades ambientais.

Itaguaí e contêineres Em relação a Itaguaí (ex-Sepetiba), o presidenta das Docas do Rio informa que apenas aguarda liberação do Tribunal de Contas da União para licitar um novo terminal de granéis para o porto, o que ampliará a capacidade de movimentar cargas como minério e carvão. Em relação aos contêineres, Mello afirma que Itaguaí já deveria estar operando com maior capacidade, mas que a conclusão do arco rodoviário (espécie de rodoanel fluminense) agilizará o escoamento do porto. Outras obras necessárias seriam o ferroanel de São Paulo e a melhoria da descida da Serra das Araras, um pedaço da velha rodovia Dutra que prejudica Itaguaí, pois o trecho – administrado pela CCR – é um obstáculo à circulação de caminhões e carretas.

No páreo

FÁBIO COSTA/JCOM/DA PRESS

Afilhado de Juscelino Kubitscheck – cuja família já declarou apoio público à sua campanha – o deputado federal Otávio Leite (foto) vai ser candidato do PSDB à prefeitura do Rio. À coluna, ele disse que reconhece ser um importante desafio para uma ascendente carreira política, que acumula 20 anos de exercício de mandatos: vereador, deputado estadual, vice-prefeito e duas vezes deputado federal. A presença de José Serra na disputa em São Paulo, nacionalizando a eleição municipal deste ano, pesou na decisão do tucano.

Learjet 400 A Bombardier canadense vendeu seu 400º jato executivo Learjet 60X. O comprador foi a empresa mexicana Cinépolis, que opera 2.690 salas de cinema na América Latina e Ásia. No Brasil, a Cinépolis está presente em nove cidades.

Randon nas compras O grupo Randon, Caxias do Sul (RS), confirmou que é comprador. E mais: o cacife para bancar as compras não faz parte dos R$ 400 milhões aportados para investir em 2012.

Sono melhora com a idade Pesquisa realizada pelo Centro para Sono e Neurobiologia Circadiana da Universidade da Pensilvânia nos Estados Unidos sugere que a qualidade do sono melhora com o avanço da idade, ao contrário do que se imaginava até agora. Segundo os depoimentos, a não ser por um período por volta dos 40 anos, a qualidade do sono aumenta com o passar do tempo.

Leilão de Oscar bate recorde Quinze estatuetas do Oscar foram vendidas por um total recorde de US$ 3 milhões em leilão pela internet. A casa Nate D. Sanders, de Los Angeles, disse que a peça mais valiosa foi o Oscar de melhor roteiro dado em 1941 a Herman Mankiewicz por "Cidadão Kane", em conjunto com Orson Welles: saiu por US$ 588.455.

DA BBC BRASIL. Apreciador de samba, feijoada e caipirinha, o chef britânico Jamie Oliver disse que quer abrir um restaurante no Brasil, mas só depois que achar o sócio ideal.

FROM POMONA. Carlinhos Brown foi convidado para fazer o show de abertura da Feira de Tecnologia CeBIT, em Hannover, Alemanha, que terá Dilma como convidada especial.

Iates: um mercado de vento em popa no Brasil

aziz.ahmed@jcom.com.br

O sonho da Presidência não está enterrado, mas adormecido. Estou no auge da minha energia De José Serra, pré-candidato do PSDB à prefeitura de São Paulo.

Sistema CNC - SESC - SENAC Do Tamanho do Brasil www.cnc.org.br


ECONOMIA

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

BRASIL S/A ANTONIO MACHADO

cidadebiz@correioweb.com.br

Jogos de guerra A nova rodada de empréstimos subsidiados do Banco Central Europeu à rede bancária da Zona do Euro, de 529,5 bilhões de euros, não foi causa imediata da decisão do Ministério de Fazenda de elevar de dois para três anos o prazo para a incidência do IOF (Imposto sobre Operações Financeiras) de 6% sobre a contratação de dívida externa por bancos e empresas brasileiras. A apreciação do real já vem de mais tempo. O processo de emissões das quatro principais moedas negociadas no circuito global — dólar, euro, iene e libra — é ação deliberada dos governos, visando, em primeiro lugar, “purificar” os balanços da banca entupidos de papéis encalhados, sobretudo de dívida soberana, para prevenir riscos sistêmicos e desobstruir o canal do crédito. Tais emissões funcionam como aditivos para as economias prostradas da Zona do Euro, Estados Unidos, Japão e Inglaterra, todas elas limitadas pela relutância ou incapacidade de o mercado financiar, voluntariamente, o endividamento público existente. Os deficits fiscais, difíceis de serem cortados sem agravar a recessão persistente na Europa e Japão e frustrar a tênue recuperação nos EUA, complicam o problema. Tais governos se debatem entre uma deflação generalizada ou algum crescimento NOVA EMISSÃO DE EUROS à custa da capaciAUMENTA O CALDO DOS dade dos orçaCAPITAIS OCIOSOS NO mentos públicos futuros — o motiMUNDO E AMEAÇA vo de a expansão INTEGRIDADE DO REAL monetária ocorrer em paralelo com o corte de gastos públicos e aumento de impostos. A recessão aberta, que seria o resultado da inanição, teria consequências mais sérias, inclusive para a economia global em que estamos todos inseridos. A distorção inevitável, nesta altura da crise originada do colapso do crédito inicialmente nos EUA, é a desvalorização competitiva das moedas utilizadas como meio de pagamento e reserva de valor, mais o dólar e logo atrás o euro que o iene, a libra e até o franco suíço. A depreciação decorre das emissões de liquidez sem correspondência com os movimentos reais das economias emissoras dessas moedas. É um processo que pode desencadear uma espiral inflacionária. Só que não há tal risco enquanto as tendências recessivas derem o tom nos EUA e Europa, tornando compensador o aventureirismo monetário. Ou, como prefere dizer o ministro Guido Mantega, “guerra cambial”. MULETA DA MOEDA FRACA A desvalorização ajuda a baratear as exportações dos EUA e da Zona Euro, funcionando, a um só tempo, como indutor de crescimento sobre o mercado interno carente de tração e como obstáculo à concorrência arrasadora da China. É o dólar barato que tem impulsionado a fraca recuperação da economia nos EUA. Não faz mais porque os países que importam aos EUA se defendem com desvalorizações competitivas. Não bem a China, que se ressente menos ao manter o renminbi atado ao dólar. Hoje menos, já que vem liberalizando a passos de cágado a sua conta de capitais, mas o suficiente para anular boa parte da competitividade do dólar. Protecionismo regulatório e salário vil completam o serviço. A Europa era a grande perdedora. Já nem tanto. A EUROPA COPIA OS EUA Como selo pessoal de seu mandato à frente do Banco Central Europeu (BCE), o italiano Mario Draghi replicou, em dezembro, o que nos EUA o Federal Reserve já fizera por duas vezes formalmente, fora outras pontuais: as emissões de moeda, lá chamadas de quantitative easing (QE), para aliviar a tesouraria da banca e motivá-la a emprestar. A Zona do Euro adotou uma nomenclatura também hermética: Long-Term Refinancing Operation, ou LTRO. No primeiro LTRO, que consiste em empréstimos lastreados em títulos públicos e privados, o BCE emitiu 489 bilhões de euros, tomados por 523 bancos. O segundo foi nesta quarta-feira, quando o BCE emprestou 529,5 bilhões de euros a 800 bancos da Zona do Euro. Tais valores revelam a fragilidade da economia europeia. FASCINADOS PELA SELIC A diferença entre tais recursos extremos de liquidez é que, nos EUA, o Fed absorveu os papéis tóxicos da banca, enquanto, na Zona do Euro, o BCE concedeu empréstimos, para que a banca os use para subscrever papéis de dívida dos países contaminados pela crise da Grécia, como Itália e Espanha. Tem funcionado, pois Espanha e Itália vêm emitido dívida nova a juros menores, embora acima do quem pagavam até 2009. Ainda assim, o grosso do que o BCE emprestou por três anos a juros de 1% ao ano está empoçado. Nem há demanda na Europa por crédito nem a banca quer maior exposição ao risco de dívidas soberanas. Entende-se o fascínio de tais capitais pelas curvas dos juros brasileiros. GOVERNO ABUSA DA SORTE A promiscuidade monetária do BCE e do Fed ameaça a integridade do real, que já tendia a se apreciar pelos bons fundamentos das contas externas. A valorização excedente, digamos assim, vem dos dólares e euros em busca do trinômio liquidez-rentabilidade-segurança. É o que encontram no Brasil, que abusa da sorte ao incentivar mais o consumo que a produção, gerando poupança negativa financiada pelo capital externo. Não dá para dispensar tais capitais por isso, mas o governo tem de filtrá-lo para evitar o colapso do real, portanto, da produção nacional. BC e Fazenda jogam na defesa, acionando ações tópicas como o IOF. Se a “guerra cambial” recrudescer, virão outras ações, e logo estaremos no limiar do câmbio administrado. Será mais sábio prevenir que cogitar radicalismos difíceis de reverter.

Jornal do Commercio A-5

AEROPORTOS - Ministro esclarece que a chamada tarifa hub está prevista no contrato de concessão dos aeroportos de Brasília, Guarulhos e Viracopos (SP)

Empresas aéreas terão que pagar tarifa por conexões DA REDAÇÃO

O

ministro da Secretaria Nacional de Aviação Civil, Wagner Bittencourt, confirmou na quinta-feira que as companhias aéreas devem começar a pagar tarifa pelas conexões aos administradores dos aeroportos que foram leiloados recentemente. Bittencourt participou de audiência pública conjunta das comissões de Infraestrutura e de Defesa do Consumidor do Senado e esclareceu que a chamada tarifa hub está prevista no contrato de concessão dos aeroportos de Brasília, Guarulhos, em São Paulo, e Viracopos, em Campinas (SP). Segundo o ministro, esses terminais são pontos de distribuição de voos e muito utilizados em conexões, serviço que atualmente não é cobrado. Segundo admitiu, as empresas que detêm as concessões po-

derão passar a cobrar tarifa das companhias aéreas. Wagner Bittencourt também explicou aos senadores que o objetivo das concessões foi propiciar investimentos nesses terminais sem aumento de custos para os passageiros. Além disso, segundo disse, o governo quer que no futuro que os aeroportos possam definir os preços das tarifas sem a mediação da Empresa de Infraestrutura Aeroportuária (Infraero) – que atualmente define os preços por tabela. Com isso, a expectativa é que aumente a concorrência e os preços caiam. O ministro também voltou a explicar que os valores arrecadados com as concessões e pelas administrações dos aeroportos ao setor privado serão utilizados nos de pequeno e médio portes. O governo quer estimular a aviação regional por meio da Infraero, que é sócia dos consórcios vencedores e admi-

nistra outros 63 terminais em todo o País. CRITÉRIO. O presidente da Infraero, Antonio Gustavo Matos do Vale, defendeu o critério adotado pelo governo no processo de privatização dos aeroportos de Brasília, Guarulhos e Campinas (Viracopos), de habilitar apenas os concessionários que já tenham operado terminais com fluxo anual acima de 5 milhões de passageiros. Durante audiência na Comissão de Infraestrutura do Senado, o senador Francisco Dornelles (PP-RJ) disse estar apreensivo em relação a esse critério, tendo em vista que o potencial do aeroporto de Brasília chegará a 50 milhões de passageiros. “Quem administra um aeroporto de 5 milhões tem toda competência para administrar aeroportos ainda maiores”, afirmou o presidente da Infraero. Para Vale, acima desse patamar, não faz muita diferença para o

operador aeroportuário o tamanho do fluxo de passageiros. Conforme disse, a maior dificuldade para o operador está em resolver com “competência” os serviços nos horários de grande movimento. O presidente da Infraero citou, como exemplo, que “qualquer administrador” aeroportuário sabe que é mais difícil, em horários de pico, operar o aeroporto de Guarulhos do que o de Goiânia. “Nós nem iríamos exigir os 5 milhões”, afirmou. Ressaltou ainda que, se fosse aumentar o patamar para 10 milhões de passageiros por ano, a concorrência seria restrita para 50 a 60 operadores em todo o mundo. O diretor-presidente da Agência Nacional de Aviação Civil (Anac), Marcelo Guaranys, também defendeu o corte em 5 milhões. Para Guaranys, quem administra um aeroporto neste patamar já sabe lidar com complexidade. (Com agências)

■ PETROBRAS

Conselho terá primeiro sindicalista SABRINA VALLE DA AGÊNCIA ESTADO

A Petrobras terá em breve e, de fato, pela primeira vez, um sindicalista no Conselho de Administração. O órgão está sendo ampliado de nove para dez membros de modo a acomodar um representante dos empregados da estatal, conforme determina lei federal. Dois representantes sindicais venceram 133 candidatos e foram para o segundo turno das eleições, que se encerra nesta segunda-feira. Concorrem o coordenador-geral da Federa-

ção Única dos Petroleiros (FUP), João Antônio de Moraes, e o presidente da Associação dos Engenheiros da Petrobras (Aepet), Silvio Sinedino. Os dois trabalham na estatal desde a década de 80. Moraes como técnico de operação de refinaria, e Sinedino como engenheiro eletricista e analista de sistemas. Um dos dois participará das decisões sobre os rumos da companhia e sentará ao lado do ministro da Fazenda, Guido Mantega; do presidente do BNDES, Luciano Coutinho; além da presidente da Petrobras, Graça Foster; e

CURTA

de outros seis conselheiros. O vencedor participará também de decisões de assuntos estratégicos não apenas para a Petrobras, mas para o País – como o preço da gasolina ou o montante de investimentos para o pré-sal. Também receberá cerca de R$ 100 mil para participar das reuniões durante os 12 meses de mandato, sendo admitida reeleição. Graça declarou na semana passada que esta será a grande oportunidade para que os 85 mil empregados da Petrobras e coligadas tenham voz e ouvidos nas reuniões do conselho.

Desde o governo João Goulart funcionários não participam das reuniões. A representação na época ocorreu por um período breve e foi interrompida no período militar. Os funcionários estão engajados na votação eletrônica: 16 mil (28% dos aptos a votar) participaram do primeiro turno e, no segundo, a tendência é que a adesão cresça. O resultado deve ser anunciado até o fim da próxima semana e nomeação do novo membro será ratificada pelos acionistas na Assembleia Geral Ordinária em 19 de março.

Ministério da Fazenda

PETROBRAS ENTREGA VOLUME RECORDE DE GÁS A Petrobras registrou crescimento de 15,3% no volume de entrega de gás natural ao mercado, de 2010 para 2011. O volume recorde de 37 milhões de metros cúbicos por dia de gás, de acordo com a empresa, é resultado da entrada em produção dos campos de Mexilhão, Uruguá e Tambaú, na Bacia de Santos.

AVISO DE LICITAÇÃO Decreto nº 5.450, de 31 de maio de 2005 Pregão Eletrônico IRB-Brasil Re nº 003/2012 Informamos que o Pregão IRB-Brasil Re foi adiado para o dia 19/03/2012, às 11 horas, e que o edital permanece inalterado. ACESSO AO EDITAL: www.licitacoes-e.com.br. Jario Paiva Sanches PREGOEIRO

CASA DA MOEDA DO BRASIL

AVISO DE LICITAÇÃO A Casa da Moeda do Brasil – CMB comunica que realizará a seguinte Licitação: - Pregão Eletrônico nº E0024/2012 – Aquisição de Gases Especiais, no dia 14 de março de 2012, às 09 horas. O Edital encontra-se disponível nos seguintes endereços eletrônicos: www.casadamoeda.gov.br e www.licitacoes-e.com.br. Tel.: (21) 2414-2732 E-mail: sequeiroz@cmb.gov.br SÉRGIO EDUARDO DA SILVA QUEIROZ PREGOEIRO

CASA DA MOEDA DO BRASIL

AVISO DE LICITAÇÃO A Casa da Moeda do Brasil – CMB comunica que realizará a seguinte Licitação: - Registro de Preços Por Pregão Eletrônico nº E0004/2012 – Aquisição de Uniformes, no dia 15 de Março de 2012, às 09 horas; O Edital encontra-se disponível nos endereços eletrônicos: www.casadamoeda.gov.br e www.licitacoes-e.com.br. E-mail: vcoelho@cmb.gov.br VALDIR DA SILVA COELHO PREGOEIRO

BOLSA BRASILEIRA DE FUTUROS CNPJ/MF n° 28.010.791/0001-50 EDITAL DE CONVOCAÇÃO ASSEMBLEIA GERAL ORDINÁRIA E EXTRAORDINÁRIA Ficam os Senhores Associados da BOLSA BRASILEIRA DE FUTUROS (“BBF” ou “Associação”) convocados a se reunirem em Assembleia Geral Ordinária e Extraordinária, a ser realizada no dia 09 de março de 2012, às 10h00min, na cidade do Rio de Janeiro, Estado do Rio de Janeiro, na Rua do Mercado, nº 11, 2º andar, Centro - CEP 20.010-120, para deliberarem sobre a seguinte ordem do dia: Em Assembleia Geral Ordinária: (1) Exame, discussão e votação das demonstrações financeiras relativas aos exercícios sociais encerrados em 31/12/1997; 31/12/1998; 31/12/1999; 31/12/2000; 31/12/2001; 31/12/2002; 31/12/2003; 31/12/2004; 31/12/2005; 31/12/2006; 31/12/2007; 31/12/2008; 31/12/2009; 31/12/2010 e 31/12/2011 e dos balanços de encerramento, da BBF e do Fundo de Garantia da BBF; e Em Assembleia Geral Extraordinária: (2) Apreciação da renúncia do atual Gestor e Superintendente Geral; e (3) Ratificação do encerramento das atividades e deliberação sobre a dissolução e a extinção da Associação. Não havendo quórum para instalação no horário fixado, a Assembleia será instalada, em segunda convocação, com qualquer número de associados, às 10h30min, no mesmo local e data. Informamos que os documentos pertinentes à ordem do dia encontram-se à disposição na sede da Associação e que os Associados poderão ser representados por procurador com poderes especiais para deliberar sobre as matérias da ordem do dia acima discriminadas. O Associado ou seu representante legal deverá comparecer à Assembleia munido de documento que comprove sua identidade, e, no caso de representante legal, de documento que ateste os seus poderes de representação. São Paulo, 02 de março de 2012. Associação BM&F - Edemir Pinto - Diretor Geral.


PAÍS A-6

EDITOR // LUÍS EDMUNDO ARAÚJO

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

FUNCIONALISMO - Projeções mostram que o novo regime de aposentadoria dos servidores fará as despesas aumentarem R$ 570 milhões anuais até 2030

Trinta anos para tapar o rombo da Previdência VÂNIA CRISTINO

A

pesar de a despesa aumentar nos primeiros anos, o gover no está convencido que a criação da Fundação de Previdência Complementar do Ser vidor Público Federal (Funpresp), recém-aprovada pela Câmara dos Deputados, vai ser um bom negócio. Pelos cálculos feitos pelo Ministério da Previdência Social a nova aposentadoria fará a despesa aumentar cerca de R$ 570 milhões anuais até 2030. A partir daí, o custo extra começará a cair até chegar a zero em 2040. De olho na solução do rombo da Previdência, o governo já pediu ao Senado que corra com a aprovação da Funpresp na Casa (leia matéria ao lado) Para o Secretário de Previdência Complementar, Jaime Mariz, esse aumento de despesa vai ser compensado, imediatamente, pela queda dos juros. “O Brasil paga em torno de R$ 200 bilhões por ano a título de serviço da dívida. O redesenho do futuro previdenciár io brasileiro é um ingrediente fundamental para que se tenha uma queda nessa taxa. Se a taxa cair 1% o que, segundo economistas, seria um percentual razoável, o País economizará em torno de R$ 2 bilhões ao ano”, explicou. Num primeiro momento, a despesa do governo cresce com a implantação dos fundos de pensão, porque, além de continuar bancando as atuais aposentador ias e pensões dos servidores inativos, o governo é obrigado a

AS CONTAS DO GOVERNO •Previsão de contratação de novos servidores: 28 mil por ano •Previsão de gasto anual, sem o fundo de pensão: R$ 8,9 milhões por ano •Deficit atual do regime de previdência dos servidores públicos: R$ 60 bilhões •Despesa adicional com o fundo de pensão: R$ 570 milhões por ano até 2030 (0,1% do PIB, a preços atuais) •Despesa adicional começa a cair a partir de 2030, zerando em 2040 •A partir de 2040, as despesas do governo com inativos serão reduzidas em R$ 28 bilhões ao ano •Despesa do governo com pagamento de juros: R$ 200 bilhões por ano •Redução esperada da despesa por causa do impacto positivo do novo modelo em longo prazo: 1% ao ano, ou R$ 2 bilhões Fonte: Ministério da Previdência Social

contribuir na proporção de 8,5% sobre a parcela do salário do novo servidor que exceder o teto do Instituto Nacional do Seguro Social (INSS). O governo também perde arrecadação, pois o servidor contribuirá para formar a reser va que, no futuro, complementará a sua aposentadoria. Só que o aporte, em vez de ir para um bolo geral, será direcionado para uma conta individualizada e que será capitalizada ao longo do tempo. No regime atual, sem fundo de pensão, os servidores contribuem com 11% sobre o salário total, tendo, no futuro, direito à aposentadoria integral. Com o fundo de pensão, de adesão obrigatória para os novos servidores e optativa para os atuais, o governo só garante a aposentadoria até o teto do regime Geral de Previdência Social (RGPS), hoje em R$ 3.916,20, como acontece

com os trabalhadores da iniciativa privada. Até o teto, a contribuição é de 11%. Acima desse valor, a complementação da aposentadoria só será possível por meio do fundo de pensão, com contribuição do patrocinador (no caso o gover no) e do próprio servidor. A alíquota prevista é de 8,5%. Com o regime atual, o governo arca, todo ano, com um deficit de R$ 60 bilhões para menos de um milhão de aposentados e pensionistas do setor público, porque as contribuições arrecadadas não são suficientes para honrar os pagamentos assumidos. Sem o fundo de pensão, a previsão é de que esse deficit crescesse à razão de 10% ao ano. É um rombo super ior ao orçamento de muitos ministérios. O deficit da previdência do setor público é também muito superior ao coberto pelo Tesouro Nacional para os trabalha-

dores da iniciativa privada. No ano passado, para pagar 29 milhões de benefícios do Regime Geral (INSS), o governo gastou pouco menos de R$ 36 bilhões. DISPARIDADE INCÔMODA. O governo está muito incomodado com essa diferença. E ela decorre do fato de que os aposentados do setor público ganham muito na inatividade, sem terem contribuído o suficiente para isso. As aposentadorias médias no Executivo, que é o que paga menos, ultrapassa R$ 4 mil, mais do que dobrando esse valor no Legislativo e Judiciário. Enquanto isso, a aposentadoria média do setor privado, bancado pelo INSS, chega a R$ 835,00, com 70% dos benefícios sendo equivalentes ao salário mínimo vigente no País (R$ 622). As previsões do governo para o novo sistema é que ingressem, por ano, 28 mil novos servidores. Cerca de 40% deles terão interesse em aderir ao fundo de pensão pois ganharão acima do teto. A expectativa do governo é de que o fundo de pensão dos servidores públicos acumule recursos consideráveis na próxima década, passando também a ser uma fonte importante de poupança no País. Hoje, os fundos de pensão dos trabalhadores da iniciativa privada, muitos deles de empresas públicas e estatais, como a Petros (da Petrobras) e a Previ (do Banco do Brasil), detêm um patrimônio de R$ 580 bilhões. De acordo com os cálculos atuariais feitos, mesmo pagando todos os compromissos, haveria uma sobra de R$ 60 bilhões.

Senado quer votar o Funpresp KARLA CORREIA

O Palácio do Planalto quer acelerar ao máximo a tramitação do projeto de lei que cria a Fundação de Previdência Complementar do Servidor Público Federal (Funpresp) no Senado. De acordo com o líder do governo na Casa, Romero Jucá (PMDBRR), a meta é fazer o texto percorrer o caminho normal de tramitação – que inclui a aprovação em três comissões, antes de ir ao plenário – em apenas 30 dias. O projeto está entre as prioridades da agenda legislativa do governo neste ano. Como o texto corre em regime de urgência constitucional, o Senado tem prazo de 45 dias antes de a Funpresp começar a trancar a pauta da Casa. “O texto da Funpresp foi melhorado e passou por um amplo acordo na Câmara. Então, ele já chega aqui em uma condição melhor de negociação, não deve haver grandes demandas em cima do texto”, acredita Jucá. O governo resistiu ao estabelecimento de metas de rendimento para a Funpresp, defendida por setores da Câmara, mas cedeu, por exemplo, ao aceitar dividir em três o fundo que vai gerir as contribuições dos servidores que entrarem no funcionalismo público depois da aprovação do projeto. “Eu acho que o processo será mais redondo no Sena-

REFORMA MINISTERIAL

PTB e PSC se unem Um bloco informal reunindo PTB e PSC embolou ainda mais o xadrez da reforma ministerial. Os dois partidos comunicaram, na quarta-feira, a aliança à ministra das Relações Institucionais, Ideli Salvatti, e deixaram em aberto a possibilidade de assumir um ministério. O nome do pré-candidato, inclusive, já estaria escolhido: Hugo Leal, deputado do PSC fluminense e um dos líderes da bancada evangélica no Congresso. O líder do PTB na Câmara, Jovair Arantes (GO), admitiu a aliança, ainda que informal. “Temos um bloco formal com o PCdoB e o PSB. Mas avisamos à Ideli que nós e o PSC vamos votar juntos, seja a favor ou seja contra aos projetos que tramitam na Casa”. Jovair não quis, no entanto, aalar sobre eventuais compensações ministeriais. “Hugo Leal é um excelente quadro, um grande parlamentar. Mas não estamos

do, para usar o jargão futebolístico”, afirmou o líder. Na Câmara, além da questão de se tratar de um tema delicado, com a retirada de direitos dos servidores públicos em ano eleitoral, o cenário político influenciou fortemente a tramitação da Funpresp. Partidos da base aliada do governo insatisfeitos com a relação com o Planalto, como o PR e o PDT, por exemplo, se posicionaram contra o texto no

pensando nisso no momento”, assegurou. No Planalto, as movimentações de PTB e PSC foram vistas com bons olhos. Principalmente depois da votação da Fundação de Previdência dos Servidores Públicos (Funpresp) na Câmara. A matéria foi aprovada, mas o comportamento do PDT irritou a presidente Dilma Rousseff. “Até mesmo o deputado Vieira da Cunha (PDT-RS), apontado como o preferido por Dilma para assumir o Ministério do Trabalho, votou contra o projeto”, reclamou um assessor palaciano. Com isso, a tendência é que o partido perca pontos na tentativa de retomar o ministério. “A situação se agrava ainda mais com as insinuações do deputado Paulo Pereira da Silva, o Paulinho, de que o PDT paulistano pode apoiar o tucano José Serra nas eleições municipais de outubro”, acrescentou um aliado da presidente. (K.C.)

plenário da Casa. A votação chegou a ser adiada por conta de atritos entre o presidente da Câmara, Marco Maia (PT-RS), e o governo, envolvendo nomeações de afilhados no Banco do Brasil. E S P L A N A D A . Na avaliação de Jucá, as demandas dos partidos governistas por ministérios estão sendo solucionadas. “A presidente Dilma Rousseff está conversando

com os partidos, com a direção do PDT, do PR. No momento oportuno, ela vai definir que tipo de espaço esses partidos terão no espectro ministerial”, disse o líder. “O PR esta discutindo o retorno da legenda a um espaço ministerial. É importante que o PR seja atendido. Trata-se de um partido grande, que tem votos importantes para o governo. É uma bancada importante aqui no Senado”.

NAS

ENTRELINHAS deniserothenburg.df@diariosassociados.com.br

DENISE ROTHENBURG

A política ferve Se alguém tinha alguma dúvida de que a eleição municipal fará ruir parte da relação amistosa entre PT e PMDB, elas estão prestes a se dissipar. O primeiro sinal de que nada vai bem é o manifesto assinado por 45 peemedebistas, a ser entregue na segunda-feira aos caciques do PMDB. Ali, a turma de Michel Temer vem com a conversa de sempre, que está excluída das definições de governo. Entre um enunciado e outro do documento, a leitura política é de recados a vários personagens. A primeira mensagem não escrita está endereçada à cúpula do próprio PMDB: ou os caciques (leia-se o presidente em exercício do PMDB, Valdir Raupp, e os líderes Renan Calheiros, no Senado, e Henrique Eduardo Alves, na Câmara) passam a jogar para o time ou, aos poucos, não terão uma grande turma sob seu comando a lhes respaldar as ações. Muitos no PMDB têm hoje uma sensação cristalina de que Raupp, Renan e Henrique – inclua-se aí o presidente do Senado, José Sarney – jogam por seus projetos pessoais. E não se preocupam em defender um projeto partidário, que inclua a massa de deputados e senadores, por enquanto, a maior do parlamento. Diante de um manifesto assinado por mais de metade da bancada, é bom esse grupo passar a reunir mais os parlamentares, tirar posições conjuntas e evitar o toque de caixa como deseja o governo. Ou seja, dar, ao menos, uma sensação de discussão dos temas, o que não ocorreu, por exemplo, na votação do fundo de previdência do servidor público federal, uma atitude que ajudou a engrossar o manifesto. O segundo recado do tal documento também está nos meandros. Até aqui, todos os grandes e bons projetos do governo são considerados do PT, e o PMDB fica sempre no prejuízo. O partido está incomodado de votar a favor de tudo o que o Executivo deseja e não receber sequer um muito obrigado na hora em que a proposta é sancionada com festa no Planalto. Cansou-se do desprezo com que Dilma trata o partido, sem esconder uma preferência pelo governador de Pernambuco, Eduardo Campos, citado inclusive como um possível futuro candidato a vice-presidente. POR FALAR EM PREJUÍZO… O recado explícito O MANIFESTO REVELA A do manifesto é a anANSIEDADE DO PMDB. siedade do PMDB. Os deputados partiOS DEPUTADOS cipam ativamente PARTICIPAM da formatação dos ATIVAMENTE DA palanques da eleição municipal no inteFORMATAÇÃO DOS rior. Cada um deles PALANQUES DA ELEIÇÃO já percebeu in loco que o objetivo maior MUNICIPAL NO do PT – além de conINTERIOR. CADA UM quistar São Paulo – é tentar tirar o PMDB DELES JÁ PERCEBEU IN do lugar mais alto do LOCO QUE O OBJETIVO pódio em número de prefeituras. O PMDB MAIOR DO PT – ALÉM elegeu pouco mais DE CONQUISTAR SÃO de 1,2 mil prefeitos. Hoje, tem 1.175. E, PAULO – É TENTAR TIRAR pelo andar da carO PMDB DO LUGAR ruagem no interior, MAIS ALTO DO PÓDIO está cada vez mais claro que o PT trabaEM NÚMERO DE lhará para reduziPREFEITURAS los. Não por acaso, dos ministérios que lidam diretamente com os municípios, só restou ao PMDB a Agricultura, enquanto o PT comanda Saúde, Educação e Comunicações. As prefeituras são consideradas cruciais para a eleição de deputados e senadores. Quem tem mais prefeitos, na prática, tem mais força para eleger deputados. O PMDB vê seu poder se reduzindo lentamente nas eleições. E agora, na avaliação de muitos, chegou ao limite: se não gritar já, chamando inclusive seus caciques para o jogo, o PT vai tomar espaço e aí não adianta chorar depois. POR FALAR EM CHORAR… O PMDB, em seus encontros mais reservados, tem dito com todas as letras que a “faxina” surge na imprensa como obra de Dilma Rousseff e do PT. Enquanto ao PMDB e demais aliados ficam com o status de “faxinados”. Diante disso, muitos acham que o manifesto pode ser visto como o início da hora da verdade. No caso dos caciques do PMDB, ou eles passam a ter uma visão mais executiva, em vez de centrar fogo apenas na conquista de poder no Legislativo, ou vão acabar perdendo esse poder lá na frente para o PT. Em relação ao governo Dilma, também não tem meio-termo: ou o PMDB passar a ter mais influência ou seus deputados vão começar a espalhar armadilhas para Dilma no parlamento. E, nessa Legislatura, eles são muitos. POR FALAR EM VERDADE… Dentro do Planalto, entretanto, há quem diga que cão que late não morde. O mais provável é que o governo Dilma dê um afago aqui e outro ali ao PMDB e deixe tudo como está, até a próxima crise. Afinal, se tem uma coisa que sempre ocorreu foi o PMDB reclamando disso e daquilo, o governo dizendo que entende a situação, e o PT fingindo que não é com ele. Resta saber o que essa fervura trará de diferente. Até o momento, a trama segue a receita normal das novelas. Se vai começar a engrossar o caldo ali na frente, aí é outra história.


PAÍS

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

BRASÍLIA-DF

Jornal do Commercio

A-7

ELEIÇÕES - Escolha de Crivella para o Ministério da Pesca atrapalha os planos dos peemedebistas de fechar aliança com o PRB na disputa por São Paulo

LUIZ CARLOS AZEDO luiz.azedo@correioweb.com.br

Com Guilherme Queiroz

Com a benção de Temer Durante jantar no Palácio do Jaburu, a cúpula do PMDB, comandada pelo vice-presidente Michel Temer, resolveu jogar pesado para garantir a candidatura de Gabriel Chalita à Prefeitura de São Paulo. Teme um ataque especulativo do PT. Participou do encontro o presidente da Federação das Indústrias de São Paulo, Paulo Skaf, que pretende disputar o Palácio dos Bandeirantes em 2014. Chalita e Skaf andaram se estranhando, mas fecharam um acordo de apoio recíproco. A entrada de Skaf na campanha é uma garantia de que não faltará sustentação empresarial à estratégia do PMDB em São Paulo, mesmo que o ex-presidente Luiz Inácio Lula da Silva, com apoio do Palácio do Planalto, jogue pesado para secar o projeto eleitoral peemedebista. O acordo, de certa forma, ajuda o candidato do PSDB, José Serra, duplamente: primeiro, porque Chalita sempre foi visto como uma espécie de plano B para o governador tucano Geraldo Alckmin; segundo, porque o tempo de televisão do PMDB, caso Chalita desistisse, aumentaria em muito o tempo de televisão da coligação liderada pelo PT.

Escorpião A velha piada do sapo e do escorpião é a melhor explicação que os petistas encontram para justificar a forma como o ex-presidente Luiz Inácio da Silva entrou no jogo do prefeito Gilberto Kassab, do PSD, ao articular a candidatura do ex-ministro da Educação Fernando Haddad. Como se sabe, o escorpião convenceu o sapo a carregá-lo nas costas durante a travessia do lago com o argumento de que morreria afogado se o atacasse. No meio do caminho, deu uma ferroada no batráquio. E disse-lhe que isso era da sua própria natureza, traiçoeira.

Na política O governador Jaques Wagner (PT) decidiu que o expresidente da Petrobras José Sérgio Gabrielli será o novo secretário de Planejamento do governo da Bahia. Zezéu Ribeiro, que ocupa o cargo, reassumirá o mandato de deputado federal, do qual estava licenciado. Wagner só anunciará oficialmente a mudança após o retorno da Alemanha, para onde viajará no sábado, na comitiva da presidente Dilma Rousseff, aproveitando para promover o Parque Tecnológico de Salvador aos empresários europeus, na Feira de Hannover.

No banco Com a volta de Zezéu para a Câmara, Acelino Popó Freitas (PRB-BA) perderá a cadeira e ficará, novamente, na condição de suplente da coligação.

Royalties O deputado federal Anthony Garotinho (PR-RJ) desceu o malho no presidente do Senado, José Sarney (PMDB-AP), por causa da participação no encontro dos 10 governadores de estados não produtores de petróleo na casa da governadora do Maranhão, Roseana Sarney (PMDB), anteontem, em Brasília: “É lamentável que exista uma ‘terceira casa’, que é a casa da governadora do Maranhão. O presidente do Senado atua em causa própria, já que o Maranhão é o estado que vai receber mais se a nova distribuição dos royalties for aprovada”, disse Garotinho.

Caserna A presidente Dilma Rousseff está uma onça com os 100 militares da reserva que assinaram o manifesto com críticas ao governo e à Comissão da Verdade, mas ninguém foi preso até agora. Todos serão punidos com penas brandas, de acordo com os regulamentos disciplinares. Caso haja envolvimento de gente da ativa, porém, a reação dos comandantes das três Forças será pôr no xadrez o indisciplinado.

Bloquinho O presidente do PCdoB, Renato Rabelo, ainda não conseguiu entender os objetivos da aliança do governador de Pernambuco, Eduardo Campos (PSB), com o prefeito de São Paulo, Gilberto Kassab (PSD). Por isso, quer discutir o futuro da aliança PSB-PTB-PCdoB na Câmara. O incômodo é provocado pela entrada iminente do PSD de Kassab no bloquinho.

Saúde Saiu o resultado do Índice de Desempenho do Sistema Único de Saúde (Idsus), criado pelo governo federal para medir o acesso do usuário e a qualidade dos serviços da rede pública. Santa Catarina (6,29), Paraná (6,23) e Rio Grande do Sul (5,9) são os primeiros colocados. Pará (4,1) Rondônia (4,49) e o Rio de Janeiro (4,58) estão na lanterninha. De 1 a 10, a média do país é 5,47

Fica pra depois Por causa das comemorações do Dia Internacional da Mulher, a senadora Marta Suplicy (PT-SP) desmarcou a reunião de prestação de contas do mandato, que estava marcada para segunda-feira, no Sindicato dos Engenheiros de São Paulo.

Estrada Três senadores por Rondônia, Acir Gurgacz (PDT), Valdir Raupp (PMDB) e Ivo Cassol (PP), cobram do diretor do Departamento Nacional de Infraestrutura de Transportes (Dnit), general Jorge Fraxe, que tape os buracos ao longo 700 quilômetros da BR-364, que liga o município de Vilhena à capital, Porto Velho.

PMDB reclama de nomeação para ministério PAULO DE TARSO LYRA

ATRITOS À VISTA

O

PMDB reclama que foi atropelado pelo Palácio do Planalto e pelo PT nas negociações com o PRB de Celso Russomano (SP). O partido negociava uma aliança com o candidato do PRB à Prefeitura de São Paulo e cogitava, inclusive, oferecer a vaga de vice na chapa. Apesar dos baixos índices de rejeição, Chalita tem seu eleitorado concentrado, principalmente, entre as pessoas que ganham mais de 10 salários mínimos. Russomano, por outro lado, tem um perfil mais popular e ajudaria a angariar votos nas regiões mais carentes da capital paulistana, redutos tipicamente petistas. O convite feito pela presidente Dilma Rousseff para que o senador Marcelo Crivella (PRB-RJ) seja o novo ministro da atrapalhou as conversas. Mesmo assim, Chalita e o vicepresidente da República, Michel Temer, conversaram pelo menos três vezes com Russomano. Não desistiram da parceria mas tentam, pelo menos, assegurar que Russomano não desista da candidatura para apoiar o PT. “Temos o segmento católico e inserção no eleitorado tucano e eles (PRB) têm a periferia”, resumiu um cacique do partido, adiantando que o PMDB também conversa com o PSC e com o PCdoB. Aliados de Temer reconhecem, contudo, que a situação não é fácil, já que o movimento de Dilma Rousseff foi cirúrgico. “Crivella é sobrinho do bispo Edir Macedo, dono da TV Record, da Igreja Universal e do PRB. É muito difícil alguém recusar uma ordem do bispo”, admitiu um interlocutor do PMDB. Caciques do partido reconhecem que a entrada do tucano José Serra na disputa – um das razões que levaram o PT e o Planalto a abrir os braços do governo para o PRB – alterou completamente o cenário. “Ninguém queria que ele entrasse, mas isso também não significa que ele seja imbatível. Nas outras duas eleições locais que venceu – prefeito em 2004 e governador em 2006 –, Serra tinha perspectivas de poder nacional. Ele não só não tem mais isso como terá que passar a campanha assegurando que vai cumprir o mandato até o fi-

Evangélicos não se sentem contemplados JÚNIA GAMA

A indicação do senador Marcelo Crivella (PRB-RJ) para o Ministério da Pesca ainda não produziu os efeitos esperados pelo Palácio do Planalto: turbinar a candidatura de Fernando Haddad em São Paulo e diminuir os atritos com os evangélicos. Parlamentares do PRB afirmam que a ida de Crivella para o primeiro escalão da Esplanada não altera o quadro político na capital paulista. Ao mesmo tempo, evangélicos deixam claro que a nomeação não servirá para aproximar a bancada do governo. Ontem, o ministro da Secretaria Geral da Presidência, Gilberto Carvalho, afirmou que a escolha facilita a relação do governo com os evangélicos, apesar de o Planalto ter “priorizado” o PRB, partido do ex-vice-presidente José Alencar. No entanto, evangélicos insistem que Crivella é um nome que contempla apenas seu partido, o PRB, e não todo segmento religioso. “Nem sequer fomos ouvidos ou consultados, a nomeação dele não atende o segmento. Se o Planalto fez por causa disso, está sendo muito infeliz”, apontou o deputado João Campos (PSDB-GO), presidente da Frente Parlamentar Evangélica. Segundo Campos, da Assembleia de Deus – a ramificação evangélica com maior número de fiéis no Brasil –, no ano passado, o ministro da Secretaria-Geral, Gilberto Carvalho, assumiu um compromisso, em nome da presidente Dilma Rousseff, com a bancada, para receber representantes do segmento em reuniões mensais, o que não tem ocorri-

nal”, afirmou um articulador da campanha de Chalita. DISSIDENTES. Se a cúpula partidária do PMDB está indignada com o Planalto, a bancada na Câmara também. Na noite de quarta-feira começaram a ser recolhidas assinaturas para um manifesto contra o PT e o governo, protestando pelo subaproveitamento do partido na Esplanada. Em um primeiro momento, parecia apenas uma manifestação dos dissidentes, mas o protesto ganhou corpo e a tendência é de que todos os deputados – menos o líder, Henrique Eduardo Alves (RN) — assinem o documento e entreguem no início da próxima semana a Temer. “Assinei o texto. O documento expressa o sentimento

do. “Essa reuniões nunca ocorreram e a ida do Crivella não muda nada, mesmo que ele fosse o ministro mais importante da República”, assevera. TERCEIRA VIA. Enquanto evangélicos jogam no colo do PRB a “maternidade”de Crivella,parlamentares do partido devolvem a bola. O líder do legenda na Câmara, Antônio Bulhões (SP), afirma que se a tentativa do governo foi dar um “xeque-mate” no partido, obrigando-o a retirar a candidatura de Celso Russomano à Prefeitura de São Paulo,a jogada terá sido inócua. “Para o partido seria mais vantajoso constituir uma terceira via, que seria chamar o vicepresidente Michel Temer e formar uma chapa com o Chalita, tendo Russomano como vice”, aponta. O líder do PRB, partido de maioria evangélica, recorda que Fernando Haddad ficou com uma mácula para os setores ligados a igrejas por causa do kit contra a homofobia. “Ele vai levar essa pecha como candidato, não tem para onde correr”, defende. Já a bancada evangélica evoca três episódios para justificar o afastamento do grupo em relação ao governo: o que chamam pejorativamente de “kit-gay do Haddad”; as declarações do ministro da Secretaria-Geral, Gilberto Carvalho, no Fórum Social Mundial sobre os evangélicos; e a nomeação da ministra da Secretaria de Políticas para as Mulheres, Eleonora Menicucci, favorável ao aborto. “Ninguém pode pensar que, porque deu o ministério para Crivella, vai passar mel na boca dos crentes”, afirma o senador Magno Malta (PR-ES).“Se foi para isso que o Planalto o escolheu, deu um tiro errado”, completa.

do PMDB”, criticou o deputado Eduardo Cunha (PMDB-RJ). A mágoa entre peemedebistas não é apenas em relação à distribuição de cargos. A forma de agir de Dilma, que toma decisões políticas sem consultar o partido, também alimenta o caldeirão de ressentimento. “Quando Lula propôs a aliança para elegermos a Dilma, a promessa era de que o poder seria compartilhado. Não somos chamados para nada. Ora, nós também elegemos a Dilma, também temos direito de participar da conversa política”, reclama um cacique do partido. Segundo outros deputados, a falta de importância do partido na visão de Dilma também ficaria nítida na forma como ela lida com o vice-presidente Michel

■ ACIDENTE

CURTAS

Hopi Hari, enfim, admite negligência de técnicos DA REDAÇÃO

O advogado Ademar Gomes, representante da família da adolescente Gabriela Yuakay Nychymura, 14 anos, morta após cair de uma altura de cerca de 25 metros em um brinquedo no parque de diversões Hopi Hari, em Vinhedo (SP), afirmou que entrará na Justiça em até 30 dias com um pedido de indenização de R$ 3 milhões – sendo R$ 2 milhões ao parque por danos morais e materiais e R$ 1 milhão à prefeitura da cidade, por negligência à suposta falta de vistoria. Depois que peritos do Instituto de Criminalística (IC) apontaram falha humana como provável causa do acidente, o advogado do Hopi Hari, Alberto Zacharias Toron, admitiu a hipótese. Segundo ele, houve erro dos técnicos de manutenção que habilitaram indevidamente o assento do qual a menina caiu, que estava interditado por questões de segurança havia 10 anos. A promotora Ana Beatriz

Temer. Embora o receba e converse com ele, Dilma não divide com Temer os assuntos de governo. “Ela dá audiência a ele, mas não dá importância”, critica outro deputado. Aliados de Temer, contudo, adiantam que o vice-presidente não encaminhará o manifesto à presidente Dilma Rousseff. Reconhecem que a insatisfação na bancada é justa e envolve não apenas o PMDB, mas outros partidos da base aliada que se sentem alijados do processo decisório do governo. “Mas os deputados devem entregar o manifesto à ministra das Relações Institucionais, Ideli Salvatti. É ela que canaliza as queixas de deputados e senadores”, afirmou uma fonte palaciana. (Colaborou Guilherme Amado)

Sampaio Silva Vieira afirmou que o depoimento prestado pelo gerente geral de manutenções do parque de diversões Hopi Hari na Delegacia de Vinhedo sugeriu que a cadeira tenha sido acionada por um funcionário de forma inadequada. Segundo depoimento de dois dos cinco funcionários que operavam a atração no momento do acidente, eles já haviam detectado problemas na trava minutos antes de o brinquedo entrar em operação. Porém, o advogado de ambos disse que eles não tinham autonomia para desativar a atração. A mãe de Gabriela, Silmara Yukay, contou que, momentos antes do acidente, chegou a perguntar à filha e à sobrinha se as meninas tinham fechado a trava de segurança e o segundo fecho. Segundo ela, Gabriela respondeu em negativa, mas em seguida ouviu do funcionário do parque: “É seguro, mesmo sem o segundo fecho, é seguro”. A Promotoria trabalha com duas frentes de investigações: uma criminal e outra do direito

do consumidor e afirma que houve grau máximo de negligência. Tanto o MP quanto a polícia atestam que o parque sempre afirmou que a cadeira estava inoperante havia anos. Para o advogado da família da vítima, o parque assumiu o risco de acidentes já que manteve no estabelecimento uma cadeira inoperante havia uma década. Ele questionou ainda o motivo de o assento não estar lacrado, ou com algum informe dizendo que não deveria ser utilizado. “Vamos lutar com o apoio do Ministério Público e do delegado de polícia para que os responsáveis sejam indiciados por homicídio doloso”, disse. O advogado que representa o Hopi Hari explicou que o parque firmou um Termo de Ajustamento de Conduta (TAC) com o MP e ficará fechado por 10 dias para auxiliar na investigação. Antes da medida, só o brinquedo do acidente estava fechado para perícia, mas com o novo acordo, todas as atrações do serão analisadas.

RECURSO DO PRÉ-SAL PODE IR PARA EDUCAÇÃO Aguardado na Câmara dos Deputados para debater o Plano Nacional de Educação (PNE), o ministro da pasta, Aloizio Mercadante, afirmou que acredita ser mais seguro vincular o investimento do setor aos royalties do pré-sal do que aumentar o percentual do PIB, que hoje é em torno de 5%. “De onde vamos tirar esse dinheiro do orçamento? É mais fácil dividir uma receita que ainda não existe”, defendeu o ministro.

TST ANULA CARTA PUBLICADA NO DOU O presidente do Tribunal Superior do Trabalho (TST), João Oreste Dalazen, anulou o ato publicado por engano no Diário Oficial da Paraíba que trazia uma carta de amor. Conforme prevê a legislação em vigor, o ato não poderia ser revogado pelo Tribunal Regional do Trabalho do estado, mas somente pela autoridade maior da Justiça Trabalhista. Assim, em caráter excepcional, Dalazen determinou a supressão do texto.


SÃO PAULO A-8

EDITOR // RODRIGO OTÁVIO CRUZ MOREIRA

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

ACSP - Indicadores do Serviço de Proteção ao Crédito apontam que resultado foi prejudicado pelo carnaval, que no ano anterior foi em março e neste em fevereiro

Vendas a prazo recuam 12,5% e à vista 10,2% DA REDAÇÃO

O

indicador da Associação Comercial de São Paulo (ACSP) que mede vendas a prazo caiu 12,5% em fevereiro em relação a janeiro e 1,1% se comparado a fevereiro do ano passado. Neste ano, o indicador acumula alta de 0,9%. O Indicador de Movimento de Cheques (SCPC/Cheque), que mede vendas à vista, também recuou no mês passado, para

10,2% frente a janeiro e de 2,1% na comparação com igual mês do ano passado. O indicador acumula alta de 2,2% no ano, até fevereiro. De acordo com a ACSP, que utiliza dados da empresa Boa Vista Serviços – que administra o Serviço Central de Proteção ao Crédito (SCPC) –, a comparação dos indicadores de fevereiro último com mês equivalente do ano passado foi prejudicada pelo carnaval, que no ano anterior ocorreu em março e neste, em fevereiro.

Para a entidade, no entanto, os resultados de fevereiro passado eram esperados. “Embora os dados de fevereiro estejam prejudicados pelo efeito calendário/base de comparação, as vendas em março deverão apresentar elevação porque o Carnaval de 2011 ocorreu naquele mês”, explica a ACSP, em nota divulgada na quinta-feira. INADIMPLÊNCIA. O Indicador de Registro de Inadimplentes aumentou 6,5% em fevereiro

DA AGÊNCIA ESTADO

ante janeiro e teve alta de 11% sobre o de igual período do ano passado. O Indicador de Recuperação de Crédito, que mede os registros cancelados ou renegociados, apresentou alta de 6,8% e de 9,6%, respectivamente, na mesma base de comparação. “A inadimplência sofreu leve alta, mas que não chega a preocupar, pois tem caráter mais sazonal, acompanhando a ligeira alta no desemprego que também tem caráter sazonal.”

Custo da construção mantém alta DA AGÊNCIA ESTADO

O Custo Unitário Básico (CUB) da construção civil no estado atingiu o valor de R$ 959,40 por metro quadrado em fevereiro, alta de 0,35% ante janeiro. Os dados foram divulgados na quinta-feira pelo Sindicato da Indústria da Construção Civil do Esta-

do de São Paulo (SindusConSP), que realiza a pesquisa em parceria com a Fundação Getulio Vargas (FGV ). O CUB é o índice oficial que reflete a variação dos custos do setor para a utilização nos reajustes dos contratos de obras. No mês passado, os custos das construtoras com materiais de construção aumentaram em 0,31% em compara-

ção a janeiro. Os gastos com mão de obra subiram 0,4% e os salários de engenheiros permaneceram inalterados pelo sexto mês consecutivo. MÃO DE OBRA. No primeiro bimestre do ano, o CUB apresentou alta de 0,45%, com os custos da mão de obra avançando 0,47% e as despesas com materiais subindo 0,46%.

Em fevereiro, 32 dos 41 insumos da construção pesquisados variaram acima do IGP-M do mês, que apresentou deflação de 0,06%. Entre os que tiveram os maiores reajustes no mês, estão: chapa compensado resinado 12mm (2,35%), alimentação tipo marmitex (1,85%) e bloco cerâmico para alvenaria e vedação (1,73%).

INFANTIL

Dinheiro para pagar os precatórios está parado FAUSTO MACEDO E MARCELO GODOY

■ FEVEREIRO

CIRCE BONATELLI

■ PREFEITURA

A Prefeitura da capital depositou R$ 1,17 bilhão, entre dezembro de 2009 e fevereiro de 2012, em conta do Tribunal de Justiça do Estado para pagamento de precatórios, mas o dinheiro está praticamente parado – apenas cerca de 20% desse montante foi levantado pelos credores. O TJ alega graves dificuldades de infraestrutura para dar conta da verificação de valores e a montanha de pagamentos. Os pagamentos começaram a ser realizados em março do ano passado e, até agora, o valor total liberado é de R$ 258,89 milhões. A ministra Eliana Calmon, corregedora nacional da Justiça, reúne-se nesta sexta-feira o presidente do TJ, desembargador Ivan Sartori. O tema central do encontro é o atraso da corte paulista em dar curso aos processos de pagamento dos precatórios. “É uma agenda positiva, não tem nenhuma divergência, nenhuma discrepância”, observou Sartori. “Meu relacionamento com a ministra é bastante cordial. Os precatórios em São Paulo estão atrasados porque não temos estrutura, é esse o problema. Quero resolver.” O dinheiro dos precatórios é repassado aos TJ por força da Emenda 62, de 2009.

Credores protestam contra a lentidão dos desembolsos e ressaltam que uma norma do Conselho Nacional de Justiça (CNJ) autoriza os tribunais a firmar convênios com bancos oficiais para operarem as contas especiais, mediante repasse de percentual a ser definido no convênio quanto aos ganhos auferidos com as aplicações financeiras realizadas com os valores depositados. Para os credores que estão na fila há muitos anos, os tribunais teriam interesse em retardar os pagamentos dos precatórios. O parágrafo 3ª do artigo 8º da Resolução 123 do CNJ prevê que “os rendimentos auferidos em função do convênio devem ser rateados entre os tribunais, na mesma proporção do volume monetário dos precatórios que possuam”. Parte desse dinheiro da aplicação de recursos de precatórios teria sido utilizada em 2010 para obras em edifícios de alguns tribunais. “Não sei exatamente se existe alguma destinação nesse sentido, o que eu sei é que a conta do Banco do Brasil onde estão depositados esses valores rende como qualquer poupança e o dinheiro vai para o credor. Não fica com o tribunal”, declarou o desembargador Venicio Salles, coordenador do Departamento de Precatórios do TJ paulista.

CONTAÇÃO DE HISTÓRIAS

A LÍNGUA DOS PÁSSAROS Com a Cia. Ginga & Prosa. Dia 3. Sáb., 15h. SÃO CAETANO

Acesse o site pelo seu celular com este QR Code

PEDRO E O LOBO Direção e adaptação: Fernando Anhê. Sáb., 11h. CONSOLAÇÃO

MÚSICA

O MISTÉRIO NO EXPRESSO DO ORIENTE

ARMANDINHO E SPOK O guitarrista baiano e o saxofonista pernambucano Spok celebram a música nordestina. Dias 2 e 3. Sex. e sáb., 21h30. BELENZINHO

11º ENCONTRO INTERNACIONAL DE HARMÔNICA ROTEIRO MUSICAL DA CIDADE DE SÃO PAULO

PASSOCA

Dia 3. Sáb., 19h. SANTANA

ALAÍDE COSTA, FÁTIMA GUEDES, ZÉ LUIZ MAZZIOTTI & NATAN MARQUES

Benê Chiréia e Marcelo Ricciardi (PR)/ Ale Ravanello Blues Band Combo (RS) e Steve Guyger (EUA). Dia 2. Sex., 21h30. Pablo Brotzman & Sérgio Pessina (ARG)/ Vitor Lopes (SP) e Big Chico Big Band (SP). Dia 3. Sáb., 21h30. Blues Jam com Flávio Guimarães (RJ) e convidados. Dia 4. Dom., 19h. POMPEIA

TEATRO

Texto e direção: Maristela Chelala. Dias 4, 11 e 18. Dom., 15h. SANTO ANDRÉ

ARTES PLÁSTICAS E VISUAIS DIA DO CIRCO

Tributo à Elis Regina. Dias 2, 3 e 4. Sex. e sáb., 21h. Dom., 18h. IPIRANGA

ESTREIA HOJE

MÔNICA SALMASO Dias 2 e 3. Sex. e sáb., 20h.

MALA-BARISTAS

PARQUES LÚDICOS Bichos da Mata, Orquestra Mágica e Espaço de Aventuras. Qua. a dom. ITAQUERA

Jacaré Gigante, Aldeia Lúdica, Casa do Guatambu e Vacalina. Qua. a dom.

ÍNDIA - LADO A LADO Pinturas, esculturas, fotografias e instalações de artistas e coletivos da cena contemporânea indiana, como Sheba Chhachhi e Shilpa Gupta entre outros. Curadoria: Tereza de Arruda. Parceria com o Centro Cultural Banco do Brasil. Ter. a dom.

SANTO AMARO

BELENZINHO

INTERLAGOS

Direção: Nelson Baskerville. Texto: August Strindberg. Sex. e sáb., 21h30. Dom., 19h30.

Com as integrantes do Projeto DR. Direção para TV: Antonio Carlos Rebesco. Dia 2. Sex., 22h. Sky canal 3 - Net canal 137 Oi TV canal 28 - GVT canal 228

AIKIDO COM EMILIA CARDOSO MARTINEZ

CARLITOS REPÓRTER + OS SALTIMBANCOS TRAPALHÕES Direção: J. B. Tanko. (Brasil, 1981). Dia 4. Dom., 11h. CINESESC

Com Lume Teatro. Dias 2, 3 e 4. Sex. e sáb., 21h. Dom., 18h. SANTANA

OSASCO

PINHEIROS

Bate-papo com a professora de Aikido 4º Dan – Yondan, pela União Sul-Americana. Dia 4. Dom., 15h.

DANÇA PERFORMAPA

INSTANTÂNEO Espetáculo interativo de dança contemporânea. Com Letícia Sekito. Dias 3 e 10. Sáb., 20h15. IPIRANGA

CHUVA DE POESIAS

ARTE PARA TODOS

Intervenção itinerante com leituras de poemas. Com Teatro Por Um Triz. De 3 a 31. Sáb., 14h e 16h.

Com o Grupo Cupuaçu. Dia 4. Dom., 17h.

OSASCO

BOI DO MARANHÃO SANTO AMARO

MULHERES DE MARÇO

POMPEIA

CRAVO, LÍRIO E ROSA

Com Palhaço Tchutchuco. Dias 4, 18 e 31. Sáb., 15h e 17h. Dom., 14h30 e 16h30.

MÊS DA POESIA

ENSAIO BRINCANDO COM FOGO

PERIPÉCIAS ITINERANTES

Com o Grupo Clã - Estúdio das Artes Cômicas. Sáb. e dom., 16h.

MULHERES QUE LUTAM...

LITERATURA

DANÇA CONTEMPORÂNEA

Com os Irmãos Becker. Dias 3 e 24. Sáb., 15h e 17h.

ÁGUA

ESPO RTE

SANTO ANDRÉ

CINECLUBINHO DO CINESESC

CIRCO

TEATRO MÍNIMO

ABAPORU, A HISTÓRIA DE TARSILA

Direção: Antônio Vanfill e Leandro Godinho. Com Ester Laccava. Estreia dia 3. Sáb., 19h30.

Telas projetadas em malas por meio de teatro de sombra. Com a Cia. Atos. Dias 3 e 24. Sáb., 14h.

A ÁRVORE SECA

IPIRANGA

BOM RETIRO

ARTES VISUAIS • CINEMA • CULTURA DIGITAL • DANÇA • ESPORTE • LITERATURA • MEIO AMBIENTE • MÚSICA • TEATRO • LAZER • EDUCAÇÃO EM 33 UNIDADES NO ESTADO DE SÃO PAULO.


cyan magenta amarelo preto

SÃO PAULO

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio A-9

Baixada Santista Energia S.A. (Controlada da Petróleo Brasileiro S.A. - Petrobras) CNPJ 03.059.729/0001-21

RELATÓRIO DA ADMINISTRAÇÃO - 2011 Senhores Acionistas: Cumprindo os preceitos legais e disposições estatutárias, apresentamos as Demonstrações Contábeis da Baixada Santista Energia S.A. (“BSE” ou “Sociedade”), relativas ao exercício findo em 31/12/2011, elaboradas na forma da legislação societária e acompanhadas do Relatório da KPMG Auditores Independentes. A BSE é uma sociedade por ações, subsidiária integral da Petróleo Brasileiro S.A. – Petrobras, cujo objeto social é a operação e manutenção de empreendimentos de geração de energia, autorizada a prática de determinados atos como produzir, comercializar, adquirir, exportar e importar energia elétrica e vapor de suas instalações. Outrossim, a BSE é detentora de concessão de geração destinada ao serviço público, nos termos do Contrato de Concessão de Geração nº 001/2008 - ANEEL, com vigência até 2015, aprovada por meio da Resolução Autorizativa da ANEEL nº 1.218/2008, publicada no Diário Oficial da União em 29/01/2008, que anuiu a transferência do Contrato de Concessão de Geração nº 002/2004 - ANEEL pela Empresa Metropolitana de Águas e Energia S.A. - EMAE à BSE, para a geração de energia elétrica, mediante a exploração da central termelétrica “UTE PIRATININGA”, com capacidade instalada de 390 MW, no Município e Estado de São Paulo. Desempenho Econômico: A principal

fonte de receita da BSE é decorrente do Contrato de Compra e Venda de Energia Elétrica firmado com a Petrobras em 01/08/2008, com vigência até 31/12/2027. A geração vendida para a Petrobras no ano de 2011 foi de 1.059.668 MWh, totalizando uma receita de R$ 59.763.657. Outra fonte de receita foi a celebração do Contrato de locação em 03/01/2011, com a sua controladora Petrobras, de um conjunto turbogerador, com 159,9 MW - 234 MVA de potência, para ser utilizado na Unidade de Geração Termoelétrica UTE Euzébio Rocha, pelo prazo de 17 anos. No exercício de 2011, a BSE realizou um prejuízo de R$ 21.585.863,52, apresentando o prejuízo acumulado no valor de R$ 56.072.300,66. Geração: No ano de 2011, a UTE Piratininga apresentou uma geração bruta de 23.262 MWh, correspondente a 1,48% de sua capacidade total de 180 MW. Para essa geração de energia elétrica, foram consumidas 91.575 toneladas de vapor fornecidas pela Petrobras através da UTE Fernando Gasparian – UTE FEG. Não houve solicitação do Operador Nacional do Sistema Elétrico – ONS para despacho de geração no ano de 2011. Em julho de 2011, a UTE Piratininga concluiu o reparo da Unidade Geradora 4 que sofreu grave avaria em 03/09/2010. Em 11/10/2011, a Superintendência de Fiscalização dos Serviços de Geração da ANEEL emitiu o

BALANÇO PATRIMONIAL EM 31 DE DEZEMBRO DE 2011 E 2010 (Em milhares de Reais) Ativo Circulante Caixa e equivalentes de caixa (Nota 4) ..................................... Contas a receber Clientes (Nota 5) ...................................................................... Empresas do Sistema Petrobras (Nota 6) Impostos e contribuições a recuperar (Nota 8a) Adiantamento a fornecedores.................................................... Despesas antecipadas (Nota 11) .............................................. Não circulante Contas a receber - Empresas do Sistema Petrobras (Nota 6) ................................................................... Imobilizado (Nota 9)................................................................... Diferido (Nota 10) ......................................................................

2011

2010

38.186

37.319

13.421 17.661 56 20.938 90.262

21 9.930 9.680 20.909 77.859

76.364 95.117 16.707 188.188 278.450

199.898 18.563 218.461 296.320

DEMONSTRAÇÃO DOS FLUXOS DE CAIXA Exercícios findos em 31 de dezembro de 2011 e 2010 (Em milhares de Reais) 2011 2010 Fluxo de caixa das atividades operacionais 223 Lucro (prejuízo) líquido do exercício ................................................ (21.586) Ajustes para: 6.873 5 Depreciação e amortização .......................................................... Juros sobre arrendamento financeiro ........................................... (21.759) Aumento/Redução de ativos e passivos (2.765) (5.732) Aumento de contas a receber ....................................................... Aumento de impostos e contribuições a recuperar....................... (7.981) (1.645) Aumento das contas a pagar ........................................................ 3.625 17.174 Aumento de impostos e contribuições a recolher ......................... 15 1 Aumento outros passivos curto e longo prazo .............................. 74 168 Redução (aumento) de despesas antecipadas ............................ (29) 6.290 Fluxo de caixa líquido (usado nas) proveniente das atividades operacionais...................................................... (43.533) 16.484 Fluxo de caixa das atividades de financiamentos - 21.000 Aumento de capital ....................................................................... Operação de arrendamento mercantil financeiro.......................... 44.400 Adiantamento para futuro aumento de capital .............................. - (7.000) Fluxo de caixa líquido proveniente das atividades 44.400 14.000 de financiamento ........................................................................ Aumento líquido de caixa e equivalentes de caixa 867 30.484 no exercício................................................................................. Caixa e equivalentes de caixa em 1º de janeiro .......................... 37.319 6.835 38.186 37.319 Caixa e equivalentes de caixa em 31 de dezembro..................... As notas explicativas são parte integrante das demonstrações contábeis.

Passivo Circulante Contas a pagar Fornecedores (Nota 12) ........................................................ Empresas do Sistema Petrobras (Nota 6) ............................ Impostos e contribuições a recolher (Nota 8b) ....................... Outras contas e despesas a pagar (Nota 13) ......................... Não circulante Adiantamentos para futuro aumento de capital ...................... Patrimônio líquido Capital social (Nota 14) .......................................................... Prejuízos acumulados ............................................................

2011

2010

8.508 28.528 62 288 37.386

3.049 30.361 47 213 33.670

-

14.000

despacho nº 4005, suspendendo a operação comercial das unidades geradoras 1 e 2, atendendo à solicitação da BSE, considerando a obsolescência dos equipamentos tratados, tendo sido alterada a capacidade da usina para 180 MW. Comercialização: Toda a energia elétrica gerada pela UTE Piratininga é disponibilizada ao Sistema Interligado Nacional, sob a responsabilidade do Operador Nacional do Sistema Elétrico – ONS. Adiantamento para Futuro Aumento de Capital: Em 29 de abril de 2011, o sócio-acionista deliberou pelo aumento do capital social em R$ 14.000 mil, com conversão automática do saldo de Adiantamentos para Futuro Aumento de Capital. Compromissos e Agradecimentos: A BSE assume o compromisso com a confiabilidade no fornecimento de energia elétrica com excelência operacional e de gestão, pautada na responsabilidade social e ambiental de suas ações. Registramos nosso reconhecimento e os mais sinceros agradecimentos aos nossos parceiros, instituições e acionistas. Cubatão, 13 de fevereiro de 2012. Ronaldo Batista Assunção - Diretor Administrativo Arthur Adelino de Freitas Cruz - Diretor Técnico

DEMONSTRAÇÃO DE RESULTADO Exercícios findos em 31 de dezembro de 2011 e 2010 (Em milhares de Reais, exceto o lucro (prejuízo) por lote de mil ações do capital social) 2011 Receita de vendas (Nota 6) ...............................................................

Custo dos produtos vendidos (Nota 17) .............................................. (80.065) (93.839) Lucro (prejuízo) bruto ....................................................................... (26.132) 15.565 Receitas (despesas) Gerais e administrativas (Nota 17) ....................................................

297.136 (56.072) 241.064 278.450

2010

53.933 109.404

(7.223)

(828)

283.136 Tributárias (Nota 18) .......................................................................... (2.240) (38) (34.486) (9.463) (866) 248.650 Lucro (prejuízo) antes do resultado financeiro 296.320 e impostos ...................................................................................... (35.595) 14.699

DEMONSTRAÇÃO DO VALOR ADICIONADO Exercícios findos em 31 de dezembro de 2011 e 2010 (Em milhares de Reais)

Resultado financeiro líquido (Nota 19) ................................................

14.009 (12.464)

Lucro (prejuízo) antes dos impostos............................................... (21.586) Imposto de renda e contribuição social (Nota 8c)................................

-

2.235 (2.012)

2011 2010 Lucro (prejuízo) líquido do exercício............................................... (21.586) 223 Receitas Vendas de produtos......................................................................... 59.786 120.047 Lucro (prejuízo) líquido básico e diluído por lote de Insumos adquiridos de terceiros mil ações do capital social ao fim do exercício Matérias-primas consumidas ........................................................... (557) (18.169) (0,07) 0,79 (em R$) ............................................................................................ Custo das mercadorias – revenda ................................................... (38.697) (38.102) As notas explicativas são parte integrante das demonstrações contábeis. Materiais, energia, serviços de terceiros e outros ........................... (41.484) (46.455) (80.738) (102.726) DEMONSTRAÇÃO DAS MUTAÇÕES DO PATRIMÔNIO LÍQUIDO Valor (retido)/adicionado bruto ...................................................... (20.952) 17.321 Exercícios findos em 31 de dezembro de 2011 e 2010 Retenções (Em milhares de Reais) Depreciação e amortização ............................................................. (6.873) (5) Valor adicionado líquido produzido pela Sociedade ................... (27.825) 17.316 Capital Prejuízos acu- Total do patriValor adicionado recebido em transferência Receitas financeiras - inclui variações monetária............................ 27.489 1.985 Social mulados mônio líquido 27.489 1.985 262.136 (34.709) 227.427 Saldos em 1º de janeiro de 2010 ........ Valor adicionado a (reter)/distribuir............................................... (336) 19.301 Aumento de capital .............................. 21.000 21.000 Distribuição do valor adicionado Tributos Lucro líquido do exercício .................... 223 223 4.630 Impostos, taxas e contribuições ...................................................... 7.771 Saldos em 31 de dezembro de 2010 .. 283.136 (34.486) 248.650 Instituições financeiras e fornecedores 14.448 Juros e variações monetárias .......................................................... 13.479 Aumento de capital .............................. 14.000 14.000 Acionistas Prejuízo do exercício ........................... (21.586) (21.586) 223 Lucro (prejuízo) líquido retido do exercício...................................... (21.586) Valor adicionado (retido)/distribuído............................................. (336) 19.301 Saldos em 31 de dezembro de 2011 .. 297.136 (56.072) 241.064 As notas explicativas são parte integrante das demonstrações contábeis. As notas explicativas são parte integrante das demonstrações contábeis.

NOTAS EXPLICATIVAS ÀS DEMONSTRAÇÕES CONTÁBEIS EXERCÍCIOS FINDOS EM 31 DE DEZEMBRO DE 2011 E 2010 (Em milhares de Reais, exceto quando indicado em contrário) 1. Contexto operacional: A Baixada Santista Energia S.A. - BSE (“Sociedade”) foi constituída em 23 de março de 1999, tendo como objeto o desenvolvimento, financiamento, construção, operação e manutenção de usina termoelétrica, com o objetivo de produzir, comercializar, adquirir, exportar e importar energia elétrica e vapor das instalações, observados os termos e condições previstos na legislação aplicável. Em 20 de dezembro de 2007, a Petróleo Brasileiro S.A. - Petrobras aprovou a cessão à Sociedade, do contrato de arrendamento de ativos da Usina Termelétrica Piratininga, localizada na capital paulista, firmado em 27 de abril de 2007 com a Empresa Metropolitana de Águas e Energia S.A. - EMAE, que pertence ao governo do Estado de São Paulo, o qual se tornou eficaz a partir de 21 de maio de 2008. O documento estabelece em R$ 45.000 por ano o aluguel da unidade pelo período de 17 anos. Em 21 de maio de 2008, a Sociedade celebrou um contrato de compra e venda de vapor com a Petrobras por dois anos, prorrogáveis, no valor total estimado de até R$ 455.520. Em 5 de agosto de 2008, a Sociedade celebrou um contrato de compra e venda de energia com a Petrobras até 31 de dezembro de 2027, para fornecimento médio ao longo do contrato de até 99 MW em 2008, até 180 MW entre janeiro de 2009 e junho de 2010 e até 228 MW a partir de julho de 2010 no Submercado Sudeste/Centro-Oeste. O preço é equivalente ao valor do “PLD médio” nesse submercado, acrescido de um valor variável durante a vigência do contrato. Em 3 de janeiro de 2011, a Sociedade celebrou contrato de locação de um conjunto turbogerador, com 159,9 MW - 234 MVA de potência, com a sua controladora, para ser utilizado na Unidade de Geração Termoelétrica UTE Euzébio Rocha. Este contrato estabelece pagamentos semestrais no montante de R$ 11.100, pelo prazo de 17 anos. Esta transação foi avaliada como Operações de Arrendamento Mercantil Financeiro, de acordo com o Pronunciamento Técnico Contábil CPC 06 (R1) – Operações de Arrendamento Mercantil. A Sociedade é uma controlada da Petróleo Brasileiro S.A. - Petrobras. Suas atividades são conduzidas com o objetivo de atender as necessidades das operações e o plano de negócios da sua Controladora. 2. Base de preparação das demonstrações contábeis: (a) Declaração de conformidade com relação às normas do Comitê de Pronunciamentos Contábeis - CPC: As demonstrações contábeis foram elaboradas com base nas práticas contábeis adotadas no Brasil, em observância às disposições contidas na Lei das Sociedades por Ações, e incorporam as mudanças introduzidas por intermédio das Leis nº 11.638/07 e nº 11.941/09, complementadas por pronunciamentos, interpretações e orientações do Comitê de Pronunciamentos Contábeis - CPC, aprovados por resoluções do Conselho Federal de Contabilidade. A emissão das demonstrações contábeis foi autorizada pela Diretoria Executiva em reunião realizada em 13 de fevereiro de 2012. (b) Base de mensuração: As demonstrações contábeis foram preparadas com base no custo histórico como base de valor, sendo que os ativos e passivos financeiros, após o reconhecimento inicial, estão mensurados ao custo amortizado. (c) Demonstração do valor adicionado: A demonstração do valor adicionado - DVA apresenta informações relativas à riqueza criada pela entidade e a forma como tais riquezas foram distribuídas, de acordo com o CPC 09 - Demonstração do Valor Adicionado, sendo apresentada como parte integrante da demonstração contábil. (d) Moeda funcional e moeda de apresentação: Estas demonstrações são apresentadas em Real, que é a moeda funcional da Sociedade. (e) Uso de estimativas e julgamentos: A elaboração das demonstrações contábeis de acordo com as práticas contábeis adotadas no Brasil requer que a Administração use de julgamento, estimativas e premissas que afetam a aplicação de políticas contábeis e os valores reportados de ativos, passivos, receitas e despesas. As estimativas incluem: depreciação e amortização, provisões para processos judiciais, ajustes a valor presente de contas a receber e a pagar das transações relevantes, imposto de renda e contribuição social. Os resultados reais podem divergir dessas estimativas. Estimativas e premissas são revistos de uma maneira contínua. Revisões com relação a estimativas contábeis são reconhecidas no período em que as estimativas são revisadas e em quaisquer períodos futuros afetados. 3. Sumário das principais práticas contábeis: As práticas contábeis descritas em detalhes abaixo têm sido aplicadas de maneira consistente a todos os períodos apresentados nestas demonstrações contábeis. a. Reconhecimento de receitas, custos e despesas: A receita de vendas compreende o valor da contraprestação recebida ou a receber pela comercialização de produtos e serviços, líquida dos descontos e encargos sobre vendas. A receita de vendas de energia elétrica é reconhecida no resultado quando todos os riscos e benefícios inerentes ao produto são transferidos para o comprador. Uma receita não é reconhecida se há incerteza significativa na sua realização. Os custos e as despesas são contabilizados pelo regime de competência. O resultado financeiro líquido inclui principalmente receitas de juros sobre aplicações financeiras e títulos públicos, receitas de juros sobre arrendamento financeiro, despesas com juros sobre arrendamento operacional, além das variações monetárias líquidas. b. Instrumentos financeiros: (i) Ativos financeiros não derivativos: A Sociedade reconhece os recebíveis e depósitos inicialmente na data em que foram originados. Todos os outros ativos financeiros são reconhecidos inicialmente na data da negociação qual a Sociedade se torna uma das partes das disposições contratuais do instrumento. A Sociedade deixa de reconhecer um ativo financeiro quando os direitos contratuais ao fluxo de caixa do ativo expiram, ou quando a Sociedade transfere os direitos ao recebimento dos fluxos de caixas contratuais sobre um ativo financeiro em uma transação no qual essencialmente todos os riscos e benefícios da titularidade do ativo financeiro são transferidos. (ii) Caixa e equivalentes de caixa: Estão representados por aplicações de alta liquidez, que são prontamente conversíveis em numerário, com vencimento em até três meses da data de aquisição. (iii) Passivos financeiros não derivativos: A Sociedade reconhece títulos de dívida emitidos inicialmente na data em que são originados. Todos os outros passivos financeiros são reconhecidos inicialmente na data de negociação na qual a Sociedade se torna uma parte das disposições contratuais do instrumento. A Sociedade baixa um passivo financeiro quando tem suas obrigações contratuais retirada, cancelada ou vencida. Os ativos e passivos financeiros são compensados e o valor líquido é apresentado no balanço patrimonial quando, e somente quando, a Sociedade tenha o direito legal de compensar os valores e tenha a intenção de liquidar em uma base líquida ou de realizar o ativo e quitar o passivo simultaneamente. A Sociedade tem os seguintes passivos financeiros não derivativos: limite de cheque especial bancário, fornecedores e outras contas a pagar. Tais passivos financeiros são reconhecidos inicialmente pelo valor justo acrescido de quaisquer custos de transação atribuíveis. Após o reconhecimento inicial, esses passivos financeiros são medidos pelo custo amortizado através do método dos juros efetivos. (iv) Capital social - Ações ordinárias: Ações ordinárias são classificadas como patrimônio líquido. Custos adicionais diretamente atribuíveis à emissão de ações e opções de ações são reconhecidos como dedução do patrimônio líquido, líquido de quaisquer efeitos tributários. c. Imobilizado: Estão demonstrados pelo custo de aquisição, formação ou construção, inclusive encargos financeiros capitalizados, deduzidos de depreciação acumulada e perdas por impairment, quando aplicável. A depreciação é calculada pelo método linear às taxas que consideram o tempo de vida útil-econômica estimado dos bens. d. Diferido: A Sociedade manteve o saldo do ativo diferido de 31 de dezembro de 2008, que continuará a ser amortizado em até 10 anos, sujeito ao teste de redução ao valor recuperável de ativos (“impairment”), em conformidade com a Lei nº 11.941/09. e. Redução ao valor recuperável - (“impairment”): A Sociedade avalia os ativos do imobilizado e do diferido quando há indicativos de não recuperação do seu valor contábil. Essas avaliações são efetuadas ao menor nível de ativos para os quais existam fluxos de caixa identificáveis. Na aplicação do teste, o valor contábil de um ativo ou unidade geradora de caixa é comparado com o seu valor recuperável, que representa o maior valor entre o líquido de venda de um ativo e o de uso. A perda por redução ao valor recuperável é reconhecida no resultado caso o valor contábil de um ativo exceda seu valor recuperável estimado. f. Provisões: Uma provisão é reconhecida no balanço quando a Empresa possui uma obrigação legal ou constituída como resultado de um evento passado, e é provável que um recurso econômico seja requerido para saldar a obrigação. As provisões são registradas tendo como base as melhores estimativas do risco envolvido. g. Arrendamentos mercantis: Os contratos de arrendamentos com transferência de benefícios, riscos e controle dos bens são reconhecidos no ativo como arrendamentos mercantis financeiros. Os demais contratos de arrendamentos são classificados como operacionais e os pagamentos são reconhecidos como despesa no resultado durante o prazo do contrato. h. Imposto de renda e contribuição social: Esses tributos são calculados e registrados com base nas alíquotas de 25% para imposto de renda e 9% para contribuição social sobre o lucro tributável. Os impostos e contribuições sociais diferidos são reconhecidos em função das diferenças temporárias, prejuízo fiscal e base negativa da contribuição social, quando aplicável. i. Novas normas e interpretações ainda não adotadas: Diversas normas, emendas a normas e interpretações IFRS emitidas pelo IASB ainda não entraram em vigor para o exercício encerrado em 31 de dezembro de

2011. Novos Standards, emendas aos Standards e interpretações são efetivos para os períodos anuais iniciados a partir de 15 de dezembro de 2013, e não foram aplicados na preparação destas demonstrações contábeis. É esperado que nenhum desses novos Standards tenha efeito material sobre as demonstrações contábeis da Empresa exceto pelo IFRS 9 Financial Instruments que pode modificar a classificação e mensuração de ativos financeiros mantidos pela Empresa. A Empresa não espera adotar esse standard antecipadamente e o impacto de sua adoção ainda não foi mensurado. O CPC ainda não emitiu pronunciamentos equivalentes aos IFRSs acima citados, mas existe expectativa de que o faça antes da data requerida de sua entrada em vigor. A adoção antecipada dos pronunciamentos do IFRSs está condicionada à aprovação prévia em ato normativo do Conselho Federal de Contabilidade. 4. Caixa e equivalentes de caixa: 2011 2010 Caixa e bancos .............................................................................. 2 5 Aplicações financeiras ................................................................... 38.184 37.314 38.186 37.319 As aplicações financeiras são representadas por fundos de investimentos, cujos recursos estão aplicados em quotas de fundo de investimentos em direitos creditórios (FIDC - NP). O FIDC-NP é um fundo exclusivo do Sistema Petrobras e consolidado nas demonstrações contábeis da Petrobras, que detém as cotas subordinadas deste fundo. A taxa média de rentabilidade das aplicações no FIDC-NP foi de 11,59% a.a. (9,71% a.a. em 2010). A exposição da Sociedade ao risco de crédito associado às instituições financeiras está divulgada na Nota Explicativa nº 15. 5. Contas a receber - clientes: Em 31 de dezembro de 2010, representavam os valores de venda de energia no mercado atacadista, por meio da Câmara de Comercialização de Energia Elétrica - CCEE, no montante de R$ 21. A exposição da Sociedade ao risco de crédito associado aos clientes está divulgada na Nota Explicativa nº 15. 6. Partes relacionadas: As operações comerciais da Sociedade com a Petrobras foram realizadas em condições normais de mercado para os respectivos tipos de operações e são realizadas por preços ajustados em contratos. Ativo circulante 2011 2010 Contas a receber, por venda de energia elétrica ......................... 12.661 9.930 Contas a receber, arrendamento financeiro .................................. 760 13.421 9.930 Ativo não circulante Contas a receber, arrendamento financeiro .................................. 76.364 Passivo circulante Fornecedores, por compra de vapor ............................................. 28.528 30.361 Resultado Receita de venda de energia elétrica ............................................ 59.764 109.404 Custo dos produtos vendidos ........................................................ 557 18.168 Receita financeira, arrendamento financeiro ................................. 21.759 7. Arrendamento mercantil: Refere-se ao contrato de arrendamento do conjunto turbo gerador com sua controladora, que teve início no ano de 2011 e tem prazo de vencimento em 2024. 2011 2012................................................................................................................ 22.200 2013 - 2016 .................................................................................................... 88.800 2017 em diante ............................................................................................... 177.600 Recebimentos de compromissos estimados ............................................ 288.600 (-) ajuste a valor presente............................................................................... (211.476) Valor presente dos recebimentos mínimos ............................................... 77.124 Circulante ....................................................................................................... 760 Não circulante................................................................................................. 76.364 Em 31 de dezembro de 2011........................................................................ 77.124 8. Impostos e contribuições: (a) Impostos e contribuições a recuperar: 2011 2010 Imposto de renda retido na fonte.................................................... 3.954 478 Imposto de renda............................................................................ 2.720 2.562 Contribuição social ......................................................................... 2.217 1.189 PIS .................................................................................................. 1.548 974 COFINS .......................................................................................... 7.148 4.477 P&D Aneel ...................................................................................... 74 17.661 9.680 (b) Impostos e contribuições a recolher 2011 2010 Imposto de renda retido................................................................. 10 24 Contribuições sociais retidas ......................................................... 15 23 INSS retido .................................................................................... 37 62 47 (c) Imposto de renda e contribuição social diferidos: A conciliação da despesa calculada pela aplicação das alíquotas fiscais combinadas e da despesa de imposto de renda e contribuição social registrada em resultado para o exercício findo em 31 de dezembro de 2010 é demonstrada como segue: 2010 Lucro do exercício antes dos impostos ........................................................... 2.235 Alíquota fiscal combinada de imposto de renda e contribuição social .............. 34% Imposto de renda e contribuição social pela alíquota fiscal combinada ................ 760 Adições permanentes ...................................................................................... 2.149 Compensação de prejuízo fiscal .................................................................... (873) Adicional de alíquota de 10% .......................................................................... (24) Despesa de imposto de renda e contribuição social ...................................... 2.012 Em 31 de dezembro de 2011 a Sociedade possuía prejuízos fiscais acumulados e base negativa de contribuição social de R$ 56.678 (R$ 32.142 em 2010), sobre a qual não houve constituição de imposto de renda e contribuição social diferidos ativo, por não haver expectativas prováveis de geração de lucros tributários futuros. A Sociedade reavaliará esta situação para 2012. 9. Imobilizado: Obras em Máquinas e andamento equipamentos Total Saldo em 1º de janeiro de 2010 ...................... 199.898 - 199.898 Saldo em 31 de dezembro de 2010 .................... 199.898 - 199.898 Transferências ................................................... (199.898) 199.898 Transferências (arrendamento financeiro) ................................. (99.765) (99.765) Depreciação ...................................................... (5.016) (5.016) Saldo em 31 de dezembro de 2011 .................... 95.117 95.117 Custo ................................................................. 199.898 - 199.898 Depreciação acumulada .................................... Saldo em 31 de dezembro de 2010 .................... 199.898 - 199.898 Custo ................................................................. 100.133 100.133 Depreciação acumulada .................................... (5.016) (5.016) Saldo em 31 de dezembro de 2011 .................... 95.117 95.117 20 Vida útil econômica em anos............................. 10. Diferido: 18.563 Saldo em 1º janeiro de 2010 ......................................................................... Amortização..................................................................................................... Saldo em 31 dezembro de 2010 ................................................................... 18.563 Amortização..................................................................................................... (1.856) Saldo em 31 dezembro de 2011 ................................................................... 16.707 Os gastos pré-operacionais são relacionados à despesa com pessoal, resultados financeiros líquidos e gastos de organização e manutenção. 11. Despesas antecipadas: Em 31 de dezembro de 2011, o saldo de despesas antecipadas, no montante de R$ 20.938 (R$ 20.909 em 2010), refere-se, principalmente, ao pagamento antecipado à EMAE da parcela corres-

pondente ao primeiro semestre de 2012 do contrato firmado de arrendamento dos ativos da Usina Termelétrica Piratininga. 12. Contas a pagar - Fornecedores: 2011 2010 Câmera de Comercialização de Energia Elétrica - CCEE........... 7.938 936 Tarifa de uso do sistema de distribuição e transmissão - CUSD/TUSD ........................................................ 570 2.113 8.508 3.049 13. Outras contas e despesas a pagar 2011 2010 Fundo Nacional de Desenvolvimento Científico e Tecnológico - FNDCT ................................................................. 46 80 Ministério de Minas e Energia - MME.......................................... 23 41 Projetos de Pesquisa e Desenvolvimento – P&D........................ 219 92 288 213 14. Patrimônio líquido: Capital social: O capital social subscrito e integralizado, em 31 de dezembro de 2011, no valor de R$ 297.136 (R$ 283.136 em 2010), está representado por 297.136.068 ações (283.136.068, em 31 de dezembro de 2010) sem valor nominal. Em 30 de abril de 2010, o sócio-acionista deliberou pelo aumento do capital social em R$ 21.000, com a conversão da parcela do saldo de Adiantamentos para Futuro Aumento de Capital. Em 29 de abril de 2011, o sócio-acionista deliberou pelo aumento do capital social em R$ 14.000, com conversão automática do saldo de Adiantamentos para Futuro Aumento de Capital. 15. Instrumentos financeiros: A Sociedade mantém operações com instrumentos financeiros. A administração desses instrumentos é efetuada por meio de estratégias operacionais e controles internos visando assegurar sua liquidez e rentabilidade. A política de controle consiste em acompanhamento permanente das condições contratadas versus condições vigentes no mercado. Em 31 de dezembro de 2011 e 2010, a Sociedade não possuía nenhum instrumento financeiro derivativo para mitigar os riscos associados aos seus instrumentos financeiros e durante os exercícios também não efetuou aplicações de caráter especulativo ou quaisquer outros ativos de risco. Os resultados estão condizentes com as políticas e estratégias definidas pela Administração da Sociedade. Os controles para identificação de eventuais derivativos embutidos nas operações da Sociedade são corporativos e aplicados por sua controladora Petrobras. Tais controles estão relacionados principalmente à identificação de possíveis derivativos embutidos e orientação relacionada ao tratamento contábil a ser dado pelas empresas do Sistema Petrobras. Durante os exercícios findos em 31 de dezembro de 2011 e 2010 não foram identificados derivativos embutidos nas operações da Sociedade. Todas as operações com instrumentos financeiros estão reconhecidas nas demonstrações contábeis da Sociedade e estão demonstradas abaixo em 31 de dezembro de 2011 e 2010: Instrumentos financeiros 2011 2010 Ativos Caixa e equivalentes de caixa ..................................................... 38.186 37.319 Contas a receber - empresas do Sistema Petrobras .................. 89.785 9.930 Contas a receber - clientes.......................................................... 21 Passivos Fornecedores .............................................................................. 8.508 3.049 Contas a pagar – empresas do Sistema Petrobras..................... 28.528 30.361 As operações da Sociedade estão sujeitas aos fatores de riscos abaixo descritos: a. Risco de crédito: A Sociedade está exposta ao risco de crédito das instituições financeiras decorrentes da administração de seu caixa, que é feita com base nas orientações corporativas de sua controladora Petrobras, e dos seus clientes. Tal risco consiste na possibilidade de não saque ou resgate dos valores depositados, aplicados ou garantidos por instituições financeiras ou de não recebimento dos clientes. A exposição máxima ao risco de crédito está representada pelos saldos de caixa de equivalentes de caixa e contas a receber, respectivamente, em 31 de dezembro de 2011 e 2010. O risco de crédito associado ao contas a receber de clientes é atenuado por vendas a uma base pulverizada de clientes e por prerrogativas legais para a suspensão de prestação de serviços a inadimplentes. Adicionalmente, parte dos valores a receber relativos a transações de venda e compra de energia, realizadas no âmbito da CCEE, está sujeita a modificação, dependendo de decisões judiciais ainda em andamento, movidas por algumas empresas do setor. Esses processos decorrem de interpretação de regras do mercado. A Sociedade procura mitigar o risco de crédito associado aos seus clientes principalmente com base no histórico de operações e recebimento e com base em análise de crédito. b. Risco de liquidez: Historicamente os recursos são gerados pelas próprias operações da Sociedade. Estas origens de recursos somadas à posição financeira da Sociedade tendem a continuar permitindo o cumprimento dos requisitos de capital estabelecidos de forma corporativa. c. Risco de taxas de juros: Decorre da possibilidade da Sociedade sofrer ganhos ou perdas decorrentes de oscilações de taxas de juros incidentes sobre seus ativos e passivos financeiros. A Administração avalia que os riscos das aplicações financeiras de suas disponibilidades são reduzidos, em função de suas operações serem realizadas com base em análise e orientações corporativas de sua controladora Petrobras e em bancos de reconhecida liquidez. d. Mensuração dos instrumentos financeiros: Os saldos de caixa e equivalentes de caixa, contas a receber, fornecedores e de contas a pagar a empresas do Sistema Petrobras estão mensurados ao custo amortizado. Os saldos de contas a receber de empresas do Sistema Petrobras estão mensurados a valor presente. Os valores justos dos instrumentos financeiros da Sociedade são equivalentes aos seus valores contábeis. 16. Cobertura de seguros: A Sociedade adota a política de contratar cobertura de seguros para os bens sujeitos a riscos por montantes considerados suficientes para cobrir eventuais sinistros, considerando a natureza de sua atividade. As premissas de riscos adotadas, dada a sua natureza, não fazem parte do escopo de uma auditoria de demonstrações contábeis, consequentemente não foram examinadas pelos nossos auditores independentes. O seguro da Sociedade foi incluído em apólice global de seguros mantida pela Controladora Petrobras. Em 31 de dezembro de 2011, na opinião da Administração, os valores segurados são suficientes para cobertura de eventuais perdas com sinistros que impactem significativamente o patrimônio da Sociedade. 17. Custo e despesas por natureza: 2011 2010 40.811 40.811 Arrendamento do ativo de geração de energia elétrica................ Insumos de produção ................................................................... 3.861 18.169 Aquisição de energia elétrica para revenda ................................. 35.393 34.859 Serviços contratados, fretes, alugueis e encargos gerais ............ 7.223 828 87.288 94.667 80.065 93.839 Custo do produto vendido ............................................................ Despesas gerais e administrativas ............................................... 7.223 828 87.288 94.667 18. Despesas tributárias: Contribuição sindical .................................................................... PIS sobre arrendamento financeiro .............................................. COFINS sobre arrendamento financeiro ...................................... Outros ...........................................................................................

2011 (38) (393) (1.808) (1) (2.240)

19. Resultado financeiro, líquido: Encargos sobre impostos pagos em atraso e contratos diversos . Juros sobre arrendamento financeiro ............................................ Receitas de aplicações financeiras ............................................... Atualização sobre impostos e contribuições a recuperar ..............

2011 2010 (13.479) (14.449) 21.759 5.323 1.667 406 318 14.009 (12.464)

COMPOSIÇÃO DA DIRETORIA Arthur Adelino de Freitas Cruz - Diretor Técnico Ronaldo Batista Assunção - Diretor Administrativo Domingues e Pinho Contadores Ltda. - CRC-RJ 001.137/O-0 Luciana dos Santos Uchôa - Contadora - CRC-RJ 081003/O-8

2010 (36) (2) (38)


A-10

SÃO PAULO

Jornal do Commercio

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Baixada Santista Energia S.A. (Controlada da Petróleo Brasileiro S.A. - Petrobras) CNPJ 03.059.729/0001-21

RELATÓRIO DOS AUDITORES INDEPENDENTES Aos Administradores e Acionista da Baixada Santista Energia S.A. São Paulo - SP. 1. Examinamos as demonstrações contábeis da Baixada Santista Energia S.A. (“Sociedade”), que compreendem o balanço patrimonial em 31 de dezembro de 2011 e as respectivas demonstrações do resultado, das mutações do patrimônio líquido e dos fluxos de caixa, para o exercício findo naquela data, assim como o resumo das principais práticas contábeis e demais notas explicativas. Responsabilidade da Administração sobre as demonstrações contábeis: 2. A Administração da Sociedade é responsável pela elaboração e adequada apresentação das demonstrações contábeis de acordo com as práticas contábeis adotadas no Brasil e pelos controles internos que ela determinou como necessários para permitir a elaboração de demonstrações contábeis livres de distorção relevante, independentemente se causada por fraude ou erro. Responsabilidade dos auditores independentes: 3. Nossa responsabilidade é a de expressar uma opinião sobre essas demonstrações contábeis com base em nossa auditoria, conduzida de acordo com as normas brasileiras e internacionais de auditoria. Essas normas requerem o cumprimento de exigências éticas pelos auditores e que a auditoria seja planejada e executada com o objetivo de obter segurança razoável de que as demonstrações

contábeis estão livres de distorção relevante. 4. Uma auditoria envolve a execução de procedimentos selecionados para obtenção de evidência a respeito dos valores e divulgações apresentados nas demonstrações contábeis. Os procedimentos selecionados dependem do julgamento do auditor, incluindo a avaliação dos riscos de distorção relevante nas demonstrações contábeis, independentemente se causada por fraude ou erro. Nessa avaliação de riscos, o auditor considera os controles internos relevantes para a elaboração e adequada apresentação das demonstrações contábeis da Sociedade para planejar os procedimentos de auditoria que são apropriados nas circunstâncias, mas não para fins de expressar uma opinião sobre a eficácia desses controles internos da Sociedade. Uma auditoria inclui, também, a avaliação da adequação das práticas contábeis utilizadas e a razoabilidade das estimativas contábeis feitas pela Administração, bem como a avaliação da apresentação das demonstrações contábeis tomadas em conjunto. 5. Acreditamos que a evidência de auditoria obtida é suficiente e apropriada para fundamentar nossa opinião. Opinião: 6. Em nossa opinião, as demonstrações contábeis acima referidas apresentam adequadamente, em todos os aspectos relevantes, a posição patrimonial e financeira da Baixada Santista Energia S.A. em 31 de dezembro

de 2011, o desempenho de suas operações e os seus fluxos de caixa para o exercício findo naquela data, de acordo com as práticas contábeis adotadas no Brasil. Ênfase: 7. Conforme mencionado na Nota Explicativa nº 1, a Sociedade foi constituída com o objetivo de atender as necessidades das operações e o plano de negócio do acionista controlador Petróleo Brasileiro S.A. - Petrobras. Estas demonstrações contábeis devem ser lidas neste contexto. Demonstração do valor adicionado: 8. Examinamos, também, a demonstração do valor adicionado (DVA), referente ao exercício findo em 31 de dezembro de 2011, elaboradas sob a responsabilidade da Administração da Sociedade. Essa demonstração foi submetida aos mesmos procedimentos de auditoria descritos anteriormente e, em nossa opinião, está adequadamente apresentada, em todos os seus aspectos relevantes, em relação às demonstrações contábeis tomadas em conjunto. Rio de Janeiro, 13 de fevereiro de 2012. Bernardo Moreira Peixoto Neto Contador - CRC-RJ-064887/O-8-S- SP

KPMG Auditores Independentes CRC SP-014428/O-6

PSDB - Líder da bancada tucana, Orlando Morando, defende que não há necessidade de prévia do partido, que o próprio pré-candidato aceitou. Porém, admite que tudo pode acontecer, inclusive o cancelamento da eleição interna FABIO BRAGA/FOLHAPRESS

Bancada estadual fecha com José Serra GUSTAVO URIBE DA AGÊNCIA ESTADO

A

bancada do PSDB na Assembleia Legislativa do estado anunciou na quinta-feira apoio à pré-candidatura de José Serra à sucessão municipal na capital. Após reunião, na sede do legislativo paulista, com participação do ex-governador, 21 dos 22 integrantes da bancada tucana declararam apoio a Serra na prévia a ser promovida pelo partido, marcada para o próximo dia 25. A exceção foi o presidente estadual do PSDB, Pedro Tobias, que preferiu não se pronunciar em decorrência do cargo. O líder da bancada tucana, Orlando Morando, justificou o apoio praticamente unânime a Serra a sua “história, experiência e trajetória”. “No nosso entendimento, o fato de José Serra colocar seu nome à Prefeitura engrandece, enaltece, ajuda, fortalece e cria uma sinergia que infeliz-

Russomano fracassa em manter ação no STF

mente não existia no partido”, afirmou Morando. “Ele traz novo ânimo ao que estava estagnado”, acrescentou. O deputado estadual voltou a afirmar que a bancada entende que não era necessária a realização das prévias para a escolha do candidato do PSDB. Em fevereiro, antes de Serra anunciar sua pré-candidatura, a bancada do PSDB divulgou nota na qual pedia ao ex-governador que aceitasse disputar a eleição municipal e defendia que o partido desistisse da eleição interna. POLÊMICA. A nota criou polêmica, na época, uma vez que alguns membros da bancada estadual alegaram não terem sido consultados sobre a divulgação do manifesto. “Hoje declaramos apoio de maneira testemunhal, pois já havíamos feito o manifesto antes dele ter definido sua candidatura”, disse Morando. O líder da bancada do PSDB negou que os deputados esta-

MOBILIZAÇÃO

Tucano diz ser óbvio que governo se mexa GUSTAVO URIBE DA AGÊNCIA ESTADO

Serra: ‘Como o governo federal vai agir, o tempo vai mostrar’ duais tenham mudado de opinião sobre a realização das prévias, mas argumentou que Serra se mostrou favorável ao processo interno. “A bancada entende que não era necessárias as prévias, mas agora o próprio José Serra aceitou a disputa. Então, não há o que discutir com quem estamos apoiando”, disse. “Não tenho a menor dúvida de que se ele tivesse colocado seu nome antes, nós não estaríamos nem discutindo as prévias.” Morando disse ainda que os deputados estaduais do PSDB mobilizarão as assessorias a fim de arregimentar o maior número de apoios à pré-candidatura do ex-governador e ressaltou que a ideia é promover, mesmo antes das prévias, um ato em favor do ex-governador. O deputado foi questionado se acredita que o processo interno pode ser suspenso antes da realização. “Nós não queremos desqualificar os outros postulantes, mas tudo é possível”, admitiu.

ALF RIBEIRO/FOLHAPRESS

DA REDAÇÃO

MARLENE BERGAMO/FOLHAPRESS

FERNANDO GALLO

MARIÂNGELA GALLUCCI

O pré-candidato do PRB à Prefeitura paulista, Celso Russomano, fracassou novamente na tentativa de manter no Supremo Tribunal Federal (STF) uma ação na qual é acusado de falsidade ideológica. Sob o argumento de que ele não tem mais mandato parlamentar, os ministros do STF rejeitaram opedido pela segunda vez. No Brasil, congressistas e autoridades como o presidente da República e ministros de Estado têm direito a foro privilegiado no Supremo. Ou seja, somente podem ser investigados e processados perante o STF. Porém, quando deixam os cargos, eventuais inquéritos e processos criminais são transferidos para a 1ª Instância. A abertura da ação criminal foi determinada pelo STF em junho de 2008. Conforme a acusação do Ministério Público Federal, o político teria simulado um contrato de locação de imóvel com terceiro para conseguir, em 1999, a transferência de domicílio eleitoral da capital para Santo André, na região do ABC. O objetivo seria concorrer à Prefeitura local em 2000. Russomano acabou perdendo a disputa.

HEGEMONIA. O deputado disse ainda que a entrada de Serra no pleito veio para impedir a hegemonia do PT tanto em São Paulo como no Brasil. Ao todo, participaram da reunião 19 dos 22 membros da bancada estadual. Os deputados estaduais Geraldo Vinholi e Marcos Zerbini não compareceram ao encontro porque estavam em viagem, enquanto o deputado Welson Gasparini permanece em licença médica. Morando garantiu que os três parlamentares ausentes declararam apoio à Serra.

DEBATE. Serra disse que não foi comunicado pela direção municipal do PSDB sobre o pedido feito pelos demais pré-candidatos do partido para a realização de, pelo menos, dois debates antes da realização da eleição interna. Em carta aberta, José Aníbal e Ricardo Trípoli, que são pré-candidatos, criticaram o adiamento do processo de prévias para o final do mês. Segundo Serra, sua estratégia na pré-campanha é visitar os diretórios zonais do PSDB na capital. O précandidato tucano antecipou que já planeja sua equipe de campanha e avaliou como excelentes nomes o deputado estadual Orlando Morando, o secretário estadual da Cultura, Andrea Matarazzo, e o secretário estadual do Meio Ambiente, Bruno Covas.

Chalita acusa Serra Haddad escolhe nomes o de buscar ‘3 turno’ para finanças e programa DA AGÊNCIA ESTADO

DA AGÊNCIA ESTADO

Na avaliação o líder tucano, com o fim das prévias, o partido teria condições de começar já uma mobilização eleitoral para a campanha eleitoral. Morando negou que o adiamento da eleição interna, do dia 4 para o próximo dia 25, tenha causado racha na sigla. Segundo ele, passado o período de prévias, o PSDB caminhará junto e buscará unidade, “o que sempre foi a marca do PSDB”.

O pré-candidato José Serra avaliou como natural a mobilização do Palácio do Planalto em torno do também pré-candidato do PT à Prefeitura, Fernando Haddad. Após reunião com a bancada estadual do PSDB, na Assembleia Legislativa do estado, Serra ressaltou que o tempo vai mostrar os meios que o governo federal vai utilizar para alavancar a candidatura do ex-ministro da Educação. “É óbvio que o governo federal vai se mexer, isso está dentro do previsto”, afirmou Serra. “Agora, a maneira como vai fazer, isso o tempo vai mostrando”, acrescentou. A presidente Dilma Rousseff (PT) anunciou ontem o nome do senador Marcelo Crivella (PRB-RJ), também bispo da Igreja Universal, como o novo ministro da Pesca. Com a indicação, o Palácio do Planalto estaria tentando blindar Haddad de ataques religiosos, bem como viabilizar uma aliança entre PT e PRB na sucessão da Prefeitura da capital, com a eventual desistência da pré-candidatura do ex-deputado federal Celso Russomanno. Serra avaliou ainda que

“seria surpreendente” se o governo federal também não agisse para impedir uma aliança entre PSDB e PSB no estado. Isso porque o PSB integra a base de apoio da presidente mas, em São Paulo, compõe a administração do governador Geraldo Alckmin (PSDB). “Seria surpreendente se eles fizessem o contrário, isso faz parte”, disse o ex-governador.

O pré-candidato do PT à Prefeitura da capital, Fernando Haddad, trabalha para ter como coordenador do programa de governo o deputado federal José de Filippi Jr (PT), que havia sido sugerido como tesoureiro da campanha. Filippi pediu ao ex-ministro que o liberasse da coordenação das finanças. O nome mais cotado para assumir o posto é o do também deputado Newton Lima (PT). “São sugestões, mas não estão processadas. É algo que apenas se cogita”, disse Haddad. O pré-candidato petista diz ter procurado Lima para pedir ao deputado que coordenasse a parte de ciência e tecnologia do programa. Segundo um interlocutor, o exministro não conseguiu contato com Lima, em viagem à Espanha. O deputado se encaixa no perfil que o pré-candidato busca: um ex-prefeito com experiência no trato com finanças e que o partido considere de “extrema confiança”, que deve centralizar todo o processo e ter de dois a quatro operadores que auxiliarão na arrecadação de fundos para sua campanha. Newton Lima foi prefeito de São Carlos, no

Haddad: Cogitando nomes interior de São Paulo, por dois mandatos consecutivos, entre 2001 e 2008. Menos cotados, mas também na lista de possíveis coordenadores de finanças, estão o deputado Ricardo Berzoini (PT ), o prefeito de Osasco, Emídio de Souza, e o tesoureiro do PT Nacional, João Vaccari Neto. O escolhido dividirá a responsabilidade da parte financeira com o tesoureiro do PT municipal, vereador Alfredinho. DESISTÊNCIA. Petistas próximos a Haddad afirmam que

Filippi, sugerido ao ex-ministro como tesoureiro pelo expresidente Lula, disse que não queria ser taxado como homem forte das finanças do partido. O deputado foi o coordenador financeiro das últimas duas campanhas petistas à Presidência: a de Lula em 2006 e a de Dilma em 2010. Na conversa com o exministro , Filippi se disse à disposição para cuidar da área metropolitana no programa de governo. Petistas reforçam a versão apresentada a Haddad, mas apontam outras razões para a recusa. Uns veem em Filippi ambições ministeriais, que o impediriam de assumir uma tarefa que lhe exigisse muito na campanha. Outros apontam a necessidade de presença maciça do deputado na eleição em Diadema (SP), onde terá de ajudar a reeleger o atual prefeito, Mário Reali (PT). Em 2010, o deputado chegou a ter a candidatura impugnada pela Procuradoria Eleitoral do estado, mas o Superior Tribunal de Justiça impediu sua inelegibilidade por avaliar que a improbidade administrativa pela qual fora condenado em órgão colegiado era culposa, ou seja, não intencional, o que permitia concorrer.

O pré-candidato do PMDB à Prefeitura da capital, Gabriel Chalita, acusou o ex-governador José Serra de querer “disputar o terceiro turno” da eleição presidencial ao se colocar como pré-candidato do PSDB na corrida municipal paulistana. “Serra entra na eleição na disputa com discurso nacional. Além disso, já deixou claro muitas vezes que não quer ser prefeito, quer ser presidente da República”, disse o parlamentar. Chalita criticou o ex-governador, de quem foi desafeto enquanto era filiado ao PSDB – ao sair do partido em 2009, passou pelo PSB antes de ir para o PMDB. “Quem pode ser acusado de incoerente é o Serra, que assina uma coisa e não cumpre o que assinou, e o Kassab, que acena para um lado e para outro. Tenho uma cara só. Na nossa linha, não tem política de subsolo, é tudo absolutamente claro”, disse ao ser indagado se o eleitorado não apontaria incoerência nas críticas, já que ele fazia parte da mesma sigla que Serra. Questionado sobre eventual pressão do PT para abrir mão de sua candidatura e apoiar o petista Fernando Haddad, no cenário com Serra na disputa, Chalita disse que a eleição não será polarizada e

Chalita: Serra quer Presidência que o PT respeita a sua intenção de disputar. “Tenho muito respeito pelo PT, pela presidente Dilma e pelo ex-presidente Lula, mas minha candidatura não é linha auxiliar de ninguém”, disse. Segundo afirmou, o vicepresidente Michel Temer (PMDB) está “muito empolgado” com sua campanha. “Não muda a estratégia do PMDB porque a gente já contava com a candidatura do Serra. O pré-candidato peemedebista disse ser bem-vindo o apoio do PSDB, caso vá ao segundo turno. “Se eu for contra o PT, espero que o PSDB apoie”. (Com agências)


cyan magenta amarelo preto

SEGUROS

EDITOR // ALBERTO SALINO

Jornal do Commercio A-11

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

PREVIDÊNCIA - Entidade teme, contudo, uso político dos recursos e defende a hipótese do servidor comprar com suas reservas renda vitalícia no setor privado

Fenaprevi apoia criação de fundo de servidores

N

CURTAS CNSEG PÕE TECNOLOGIA EM SEGURO EM DEBATE Preço baixo e popularização do seguro são os temas que estarão na ordem do dia durante a 6ª edição do Insurance Service Meeting 2012, evento marcado para os próximos dias 16 e 17, em Angra dos Reis (RJ), com promoção da Confederação Nacional das Seguradoras (CNSeg). Serão apresentadas novas soluções e processos de tecnologia que permitam popularizar e baratear as apólices. Informações: www.insurancemeeting.org.br .

ICATU LANÇA CAMPANHA DE VENDA 2012 EM SP A Icatu Seguros lançou nesta quinta-feira, em São Paulo, a sua campanha de vendas 2012, entre cerca de 300 pessoas (clientes, parceiros e corretores de seguros), convidadas, em seguida, para assistirem ao show de estreia de Chico Buarque na capital paulista. A seguradora é patrocinadora exclusiva da turnê do cantor.

CESCEBRASIL ESTIMA CRESCER 25% ESTE ANO A CesceBrasil, seguradora especializada em seguro de crédito e de garantia, planeja crescer 25% em 2012. Outra aposta da companhia é o amadurecimento das operações de suas filiais no Nordeste (Salvador e Fortaleza), "mercados que possuem uma grande carência por obras de infraestrutura". O cenário para a demanda por seguro de crédito, na avaliação da empresa, também é positivo, estimulado pelo aquecimento do consumo interno no País.

FENAPREVI/DIVULGAÇÃO

a avaliação dos seguradores, o governo está no caminho certo com a criação da previdência complementar para os servidores públicos federais, cujo projeto foi aprovado nesta quinta-feira na Câmara dos Deputados, estabelecendo a instituição de três fundações, que atendem pela sigla Funpresp. "É passo fundamental no conjunto de iniciativas que vêm sendo conduzidas nos últimos anos para equacionar os desequilíbrios da Previdência Social no Brasil", opina o diretor-executivo da Federação Nacional de Previdência Complementar e Vida (Fenaprevi), Luiz Peregrino, ao analisar o assunto no site Viver Seguro, da Confederação Nacional das Seguradoras (CNSeg). Segundo ele, é inegável que a sociedade espera que o governo e o Congresso Nacional deem, finalmente, sequência à reforma do setor, iniciada com a aprovação da Emenda Constitucional 41, de 2003. Nesse sentido, ele entende que a solução proposta para os servidores públicos é imprescindível para recompor o equilíbrio da Previdência Social e garantir sua solvência no longo prazo. O projeto das fundações dos servidores públicos segue agora para análise do Senado. Luiz Peregrino espera que o

LUIZ PEREGRINO

DIRETOR-EXECUTIVO DA FENAPREVI

É passo fundamental no conjunto de iniciativas que vêm sendo conduzidas nos últimos anos para equacionar os desequilíbrios da Previdência Social no Brasil."

novo regime reduza a pressão sobre os recursos públicos, crescentemente alocados à previdência, permitindo recompor a capacidade de gastos públicos em áreas como a de infraestrutura e de programas de inclusão social, indispensáveis ao desenvolvimento sustentado do País. "O projeto viabilizará uma nova configuração no tocante aos dispêndios e obrigações futuras da União para com seus servidores, viabilizando a construção de um modelo inovador de previdência para os novos servidores públicos, isonômico ao dos trabalhadores da iniciativa privada", observa o executivo.

Contudo, ele aponta alguns riscos na governança das fundações, incluindo a possibilidade de uso político dos recursos. Nesse aspecto, o diretor da Fenaprevi entende que será preciso observar rigorosamente as regras, diretrizes e limites prudenciais estabelecidos pelo Conselho Monetário Nacional (CMN) para a aplicação dos recursos das reservas. Essa medida, por si só, já constituiria razoável barreira ao uso político dos recursos. O especialista teme ainda as eventuais pressões políticas sobre a Secretaria de Previdência Complementar (Previc) e o CMN e, nesse con-

texto, como serão punidas eventuais transgressões às regras estabelecidas. Luiz Peregrino vê também com preocupação a criação três entidades fechadas de previdência complementar, uma para cada Poder da União, e isso sem contar com a possível proliferação de planos dentro de cada uma dessas entidades, um para cada categoria de servidores, por exemplo. "Quanto menor for o grupo de participantes, maior será a dificuldade de diluição dos riscos atuariais", adverte. PLEITO. Ele defende a tese de que os participantes desses fundos fechados possam exercer o direito de transferir suas reservas para entidades abertas de previdência complementar, visando a compra de renda vitalícia. Para ele, essa transferência de reservas às referidas entidades é, inclusive, facultada pela Lei Complementar 109, de 2001, mas somente com excepcional autorização do órgão fiscalizador (Previc), constituindo-se tal fato em limitador à compra, pelo assistido, de rendas vitalícias. O diretor da Fenaprevi diz ainda que esse tipo de renda protegeria o assistido de variações no valor do seu benefício, ou de sua extinção por esgotamento do saldo da pertinente conta individual.

■ ESTUDO

Brasil tem ambiente propício ao investimento em energia O Mapa de Risco Político de 2012 recém-divulgado pela empresa Maplecroft, em conjunto com a corretora de seguros norte-americana Marsh, mostra que, apesar de um período de inigualável turbulência geopolítica, muitas economias apresentam agora maiores oportunidades de crescimento para as empresas globais de energia devido às reduções no risco político e melhorias em seus ambientes legais e regulatórios. São países em crescimento e com um clima mais favorável ao investimento empresarial em recursos naturais, como Brasil, Bolívia, Chile, Colômbia, Indonésia, México, Peru, Rússia, Tailândia, Turquia e Uruguai. O estudo aponta ainda a existência de países menos desenvolvidos e com riscos mais elevados, como República Democrática do Congo, Mongólia e Mianmar, que mostram evi-

dências de melhorias nos ambientes de negócios legais e regulatórios e que podem oferecer oportunidades de investimentos para as empresas de energia. Os resultados do mapa, destinados a proporcionar às organizações uma maior compreensão sobre como os riscos globais podem afetar as oportunidades de investimento, foram lançados pela CEO da Maplecroft, professora Alyson Warhurst, na recente conferência da Marsh sobre as Companhias Nacionais de Petróleo (National Oil Companies - NOC) em Dubai (Emirados Árabes). PREVISÃO. "As economias em crescimento do Brasil, Rússia, Índia, China, México, Indonésia, Coreia do Sul e Turquia são destinos cada vez mais atraentes para os investimentos devido à redução dos riscos políticos. No entanto, o país para se

observar no próximo ano será Mianmar", disse Alyson Warhurst, que acrescenta: "Mesmo que seja classificado como o segundo maior em riscos no mapa de 2012, com as recentes reformas políticas e a perspectiva das sanções serem levantadas se Aung San Suu Kyi juntar-se ao gabinete, o país poderá ser colocado no centro do panorama estratégico de 2012. Haverá grandes oportunidades pela frente para as empresas de petróleo e gás que procuram regressar ao país". Presidente da Prática Global de Energia da Marsh, Jim Pierce, alertou que, enquanto economias em rápido crescimento apresentam novas oportunidades de investimento para as empresas globais de petróleo e gás, outras regiões em todo o mundo permanecem como centros de risco geopolítico que precisam ser devidamente monitorados e gerenciados.

■ EMPREENDEDORISMO

Liberty adere à incubadora de negócios como mantenedora A Liberty Seguros decidiu juntar-se a Bradesco, Porto Seguro, MetLife e RSA na qualidade de companhia mantenedora da Incubadora de Negócios de Seguros (Incubaseg). O faturamento dessas cinco seguradoras representa 37,6% do mercado de seguros brasileiro. "Estou muito feliz e orgulhoso com a adesão da Liberty, que tem em seu DNA o desenvolvi-

mento de produtos e, consequentemente, alinhada à estratégia da Incubaseg. O apoio das seguradoras como mantenedoras é essencial para dar continuidade a ação da incubadora. Elas irão levar através da Incubaseg, a cultura inovadora e empreendedora aos diversos partícipes do setor, fator decisivo na hora de alavancá-lo", conta Carlos Alberto Oliveira,

coordenador da Incubaseg. O superintendente de Desenvolvimento de Novos Produtos da Liberty Seguros, Mario Cavalcante, afirma que a parceria com a Incubaseg tem como foco a inovação cada vez maior dos produtos e serviços da empresa, além de reforçar a parceria com os corretores, aumentando a proximidade e auxiliando na implementação de seus projetos.

■ CENTRO AUTOMOTIVO

BB Mapfre faz mais de 16 mil atendimentos Em cinco anos de atividade, o centrou automotivo da BB Mapfre Seguros na cidade de Bauru (SP) realizou mais de 16 mil atendimentos, entre avisos de sinistro, check-ups, vistorias prévias e concessões de carro reserva. O espaço recebe clientes de seguro de automóvel e terceiros que sofrem pequenas colisões, panes elétricas e mecânicas. O diretor-geral de Automóvel da seguradora, Jabis Alexandre, diz que a proposta do centro automotivo é minimizar as dificuldades que, em geral, acontecem quando ocorre um acidente. "Ao deixar o veículo em nosso centro automotivo o motorista não precisa se preocupar com mais nada. E ainda sai com o carro reserva", comenta, acrescentando que "a população de Bauru, uma cidade em constante avanço, reconheceu essas características do nosso centro e fez com que chegássemos a esse número importante de atendimentos, um marco para o grupo no Estado de São Paulo". Como todo o processo é realizado no local, segundo ele, a estrutura traz agilidade e ainda mais qualidade ao padrão de atendimento BB Mapfre. E não são apenas segurados e terceiros que podem usufruir das facilidades e especialidades do centro automotivo. A exemplo do Serviço de Prevenção de Acidentes, todo motorista pode fazer o check-up gratuito de até 50 itens, incluindo sistema de freios, suspensão, direção e

faróis, entre outros. A análise, monitorada por especialistas em sistemas mecânicos e elétricos, leva 20 minutos e antecipa a Inspeção Técnica Veicular (ITV) homologada pelo Inmetro, que já é obrigatória em São Paulo. Ao fim do trabalho é emitido um relatório, em que são apontadas as irregularidades. O motorista tem a liberdade de encaminhar o carro a um mecânico de sua confiança, caso seja necessário. MARÍTIMA. A Zona Sul de São Paulo (SP) foi o local escolhido pela Marítima Seguros para abrir mais um centro automotivo. Na unidade, que segue a tendência de centralizar serviços automotivos num único espaço para garantir mais conforto e praticidade ao segurado, são realizados diversos serviços. A lista inclui vistoria de sinistros e vistoria prévia para inspeção veicular, além de reparos em geral, bem como uma série de vantagens propiciadas pelas parcerias com marcas como Roma Pneus, Carglass e Localiza, que têm unidades de atendimento no local. Em quatro anos, as ocorrências com problemas elétricos tiveram evolução de 61% e os reboques, de 32%. Em 2010 aconteceram mais de 2,1 milhão de atendimentos nas estradas, índice 59,6% superior ao registrado em 2006. Do total, 53% aconteceram por causas mecânicas, 4% elétricas e 38% foram reboques.

■ AUTOMÓVEL

Tokio mexe nas apólices de pagamento mensal A Tokio Marine decidiu mexer em dois produtos, na modalidade de pagamento mensal, da sua carteira de automóvel, implementando melhorias válidas para as apólices com vigência a partir do dia 16 de fevereiro. Agora, em caso de indenização integral (perda total do veículo), o cliente não pagará as parcelas a vencer até o momento da renovação. Outra novidade é a gratuidade do pagamento da primeira parcela do seguro sempre que a apólice for renovada, ou seja, 12 meses após a sua contratação. "Além das novidades oferecidas, vale ressaltar que não há custo de emissão de apólice e incidência de juros no produto Mês a Mês, dois grandes diferenciais desse seguro", afirma o diretor-

executivo de Massificados da seguradora, Marcelo Goldman. Os benefícios da indenização integral são válidos tanto para renovações de seguros da Tokio Marine quanto de congêneres. Já isenção do pagamento da primeira parcela só é válida para renovações da própria seguradora. A contratação dos benefícios pode ser feita automaticamente pelos corretores no sistema de cálculo na web. O seguro Mês a Mês, segundo Goldman, é uma grande opção para clientes que querem ter seu seguro garantido na renovação, principalmente aqueles que optam pelo débito das parcelas em conta corrente, além daqueles que preferem diluir o custo do seguro em 12 vezes.

■ GARANTIA ESTENDIDA

Classic tem mais nove pontos de vendas em SP A Brasil Insurance Classic fechou parceria com o supermercado D´Avó para oferecer aos clientes o seguro de garantia estendida para eletroeletrônicos comprados nas nove lojas da rede localizadas em São Paulo e na região metropolitana. Com a novidade, é possível esticar o tempo em que o eletrônico pode ser reparado sem custos adicionais por um período que varia entre um e dois anos depois do término da garantia da fábrica. Assim como os demais seguros massificados, a garantia estendida pode ser adquirida pelo consu-

midor no ato da compra. De acordo com o diretor de simplicidade e facilidades do supermercado, Marcio Mota, com a nova parceria, a expectativa é de que a garantia estendida tenha uma penetração de 23% na venda de eletroeletrônicos. Para o presidente da corretora, Rubens Nogueira Filho, "por sermos referência no segmento de seguros massificados, desenhamos um produto bastante personalizado e confiável para que os clientes D´Avó tenham ainda mais tranquilidade em relação às suas compras".


RIO DE JANEIRO

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

JUSTIÇA SOCIAL - Estado é o primeiro do País a conceder RGI para descendentes de escravos. Preto Forro tem 15 famílias. Pedra do Sal, na Zona Portuária, será a próxima

Quilombolas recebem títulos de propriedade DIVULGAÇÃO

DA REDAÇÃO

O

de imensa de processos. Guardam ainda uma riqueza de diversidade cultural, relacionada à culinária, artesanato, festas, construções, comemorações, práticas religiosas e modo de viver que remetem às raízes africanas. No Rio de Janeiro existem diversos grupamentos de descendentes de escravos, em sua maioria isolada dos grandes centros e vivendo em condições ainda bastante precárias. Entre os pólos estão Comunidade Bracuí, em Angra dos Reis; Comunidade Campinho da Independência, em Paraty; Comunidade Carumbi, em Campos; Comunidade Caveira, em São Pedro da Aldeia; Comunidade do Rasa, em Búzios; Comunidade Sacopã, próximo a Lagoa Rodrigo de Freitas, na capital, e Comunidade São José da Serra, na cidade de Valença. Entre todas estas comunidades, a que mais se destaca é a do Quilombo São José da Serra. Localizado no município de Valença, possui cerca de 150 anos e é o quilombo mais antigo do estado. Moram no local cerca de 200 pessoas. O foco é a preservação e o culto de suas lendas, tradições, música e o jongo – ritmo considerado o ancestral do samba e do pagode. Tombado pelo Instituto do Patrimônio Histórico e Artístico Nacional (IPHAN) em 2005, o Grupo Cultural Jongo da Serrinha, do bairro de Madureira, é o que mais se destaca na mídia.

Quilombo Preto Forro, em Cabo Frio, no litoral norte do estado, recebeu do governo o Registro Geral de Imóveis (RGI), documento que formaliza a propriedade. Na última quinta-feira o governador Sérgio Cabral entregou o documento a Elias Santos, líder da comunidade formada por 15 famílias de descendentes de escravos. A entrega do RGI foi realizada no Palácio Guanabara – marcado na história brasileira como o lugar onde a princesa Isabel, em 1888, assinou a Lei Áurea, que pôs fim à escravidão. Com a medida, o estado se tronou referência ao ser o primeiro do País a conceder o registro de propriedade a uma área quilombola. “O Brasil é um país de muitas injustiças sociais. Hoje, é um dia especial porque nós estamos fazendo uma reparação histórica no que se refere aos negros. Vamos trabalhar junto com a comunidade quilombola e fazer do Preto Forro um exemplo para o País”, enfatizou o governador. O título definitivo da terra é direito previsto na Constituição Federal aos descendentes que ocupam áreas remanescentes de quilombos. Elias Santos ressaltou que foram muitos anos de incertezas e medo. “Depois de 20 anos, tivemos um momento maravi-

lhoso e vamos pedir para que isso venha acontecer em outros lugares também”, frisou. Segundo a Secretaria Estadual de Habitação, o Rio possui 33 comunidades quilombolas e a próxima a receber o registro definitivo de propriedade será a da Pedra do Sal, na Zona Portuária. A data ainda será marcada. “O tempo que leva para cumprir todas as etapas legais depende de vários fatores. No caso do Preto Forro, o fato das terras serem do estado facilitou o processo”, explicou o secretário de Habitação, Rafael Picciani. Aos 76 anos, Leonídia Maria dos Santos, moradora mais antiga do quilombo, viu seu sonho ser realizado após

■ INTERCÂMBIO

■ SENA LIMPA

Governador recebe vice-ministro dos EUA

Seis praias da cidade serão despoluídas até 2014

Terreno em Cabo Frio onde vivem os moradores de Preto Forro

DA REDAÇÃO

DA REDAÇÃO

O governador Sérgio Cabral recebeu, na última quinta-feira, no Palácio Laranjeiras, o vice-ministro das Relações Exteriores dos Estados Unidos, William J. Burns. Durante o almoço, foram discutidos temas como o importante momento econômico do Rio de Janeiro, a política de pacificação de comunidades e o calendário de eventos do estado, com a Olimpíada de 2016. Os secretários da Casa Civil, Regis Fichtner, e de Desenvolvimento Econômico, Energia, Indústria e Serviços, Julio Bueno, participaram do encontro. O principal diplomata do Departamento de Estado dos Estado Unidos está no Brasil para falar sobre as relações bilaterais entre os dois países, incluindo cooperação econômica, meio ambiente, ciência e tecnologia, inclusão social e educação. Segundo Burns, que se tornou vice-ministro em julho de 2011, o objetivo é trabalhar em conjunto para promover a estabilidade, prosperidade e dignidade em todo o mundo. Depois do almoço com o governador, o diplomata se reuniu com o presidente do Banco Nacional de Desenvolvimento Econômico e Social (BNDES), Luciano Coutinho, e com a presidente da Petrobras, Maria das Graças Silva Foster.

Os cariocas receberam uma boa notícia no dia em que o Rio de Janeiro completou 447 anos: a despoluição das praias da Bica, na Ilha do Governador, e Ipanema, Leblon, São Conrado, Leme e Urca, na zona sul. Para isso, a Secretaria do Ambiente lançou, na última quinta-feira, o programa Sena Limpa, que pretende concluir o trabalho até 2014. A operação, feita em conjunto por órgãos do governo estadual e da prefeitura, custará R$ 150 milhões e inclui obras de saneamento, coleta de lixo superficial, limpeza de galerias e monitoramento e fiscalização de despejo de esgoto. Os investimentos são provenientes do Fundo Estadual de Conservação Ambiental (Fecam) – já foram disponibilizados R$ 56 milhões, mas os recursos podem chegar a R$ 70 milhões –, R$ 40 milhões do Morar Carioca, programa municipal de reurbanização de favelas, além de verbas da Comlurb, da Cedae e da prefeitura. Um mapeamento preciso, realizado em parceria com a Cedae e as Secretarias Municipal de Habitação, Obras (através da RioÁguas) e Conservação (por meio da Comlurb), detectou os principais pontos de contaminação das praias e baseou as ações para um plano de combate à poluição. Segundo o secretário do Ambiente, Carlos Minc, a primeira a se livrar da poluição será Ipanema. No bairro, estão previstas seis intervenções de esgotamento sanitário, execu-

70 anos de vida sob ameaça de ser expulsa do lugar onde nasceu. Emocionada, ela mal conseguia falar. Nascida e criada na comunidade,Tereza dos Santos, de 23 anos, diz que, agora, pode sonhar com um futuro melhor para seus três filhos. “Esperamos muito por isso. Tenho certeza de que as coisas só vão melhorar”, comemorou a moradora do quilombo. HISTÓRIA. As comunidades remanescentes de quilombos no estado do Rio são uma das maiores fontes de conhecimento sobre o patrimônio cultural e histórico de origem afro-brasileira e se constituíram a partir de uma diversida-

CLÁUDIO HUMBERTO ch@claudiohumberto.com.br

Com Ana Paula Leitão e Teresa Barros // www.claudiohumberto.com.br

PSC entra na briga para tirar Trabalho do PDT Após o PRB ter sido contemplado com Marcelo Crivella no comando da Pesca, o PSC também entrou na disputa por espaço na Esplanada. O partido do Pastor Everaldo pretende a vaga do PDT no Ministério do Trabalho, alegando a infidelidade dos pedetistas nas votações de interesse do governo. Além disso, o PDT está em plena negociação para participar do governo tucano de Geraldo Alckmin, em São Paulo.

Vai que cola A bancada do PSC sugere o nome de Hugo Leal (RJ) e propõe que a indicação seja conjunta com o PDT. Leal é ex-pedetista.

Também quero Os sociais-cristãos reclamam que, apesar de possuir bancada de 17, foi o PRB quem emplacou ministro, reunindo apenas dez deputados. PODER SEM PUDOR

O sociólogo e o operário Na campanha de 1978, o MDB de São Paulo lançou ao Senado um professor e sociólogo, que começou distribuindo panfletos na porta da Volkswagen. Era uma chatíssima carta de compromissos, solenemente desprezada pelos operários. Fominha, ele mandou recolher os papéis no chão, para reaproveitá-los. Mas um sindicalista passava por ali, e, gentil, subiu no carro de som de Fernando Henrique Cardoso e, ao microfone, pediu aos companheiros atenção aos panfletos. Deu certo. O sindicalista que quebrou o galho do sociólogo era Luiz Inácio da Silva, o Lula.

Caiu a ficha

tadas pela Cedae. “Já vamos tirar, até o fim do ano, mais de 90% da poluição que chega ao Jardim de Alah pela Cruzada de São Sebastião (no Leblon) e por um coletor de águas contaminadas que vêm do Cantagalo e do Pavão-Pavãozinho, transportando esses efluentes até o emissário de Ipanema a 3,8 mil metros dali. Está comprovado que não há retorno do esgoto do emissário para as praias”, explicou Minc. CRONOGRAMA. O cronograma da Secretaria prevê para 2013 a despoluição da praia do Leme até junho, da Urca até outubro, da Bica, até novembro, e a de São Conrado até dezembro. A última a ficar livre dos coliformes fecais será a praia do Leblon, que recebe parte do esgoto das comunidades da Rocinha e Parque da Cidade. A praia do Leblon que, de acordo com estudo do Instituto Estadual do Ambiente (Inea), esteve imprópria para banho durante metade do ano de 2011, será a última a ter suas águas despoluídas. A previsão é que as 24 intervenções previstas sejam concluídas até dezembro de 2014, possibilitando a limpeza da praia. “A contribuição de esgoto para a praia do Leblon vem da encosta da Rocinha, através do canal do Leblon, e das favelas do alto Gávea, em torno do Parque da Cidade. Faremos oito intervenções para fazer construir coletores, evitando que os efluentes que chegavam pelas redes pluviais caiam na praia. A falta de saneamento

das comunidades tem dois reflexos importantes: tira saúde e cidadania de quem mora nelas e acaba com a praia e o lazer da população”, argumentou o secretário. O estudo apontou ainda que as praias da Urca e da Bica não apresentaram condições próprias para banho durante 95% de 2011. Isso porque os níveis de coliformes fecais superavam a norma estabelecida pelo Conama (Consleho Nacional do Meio Ambiente), de mil coliformes por decilitro. A balneabilidade do mar de Ipanema também foi comprometida em 40% do tempo, assim como o de São Conrado (90%) e Leme (35%). A opção por esses locais, segundo Minc, se deve à possibilidade imediata de eliminação do despejo de efluentes, enquanto a limpeza de outras praias depende de um programa mais complexo, o de despoluição da Baía de Guanabara. No acordo firmado entre o governo e a prefeitura, caberá à Cedae operar e fazer a manutenção das ligações domiciliares das comunidades, que serão realizadas pela RioÁguas. A Secretaria do Ambiente ficará encarregada de construir troncos coletores para transportar o esgoto até os emissários ou estações elevatórias. O Inea ficará responsável pelo monitoramento da balneabilidade das águas e fiscalizar irregularidades. Enquanto a Comlurb promoverá a limpeza do lixo superficial, impedindo o entupimento das galerias pluviais que desembocam no mar.

As notícias sobre o tratamento de câncer na garganta não são exatamente ruins, mas o ex-presidente Lula anda muito deprimido.

Código e STF não punem militares da reserva Militares da reserva que se manifestaram contra Dilma não podem ser punidos, segundo um subprocuradorgeral do Ministério Público Militar consultado pela coluna. Ele não viu crime previsto no Código Penal Militar. Podem apenas sofrer sanções disciplinares, de acordo com o regimento de cada Força. Segundo a súmula 56 do Supremo Tribunal Federal em vigor, “militar reformado não está sujeito a pena disciplinar”.

Continência indevida Dirigentes de clubes militares estão sendo pressionados a renunciar, após o vexame de obedecerem a “ordem” de retirar criticas a Dilma.

Pensando com o fígado Dilma cometeu um erro primário, tentando sufocar a insatisfação de militares da reserva. Se os tivesse ignorado, mal se falaria no assunto.

Investigação geral Militares admitem a Comissão da Verdade, desde que investigue os dois lados, como a autoria de alegados 129 assassinatos do lado deles.

Dilma supera Lula A presidenta anda “insuportável”, dizem assessores, após pesquisa nacional de avaliação do seu desempenho, ainda não divulgada: 62% de “ótimo” e “bom”. Mais que o ex-presidente Lula em qualquer tempo.

Pensando bem...

A-12

EDITOR // KATIA LUANE

...Dilma deu a vara a Marcelo Crivella, agora precisa ensiná-lo a pescar.

Não sei colocar uma minhoca no anzol Marcelo Crivella, novo ministro da Pesca, admitindo que é apenas pescador de almas


RIO DE JANEIRO

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

ABL abre temporada 2012 de palestras DA REDAĂ‡ĂƒO

A Academia Brasileira de Letras (ABL) abre os ciclos de conferĂŞncias de 2012 com o tema “Pensar hoje Iâ€?, sob coordenação do acadĂŞmico Marco Lucchesi. A primeira palestra serĂĄ “O que significa pensarâ€?, tendo como conferencista o professor Emmanuel Carneiro LeĂŁo. LeĂŁo ĂŠ professor titular emĂŠrito da Universidade Federal do Rio de Janeiro e professor titular da Universidade Gama Filho. Possui graduação pelo PontifĂ­cio Atheneo Antoniano e doutorado na De Universa Philosophia – AlbertLudwigs-Universität Freiburg. De acordo com Lucchesi, o ciclo “responde a uma demanda de verticalizar diver-

sas questĂľes, de aprofundĂĄlas a partir de uma proposta dialĂłgica, frente ao desafio das diversas formas de pensar hoje o mundo, a arte e a ciĂŞncia, em seus diversos desdobramentos, sem perder de seu horizonte a visĂŁo ĂŠtica do prĂłprio pensamentoâ€?. O ciclo terĂĄ mais trĂŞs conferĂŞncias: “Pensar as artesâ€?, com o poeta Ferreira Gullar; “Pensar a Humanidadeâ€?, com JosĂŠ Arthur Giannotti; e “Pensar as CiĂŞncias Humanasâ€?, com o acadĂŞmico Candido Mendes de Almeida. O evento estĂĄ programado para o dia 6 de março, Ă s 17h30min, no Teatro R. MagalhĂŁes Jr., sede da Academia, na Avenida Presidente Wilson 203, Castelo. A entrada ĂŠ franca.

â– FALTA DE METAS

Documento da Rio+20 frustra ambientalistas DA AGĂŠNCIA BRASIL

O rascunho do documento-base para a Conferência das Naçþes Unidas sobre Desenvolvimento Sustentåvel, a Rio+20, causou frustração entre ambientalistas e especialistas pela falta de metas claras para a sustentabilidade, que deverão ser seguidas pelos países nos próximos anos. A avaliação Ê do presidente do Comitê Brasileiro do Programa das Naçþes Unidas para o Meio Ambiente (Instituto Brasil Pnuma), Haroldo Mattos Lemos. De acordo com Lemos, o documento, divulgado em janeiro, Ê composto por muitas intençþes e renovaçþes de compromissos que jå foram assumidos pelos países em outras ocasiþes. O Draft Zero, como Ê conhecido o documento, reúne sugestþes e contribuiçþes de países, gru-

pos regionais, organizaçþes internacionais e da sociedade civil. Ele serĂĄ o principal texto discutido pelos lĂ­deres mundiais na conferĂŞncia e submetido Ă aprovação dos estadosmembros da ONU na Rio+20. “A Rio+20 estĂĄ cercada de muita expectativa, mas esse documento nĂŁo apresenta metas definidas para a sustentabilidade, que era o que todos nĂłs esperĂĄvamos, e gera frustração. Fala sobre economia verde, criação de empregos verdes e sobre o comprometimento dos governos com o que foi decidido na Rio 92, com a Agenda 21, e em outros documentos da ONU, mas nĂŁo tem metas, como o que fazer e atĂŠ quandoâ€?, avaliou Lemos, que participou, na Ăşltima quinta-feira, no Rio, de encontro promovido pelo FĂłrum Permanente de Desenvolvimento EstratĂŠgico do Estado, vinculado Ă  Alerj.

COMÉRCIO - Promoçþes e facilidades de pagamento estimularam o consumidor, sobretudo no setor de eletrodomÊsticos que comandou o faturamento das lojas

Vendas no Rio cresceram 8,2% no mĂŞs de janeiro FĂ BIO COSTA/JCOM/D.A PRESS

FERNANDA MARTINS

O

comĂŠrcio lojista da cidade do Rio vendeu mais 8,2% em janeiro deste ano em relação a igual mĂŞs de 2011. Este ĂŠ o resultado da pesquisa ‘TermĂ´metro de Vendas’ divulgada mensalmente pelo Centro de Estudos do Clube de Diretores Lojistas do Rio de Janeiro (CDL-Rio), que abrange cerca de 750 estabelecimentos comerciais da Cidade. O desempenho do primeiro mĂŞs de 2012 ficou bem prĂłximo do resultado de todo ano passado, quando as vendas cresceram 8,6%. Segundo o presidente do CDL-Rio, Aldo Gonçalves, o resultado foi bom, porque normalmente janeiro ĂŠ um mĂŞs imprensado entre o Natal e o Carnaval. “O aumento das vendas reflete as açþes promovidas pelo comĂŠrcio lojista como a manutenção de promoçþes e facilidades de pagamento. Isso estimulou o consumidor e influenciou o resultado de janeiroâ€?, disse Aldo. A pesquisa mostra que os indicadores do mĂŞs de janeiro foram puxados pelo crescimento das vendas do comĂŠrcio varejista especializado nos segmentos de eletrodomĂŠstico (8,8%); mĂłveis (8,4%); confecçþes,moda Infantil e jĂłias (6,8%); tecidos

â?ž

â– ACADEMIA

Jornal do Commercio A-13

ALDO GONÇALVES

PRESIDENTE DO CDL-RIO

A segurança melhorou bastante e isso Ê refletido diretamente nas vendas..."

(6,3%); e calçados (5,6%). Aldo observou que o Rio vive uma fase excelente, o que torna o ambiente local ainda mais favorĂĄvel aos bons negĂłcios. “Esta ĂŠ a dĂŠcada de ouro do Rio e todos estĂŁo empolgados pelos eventos que receberemos como a Rio+20, os Jogos Mundiais da Juventude (JMJ), a Copa do Mundo de Futebol e os Jogos OlĂ­mpicos. Isso eleva todas as nossas expectativasâ€?, ressaltou. O presidente do CDL-Rio, percebeu que o investimento em segurança pĂşblica tambĂŠm propiciou o bom momento dos negĂłcios. “A segurança melhorou bastante e isso ĂŠ refletido direta-

mente nas vendas, atĂŠ porque o comĂŠrcio ĂŠ muito suscetĂ­vel a alteração da ordem pĂşblica. Com a tranquilidade nas ruas, o carioca fica de bem com a vida e compra maisâ€?, argumentou. Ao contrĂĄrio do que se via hĂĄ pouco tempo, Aldo revelou que a PĂĄscoa passou a ser outra data de boas vendas. “As pessoas nĂŁo se limitam apenas aos chocolates. Os clientes costumam trocar presentes como ursinhos de pelĂşcia, alimentos e brinquedosâ€?, explicou. A pesquisa apontou ainda que o ramo duro (bens durĂĄveis) teve desempenho melhor do que o ramo mole (bens nĂŁo

duråveis): 8,7% contra 6,1%. Quanto à forma de pagamento, a venda a prazo foi a preferida pelos consumidores: 9,7% contra 6,7% da venda à vista. Em relação as vendas conforme a localização dos estabelecimentos comerciais, o levantamento mostrou que no ramo mole vendeu mais na Zona Sul (9,2%), seguida pelo Centro com 5,2% e pela Zona Norte com 4,1%. No ramo duro, a Zona Norte comandou com mais 11,4%,, seguida pelo Centro com 6,7% e pela Zona Sul com 1,7%. O Serviço de Proteção ao CrÊdito do Clube de Diretores Lojistas do Rio de Janeiro – CDL-Rio, registrou em janeiro aumento de 8,6% nas dívidas quitadas, 1% nas consultas e 1,4% na inadimplência. No acumulado dos últimos doze meses (fevereiro/2011 a janeiro/2012) a inadimplência, as consultas e as dívidas quitadas subiram, respectivamente, 1,8%, 8,3% e 7,2%. No movimento de cheque em janeiro, a inadimplência e as dívidas quitadas cresceram, respectivamente, 0,7%, 5,3% e as consultas diminuíram 9,8%. No acumulado dos últimos doze meses (fevereiro/2011 a janeiro/2012) a inadimplência e as dívidas quitadas cresceram, respectivamente, 1,2% e 5,8 %, e as consultas caíram 7,8 %.

COMUNICADO O MetrĂ´Rio informa aos seus clientes que a partir do dia 02 de abril de 2012, o valor unitĂĄrio da tarifa serĂĄ de R$3,20 (trĂŞs reais e vinte centavos). A tarifa foi aprovada pelo Conselho Diretor da AGETRANSP em SessĂŁo RegulatĂłria OrdinĂĄria realizada no dia 28 de fevereiro de 2012. CONCESSĂƒO METROVIĂ RIA DO RIO DE JANEIRO S/A

MinistĂŠrio de Minas e Energia

AVISO DE ADIAMENTO Tomada de Preços nÂş GAA.A/TP-061/12 A ELETROBRAS ELETRONUCLEAR torna pĂşblico que a data para entrega e abertura dos envelopes de proposta da licitação supracitada, cujo objeto ĂŠ a prestação de serviços de reforma do piso, confecção de bancadas e divisĂłrias de granito para instalação no antigo EdifĂ­cio de Soda CĂĄustica nas dependĂŞncias GD8QLGDGHGD&HQWUDO1XFOHDU$OPLUDQWHĂˆOYDUR$OEHUWRÂą&1$$$ÂżFDDGLDGD para o dia 16 de março de 2012, Ă s 15h00. Os demais termos e condiçþes permanecem inalterados. JosĂŠ Paulo Franco de Aguiar Gerente de Aquisiçþes Angra

MinistĂŠrio de Minas e Energia

PETROBRAS DISTRIBUIDORA S.A. CNPJ 34.274.233/0001-02 NIRE 33300013920

ASSEMBLEIA GERAL ORDINà RIA Edital de Convocação O Conselho de Administração da PETROBRAS DISTRIBUIDORA S.A. convoca os Senhores Acionistas a se reunirem em Assembleia Geral Ordinåria, às 10 Horas do dia 14 de março de 2012, na Sede da Sociedade, localizada na Rua General Canabarro, nº. 500, Maracanã, na Cidade do Rio de Janeiro, no Auditório do 7ºDQGDUD¿PGHGHOLEHUDUVREUHDVHJXLQWHRUGHPGRGLD I.

,, ,,, ,9 9 9,

Tomada de contas dos administradores, bem como o exame, discussão e YRWDomRGDVGHPRQVWUDo}HV¿QDQFHLUDVFRUUHVSRQGHQWHVLQFOXLQGRDDQiOLVH GRV VHJXLQWHV GRFXPHQWRV 5HODWyULR GD $GPLQLVWUDomR 'HPRQVWUDo}HV Contábeis e Parecer do Conselho Fiscal relativos ao exercício de 2011; 2UoDPHQWRGH&DSLWDOSDUDRH[HUFtFLRGH 'HVWLQDomRGR5HVXOWDGRGR([HUFtFLRGHH'LVWULEXLomRGRV'LYLGHQGRV (OHLomRGRVPHPEURVHIHWLYRVGR&RQVHOKR)LVFDOHUHVSHFWLYRVVXSOHQWHV (OHLomRGRPHPEURUHSUHVHQWDQWHGRVHPSUHJDGRVQR&RQVHOKRGH$GPLQLVWUDomR )L[DomRGDUHPXQHUDomRGRV$GPLQLVWUDGRUHVHGRVPHPEURVHIHWLYRVGR &RQVHOKR)LVFDOEHPFRPRGDSDUWLFLSDomRQRVOXFURVQDIRUPDGRVDUWLJRV HGR(VWDWXWR6RFLDOGD%5 Rio de Janeiro, 09 de fevereiro de 2012 Guido Mantega Presidente do Conselho de Administração


A-14

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

Marcia

A arte nasce sempre de alguma paixão. Fernando Pessoa

PELTI ER

www.marciapeltier.com.br

mpeltier@jcom.com.br

www.facebook.com/marciapeltier

www.twitter.com/@PeltierMarcia

COM MARCIA BAHIA, CRISTIANE RODRIGUES, MARCIA ARBACHE E GABRIELA BRITO MARCO RODRIGUES/DIVULGAÇÃO

AÇÃO IVULG TES/D A PON IC N ERÔ S DE V FOTO

Influência verde e rosa

Salve elas

Vai se chamar Primera Escuela de Samba de San Luis, com 500 componentes, todos eles argentinos, a primeira agremiação carnavalesca nascida na terra de Gardel. Ela desfilará cantando um samba em português no evento que acontecerá pela terceira vez no autódromo de Potrero de Los Funes, dias 9 e 10, e que terá, também, duas escolas formadas por mil cariocas, cada. Como a quantidade de mangueirenses que as integra é grande, dizem que a escola hermana se inspirou na Estação Primeira para escolher seu nome.

José Wilker, Waldick Jatobá e a galerista Luciana Caravello

Tempo integral A festa argentina já representa o maior faturamento econômico e turístico da província. Por isso, até o hábito da siesta será abolido nesses dois dias. O comércio, que costuma fechar das 13h às 17h, ficará aberto até as 22h para atender aos turistas. A produtora do evento é a Gangazumba, de Antônio Pitanga.

Rock eternizado Roberta Medina está cheia de projetos para as próximas edições do Rock in Rio. O primeiro deles será lançado durante o festival de Lisboa, que agita Portugal em maio. Trata-se do lançamento do livro Eu Fui, com depoimentos de artistas, episódios inusitados dos fãs e fotos de bastidores captadas pelo público.

O projeto Roteiros Geográficos do Rio promoverá, no Dia Internacional da Mulher, quinta-feira próxima, um passeio especial. Serão percorridos pontos em que a presença feminina tornou-se um marco na capital. Estão na rota as escolas Anna Nery, de enfermagem, e Tia Ciata, que reunia sambistas em sua casa, na Praça Onze. Não faltará nem mesmo a extinta área de prostituição do Mangue. “O busto de Chiquinha Gonzaga no Passeio é a única referência que temos de mulheres que se destacaram na cidade’’, diz João Baptista de Mello, coordenador do projeto.

ndo Ferna ntro, a t s i O ar t na, ao ce a Camp graça com e faz feld la Ha m Danie shihama e e, I g a e s Felip de vernis noite Ipanema em

Humberto Campana recebeu Patricia Fainziliber na abertura da exposição Arte de sentar com arte, na Galeria Luciana Caravello Arte Contemporânea

Em campanha Nesta quinta-feira, Manoel Dias, secretário-geral do PDT, conseguiu o apoio da UGT, da Nova Central e de antigos militantes da CGTB à sua indicação para o Ministério do Trabalho. O fundador do PDT já contava com o apoio da Força Sindical e do presidente da CUT, Artur Henrique. Há uma semana, Carlos Lupi visitou Lula, que intercedeu pelo nome de Maneca junto a Dilma Rousseff. Mas continua faltando o principal: a presidente decidir nomeá-lo.

Figuraça Jack Bender, o diretor das séries Lost, Família Soprano e Alcatraz, que abriu, quarta, o Rio Content Market, passou ontem o dia na área reservada do fórum, no Windsor Barra, jogando conversa fora e pintando(!). Quem viu a tela depois de pronta disse se tratar de uma paisagem carioca. É que Bender chegou ao Rio sexta passada, já circulou muito pela cidade e assistiu até ao Desfile das Campeãs no camarote da Prefeitura. Durante sua palestra, Bender também pintou um quadro.

Túlio Mariante com o casal Carlos Alberto e Silvia Chateaubriand

Procura-se

Danie nada la Maia e A co n ve n c i o n n a L u i za R al, fe ego s e it p e l o s a co m b i c d i ve r t e m co ho irmão s Ca m s d e p e l ú m a c a d e ir cia, a pana ssinad a a

Um grupo de empresários do Rio já finalizou o acordo com os paulistas para usar a marca do restaurante Figueira Rubaiyat por aqui. A procura pelo espaço no Rio de Janeiro está a todo vapor. A ideia é iniciar as obras ainda neste ano, mas a casa só deve funcionar para valer em 2013. A casa carioca deverá ter vista para o mar, parede e teto de vidro, além de estacionamento cercado de verde.

Arte e design Com iluminação de Maneco Quinderé, ambientação do cenógrafo croata Marko Brajovic e curadoria de Waldick Jatobá, o vernissage da exposição das 11 cadeiras assinadas pelos irmãos Campana, quartafeira, lotou a galeria de arte de Luciana Caravello, em Ipanema. A presença mais inusitada foi a do empresário Naji Nahas, que veio de São Paulo no jatinho da publicitária Silvana Tinelli. Ele fez a reserva de um banco de vime. Outras quatro peças também foram reservadas. Os preços variam de R$ 19 mil a R$ 120 mil.

Pela segurança Está marcada para os próximos dias uma reunião entre representantes da Confederação Nacional dos Dirigentes Lojistas e o senador Paulo Bauer (PSDB-SC). O parlamentar é o autor projeto de lei que propõe liberar pela internet o acesso dos consumidores às informações do SPC Brasil e Serasa. Para os lojistas, o projeto facilitará a ação de terceiros que poderão usar as informações para constranger devedores. Hoje, o acesso virtual a esses dados é feito através de uma senha única, impressa na correspondência enviada ao consumidor inadimplente.

O casal Vanda Klabin e Paulo Bertazzi

Miúcha e Georgiana de Moraes à vontade Verônica Nieckele e Edgar Moura Brasil

Mal-estar No começo, os convidados ficaram receosos de sentar nos móveis. Mas, depois que os artistas pediram para que as obras fossem experimentadas, as filas foram formadas. Humberto Campana, no entanto, não pôde desfrutar do sucesso por muito tempo. Por causa do calor, o paulista passou mal e voltou para o hotel.

L I V R E O Liceu Literário Português está com inscrições abertas para dois cursos gratuitos em março. A partir do dia 13 o professor Arno Wehling ministra o curso de extensão Questões da História Moderna: Rupturas e Continuidades. No dia 14 começa o curso Problemáticas de Pesquisa e Ensino em História do Brasil Contemporâneo, ministrado pelos professores e doutores Cláudia Affonso e Jayme Lúcio. A grife carioca Lucci apresenta sua linha de festa, nesta sexta-feira, na loja do Fashion

Mall. A estilista Ana Carolina Vilela aposta nos bordados finos, nos plissados e em longos e curtos em renda. O grupo Galo Preto faz uma homenagem a Nelson Cavaquinho neste sábado, na Livraria Arlequim, no Paço Imperial. O blog rioetc lança a coleção Encantos mil, em homenagem aos 447 anos do Rio, nesta sexta, com happy hour na Kalimo, em Ipanema. Várias marcas cariocas como Farm,

A C E S S O Cantão, Blue Man e Totem desenvolveram camisetas que serão vendidas por R$ 89. Vinte por cento do valor arrecadado será doado para a ONG Urece. A DJ Mary Olivetti anima a festa Verão Lev 2012, domingo, nas areias do Leblon, das 10h às 20h, em frente à General Artigas. Luiz Carlos Miele comanda, nesta sexta, evento comemorativo dos 65 anos do Laboratório Richet.

 O aniversário de Dea Liao será comemorado, nesta sexta, no restaurante Garden, com almoço oferecido por suas netas Maria Isabel e Cecília Paes de Carvalho, e a filha Lílian Castro. O Boticário acaba de disponibilizar o livro O Boticário Maquiagem by Fernando Torquatto para iPad. A ferramenta também permite testar maquiagem virtual em fotos, aprender a se maquiar por meio de passo a passo e ainda compartilhar o resultado com as amigas.


cyan magenta amarelo preto

O Rio de Janeiro no radar dos executivos

Nanorobôs contra células cancerígenas

Consequência direta do momento econômico do estado, o Rio se transformou no oásis para os executivos. Em busca de mão de obra, as empresas oferecem salários compatíveis o que fazem com que profissionais retornem do exterior, conta Carlos Contar (foto). B-12

Equipe de Harvad usa moléculas humanas para criar equipamento em escala nanométrica capaz de combater tumores cancerígenas. Com o uso do equipamento, a esperança é que no futuro o diagnóstico ocorra logo no início da doença, e o tratamento seja imediato, a ponto de o paciente, às vezes, nem sequer saber que havia algo de errado dentro de si. B-5

Seudinheiro

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

AÇÕES - Sem notícias ruins da Europa e com queda do desemprego nos EUA, commodities em alta e sinais de juros mais baixos, Ibovespa fecha próximo dos 67 mil pontos, em dia de ganhos para Vale e Petrobras

Bolsa na máxima desde abril estimativa dos analistas era de que o número ficasse em 355 mil, segundo pesquisa Bloomberg, o menor em quatro anos.

DA REDAÇÃO

E

m dia de cenário positivo no exterior – sobretudo em relação à Europa, onde os mercados trabalharam com visão mais otimista após a operação de liquidez do Banco Central na véspera –, a Bovespa ficou à vontade para um dia de ganhos expressivos e atingiu o melhor fechamento desde 26 de abril do ano passado. O Ibovespa fechou em alta de 1,52%, aos 66.809,80 pontos. Na máxima do dia (66.931 pontos +1,7%), o índice encostou no patamar dos 67 mil pontos. A mínima do dia foi de 65.812 pontos (0,00%). No ano, o ganho acumulado subiu para 17,72%, o que quase anula a perda de 18,11% registrada em todo o ano passado. O volume financeiro da sessão atingiu R$ 6,437 bilhões. Operadores reportaram que investidores estrangeiros vieram às compras na sessão de quinta-feira após embolsar parte dos ganhos em fevereiro. A deixa para o movimento foi dada na véspera, após o Banco Central Europeu (BCE) informar que emprestou 529,23 bilhões de euros em

sua operação de refinanciamento com prazo de três anos, injetando liquidez no sistema bancário. A Associação Internacional de Swaps e Derivativos (ISDA) decidiu que não houve evento de crédito na reestruturação da Grécia e, por isso, os pagamentos dos swaps de default de crédito (CDS) não serão acionados. IOF. Logo cedo, o governo também animou os investidores, ao anunciar que passou a isentar os BDRs (Brazilian Depositary Receipts) de IOF nas liquidações de operações de câmbio contratadas

por investidor estrangeiro, corrigindo um erro. O governo também informou que estendeu para três anos a alíquota do IOF de 6% cobradas sobre os empréstimos externos. Em abril do ano passado, o prazo já havia sido estendido de 360 para até 720 dias. A mudança vale a partir de hoje e visa conter a valorização do real, além de ser vista como mais um passo em direção a juros mais baixos. Houve também alívio por não ter sido considerado, segundo o governo, taxar os investimentos em ações. "Há tempos o governo vem

Momento é de consumo

adotando medidas e sinalizando que o investimento direto, aquele que gera riqueza, é bem vindo e que tem instrumentos para coibir o capital especulativo", disse o gerente de renda variável da Concórdia Corretora, Romeo Vidali, explicando que a notícia foi considerada positiva pelo mercado. Para completar o panorama propício para as compras de ações, o número de americanos que entrou com pedido de auxílio-desemprego na semana de 25 de fevereiro caiu 2 mil, para 351 mil, segundo o Departamento de Trabalho. A

BLUE CHIPS. Depois de um fevereiro de perdas, Vale e Petrobras foram as maiores responsáveis pela alta do Ibovespa na primeira sessão de março. As blue chips locais acompanharam as commodities e subiram. Vale ON ganhou 1,15%, a R$ 44,05, e PNA, 1,06%, a R$ 42,95. Já as ações da Petrobras aceleram o movimento perto do fechamento, com a ON encerrando o dia com ganhos de 1,95%, a R$ 26,20, e a PN em alta de 2,34%, a R$ 24,88, após a rede de notícias iraniana Press TV afirmar que oleodutos na cidade de Awamiyah, na Arábia Saudita, foram atingidos por uma explosão, sem divulgar mais detalhes sobre o assunto. Awamiyah fica na Província do Leste, região onde estão os principais campos petrolíferos sauditas. A notícia fez o preço do petróleo no mercado after hours acentuar os ganhos do dia. A outra petroleira do Ibovespa, a OGX, também subiu na esteira da notícia, fechando em alta de 1,06%, a R$ 17,18. (Com agências)

BOLSAS PELO MUNDO DA REDAÇÃO

S&P vence resistência importante

EUA

REBECCA MELLO

A proximidade da reunião do Copom – que deve diminuir a taxa básica de juros – beneficiou as ações atreladas ao consumo na sessão de quinta-feira, especialmente as dos setores de varejo e construção. Na construção civil, Cyrela avançou 5,14%, a R$ 18,21; PDG evoluiu 2,86%, a R$ 7,55 e MRV ganhou 2,02%, a R$ 14,13. Para Fernando Goes, analista da Octo Investimentos, os papéis das construtoras têm sido destaques na retomada da Bolsa, beneficiadas principalmente pela queda de juros. “Ainda têm bastante espaço para ganhos. Acredito que a política de redução da Selic irá permanecer. PDG, MRV, Rossi e Brookfield são minha preferência”, destacou Goes. Gafisa é o “patinho feio” do setor, segundo o analista.. “O mercado detesta incerteza”, lembra. Completando o desempenho de quinta-feira, Brookfield se elevou 1,69%, a R$ 6,61; Gafisa subiu 1,67%, a R$ 4,86 e Rossi fechou em alta de 0,29%, a R$ 10,32. Ratificando a sessão positiva para os papéis atrelados ao consumo doméstico, Hypermarcas ON galgou 3,76%, a R$ 11,60; Natura ON se apreciou 3,11%, a R$ 41,75 e BR Malls

ON subiu 2,77%, a R$ 22,62. O analista da Octo considera as ações de consumo ótimas opções para compra em março. “Prefiro Lojas Americanas, Pão de Açúcar e Hering, que ainda apresentam espaço para ganhos. O papel da B2W pode ter uma correção forte, apesar de ser uma aposta arriscada, já que a empresa ainda enfrenta algumas dificuldades”, diz Goes. Pão de Açúcar PN subiu 0,25%, a R$ 79,80; Lojas Americanas PN fechou no zero a zero, a R$ 18,30 e B2W ON recuou 4,27%, a R$ 10,53. A ação ordinária da JBS registrou um desempenho espetacular na sessão de quintafeira e disparou 10,14%, a R$ 8,04. De acordo com o analista Leonardo Zanfelicio, da Concórdia Corretora, a alta do papel não esteve ligada a nenhum fundamento que explicasse uma valorização tão brusca. “O maior comprador da ação foi a Bradesco Corretora, que também não apresentou uma justificativa”, disse Zanfelicio. BALANÇO. Na contramão das varejistas, Hering ON perdeu 2,21%, a R$ 45,17. A companhia divulgou os números referentes ao quarto trimestre de 2011 na quarta-feira após o fechamento, com avanço de

40,2% no lucro líquido, a R$ 297,3 milhões. O balanço dividiu opiniões de analistas. Guilherme Assis, da Raymond James, rebaixou a recomendação do papel de outperform para market perform por conta dos números. Por outro lado, a Concórdia Corretora apreciou o resultado. “O modelo de crescimento baseado em franquias tem sido muito bem sucedido, haja vista que por mais um ano, todas as marcas da empresa registraram crescimento acima de 20% nas receitas brutas. Recomendamos a ação e estamos revisando a projeção para o preço alvo”, disse a corretora, em relatório. Klabin PN subiu 0,7%, a R$ 8,60. A cotação do papel foi a uma cotação recorde desde pelo menos agosto de 1994 após a produtora de papel e celulose registrar lucro líquido maior que o esperado. O número do quarto trimestre de 2011 veio em queda de 46%, para R$ 122 milhões, contra estimativa média de seis analistas consultados pela Bloomberg de R$ 90,63 milhões. “O resultado veio um pouco melhor que a perspectiva e o papel acabou refletindo também a alta da bolsa”, disse Pedro Galdi, analista chefe da SLW Corretora. (Com agências)

As principais bolsas dos Estados Unidos fecharam em alta na quintafeira, voltando às máximas desde 2008, após um salto em ações de bancos e novos dados positivos do mercado de trabalho do país, apesar de fortes ganhos nos preços do petróleo. O índice Dow Jones avançou 0,22%, para 12.980 pontos. O Standard & Poor's 500 teve valorização de 0,62%, para 1.374 pontos. O Nasdaq subiu 0,74%, para 2.988 pontos. Após as perdas de quarta-feira, a recuperação levou o S&P 500 a superar novamente o nível de resistência de 1.370 pontos, algo visto como crucial para a continuidade do rali, que já dura cinco meses. As ações de bancos estiveram entre as de melhor performance do dia, com esperanças de que a segunda injeção de dinheiro pelo Banco Central Europeu (BCE) alivie a crise financeira da região.

EUROPA As bolsas europeias fecharam em alta na quinta-feira, com os investidores ainda animados com o resultado da operação, realizada na quarta-feira, de refinanciamento de longo prazo do Banco Central Europeu (BCE). Também colaborou para o otimismo europeu uma decisão da Associação Internacional de Swaps e Derivativos (ISDA, na sigla em inglês) sobre os swaps de default de crédito (CDS, na sigla em inglês) da dívida soberana da Grécia. Os ganhos foram contidos pelos números fracos da atividade industrial nos Estados Unidos. Na Bolsa de Frankfurt, o índice DAX subiu 1,25%; em Londres, o FTSE avançou 1,02%; Paris subiu 1,37%. Vivendi caiu 10% após avisar que seu lucro pode ficar prejudicado até 2014.

ÁSIA A maioria dos mercados asiáticos apresentou queda. O desempenho das bolsas da região foi afetado pelas declarações de quarta-feira do presidente do Federal Reserve, Ben Bernanke, de que o crescimento dos EUA continua " instável”diminundo a possibilidade de um novo programa de estímulo norte-americano. A Bolsa de Seul permaneceu fechada em razão de feriado. Tóquio registrou baixa modesta. Uma abrupta valorização do iene prejudicou as ações sensíveis ao câmbio, tais como Sharp, que desabou 3,1%. O Nikkei perdeu 0,2%. A Bolsa de Xangai, na China, encerrou estável. O Xangai Composto caiu apenas 0,1%, enquanto o Shenzhen Composto ganhou 0,4%. Hong Kong perdeu mais (-1,4%). Taiwan caiu somente 0,04%, mas Sydney retrocedeu 1%.

EDITOR // DIRLEY FERNANDES

Jornal do Commercio

B-1

■ JUROS FUTUROS

DIs indicam corte maior na Selic DA REDAÇÃO

Os investidores em juros futuros continuam dando tração às apostas em um corte de maior magnitude da taxa Selic na reunião do Copom que termina na quarta-feira. As especulações são de que o BC poderia usar o corte da taxa básica para ajudar a conter o real. Embora tal movimento não seja majoritário, pode ganhar espaço nos próximos dias com a aproximação do encontro de política monetária. “Desde ontem surgiram essas especulações”, disse Luciano Rostagno, do WestLB. “O mercado está vendo que o governo prioriza o crescimento.” As declarações do ministro da Fazenda, Guido Mantega, e da presidente Dilma Rousseff em relação ao aumento da liquidez internacional, e a própria elevação do IOF para empréstimos externos – combinação vista como reação à operação de liquidez de longo prazo (LTRO) do Banco Central Europeu (BCE) – abriram espaço para que os agentes de mercado passassem a forçar mais a queda das taxas nos prazos mais curtos, com expectativa de que o BC possa fazer cortes mais intensos da Selic para contribuir no esforço de evitar valorização adicional da moeda brasileira. O DI janeiro de 2013 recuou para 9,15%, ante 9,23% no ajuste, enquanto o DI janeiro de 2014 desceu a 9,68%, de 9,73% na véspera. O DI janeiro de 2017 marcou 10,83%, de 10,82%, e o DI janeiro de 2021, como na véspera, melhorou o prêmio, fechando na máxima de 11,26%, de 11,22%. (Com agências)

■ TÍTULOS PÚBLICOS

Tesouro lança NTN-F com vencimento em 2023 ADRIANA FERNANDES DA AGÊNCIA ESTADO

O Tesouro Nacional informou nesta quinta-feira que realizará na próxima quinta-feira a primeira oferta pública da NTN-F – título prefixado – com vencimento em 1o de janeiro de 2023. O papel será o novo benchmark prefixado de dez anos no mercado doméstico. Segundo o Tesouro, o novo título tem como objetivo "consolidar a referência de 10 anos na curva prefixada e aumentar a diversificação de investidores para este prazo, indo ao encontro das diretrizes de melhoria da composição e alongamento da dívida pública". AS NTN-Fs com vencimento para janeiro de 2011, oferecidas por meio do Tesouro Direto, pagavam na quinta-feira juros de 11,34% ao ano.


cyan magenta amarelo preto

MERCADOS B-2

EDITOR // DIRLEY FERNANDES

Jornal do Commercio

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

CÂMBIO - Apesar de dois leilões do BC ao longo da sessão e do aumento da taxação para empresas que trazem capital do exterior, moeda retomou o rumo das baixas

Dólar não reage a alta do IOF e cotação cai 0,47% DA REDAÇÃO

O

dólar fechou em queda ante o real a sessão de quinta-feira, ignorando uma medida do governo para estancar a espiral de desvalorização da moeda, em mais um dia de intervenção dupla do Banco Central no mercado. A taxa de câmbio recuou 0,47%, para R$ 1,71 na compra e R$ 1,712 na venda, revertendo parte do salto de 1,25% na véspera. Ao longo da sessão, a divisa oscilou entre máxima de R$ 1,727 e a mínima de R$ 1,710. O euro comercial perdeu 0,17%, negociado a R$ 2,28 na compra e a R$ 2,282 na venda. O governo decidiu aumentar de dois para até três anos o prazo de incidência de alíquota do Imposto sobre Operações Financeiras de 6% para empréstimos de empresas no exterior. Em 2012, até aqui, empresas brasileiras já levantaram cerca de US$ 18 bilhões com a venda de bônus no exterior. Nenhum dos títulos têm prazo de vencimento inferior a cinco anos. A medida visa reduzir o ingresso de mais dólares, cuja cotação em relação ao real chegou a ficar abaixo de R$ 1,70 nesta semana. "Hoje (quinta-feira), prevaleceu aquela máxima: sobe no boato, cai no fato. E o fato foi bem menos assustador", disse o diretor de tesouraria do Banco Prosper, Jorge Knauer. Na véspera, uma fonte da equipe econômica disse à agência Reuters que o governo analisa a possibilidade de voltar a taxar investimentos estrangeiros em ações no Brasil, com o intuito de proteger o mercado brasileiro das fortes

TAXAÇÃO DE EMPRÉSTIMOS EXTERNOS

Para analistas, efeito é pequeno DA REDAÇÃO

Alfredo Barbutti, economista da Liquidez, não acredita que o mercado de câmbio reagirá ao anúncio do ministro Guido Mantega de que o governo poderá tomar novas medidas para segurar a alta do real.“A medida adotada é inócua e a fala do ministro não acrescentou nada”, disse. “As captações são feitas por prazos de cinco a dez anos. O ministro disse que não vai taxar o IED e há uma expectativa positiva em termos de investimentos.” Para o operador Ovídio Pinho Soares, da corretora Interbolsa Brasil, disse que as expectativas de novos ingressos de recursos estrangeiros no País vão continuar sustentando a tendência de baixa do dólar ante o real. "A medida da Fazenda até poderá vir a ter algum efeito sobre a formação de preço do dólar em médio prazo, em quatro a cinco meses, porque no curto prazo não teve impacto, já que é uma ação paliativa". Para ele,

oscilações cambiais. Segundo a fonte, a decisão de voltar a taxar essas operações ainda não foi tomada e, se ocorrer, não deve ser no curto prazo. O governo voltou a afirmar que continuará agindo para conter uma valorização excessiva do real. A palavra mais forte veio da presidente Dilma Rousseff, que criticou as políticas monetárias expansionistas adotadas por países desenvolvidos para enfrentar a atual crise econômica internacional, causadoras, segundo ela, de um "tsunami monetário". Em outra frente, o ministro da Fazenda, Guido Mantega, sustentou que o governo continuará tomando novas medi-

o governo deveria ampliar o prazo de incidência de IOF sobre empréstimos no exterior com prazos entre cinco e dez anos, em vez de apenas três anos. "Os grandes emissores de bônus corporativos no exterior estão internalizando os recursos captados e também há o fluxo de recursos mundial rumo aos Brics. Essa migração de dinheiro para cá sustenta a trajetória descendente do dólar", avalia Soares. "Esse sinal não intimida o mercado, mas deixa os agentes financeiros de certa forma na defensiva", explicou. O estrategista Tony Volpon, da Nomura Securities, disse que o governo brasileiro tem se esforçado para conseguir diferenciar o capital especulativo do produtivo, num jogo de "gato e rato". "Todo mundo sabe que há empresas mascarando Investimento Estrangeiro Direto (IED) para evitar juros", disse, em referência a multinacionais que enviariam dinheiro às subsidiárias brasileiras para aplicações, mas como se fosse IED. (Com agências)

das para impedir a valorização excessiva do real frente ao dólar. "A medida em si não é significativa. Então, há um impacto marginal, mas nada significativo. (Mas) ela manda um sinal de que o governo está pronto para fazer algo mais severo se quiser", afirmou o economista do Standard Chartered Bank para América Latina Italo Lombardi. Os mais de US$ 12,5 bilhões que ingressaram ao Brasil desde o início do ano, em parte devido às políticas expansionistas de países desenvolvidos, ajudaram o dólar a tombar 8,38% desde janeiro, o levando a rondar o patamar considerado "piso informal" pelo BC, na ava-

liação do mercado. Desde o início do mês, o BC voltou a comprar dólares nos mercados. Nesta quinta-feira, a autoridade monetária fez mais dois leilões de compra de moeda, na sétima sessão consecutiva de intervenção, que também vem contando com operações nos mercados a termo e leilões de swap cambial reverso. O dólar turismo caiu 0,95%, cotado a R$ 1,653 na compra e a R$ 1,773 na venda. O euro turismo se desvalorizou 2,175 na compra e a R$ 2,365 na venda. No exterior, o euro mantinha cotação estável em relação ao dólar, sendo negociado a US$ 1, 1.331 (-0,09%). (Com agências)

■ FISCALIZAÇÃO

CVM conta com Eagle na caça aos insiders MARIANA DURÃO E SABRINA VALLE DA AGÊNCIA ESTADO

Está aberta a temporada de caça a insiders e adeptos de outras práticas ilícitas no mercado de capitais. A Comissão de Valores Mobiliários (CVM) começou a operar um sistema de filtro que promete dar mais munição para a investigação e combate dessas condutas pelo regulador brasileiro. Batizado de Eagle, o software foi encomendado à empresa italiana SIA em dezembro de 2010. A perspectiva era de que entrasse em operação em meados do ano passado, mas o corte de orçamento pelo governo federal atrasou o cronograma do projeto. A CVM já investiu R$ 6,1 milhões, 50% na ferramenta e outros 50% em infraestrutura. A ferramenta só entrou no ar nos últimos dias de dezembro, após uma série de testes. Em fevereiro, uma nova versão passou a ser utilizada e outra atualização deve ocorrer em maio, para aperfeiçoamento do sistema. Baseado em algorítimos, o Eagle vai permitir ao xerife do mercado o acompanhamento em tempo real da negociação de ações, debêntures e derivativos na BM&FBovespa e na Cetip. A estimativa é de que possam ser analisadas cerca de um milhão de transações por dia. Só não entram no pacote títulos públicos, cujo monitoramento é do Banco Central. Os dados coletados serão armazenados e cruzados para confirmar suspeitas de manipulação de mercado, movimentações atípicas e jogadas financeiras ilegais difíceis de detectar. A CVM poderá, por exemplo, fazer a ligação entre uma informação plantada no mercado por um investidor e a posterior ordem de compra e venda de ações dada por ele para se beneficiar da valorização dos papéis. "Teremos mais material que dará segurança suficiente para pedir uma ordem judicial de quebra de sigilo telefô-

nico, por exemplo. Poderemos fortalecer as provas num eventual processo e identificar um padrão de negociação do mercado. O sistema vai melhorar nossa pontaria", disse a presidente da CVM, Maria Helena Santana. De acordo com a Pesquisa Global sobre Crimes Econômicos 2011, da PwC, a prática de insider trading no Brasil já representa 15,8% dos crimes econômicos no País, ocupando a quarta posição no ranking. O percentual é similar ao do México (15,9%) e inferior ao da Venezuela (22,7%) e Equador (50%). Globalmente, o índice de informação privilegiada é de 6,2%. De 2000 a 2010 a CVM registrou 39 processos por insider trading, dos quais 24 já foram julgados. Pela lei brasileira, o uso indevido de informação privilegiada pode resultar em prisão de um a cinco anos. Já o crime de manipulação de mercado – manobras fraudulentas para alterar cotações – tem pena de até oito anos. No entanto, ninguém foi preso por esses crimes no Brasil. Além de monitorar os passos de emissores, administradores e acionistas, também passarão pelo superfiltro notícias, relatórios de análise e mais documentos que possam influenciar o sobe e desce das ações. Segundo a autarquia, a ideia de contratar o sistema veio junto com o crescimento do mercado brasileiro e as dificuldades impostas à supervisão de um grande volume de operações. "A grande vantagem está no ganho de capacidade de processamento de um grande volume de informações obtidas em fontes diversas, de forma a imprimir rapidez, agilidade e maior confiança nos resultados", disse a CVM por meio de nota. Essa é mais uma tentativa do órgão regulador de reduzir a sensação de impunidade em relação a esses crimes. Em 2010, a CVM fechou convênios com a Polícia Federal e o Ministério Público Federal.

CURTA PETRÓLEO AVANÇA MAIS, PARA US$ 108,84 Os preços dos contratos futuros do petróleo fecharam em alta, com preocupações com a possibilidade de um agravamento na tensão entre o Irã e os EUA resulte em problemas de fornecimento da commodity. Após o fechamento, o petróleo subiu ainda mais e superou US$ 110 por barril, reagindo à notícia de que um oleoduto foi destruído por uma explosão na Arábia Saudita. Os sauditas negaram a informação e os preços recuaram. O contrato do petróleo para abril negociado na New York Mercantile Exchange (Nymex) subiu US$ 1,77, ou 1,65%, para US$ 108,84 por barril, mas após a notícia da explosão do oleoduto tocou um pico de US$ 110,55. Na plataforma ICE, o contrato do petróleo para abril avançou US$ 3,54, ou 2,88%, para US$ 126,20 por barril.

www.jornaldocommercio.com.br ASSINATURA EXECUTIVA (2ª A 6ª) Pagamento Semestral Anual À Vista R$ 277,00 R$ 554,00 2 Vezes R$ 138,50 R$ 277,00 3 Vezes R$ 92,33 R$ 184,67 4 Vezes R$ 69,25 R$ 138,50 5 Vezes R$ 55,40 R$ 110,80 6 Vezes R$ 92,33 7 Vezes R$ 79,14 8 Vezes R$ 69,25 9 Vezes R$ 61,56 10 Vezes R$ 55,40 11 Vezes R$ 50,36

ASSINATURA DIGITAL Pagamento Semestral À Vista R$ 205,00 2 Vezes R$ 102,50 3 Vezes R$ 68,33 4 Vezes R$ 51,25 5 Vezes R$ 41,00 6 Vezes 7 Vezes 8 Vezes 9 Vezes 10 Vezes 11 Vezes

ASSINATURA IMPRESSA Pagamento Mensal À Vista R$ 46,50

Pagamento Mensal À Vista R$ 35,00

Anual R$ 410,00 R$ 205,00 R$ 136,67 R$ 102,50 R$ 82,00 R$ 68,33 R$ 58,57 R$ 51,25 R$ 45,56 R$ 41,00 R$ 37,27

PREÇO DO EXEMPL AR EM BANCA: R$ 2,50 (R J, SP e DF) CENTRAL DE ATENDIMENTO E VENDAS: 0800-0224080


EMPRESAS

EDITORA // MARTHA IMENES

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

B-3

ENERGIA - Empreendimentos, no Rio Grande do Norte, foram construídos com turbinas com 60% de conteúdo local, produzidas pela GE, e demandaram investimento total de R$ 120 milhões. Companhia quer entrar no mercado de energia solar

Bioenergy inaugura 2 parques DIVULGAÇÃO

Bioenergy inaugurou, na quinta-feira, os parques eólicos de Miassaba 2 e Aratuá 1, em Guamaré, no Rio Grande do Norte. Com capacidade total de 28,8 megawatts (MW ), os empreendimentos são construídos com turbinas com 60% de conteúdo local – produzidas pela GE, e demandaram investimento total de R$ 120 milhões. O Miassaba 2 é o primeiro do País a ter toda a sua produção vendida no mercado livre, diretamente para a Cemig, em contrato com duração de 20 anos. O presidente da Bioenergy, Sérgio Marques, afirma que a intenção é de que empreendimentos futuros sigam modelo similar, também voltados para o mercado livre. “Colocar um parque eólico para fornecer energia no mercado livre era considerado heresia, mas agora estamos começando a ver eólicas mais baratas que hidrelétricas”, disse o executivo, dando como exemplo o leilão A-3, realizado em agosto do ano passado. Nele, a energia eólica saiu por R$ 99,57 MW/h, contra o preço médio de R$ 102,07 MW/h. De acordo com Marques, que não revelou o valor do contrato firmado com a estatal mineira, a tarifa foi possível devido ao fato do contrato ser de

longo prazo. O executivo afirma que o mercado tem se mostrado receoso em relação a contratos deste tipo, mas disse ter boas expectativas para o próximo leilão, a ser realizado em abril, onde a empresa oferecerá empreendimentos com contratos com prazo de 15 a 20 anos. “Temos 450 MW concorrendo, divididos em 15 parques eólicos no Maranhão.” Além deste projeto, a Bioenergy tem contratados 172,8 MW, no qual serão investidos R$ 620 milhões. Estes parques deverão estar operacionais até o fim do ano que vem, segundo Marques. A empresa recorrerá a financiamento para construir os novos aerogeradores. Apesar de considerar que o dinheiro obtido por meio de uma oferta pública de ações seja mais barato, o presidente da Bioenergy descartou a opção. “Vemos que este não é o momento, mas temos nossos balanços auditados externamente e buscamos a governança para agarrar esta oportunidade, caso ela surja.” Com o início de operação dos dois parques da Bioenergy, sobe para 18 o número das unidades já em operação no estado. A governadora do Rio Grande do Norte, Rosalba Ciarlini (DEM), aponta que 35% de toda a energia eólica autorizada a ser construída no País se encontra no estado. Se-

■ AQUISIÇÃO

■ PAPEL E CELULOSE

■ BNDES

Principal compra a gestora Claritas

Lucro da Klabin surpreende

BG Group negocia liberação de US$ 1,8 bi

FÁBIO TEIXEIRA*

A

DA AGÊNCIA REUTERS

A empresa norte-americana de investimentos Principal Financial Group acertou acordo para comprar 60% de participação na gestora brasileira de recursos Claritas, anunciaram as empresas nesta quinta-feira. O valor da operação não foi imediatamente divulgado. A operação marca a segunda "parceria de negócios" da Principal no Brasil. Desde 1999, a empresa tem oferecido soluções de previdência privada através da Brasilprev, sua operação em joint venture com o BB. A nova aliança estratégica com a Claritas oferecerá fundos de investimento e expertise em gestão de recursos, informaram as empresas em comunicado.

CURTA BR BROKERS ABOCANHA 65% DA MIRANDA A Brasil Brokers assinou contrato de aquisição de 65% da Miranda Imobiliária por um valor estimado de R$ 6,6 milhões. Desse valor, será pago um valor inicial de R$ 3 milhões, com restante sendo dividido em três parcelas anuais variáveis, calculadas em função dos resultados futuros. "A Miranda possui seis lojas no Distrito Federal e atua exclusivamente no mercado secundário", afirmou a BR Brokers na noite de terçafeira.

ELISA SOARES

Graças a um quarto trimestre brilhante, a Klabin fechou 2011 com desempenho acima do esperado pelo mercado, com a última linha do balanço, em azul, totalizando R$ 183 milhões. Apenas nos últimos três meses do ano, a companhia de papel e celulose registrou lucro líquido de R$ 122 milhões, frente a desempenho ruim no trimestre imediatamente anterior, quando teve prejuízo de R$ 243 milhões. O setor enfrentou um ano difícil, em virtude da crise da dívida nos países europeus e da valorização do real frente ao dólar, de 13% no ano, que facilitou a entrada de importados no País. Por isso, apesar da grande recuperação apresentada pela Klabin no final do ano, o lucro consolidado da empresa caiu 67% no consolidado do ano, na comparação com o exercício anterior. “O ano passado foi marca-

gundo ela, são cerca de 80 projetos, sendo que 60 já estão em processo de instalação. A Bioenergy também estuda entrar no mercado de energia solar. Segundo Marques, a empresa está com projetos de medição no Rio Grande do Norte, para conseguir uma estimativa do potencial gerador que a energia fotovoltaica teria na região. “Estamos investindo em licenciamento e medição para se houver a possibilidade, termos a capacidade para acessá-la.” Além do Rio Grande do Norte, a empresa tem estudado áreas na Bahia – conhecida por seu alto potencial eólico – e Minas Gerais. “Energia solar é a eólica de cinco anos atrás”, diz Marques. GENERAL ELECTRIC. A governadora convidou o executivo de negócios da GE na América Latina, Jean-Claude Robert, para a instalação de uma fábrica de aerogeradores no estado. “Não vai faltar incentivo fiscal.” A empresa tem, no momento, uma fábrica em funcionamento em São Paulo e um protocolo de intenção assinado com o governo da Bahia para mais uma unidade. Os 18 aerogeradores que compõem os parques de Miassaba 2 e Aratuá 1 são os primeiros com turbinas da GE instaladas no Brasil. O número deve aumentar em breve: até

do pela incerteza na economia mundial. No Brasil, o cenário econômico também repercutiu as instabilidades do mercado global e a demanda por papéis para embalagens não apresentou o crescimento que se esperava no final de 2010”, afirmou a empresa em balanço financeiro, divulgado na última quinta-feira. Para manter sua lucratividade em meio a um cenário adverso, a companhia reduziu custos, fez esforços de performance e financeiros e obteve aumento nas margens e retorno sobre seus ativos. A receita líquida da Klabin avançou 6% no ano passado em relação a 2010, para R$ 3,63 bilhões, sendo o mercado interno o responsável por 78% desse total. O forte peso da demanda doméstica nas operações da companhia, segundo analistas consultados pelo Jornal do Commercio, foi o que garantiu o desempenho da empresa no ano passado, melhor do que o esperado pe-

julho a GE entregará mais 184 turbinas para parques na Bahia e 91 para o Rio Grande do Norte. “O Brasil está com muito volume de pedidos”, disse Robert. A carteira de pedidos da GE no Brasil já soma 1,4 GW em capacidade até 2014. o fornecimento destes equipamentos deve gerar algo em torno de US$ 2 bilhões para a multinacional. Robert não descartou a possibilidade de uma unidade de produção no Rio Grande do Norte. Embora diga preferir focar no Brasil, por enquanto, o executivo diz que a GE olha com atenção para outros mercados na América Latina, especificamente o México. “Naquele país, o mercado para eólicas está hoje como estava no Brasil em 2009”, diz o executivo, fazendo referência ao ano do primeiro leilão exclusivo para energia eólica no País. “Temos tratado com atenção este mercado.” O executivo afirma ainda haver potencial para o desenvolvimento de energia eólica na Argentina. De acordo com ele, porém, a falta de financiamento ainda é um entrave. “Lá não tem BNDES (Banco Nacional de Desenvolvimento Econômico e Social), que é o órgão viabilizando quase todos estes projetos no Brasil.” *O repórter viajou a convite da GE

lo mercado e também de suas concorrentes, como a Fibria e a Suzano, que exportam celulose e encontram-se, portanto, mais expostas à crise internacional. O Ebitda ajustado (lucro antes de juros, impostos, depreciação e amortização), por sua vez, registrou R$ 1,02 bilhão no ano passado, aumento de 7% se comparado à 2010 e o maior volume apurado até então. No último trimestre, a geração de caixa da companhia avançou 30% na comparação com igual período do ano anterior, para R$ 319 milhões. A Klabin explicou, em seu balanço, que no terceiro trimestre de 2011 teve início um salto na performance da companhia, em consequência dos esforços para reduzir custos e da maior agressividade comercial adotada pela empresa no ínício do ano. Soma-se ao resultado apurado pelo Ebitda, ainda, a aquisição de participação na Florestal Vale do Corisco a partir de novembro,

Aerogeradores que compõem os parques têm turbinas da GE

que obteve R$ 2,2 milhões em venda de madeira, contabilizados no resultado financeiro da Klabin. ENDIVIDAMENTO. O endividamento bruto consolidado da companhia totalizou R$ 2,73 bilhões, frente a R$ 2,18 bilhões apurados em dezembro de 2010. O aumento foi influenciado, segundo a Klabin, pelo efeito de apreciação do câmbio sobre a parcela da dívida em moeda estrangeira, e pela aquisição da Vale Corisco. Atualmente, a relação entre dívida líquida e Ebitda é de 2,5 vezes. Para este ano, segundo analistas, a previsão para desempenho da Klabin são positivas, já que a companhia tem ativos apenas em papeis (voltados principalmente para embalagens), e por isso está menos exposta às variações nas economias internacionais. Além disso a área de atuação da companhia é muito vasta, o a que favorece.

■ LUBRIFICANTES

Cosan adquire a Comma Oil DA AGÊNCIA REUTERS

A Cosan comprou a Comma Oil and Chemicals buscando entrar no mercado europeu de lubrificantes e especialidades automotivas, em uma transação com valor inferior a US$ 100 milhões, já contabilizados potenciais ajustes, informou a companhia em comunicado nesta quinta-feira. Para facilitar a entrada da Cosan no mercado de lubrificantes da Europa, a Comma deve continuar a fabricar e

vender os produtos sob marca própria e de terceiros após a mudança de controle. A transição deve ser concluída até o terceiro trimestre deste ano, segundo o comunicado da Cosan. Com 215 funcionários, a Comma é subsidiária da EPCo e produz e distribui lubrificantes, anticongelantes, aditivos e outros produtos automotivos para o mercado europeu e asiático, principalmente sob a própria marca. "A aquisição da Comma in-

clui os negócios de lubrificantes acabados, fabricação de produtos químicos automotivos e vendas para terceiros, além de todos os ativos da companhia situados na planta de produção em Kent (Inglaterra) e as propriedades relacionadas à marca Comma", explicou a Cosan em comunicado ao mercado. Também serão assinados acordos para a Comma continuar a distribuir lubrificantes da marca Mobil e a produzir e distribuir às afiliadas da

ExxonMobil sua linha de produtos automotivos. "Nos próximos anos, um dos objetivos estratégicos da Cosan é diversificar e expandir os negócios internacionalmente. A aquisição da Comma é a nossa primeira operação na Europa, e trará, além do acesso ao mercado europeu, o conhecimento e expertise em produzir e distribuir produtos automotivos em outros países", afirmou o diretor-executivo, Nelson Gomes, em comunicado.

DA AGÊNCIA REUTERS

A BG Group deu entrada junto ao Banco de Desenvolvimento Econômico e Social (BNDES) para a liberação de empréstimo de até US$ 1,8 bilhão para financiar parte dos investimentos da empresa no desenvolvimento do pré-sal da Bacia de Santos. O empréstimo ainda está em trâmite dentro do banco e sujeito a aprovações adicionais e à conclusão de um acordo final, disse a BG em comunicado. O BNDES disse que não comenta operações que ainda não foram aprovadas por conta do sigilo bancário. Segundo a BG, os recursos serão para a aquisição e construção de oito plataformas flutuantes de produção, armazenamento e descarregamento de petróleo (FPSO). Em uma primeira fase, essas plataformas irão produzir 150 mil barris de petróleo por dia, mas o objetivo é atingir uma produção de 2,3 milhões de barris de óleo equivalente por dia de capacidade até 2017. A BG disse que espera finalizar com o BNDES os termos do acordo até o segundo trimestre de 2012, e espera um prazo de pagamento do financiamento em até 14 anos. O presidente da BG no Brasil, Fabio Barbosa, disse em nota que o financiamento de longo prazo do BNDES permitirá que a empresa avance em seu programa de crescimento global.


B-4

EMPRESAS

Jornal do Commercio

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

■ MERCADO

ABERTURA DE CAPITAL- Valor atual do banco estaria em torno de US$ 15 bi, o que o colocaria entre as 20 maiores companhias listadas em Bolsa no Brasil

BM&FBovespa não fará clearing em breve

BTG se firma entre grupos mais valiosos do País

A BM&FBovespa não pretende vender tão cedo serviços de clearing a eventuais companhias que queiram disputar com ela o mercado doméstico, segundo o diretor Financeiro e de Relações com Investidores da Bolsa paulista, Eduardo Guardia. "Estamos num processo de integração de clearings e de um novo modelo de risco, que vai terminar em 2014", afirmou. "Não tem o menor sentido parar o que estamos fazendo para conectar outras bolsas", complementou. Nos últimos meses, analistas têm mostrado preocupação que uma possível guerra de preços oriunda da entrada de novos players atinja as margens da BM&FBovespa. Em 2011, as bolsas norte-americanas Bats e Direct Edge anunciaram planos de entrar no mercado brasileiro. O modelo de negócios da BM&FBovespa hoje representa uma forte barreira à entrada de concorrentes. Isso porque ela concentra atividades de negociação e de clearing. Qualquer empresa que queira entrar nesse mercado teria que investir pesado para montar um modelo semelhante ou comprar os serviços de clearing da Bolsa brasileira. Atualmente, a Comissão de Valores Mobiliários (CVM) estuda mudanças na instrução que regula a atividade de bolsas no País, que deixa a critério da companhia a decisão de vender ou não seus serviços a terceiros. A BM&FBovespa deve concluir em 2013 um cronograma de investimentos de R$ 1,1 bilhão, que incorre na unificação de suas quatro clearings (ativos, câmbio, derivativos e ações) e na adoção de um novo modelo de risco. Segundo a companhia, isso lhe dará uma visão mais

JIN LEE/BLOOMBERG

te fragmentados. "Nossa função é fazer a máquina da economia funcionar ao máximo", disse Esteves, principal sócio do BTG e presidente do banco, a jornalistas recentemente. Numa de suas maiores tacadas, o BTG anunciou em janeiro de 2011 a compra do controle do Banco Panamericano por R$ 450 milhões, após a instituição, então do grupo Silvio Santos, ter sido alvo de uma fraude de R$ 4,3 bilhões. Em dezembro último, Panamericano e BTG compraram a Brazilian Finance & Real State, que atua no mercado financeiro imobiliário, numa transação estimada em R$ 1,2 bilhão. Unindo todos os investimentos do grupo, incluindo o braço de private equity que tem sob o guarda-chuva as construtoras WTorre e BRProperties, além da gestão de recursos de brasileiros e de nãoresidentes, o BTG administra uma carteira de cerca de R$ 100 bilhões, segundo o próprio Esteves. Além disso, o braço de banco de investimentos do BTG costuma frequentar as primeiras posições dos rankings de coordenadores de captações no mercado de capitais brasileiro. No IPO do grupo, os acionistas vendedores serão a Marais LLC e a Europa Lux, sediadas nos Estados Unidos e em Luxemburgo, respectivamente. No prospecto preliminar da oferta, não há dados sobre a quantidade de ações que cada um dos sócios irá se desfazer. A Marais tem 0,45% do capital social do Banco BTG Pactual e 0,03% do BTG Pactual Participations, enquanto a Europa Lux possui ações representativas de 4,15% do capital social do banco e de 0,31% da unidade de participações, segundo o prospecto.

DA AGÊNCIA REUTERS

O

BTG Pactual , maior banco de investimentos independente da América Latina, fez pedido nesta quinta-feira para realizar uma Oferta Pública Inicial de Ações (IPO, na sigla em inglês). O valor atual do banco estaria em torno de US$ 15 bilhões – o que o colocaria entre as 20 maiores companhias listadas em Bolsa no Brasil, acima de nomes como Cemig, BM&FBovespa e JBS. O IPO da instituição financeira do banqueiro André Esteves era amplamente aguardado no mercado. A operação compreenderá novas ações (oferta primária) e a venda de papeis nas mãos de alguns sócios (oferta secundária), e terá esforços de colocação no exterior. O Banco BTG Pactual venderá certificados de valores mobiliários, ou units, compostos por ações ordinárias e preferenciais na Bolsa paulista. Além disso, as units incluirão Brazilian Depositary Receipts (BDRs) representativos de ações da BTG Pactual Participations. As units do banco serão negociadas no Nível 1 de governança corporativa da Bovespa. Simultaneamente será realizada uma oferta no exterior apenas para investidores institucionais, com listagem no Euronext Amesterdam, informou o banco em fato relevante. Detalhes da oferta como faixa sugerida de preço para as units e quantidade de títulos, além do cronograma da operação, ainda não foram divulgados. O BTG pediu registro de companhia aberta em agosto de 2011, meses após ter vendido 18,65% de seu capital por

Oferta da instituição de Esteves era aguardada pelo mercado US$ 1,8 bilhão para um consórcio com fundos soberanos de Cingapura e de Abu Dhabi, o fundo de pensão canadense Ontario Teachers (OTPP) e a empresa de investimentos no setor financeiro J.C. Flowers. Na época, o BTG afirmou ter um patrimônio líquido de US$ 4,4 bilhões. Também no fim de agosto passado, o BTG iniciou conversas para fusão com a chilena Celfin Capital, negócio que foi concluído no começo de fevereiro. Com base no valor das ações envolvidas na compra do Celfin, o BTG teria atualmente um valor de mercado de cerca de US$ 15 bilhões, segundo uma fonte revelou à Reuters. Os recursos da oferta primária que irão para o caixa do banco serão usados para expandir

todas as áreas de negócio da instituição, segundo informações no prospecto preliminar. US$ 100 BILHÕES. Nos últimos anos, o BTG vem expandindo agressivamente sua atuação como merchant bank -quando o banco fornece capital para as empresas sob a forma de participação acionária em vez de empréstimos. A carteira inclui fatias na empresa de estacionamentos Estapar, na holding de drogarias Brazil Pharma e na Rede D’Or de hospitais, entre outras. A ideia é usar a experiência do grupo para conseguir recursos de longo prazo no mercado ao menor custo possível para financiar a expansão de empresas que sirvam como veículo de consolidação em setores da economia altamen-

abrangente do risco dos investidores, o que exigirá deles até 25% menos de garantias nas transações. O executivo, no entanto, evitou classificar o projeto como uma nova barreira de entrada para concorrentes. "Ter uma posição monopolista seria um erro estratégico nosso", disse Guardia. "Não temos medo de concorrência". Segundo Guardia, os efeitos das crises sobre os mercados de capitais nos últimos anos prejudicaram o crescimento do mercado brasileiro, especialmente o de ações, mas as expectativas para este ano seguem positivas. Em 2011, os volumes de negócios no mercado de ações ficaram estáveis em relação ao ano anterior. O principal índice doméstico, o Ibovespa, caiu 18,1% e o volume levantado com ofertas foi o pior desde 2005, em meio aos efeitos da crise de dívida soberana na zona do euro. No mês passado, porém, com o alívio das tensões na Europa o apetite por risco voltou e a entrada líquida de capital externo na Bovespa somou o recorde de R$ 7,2 bilhões.

DA AGÊNCIA REUTERS

PAUSA NA CONSOLIDAÇÃO. Segundo Guardia, o ritmo de consolidação nos mercados de bolsa globais deve desacelerar após reguladores antitruste da União Europeia (UE) terem bloqueado em fevereiro a fusão da Deutsche Boerse com a Nyse Euronext. Nessa linha, a BM&FBovespa também não está considerando nenhum avanço mais significativo. "Não estamos olhando nenhuma oportunidade de aquisição no exterior", disse, descartando inclusive o interesse na disputa pela Bolsa de Metais de Londres, que tem entre os concorrentes seu sócio, o CME Group.

» Indicadores econômicos // 1º de março de 2012 Juros

O MERCADO

30 dias

60 dias

0,22%

9,91%

9,78%

ao ano

ao ano

Dólar comercial

HOT MONEY

CAPITAL DE GIRO

Alta de

Alta de

1,52% Principais ações VALE PNA PETROBRAS PN TAÚ UNIBANCO PN BRADESCO PN BM&F BOVESPA ON GERDAU PN USIMINAS PNA CSN ON PETROBRAS ON VALE ON

0,99% 2,34% 2,31% 1,31% 1,83% 1,17% 2,23% 1,66% 1,95% 1,15%

Maiores altas JBS ON CYRELA ON HYPERMARCAS ON COPEL PNB LOCALIZA ON NATURA ON PDG REALTY ON ITAUSA PN BR MALLS PART. ON PETROBRAS PN

10,14% 5,14% 3,76% 3,4% 3,28% 3,11% 2,86% 2,86% 2,77% 2,34%

Compra Venda

1,71 R$ 1,712 R$

Queda de -0,47% Compra

-4,27% -3,6% -2,21% -1,86% -1,06% -0,78% -0,54% -0,5% -0,42% -0,4%

Venda

Paralelo

R$ 1,76

R$ 1,87

Turismo

R$ 1,653

R$ 1,773

Compra

Comercial

R$ 2,28

R$ 2,282

Turismo

R$ 2,175

R$ 2,365

Até 1.637,11 De 1.637,12 até 2.453,50 De 2.453,51 até 3.271,38 De 3.271,39 até 4.087,65 Acima de 4.087,65

13,7%

OVER

CDI

Ao ano:

Ao ano:

10,4% 10,28% Título da Dívida Externa Global 40

133,50 Centavos de Dólar

TBF

UFIR-RJ/2012

INSS IGP-M (FGV)

1,0453

IGP-DI (FGV)

1,0429

IPCA (IBGE)

1,0622

INPC (IBGE)

1,0563

Alíquota (%)

7,5 15 22,5 27,5

1,0343

Contribuinte individual e facultativos Salário de contribuição

R$

%

Valor mínimo

622,00*

11 ou 20

Valor máximo

De 622,01 a 3.916,20

20

*Quem optar pela alíquota de 11% só pode se aposentar por idade Deduzir (R$)

Isento 122,78 306,80 552,15 756,53

Deduções: R$ 164,56 por dependente; pensão alimentícia integral; contribuição ao INSS. Aposentado com 65 anos ou mais tem direito a uma dedução extra de R$ 1.566,61 no benefício recebido da previdência.

28/Fev./2012 0,5223% 29/Fev. 0,5% 1º/Mar. 0,5% 2/Mar. 0,5228% 3/Mar. 0,5259% 4/Mar. 0,5018% 5/Mar. 0,5018% 6/Mar. 0,5225% 7/Mar. 0,5032% 8/Mar. 0,5012% 9/Mar. 0,528% 10/Mar. 0,5087% 11/Mar. 0,5% 12/Mar. 0,5% 13/Mar. 0,509% 14/Mar. 0,5215% 15/Mar. 0,5311% 16/Mar. 0,507% 17/Mar. 0,517% 18/Mar. 0,5% 19/Mar. 0,5% 20/Mar. 0,5247% 21/Mar. 0,5509% 22/Mar. 0,5735% 23/Mar. 0,5556% 24/Mar. 0,5862% 25/Mar. 0,5575% 26/Mar. 0,5575% 27/Mar. 0,5836% 28/Mar. 0,5819% Obs.: De acordo com norma do Banco Central, os rendimentos dos dias 29, 30 e 31 correspondem ao dia 1º do mês subsequente.

Taxa Básica Financeira

Fevereiro/12

Segurados de empregos, inclusive domésticos e trabalhadores avulsos Salário de contribuições (R$)

Alíquotas (%)

Até 1.174,86

8%

de 1.174,87 até 1.958,10

9%

de 1.958,11 até 3.916,20

11%

Valores em %

Índice

Estável

R$ 2,2752

Aluguel Janeiro/12

Ao ano:

1,34%

Venda

Imposto de Renda Base de Cálculo (R$)

Ao mês:

Euro Comercial

Maiores baixas B2W VAREJO ON GOL PN HERING ON FIBRIA ON TIM PARTICIPAÇÕES ON VIVO PN ELETROBRÁS ON ELETROBRÁS PNB DURATEX ON LIGHT ON

Dia

CDB

Dow Jones

Ibovespa

Inflação

Poupança Correção

31/Jan./2012 1º/Fev. 2/Fev. 3/Fev. 4/Fev 5/Fev 6/Fev 7/Fev. 8/Fev. 9/Fev. 10/Fev. 11/Fev. 12/Fev. 13/Fev. 14/Fev. 15/Fev. 16/Fev. 17/Fev. 18/Fev. 19/Fev. 20/Fev. 21/Fev. 22/Fev. 23/Fev. 24/Fev. 25/Fev. 26/Fev. 27/Fev. 28/Fev. 29/Fev.

Mês

INPC IBGE

INCC (IGP-DI/FGV)

IGP-DI FGV

IGP-M FGV

IPCA IBGE

JAN/11

0,94

0,41

0,98

0,79

0,83

FEV/11

0,54

0,28

0,96

1

0,8

MAR/11

0,66

0,43

0,61

0,62

0,79

ABRIL/11

0,72

1,06

0,50

0,45

0,77

MAI/11

0,57

2,94

0,01

0,43

0,47

JUN/11

0,22

0,37

-0,13

-0,18

0,15

JUL/11

0

0,45

-0,05

-0,12

0,16

AGO/11

0,42

0,13

0,61

0,44

0,37

SET/11

0,45

0,14

0,75

0,65

0,53

OUT/11

0,32

0,23

0,40

0,53

0,43

NOV/11

0,32

0,72

0,43

0,5

0,52

DEZ/11

0,51

0,11

-0,16

-0,12

0,5

JAN/12

0,51

0,89

0,3

0,25

0,56

FEV/12

-0,06

NO ANO

0,51

0,89

0,3

0,19

0,56

12 MESES

5,63

8,01

4,29

3,43

6,22

Salário Mínimo e UPC 0,7154% 0,7287% 0,7129% 0,7160% 0,6718% 0,6718% 0,7026% 0,7232% 0,7312% 0,7081% 0,6888% 0,6762% 0,6762% 0,7391% 0,6715% 0,7111% 0,687% 0,697% 0,6486% 0,6486% 0,6848% 0,7209% 0,7436% 0,8057% 0,7864% 0,7476% 0,7476% 0,7838% 0,7821% 0,7846%

Taxa Selic

Mês

Sal./Mínimo

UPC

Vigência

MAR/11

545,00

17,45

28/4/10 9/6/10 21/7/10 1º/9/10 20/10/10 8/12/10 19/1/11 2/3/11 20/4/11 08/6/11 20/7/11 31/8/11 19/10/11 30/11/11 18/1/12

ABR/11

545,00

17,45

MAI/11

545,00

17,45

JUN/11

545,00

17,45

JUL/11

545,00

17,45

AGO/11

545,00

17,45

SET/11

545,00

17,45

OUT/11

545,00

17,45

NOV/11

545,00

17,45

DEZ./11

545,00

17,45

JAN./12

622,00

17,45

FEV./12

622,00

17,45

MAR./12

622,00

17,45

Valores em R$

Salário Família

Valores

9,5% 10,25% 10,75% 10,75% 10,75% 10,75% 11,25% 11,75% 12% 12,25% 12,5% 12% 11,5% 11% 10,5%

TJLP

Salário até R$ 608,80

R$ 31,22

Salário de R$ 608,81 a R$ 915,05

R$ 22,00

Julho a setembro/2011

6% ao ano

Outubro a dezembro/2011

6% ao ano

Janeiro a março/2012

6% ao ano


cyan magenta amarelo preto

TECNOLOGIA &CIÊNCIA Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

NANOBIOTECNOLOGIA - Pesquisadores de Harvard usam moléculas para criar equipamento em escala nanométrica capaz de combater tumores

Robô de DNA é esperança no combate ao câncer THAIS DE LUNA

U

sar estruturas do corpo humano para criar robôs parece uma ideia saída de filmes de ficção. Pensar que tais máquinas poderiam agir no organismo e tratar uma série de doenças soa ainda mais surreal. Pois pesquisadores do Wyss Institute for Biologically Inspired Engineering, da Escola Médica de Harvard, nos Estados Unidos, decidiram mergulhar no universo da nanobiotecnologia e construir minúsculos mecanismos médicos a partir de partes de DNA (conjunto de moléculas que contém as informações genéticas dos seres vivos). Os nanorrobôs são usados para transportar moléculas específicas até tumores. Ao encontrar as células cancerígenas, entregam uma mensagem que as induz à autodestruição, preservando as estruturas saudáveis. Capazes de apresentar diferentes doses de moléculas para células alvejadas, esses robôs, apresentados recentemente na revista científica Science, podem ser usa-

dos para inserir medicamentos no organismo. No caso da pesquisa, as estruturas foram montadas para localizar e destruir células de linfoma e leucemia – tipos de câncer que afetam os linfócitos e os glóbulos brancos, respectivamente. “Essas nanoestruturas são feitas com a técnica de origami de DNA. Elas contêm anticorpos que mandam mensagens de sinalização para as células que são seus alvos. Os nanorrobôs normalmente são mantidos fechados por uma sequência da estrutura chamada aptâmero”, descreve ao Jornal do Commercio o pesquisador Shawn Douglas. O aptâmero é como um cadeado codificado que só é aberto se receber os números corretos. Para cada tipo de célula cancerígena, há um código específico, a fim de que o robô ataque apenas as estruturas desejadas. “Quando essa fechadura se liga a uma ‘chave’ na superfície da unidade celular danificada, ela permite que o dispositivo seja aberto e revele o que leva dentro de si”, detalha. Inspirada no sistema imunológico humano, a tec-

nologia pode ser usada para programar respostas do organismo para combater diversas doenças. A técnica de origami de DNA, que o coloca em formato tridimensional, já é conhecida pelos pesquisadores. De acordo com o professor do Laboratório de Nanobiotecnologia da Universidade Federal de Uberlândia (UFU) Luiz Goulart, um dos primeiros relatos sobre o assunto foi feito há cerca de três anos, quando foram criados eletrodos em escala nanométrica – um nanômetro equivale a um milionésimo de milímetro – formados a partir de estruturas de DNA artificial. “Eles serviram para potencializar a montagem de equipamentos microscópicos com aplicações na área de computação, como microchips, e nanorrobôs”, ensina. SEM EFEITOS COLATERAIS. A grande inovação desse trabalho de Harvard foi ter combinado diversos elementos em um único dispositivo. “O mais interessante é que conseguimos unir as nanoestruturas de DNA, aptâmetros e fragmentos de anticorpos em

um robô que funciona”, comemora Douglas. “Há uma enorme necessidade de terapias inteligentes, que enviam os medicamentos apenas para as células doentes e deixam as saudáveis intactas, a fim de evitar efeitos colaterais. Esse é nosso objetivo”, acrescenta. Além disso, como o DNA é compatível com o organismo, o nanorrobô é absor vido pelo fígado após cumprir sua função. Há a expectativa de que, nos próximos anos, a ciência possa elaborar nanorrobôs sofisticados que se movam, sentem, processem informações e ajam de maneira autônoma. “Quando chegarmos a esse ponto, seremos capazes de buscar estruturas cancerosas, bactérias e outros agentes infecciosos e destruí-los”, destaca o diretor do Laboratório de Robótica Molecular da Universidade de Southern California, Aristides Requicha. Desse modo, o diagnóstico ocorreria logo no início das doenças, e o tratamento seria imediato, a ponto de o paciente, às vezes, nem sequer saber que havia algo de errado dentro de si.

■ BIOLOGIA

Corais usam a autoclonagem DA REDAÇÃO

Os corais são seres únicos no mundo animal que continuam a intrigar cientistas. Pesquisa publicada na edição de quinta-feira da revista Science revela uma nova faceta desses animais que vivem em grandes arrecifes. Especialistas do Instituto Australiano de Ciência Marinha descobriram que exemplares jovens desses seres têm a capacidade de se clonarem. A estratégia garante mais chances de sobrevivência quando as colô-

nias são destruídas. Normalmente, a reprodução dos corais se dá de maneira sexuada. Os ovos são fertilizados e depois liberados pelo “coralpai” para serem levados pelas correntezas e formarem novas colônias a centenas de quilômetros dali. Contudo, esses embriões são frágeis, não possuindo nenhuma membrana protetora. Assim, uma tormenta mais forte pode destruí-los. Para lidar com esse problema, os seres desenvolveram um mecanismos de proteção. Quando o embrião de coral é

quebrado, em vez de morrer, ele inicia um processo de autoclonagem, dando origem a uma série de outros embriões iguais a ele – e intactos. “Para nossa surpresa, muitos dos embriões de corais fragmentados desenvolveram-se e, mais tarde, começaram a se estabelecer da mesma maneira que seus irmãos que permaneceram intactos”, informou em comunicado o pesquisador Andrew Heyward. REPRODUÇÃO MISTA. Os pesquisadores acreditam que não

se trata de um acidente natural. “Quase metade de todos os embriões foi fragmentada em nossos experimentos, sugerindo que esse fenômeno tem sido parte do repertório de mecanismos de reprodução dos corais para maximizar o impacto de seus esforços reprodutivos”, explicou o especialista australiano. “Isso significa que o sistema reprodutivo dos corais é misto e utiliza, simultaneamente, duas técnicas colonizadoras, aproveitando as vantagens das reproduções sexuada e assexuada”, completou Heyward.

■ DOENÇA DE HUNTINGTON

Enzima propulsora é bloqueada THAIS DE LUNA

Uma simples mutação genética, transmitida dos pais para os filhos, faz com que a pessoa tenha movimentos involuntários em todo o corpo, como se fossem tiques nervosos, alteração da fala e, em casos mais graves, dificuldade para mastigar e engolir alimentos. Alguns indivíduos também sofrem perdas cognitivas, problemas de memória e alterações na personalidade. Muito confundida com problemas neurológicos, como o mal de Parkinson e o de Alzheimer, a doença de Huntington é extremamente rara, afetando de três a sete pessoas a cada 100 mil. Descrito pela primeira vez pelo médico norte-americano George Huntington, em 1872, o distúrbio é incurável e não há tratamentos específicos para retardar seu avanço. Um grupo de cientistas da Irlanda, no entanto, conseguiu dar o primeiro passo para diminuir a progressão da doença, a partir do bloqueio de uma enzima que intensifica as modificações no ge-

UM PASSO À FRENTE doença de Huntington é causada por alterações em um gene específico, que atua como uma arma disparando e A causando uma série de graves danos. Pesquisadores irlandeses descobriram uma forma de minimizar essas modificações genéticas.

ne IT15, causador do problema. As enzimas histona deacetilase complexas (HDACs) controlam a expressão dos genes no corpo humano. Isso significa que elas processam a informação genética do organismo, regulando a função das células e, normalmente, ajudando os indivíduos a continuarem saudáveis. Algumas dessas enzimas, contudo, trabalham intensamente na expressão do gene IT15 mutado, o que faz com que a doença de Huntington fique cada vez mais intensa e a saúde do paciente, pior. “Existem cerca de 20 HDACs nas células humanas, principalmente no cérebro. Descobrimos que inibir apenas uma delas – a HDAC3 – foi o suficiente para bloquear, pelo me-

nos em laboratório, as alterações genéticas em 75%”, relatou ao Correio o líder da pesquisa, Robert Lahue, professor do Centro de Biologia Cromossômica da Universidade Nacional da Irlanda em Galway. Para obter esses resultados, publicados na última edição da revista científica on-line PLoS Biology, os pesquisadores inseriram moléculas de RNA interferente na enzima, o que alterou a estrutura original e praticamente impediu que houvesse a expressão do gene ligado à patologia. “Também usamos inibidores moleculares para bloquear as mutações”, acrescenta Lahue. Pode-se comparar o gene IT15 a uma arma. Ela dispara e causa todos os danos já citados. Para evitar que isso

aconteça, os cientistas, basicamente, criaram um obstáculo para acionar o gatilho, o que praticamente impede que ela funcione. A grande questão é que, até hoje, não há tratamentos efetivos para bloquear essa “arma”, mas apenas para tratar os problemas decorrentes do disparo. O neurocirurgião Claudio Corrêa, coordenador do Centro de Dor e Neurocirurgia Funcional do Hospital 9 de Julho, em São Paulo, confirma que as terapias são apenas paliativas, atuando sobre os sintomas da doença. “O que podemos fazer é, se a pessoa sentir tonturas, lhe dar um remédio para diminuir a incidência do desconforto. Se ela apresentar retenção de líquidos, lhe receitar um diurético”, exemplifica. Rafael Higashi, neurologista da Clínica Higashi e do Centro Médico Athenas, do Rio de Janeiro, acrescenta que outras medidas ajudam a lidar com o transtorno e fazer com que o paciente tenha mais qualidade de vida, como reabilitação fonoaudiológica, fisioterapia e psicoterapia.

B-5

■ PRIVACIDADE

Para União Europeia, Google viola leis DA AGÊNCIA REUTERS

Agências de proteção da informação de países europeus concluíram que a nova política de privacidade do Google está violando a lei europeia, disse na quinta-feira a comissária de Justiça da União Europeia, Viviane Reding. O CNIL, órgão regulador francês de proteção de dados, também levantou dúvidas sobre a legalidade da política do Google e informou que vai liderar uma ampla investigação europeia. Reding disse à BBC Radio Four que as autoridades de controle de informação na Europa pediram às contrapartes francesas para analisarem a nova política, “e eles chegaram à conclusão de que estão profundamente preocupados, e que as novas regras não estão de acordo com a lei europeia, e que as regras de transparência não foram aplicadas”, disse Reding. O Google afirmou em janeiro que estava simplificando sua política de privacidade, consolidando 60 diretrizes em uma única que se aplica para todos os seus serviços, incluindo YouTube, Gmail e a rede social Google+. Os usuários não podem optar por não participar da nova política, se quiserem continuar utilizando os serviços do Google. Questionada sobre quais aspectos a regra do Google poderia desrespeitar a lei da União Europeia, Reding disse: “Em vários aspectos. Um deles é que ninguém foi con-

sultado, não está em conformidade com a lei de transparência e utiliza a informação privada para entregá-la para terceiros, o que não é o que os usuários concordaram. A proteção de informações pessoais é uma regra básica para a União Europeia”, disse ela. “Isto está escrito em tratados. Não é uma questão de dúvida, mas de obrigação, completou. Também na quinta-feira, o Google publicou mensagem em seu blog, defendendo a regra da companhia. “Nossa política de privacidade agora é muito mais fácil de ser compreendida”, afirmou a empresa. “Nós incluímos partes importantes de mais de 60 itens na principal política de privacidade do Google”, informa o comunicado, sem chegar ao cerne da questão sobre a violação ou não da privacidade dos internautas. Reding argumentou que a maior parte dos usuários não está ciente sobre o que esta concordando. “70% dos usuários raramente, ou nunca, leem os termos e condições, que são escritas muitas vezes em letras muito pequenas, e são muito complicados e incompreensíveis para o usuário normal”, disse ela à BBC. “Sabemos que os dados são a linha vital dessas novas empresas, mas, ao mesmo tempo, existem regras básicas europeias que precisam ser aplicadas, e infelizmente sempre vemos que estas normas não são observadas e a ilegalidade acaba assumindo.”

■ VIDEOCONFERÊNCIA

Gigantes brigam pelo próximo filão DA AGÊNCIA REUTERS

A tentativa da Cisco Systems de convencer um tribunal europeu a impor condições mais severas à aquisição da Skype pela Microsoft sinaliza que as empresas de tecnologia estão se preparando para a batalha pelo controle daquilo que muitos dizem que será a próxima grande tendência: videoconferências. À medida que a gigante das redes corre para proteger sua liderança de mercado e controle sobre uma tecnologia que está avançando do mundo dos negócios para o uso pessoal, empresas rivais como a Polycom e Citrix Systems vêm desenvolvendo soluções de fácil uso. Todas concorrerão contra a Microsoft, que segundo os analistas planeja integrar o

Skype aos seus produtos, o que pode tornar seu software mais atraente e beneficiar futuras gerações de aparelhos com o Windows. O mercado de teleconferências é pequeno, mas sua crescente popularidade junto aos consumidores e uso mais amplo em celulares fazem com que a disputa - travada nos tribunais, junto às autoridades regulatórias e por meio de fusões e aquisições - ganhe importância. “O vídeo é o novo mundo, e veremos muitas aquisições, muitos processos, e as empresas que ficarem para trás certamente tentarão contestar judicialmente o uso de patentes”, disse Krish Ramakrishnan, presidente-executivo da Blue Jeans Network, uma companhia de videoconferências online.


cyan magenta amarelo preto

DIREITO & JUSTIÇA B-6

Jornal do Commercio

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

SEGURANÇA - Criação de Sinaspj estabeleceria diretrizes e medidas de proteção institucional e pessoal dos magistrados e seus familiares que estejam em risco

CNJ debate sistema para Poder Judiciário DA REDAÇÃO

CÓDIGO PENAL

O

Conselho Nacional de Justiça (CNJ) deve analisar na próxima sessão plenária uma proposta de resolução para instituir o Sistema Nacional de Segurança do Poder Judiciário (Sinaspj), estabelecendo diretrizes e medidas de segurança institucional e pessoal dos magistrados e familiares em situação de risco. A proposta de resolução foi aprovada na noite de quarta-feira, pelo grupo de trabalho do CNJ criado para estabelecer normas para a segurança dos magistrados. De acordo com a proposta, o Sinaspj vai abranger também a segurança da informação. Caberá à Corregedoria Nacional de Justiça propor diretrizes, planejamento, coordenação, supervisão e o controle das ações do sistema. As iniciativas terão de ser aprovadas pelo plenário do CNJ. Na promoção do sistema de segurança do Poder Judiciário, a Corregedoria Nacional poderá firmar acordos de cooperação técnica com o Conselho Nacional do Ministério Público (CNMP), com os ministérios públicos e órgãos de inteligência, inclusive internacionais. Poderá ainda requisitar servidores e militares para a segurança do Judiciário. REMOÇÃO. Pela proposta, a Corregedoria Nacional terá poder para determinar a remoção do magistrado em situação de risco ou autorizar o exercício provisório da função fora da sede do juízo. Além disso, poderá requisitar força policial para garantir a segurança de magistrados ameaçados. O texto aprovado pelo grupo de trabalho propõe a criação do Departamento de Segurança e Inteligência do Poder Judiciário, subordinado à Corregedoria Nacional. Esse departamento vai coordenar e supervisionar as iniciativas dos tribunais de Justiça, com o objetivo de integrar e compartilhar informações dentro do Judiciário. Integram o grupo de trabalho os conselheiros José Roberto Neves Amorim, Sílvio Luis Ferreira da Rocha, Gilberto Valente Martins e Jefferson Kravchychyn. Na elaboração da proposta de resolução, eles contaram com o apoio de outros magistrados e de policiais federais. O CNJ anulou, na terça-feira,

Comissão de reforma ouvirá secretários DA REDAÇÃO

A comissão de juristas encarregada de elaborar a proposta de reforma do Código Penal se reunirá no dia 8 de março com os 27 secretários de segurança pública do País, para ouvir e debater sugestões que poderão ser aproveitadas na elaboração do anteprojeto a ser apresentado ao Senado. O encontro será realizado a partir das 8h30, na Subcomissão Permanente de Segurança Pública, no âmbito da Comissão de Constituição, Justiça e Cidadania (CCJ) do Senado. O ministro do STJ Gilson Dipp preside a comissão de juristas, que tem 16 membros. Eles trabalham desde outubro nos estudos para a modernização do Código Penal, que já tem quase 72 anos de vigência e é considerado atrasado em relação às atuais exigências da sociedade brasileira. No dia seguinte ao encontro com os secretários, a comissão de juristas se reunirá novamente no Senado, às 10 horas, para

durante a 142ª. sessão plenária, o processo de verificação de invalidez que o Tribunal Regional do Trabalho da 2ª Região (TRT2) instaurou contra o juiz Laércio Lopes da Silva. O tribunal afastou o magistrado em outubro de 2010, ao abrir processo administrativo para apurar se ele poderia ser aposentado compulsoriamente por incapacidade mental. Venceu a tese divergente levantada pelo conselheiro Silvio Rocha, que acolheu o procedimento de controle administrativo proposto pelo próprio juiz. Segundo o conselheiro, o ato do TRT-2 é nulo porque o magistrado Laércio Lopes da Silva não foi intimado a participar da sessão. Seguiram a divergência os conselheiros Bruno Dantas, Gilberto Valente, Jorge Hélio Chaves de Oliveira, Ney José de Freitas e o ministro Carlos Alberto Reis, que mudou de voto após a votação ficar empatada. Os conselheiros Fernando Tourinho Neto, José Roberto Neves Amorim, Wellington Cabral Saraiva e Jefferson Kravchychyn votaram a favor do relatório do conselheiro José Guilherme Vasi Werner. O conselheiro José Lúcio Munhoz de-

definir os próximos compromissos. Dois eventos já estão definidos. Um deles será uma audiência pública no próximo dia 23 no auditório do Tribunal Superior do Trabalho (TST), em Brasília. Nela, devem ser apresentadas sugestões em relação aos crimes contra a administração pública. Também está marcado um seminário em Aracaju (SE), no dia 13 de abril, cujos temas deverão ser definidos na reunião do dia 9. Propostas sobre a reforma estão sendo recebidas no site do Senado. As sugestões podem ser enviadas individualmente ou por organizações da sociedade civil. A primeira audiência pública da comissão foi no dia 24 de fevereiro, em São Paulo, quando foram recolhidos subsídios para o capítulo que trata dos crimes contra a vida. O prazo fixado inicialmente para apresentação do anteprojeto do novo Código Penal termina em 25 de maio, mas pode ser prorrogado. O texto será analisado pelo Senado e, depois, pela Câmara dos Deputados.

clarou-se suspeito para julgar o caso. A questão que dividiu o plenário dizia respeito à abertura do processo de verificação da sanidade mental do juiz Laércio Lopes da Silva. Os conselheiros debateram uma suposta omissão da Lei Orgânica da Magistratura Nacional (Loman) e do regimento interno do TRT-2, que não normatizariam o processo de verificação de invalidez para fins de aposentadoria. SEM INTIMAÇÃO. Segundo o relator, a intimação do juiz não era necessária por não se tratar de processo administrativo disciplinar. “Um processo de verificação de invalidez não é um processo de constatação de invalidez. Não pressupõe intimação prévia”, afirmou o relator. Vasi Werner citou o artigo 76 da Loman, segundo o qual o presidente do tribunal pode iniciar um processo por conta própria, “de ofício”. A tese divergente do conselheiro Silvio Rocha se baseou na Lei 9.784, de 1999, que regulamenta o processo administrativo na Administração Pública Federal. De acordo com o artigo 28, “devem ser objeto de intimação os atos do processo que re-

sultem para o interessado em imposição de deveres, ônus, sanções ou restrição ao exercício de direitos e atividades, e os atos de outra natureza, de seu interesse”. A falta de intimação do magistrado era uma das nulidades do processo, segundo a defesa do juiz, assumida por advogados da Associação dos Magistrados Brasileiros (AMB) e da Associação Nacional dos Magistrados da Justiça do Trabalho (Anamatra). “O então presidente do TRT-2 (Décio Daidone) me afastou em uma sessão secreta, sem que eu fosse avisado”, afirmou o juiz Laércio, durante sua sustentação oral. De acordo com o relatório, a perícia médica afirmou que o magistrado só poderia seguir trabalhando sob tratamento, o que Lopes sempre recusou. Segundo o relator do PCA, depoimentos de pessoas que conviviam com o juiz titular da 1ª Vara de Barueri atestariam que ele teria mania persecutória. “Nunca tive nenhum problema mental”, disse o magistrado, que atribuiu a iniciativa da presidência do tribunal a uma “perseguição política” da antiga presidência contra ele.

■ RIO GRANDE DO NORTE

A primeira semana de trabalho da Corregedoria Nacional de Justiça no Tribunal de Justiça do Rio Grande do Norte (TJ-RN) resultou na publicação de normas que darão maior transparência ao pagamento dos precatórios. A ida da equipe ao estado para reestruturar o setor responsável pela gestão dessas dívidas foi solicitada ao CNJ pela própria presidência do tribunal, que detectou irregularidades na área. “Fizemos várias sugestões à presidente que vão clarear e trazer transparência ao funcionamento do setor”, afirmou a juíza auxiliar da Corregedoria Nacional de Justiça e coordenadora dos trabalhos, Agamenilde Dantas, nesta quinta-feira. Entre as providências adotadas esta semana pelo tribunal,

■ STJ

Captação de diálogo não invalida escuta DA REDAÇÃO

O sigilo profissional da relação entre advogado e cliente não invalida a integralidade das interceptações telefônicas autorizadas judicialmente contra o cliente se, eventualmente, são gravados alguns diálogos entre eles. A decisão, unânime, é da Quinta Turma do Superior Tribunal de Justiça (STJ), que julgou um recurso em habeas corpus contra decisão do Tribunal Regional Federal da 2ª Região (TRF-2). O recurso objetivava retirar do processo todas as escutas determinadas pelo juiz e executadas pela polícia. Dois acusados de tráfico de drogas tinham suas ligações telefônicas monitoradas por ordem judicial. Um deles teve conversa com um terceiro gravada; posteriormente, este foi identificado como seu advogado. O réu recorreu à Justiça, afirmando que a denúncia seria nula pela violação do sigilo da comunicação entre advogado e cliente. Entretanto, o TRF-2 entendeu que o fato de a polícia ter gravado a conversa com o advogado não invalidava as interceptações. FORTUITA. O TRF-2 afirmou que em nenhum momento o alvo da quebra de sigilo telefônico foi o advogado – menos ainda um advogado no exercício legítimo de sua profissão –, sendo a captação fortuita e incidental. Também não foi intenção dos investigadores chegar ao advogado a partir de seu cliente. Não se aplica, portanto, a proteção do artigo 7º, inciso II, da Lei 8.906/94 (Estatuto da Advocacia). Concluiu destacando que não cabe aos agentes policiais “selecionar” ou “escolher” os trechos da interceptação que devem ser gravados. O TRF-2, porém, determinou que os diálogos entre o advogado e o seu cliente e entre este e o outro investigado que citassem o profissional de direito fossem retirados dos autos. Também determinou que todas as referências a esses diálogos fossem riscadas das peças processuais e que esses trechos das gravações fossem apagados, preservando o sigilo. Insistindo na tese da nulidade da denúncia, por ter se baseado em interceptações telefônicas supostamente ilí-

após recomendação do CNJ, está a edição da Portaria N° 138/2012. A norma prevê a publicação, no site do TJ-RN, da lista geral de precatórios, incluindo os nomes dos credores, os entes devedores e a natureza do crédito, imediatamente após a conclusão do trabalho de reestruturação do setor, prevista para o mês de abril. Como resultado do trabalho da Corregedoria Nacional, o TJRN também publicou a Portaria 136/2012, determinando a abertura de contas individuais e distintas para cada ente devedor (estado e municípios). A presidência do tribunal determinou ainda a reestruturação do setor de precatórios, por meio da Portaria nº 137/2012, ficando a cargo da presidente da Corte designar um juiz de direito para assessorar a área. A desembargadora Judite

Nunes, presidente do TJ-RN, destacou a importância do auxílio prestado pela Corregedoria Nacional de Justiça ao tribunal. “Todas as recomendações feitas pelo CNJ foram acatadas de pronto, para que o setor de precatórios funcione da melhor forma possível”, afirmou a desembargadora. RESOLUÇÃO. O plenário do CNJ, reunido na 142ª. sessão ordinária, decidiu alterar trechos da Resolução n° 115 que regulamenta a gestão dos precatórios nos tribunais, de forma a adequá-la à decisão do Supremo Tribunal Federal (STF). A nova redação estabelece o índice de correção de 6% de juros de mora ao ano para o saldo remanescente de precatórios que foram parcelados com base no artigo 78 do Ato das Disposições Constitucionais Transitórias

(ADCT), suspenso por liminar concedida pela Suprema Corte, em novembro de 2010. Por unanimidade, os conselheiros acompanharam o mérito da Comissão de Eficiência Operacional e Gestão de Pessoas, relatado pelo conselheiro Jefferson Kravchychyn, que acrescentou novo artigo (44-A) à Resolução nº 115. Pelo novo dispositivo, os juros de mora de 6% ao ano incidentes sobre o saldo remanescente dos créditos parcelados com base no artigo 78 do ADCT serão calculados a partir do mês de janeiro do ano subsequente ao pagamento da primeira parcela da dívida. A medida atinge os créditos parcelados com base no artigo 78 do ADCT, que não foram totalmente quitados e tampouco submetidos ao regime especial de parcelamento do artigo 97 do ADCT.

citas, a defesa recorreu ao STJ, afirmando que houve violação do sigilo cliente/advogado. Pediu que toda a prova apontada como ilícita, ou seja, a totalidade das interceptações telefônicas, fosse desentranhada (removida) dos autos e, consequentemente, que a denúncia e o decreto de prisão preventiva do cliente fossem considerados nulos. LIMITES. O relator do recurso, ministro Marco Aurélio Bellizze, entendeu que a interceptação dos diálogos envolvendo o advogado não é causa de nulidade do processo. Ele disse que o TRF-2 agiu de forma adequada ao determinar a exclusão dos trechos de gravações e documentos que citam o advogado e também concordou com o tribunal regional quanto à questão dos limites da atividade policial. “Não compete à autoridade policial filtrar os diálogos a serem gravados, mas sim executar ordem judicial”, afirmou, acrescentando que a colheita de provas não deve ficar ao arbítrio da polícia. Segundo o relator, não há razão para o desentranhamento de todas as conversas captadas e degravadas, como sustenta a defesa, “pois as provas não passaram a ser ilícitas, já que autorizadas por autoridade judicial competente e em observância às exigências legais”. Ao menos, destacou o ministro, não houve contestação da defesa quanto à legalidade da quebra do sigilo telefônico. Além disso, Marco Aurélio Bellizze observou que os trechos suprimidos, relativos aos diálogos envolvendo o advogado, são ínfimos em relação a todo o conteúdo da denúncia – que tem 120 folhas e está amparada em inúmeros outros diálogos, captados em nove meses de interceptações telefônicas e telemáticas, bem como em outros elementos de prova. O ministro informou que, após a interposição do recurso em habeas corpus no STJ, sobreveio sentença que condenou o réu a 26 anos e 20 dias de reclusão, em regime inicial fechado. A decisão negou ao condenado a possibilidade de recorrer em liberdade, com base em fundamentos que não fazem referência aos trechos gravados irregularmente.

■ GRU

Recurso é analisado mesmo sem número DA REDAÇÃO

Mais transparência para precatórios DA REDAÇÃO

EDITOR // LUÍS EDMUNDO ARAÚJO

A Caixa Consórcios S/A e Administradora de Consórcios terá um recurso especial analisado, mesmo tendo preenchido a Guia de Recolhimento da União (GRU) sem o número do processo na origem. A Corte Especial do Superior Tribunal de Justiça (STJ) decidiu que a identificação do número original do processo não poderia ser exigida no caso. O recurso especial da Caixa havia sido rejeitado monocraticamente, sem julgamento de mérito, pelo ministro Raul Araújo. Ele observou que as guias de recolhimento das custas judiciais e do porte de remessa e retorno não foram preenchidas com o número do respectivo processo no tribunal de origem, conforme determinava a Resolução 20/2004 do STJ. Em agravo regimental, a Caixa pediu a reconsideração da decisão, ou que o caso fosse

analisado por órgão julgador colegiado. Alegou que somente a partir da Resolução 4/2010, do STJ, passou a ser obrigatório o referido preenchimento. A decisão então passou para apreciação da Quarta Turma, que, após votovista do ministro Luis Felipe Salomão, em questão de ordem, decidiu submeter à Corte Especial a análise do pedido. A Corte Especial entendeu que o recurso merecia particular exame pelo fato de ter sido interposto em 25 de junho de 2008, na vigência da Resolução 1/2008, que não exigia o preenchimento do número do processo de origem. O relator apontou que resoluções anteriores traziam expressamente essa determinação, mas não a de 2008. “É princípio basilar da hermenêutica que não pode o intérprete restringir onde a lei não restringe, condicionar onde a lei não condiciona ou exigir onde a lei não exige”, analisou o ministro Raul Araújo.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

DIREITO & JUSTIÇA

LEGISLATIVO - Câmara analisa proposta que permite prorrogação de contrato de estudante formado que ainda fará avaliação necessária para exercício da profissão

Projeto amplia estágio antes de prova da OAB

A

Câmara dos Deputados analisa proposta que permite a prorrogação do contrato de estágio de pessoa formada, desde que o ex-estudante ainda vá realizar alguma avaliação necessária para o exercício da profissão. Esse é o caso dos bacharéis em direito, que devem passar por exame da Ordem dos Advogados do Brasil (OAB) antes de atuar como advogados. A prorrogação está prevista no Projeto de Lei 3158/12, do deputado Paulo Abi-Ackel (PSDB-MG). A proposta permite que o contrato de estágio seja prorrogado por até dois anos após a formatura. Caso a avaliação obrigatória ocorra periodicamente, o contrato poderá durar até o resultado final do terceiro exame ocorrido após a formatura do estagiário. LEI. A proposta altera a Lei do Estágio (11.788/08), que, entre outras medidas, evita que empresas contratem estagiários para exercerem atividades típi-

DA REDAÇÃO

PAULO ABI-ACKEL

DEPUTADO FEDERAL (PSDB-MG)

O estudante de direito faz estágio em escritório de advocacia, demonstra bom aproveitamento e bom aprendizado. O escritório manifesta o interesse em ter esse estudante (…) Entretanto, o escritório não poderá manter este agora bacharel, no hiato entre sua colação de grau e sua aprovação no exame da OAB”. cas de empregados, pagando menos e deixando de oferecer benefícios trabalhistas. “Após três anos em vigor, já é possível avaliar os resultados positivos que a lei teve, mas também é possível identificar pontos em que ela merece ser aprimorada”, diz Abi-Ackel. Segundo o deputado, a lei criou uma situação desfavorável aos formandos que ainda não passaram no exame da OAB – seus contratos de estágio não podem ser mantidos, mas eles também não podem

ser contratados pelos escritórios onde trabalham. “O que tem ocorrido em todo o Brasil é que o estudante de direito faz estágio em escritório de advocacia, demonstra bom aproveitamento e bom aprendizado. O escritório manifesta o interesse em ter esse estudante, após formado e aprovado no exame da OAB, para integrar seu quadro societário ou de associados como advogado. Entretanto, o escritório não poderá manter este agora bacharel, no hiato

entre sua colação de grau e sua aprovação no exame da OAB”, explica o deputado. Se o projeto for aprovado, a possibilidade de prorrogação do contrato de estágio valerá não só para os formandos em direito, como para os ex-estudantes de qualquer curso cujos formandos dependam de aprovação em exame para o exercício da profissão. ANISTIA. A proposta anistia qualquer sanção administrativa às empresas que tenham dado continuidade aos contratos de estágio nesses casos. Se a situação tiver sido levada à Justiça, o juiz poderá extinguir o processo sem julgamento de mérito. Se houver trânsito em julgado, a parte interessada, as entidades de classe, os conselhos profissionais e o Ministério Público do Trabalho (MPT) poderão ajuizar ação rescisória, com o objetivo de desfazer os efeitos da decisão judicial. O projeto tramita em caráter conclusivo e será analisado pelas comissões de Trabalho, de Administração e Serviço Público; e de Constituição e Justiça e de Cidadania.

■ STF

Supremo anula efeitos de liminar que suspendia inspeções do CNJ NELSON JR./SCO/STF

DA REDAÇÃO

Em despacho assinado na quarta-feira, o ministro do Supremo Tribunal Federal (STF) Luiz Fux autorizou a Corregedoria Nacional de Justiça, órgão do Conselho Nacional de Justiça (CNJ), a “prosseguir nas inspeções que eram rotineiras antes da concessão da liminar” referente ao Mandado de Segurança (MS) 31085. Essa liminar foi concedida no dia 19 de dezembro do ano passado, no sentido de suspender as inspeções, uma vez que a Associação dos Magistrados Brasileiros (AMB), a Associação Nacional dos Magistrados da Justiça do Trabalho (Anamatra) e a Associação dos Juízes Federais do Brasil (Ajufe) alegaram que tais processos seriam irregulares por submeter os investigados à quebra de sigilo bancário e fiscal em sede de procedimento administrativo que não visava à apuração de infração disciplinar, e sim de “conduta supostamente criminosa, que é da competência da Polícia e do Ministério Público”. No mesmo despacho, o ministro Fux determinou a expedição de ofícios ao CNJ para

Luiz Fux, ministro do STF autorizou investigações de Corregedoria atender pedidos das associações no sentido de obter mais informações sobre os processos instaurados para investigar movimentações financeiras de magistrados. COAF. Entre os pedidos, as entidades solicitam que o CNJ esclareça se o Conselho de Controle de Atividades Financeiras (Coaf ) atendeu a determinação do CNJ no sentido

de comunicar à Corregedoria Nacional de Justiça as ocorrências em que se verifiquem “fundados indícios da prática de ilícito por magistrado, servidores do Poder Judiciário Federal, distrital ou estadual, notários ou registradores”. Conforme as associações, tais informações não teriam sido mencionadas pela Corregedoria ao prestar esclarecimentos no processo. Assim,

solicitaram que fossem listados os processos instaurados diante do atendimento da determinação. Da mesma forma, as associações pedem que a Corregedoria do CNJ esclareça se foram requisitados dados sigilosos ao Banco Central e indique quais processos teriam sido instaurados a partir do atendimento de tal determinação. Além disso, solicitam que a Corregedoria informe o teor do documento (CD-ROM) extraído do processo um dia antes das informações serem prestadas ao Supremo. Pedem ainda que uma cópia desse documento seja enviada ao STF. Por fim, o ministro Fux salientou que documentos apresentados pelas associações evidenciam que as investigações conduzidas pelo CNJ se estendem aos notários e registradores de todo o Brasil. Dessa forma, intimou a Associação dos Notários e Registradores do Brasil (Anoreg) para que ingresse no MS 31085 no sentido de tutelar os interesses de seus associados. O prazo para que a Anoreg ingresse no processo é de 15 dias, conforme o artigo 47 do Código de Processo Civil (CPC). (Com Agência CNJ. (Com informações do STF)

Arquivado habeas corpus de deputado DA REDAÇÃO

O plenário do Supremo Tribunal Federal (STF) decidiu não conhecer (arquivar sem analisar o mérito) o Habeas Corpus (HC) 107325, impetrado na Corte pela defesa do deputado federal José Carlos Becker, o Zeca Dirceu (PT/PR). Ele pretendia trancar procedimento penal em curso no STF pelos supostos crimes de boca de urna e arregimentação de eleitores. Por maioria de votos, os ministros reafirmaram a jurisprudência de que não cabe HC contra ato de ministro do Supremo. O processo começou a tramitar perante o juiz eleitoral da 31ª zona eleitoral do Paraná mas, com a diplomação de Zeca Dirceu, o caso foi remetido para

o Supremo. Autuado como PET 4868, o processo que se busca trancar tem como relator o ministro Joaquim Barbosa. Ao se manifestar durante o julgamento, o advogado do parlamentar disse que não houve crime algum. Segundo ele, seu cliente teria sido preso injustamente. O então candidato apenas teria exercido seu direito de circular legalmente pelo ambiente eleitoral, disse o defensor. Segundo ele, testemunhas ouvidas afirmaram que não teria havido nem boca de urna nem arregimentação. A vice-procuradora-geral da República, Deborah Duprat, assegurou que o que se pretende com o habeas corpus é o trancamento de processo em curso no Supremo. Assim, disse Deborah Duprat, como o caso está

sob relatoria de um ministro da Corte, o habeas na verdade se volta contra esse ministro – que seria a autoridade supostamente coatora. Segundo ela, a jurisprudência da Corte é pacífica no sentido de que não cabe HC contra ato de ministro relator no Supremo. DEPOIMENTOS. Além disso, a vice-procuradora revelou que no habeas a defesa discute se o parlamentar praticou ou não os atos apontados. Na opinião dela, existem realmente depoimentos afirmando que não houve boca de urna e depoimentos dizendo que houve, o que seria apurado nos autos do procedimento penal, se houve a prática do delito ou não. Relator do HC, o ministro Marco Aurélio Mello ressaltou

o fato de estar em tramitação no STF o procedimento criminal contra o parlamentar, em que já houve notificação do envolvido para apresentar defesa prévia. Assim, sem visualizar qualquer tipo de ilegalidade, o ministro votou pelo indeferimento da ordem. Ele foi acompanhado pelos ministros Dias Toffoli e Gilmar Mendes, que entenderam ser cabível o HC, mas também se manifestaram por seu indeferimento quanto ao mérito. Já as ministras Cármen Lúcia Antunes Rocha e Rosa Weber e os ministros Luiz Fux, Ricardo Lewandowski, Ayres Britto e Cezar Peluso formaram a maioria ao se manifestarem pelo não conhecimento do HC, uma vez que a autoridade coatora é ministro da Corte.

Jornal do Commercio

B-7

■ BRASIL-BOLÍVIA

Revista indiscriminada na fronteira vai acabar DA REDAÇÃO

O Departamento da Força Nacional de Segurança Pública encaminhou ofício ao Ministério Público Federal (MPF) informando que o órgão acatou integralmente recomendação que determinava critérios para a realização de revista pessoal em passageiros de ônibus intermunicipais oriundos de Corumbá/MS, na fronteira do Brasil com a Bolívia. Agora, as revistas só serão realizadas quando houver fundada suspeita ou risco à segurança dos passageiros. A recomendação do MPF foi expedida em investigação que constatou abuso nas abordagens policiais. Todos os passageiros, sem qualquer suspeita concreta e específica da ocorrência de crime – tráfico de drogas ou armas, por exemplo –, eram revistados um a um, inclusive idosos e crianças. Para a Força Nacional, tratava-se de um “abordagem padrão”, já que a região é rota do tráfico internacional de drogas. Contudo, para o Ministério Público Federal, pressupor que todas as pessoas que embarcam nos ônibus da região possam ser traficantes não é razoável. “Trata-se de opinião preconceituosa e equivocada em relação à população que reside e trabalha nesta região de fronteira”. Com a resposta oficial da Força Nacional, será promovido o arquivamento do inqué-

rito civil público instaurado na Procuradoria da República em Corumbá, sujeito à homologação da 2ª Câmara de Coordenação e Revisão do MPF. Caso abordagens irregulares continuem acontecendo, o MPF em Corumbá poderá ser acionado para a adoção das medidas cabíveis, inclusive na esfera criminal. AGU. Em dezembro de 2011, a Advocacia Geral da União (AGU) emitiu parecer favorável à recomendação do MPF. O documento, elaborado a pedido da Secretaria Nacional de Segurança Pública, enfatiza que a revista pessoal sem mandado judicial só pode ser realizada sob fundada suspeita de que a pessoa porte arma ou objetos que constituam prova de crime. Para a AGU, o procedimento da Força Nacional em Corumbá poderia "acarretar a declaração da ilicitude da prova pelo Judiciário, bem como a condenação do policial por abuso de poder”. Ainda de acordo com o parecer, “não se pode presumir que todo e qualquer passageiro de transporte coletivo naquela região de fronteira seja portador ou traficante de droga. É inconstitucional a presunção de que todas as pessoas são suspeitas (…) Os agentes públicos não podem agir de acordo com o que consideram ser de interesse da sociedade e sim de acordo com os preceitos constitucionais”.

■ SANTA CATARINA

MPF alerta para proteção ambiental DA REDAÇÃO

O Ministério Público Federal em Santa Catarina (MPF/SC) encaminhou recomendação ao Instituto de Planejamento Urbano de Florianópolis (Ipuf ) e ao Núcleo Gestor do Plano Participativo para que, na elaboração do Mapa das Condicionantes Ambientais do Plano Diretor da capital catarinense, seja respeitada a legislação federal específica no que se refere à questão ambiental. O documento, assinado pelos procuradores da República Analúcia Hartmann e Eduardo Barragan da Motta, foi elaborado no momento da retomada dos trabalhos de elaboração do anteprojeto do Plano Diretor da capital. O MPF – que acompanha, desde 2007, a tramitação da proposta de alteração da lei municipal sobre o Plano Diretor Participativo – quer ter acesso mensal aos trabalhos realizados pelo núcleo gestor, além de relatório que comprove o cumprimento das medidas. Conforme os procuradores, a proposta anterior foi rechaçada pelas comunidades locais por não atender às limitações impostas pelos zoneamentos ambientais, e "especialmente por desconsiderar a necessidade da efetiva participação da sociedade civil nas etapas de sua discussão", conforme previsto em lei. No documento, os procuradores da República apontam especificidades que devem ser respeitadas no planejamento, como a questão das dunas de Ingleses e Santinho ou as áreas alagadiças do Pântano do Sul.

Em relação às dunas do norte da ilha, o MPF ressalta que são locais onde há depósitos de água potável, essenciais àquela região, por isso são áreas non aedificandi, que devem ser protegidas. No que se refere ao Pântano do Sul, o MPF encaminhou a Recomendação ao Ibama/SC, à Fatma e à Floram para que se respeite as presença das APPs nos procedimentos de fiscalização e licenciamento ambientais. A intenção do MPF é proteger as características naturais da zona costeira da capital. Para tal, os órgãos públicos licenciadores, ao autorizarem parcelamento e desmembramento do solo, construção, instalação, funcionamento de atividades que alterem estas características devem respeitar as diretrizes da Lei 7.661/68, que define o Plano Nacional de Gerenciamento Costeiro. Além da legislação ambiental brasileira, o ordenamento territorial urbano também deve adotar como parâmetro outra lei federal, a Lei 10.257/01, mais conhecida como Estatuto das Cidades, que prevê a plena participação da sociedade na elaboração do Plano Diretor. A preocupação dos procuradores da República é que, em Florianópolis, os interesses comerciais e a especulação imobiliária têm vencido a queda de braço em relação aos valores culturais e ambientais presentes na ilha de Santa Catarina. O MPF estipulou o prazo de 15 dias para que sejam informadas as medidas adotadas para o cumprimento da recomendação. (Com informações do MPF)

CURTA TRF-2 DIVULGA NOTAS DE PROVA PARA JUIZ FEDERAL A Comissão Organizadora e Examinadora do XIII Concurso para juiz federal substituto da 2ª Região comunica que a sessão pública de identificação das provas e divulgação das notas da primeira prova escrita – segunda etapa do concurso – será realizada na quarta-feira, 7 de março, às 13 horas, no Plenário do TRF-2 (Rua do Acre, 80, Centro do Rio de Janeiro). O comunicado foi assinado no dia 29 de fevereiro pelo presidente da Comissão, desembargador federal Poul Erik Dyrlund.


cyan magenta amarelo preto

MUNDO ECONOMIA B-8

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

SINAL AMARELO - Gastos, que ajudram a impulsionar a economia no quarto trimestre de 2011, mostram desaceleração, reavivando as preocupações que ritmo da retomada pode não estar tão forte como previam os analistas

EUA: consumidor fecha o bolso

O

s norte-americanos registraram poucos novos pedidos de auxíliodesemprego na semana passada, mas os gastos do consumidor ficaram estáveis em janeiro pelo terceiro mês consecutivo depois de descontada a inflação, lançando uma nuvem sobre a perspectiva econômica. Embora a melhora no mercado de trabalho – a taxa de desemprego caiu fortemente nos últimos meses – pareça estar impulsionando a renda, a inflação e os impostos comeram os ganhos em janeiro. “As coisas não estão tão floridas no jardim e o consumo ainda está enfrentando significativos ventos contrários aqui”, afirmou o chefe de estratégia de câmbio do BNP Paribas para a América do Norte em Nova York, Ray Attrill. Os gastos dos consumidores e um grande ganho em estoques ajudaram a impulsionar a economia, que cresceu 3% em uma taxa anual durante os últimos três meses de 2011, o ritmo mais rápido em mais de um ano. O relatório desta quinta-feira , contudo, mostrou que algumas medidas de

gastos talvez começaram a se estabilizar. Os gastos subiram 0,2% em janeiro, pouco abaixo das expectativas dos analistas. A leitura, porém, ficou estável após ajustada pela inflação, como aconteceu em dezembro e novembro. Isso ofusca a perspectiva econômica porque as compras das famílias, desde televisões até refeições em restaurantes, são os principais motores do crescimento. O aumento da renda veio pouco abaixo das previsões dos analistas, de ganho de 0,4%. A renda após os impostos caiu 0,1%, quando ajustada pela inflação. A alta de preços acelerou recentemente devido ao aumento dos aluguéis e dos reajustes da gasolina. Os preços nos gastos de consumo pessoal subiram 0,2% em janeiro, ante 0,1% em dezembro. Além disso, os dados de auxílio-desemprego somam-se à visão de que o relatório de emprego da próxima semana pode mostrar que as companhias estão contratando em ritmo rápido. “Isso realmente se soma à evidência de que a economia teve uma dinâmica melhor do que as pessoas esperavam”, disse o economista do UBS Securities in Stamford, Connecticut, Kevin Cummins.

DA REDAÇÃO

RAY ATTRILL

CHEFE DE ESTRATÉGIA DE CÂMBIO DO PNB PARIBAS PARA A AMÉRICA D O NORTE

As coisas não estão tão floridas no jardim e o consumo ainda está enfrentando significativos ventos contrários aqui.”

Os pedidos iniciais de auxílio-desemprego tiveram queda de 2 mil solicitações, para 351 mil em números sazonalmente ajustados. O dado da semana anterior foi revisado para cima, para 353 mil, dos 351 mil informados previamente. O número de pedidos tem girado perto das mínimas de quatro anos ao longo das últimas semanas. Economistas consultados pela Reuters previam que o número ficaria em 351 mil. A média móvel de quatro semanas, considerada uma medida melhor das tendências do mercado de trabalho, caiu em 5.500, para 354 mil, menor nível desde março de 2008. O governo vai divulgar o relatório de emprego de fevereiro no próximo dia 9. Embora o mercado de trabalho esteja ganhando impulso, o nível de emprego ainda está 5,82 mi-

lhões aquém de seu nível prérecessão. Uma autoridade do Departamento do Trabalho disse que não há nada incomum nos dados estaduais. O número de pessoas que ainda está recebendo os benefícios sob programas regulares do governo após a primeira semana de ajuda caiu em 2 mil, para 3,4 milhões na semana encerrada em 18 de fevereiro. Já o número de norte-americanos que estão recebendo auxílio-desemprego emergencial subiu em 1.347, para 2,9 milhões na semana encerrada em 11 de fevereiro, a última semana em que o dado foi atualizado. Um total de 7,5 milhões de pessoas estavam solicitando auxílio-desemprego durante o período sob todos os programas, alta de 11.933 em relação à semana anterior. A recuperação econômica dos Estados Unidos tem im-

pulsionado os lucros mais que os salários, o que pode ser o motivo de muitos norte-americanos ainda estarem inseguros com as perspectivas, disse na quinta-feira o chairman do Federal Reserve (Fed, o banco central americano), Ben Bernanke. O Produto Interno Bruto (PIB) dos EUA cresceu 3% no quarto trimestre, mas dados divulgados na quinta-feira apontaram estagnação no gasto do consumidor. “A parcela dos lucros sobre o PIB está incomumente elevada, a fatia de renda dos assalariados está menor que o normal”, afirmou Bernanke a parlamentares. Ele reiterou aos parlamentares em um segundo dia de pronunciamento que tem preocupações de que o rápido declínio da taxa de desemprego possa não ser sustentável. “Ainda há um pouco de contradição entre a melhora no mercado de trabalho e a velocidade da recuperação como um todo. Você ainda tem um gasto com consumo crescendo de forma relativamente fraca.” Defendendo a política monetária expansionista do Fed, Bernanke disse que as medidas de estímulo heterodoxas estão afastando a possibilidade de deflação.

O ritmo de crescimento do setor manufatureiro dos Estados Unidos desacelerou inesperadamente em fevereiro, de acordo com o relatório do Instituto de Gestão do Fornecimento (ISM, na sigla em inglês), divulgado na quinta-feira. O índice de atividade fabril nacional do ISM caiu para 52,4, de 54,1 no mês anterior. A leitura ficou aquém das expectativas, de 54,5, segundo pesquisa da Reuters com economistas. A inesperada desaceleração interrompe três meses seguidos de aumento do crescimento no setor. Uma leitura abaixo de 50 indica contração no setor manufatureiro, enquanto um número acima disso significa expansão. Também os gastos com construção caíram em janeiro pela primeira vez em seis meses, à medida em que as empresas cortam investimento em edifícios e o governo federal reduz projetos, informou o Departamento do Comércio. Os gastos com construção diminuíram 0,1%, para uma taxa anual de US$ 827 bilhões, frustrando as expectativas dos analista de alta de 1%. Essa foi a primeira queda desde julho de 2011. Já os gastos com moradias subiram 1,8%, compensando a queda de 1,5% em estruturas empresariais. (Com agências)

■ ZONA DO EURO

■ ÁSIA

Grécia e UE assinam memorando

Pedidos à indústria voltam a crescer

DA REDAÇÃO

O ministro das Finanças da Grécia, Evangelos Venizelos, e o comissário europeu de assuntos econômicos, Olli Rehn, assinaram na quinta-feira um memorando de entendimento delineando as reformas que o governo grego terá de adotar em troca de um novo pacote de resgate financeiro. O memorando também leva a assinatura do presidente do Banco da Grécia, George Provopoulos, e as cartas de compromisso assinadas pelos líderes dos dois maiores partidos políticos gregos foram anexadas ao documento. O Ministério das Finanças da Grécia informou que também foram assinados outros cinco acordos, entre eles um para que a Linha de Estabilidade Financeira Europeia (EFSF, nas iniciais em inglês) forneça garantias de liquidez ao sistema bancário grego durante a implementação da reestruturação da dívida grega com o setor privado. A assinatura dos acordos ocorre depois de o Parlamento grego ter aprovado uma série de medidas de austeridade exigi-

das pelos credores internacionais do país em troca do novo resgate. Segundo a nota do Ministério, os acordos enviam mensagem ao setor privado, aos mercados e à comunidade internacional segundo a qual o setor oficial apoia a Grécia em todos os aspectos. Com isso, os ministros das Finanças dos países da zona do euro voltarão a se reunir na próxima semana para tomar uma decisão definitiva sobre o novo resgate à Grécia, segundo disseram ministros da Alemanha e da Finlândia. A Grécia progrediu o suficiente na adoção das leis que prometeu implementar, assim como na de ações anteriores exigidas em troca de um rigoroso programa de resgate financeiro, mas a decisão final sobre o segundo pacote ainda depende do êxito da reestruturação da dívida e da formalização do acordo pelo trio de credores externos do país, afirmaram ministros das Finanças da zona do euro reunidos na quinta-feira em Bruxelas. Em um comunicado do Eurogrupo, os ministros das Finanças dos países da zona do

euro disseram que o trio de credores formado por Comissão Europeia, Fundo Monetário Internacional (FMI) e Banco Central Europeu (BCE) apresentará nos próximos dias uma análise detalhada da qualidade das ações previamente adotadas pela Grécia. AJUDA. No encontro, o Eurogrupo autorizou a Linha de Estabilidade Financeira Europeia a autorizar uma linha de 35 bilhões de euros para auxiliar a Grécia a recomprar títulos soberanos nas mãos de bancos centrais nacionais dos países da zona do euro. Os ministros das finanças também autorizaram a abertura de uma linha de proteção para a recapitalização dos bancos gregos e a emissão do EFSF para financiar a contribuição da zona do euro para a reestruturação da dívida grega. O governo central da Grécia registrou superávit de 865 milhões de euros em janeiro. De acordo com o Banco da Grécia, as receitas ordinárias do governo alcançaram 5,01 bilhões de euros em janeiro deste ano, de 4,96 bilhões um ano antes, enquanto

as despesas caíram para 4,12 bilhões de euros, de 4,24 bilhões em janeiro de 2011. Os dados, no entanto, refletem apenas as operações do governo central e as despesas com projetos públicos, sem incluir as contas de empresas estatais e fundos de pensão que também entram no orçamento geral do governo. Na série de esforços para demonstrar aos credores o empenho do governo grego com as reformas necessárias, o primeiro-ministro, Lucas Papademos, seguiu o caminho do presidente do país, Carolos Papoulias, e abriu mão de seu salário com a finalidade de ajudar a reduzir a dívida grega, afirmou uma fonte do governo. “Foi uma decisão pessoal, e o primeiro-ministro não acha que isso precisa ser anunciado", declarou a fonte. O jornal Ta Nea disse que Papademos fez a revelação na quarta-feira durante uma visita a Bruxelas, onde os ministros das Finanças vão discutir um novo pacote de resgate para a Grécia de 130 bilhões de euros. Na quarta-feira, o Ministério das Finanças divulgou uma lista de seus servidores públicos

mais bem pagos, incluindo o primeiro-ministro, que têm direito a salários de mais de 5 mil euros por mês. O vice-ministro das Finanças, Filippos Sachinidis, divulgou a informação em resposta a uma pergunta parlamentar, afirmou a agência de notícias Athens News. LISTA DE SALÁRIOS. A lista de salários mensais antes de impostos de cerca de 5 mil euros inclui Papoulias, Papademos, ministros do gabinete, ministros júnior e legisladores do Parlamento. Papoulias anunciou recentemente que estava abrindo mão de um salário anual de cerca de 280 mil euros. Os servidores públicos já tinham sofrido cortes de salários nos últimos dois anos em razão das reformas fiscais sem precedentes no país. O Parlamento também disse em novembro que os salários dos legisladores seriam reduzidos em cerca de 46 mil euros em 2012, um corte de 40%. O Ministério das Finanças da Grécia informou que os números fornecidos na quarta-feira foram ajustados por cortes de salários. (Com agências)

Desemprego volta a subir no bloco DA REDAÇÃO

A taxa de desemprego na zona do euro subiu para perto da máxima em 15 anos em janeiro, enquanto a inflação anual aumentou em fevereiro. Os dois indicadores são um golpe para a economia do bloco, e destacam a dificuldade que os formadores de política enfrentam para restaurar o crescimento diante dos programas de austeridade destinados a reduzir os altos níveis de dívida dos governos. De acordo com a Eurostat, a agência oficial de estatísticas do bloco, a taxa de desempre-

go subiu para 10,7% em janeiro, de 10,6% em dezembro, percentual que foi revisado do cálculo inicial de 10,4%. A taxa em janeiro foi a mais alta desde outubro de 1997. A quantidade de pessoas sem trabalho aumentou 185 mil, para 16,925 milhões, o maior número desde que os registros começaram a ser feitos, em 1995. Nos dez países restantes da União Europeia (UE), a taxa de desemprego em janeiro ficou em 10,1%. No bloco como um todo, os números indicam que em janeiro, 24,3 milhões de pessoas estavam desempregadas. Desse total, 16,9 vivem

nos países da zona euro. No ano, dez países conseguiram reduzir a taxa de desemprego, 15 registraram aumento e em dois o índice ficou estável. O maior aumento foi observado na Grécia, passando de 14,1% em dezembro do ano passado para 19,9% em janeiro de 2012. No Chipre, o percentual passou de 6,3% para 9,6%, no período, enquanto na Espanha subiu de 20,6% para 23,3%. Irlanda e Portugal mostraram taxas de 14,8%. Pelos dados, as menores taxas menores foram registadas na Áustria (4%), nos Países Baixos (5%) e em Luxemburgo

(5,1%). Os percentuais mais altos são os da Espanha (23,3 %), Grécia (19,9%), Irlanda e de Portugal (14,8%). INFLAÇÃO. Uma queda abrupta das temperaturas na Europa e a elevação dos preços do petróleo provavelmente estiveram por trás da ligeira alta nos preços ao consumidor em fevereiro, que levou a inflação da zona do euro para 2,7%, comparada a 2,6% em janeiro, mostraram dados da Eurostat. A crise econômica da zona do euro ajudou a trazer para baixo os preços de bens, alimentos e combustíveis em re-

lação ao pico de 3% do ano passado, mas os preços do petróleo atingiram máximas recordes em euros neste mês e minaram a tendência de queda da inflação. Isso sugere que o BCE deve deixar de lado qualquer decisão rápida para levar as taxas de juros para abaixo de 1% pela primeira vez e os economistas veem o banco em compasso de espera. O banco quer manter a inflação baixa, mas próxima de 2% no médio prazo. Excluindo os preços voláteis da energia e dos alimentos, a inflação de janeiro foi de 1,9% em base anual. (Com agências)

DA AGÊNCIA REUTERS

Os novos pedidos para a indústria da Ásia subiram em fevereiro, diminuindo alguns temores sobre a desaceleração da economia global, segundo índices de gerentes de compras divulgados na quinta-feira. A indústria chinesa cresceu mais que o esperado em fevereiro com novos pedidos de exportação para grandes empresas se recuperando, de acordo com o índice de gerentes de compras do governo (PMI, na sigla em inglês). O PMI oficial subiu para 51, acima das expectativas de 50,7 e maior que os 50,5 registrados em janeiro. Os PMIs do setor privado, também divulgados na quinta-feira, apontaram algumas melhoras na atividade industrial da China, Índia e Taiwan, apesar de mostrar que as empresas menores chinesas estão se recuperando com menos vigor que as maiores. O PMI do HSBC da China ficou em 49,6, pequena alta em relação à leitura de janeiro de 48,8, mas ainda abaixo de 50 pontos, patamar que separa expansão de contração. As pesquisas sobre o setor manufatureiro, as primeiras indicações da atividade industrial da região, ofereceram sinais de uma recuperação da baixa dos últimos meses de 2011, causada pela vacilante demanda externa e as frágeis confianças do empresário e do consumidor. No entanto, a cena econômica estava longe de estar completa. A economia da China registrou o menor crescimento em dois anos e meio no quarto trimestre de 2011.


cyan magenta amarelo preto

MUNDO GERAL

EDITOR // RODRIGO OTÁVIO CRUZ MOREIRA

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio B-9

IRÃ - Com a oposição reformista excluída, pleito reflete uma queda de braço entre aliados do presidente e do líder religioso supremo Ali Khamenei

Ahmadinejad na berlinda em eleição parlamentar CAROLINA VICENTIN

O

s iranianos renovam nesta sextafeira, nas urnas, as 290 cadeiras do Majlis (parlamento), mas a expectativa é de baixa participação dos 48 milhões de eleitores. Com candidatos selecionados pelo grupo de clérigos que controla o país, a escolha se fará apenas entre representantes da facção conservadora do regime islâmico. Um personagem, porém, tem interesse capital no resultado: o presidente Mahmud Ahmadinejad é, ao mesmo tempo, o fator que diferencia os concorrentes e o político que mais tem a ganhar ou a perder. "Será, na verdade, uma briga entre aliados e opositores de Ahmadinejad", resume o professor Murilo Meihy, especialista em história contemporânea do Irã na Pontifícia Universidade Católica do Rio de Janeiro. As principais coligações que participam representam apoiadores do presidente ou setores críticos à sua tentativa de ganhar poder internamente. Nos últimos dois anos, Ahmadinejad — eleito e reeleito graças ao apoio do líder supremo do país, o aiatolá Ali Khamenei — passou a adotar uma posição mais forte em relação a vários temas. Por diversas vezes, ensaiou contrariar o líder, criando uma tensão política interna que aumenta as preocupações da comunidade internacional. O principal temor é de que esse quadro dificulte ainda mais as negociações sobre o programa nuclear. "O Majlis tem muito pouco poder em relação à política externa. Mas, se Khamenei centralizar o poder em torno de seu grupo, é possível que o diálogo com o Ociden-

TRÊS PERGUNTAS PARA LUCIANO ZACCARA, DIRETOR DO OBSERVATÓRIO ELEITORAL DE PAÍSES ÁRABES E ISLÂMICOS DA UNIVERSIDADE AUTÔNOMA DE MADRI, NA ESPANHA Como o senhor imagina que será a participação popular nas eleições? O boicote dos reformistas e a desqualificação de muitos candidatos dessa corrente fazem com que essa eleição seja vista apenas como uma disputa entre conservadores. Eu não vejo o mesmo ambiente eleitoral que observei, também pessoalmente, em outras ocasiões. A maioria das pessoas com quem tenho falado (em Teerã) me diz que não vão votar e que não há nenhuma diferença entre os candidatos. Para eles, não vale a pena participar do processo. O senhor acredita que possa haver protestos, como na eleição presidencial de 2009? Não. Em 2009, houve uma situação muito concreta de descontentamento, relacionada aos resultados. Como agora não há muita expectativa em relação aos vencedores, tampouco há motivo para que as pessoas saiam às ruas e se manifestarem. Simplesmente, quem estiver em desacordo com o governo não vai votar. Além disso, a repressão de 2009 deixou a maioria dos iranianos sem força para esse tipo de movimento. Eles estão muito mais preocupados com a situação econômica do que com a situação política. O líder supremo exerce um controle muito rígido sobre a composição do parlamento. É possível que haja alguma mudança? O aiatolá Ali Khamenei, por meio do Conselho dos Guardiões, deixou de fora da corrida muitos adversários políticos — tanto reformistas como partidários de Ahmadinejad. Mais de 30 deputados que integram atualmente o Majlis foram desqualificados a concorrer à reeleição, assim como todos aqueles que participaram dos protestos de 2009. É impossível a vitória de alguém que discorde do regime islâmico, porque não há candidatos com esse perfil.

te siga estancado", afirma Luciano Zaccara, diretor do Observatório Eleitoral de Países Árabes e Islâmicos. "Nos últimos anos, foi justamente Ahmadinejad quem deu mostras de que deseja negociar com os Estados Unidos, algo a que o líder supremo se opõe", lembra o especialista. Antes de a campanha começar, o Conselho de Guardiões, que supervisiona os processos eleitorais e legislativos, vetou candidatos mais críticos ao regime e ao governo. A medida atingiu principalmente a facção reformista do regime, que defende mudanças em alguns aspectos da Constituição e optou por boicotar o pleito. Dois de

seus principais expoentes, Mir Hossein Mousavi e Mehdi Karrubi, ambos derrotados por Ahmadinejad na eleição presidencial de 2009 — sob denúncias de fraude generalizada —, estão sob prisão domiciliar. Outra razão para um alto índice de abstenção é que os iranianos estão mais preocupados com a economia do que com os rumos políticos do país. CONVOCAÇÃO. É possível, no entanto, que o governo acabe pressionando os cidadãos a votarem. "Acho que o líder supremo e muitos conservadores da Guarda Revolucionária instaram a população a ir às urnas", opina a iraniana Haleh Esfan-

diari, radicada nos EUA e diretora do programa para o Oriente Médio no Woodrow Wilson International Center for Scholars. Na quarta-feira, o ministro do Interior iraniano, Mostafa Najar, afirmou à imprensa que as eleições parlamentares seriam "gloriosas", com alto comparecimento da população. Para Haleh Esfandiari, mesmo que isso não ocorra, o regime islâmico vai mascarar dados para dizer que a eleição foi um sucesso. "Se eles precisarem, vão aumentar os números e divulgar que 60% dos eleitores participaram", disse ela, em entrevista à reportagem. O novo parlamento deve assumir após 21 de março, quando se comemora o ano-novo persa.

Israel e EUA discutem ataque As diferenças entre os governos de Israel e dos Estados Unidos sobre uma possível ação militar contra instalações nucleares do Irã deverão dominar a agenda da visita que o premiê Benjamin Netanyahu faz a Washington a partir de segunda-feira. "Será o principal tema", confirmou o próprio Netanyahu, antes de embarcar na noite de quarta-feira para o Canadá, em meio a rumores de que ele tentará obter do presidente Barack Obama uma declaração pública de apoio a um

“ataque preventivo” israelense. Embora afirme que "todas as opções" estão abertas para a crise iraniana, Obama tem sinalizado que seu governo espera ser consultado por Israel antes de qualquer iniciativa. "O Irã segue avançando rapidamente e com arrogância em seu programa nuclear, desprezando completamente as decisões da comunidade internacional", afirmou Netanyahu, que mantém com o presidente americano uma relação marcada por diferenças

em temas-chaves, como o processo de paz com os palestinos. O premiê será recebido na Casa Branca na segundafeira e, no mesmo dia, discursará para o Comitê Americano-Israelense de Assuntos Públicos (Aipac, em inglês), principal lobby pró-israelense que atua em Washington. O próprio Obama também falará perante a organização. A linha dura assumida por Netanyahu no impasse com o Irã é aprovada por 49% dos israelenses, segundo pesquisa

divulgada pela imprensa local. O vice-chanceler Danny Ayalon, considerado uma voz influente nas decisões de política externa, rejeitou um tratamento semelhante ao dispensado à Coreia do Norte, que já testou armas atômicas e acaba de anunciar uma moratória em seu programa nuclear, em troca de ajuda alimentar. “A Coreia do Norte já cruzou o limite da capacidade nuclear bélica, e não queremos em hipótese alguma que o Irã faça o mesmo”, disse Ayalon. (C.V.)

■ MALVINAS

Kirchner quer mais voos semanais DA AGÊNCIA ESTADO

A presidente da Argentina, Cristina Kirchner, anunciou que instruiu o presidente da estatal Aerolíneas Argentinas para que negocie com a chilena LAN uma mudança nos voos para as Ilhas Malvinas, chamada de Falkland pelos ingleses. Em troca de um voo semanal que a LAN oferece ao arquipélago, saindo de Punta Arenas, com escala em Rio Gallegos, a Aerolíneas Argentinas oferecerá três voos semanais, porém saindo de Buenos Aires até as Ilhas Malvinas. Os cerca de três mil kelpers, habitantes do arquipélago, temiam que a presidente, em al-

gum momento, pressionasse a LAN para suspender os voos e deixá-los isolados. Essa possibilidade chegou a ser aventada pela própria presidente durante assembleia da Organização das Nações Unidas (ONU), no ano passado, como forma de forçar o governo britânico a sentar-se para negociar a soberania das Malvinas com a Argentina. YPF. Em discurso de mais de três horas na abertura das sessões do Congresso Nacional, a presidente Cristina Kirchner não fez nenhum anúncio de medidas drásticas contra a petrolífera YPF, frustrando os crescentes rumores que circularam no mercado argentino,

na imprensa e no próprio governo nos últimos dias. Cristina apenas repetiu declarações feitas em discursos anteriores que criticam a queda de produção de petróleo e gás. “Desde que a YPF foi privatizada, a produção vem caindo vertiginosamente”, reclamou a presidente, recordando que “a Golden share do Estado e as que eram das províncias permitiam ao governo ter poder de decisão na empresa”. Atualmente, apenas o governo federal mantém a Golden share que lhe dá direito a veto nas decisões do conselho da YPF. As províncias perderam esse benefício após a privatização. Neste sentido, Cris-

tina reclamou do preço dos combustíveis e da elevada importação do setor em 2011, de quase US$ 10 bilhões. “Vamos tomar todas as medidas para garantir o abastecimento dos combustíveis na Argentina e da competitividade da economia no que diz respeito aos custos de produção. As grandes empresas têm que entender que parte de seus lucros se devem aos subsídios estatais”, afirmou Cristina. “É uma questão de defesa da lei de abastecimento, de defesa dos direitos argentinos, e vamos lutar com todas as armas que nos dá a Constituição e a lei vigentes para garantir isso”, disse a presidente.

■ ONU

Síria sem os 100% de apoio sino-russo DA REDAÇÃO

A Rússia e a China uniram-se aos demais membros do Conselho de Segurança da Organização das Nações Unidas (ONU) na quinta-feira para expressar decepção com o fato de o governo sírio não ter permitido a visita ao país da chefe de ajuda humanitária da ONU, Valerie Amos, e pedir que ela tenha a entrada na Síria autorizada imediatamente, informou a França. Os 15 países do conselho também afirmaram em um comunicado, aprovado por unanimidade, que “deploram” a deterioração rápida da situação humanitária no país, onde a repressão do governo aos manifestantes pró-democracia deixou mais de 7,5 mil civis mortos ao longo de 11 meses, de acordo com a ONU. TWITTER. A missão da França na ONU anunciou a aprovação da declaração por meio de sua conta no Twitter (@franceonu). Essa é a primeira declaração do conselho sobre a Síria em meses. O conselho vive um impasse desde agosto de 2011, quando repreendeu o governo sírio pela escalada da violência no país. Depois disso, Rússia e China vetaram duas propostas de resolução do Conselho de Segurança que condenavam Damasco e pediam o fim da violência. Os dois países diziam que nações ocidentais e árabes pressionavam por uma “mudança de regime” na Síria ao estilo do que ocorreu na Líbia. Em uma rara demonstração de boa vontade do go-

verno sírio, o Comitê Internacional da Cruz Vermelha (CICV ) recebeu "luz verde" para resgatar feridos, além de entregar medicamentos e alimentos aos moradores de Baba Amr. Saleh Dabbakeh, porta-voz do CICV em Damasco, explica que a nova operação deverá ser realizada na sexta-feira, em cooperação com a Crescente Vermelho da Síria. "Na última segunda-feira, retiramos três pessoas de Homs. Três dias antes, foram resgatados mais 27 civis. Em 13, 15 e 28 de fevereiro, levamos comida, cobertores, medicamentos e produtos de higiene para a população", lembrou, ao destacar que o CICV já está mobilizado na região. "Há mais necessidade de uma operação agora, porque a situação está cada vez mais difícil", admite, por telefone, ao Jornal do Commercio. JORNALISTAS. Os jornalistas franceses Edith Bouvier, gravemente ferida na perna, e William Daniels conseguiram na quinta-feira deixar a Síria e já estão no Líbano. A notícia foi confirmada pelo presidente da França, Nicolas Sarkozy. O casal estava há vários dias impedido de abandonar Homs, sob pesados bombardeios. "Edith Bouvier e William Daniels estão atualmente em segurança em território libanês e estarão sob a proteção de nossa embaixada em Beirute", declarou o mandatário. Em 22 de fevereiro, Edith foi atingida no bombardeio que custou a vida de dois colegas, a repórter norte-americana Marie Colvin e o fotógrafo francês Rémi Ochlik.

■ DOENÇA

Oficialmente, Chávez trabalha de Cuba DA AGÊNCIA REUTERS

O presidente da Venezuela, Hugo Chávez, voltou a trabalhar em questões governamentais em Cuba, depois de uma cirurgia bem sucedida por conta de uma suspeita recorrência de um câncer, informaram aliados na quinta-feira. Apesar da avaliação otimista dos ministros sobre o estado de saúde do líder socialista de 57 anos, persistem os rumores de que sua condição pode ser muito pior que a versão oficial. O ministro de Ciência e Tecnologia, Jorge Arreaza, disse que Chávez, que teve um possível tumor maligno removido no começo da semana, reuniu-se com vários membros do gabinete na noite de quarta-feira para discutir o progresso dos planos de bem-estar social do governo. “Eu saí de uma reunião de trabalho com o presidente-comandante”, disse ele via Twitter, o meio preferencial de comunicação de Chávez e seus aliados seniores nos últimos dias. Na quarta-feira no final da tarde, Chávez quebrou o silêncio desde que foi para Havana na semana passada, para enviar saudações à Venezuela. “Aqui vou eu, voando como o condor!”, escreveu ele em uma de uma série de mensagens otimistas no Twitter, supostamente de seu quarto no

hospital Cimeq, em Havana, onde acredita-se que ele esteja sendo tratado. OPOSIÇÃO. Com os resultados dos testes sobre o material extraído de Chávez durante a cirurgia devendo sair nos próximos dias, alguns jornalistas pró-oposição de dentro e fora da Venezuela vêm citando fontes médicas dizendo que o câncer do líder pode estar em metástase e ele pode correr risco de vida. O governo os chama de desestabilizadores de direita, mas detalhes sobre as condições de Chávez são escassos. Tendo prosperado com a imagem de força e energia desde sua primeira vitória presidencial em 1998, Chávez sofreu um golpe no ano passado com a descoberta de um câncer na pélvis. A credibilidade dele também foi abalada desde que ele anunciou no final do ano passado que estava completamente recuperado, mas teve que retornar a Havana para mais cirurgia. Não há informação sobre quando Chávez retornará, o que tem provocado pedidos da oposição pela nomeação de um substituto. O rival do líder venezuelano nas eleições de 7 de outubro é Henrique Capriles, um governador de 39 anos que espera atrair os eleitores de Chávez com a promessa de um governo de “esquerda moderna” ao estilo brasileiro.


cyan magenta amarelo preto

OPINIÃO B-10

EDITOR // LUÍS EDMUNDO ARAÚJO

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

SON SALVADOR FUNDADO POR PIERRE PLANCHER EM 10 DE OUTUBRO DE 1827 F U N D A D O R D O S D I Á R I O S A S S O C I A D O S : A S S I S C H AT E AU B R I A N D

GRÁFICA EDITORA JORNAL DO COMÉRCIO MAURICIO DINEPI Diretor-Presidente

ALFREDO RAYMUNDO FILHO Vice-Presidente Executivo

SOLON DE LUCENA Vice-Presidente Institucional

EDITORIAL

Morar Carioca A aprovação, pelo Senado Federal, do financiamento de US$ 150 milhões ( R$ 256,6 milhões) do Banco Interamericano de Desenvolvimento (BID) para a Prefeitura do Rio, no âmbito das ações do Programa Morar Carioca, coordenado pela Secretaria Municipal de Habitação e cuja meta é urbanizar todas as favelas da cidade até 2020, reforça a execução de empreendimentos de singular alcance, à luz de uma proposta de integração urbana de que o referido programa se tornou, desde o seu lançamento, em agosto de 2010, um referencial de reconhecida importância, no conjunto das iniciativas a esse respeito. O contrato entre a Prefeitura e o BID deverá ser assinado no prazo de 20 dias, nele estando prevista a contrapartida de US$ 150 milhões por parte do Município. Os recursos, ao que igualmente se anuncia, serão aplicados em pelo menos 20 comunidades com, ao todo, 28 mil domicílios, totalizando cerca de 100 mil moradores a serem beneficiados, em diferentes regiões urbanas. As intervenções do Morar Carioca, como igualmente se anuncia, incluem implantação de infraestrutura como redes de água, esgoto e drenagem; pavimentação e abertura de ruas; colocação de novos pontos de iluminação pública, além da construção de equipamentos sociais como escolas, creches, clínicas da família, cinema, centro de inclusão digital e outros. Além disso, o programa também atua para melhorar a acessibilidade e a mobilidade nas comunidades, e incorpora conceitos como conservação das obras, controle, monitoramento e ordenamento da ocupação e do uso do solo. Neste momento, como informa a Secretaria Municipal de Habitação (SMH), o Morar Carioca es-

tá presente em comunidades em todas as regiões da cidade, investindo R$ 2 bilhões e chegando a cerca de 70 mil domicílios. Até 2020, a meta é investir cerca de R$ 8 bilhões para urbanizar todas as comunidades do Rio. Nas comunidades da Babilônia e do Chapéu Mangueira, no Leme, a SMH já está investindo R$ 43,4 milhões em obras do Morar Carioca, tendo as intervenções, como objetivo, garantir uma infraestrutura adequada, com a implantação de novas redes de água, esgoto e drenagem. Por outro lado, as obras nessas comunidades, como se esclarece, têm uma característica especial que justifica serem chamadas de Morar Carioca Verde, devendo ser apresentadas aliás, pela Prefeitura, como modelos em prática de sustentabilidade na Rio + 20, a conferência da Organização das Nações Unidas que aqui será realizada em junho, vinte anos após as Rio 92. Além da urbanização, o Morar Carioca abrange outras quatro linhas de atuação:conservação do espaço público, controle do crescimento das favelas, legislação urbanística, com a criação de Postos de Orientação Urbanística e Social (Pouso), bem como o reassentamento de moradores de áreas de risco. Na variedade de ações compreendidas no programa e na variedade de efeitos diretos e indiretos que dele se irradiam, em perspectiva de ordenação do crescimento e correção das disfunções e desequilíbrios na ocupação do solo, abre-se espaço para a renovação e para a integração urbana e para a elevação dos índices de desenvolvimento humano, em escala que guarde, como se requer, razoável compatibilidade com as necessidades sociais, tais como atual e potencialmente se fazem sentir.

Exemplo a ser seguido É impressionante a capacidade de determinadas instituições de acumular benesses para beneficiar seus membros. É impressionante também a resistência de revê-las ou delas abrir mão. Vale o exemplo do 14º e 15º salário. Pressionada pela população, a Câmara Legislativa do Distrito Federal extinguiu os dois ganhos extras a que os distritais tinham direito, inspirados no exemplo dos colegas federais. É natural que os olhares se voltem agora para a Câmara e o Senado. As duas casas arcam, entre tantos outros privilégios, com o pagamento de 15 subsídios para os 513 deputados e 81 senadores. A cada legislatura (4 anos), a regalia onera o erário em R$ 126,9 milhões. Dois projetos de decreto legislativo propuseram acabar com a farra. Um, de autoria do deputado José Antônio Reguffe, do PDT do Distrito Federal. O outro, da senadora hoje chefe da Casa Civil, Gleisi Hoffmann (PT-PR). Ambos tiveram o mesmo destino – a gaveta. Deputados e senadores não querem sequer falar no assunto. Alegam que os dois depósitos não podem ser considerados vantagem. Constituiriam, isso sim, ajuda de custo para a atividade política, que exige deslocamentos. Ora, omitem os ilustres parlamentares que contam com verbas des-

tinadas a pagamento de passagens e despesas decorrentes de viagens aos estados. O que dizer dos representantes do Distrito Federal? Eles residem na capital, cidade que sedia os poderes da República. Além disso, há de levar em conta que, ao serem criados os salários extras, as comunicações andavam de mula. Hoje são on-line. Nada justifica o a crença de que, se todos são iguais perante a lei, o detentor de mandato é mais igual. Não é. Se o trabalhador embolsa 13 salários anuais, por que seu representante teria direito a 15? Passou da hora de mudar de mentalidade. Os tempos da casa grande e senzala passaram. Estamos na era da internet e das redes sociais. Mobilizar o cidadão na luta por causas justas está ao alcance de um teclar. Os deputados distritais servem de exemplo. Sem saída, curvaram-se à pressão popular. Há muito, lamentavelmente, os congressistas perderam a noção do papel que desempenham na sociedade. O Legislativo é um dos tripés em que se assenta a democracia. Fragilizado, desrespeitado e desacreditado, em nada contribui para o aprimoramento das instituições. Impõe-se reconquistar a confiança da população. Abrir mão de privilégios constitui passo importante que precisa ser dado. Agora.

cartasdosleitores@jcom.com.br

LEITORES

❚ ESPANHA

❚ CHÁVEZ

Nada mais justa e correta do que essa decisão do governo brasileiro de pagar com a mesma moeda a atitude discriminatória que a Espanha demonstra para com brasileiros na chegada ao seu país, como se todos os que lá desembarcam estivessem pretendo emigrar para aquele quase falido país. Em minha opinião, demorou demais para ser tomada.

O presidente Hugo Chávez, da Venezuela, foi operado, mas continua preso ao poder. Sua saúde deveria ser sua prioridade, mas o déspota está preocupado com a sucessão presidencial e com possíveis traidores infiltrados no chavismo, mascarados de progressistas. A raposa perde o pelo, mas não perde a vergonha. É o que acontece com quem chega ao poder de forma autoritária. Depois de instalado, Chávez, prepotente que é, passa o tempo fazendo ameaças àqueles que defendem uma eleição limpa e a alternância no poder. Chávez disse que com câncer ou em câncer disputará seu quarto mandato. Foi longe demais, esqueceu-se de que há um Deus que é quem vai dizer o que será melhor ao povo venezuelano. Vamos aguardar quem de fato manda.

Retaliação

RONALDO GOMES FERRAZ

JACAREPAGUÁ, RIO

Prepotência

IZABEL AVALLONE

SÃO PAULO, SP

❚ CORREÇÃO Diferente do que publicamos na página B-1 da nossa edição de 29 de fevereiro, a grafia correta do nome do diretor estatutário da Mirae Asset Securities é Pablo Spyer.

MEMÓRIA O JORNAL DO COMMERCIO PUBLICAVA NAS EDIÇÕES DE 2, 3 E 4 DE MARÇO

HÁ 150 ANOS REMÉDIO O remédio de Fahnstock é o melhor que há para tratar de problemas desagradáveis nos estômagos e intestinos, especialmente das crianças, que muito costumam se afligir por causa deste tipo de moléstia. Os fabricantes afiançam que o produto é muito bom e útil, além de não causar qualquer tipo de efeito nocivo ao organismo das pessoas que o utilizam com frequência. Na Rua Direita, 12. RECLAMAÇÃO Atenção: estando em trato a casa de pasto situada na Rua Senhor dos Passos, número 80, o anunciante participa que, se alguém tiver alguma reclamação a fazer contra o atual proprietário ou contra os negócios do respectivo estabelecimento poderá fazê-la no prazo de três dias a contar da publicação deste texto. Findo este período, não se atenderá a qualquer reclamação. PRIMÁRIO Atenção: precisa-se de um professor que seja habilitado em todo o curso primário, que exiba provas de sua moral e conduta. O candidato deverá ser solteiro, ter mais de 30 anos de idade e trabalhará em um colégio que fica for a desta corte do Rio de Janeiro. Para mais informações o interessado deverá dirigir-se sem demora à Rua dos Ourives, número 82, das 10 às 14 horas. HÁ 100 ANOS TROPA Sabe-se na Arábia que a Inglaterra pretende enviar uma tropa de mais de 300 homens para a re-

gião. O objetivo será evitar que um líder local de nome Mullah penetre no território sobre jurisdição britânica, que já estaria sendo ameaçado por tribos árabes sob o comando do carismático chefe. Os soldados da potência europeia deverão chegar já nos próximos dias ao território da Arábia. TRÁFICO Em sessão realizada ontem, em Haia, a Segunda Câmara dos Estados Gerais aprovou uma convenção internacional de combate ao tráfico de mulheres brancas em diferentes países do mundo. O problema tem se tornado muito intenso nos últimos tempo, o que motivou o surgimento da convenção, que deverá unir as nações em defesa das mulheres brancas que correm tal risco. CAPITAIS Círculos políticos de Montenegro comentam, de forma favorável, a recente visita do rei daquele país dos Balcãs à Rússia, onde esteve com o czar Nicolau. Espera-se que tal visita a São Petersburgo sirva para que o país consiga os tão desejados capitais franceses e russos para minorar os sérios problemas econômicos que o atingem nos últimos meses e que têm causado muita pobreza. HÁ 50 ANOS MINUANO Restam apenas algumas formalidades burocráticas para a inauguração da linha férrea que ligará Porto Alegre a Montevidéu. O anúncio foi feito ontem, no Rio de Janeiro, pelo superintendente da Viação Férrea do Rio Grande do Sul, engenheiro Vicente Raphael Fortunato, que veio à Guanabara

para tratar de problemas administrativos junto á diretoria da Rede Ferroviária Federal. Os trens da futura linha já foram apelidados de Minuanos. CUSTO DE VIDA O índice do custo de vida da Fundação Getúlio Vargas (FGV ), divulgado mensalmente, acusou em fevereiro deste ano um aumento de 2,1%. É a menor taxa de incremento do referido índice desde o início da crise política, em agosto do último ano, quando ocorreu a renúncia do então presidente da República, Jânio Quadros. O dado deixou muito otimistas os especialistas do setor econômico. ISENÇÃO Está isenta do imposto e taxa aduaneira ou de melhoramentos dos portos a importação de produtos paraguaios e constantes das concessões outorgadas a este país pelo Brasil. Recomendação expressa neste sentido foi feita pelo diretor das Rendas Aduaneiras, Milton da Costa Belhmam, em circular baixada sobre o funcionamento da Zona de Livre Comércio instituída pelo Tratado de Montevidéu. CÚPULA Diplomatas da União Soviética no Brasil enfatizaram ontem, no Palácio do Itamarati, que seu país insistirá com sua campanha em prol de uma nova reunião de cúpula para tratar da importante questão do desarmamento nuclear no mundo. Os soviéticos querem que todos os interessados sentem á mesa de negociação para que se chegue a um acordo sobre a redução ou completa eliminação das armas atômicas. JOSÉ PINHEIRO JÚNIOR


cyan magenta amarelo preto

OPINIÃO

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio B-11

DELFIM NETTO Carga tributária É natural a discordância de opiniões quando se discute o nível da carga tributária no Brasil. Praticamente só existe acordo em um ou dois aspectos importantes, a saber: os impostos pesam cada vez mais sobre o consumo do que sobre a renda e o Estado devolve cada vez menos ao cidadão serviços de qualidade. O valor total dos impostos cobrados dos brasileiros, que se manteve durante anos em 25% do PIB até a metade da década dos noventa no século passado, hoje representa 36%. Quando arrecadava 25%, o Estado investia entre 4% e 5% do Produto Interno Bruto. Ao longo das duas últimas décadas o investimento público foi caindo de nível, mantendo-se próximo dos 2% de tudo o que o Estado tomou do contribuinte privado. O crescimento foi sensivelmente prejudicado no período, ao se transferir os recursos do setor mais produtivo da economia para o menos produtivo. Isso torna muito mais difícil inclusive realizar as políticas que procuram diminuir as desigualdades sociais. Reduzir o montante da carga é muito difícil. O que se pode fazer é dar mais eficiência ao sistema, eliminar a burocracia, facilitar o recolhimento dos impostos. Mexer na tributação significa alterar o atual sistema de transferências, que é a forma pela qual o Estado cuida de distribuir os benefícios. Cada nicho da sociedade está recebendo um pedaço dos recursos nessa distribuição. O Estado não produz os recursos. Ele redistribui os que a sociedade produz. O máximo que ele faz é estimular o setor privado, apropriando-se de uma parte da produção. Esclarecer esses pontos é importante: em primeiro lugar, o Estado não pode distribuir nada que ele não tenha tomado de alguém; em segundo lugar, não adianta querer, a sociedade não pode receber mais em serviços do Estado

O Estado não produz os recursos. Ele redistribui os que a sociedade produz. O máximo que ele faz é estimular o setor privado, apropriando-se de uma parte da produção

do que aquilo que ele tenha recolhido dos contribuintes como impostos. Tem mais: num processo de redistribuição, sempre alguém vai ganhar e alguém vai perder; quem perder vai espernear mesmo que tenha sido dos que mais pediram reforma e eventualmente não avaliou bem o que estava exigindo. Quando estive no Congresso pude ver a dificuldade de se aceitar a premissa que alguém podia sair perdendo com a reforma tributária. Todos pensam no que ela pode beneficiar sua região e a população que os elegeu. É extremamente complicado mesmo nas coisas que são óbvias, como a cobrança do ICMS no destino da mercadoria. São coisas que exigem um amplo entendimento, negociações demoradas entre os Estados, que estabeleçam um período de “passagem” de um sistema de cobrança por outro e nem sempre há compreensão de como a mudança poderá funcionar. É por isso que a reforma tributária é uma coisa da qual muito se fala, mas com pouco entendimento sobre o fato que se trata do processo de transferência de renda, de benefícios e também de custos entre as pessoas e os entes federativos. É essencialmente uma questão de partilha dos recursos entre a União, os Estados e os municípios. O começo de tudo teria que ser reduzir a concentração dos recursos em mãos da União. Afinal nós somos uma federação, mas continuamos a ignorar que a vida acontece nos municípios, onde estão os problemas da saúde, da educação, mas agimos como se eles residissem em Brasília, de onde superministérios e uma gigantesca burocracia pretendem cuidar do ensino e do estado de saúde dos brasileiros.

Queremos um aluno feliz DA ACADEMIA BRASILEIRA DE LETRAS, PRESIDENTE DO CIEE/RJ E PROFESSOR DE HISTÓRIA E FILOSOFIA DA EDUCAÇÃO

de ou mesmo pelas contradições das fórmulas saídas da crise, num anticlímax que perdura após a derrota das esquerdas espanholas. O que mais marca a demissão histórica do governo de Madri é que poderá gozar, ainda, de uma flexibilidade tributária, para a intervenção pública, cancelada pelos pressupostos do status quo chegado ao poder. A Es-

www.jornaldocommercio.com.br E-mail: jornaldocommercio@jcom.com.br

REDAÇÃO E D ITO R A - E X E C UTI VA JÔ GALAZI jgalazi@jcom.com.br reportagem@jcom.com.br EDITOR ESPECIAL MARIO RUSSO mrusso@jcom.com.br Economia MARIO RUSSO mrusso@jcom.com.br PEDRO ARGEMIRO pargemiro@jcom.com.br

sados pedem convênios para estágio em empresas, uma garantia para o primeiro emprego, num Estado que vive excepcional fase de expansão econômica e social. Para isso, dizemos nós, nada mais simples do que mobilizar o Centro de Integração Empresa-Escola, com 47 anos de experiência na área e uma ilibada reputação. Mesmo que se empregue o recurso do pregão eletrônico, é difícil competir com o CIEE, dada a nítida comprovação da excelência

respectivos cursos de formação; 31% querem aulas de reforço e uma orientação vocacional adequada; 29% desejam atividades extras, como cursos de línguas e informáPrimeiro que tudo, é precitica, e matérias mais ligadas so que todos estejam na esao uso prático. cola. Hoje, a população braCerca de 27% pedem que sileira de 4 a 17 anos tem 3,8 os mestres faltem menos e milhões de crianças e jovens 26% reclamam banheiros em fora da escola, o que é um melhores condições. Senúmero impressionante. guem-se outras reivindicaQuando parecia que a quesções naturais, como ar contão da quantidade estava redicionado, computador densolvida, eis que surge a triste tro e fora da escola, maior serealidade. Em segundo lugar, gurança e a existência de buscamos a esuma boa e atualicola ideal, ainda zada biblioteca ou distante, que sesalas de leitura. Quando se trata de educar a nossa ria aquela em O que se pode juventude, a busca de soluções que os alunos seinferir disso tudo riam felizes, com é que a garotada mirabolantes nos parece o melhor praticamente tonão está desintecaminho para que nada se modifique das as suas neressada do processidades básicesso, sabe o que cas atendidas. quer, e certamenA Secretaria de Estado de dos seus resultados, sendo te isso encontrará eco no esEducação do Rio de Janeiro uma entidade filantrópica. pírito dos dirigentes. Quando encomendou ao Instituto Seguindo a linha das con- se afirma que há evasão no Mapear uma pesquisa para clusões da pesquisa mencio- ensino médio, fenômeno narevelar o perfil dos seus alu- nada, reparem nas reivindi- cional, quem sabe muitas nos de ensino médio. Há da- cações mais objetivas dos es- das razões estarão nesses dos interessantes, que ser- tudantes fluminenses: 37% itens que foram levantados vem para uma boa reflexão, querem cadeiras mais con- na pesquisa do Rio de Janeiro como a que está fazendo o fortáveis (o que torna o item e que bem poderão servir de Secretário Wilson Risolia. Por mais relevante em função da guia para as demais unidades exemplo, mais da metade do perspectiva de tempo inte- da federação. Quando se traefetivo da rede deseja um gral); 36% pedem que os pro- ta de educar a nossa juventucurso profissionalizante após fessores expliquem melhor de, a busca de soluções miraou antes da aula (51%), o que as suas matérias e mudem o bolantes nos parece o meprova o grau de insatisfação jeito de ensinar, o que vai ao lhor caminho para que nada com o confuso quadro da encontro do que sempre afir- se modifique. O melhor meio educação média nacional. mamos: é fundamental dar está na busca do entendiNo mesmo instrumento, um choque de ordem na for- mento desses pleitos, forma 47% dos estudantes pesqui- mação dos mestres em seus de chegar aos alunos felizes.

ARNALDO NISKIER

sidente, no impacto das previsões eleitorais, beneficiando o candidato socialista François de Hollande. Não há claramente programa econômico de recuperação à direita, e é melancólico que Não temos precedentes Sarkozy possa fazer apelo à de certezas tão tranquilas de defesa dos “valores francederrota, quanto as que se ses”, no eixo da sua futura pronunciaram, neste último pregação. Mas o pódio do fabiênio, em situações limites vorito continua vazio, na hecomo a da Espanha e, agora, sitação de antecipar os castida França. O gogos econômicos verno de Zapatero da recuperação, escolheu como que não poderá candidato um bofugir a um proNão temos precedentes de certezas tão de expiatório, cergrama fiscal tranquilas de derrota, quanto as que to da derrota, codrástico que, de se pronunciaram, neste último biênio, mo a própria convez, penalize o em situações limites como a da dição de sobrevicapital financeivência do Partido ro do país. Espanha e, agora, da França Socialista EspaMuito da nhol a largo prainesperada zo. Os números campanha de devastadores do desempre- panha seria, ainda, o único Merkel por Sarkozy resulta go, a mostrar a profundida- caso de escape à dilaceração dessa confrontação imediade da crise de 2008, não dei- final das esquerdas hoje, ta, em que a sobrevivência xavam nenhuma ilusão diante dos impasses estru- das esquerdas dependerá do quanto às esperanças das turais de governo no oci- ataque no cerne do próprio esquerdas, então no poder. dente europeu. Chegaram à modelo econômico em que De toda a forma, a fragmen- saturação fiscal, à irregene- se mantém a equação protação dos resultados locais, rabilidade do investimento dutiva do ocidente. Hollanespecialmente na Catalu- público, sem romper os cír- de é um herdeiro longínquo nha, não deu ao governo Pu- culos viciosos do capitalis- de León Blum, muito mais jol a visão de uma maioria mo pós-2008. do que de Mitterrand ou Josnítida e, sobretudo, a de É essa mesma sensação pin. Mas, não há outro país uma mobilização conserva- que leva, hoje, e exatamente europeu, em que uma consdora. Desaparecia toda pro- no extremo oposto, ao con- ciência social garanta, de fagramática, diante de um formismo com a da derrota to, militância política e a vimal-estar difuso do país, de Sarkozy nas próximas rada de página como a da roído pela crise, mas, espe- eleições de abril. Começa o França, agora no chamado cialmente, pela ambiguida- tartamudeio do próprio pre- crítico das urnas.

MEMBRO DO CONSELHO DAS NAÇÕES UNIDAS PARA A ALIANÇA DAS CIVILIZAÇÕES, MEMBRO DA ACADEMIA BRASILEIRA DE LETRAS E DA COMISSÃO BRASILEIRA DE JUSTIÇA E PAZ

Nós somos uma federação, mas continuamos a ignorar que a vida acontece nos municípios, onde estão os problemas da saúde, da educação, mas agimos como se eles residissem em Brasília

Professor emérito da FEA/USP. Ex-ministro da Fazenda, Agricultura e Planejamento

Os simétricos descaminhos europeus CANDIDO MENDES

delfimnetto@terra.com.br

RIO DE JANEIRO

SÃO PAULO

BRASÍLIA

MINAS GERAIS

Rua do Livramento, 189 - CEP 20.221-194 - Rio de Janeiro - RJ Telefone geral: (21) 2223-8500 jornaldocommercio@jcom.com.br

Avenida Moema, 170 - 120 andar - Conjs 122 e 123 Planalto Paulista - São Paulo - SP - CEP 04077-020 (11)5051-5115 jornaldocommercio.sp@jcom.com.br

SCN Qd. 2 Bl. D Edifício Liberty Mall Torre A salas 410/412 - CEP 70712-903 - Tel.: (61) 3037-1280 jornaldocommercio.bsb@jcom.com.br

Rua Tenente Brito Melo, 1223 Cj 604 Barro Preto - Belo Horizonte Tel: (31)3048-2310 - CEP 30180-070

País LUÍS EDMUNDO ARAÚJO laraujo@jcom.com.br

Empresas MARTHA IMENES mimenes@jcom.com.br

Mundo RODRIGO OTÁVIO CRUZ MOREIRA rcmoreira@jcom.com.br

Direito & Justiça LUÍS EDMUNDO ARAÚJO laraujo@jcom.com.br

Rio de Janeiro KATIA LUANE kluane@jcom.com.br

JC&CIA KATIA LUANE kluane@jcom.com.br

São Paulo RODRIGO OTÁVIO CRUZ MOREIRA rcmoreira@jcom.com.br

Caderno Artes MÁRIO RUSSO mrusso@jcom.com.br

Opinião LUÍS EDMUNDO ARAÚJO laraujo@jcom.com.br

Artes Gráficas RICARDO GOMES rgomes@jcom.com.br

Mercados DIRLEY FERNANDES dfernandes@jcom.com.br SERVIÇOS NOTICIOSOS Agências Estado, Folhapress, Brasil, France Presse, Bloomberg e Reuters

DEPARTAMENTO COMERCIAL

ADMINISTRAÇÃO

RIO publicidade@jcom.com.br (21)2223-8590

Diretor Administrativo e Financeiro NELSON GIMENEZ CORRÊA gimenez@jcom.com.br

Diretor Comercial

Gerente Comercial

JAIRO PARAGUASSÚ jparaguassu@jcom.com.br

ROZANA MARQUES rmarques@jcom.com.br

SÃO PAULO Gerente Comercial WALDEMAR GOCKOS FILHO wfilho@jcom.com.br (11) 5051-5115

BRASÍLIA Gerente Comercial MARCELO DE LUCENA mlucena@jcom.com.br (61) 3037-1280

MINAS GERAIS MÍDIA BRASIL COMUNICAÇÃO LTDA. Rua Tenente Brito Melo, 1223/604 - Barro Preto Belo Horizonte -MG -CEP: 30180-070 comercial@midiabrasilcomunicacao.com.br (31) 3048 -2310

Circulação 2223-8570 / 2223-8545 circulacao@jcom.com.br Departamento de Cobrança (21) 2223-8516/2223-8509 Fax. 2223-8599 cobranca@jcom.com.br D.A PRESS MULTIMÍDIA ATENDIMENTO PARA VENDA E PESQUISA DE IMAGENS

Departamento de Compras compras@jcom.com.br (21) 2223-8500, ramal 9582

Endereço: SIG Quadra 2, nº 340, bloco I, Cobertura – 70610-901 - Brasília – DF, de segunda a sexta, das 13 às 17h E-mail, fax ou telefone: (61) 3214.1575/1582 | 3214.1583 dapress@diariosassociados.com.br, de segunda a sexta, das 13 às 21h / sábados e feriados, das 12 às 18h


cyan magenta amarelo preto

JC&CIACARREIRAS B-12 Jornal do Commercio

EDITOR // KATIA LUANE

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

OÁSIS - Rio de Janeiro se transformou no principal destino de profissionais atrás de oportunidades de trabalho. O momento econômico do estado é o principal atrativo, mas a qualidade de vida na cidade contribui para o movimento

A nova rota dos executivos

BIANCA MELLO

C

CARLOS CONTAR

DIRETOR REGIONAL DO RIO DE JANEIRO E ESPÍRITO SANTO DO GRUPO BUSINESS PARTNERS CONSULTING

Há cerca de oito anos, muitos profissionais saíram do estado em busca de oportunidades de trabalho em outras grandes capitais”.

NICHOLAS SPITZMAN

CEO DO SITE BRASILEIRO ALUGUETEMPORADA

A oportunidade ainda agrega três setores que crescem no Brasil que são a internet, o setor imobiliário e o turismo”.

DESENVOLVIMENTO

Oportunidades em todo o estado O estudo Decisão Rio 2011-2013 prevê que os investimentos em infraestrutura servirão como fonte de atração de novos negócios para o estado. Os benefícios se espalham pelo Rio de Janeiro em quatro eixos de desenvolvimento: Norte, Sul, Leste e Sepetiba. O eixo da região sul tem como motor principal a construção da terceira usina nuclear brasileira, em Angra dos Reis. O investimento previsto é de R$ 10 bilhões em toda a cadeia produtiva. O de

O CEO do site brasileiro AlugueTemporada, Nicholas Spitzman, é filho de mãe brasileira e pai americano naturalizado. No início dos anos 1990, os negócios para seu pai no Brasil não estavam bons e a família se mudou do Rio de Janeiro para os Estados Unidos. Spitzman é carioca e, depois de mais de 15 anos morando fora, voltou ao Rio de Janeiro para assumir o AlugueTemporada e comandar todas as operações da

Sepetiba possui uma combinação de portos, rodovias e indústrias. A localização geográfica da Baía de Sepetiba atraiu o interesse de diversos grupos para a construção de novos portos. O eixo de desenvolvimento do norte fluminense inclui os investimentos para a construção do Complexo Portuário do Açu, que atrai novas empresas, gerando demandas de mão-de-obra e infraestrutura. O Leste é apoiado pela construção do Complexo Petroquímico do Rio de

empresa no País. O site faz parte de um grupo global chamado HomeAway, que vem expandindo sua atuação no Brasil e principalmente no Rio de Janeiro, onde instalou a sua sede. Spitzman estava fazendo MBA na Filadélfia quando soube que o grupo HomeAway buscava um executivo para assumir a operação no Brasil que entendesse da realidade dos dois países. "A oportunidade ainda agre-

Janeiro (Comperj) que deve criar inclusive oportunidades no setor terciário (comércio e serviços) e na construção civil. Além dos quatro eixos, o estado deve continuar se destacando em seus setores tradicionais que são petróleo e gás, naval e turismo, complementados pelos investimentos em infraestrutura. Por tudo isso, a pesquisa do Sistema Firjan concluiu que os investimentos recordes que o estado já está recebendo, continuarão nos próximos anos.

ga três setores que crescem no Brasil que são a internet, o setor imobiliário e o turismo. Para encontrar uma chance igual fora do País é mais difícil", ressalta o CEO do AlugueTemporada. Leandro Pires, da General Brands, espera ficar na cidade por muitos anos e apesar de ainda estar se adaptando, tudo está sendo mais fácil do que imaginou que seria. "Na minha opinião, a qualidade de vida aqui é maior que em São Paulo.

É uma cidade tão grande quanto e eu não preciso ir muito longe para ir à praia", brinca o executivo. CRESCIMENTO. Spitzman afirma que está satisfeito com a oportunidade, mas que não é possível ter previsão de como será daqui para frente. "Há cerca de 10 ou 15 anos, ninguém teria previsto um crescimento do Brasil a esta escala, então é impossível diz-

PRATELEIRA TÍTULO: 17 Princípios do trabalho em equipe AUTOR: John C. Maxwell EDITORA: Thomas Nelson Brasil PREÇO: Sob consulta NÚMERO DE PÁGINAS:168 Pode-se até mesmo perder um jogo, mesmo tendo bons jogadores no time, mas não se pode vencer se não for possível contar com nenhum deles. A regra vale tanto para o esporte quanto para o ambiente corporativo. Entretanto, como alguém pode tornar-se um craque em sua equipe de trabalho? Ou ainda, como identificar os jogadores talentosos que são mais necessários ao time? Com estas questões em mente, o autor – uma referência mundial em tudo o que diz respeito à liderança – ensina que existem apenas duas opções: treinar ou contratar um talento nato. Nesta obra, ele descreve quais são as 17 principais virtudes que todo líder sonha para sua equipe de trabalho. O leitor descobrirá que

qualidades como a capacidade de adaptação, comprometimento e disciplina são essenciais no sucesso profissional. Também saberá como colocá-las em prática e incentivá-las entre os integrantes de uma equipe. Se o leitor faz parte de alguma equipe ou exerce alguma posição de autoridade em uma, pode ter a certeza de que terá em mãos o livro certo para o tema. Muito bem suprida de ensinamentos, a obra é fundamental para a biblioteca de um executivo que pretende liderar ou destacar-se em uma organização empresarial ou de outro ramo. Seguindo as diretrizes estabelecidas pelo autor, será bem mais fácil chegar a uma equipe perfeita, com as peças em pleno funcionamento. O leitor poderá ler capítulos como Adaptável, Colaborador, Compromissado, Comunicativo, Competente, Confiável, Disciplinado e Expansivo; importantes temas para quem deseja trabalhar com sucesso em equipe e tornar-se um verdadeiro líder de destaque.

er onde a empresa estará daqui a 10 anos. O céu é o limite", opinou. Pires observa que para que o executivo aceite ser remanejado de cidade, é importante ter o apoio da empresa. A organização precisa oferecer algo a mais e dar apoio financeiro para o profissional ter tranquilidade para trabalhar. "Acho que quem está buscando crescer na carreira deve aceitar este tipo de desafio, pois é bem visto pelo mercado de trabalho", diz Pires. Na avaliação de Spitzman, não existe perfil ideal de profissional. O que existe são pessoas dispostas a crescer e que topam novos desafios. "Muitas pessoas estão aproveitando o cenário econômico, outras estão retornando à cidade natal como eu. No momento, estou apostando a minha carreira nesta oportunidade", afirma o executivo. Na opinião de Carlos Contar, a expansão do mercado de trabalho ressalta a importância estratégica do capital humano para as empresas. "O recrutamento passou a exercer maior impacto na gestão de RH em decorrência dos altos índices de retorno que esta ferramenta pode gerar para as organizações", observa Contar.

Katia Luane kluane@jcom.com.br A consciência da missão no interior da equipe e da organização como um todo e a necessidade premente de aperfeiçoamento também são abordadas pelo autor na obra em análise. Enfim, um “prato cheio” também para os estudiosos da arte da liderança no mercado nacional. John C. Maxwell é o maior especialista em treinamento de líderes de todo o mundo. Palestrante e escritor com cerca de 20 milhões de livros vendidos em dezenas de países, é o fundador das organizações Injoy Stewardship Services e Equip., que já treinaram mais de 1 milhão de líderes em todo o planeta. Em suas palestras, é comum encontrar executivos das maiores empresas americanas e líderes de governo. Entre os vários best sellers de John C. Maxwell publicadas pela editora Thomas Nelson Brasil estão O Livro de ouro da liderança, Liderar é influenciar, As 21 Irrefutáveis leis da liderança, A Atitude vencedora, A Arte de formar líderes e Dia a dia com Maxwell, além de muitos outros.

REPRODUÇÃO

om os novos negócios do pré-sal, o aquecimento da construção naval e civil, bem como da siderurgia, mais as obras previstas para as Olimpíadas, o Rio de Janeiro vem abrindo muitas frentes de trabalho. Segundo o estudo Decisão Rio 2011-2013, do Sistema Firjan (Federação das Indústrias do Estado do Rio de Janeiro) , a economia fluminense movimentará, em investimentos, recursos públicos e privados R$ 181,4 bilhões nos próximos três anos. De acordo com o estudo, os investimentos não se restringem à região metropolitana. Com o mercado de trabalho aquecido, diversos executivos estão chegando ou retornando à cidade. O diretor regional do Rio de Janeiro e Espírito Santo do Grupo Business Partners Consulting, Carlos Contar, afirma que as companhias vêm contratando em ritmo acelerado e oferecendo ótimas oportunidades com remunerações compatíveis às empresas do exterior. Contar lembra que há cerca de oito anos, muitos profissionais saíram do estado em busca de oportunidades de trabalho em outras grandes capitais. O atual movimento para o Rio deve-se tanto aos profissionais fluminenses que retornam quanto às empresas instaladas no estado. "Pessoas estão voltando e, ao mesmo tempo, as empresas estão recrutando em outras localidades para atender à demanda de mão-de-obra", completa o consultor. A fabricante de néctar de frutas, gelatinas e refresco em pó General Brands espera dobrar o faturamento no estado do Rio de Janeiro este ano (fechar com R$ 12 milhões). Para ampliar sua participação no mercado fluminense, a empresa criou uma gerência regional de vendas e convidou o executivo Leandro Pires para coordená-la. Ele trabalha na empresa há 11 anos e ocupava o cargo de gerente de varejo da Grande São Paulo e Baixada Santista. Pires conta que a proposta foi feita no final de janeiro e o fato de ser na cidade do Rio fez toda a diferença. Talvez se tivesse sido para outra localidade ele não tivesse aceitado tão prontamente. O executivo nasceu e morou a vida inteira em São Paulo. É solteiro, está com 27 anos, e acredita que isso também facilitou na hora da mudança de estado.


i

m m m m m m m m m m m m m m m m m m m

m m m m m m m m m m m mm m m m m m mm

m mm m m m m m m m m mm mm m m m

I

s m m e m t m m m r m m m A m m

INEXORAVEL

C-1

SEXTA-FEIRA E FIM DE SEMANA, 2, 3 E 4 DE MARÇO DE 2012 :: Editor Mario Russo :: mrusso@jcom.com.br

NAIRA SALES

O Centro Cultu-

ral Banco do Bra-

sil (CCBB-Rio)

apresenta, até 22

de março, a 11º

Mostra do Filme Li-

vre (MFL), que segue

depois para Brasília,

pela primeira vez, e pa-

ra São Paulo, onde já

aconteceu em 2011. A

mostra, realizada desde

2002, bateu todos os recor-

filme m m m m m m m m m m m m mm m m m m m m mm livre invade des este ano com 801 inscri-

tos. Os cariocas poderão as-

sistir aos 180 filmes seleciona-

dos e outros 50 convidados

com que há de mais ousado na

produção audiovisual indepen-

dente nacional. Com exibições

gratuitas, por meio de senhas reti-

radas uma hora antes de cada ses-

são, os organizadores calculam atrair

cerca de 10 mil pessoas, entre as três

capitais, nas ações nos CCBBs e pelas

2

g

o rio

co n nt a in u p a a

parcerias com os cineclubes.


C-2

ARTES :: Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

i

m m m m m m m m m m filme livre invade o rio m m mm m mm m mm m mm m m m m mm m m m mm m m m m m m m m mm m mm mm m m m m m m m m m m m m m m m m m i

continuacao da

capa

m m m m m m m m m m m mm m mm m m m mm m m m mm m mm m m m mm m m m m m m m m mm m mm mm m m m m m m m m m m m m m m m m m

E

m m m m m mm mm m m m m m mm m m m m m m

ste ano estão previstos debates com o homenageado Edgard Navarro, logo na primeira semana da mostra, e o debate Que País é este?, sobre os problemas enfrentados pelos moradores do Porto do Açu nos últimos anos. Mais para o final do evento haverá o debate Cinema de Borda ou Trash Mesmo?, sobre o gênero, que ganhará na MFL seis sessões de curtas e longas.

m m m m m m m m m mm m mm m mm mm m mm m m m mm m m m m m m m m m m m m

m m m m m m m m mm m mm m mm mm m m m m mm m mm m m m m m m m m m m m m A FELICIDADE DOS PEIXES

p

ara esta edição, a MFL está dividida em Panoramas Livres (com oito sessões de curtas que passarão no cinema), Outro Olhar (com cinco sessões em vídeo), Curta o Longa (com nove longas precedidos de curtas) e diversas sessões especiais, como a Mostrinha Livre para a garotada, Sessão Salvá, em homenagem ao diretor Alberto Salvá, falecido recentemente, Sexuada (de temática sexual), Mundo Livre (com filmes feitos por brasileiros no exterior), Pílulas (com filmes de até cinco minutos) e Coisas Nossas (com filmes feitos pela própria curadoria e equipe da MFL). O curador da mostra Christian Caselli diz que a proposta da mostra é exibir filmes que fujam do lugar comum narrativo, preferencialmente (mas não apenas ) filmes feitos por conta própria, ou seja, indenpentes (de editais e patrocínios) , ou seja, livres de fato. A mostra quer potencializar estes filmes que, muitas vezes, encontram dificuldades de seleção em festivais que preferem mais glamour do que linguagem audiovisual”, diz o curador. Ainda segundo Caseli, a MFl quer mostrar que há vida inteligente sem verbas públicas, e que é possível fazer bons filmes com baixo custo. “São filmes bancados por leis e editais que custam milhões de verba pública e depois ainda são exibidos nos cinemas cobrando ingresso do público que, em tese, o bancou. Mesmo assim é raro ver um longa assim ter retorno comercial, ou seja, não seria melhor para todos que, ao invés de se gastar milhões para fazer um longa, que se usasse tal verba para produzir dúzias de curtas ou mais longas do que apenas um?”

m m m m m m m m mm mm m mm m mm m m m mm m m m mm m m m m m m m m m m m

m m m m m m m m mm mm m mm mm m m m m mm m m m mm m m m m m m m m m m m I

COM SABOR DE GASOLINA

ADORMECIDOS

O HOMEM QUE NaO DORMIA

o

curador destaca alguns dos filmes que vão ser exibidos, como o da pré-estreia, o longa O Homem que não Dormia, o último longa de Edgard Navarro, além da exibição do anterior, Eu me Lembro (grande vencedor do Festival de Brasília de 2005), ambos exibidos em 35mm, e de todos os seus curtas e do seu clássico, o média O Super Outro, de 1989. Teremos um dia também para o Mestre do Terrir, Ivan Cardoso, exibindos três filmes raros dele. Na parte Trash ou Bordas?, teremos filmes curiosos, como o longa Capital dos Mortos, filme de mortos-vivos ambientado em Brasília, além do curta Mistério na Colônia, de 2003, estrelado por Luciano Huck em início de carreira e todo sujo de sangue. O organizador da mostra, Guilherme Whitaker, atribui ao sucesso de recorde de inscrições a uma série de fatores. “Uma, de forma mais prática, foi o aumento do consumo de aparelhos eletroeletrônicos no País, e isso incluí desde celulares que filmam ao melhor da tecnologia atual, como câmeras 5D, 7D. Ou seja, nunca foi tão prático e barato se expressar audiovisual-

BRATISLAVA

mente no mundo e isto inclui, é claro, o Brasil com o seu momento econômico favorável. Outro fator é que os brasileiros cada vez mais estão se expressando em vídeo e conseguindo visibilidade viainternet, o que aumenta a produção de filmes. Ou seja, não estamos mais esperando entrar em circuito comercial para fazer qualquer coisa, nem mesmo entrar na TV ou ganhar editais”, explica Whitaker. A MFL também vai premiar 13 filmes e seus realizadores serão convidados para virem ao Rio de Janeiro para receberem o troféu Filme Livre! e conversarem com o público. Diferentemente de outros festivais, os destaques a serem premiados são escolhidos não por um júri convidado, mas pela própria curadoria, que também escreve um texto inédito sobre cada filme premiado. A oficina de vídeo desta edição será a Oficina do Fim do Mundo, com orientação dos cineastas Petter Baiestorf, de Santa Catarina, e Christian Caselli, ambos referências na realização de filmes de baixo orçamento e muita ousadia. A oficina é gratuita e acontecerá entre os dias 6 e 15 de março, de 13h30 às 16h30, no próprio Centro Cultural Banco do Brasil.

m m m m m m m m mm mm m mm m mm m m m mm m m m mm m m m m m m m m m m m 11ª MOSTRA DO FILME LIVRE – MFL 2012CENTRO CULTURAL BANCO DO BRASIL :: Rua Primeiro de Março, 66 - Centro :: Telefone: 3808 -2020 :: Entrada franca :: Distribuição de senhas 1h antes de cada sessão :: www.bb.com.br/cultura e www.twitter.com/ccbb_rj :: Mais informações:http://www.mostradofilmelivre.com :: www.facebook.com/mostradofilmelivre :: Até 22 de março


C-3

ARTES :: Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

MÚSICA

MESTRE HERIVELTO, 100 ANOS Um dos grandes astros do rádio brasileiro, na primeira metade do século 20, e compositor chave para a riqueza da música popular nacional em qualquer época, Herivelto Martins será homenageado neste final de semana na Caixa Cultural Rio. O Show Cem Anos de Herivelto Martins foi idealizado e dirigido pelo músico Gabriel Azevedo e comandado por seu grupo Casuarina, e contarará com participações especiais do cantor Moyseis Marques, um dos grandes representantes da nova geração do samba brasileiro, Áurea Martins, que já cantou e excursionou com Herivelto, e Nilze Carvalho, cantora e instrumentista consagrada. NAIRA SALES

C

antor, compositor, instrumentista e entusiasta do rádio, Herivelto Martins é autor de grandes clássicos da música brasileira, entre eles, muitos sambas, como Praça Onze, parceria com Grande Otelo. “Os dois se encontravam no vestiário do Cassino da Urca e o Grande Otelo insistia para que Herivelto musicasse uma letra sua. Não tendo mais como fugir do colega, o compositor decidiu transformar aquele ‘romance’ em samba e surgiu Praça Onze. Tempos depois, empolgado com a canção, Herivelto escreveu uma continuação, Laurindo , que já começa afirmando: ‘Não acabou a Praça Onze, não!’”, conta Gabriel Azevedo, que promete lembrar, entre uma e outra música, algumas histórias do homenageado. Não podiam ficar de fora do repertório canções como Segredo, parceria com Marino Pinto, Meu Rádio e Meu Mulato e Saudosa Mangueira. Gabriel Azevedo conta que o repertório será voltado para o samba de Herivelto, não esquecendo o sambista Herivelto, de sua história com as escolas de samba, por exemplo. “Com um repertório tão vasto, achamos que uma homenagem justa ao compositor seria focarmos no samba, já que essa é a proposta do Casuarina”, explica o músico.

ARQUIVO JCOM/D.A PRESS

Além desses três dias, o grupo pretende levar a homenagem a outras cidades do Brasil. “A obra do Herivelto já faz parte do patrimônio cultural do nosso País, e tenho certeza de que, por onde passarmos com esse espetáculo, a identificação do público será imediata. Conseguimos o apoio da Caixa Cultural aqui no Rio, o que possibilitou a realização do projeto. Vamos correr atrás de mais parceiros que possam viabilizar a continuação dessa justa celebração”, diz. Herivelto Nasceu há cem anos, em 30 de janeiro de 1912, no distrito de Rodeio (hoje município de Engenheiro Paulo de Frontin), no Rio Janeiro. Herivelto é especialmente conhecido pela participação no grupo Trio de Ouro, no qual também cantavam Nilo Chagas e Dalva de Oliveira. Herivelto manteve um turbulento e apaixonado caso de amor com Dalva, tornada série de TV em 2010, escrita por Maria Adelaide Amaral, com Adriana Esteves no papel de Dalva e Fábio Assunção no de Herivelto. Além do casamento com Dalva, casou-se outras duas vezes e teve sete filhos, um deles, o cantor Pery Ribeiro, falecido em fevereiro. Herivelto morreu em 1992, aos 80 anos.

CEM ANOS DE HERIVELTO MARTINS :: Caixa Cultural Rio de Janeiro – Teatro de Arena :: Av. Almirante Barroso, 25 – Centro :: Telefone: 2544 -4080 :: Até 3 de março às 19h :: Ingressos: R$ 20 :: www.caixa.gov.br/caixacultural

MÚSICA Capacidade: 200 lugares João Carlos Assis Brasil, piano Programa: Tributo a Ernesto Nazareth

P R O G R A M A Ç Ã O DIA 1º – QUINTA-FEIRA – 12H30 Clube de Engenharia Av. Rio Branco, 124-22º Andar – Centro Capacidade: 80 lugares Músico: Paula da Matta, piano Programa: Chopin, Liszt, Piazzolla

DIA 22 – QUINTA-FEIRA – 19 HORAS Museu Militar Conde de Linhares Av. Pedro II, 383 – São Cristóvão Capacidade: 80 lugares Musica no Museu – Encontro de Corais Programa: Clássicos brasileiros

DIA 2 – SEXTA-FEIRA – 15 HORAS Centro Cultural Light Rua Marechal Floriano, 168 – Centro Capacidade: 182 lugares Duo Milewsky – Jersy Milewsky, violino, e Aleida Schweitzer, piano Programa: Paganini, Sarasate, Handel, Bach, Z. Huba DIA 3 – SÁBADO – 12H30 Museu do Exército / Forte Copacabana Praça Cel. Eugenio Franco, 1 – Posto 6 Capacidade: 200 lugares Coral Al-Shalon (Israel) Programa: Havenu Shalom Aleichem, Adon Olam, Cuando El Rey Nimrod (Avraham Avinu), Mi Haish, Oseh Shalom, Shir Lashalom, Yerushalayim Shel Zahav, Hatikva DIA 4 – DOMINGO – 11H30 Museu da República Rua do Catete, 153 – Catete Capacidade: 80 lugares Paulo Brasil, piano Programa: Villa-Lobos, Chopin DIA 5 – SEGUNDA-FEIRA – 12H30 Biblioteca Nacional Rua México, s/n – Centro Capacidade: 120 lugares João Wilson & Sérgio Ribeiro, duo de violões Programa: Edmundo Villani-Cortes, Luís Carlos Barbieri, Erik Satie, Mário Castelnuovo, Enrique Granados DIA 7 – QUARTA-FEIRA – 12H30 Teatro Sesi-Centro (Firjan) Av. Graça Aranha, 1 - Centro Capacidade: 450 lugares Músico: Turíbio Santos, violão Programa: Villa-Lobos, Agustin Barrios, Dilermando Reis, Turíbio Santos, João Pernambuco, Isaac Albeniz, Luiz Gonzaga DIA 8 – QUINTA-FEIRA – 12H30 Museu Nacional de Belas Artes Av. Rio Branco, 199 – Centro Capacidade: 110 lugares Dia Internacional da Mulher Alda Leonor, piano Programa: Chiquinha Gonzaga, Dinah Menezes, Lavínia Cazzani, Maria Amélia, Maria de Lourdes Campelo, Diva Lyra

DIA 23 – SEXTA-FEIRA – 12H30 Centro Cultural Justiça do Trabalho Av. Presidente Antônio Carlos, 251 – térreo – Centro Capacidade: 70 lugares Quarteto de Clarinetas – Camila Claudino, Midian Miguel, Andressa Leal e Thatiana da Silva Programa: Handel, Pixinguinha, Ernesto Nazareth e Zequinha de Abreu

Mês especial no Música no Museu NAIRA SALES

O projeto Música no Museu realiza uma programação especial este mês no Rio de Janeiro. Em comemoração aos 15 anos de grandes conquistas, o Música no Museu montou uma programação junto ao público para reforçar ainda mais a programação. Este mês a atração dos dez melhores concertos é mais que especial: Turíbio Santos – um dos maiores violonistas brasileiros e responsável pelo concerto inaugural do festival, em 1997, no Museu Nacional de Belas Artes – está completando meio século de carreira e se apresenta no seu aniversário, na próxima quarta-feira. “Inicialmente teríamos os 10 Melhores Concertos da Série, mas as manifestações foram tão grandes que resolvemos ampliar este numero a cada mês. A idéia inicial, porém, está mantida: toda a primeira quarta-feira do mês, no teatro SesiCentro- Firjan apresentaremos os mais votados”, explica o Diretor do Musica no Museu, Sérgio Costa e Silva. A grande atração internacional é o Coral da Lituânia que se apresenta no dia 12 na Igreja Nossa Senhora da Paz e, também comemorando 60 anos de Brasil, Odette Ernest Dias e Noel Devos, dois nomes sagrados da musica clássica no Brasil apresentam-se no Museu da República. Enfim um mês de comemorações, homenagens e grandes atrações nos seus 30 concertos, todos gratuitos.

Cedmon Alves, violão Programa: Francisco Tárrega, Cedmon Alves e João Pernambuco

DIA 9 – SEXTA-FEIRA – 15 HORAS Centro Cultural Justiça Federal Av. Rio Branco, 241 – Centro Capacidade: 144 lugares Artur Cimirro, piano Programa: Bach, Beethoven, Chopin, Rubinstein, Balakirev; Tausig, Strauss / Godowsky, Cziffra, Nazareth

DIA 11 – DOMINGO – 11H30 Museu da República Rua do Catete, 153 – Catete Capacidade: 80 lugares Homenagem a Gershwin Jazztopia – com participação de Wolfram Goebel (Alemanha), sax tenor, Lennart Goebel (Alemanha), piano, e Sami Kontola (Finlândia), bateria Programa: George Gershwin

DIA 10 – SÁBADO – 11H30 Museu Parque das Ruínas Rua Murtinho Nobre, 169 – Santa Teresa Capacidade: 100 lugares

DIA 12 – SEGUNDA-FEIRA – 18H30 Igreja Nossa Senhora da Paz Praça Nossa Senhora da Paz – Ipanema Capacidade: 500 lugares

Coral Pro – Música da Universidade de Vilnius, Lituânia e do Coral Altivoz da UERJ Programa: Bach, Rossini e Tadeusz Melon DIA 13 – TERÇA-FEIRA – 12H30 Arquivo Nacional Praça da República, 173 – Centro Capacidade: 150 lugares Duo Cedmon Alves, violão, e Mauro Pestana, percussão Programa: Américo Jacomino, Villa-Lobos, Bach, Cedmon Alves DIA 14 – QUARTA-FEIRA – 12H30 Museu da República Rua do Catete, 153 – Catete Capacidade: 80 lugares Música De Câmera Pro Arte – Luiza Braga, flauta, Ivan Scheinvar Tavares, violino, e

Costa e Silva diz que o diferencial do festival entre as versões internacionais e a brasileira é que o Musica no Museus é todo gratuito devido as leis de incentivo. “Lá fora custa de U$ 800 a U$100, de 80 a 120 euros”, diz. Música no Museu tem o orgulho de já ter trazido os maiores nomes da musica clássica brasileira nestes 14 anos: Nelson Freire, Arnaldo Cohen, Artur Moreira Lima (várias vezes), João Carlos Assis Brasil, Paulo Moura, Miguel Proença, Clara Sverner, Leo Gandelman, Maria Teresa Madeira, OSB, OSB Jovem e outras orquestras além de grandes atrações internacionais, com apoio de embaixadas e consulados de vários países. “Esta colaboração dos músicos tem sido fundamental e, atualmente, apesar de fazer esta quantidade de concertos, há uma grande demanda ainda não atendida mas que esperamos atener ao longo do ano”, diz Costa e Silva. Ao longo de seus 14 anos, o Música no Museu já foi patrocinado pela Telebras/Telerj, Petrobras, Eletrobras, Furnas, Banco Bradesco, Carioca Engenharia, Açominas, Concremat, TBE, e nos últimos anos vem sendo patrocinado pela Light (Rio de Janeiro), Cemig (Minas Gerais), BNDES (Norte-Nordeste) e na versão internacional com o apoio de embaixadas do Brasil nos vários países e a Duffry. Tudo dentro das leis de incentivos fiscais o que proporciona a gratuidade de seus eventos.

Pedro Borges, piano Programa: G.P. Telemann DIA 15 – QUINTA-FEIRA – 18 HORAS Centro Cultural Justiça Federal- Sala de Sessões Av. Rio Branco, 241 – Centro Capacidade: 82 lugares Gaetano Galifi, violão Programa: Gaetano Galifi, Joaquin Turina, Chopin e Paganini DIA 16 – SEXTA-FEIRA – 15 HORAS Centro Cultural Justiça Federal Av. Rio Branco, 241 – Centro Capacidade: 144 lugares Villa-Lobos inJazz Programa: Villa-Lobos

DIA 18 – DOMINGO – 11H30 Museu da República Rua do Catete, 153 – Catete Capacidade: 80 lugares Monica Kudless, piano Programa: Debussy e Chopin DIA 20 – TERÇA-FEIRA – 12H30 Clube de Engenharia Av. Rio Branco, 124 – 22º andar – Centro Capacidade: 80 lugares Marcos Leite, piano Programa: Carlos Gomes, Franz Ventura, Mozart, Camargo Guarnieri e Alberto Nepomuceno DIA 21 – QUARTA-FEIRA – 19H30 Iate Clube do Rio de Janeiro Av. Pasteur, nº 333 – Urca

DIA 24 – SÁBADO – 11H30 Museu Parque das Ruínas Rua Murtinho Nobre, 169 – Santa Teresa Capacidade: 100 lugares Trio Dilettante Programa: Handel, Bach, Vivaldi e Mozart DIA 25 – DOMINGO – 11H30 Museu da República Rua do Catete, 153 – Catete Capacidade: 80 lugares Luiz Bomfim, barítono, e Regina Lacerda, piano Programa: Handel, Schubert, Schumann, Carlos Gomes, Verdi, Rossini e Puccini DIA 27 - TERÇA-FEIRA – 18H Museu do Exército / Forte Copacabana Praça Cel Eugenio Franco, 1 – Posto 6 Duo Tocata Dois – Roberto Velasco, violão, e Rubens Küffer, flauta Programa: Velasco DIA 28 – QUARTA-FEIRA – 12H30 Museu da República Rua do Catete, 153 – Catete Capacidade: 80 lugares Odette Ernest Dias, flauta, e Noel Devos, oboé Programa: Beethoven, Bach, Andre Jolivet DIA 29 – QUINTA-FEIRA – 12H30 Museu Nacional de Belas Artes Av. Rio Branco, 199 – Centro Capacidade: 110 lugares Monica Kudiess, piano Programa: Debussy e Chopin DIA 30 – SEXTA-FEIRA – 12H30 Museu Histórico Nacional Praça Marechal Âncora, s/n - Centro Suoni, cravo, e Silenzi, flauta Programa: Francesco Mancini, Francesco Barsanti, Domenico Scarlatti e Arcangelo Corelli DIA 31 – SÁBADO – 19H Clube Hebraica – Rio Rua das Laranjeiras, 346 – Laranjeiras Capacidade: 90 lugares Coral Al-Shalon (Israel) Programa: Havenu Shalom Aleichem, Adon Olam, Cuando El Rey Nimrod (Avraham Avinu), Mi Haish, Oseh Shalom, Shir Lashalom, Yerushalayim Shel Zahav, Hatikva


C-4

ARTES :: Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012 TEATRO

TEATRO

MERGULHO NUM MUNDO DE SENSAÇÕES ONÍRICAS GUGA MELGAR/DIVULGAÇÃO

DANIEL SCHENKER ESPECIAL PARA O JORNAL DO COMMERCIO

A Cia. Omondé nasceu da elogiada experiência de As Conchambranças de Quaderna, junção de textos de Ariano Suassuna, autor com quem a diretora e atriz Inez Viana travou cumplicidade artística. Agora permanecem na dramaturgia brasileira, migrando, porém, para terreno mais contemporâneo. Jô Bilac foi o dramaturgo escolhido. Os Mamutes está em cartaz no Espaço Sesc, em Copacabana.

O poder das imagens no teatro de Tchekhov DANIEL SCHENKER ESPECIAL PARA O JORNAL DO COMMERCIO

O Grupo Oficcina Multimédia, fundado há 35 anos, realiza uma apropriação singular de O Jardim das Cerejeiras, uma das mais importantes peças de Anton Tchekhov. O espectador não se depara com o texto do autor russo – centrado num momento de passagem, no qual a ordem de valores deixa de ser afetiva e se torna pragmática –, e, sim, com uma ousada criação imagética. “Na montagem, suprimimos o texto. Não utilizamos uma única palavra. Optamos por outra linguagem: a não verbal, que comunica apenas pela sucessão e superposição de imagens com um discurso próprio e uma lógica similar a dos sonhos, onde tudo se dilui, ou se desfaz, ou se desloca. É o próprio Tchekhov que afirma que uma imagem vale por muitas palavras”, resume a diretora Ione Medeiros, acerca do trabalho desenvolvido pelo grupo mineiro. FOTOS GUTO MUNIZ E MARCO AURÉLIO PRATES/DIVULGAÇÃO

O espectador transita por espaço labiríntico em encenação influenciada por Hélio Oiticica A Cia. Omondé investe agora na dramaturgia contemporânea de Jô Bilac

“C

ontinuamos na pesquisa dos signos teatrais, nas partituras de grupo, no ilusionismo. Há referências ainda muito presentes em relação aos circos populares. Para este trabalho recorremos aos filmes de Jean-Pierre Jeunet e à dança do Angelin Preljocaj, que trazem sensações oníricas”, compara Inez. Em Os Mamutes, Isadora, menina perversa e inteligente, escreve a história de Leon, um rapaz honesto, criado pela avó através dos valores cristãos, que precisa de um emprego para sustentá-los. Com isso, tenta uma vaga de fritador de hambúrgueres na Mamute’s Food, um fast food que vende hambúrguer de carne humana. Para conseguir a vaga, ele precisa matar um mamute – um ser humano sem valores morais. Este dilema o persegue e ele se vê diante de uma encruzilhada: matar um ser humano, por pior que ele seja, e carregar essa culpa, ou entrar para o sistema e se tornar também um mamute? A música, bastante presente em As Conchambranças de Quaderna, terá a mes-

ma importância no novo espetáculo. “O diretor e criador musical, Marcelo Alonso Neves, arregimentou três músicos (acordeão, clarone e percussão) para não só tocar os temas criados, mas possibilitar que a música contracenasse com os atores e pontuasse as cenas”, diz. Também em cena, Inez conduz elenco formado por Débora Lamm, Cristina Flores, Carolina Pismel, Ricardo Souzedo, Diogo Camargos, Luiz Antonio Fortes, Jefferson Schroeder, Iano Salomão, Zé Wendell, Junior Dantas e Juliane Bondinie. No próximo trabalho da Omondé, a brasilidade deverá ceder espaço à dramaturgia estrangeira clássica.

“As imagens vieram de sua própria obra. Na ultima cena de O Jardim das Cerejeiras, ouvimos o som das machadadas derrubando as cerejeiras em flor. Nesta descrição, a força da imagem aliada à presença do som nos coloca diante da questão referencial da obra. É o próprio Tchekhov que conclui sua peça e no lugar do discurso de encerramento ele apenas nos confronta com imagens sem personagens, mas que falam e nos fazem pensar. A cerejeira tem uma floração efêmera que não ultrapassa 15 dias. Cortar as cerejeiras em plena floração demonstra a insensibilidade e a ganância por lucros imediatos, deflagrando uma mentalidade imediatista, que quer instalar o progresso a qualquer preço. As consequências deste imediatismo tornam-se cada vez mais evidentes em nossos dias, e todos estamos pagando um preço muito alto por ela”, afirma a diretora Ione de Medeiros. As Últimas Flores do Jardim das Cerejeiras poderá ser visto apenas até domingo no Espaço Sergio Porto.

ANTONIO PESSOA/DIVULGAÇÃO

TEATRO

PARA SENSIBILIZAR O PÚBLICO DANIEL SCHENKER ESPECIAL PARA O JORNAL DO COMMERCIO

Influenciado pelo trabalho desenvolvido na Cia. Teatro Autônomo, de Jefferson Miranda, Miguel Thiré desenvolveu uma pesquisa centrada na relação entre ator e espectador que chega agora ao palco: O que Você Gostaria que Ficasse, trabalho do Brecha Coletivo, fundado em 2006, pode ser conferido na Sala Multiuso do Espaço Sesc, em Copacabana. A montagem foi estruturada a partir de um entrelaçamento entre tudo o que foi estipulado ao longo do processo de ensaios e a abertura para assimilar a contribuição do público. Um direcionamento que tende a realçar as especificidades de cada apresentação, ainda que, inevitavelmente, uma noite nunca seja igual à outra em teatro. “Como ator e diretor, acredito que cada apresentação pode ser considerada única. Há o jogo da contracena, a troca com o público, participativo (no nosso caso) ou não. São fatores que fazem com que cada apresentação seja um acontecimento diferente. Quando a arte contemporânea surge, propondo uma expansão do conceito de arte, passamos a ter um novo receptor. Uma nova plateia, no caso do teatro, que participa efetivamente. Quantos fragmentos de outros espectadores estão em cena?”, questiona Miguel, que dirige os atores Cynthia Reis, Eduardo Cravo, Jarbas Albuquerque, Raquel Alvarenga e Suzana Nascimento. O que Você Gostaria que Ficasse parece problematizar,

O espetáculo aborda como ficaria o mundo sem a presença do homem

inevitavelmente, a noção tradicional de teatro. “Acho que é teatro em muitos momentos, mas não se sustenta só na cena. Estou preocupado em provocar algo na plateia e não em negar o teatro convencional”, garante. Em relação ao universo temático, o livro O Mundo sem Nós, de Alan Weisman, foi adotado como base. “Weisman pensou, junto com outros cientistas, o que aconteceria com o mudo como ele está agora sem a presença do homem (a partir de um passe de mágica). Como todos os nossos vestígios se comportariam sem nós? Quanto tempo demoraria para que sua casa, seu diário, o museu do Louvre ou a ponte Rio-Niterói deixassem de existir? Tudo se apagaria. Isto é dividido com o público. A partir dessa hipótese propomos um inventário das coisas que gostaríamos que ficassem conservadas sem sofrer a ação do tempo. Eu queria que ficasse um quadro de Van Gogh , a broa de milho da minha avó e uma viagem que fiz com amigos para Gericoacoara. E você?”, pergunta. Miguel Thiré retoma a função de diretor depois da bemsucedida experiência de Superiores. “São proposições diferentes. Superiores surgiu da minha pesquisa em mímica e teatro físico. Estudei com Desmond Jones, em Londres. Estou prestes a estrear outra criação na mesma linha. Um monólogo chamado O Cara, com Paulo Mathias Jr., previsto para maio. Já O que Você Gostaria que Ficasse surgiu de uma provocação voltada para um espectador que deixa de ser espectador”, compara.

A morte ronda os personagens de O Jardim das Cerejeiras. “O funeral de uma criança (na obra de Tcheckov, Gricha, filho de Liubov, que tinha cinco anos quando morreu) remete e reforça o caráter prematuro e inadequado do corte das cerejeiras, ceifadas no momento de sua máxima floração, e acentua o caráter irreversível de uma perda inaceitável. A morte é uma condição a qual estão sujeitos todos os que se defrontam com o Minotauro – ou seja, todos aqueles que não encontraram a saída do labirinto. A morte ronda o espetáculo, tendo no Minotauro e no seu confronto com Ariadne um embate simbólico, no qual o vencedor nem sempre será o mais forte.”, destaca Ione, traçando conexões com a mitologia. O espetáculo também promove uma articulação importante com Hélio Oiticica. “Este artista, em suas obras, sempre favoreceu os ‘adentramentos’, estimulando o público a penetrar espaços inusitados e passar por experiências novas. Com este objetivo, suas obras estimulavam todos os sentidos, promovendo um contato direto com o público, tornando-o vivo, criativo e participativo”, justifica.

O público (50 espectadores por sessão) é afastado de uma apreciação confortável e literalmente inserido num espaço labiríntico, uma instalação de 18m por 18m. O espaço é formado por cubos de metal e madeira e paredes de tecidos (algodão e filó, que recebem projeções em vídeo, e promovem multiplicidade de transparência e imagens). O chão é recoberto de carpete e sobre o labirinto são instaladas passarelas, pois a atuação acontece no solo e no alto das passarelas. “A forma assimétrica do cenário, a superposição de imagens, os corredores e espaços sem cadeiras, tiram o espectador de seu conforto e os coloca na condição de decifrar e escolher seu próprio caminho. Ele entra sem sapatos, se move em ressonância com o próprio espaço e escolhe seu percurso a partir das imagens que se deslocam dentro de uma área de 360 graus. Hoje os problemas se avolumaram e se acumularam e as saídas se tornam cada vez mais difíceis, cabendo a cada um a responsabilidade de refletir e passar pela experiência de buscar novos caminhos”, conecta.


C-5

ARTES :: Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

CINEMA

BICHO DE ESTIMAÇÃO QUE FALA É DESTAQUE EM BILLI PIG FOTOS: REPRODUÇÃO INTERNET/WWW.BILLIPIG.COM.BR

LUIZ CARLOS MERTEN DA AGÊNCIA ESTADO

Grávida de sete meses, Grazi Massafera sofre os inconvenientes da celebridade. “É a desvantagem de ter uma gravidez pública. Todo mundo sabe que estou de sete meses. Quase não me deixaram embarcar no Rio, para vir a São Paulo.” Grazi curte o seu momento Billi Pig. Ela queria acompanhar a pré-estreia da comédia de José Eduardo Belmonte em todas as praças. O filme entra esta sextafeira em 200 salas de todo o País. As restrições das viagens aéreas para grávidas estão impedindo que isso ocorra, mas Grazi ia forçar a barra para ir a Curitiba.”"Quero ver o filme com minha família.”

E

la está linda, deslumbrante, com aquela aura que a maternidade confere às mulheres. O bebê é uma menina. “Ele está muito feliz, vive todo esse processo com a mesma alegria e encantamento que eu.” Ele é o pai da criança, Cauã Reymond. Selton Mello, que conhece os dois – e estrela Billi Pig –, só tem elogios. “Grazi e Cauã são bonitos, são globais, podiam levar a vida só nas capas de revistas, mas estão muito empenhados em se superar. Levam a sério a representação, e são bons. Para mim, ela é a revelação do Billi. Espero que as pessoas percebam isso e não fiquem com preconceito, lembrando o BBB.” O diretor José Eduardo Belmonte concorda. “Já conhecia a Grazi através do Cauã, mas confesso que ela me surpreendeu no set. Grazi tem brilho próprio.” Ela admite que sofreu. “Para uma principiante, como eu, representar com todas aquelas feras, o Selton, Milton (Gonçalves), Otávio (Muller) e Milhem (Cortaz), era uma audácia. Me sentia uma abusada.” Todos ajudaram. “Foram generosos e o método do Zé (o diretor) aju-

dou bastante. Ele criou umas partidas de pingue-pongue. Jogávamos a três, a quatro. Revezávamos ao redor da mesa e o perdedor tinha sempre que criar umas improvisações.” Billi Pig nasceu da deliberada vontade do diretor de criar uma terceira via para o cinema brasileiro. Como ator e diretor, Selton Mello se antecipou e, com O Palhaço, criou o evento no cinema brasileiro do ano passado – 1,5 milhão de espectadores para um filme autoral, sensível. Num cinema brasileiro polarizado entre as comédias descerebradas, que arrebentam nas bilheterias, e o filme cabeça, que ninguém vê, O Palhaço apontou um outro caminho. Belmonte ingressa na mesma via, e arrisca tudo. “Sempre quis dialogar com a chanchada, fazer um musical. Billi Pig tem tudo isso, e mais.” Desde que passou em janeiro, na Mostra de Tiradentes, integrando a homenagem que o evento prestou a Selton Mello, Billi Pig tem recebido muitas críticas. “Tão falando muito mal, é?”, pergunta o diretor. Para ele, o filme não é diferente de seus anteriores, nem do próximo, que finaliza. O Gorila, com Alessandra Negrini, nasceu de uma encomenda. Nem por isso, Belmonte deixou de fazer o filme que queria, como queria. “Não sei se sou autor, mas tenho meu jeito de fa-

Gazi Massafera e Selto Mello: interpretações marcantes no filme de José Eduardo Belmonte

zer cinema, de encarar a vida e a arte, e tudo se mistura.” Billi Pig tem um crédito que não é original na carreira do cineasta. “Um filme de José Eduardo Belmonte e equipe.” Ele justifica o crédito dizendo que gosta de improvisar com os atores, e num filme com vocação de chanchada, então, deixou todo mundo solto para criar com ele. “Era uma loucura, de repente eu estava improvisando com o Selton, o Milton, que têm uma cancha enorme”, resume Grazi. O filme é sobre essa aspirante a atriz (Grazi) que tem um marido trambiqueiro (Selton). Eles se unem a um pastor também trambiqueiro (Milton), prometendo um milagre para um pai traficante cuja filha recebeu um tiro e entrou em coma. Imagine tudo isso com números musicais e um porco de brinquedo, cor de rosa (Billi), que fala. O porco é herança de uma ex-namorada do diretor. “Ela era maravilhosa, mas só dormia agarrada no seu ursinho.” O filme é um salto sem paraquedas do diretor. Grazi também arrisca. O marido e ela vieram do esporte. “Cauã fazia jiu-jítsu, eu venho do coletivo, o vôlei. O esporte nos ensinou a ousar, a testar os limites.” Independentemente do que você achar de Billi Pig, vai ter de concordar que ela é, sim, ótima.

TEATRO

Uma palestra sobre o preconceito DANIEL SCHENKER ESPECIAL PARA O JORNAL DO COMMERCIO

O monólogo Olá Pessoa foi adaptado do livro de Marcelo Garcia

A relação frontal, direta, entre a cena e o espectador desponta como elemento principal da Odeon Companhia de Teatro em Olá Pessoa, monólogo com Alexandre Cioletti, dirigido por Carlos Gradim, que desembarca no Espaço Anônimo, na Fundição Progresso (Lapa). “Nesse trabalho, focamos na atuação e na linguagem híbrida, mesclando cinema/vídeo e teatro. A linguagem é muito simples e voltada para o ator. A ideia é fazer com que o publico se sinta ouvindo uma história, palestra e tenha, inclusive, vontade de participar”, sintetiza Gradim, que, em 1998, fundou o grupo em Belo Horizonte, juntamente com a atriz e diretora Yara de Novaes. Olá Pessoa surgiu de uma adaptação do livro E Ninguém Tinha Nada com Isso..., de Marcelo Garcia, devidamente adaptado para a cena por Edmundo de Novaes Gomes (dramaturgo do grupo), sobre um servidor público que assume a própria homossexualidade. “A companhia sempre valorizou uma dramaturgia que buscasse compreender as inquietações humanas. Num primeiro momento discutimos a busca pelo poder e seu mal para a sociedade (Ricardo III, O Coordenador, Mata Hari). Depois mergulhamos na

angústia e na solidão, na busca por prazer e preconceito (Amor e Restos Humanos, Bárbara, Quando você está no Céu). Agora, Olá Pessoa tem como eixo o homossexualismo, mas também tentamos ampliar a discussão para qualquer tipo de preconceito e sua negatividade para uma sociedade saudável. O tema da homossexualidade me interessa particularmente porque toca em várias questões, como hipocrisia social, preconceito, afeto, crueldade e como a sociedade coloca à margem qualquer tipo humano que não se enquadra nos padrões ditos corretos”, explica. Gradim e Cioletti adaptaram o livro de Garcia e depois incluíram contribuições dos espectadores na costura dramatúrgica. “Durante um mês eu e Alexandre nos debruçamos na leitura do livro, enquanto paralelamente íamos improvisando e escolhendo as histórias que mais nos tocavam. Relacionávamos as histórias de Marcelo com o universo emocional de Alexandre para que a fala parecesse sua. Edmundo entrou no processo e costurou a dramaturgia até chegarmos à estrutura final do texto. Ao final do segundo mês de trabalho, fizemos ensaios abertos com a participação do público ao final, nos contando suas próprias histórias. Depois disso escolhemos algumas e finalizamos o texto, que chamamos de base, pois ainda hoje sempre o atualizamos para dimensionarmos o tema”, relata.

DIVULGAÇÃO

Alexandre Cioletti no monólogo Olá Pessoa, na Fundição Progresso


C-6

ARTES :: Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

O BERÇO DA PALAVRA

M A R C I O

Comer pelas beiradas

A

expressão, bastante popular, quer dizer ir aos pouquinhos. Aprendemos com nossas avós que mingau quente deve ser comido pelas beiradas, para não queimar a boca. Em Minas, a expressão cai como uma luva: quando algo parece muito difícil, o mineiro prefere ir devagar, sem pressa, até alcançar o objetivo. Em outras palavras, é a atitude do come quieto, o que faz mas não conta, não abre o jogo, não revela o pulo do gato – e quando você percebe, ele, no mocó, e sem alarde, já fez o que queria fazer. Na política, há partidos – como o antológico PSD mineiro de Alckmin e Benedito Valadares – que passaram décadas no poder comendo pelas beiradas alguns dos melhores nacos da política brasileira. Hoje, o PMDB cumpre o mesmo papel. Ocupa todos os espaços. Entra governo, sai governo, ele lá continua, lampeiro e serelepe. Mestre em comer pelas beiradas, não se queimar e preservar as posições conquistadas. Lição de sabedoria de muita raposa felpuda... FOLCLORE – O berço dessa palavra se deve ao antiquário inglês William John Thoms. Em 22 de agosto de 1846 – dia em que, aliás, se comemora o Dia do Folclore –, usando o pseudônimo de Ambrose Merton, ele publicou um artigo com o título Folk-lore na revista The Athenaeum, de Londres. Propunha o termo como apropriado ao estudo das lendas, tradições e superstições de um povo. Folk quer dizer (afim do alemão Volk), povo, nação, família + lore, (afim do inglês to learn), instrução, conhecimento, saber. Portanto, folk-lore ou folclore é a reunião das manifestações da sabedoria popular. Depois, o vocábu-

lo passou a designar a cultura originária das classes menos favorecidas, instrumento da história não escrita de um povo. Hoje, é reconhecido como ciência, a ponto de tornar seu objeto um tema de educação nas escolas e um bem protegido pela Unesco. Não é, por conseguinte, e como muitos pensam, simples coleção de fatos isolados e disparatados, e sim a fascinante reunião de tudo aquilo transformado, desde tempos imemoriais, um tesouro inesgotável. De certa forma, excelente lenitivo para a sofrida espécie humana. . . CARDÁPIO – Neologismo criado

pelo filólogo brasileiro Castro Lopes, com o que pretendia substituir o menu francês. Formou-se a partir das palavras latinas charta, folha de papiro, papel escrito e dapis, qualquer tipo de refeição ou comida. A palavra evoluiu para a supressão da sílaba ta, ficou cardapis e, afinal, cardápio, a lista escrita das iguarias disponíveis numa refeição. Embora usado hoje, o vocábulo não conse-

C O T R I M

marciocotrim@correioweb.com.br

guiu desalojar completamente o menu, que se universalizou a partir de seu berço na frase indication de ce qu’on aura à manger le plus menu détail, ou seja, indicação do que se tem para comer, até o mais miúdo pormenor. Bom motivo para abrir o apetite . . . O LEITOR SÉRGIO BELTRÃO deseja conhecer o berço do nome

de sua cidade natal, Tacaimbó (PE). A povoamento do lugar teve início na segunda metade do século 19. Foi quando lá chegou Luiz Alves Maciel, que se instalou numa fazenda. Mais tarde, em função da atividade pecuária e dos vários currais ali existentes, o lugarejo ficou conhecido como Curralinho. Anos depois, a empresa GreatWestern construiu a primeira estrada de ferro da região, inaugurada em 25 de dezembro de 1896. Na ocasião, o povoado ganhou o nome de Antônio Olinto, em homenagem ao engenheiro que construiu a estação da ferrovia. O nome Tacaimbó é indígena e significa pau oco. Lembra a tribo dos índios itacaités, que ali habitaram. Tacaimbó teve o nome oficializado em 1945. A cidade possui cerca de 15 mil habitantes e sua atividade predominante é a agropecuária. O ritmo do coco é uma de suas principais manifestações culturais e na feira de artesanato que lá se realiza todo sábado, marcada pela produção de bordados, ele é cantado e dançado em roda. Lúcia Freitas, secretária da prefeitura local, informa, com orgulho, que o município tem tido notável progresso e seus habitantes são conhecidos pela hospitalidade e cordialidade. Acrescenta delicado convite para uma visita. Quem sabe?

EXPOSIÇÃO

BRASILIDADE NA ARTE CONTEMPORÂNEA FOTOS CCBB-RJ/DIVULGAÇÃO

ANNA BEATRIZ THIEME

A percepção sobre o sentido da brasilidade na arte contemporânea é o fio condutor da segunda edição da Sala A Contemporânea, que será aberta ao público carioca na próxima terça-feira, com entrada franca, no Centro Cultural Banco do Brasil (CCBB-RJ). Artistas de diversas regiões do País participarão da nova programação do espaço, destinado exclusivamente à arte contemporânea brasileira emergente.

A

nova temporada começa com a instalação do artista paraibano José Rufino. Será a Divortium Aquarum – termo em latim que designa o espaço geográfico de separação das águas –, feita especialmente para a mostra. A instalação tem suas referências no universo dos rios e do mar. Segundo o artista, o Rio parece a cidade perfeita para a criação da instalação, já que está localizado em um sítio dominado por nascentes, rios, lagoas, uma enorme baía, além do mar. “O local onde está o CCBB mais ainda, porque já foi um ambiente alagadiço e cheio de canais que desaguavam na Baía de Guanabara”, diz Rufino.O destaque da instalação é a figura de resina reproduzindo a imagem do próprio artista, sobre uma antiga coluna de madeira, com cracas e ostras. Nas mãos deste “marujo” estão cordas partidas, numa referência à perda de controle da dezena de barcos usados, inteiros e cortados, que estão logo à sua frente e chegam a medir até sete metros. Rufino explica que a figura pensativa do homem parece atrair e orquestrar os barcos, ao mesmo

tempo que também parece os repelir. “O marujo empunha cordas de barcos partidas como se tivesse, de alguma forma, perdido o controle, passando a ser uma espécie de comandante anacrônico e silencioso”, explica. “Assim, ele próprio personifica o conceito de divortium aquarum. É dele que fogem as águas”, completa. No lado oposto ao marujo está uma estante guardando 100 garrafões de vidro, com água colhida de diversos rios que desembocam na Baía de Guanabara. Alguns deles contêm desenhos de iconografia colonial da cidade e motivos navais, impressos em papel impermeabilizado. Ainda de acordo com o artista, os barcos serão instalados à partir da localização do CCBB em relação ao Porto do Rio, posicionados como que se rompessem a parede, vindos de uma onda externa imaginária. Divortium Aquarum poderá ser visitada no

espaço até 22 de abril. A programação, idealizada pelo produtor Mauro Saraiva, seguirá com o coletivo Opavivará!, grupo de artistas do Rio de Janeiro, a partir do dia 30 de abril. A segunda edição da Sala A Contemporânea contará ainda com a dupla de artistas de São Paulo, Gisela Motta e Leandro Lima, além de Fernando Lindote, do Rio Grande do Sul, que terão suas obras expostas a partir da segunda metade do ano. Fechará a programação de 2012 da sala a dupla inventada exclusivamente para o projeto, os artistas Daniel Acosta, do Rio Grande do Sul, e Daniel Murgel, de Niterói (RJ). Ainda como parte da segunda edição, irão expor, em 2013, Cintia Marcelle, de Minas Gerais, Eduardo Berliner, do Rio de Janeiro, e Clarrisa Diniz, de Pernambuco, que fechará a temporada 2012/2013 da sala. Pela segunda vez à frente da proposta, Saraiva explica que ideia para a sala surgiu de sua

percepção quanto à falta de espaço para artistas na faixa dos 30 anos no circuito da arte contemporânea no Brasil. “Nesta segunda edição, resolvemos inovar, ao propor o conceito da brasilidade para a programação, além da criação de diversas categorias, como solo, dupla, dupla inventada, coletivo artístico e exposição coletiva com curadoria”, conta. “O fato de termos convidado artistas de vários cantos do País também irá contribuir para o sucesso desta edição”, acrescenta. Segundo Saraiva, o objetivo para a nova temporada foi buscar diferentes leituras do que é o Brasil para cada um dos artistas convidados. “Não estamos buscando um Brasil óbvio, folclórico. Ao contrário, estamos apresentando artistas nos quais a brasilidade aparece de forma diversa, nem sempre formal, mas certamente como potência criativa”, explica o produtor.

:: DIVORTIUM AQUARUM :: - José RufinoSala A Contemporânea :: 2º andar :: Centro Cultural Banco do Brasil :: Rua Primeiro de Março, 66 – Centro :: :: De terça a domingo, das 9 às 21horas :: Até 22 de abril :: Entrada franca ::


Leandro Brame

João Emílio

O leiloeiro Leandro Brame comandará no próximo dia 13, às 16 horas, na Travessa do Paço, sala 1.212, no Centro, o apartamento C01 do edifício situado na Rua Bartolomeu Mitre, 980, no Leblon, Zona Sul do Rio de Janeiro. O imóvel está vazio e em boas condições de conservação.

Automóveis, motocicletas e outros veículos, além de equipamentos e materiais em uma grande diversidade. Tudo isto o leiloeiro João Emílio apregoará em três eventos que ocorrerão até o próximo dia 16, em seu salão de vendas, na Estrada dos Bandeirantes, 10.639, ou pelo site www.joaoemilio.com.br.

Leilões

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

EVANDRO CARNEIRO - Leiloeiro venderá mais de 638 lotes durante cinco noites. Entre os bens estão incluídas obras de Di Cavalcanti e Iberê Camargo

Arte em Copacabana FOTOS: DIVULGAÇÃO

N

os dias 6, 7, 8, 9 e 10, às 20 horas, na Avenida Atlântica, em Copacabana, o leiloeiro Evandro Carneiro baterá o martelo e apregoará dezenas de bens de interesse para colecionadores ou simples amantes das artes. A exposição está marcada para ocorrer entre este dia 2 e 5 deste mês, das 12 às 21 horas, no mesmo local. O leilão terá duas grandes coleções: Astrid Monteiro de Carvalho e Linneo de Paula Machado. Serão, ao todo, 638 lotes distribuídos por cinco noites. As coleções foram formadas ao longo de quase 100 anmos e têm muitos destaques. Além de óleos de Cícero Dias, Pancetti e Di Cavancanti, o acervo conta com uma vasta coleção de porcelanas da

Companhia das Índias, brasonadas, imagens religiosas dos dois últimos séculos e mobiliário brasileiro do século XIX. Também serão vendidas obras como joias de Roberto Burle Marx e quadros de Iberê Camargo, Pancetti e outros. O catálogo do leilão tem 416 páginas e 647 obras reproduzidas, além de uma série de entrevistas com artistas e colecionadores brasileiros, realizada pelo crítico e historiador Frederico Morais e trechos de um ensaio sobre Castagneto de Clarival do Prado Valadares. Mais informações sobre o leilão de Copacabana pelo e-mail contato@soraiacals.com. br ou contato@evandrocarneiroleiloes. Outra opção é ligar para os telefones (21) 2540-0688, 25400106 e 9955-9914 (falar com Marcella ou Soraia Cals).

Obra Praia e Igreja de Santa Luzia, de Castagneto, e sopeira fina

■ JOÃO EMÍLIO

Automóveis e materiais

EDITOR // JOSÉ PINHEIRO JÚNIOR

Jornal do Commercio

D-1

■ ROGÉRIO MENEZES

Novidades em carros e equipamentos DIVULGAÇÃO

O leilão da última terça-feira, promovido por Rogério Menezes, registrou a venda de 340 lotes para um auditório completamente lotado, demonstrando o sucesso dos pregões realizados por este leiloeiro. Ele adianta que já está em preparação o próximo evento, que será na sexta-feira, dia 9 de março, às 11 horas. Os lotes estarão disponíveis no site à medida em que ocorrem as liberações das seguradoras, financeiras e demais empresas e, até a próxima quarta-feira, já serão centenas de carros populares, médios e de luxo, motos das mais variadas cilindradas e utilitários. Muito em breve, o leiloeiro Rogério Menezes estará apregoando também os veículos do Banco Pecúnia. Vale reforçar que além de apregoar veículos, o leiloeiro também vem realizando leilões online de equipamentos, materiais e sucata, onde tem alcançado ótimos resultados. Já foram realizados vários leilões deste tipo, sempre com uma participação muito significativa de arrematantes.

Mitsubishi Pajero TR-4 Este é, sem dúvida, um segmento que tem demonstrado ter um grande potencial e ainda estava sendo pouco aproveitado, o que foi observado pelo leiloeiro, à partir da quantidade de acessos em sua página na internet, que hoje beira cerca de 4 mil acessos diários. Sempre atento às mudanças, Rogério Menezes prepara muitas novidades para este ano. Elas podem ser acompanhadas diariamente no site w w w. r o g e r i o m e n e z e s . com.br, além do facebook e do twitter. O telefone do escritório do leiloeiro é (21) 22702270, onde sua equipe está preparada a informar e esclarecer dúvidas.

■ LEANDRO BRAME TATIANE THOMAZ

Automóveis, motocicletas e outros veículos, além de equipamentos e materiais em uma grande diversidade. Tudo isto o leiloeiro João Emílio apregoará em três eventos que ocorrerão até o próximo dia 16, em seu salão de vendas, na Estrada dos Bandeirantes, 10.639, ou pelo site www. joaoemilio.com.br. No dia 14, às 14 horas, no

Recreio, o leiloeiro baterá o martelo e venderá vários bens da Uranus. A visitação deverá ser agendada no e-mail visitas@joaoemilio.com.br. No dia 16, ás 14 horas, João Emílio comandará um pregão multimarcas de veículos como carros, motocicletas e caminhões. O leilão será na Estrada dos Bandeirantes e a visitação poderá ser feita no

■ C. ALBERTO BARROS

■ VALDIR TEIXEIRA

mesmo local, das 9 às 13h30 do mesmo dia. Também no dia 16, apenas pelo site, o leiloeiro venderá veículos e equipamentos da Light. O leilão está marcado para começar às 11 horas. Mais informações sobre os eventos comandados por João Emílio podem ser obtidas no site www.joaoemilio.com.br.

Imóvel de luxo na Zona Sul do Rio DIVULGAÇÃO

Transformador em bom estado

Sofisticação em Botafogo DIVULGAÇÃO

Terreno desocupado

Lotes em São Gonçalo No próximo dia 07/03/ 2012, o Leiloeiro Carlos Alberto Barros, levará a leilão uma área de terras com 45.329 metros quadrados , divididas em 112 lotes urbanos. O loteamento está pronto e todos os lotes serão vendidos livres, desembaraçados e quite com taxas e tributos. Trata-se de uma oportunidade ímpar de investimento, pois o empreendimento localiza-se próximo ao Shopping São Gonçalo e a Vibe Show (Casa de Espetáculo). A documentação, edital e plantas estão disponíveis no escritório do Leiloeiro à Av. Nossa Senhora de Copacabana, 540, sala 902 Copacabana - RJ. Maiores detalhes e informações nos telefones: (21) 2548-5850 e (21) 25474573 e sites: www.carlosalbertobarros.lel.br e www. leilaototal.com.br

Um grande pregão – com mais de 500 lotes – será comandado pelo leiloeiro Valdir Teixeira nos dias 6, 7 e 8 do próximo mês, às 20 horas, na Rua Assunção, 210, em Botafogo. A exposição ocorrerá nos dias 3, 4 e 5, das 16 às 22 horas, no mesmo local. Entre as opções estão quadros, objetos de decoração e móveis finos. Entre os quadros há, por exemplo, Abstração, de Barbosa (óleo sobre tela), Flores, de B. Poloni e Sala de Música, de H. Bernari, também óleos sobre tela. Também serão apregoadas esculturas como um casal de gansos (em murano), e uma oriental, representando Dama. Para quem optar por um móvel de época, há opções co-

Um dos quadros do pregão mo um criado mudo em madeira talhada, mesa de apoio (estilo Luiz XV) e escrivaninha com cadeira em madeira nobre. No mesmo pregão serão leiloados cômodas e muitos outros móveis de interesse e

sofisticação. No mesmo evento haverá opções em porcelana, cristais, espelhos e jóias, além de muitos outros objetivos de arte que agradam a diferentes gostos. Aparelhos para jantar e outros itens para uma casa nobre completam o extenso catálogo do leilão. Mais informações podem ser obtidas no site www.valdirteixeiraleiloeiro.com.br, onde há fotos das peças e pequenas descrições. O e-mail para contato é leiloeiro@valdirteixeiraleiloeiro.com.br. Telefones: (21) 2539-4907, (21) 2537-4040 e (21) 8205-3736. Peças muito antigas, ideiais para colecionadores, também farão parte do leilão de Botafogo.

■ EDGAR DE CARVALHO JR.

Veículos na Baixada O leiloeiro Edgar de Carvalho Jr. dando prosseguimento aos leilões autorizados pela Prefeitura de São de Meriti, na Baixada Fluminense, realizará hoje, dia 2, a partir das 10 horas, o leilão de veículos e sucatas de veículos, totalizando 300 lotes. O leilão ocorrerá na sede da empresa Alarm Rio 2004, localizada na Avenida Getúlio Vargas, n° 49, Vila São José, São João de Meriti. Os bens serão apregoados no estado em que se encontram de acordo com a Resolução 331 de 2009 do Contran que determina que os bens apreendidos pelo Sistema Nacional de Trânsito sejam desti-

nados à hasta pública após 90 dias e que não foram retirados dos depósitos. O arrematante irá adquirir o bem desonerado de multas e IPVA cabendo, entretanto o pagamento do IPVA relativo ao exercício de 2012. Incidirá sobre a arrematação a comissão de 5% do leiloeiro, ISS e ICMS com redução. O arrematante terá o prazo de 15 dias, após a emissão da nota fiscal do leiloeiro, para retirar o bem do pátio sob pena de pagar diária. A legalização do veículo arrematado deverá ocorrer no prazo máximo de 30 dias, sob pena de multas e perda de pontos na carteira.

Serão leiloados motos e autos dentre os quais: Honda CG 150 Titan, Honda C100 Biz, Honda CBX 200 Strada, Honda CBX 250 Twistter, Ford Fiesta, Kombi, Fiat Uno Eletronic, Apollo GL, Fiat Tipo entre outros. Para Edgar de Carvalho, “trata-se de uma oportunidade para quem quer arrematar moto ou auto por preços abaixo do mercado. O leilão de veículos apreendidos torna-se um dos melhores investimentos do momento. Lances poderão ser oferecidos através do site do leiloeiro www.edgarcarvalholeiloeiro.com.br ou pelo email carva61@attglobal.net..

O leiloeiro Leandro Brame comandará no próximo dia 13, às 16 horas, na Travessa do Paço, sala 1.212, no Centro, o apartamento C-01 do edifício situado na Rua Bartolomeu Mitre, 980, no Leblon. O bem está vazio e em boas condições. Trata-se, segundo o leiloeiro, de uma cobertura com sala, três suítes, cozinha, área externa com piscina e churrasqueira. O imóvel tem área construída de 111 metros quadrados. Lances online poderão ser feitos pelo site www.brameleiloes. com.br, acessando a opção Habilitese com antecedência de pelo menos 24 horas úteis antes do leilão presencial no Centro. O lance inicial é de R$ 1,09 milhão e a arrematação se fa-

Cobertura no Leblon rá à vista ou a prazo mediante o pagamento de 30% no ato da arrematação, a título de de sinal. O saldo remanescente deverá ser pago em até 30 dias da data do leilão. O leiloeiro enfatiza que trata-se de uma excelente oportunidade para a aquisição de um imóvel de qualidade em um dos melhores bairros da Zona Sul do Rio de Janeiro.

■ JONAS RYMER

Oportunidades em Niterói e Angra O leiloeiro público Jonas Rymer baterá o martelo e venderá uma série de imóveis até o próximo dia 12, incluindo apartamentos em locais como Angra dos Reis e Niterói. No próximo dia 12, às 14h30, no Fórum da Capital (Avenida Erasmo Braga, 115, Castelo), será vendido o apartamento 6, do bloco B do Condomínio Morada do Pontal, em Angra dos Reis. O apartamento constituise de sala, quarto, banheiro e uma minicozinha. No dia 5, às 12 horas, no átrio da Justiça Federal, na Avenida Rio Branco, 243, anexo II, Centro, Rymer venderá vários equipamentos como três bombas de combustível, marca Gilbarco e veículos como uma caminhonete marca Mitsubishi, a diesel. No mesmo dia, às 14h30, no Fórum da Capital, o leiloeiro baterá o martelo e venderá o apartamento 404 do bloco 5 do prédio da Rua Maturaca,

393, Penha, com sala, corredor, dois quartos e cozinha conjugada; o apartamento 902 da Rua Barão do Bom Retiro, 1.760, Engenho Novo, com área edificada de 64 metros quadrados e o apartamento 201 da Casa 6, situada na Rua Flack, 101, em Riachuelo, com dois quartos. No dia 6, às 12 horas, no átrio do Fórum de Niterói, Rymer venderá 50% de direito sobre o imóvel situado na Rua Coronel Moreira César, 229, loja 103 Trata-se de um bem com direito a uma vaga de garagem, Shopping Icaraí. Também serão vendias as salas comerciais 1.204 e 1.205, com direito às vagas 20 e 21, no pavimento térreo no edifício Andrade Neves, situado na Rua General Andrada Neves, 25, São Domingos, Niterói. Jonas Rymer ainda venderá vários outros imóveis , com opções no Centro de Niterói e Maracanã.


D-2

LEILÕES

Jornal do Commercio SCHULMANN

LEONARDO SCHULMANN LEILOEIRO PÚBLICO

CASA DUPLEX NO RECREIO - 306m2 Leilão Judicial - (direito e ação) RUA ARTHUR POSSOLO Nº 246 1º pavimento: sala, cozinha, área de serviço, quarto de empregada com banheiro, casa de caseiro na parte dos fundos, sala, quarto e banheiro e canil. Piscina na parte da frente. 2º pavimento: acesso escada interna, saleta, três quartos, sendo uma suíte, varanda e banheiro.

Leilões: 1ª data: 05/03/2012, às 12h (acima da avaliação) 2ª data: 15/03/2012, às 12h (melhor oferta) Local: Átrio do Fórum da Capital Av. Erasmo Braga nº 115 - térreo - Castelo Condições: Arrematação à vista, mais 5% de comissão do Leiloeiro, 0,25% de ISS e custas de cartório.

Tels.: (21)2533-0307 / 2533-2804

silasleiloeiro@globo.com - www.silasleiloeiro.lel.br

QUARTO/SALA NO LEME - Fundos; 49m2 Leilão Judicial

RUA GUSTAVO SAMPAIO Nº 410,

APT. 904

Imóvel: sala, quarto, cozinha, banheiro, quarto e banheiro de empregada. Leilões: 1ª data: 15/03/2012, às 16:30 h (acima da avaliação) 2ª data: 27/03/2012, às 16:30 h (melhor oferta) Local: Átrio do Fórum da Comarca da Capital Av. Erasmo Braga, nº 115 - térreo - Castelo Condições: Arrematação à vista, mais 5% de comissão do Leiloeiro, 0,25% de ISS e custas de cartório.

Tels.: (21)2533-0307 / 2533-6443

www.andersonleiloeiro.lel.br - anderson.leiloeiro@globo.com

LEILÃO EXTRAJUDICIAL

APARTAMENTO NA BARRA DA TIJUCA Rua Coronel Paulo Malta Rezende nº 180 bl 01 apto 1.803 – Barra da Tijuca Leilão será realizado no ATLANTICO BUSINESS HOTEL, situado na Rua Senador Dantas nº 25 – Centro, Rio de Janeiro

VENDERÁ EM LEILÃO 08 DE MARÇO às 11 horas CONDIÇÕES: À VISTA, 5% DE COMISSÃO, 0,25% DE ISS.

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

SCHULMANN

LEILÃO JUDICIAL

SALAS NO CENTRO AV. TREZE DE MAIO Nº 23

SALAS 430, 431 e 432

(4º PAVIMENTO) CENTRO / RJ Av. Treze de Maio nº 23 Grupo XIII – Salas 430, 431 e 432 – 4º pavimento – Centro.Edifício denominado «Darke», de ocupação comercial. Sexta-feira, dia 09 (nove) de março de 2012, a partir das 14:00 horas Pelo valor da avaliação Segunda-feira, dia 19 (dezenove) de março de 2012, a partir das 14:00 horas Pela melhor oferta acima de 50%. O Leilão será realizado no Átrio do Fórum da Comarca da Capital, sito à Avenida Erasmo Braga n° 115 – hall dos elevadores, andar térreo – Centro / RJ. Condições: à vista, 5% de comissão, 0,25% de ISS.

Maiores informações no site: www.schulmannleiloes.com.br Ou no escritório do Leiloeiro:

Maiores informações no site: www.schulmannleiloes.com.br Ou no escritório do Leiloeiro:

2532-1961 / 2532-1739 / 2532-1705

2532-1961 / 2532-1739 / 2532-1705

LEILÃO JUDICIAL

DEVIDAMENTE AUTORIZADO

LEONARDO SCHULMANN LEILOEIRO PÚBLICO

MELHOR OFERTA

PREFEITURA MUNICIPAL DE CASIMIRO DE ABREU

RECREIO DOS BANDEIRANTES

LEILÃO DE VEÍCULOS, MÁQUINAS E SUCATAS Dia 06 de março de 2012 – às 14h. Rua Waldemir Heringer, 380 Centro - Casimiro de Abreu/RJ.

LOTES 3,5,6,7,8,10 e 12, DA QUADRA 103 DA ESTRADA DO PONTAL POSSUEM UMA ÁREA TOTAL DE 3.252,83 m². Os lotes 3,5 e 6 (esquina) estão voltados para a Estrada do Pontal; os lotes 7 e 8 para a Rua Geraldo Irineu Joffily e os lotes 10 e 12 voltados para a Rua CW. INDIVIDUALMENTE: Lote 3: área de 451,81 m² avaliado por R$ 1.207.000,00 ; lote 5: área de 451,81 m² avaliado por R$ 1.207.000,00; Lote 6: área de 417,96 m² avaliado por R$ 1.127.000,00; Lote 7: área de 411,75 m² avaliado por R$ 741.000,00; Lote 8: área de 379,50 m² avaliado por R$ 689.000,00; Lote 10: área de 589,00 m² avaliado por 874.828,63 e Lote 12: área de 551,00 m² avaliado por 794.000,00. TOTALIZANDO UMA ÁREA DE : 3.252,83 M² COM VALOR TOTAL DE R$ 6.639.828,63 (seis milhões, seiscentos e trinta e nove mil, oitocentos e vinte e oito reais e sessenta e três centavos).

Veículos: VW/Kombi, VW/Gol, VW/Parati, VW/ Santana, Fiat/Uno, Fiat/Marea, Fiat/Fiorino, Furgão MB/180D, Peugeot/Partner. Retro escavadeira MF, Trator de Corte de Grama. Sucatas de Antenas Parabólicas, Armários de aço, Ap. de Ar condicionado, Ventiladores, Sucata Hospitalar, Informática, etc.

VISITAÇÃO Dia 05/03/2012 das 09h às 12h e das 13h às 15h E no dia do Leilão de 09h às 13:30 Locais de Visitação no site do Leiloeiro.

VENDERÁ EM LEILÃO 2ª DATA: 09 de MARÇO de 2012, Pela Melhor Oferta, às 13:00 hs,

Condições dos Leilões: Arrematação à vista, acrescido de comissão do Leiloeiro e ISS.

LOCAL: No Átrio do Fórum, sito na Av. Luiz Carlos Prestes s/ nº - Barra da Tijuca - RJ. Condições: Preço à vista ou a prazo de 15 dias, mediante caução de 30%, comissão do Leiloeiro de 5%, ISS de 0,25% e custa de Cartório de 1% até o limite máximo permitido por Lei.

Catálogo e Fotos dos Lotes no site do Leiloeiro PEDRO JOSÉ DE ALMEIDA - LEILOEIRO PÚBLICO Tel.: (21) 2560-4824 / Cel.: 7874-2906 / ID: 91*10197 www.pedroalmeidaneto.com.br // leiloes@pedroalmeidaneto.com.br

(21) 9394-4009 leiloes@andrekuhne.lel.br

LEILÃO JUDICIAL

JUÍZO DE DIREITO DA DÉCIMA SEGUNDA VARA CÍVEL DA COMARCA DA CAPITAL EDITAL DE 1ª e 2ª PRAÇAS E INTIMAÇÃO a DIRCE DO NASCIMENTO MACHADO, com o prazo de 05 (cinco) dias, extraído dos autos da AÇÃO DE COBRANÇA DE COTAS COMDOMINIAIS movida pelo CONDOMINIO DO EDIFICIO ESTRELA FORMOSA contra DIRCE DO NASCIMENTO MACHADO (Proc. nº 2001.001.103378-3, atual nº 0105976-57.2001.8.19.0001), na forma a seguir: O Dr. ÁLVARO HENRIQUE TEIXEIRA DE ALMEIDA, Juiz de Direito da Décima Segunda Vara Cível da Comarca da Capital, FAZ SABER, por este Edital, a devedora e demais interessados, que no dia 19/03/2012, às 16:30 horas, no Átrio do Fórum da Comarca da Capital, situado na Av. Erasmo Braga, nº 115 - térreo (hall dos elevadores) - Castelo - pelo Leiloeiro Público SILAS BARBOSA PEREIRA, será apregoado e vendido a quem mais der acima da avaliação, ou no dia 29/03/2012 nos mesmos horário e local, a quem mais der independente da avaliação, o imóvel constituído pelo apartamento 506 do bloco A do edifício situado na rua Haddock Lobo nº 61, Estácio, com avaliação atualizada de R$111.575,42 - O imóvel será vendido livre de débito de condomínio, IPTU e taxas, de acordo com o art. 130, parágrafo único do Código Tributário Nacional, desde que o produto da venda comporte, após satisfeito o crédito do autor. Caso contrário, fica ciente o arrematante que arcará com referidas dívidas.- Condições de venda: pagamento imediato do preço ou em até quinze dias mediante caução idônea; mais 5% de comissão ao Leiloeiro, 0,25% de ISS e custas de Cartório de 1% até o máximo permitido.- As certidões de praxe encontram-se nos autos e serão lidas no ato do pregão.- Caso a devedora não seja intimada por outra forma legal, fica pelo presente edital intimada das hastas públicas, suprida assim a exigência contida no § 5º do art. 687 do CPC.- Outro Edital, na íntegra, encontra-se afixado no Átrio do Fórum e nos autos.- RJ, 07/02/2012.- Eu, Maria Amália De Abreu Costa, Escrivã(o)/RE, Matrícula nº 01/25891, o fiz digitar e subscrevo. (as) Dr(a). ÁLVARO HENRIQUE TEIXEIRA DE ALMEIDA, Juiz de Direito.

SALA E TRÊS EM RAMOS LEILÃO JUDICIAL - MELHOR OFERTA

Caderno de Leilões. Todas às sextas no Jornal do Commercio

Apartamento 201,

BAIRRO DO RIACHUELO

na Rua Emílio Zaluar, nº 40 – Ramos/RJ.

APARTAMENTO Nº 403 – BlOCO I Á RUA MARECHAL BITTENCOURT Nº 154 = EDIFÍCIO PORTINARI = Apto com direito a uma vaga na garagem, de lateral dividido em sala, sacada, dois quartos, banheiro, cozinha acoplada c/ área de serviço + dep. de empregada. Edifício c/ 02 Blocos, 06 pav e 04 aptos por andar, dispõe de 2 elevadores. Área: 59 m2.

De frente, divide-se em sala, 03 quartos, cozinha, copa, 02 banheiros e depósito. Área de 80m². Edifício fachada em pastilhas, esquadrias de alumínio, 05 andares, 04 aptos por andar , mais duas coberturas no quinto andar. Dispõe de porteiro eletrônico.

Ás 14:00 hs, no Átrio do Fórum da Capital, á Avenida Erasmo Braga, nº 115 – térreo, Hall de entrada, Centro/RJ.

VENDERÁ EM LEILÃO Dia 09/03/2012, às 15:00 horas, acima da avaliação Dia 19/03/2012, às 15:00 horas, pela melhor oferta Edital, RGI e fotos no site LOCAL DO LEILÃO Rua Aristides Caire, nº 53 – Méier/R.J.

Condições: Arrematação à vista, 5% comissão ao leiloeiro, 0,25% de ISS e 1% de custas de cartório até o máximo permitido.

Condições do Leilão: À vista, 5% de comissão ao Leiloeiro, 0,25% de ISS e custas judiciais de 1% do valor da arrematação até o máximo permitido por Lei.

VENDERÁ EM LEILÃO

Dia 08 de Março de 2012 – pela melhor oferta.

Av. Erasmo Braga, nº 277 – Sala 511 / 512 Tel: 2220-0863 - Site: www.gustavoleiloeiro.lel.br

COMARCA DA CAPITAL JUÍZO DA 16ª VARA CÍVEL EDITAL DE 1ª E 2ª PRAÇA / LEILÃO E INTIMAÇÃO COM PRAZO DE 05 DIAS, EXTRAÍDOS DOS AUTOS DA AÇÃO DE DESPEJO POR FALTA DE PAGAMENTO MOVIDA POR MARIA CRISTINA TAVARES NEGREIROS EM FACE DE JULIO LUIS SIQUEIRA PROCESSO Nº 2003.001.068489-4 (0066962-95.2003.8.19.0001), NA FORMA ABAIXO: O(A) Doutor(a) ADRIANA SUCENA MONTEIRO JARA MOURA – Juiz(a) de Direito da Vara acima, FAZ SABER por esse Edital de 1ª e 2ª Praça / Leilão e intimação com prazo de 05 dias, a todos os interessados, e especialmente ao(s) devedor(es), que no dia 19/03/2012 às 16:30 h, será(ão) vendido(s) acima da avaliação, ou no dia 29/03/2012 às 16:30 h, pela melhor oferta, na Av. Erasmo Braga, 115 Átrio do Fórum, da Comarca da Capital – Centro/RJ, pelo Leiloeiro Público ALEXANDRO DA SILVA LACERDA, com escritório na Rua da Assembléia nº 93/Gr 502 – Centro/RJ, o(s) bem(ns) móvel(is) adiante descrito(s) e avaliado(s). Laudo de avaliação às fls 436: Imóvel – Direito e Ação do apartamento C-01 do prédio situado na Rua Henrique de Moura Costa, n° 241 – Barra da Tijuca/RJ, na freguesia de Jacarepaguá, com direito a 02 vagas de garagem e correspondente fração ideal de 164,215/1.363.35 do respectivo terreno. O terreno encontra-se devidamente dimensionado, caracterizado e registrado sob a matrícula 273.615 do cartório do 9° RGI (capital). Edifício – Ocupação residencial, construção antiga, constituído de três pavimentos, sendo quatro unidades no 1°, 2° pavimento e duas coberturas. Hall social acesso porta de vidro, é servido de 1 elevador. Apartamento C-01 – Posição frente/ área edificada com aproximadamente 263m²/ idade do imóvel 1980/ Inscrição Municipal 1339750-0. Avaliado indiretamente, o imóvel acima descrito em R$ 1.200.000,00 (um milhão e duzentos mil reais). Rio de Janeiro 01 de março de 2011. Atualizada nesta data no valor de R$ 1.278.681,10 (um milhão duzentos e setenta e oito mil seiscentos e oitenta e um reais e dez centavos) referente a 562.008,24 UFI’R. Consta débito de IPTU referente ao período de 2004 a 2011 no valor de R$ 20.836,28 (vinte mil oitocentos e trinta e seis reais e vinte e oito centavos). Pagamento: Art. 690. A arrematação far-se-á mediante o pagamento imediato do preço pelo arrematante ou, no prazo de até 15 (quinze) dias, mediante caução. (conforme aviso n.º 189/2005, de 02/05/2005 da CGJ, através de guia que será retirada no cartório – Art. 366 da Consolidação Normativa da Corregedoria Geral de Justiça/RJ), acrescido de 5% de comissão ao Leiloeiro, 0,25% de ISS e custas de até 1% sobre a arrematação, adjudicação ou remição. Cientes os interessados que o imóvel será vendido livre e desembaraçado de débitos de Condomínio e IPTU, desde que o produto da arrematação comporte esses débitos, após a satisfação do crédito do autor, cabendo ao arrematante o pedido de reserva de numerário e pagamento. Caso contrário, o adquirente arcará com os débitos. E para que chegue ao conhecimento de todos os interessados, foi expedido o presente, para cautelas de estilo. Ficando o(s) Executado(s) intimado(s) da hasta pública se não for(em) encontrado(s) por intermédio deste Edital na forma do §5º do art. 687 do CPC. Rio de Janeiro, 09 de janeiro de 2012. Eu ___________ T.J.J. datilografei e Eu _______________________________________ , titular subescrevo. (ass) ADRIANA SUCENA MONTEIRO JARA MOURA – Juiz(a) de Direito.

JUÍZO DE DIREITO DA 4ª. VARA CÍVEL DE MADUREIRA/RJ EDITAL de 1ª, 2a. Praça e Intimação, extraído dos autos da Ação de Extinção de Condomínio proposta por SALIM GEORGES em face de ELIAS GEORGES e SOLANGE BENZI, na forma abaixo: Processo 000847638.1999.8.19.0202 (1999.410.008386-8). A DOUTORA CLARICE DA MATTA E FORTES, Juíza de Direito da Vara acima. Faz saber a todos, especialmente aos Condôminos acima, de que foram designadas as datas de 16/03/2012 e 30/03/2012, ambos às 16:00 horas, no átrio do Fórum de Madureira, na Av. Ernani Cardoso, 152 - térreo (hall dos elevadores), pela leiloeira pública Ana Lucia Gomes de Sá, para realização da 1ª. Praça obedecida à avaliação e da 2ª. Praça pela melhor oferta, nos termos do art. 1115 do CPC, dos imóveis descritos e avaliados às fls. 347/349, a seguir: PRÉDIO de dois pavimentos, contendo loja, um apartamento no térreo e quatro apartamentos no 2º pavimento, com acesso por escadas, situados na Rua Sirici, 150 Marechal Hermes/RJ, próximo a Avenida Aurélio Valporto, e fração ideal do terreno, tudo devidamente registrado, dimensionado e caracterizado no Cartório do 8º Oficio do RGI/RJ, matriculados sob os nºs. 1171142/DH-4 240, 1171242DH-4 240, 1171342/DH-4 241, 1171442DH-4 241, 1171542/ DH-4 242, 1171642DH-4 242, em nome dos condôminos. LOJA A com 127m2, comercial, composta por salão e banheiro, Avaliada em R$ 118.000,00 atualizada para R$ 130.060,00. APARTAMENTOS: 101 (térreo) 201, 202, 203 e 204, (2º pavimento) divididos em cômodos para moradia, com 70,00m2 avaliados em R$ 58.000,00 atualizado em R$ 63.928,00 cada um. Avaliação Indireta no total: R$ 449.701,00. As certidões da Consolidação de Normas da Corregedoria do Estado do Rio de Janeiro/RJ encontram-se nos autos. De acordo com as certidões do 1º, 2º e 4º Oficio do Registro de Distribuição constam outras ações contra Elias Georges. Inscrição na Prefeitura: 0052587-3, 002588-1, 0052589-9, 002590-7, 0052591-5, 0052592-3. De acordo com a Certidão de Situação Fiscal Imobiliária, a loja A consta em aberto o IPTU do exercício de 2011, no valor de R$ 1.528. Os apartamentos acima são isentos de IPTU. De acordo com a Certidão da Funesbom, consta débito de taxa de incêndio referente ao exercício de 2011, da Loja A, no valor de R$ 337,11 e dos Apartamentos 101, 201 a 204, no valor de R$ 50,16 cada um. Ficam cientes os interessados de que a alienação se dará livre de débitos de impostos e taxas, sendo procedido na forma do § único do art. 130 do CNT, bem como cotas condominiais se houver. E para que chegue ao conhecimento dos interessados, foi expedido o presente edital que será publicado e afixado no lugar de costume. A arrematação far-se-à: Pagamento de imediato do preço ou no prazo de até 15 dias, de acordo com o art. 690 do CPC, mediante pagamento de caução de 30% do lance ofertado para garantia da aquisição, 5% de comissão da leiloeira e custas de 1% conforme tabela, sendo devida à comissão da leiloeira em caso de Adjudicação. Dado e passado nesta cidade do Rio de Janeiro, aos 30 dias do mês de Janeiro de dois mil e doze. Eu, (ass.) Inês Filgueiras Riederer, mat. 01/22800, responsável pelo expediente, subscreve e assina por ordem da MMa. Dra. Juíza de Direito.

ESCRITÓRIO: Rua Sete de Setembro, nº 55/sala 2601 PABX 2242-9547 - www.alexandrecostaleiloes.com

JUÍZO DE DIREITO DA 3ª. VARA CÍVEL DA BARRA DA TIJUCA/RJ. EDITAL de 1a, 2a PRAÇA e INTIMAÇÃO, com o prazo de 05 (cinco) dias, extraído dos autos da Ação de Cobrança proposta por CONDOMÍNIO VIVENDAS DA BARRA em face do ESPÓLIO DE CARLOS ALBERTO CARVALHO DA CUNHA, Processo de nº. 0014554-46.2007.8.19.0209 (2007.209.014139-9), na forma abaixo: O DOUTOR AUGUSTO ALVES MOREIRA JUNIOR, Juiz de Direito Titular da Vara acima. FAZ SABER aos que o presente Edital, virem ou dele conhecimento tiverem e interessar possa, especialmente ao Espólio de CARLOS ALBERTO CARVALHO DA CUNHA, representado por sua inventariante CARLA DE SÁ FREIRE CARVALHO DA CUNHA, na forma do § 5° do art. 687 do CPC, que no dia 15/03/2012, às 16:00 horas, no átrio do Fórum da Barra da Tijuca, à Av. Luiz Carlos Prestes, s/nº - térreo (hall dos elevadores), Barra da Tijuca/RJ, pela Leiloeira Pública Oficial ANA LUCIA GOMES DE SÁ, será apregoado e vendido em 1ª. Praça, a quem mais der acima da avaliação, ou no dia 29/03/2012, em 2ª. Praça, no mesmo horário e local, a quem mais der independente da avaliação, de acordo com o art. 692 CPC, o «Direito e Ação» ao imóvel conforme termo de penhora fls.105, avaliado às fls. 145, LAUDO DE AVALIAÇÃO INDIRETA: APARTAMENTO 103 do Condomínio denominado «VIVENDAS DA BARRA», situado a Rua Manoel Brasiliense, nº 116, Barra da Tijuca. EDIFICIO de ocupação residencial, construção antiga em estrutura de concreto armado e alvenaria de tijolos, fachada avarandada com granito e parte pintada, cerca em infravermelho ao redor do prédio, grade de alumínio anodizado à frente, jardim na entrada com pedras portuguesas, interfone, com entrada social e de serviço, pequeno cômodo que serve como depósito localizado na garagem para cada unidade. Constituído de três pavimentos, com oito unidades, sendo 1º. Andar quatro unidades e o 2º. andar mais quatro unidades duplex. Hall social mobiliado decorado, porta de vidro temperado, pisos em cerâmica, corredores de circulação em formipiso, escadas em vulcapiso. É servido por um elevador da marca Thyssenkrup com capacidade para 450kg, idade 32 anos (1979). O Apartamento é de fundos, com área edificada de 101m², com direito a duas vagas de garagem. Avaliação Indireta: R$ 600.000,00 (Seiscentos mil reais) em 12/07/2011, atualizada nesta data para R$ 637.879,00. O Imóvel devidamente registrado, dimensionado e caracterizado sob a matricula nº. 43.325 no Cartório do 9º Ofício do RGI/RJ, constando os seguintes gravames: R-7- PROMESSA DE COMPRA E VENDA – Forma de Título - Escritura do 21º Oficio de Notas desta cidade em 21.05.79, livro 1217, fls. 91, re-retificada por outra de 04.11.81 , do 9º Oficio, livro 2275, fls. 63, ato 44, Jorge Abelardo Barbosa Medeiros prometeu vender em caráter irrevogável e irretratável, a Carlos Alberto Carvalho da Cunha, por R$ 1.509.353,77. AV-08 - FÕRO, prenotação da Secretaria de Patrimônio da União e foi averbado fôro do imóvel em favor da União, por se constituir de natureza de Marinha. R-16 – PENHORA em 1º grau - 12ª. Vara da Fazenda Publica Execução Fiscal nº. 2004.120.042009-0, proposta por Município do Rio de Janeiro, no valor R$ 7.134,04. Av.-18 – SUSPENSÃO DE EFEITOS – Pelo Oficio nº T2-OFI-2009 de 09/1 do Tribunal Regional Federal/2ª. Região fica averbada a suspensão dos efeitos da averbação de foro do imóvel, a partir de 26/08/09, do julgamento deferido a antecipação dos efeitos da tutela recursal, nos autos da Apelação Cível nº. 2006.5101004674-4 de Associação de Moradores e Amigos do Tijucamar e Jardim Oceânico Amar e UNIÃO FEDERAL. R-19 – PENHORA em 2º grau, proveniente desse Juízo 3ª. Vara Cível da Barra da Tijuca. De acordo com Certidão de Situação Fiscal e Enfitêutica (IPTU) inscrição nº. 1394924-3 consta débito em dívida ativa no valor de R$ 43.201,05 (1999 a 2009). Débito referente a 2010 a 2012 no valor de R$ 6.515,31. Totalizando R$ 49.716,36 mais acréscimos legais. De acordo com Certidão Funesbom consta débito em divida ativa de taxa de incêndio de R$ 522,93 (2001 a 2004) e debito 2007 a 2011 de R$ 453,61. Totalizando R$ 974,54 mais acréscimos legais. O imóvel será vendido livre de débitos, conforme estabelece o parágrafo único do art. 130 do Código Tributário Nacional, bem como, das cotas condominiais em atraso, desde que o saldo do produto da hasta seja suficiente para quitá-lo. E para conhecimento de todos, foi expedido este edital, que será publicado e afixado no lugar de costume, ficando os executados cientes da hasta publica. Cientes que a arrematação far-se-á mediante o pagamento imediato do preço, ou no prazo de até 15 (quinze) dias, de acordo com o art. 690 do CPC, mediante pagamento de caução de 30% sobre o lance, para garantia da aquisição, comissão da leiloeira de 5%, e custas de cartório de 1% conforme tabela. Sendo devida a comissão da leiloeira em caso de adjudicação. Dado e passado nesta Cidade do Rio de Janeiro, 01 de fevereiro de 2012. Eu, Tânia Mara Caetano Ferreira, mat. 01/5513, Escrivã, subscreve e assina por ordem do MM.Dr. Juiz de Direito..

JUÍZO DE DIREITO DA QUADRAGÉSIMA VARA CÍVEL DA COMARCA DA CAPITAL - RJ EDITAL DE 1ª e 2ª PRAÇAS E INTIMAÇÃO a OSWALDO SOUZA, com o prazo de 05 (cinco) dias, extraído dos autos da EXECUÇÃO DE TÍTULO JUDICIAL movida por JOÃO FORTES ENGENHARIA S/A contra OSWALDO SOUZA (Proc. 2000.001.130429-6, Atual 0136694-71.2000.8.19.0001), na forma a seguir: A Dra. ADRIANA MARQUES DOS SANTOS LAIA FRANCO, Juíza de Direito da Quadragésima Vara Cível da Capital/RJ, FAZ SABER, por este Edital, ao devedor e demais interessados, que no dia 13/03/ 2012, às 16:30 horas, no Átrio do Fórum da Capital/RJ, situado na Av. Erasmo Braga, nº 115 - térreo - Castelo - pelo Leiloeiro Público SILAS BARBOSA PEREIRA, será apregoado e vendido a quem mais der acima da avaliação, ou no dia 26/03/2012, nos mesmos horário e local, a quem mais der independente da avaliação, o direito e ação sobre o imóvel constituído pela sala 112, bloco 01, do edifício situado na Av. Ayrton Senna nº 3000, Barra da Tijuca, com avaliação atualizada de R$234.424,86. - O imóvel será vendido livre de débito de condomínio, IPTU e taxas, de acordo com o art. 130, parágrafo único do Código Tributário Nacional, desde que o produto da venda comporte, após satisfeito o crédito do autor. Caso contrário, fica ciente o arrematante que arcará com referidas dívidas.- Condições de venda: pagamento imediato do preço ou em até quinze dias mediante caução idônea; mais 5% de comissão ao Leiloeiro, 0,25% de ISS e custas de Cartório de 1% até o máximo permitido.As certidões de praxe encontram-se nos autos e serão lidas no ato do pregão.- Caso o devedor não seja intimados por outra forma legal, fica pelo presente edital intimado das hastas públicas, suprida assim a exigência contida no § 5º do art. 687 do CPC.- Outro Edital, na íntegra, encontra-se afixado no Átrio do Fórum e nos autos.- RJ, 13/02/2012.- Eu, Paulo Roberto Cortez Rosa, Escrivã/RE, Matrícula nº 01/14822, o fiz digitar e subscrevo. (as) Dra. ADRIANA MARQUES DOS SANTOS LAIA FRANCO, Juíza de Direito.

SINDICATO DOS LEILOEIROS DO RIO DE JANEIRO - LEILOEIRO SINDICALIZADO, ARREMATAÇÃO GARANTIDA htpp:///www.sindicatodosleiloeirosrj.com.br


LEILÕES

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

LEILÃO JUDICIAL

MELHOR OFERTA

– TIJUCA–

APARTAMENTO 105 DO BLOCO I, R. BARÃO DE ITAPAGIPE, Nº 385,

R. BARÃO DO BOM RETIRO, Nº 1.760,

Edifício residencial, constituído de 12 pavimentos, tendo 12 unidades por andar. Possui interfone; playground; piscina; sauna; salão de festas; academia; parquinho infantil e câmeras internas de segurança. Escadas de acesso em mármore e corredores de circulação em concreto com revestimento em cerâmica. É servido por 04 elevadores. O imóvel é de fundos, com área edificada de 76m² e possui 01 vaga na garagem.

VENDERÁ EM LEILÃO: Dia 08 de março de 2012 – pela melhor oferta às 14:30 no Átrio do Fórum da Capital, na Av. Erasmo Braga, nº 155 – térreo (hall dos elevadores) - Castelo / RJ

À vista, 5% de comissão ao leiloeiro, 0,25% de ISS e 1% de custas cartoriais até o máximo permitido. Rua do Carmo, nº 09, Sala 701 – Centro / RJ

Tels: (21) 2532-2266 - www.jonasrymer.lel.br,

LEILÃO JUDICIAL

MELHOR OFERTA

– VILA ISABEL –

CONDOMÍNIO DO EDIFÍCIO GENEVE

APARTAMENTO 604 DO BLOCO II, R. OITO DE DEZEMBRO, Nº 306,

Edifício residencial, constituído por 06 pavimentos sendo 10 unidades por andar e uma cobertura. Hall social simples. Infraestrutura: playground e salão de festas. Trata-se de uma cobertura duplex, de fundos e possui 103m² de área edificada. Com direito a duas vagas de garagem.

VENDERÁ EM LEILÃO: Dia 08 de março de 2012 – pela melhor oferta às 14:30 no Átrio do Fórum da Capital, na Av. Erasmo Braga, nº 155 – térreo (hall dos elevadores) - Castelo / RJ

APARTAMENTO 902,

Edifício residencial, constituída de 11 pavimentos, tendo 8 unidades por andar. Possui interfone; playground; salão de festas e parquinho infantil. Escadas de acesso, corredores de circulação. É servido por 03 elevadores. O imóvel é de frente, com uma área edificada de 64m².

VENDERÁ EM LEILÃO: Dia 05 de março de 2012, acima da avaliação Dia 15 de março de 2012, pela melhor oferta às 14:30 no Átrio do Fórum da Capital, na Av. Erasmo Braga, nº 155 – térreo (hall dos elevadores) - Castelo / RJ

À vista, 5% de comissão ao leiloeiro, 0,25% de ISS e 1% de custas cartoriais até o máximo permitido. Rua do Carmo, nº 09, Sala 701 – Centro / RJ

Tels: (21) 2532-2266 - www.jonasrymer.lel.br,

LEILÃO JUDICIAL

– RIACHUELO– APARTAMENTO 201

da CASA 06, R. FLACK, 101,

LEILÃO JUDICIAL

O imóvel divide-se em: sala, 02 quartos, banheiro e cozinha. A sala e os 02 quartos possuem pisos de taco em madeira. O banheiro e a cozinha possuem pisos e paredes em cerâmica.

– COPACABANA –

VENDERÁ EM LEILÃO: Dia 05 de março de 2012 acima da avaliação Dia 15 de março de 2012 pela melhor oferta às 14:30 no Átrio do Fórum da Capital, na Av. Erasmo Braga, nº 155 – térreo (hall dos elevadores) - Castelo / RJ

CONDOMÍNIO DO EDIFÍCIO GUARÁ

COBERTURAS 801 E 802 (UNIFICADAS)

À vista, 5% de comissão ao leiloeiro, 0,25% de ISS e 1% de custas cartoriais até o máximo permitido.

AV. ATLÂNTICA, Nº 2.536,

Tels: (21) 2532-2266

Trata-se de dois imóveis, ambos, coberturas duplex unificadas, em extraordinário ponto da Avenida Atlântica, entre as Ruas Figueiredo Magalhães e Santa Clara, próximo ao Hotel Marriott.

LEILÃO JUDICIAL

MELHOR OFERTA

– TIJUCA –

LEILÃO JUDICIAL

APARTAMENTO 404,

R. CONDE DE BONFIM, Nº 862,

O Edifício é residencial. O apartamento é de fundos, divide-se em: sala, corredor, 02 quartos, cozinha conjugada com área e possui 54 m² de área edificada.

COBERTURA 01 DO BLOCO II,

Edifício residencial, construção antiga, concreto armado e alvenaria, fachada de massa e pastilha, esquadria de alumínio, sendo 07 pavimentos com 04 apartamentos por andar, 02 blocos e mais 02 coberturas no alinhamento da via pública, gradeado, a entrada dispões portaria, portão social, porteiro, comunicação interna por interfone, playground, salão de festas e câmera de segurança. Hall social com piso Granito com paredes mármore branco e azulejos decorados. Dispõe de garagem. O imóvel é de frente, com área 160m2.

VENDERÁ EM LEILÃO: Dia 14 de março de 2012, pela melhor oferta às 13:00 horas, no Átrio do Fórum da Região Oceânica, na Estrada Caetano Monteiro, s/n, Pendotiba – Niterói/RJ À vista, 5% de comissão ao leiloeiro, 0,25% de ISS e 1% de custas cartoriais até o máximo permitido.

Rua do Carmo, nº 09, Sala 701 – Centro / RJ

Rua do Carmo, nº 09, Sala 701 – Centro / RJ

Tels: (21) 2532-2266 - www.jonasrymer.lel.br,

VENDERÁ EM LEILÃO Dia 05 de março de 2012 – 1ª Data Dia 15 de março de 2012 – 2ª Data

- PENHA CIRCULAR -

CONDOMÍNIO DO EDIFÍCIO ROMULO E REMO

À vista, 5% de comissão ao leiloeiro, 0,25% de ISS e 1% de custas cartoriais até o máximo permitido.

Tels: (21) 2532-2266 - www.jonasrymer.lel.br,

D-3

LEILÃO JUDICIAL

– VILA ISABEL – CONDOMÍNIO DO EDIFÍCIO VIA RAFAEL

CONDOMÍNIO DO EDIFÍCIO SOLAR 385 BLOCO I

Jornal do Commercio

BLOCO 05 R.MATURACÁ, Nº 393

às 14:30 no Átrio do Fórum da Capital, na Av. Erasmo Braga, nº 155 – térreo (hall dos elevadores) - Castelo / RJ.

VENDERÁ EM LEILÃO:

Dia 05 de março de 2012 acima da avaliação

Dia 15 de março de 2012

pela melhor oferta às 14:30 no Átrio do Fórum da Capital, na Av. Erasmo Braga, nº 155 – térreo (hall dos elevadores) - Castelo / RJ

À vista, 5% de comissão ao leiloeiro, 0,25% de ISS e 1% de custas cartoriais até o máximo permitido.

Rua do Carmo, nº 09, Sala 701 – Centro / RJ

Tels: (21) 2532-2266

À vista, 5% de comissão ao leiloeiro, 0,25% de ISS e 1% de custas cartoriais até o máximo permitido.

home page: www.jonasrymer.lel.br

Tels: (21) 2532-2266

LEILÕES

ON LINE E PRESENCIAL 3ª FEIRA - 06/03/2012 - 13h NA RODOVIA PRESIDENTE DUTRA, 748 JARDIM AMÉRICA - RIO/RJ

E DIVERSOS COMITENTES L-200 TRITON 2009 4x4

PAJERO SPORT 2002 BLINDADO

E VEÍCULOS DIVERSOS DE EMPRESAS E SEGURADORA

MATERIAIS, EQUIPAMENT OS E SUCATAS

4 GERADORES “NEGRINI” SENDO: 3 150Kva E MOTORES DIESEL “SCANIA” E 1 DE 75Kva E MOTOR DIESEL “MERCEDES BENZ”

3 CÂMARAS CLIMÁTICAS PONTE ROLANTE - MOTORES EQUIPAMENTOS DIVERSOS PARA LABORATÓRIOS

MÓVEIS DIVERSOS (CADEIRAS, MESAS, ARQUIVOS, ESTANTES E ETC.)

SUCATA DE FERRO E MISTA 3ª FEIRA - 13/03/2012 - 13h

RODOVIA PRESIDENTE DUTRA, 748 - J. AMÉRICA - RIO/RJ

E DIVERSOS OUTROS COMITENTES

VEÍCULOS CLÁSSICOS VERDADEIRAS RARIDADES

CADILLAC FLETTWOOD 1994/1995

9

CAMINHÕES

FORD

4 CARGO 1615 (BASCULANTES E TRUCADOS) E 5 F-11.000 (PIPA)

100.000 LITROS DE COMBUSTÍVEL JP5

16.000Kg DE SUCATA FERROSA 8.000Kg BRUTO E 8.000Kg DE VIRUTAS I N F S . : M U R I L O C H AV E S L E I L O E I R O TEL: (21) 2474-3304 - FAX: (21) 3654-3053 FOTOS NA INTERNET - www.murilochaves.com.br

ALPHAVILLE Galeria de Arte

R Pinheiro Machado, 25 Lojas B e C - Laranjeiras Exposicão

Dias 3 e 4 de Março de 2012, das 15 as 22 h Leilão

Dia 5 de Março de 2012, c/continuação dia 6, a partir das 20.00 h

Catalogo disponivel na internet: www.alphavillegalartes.com.br e-mail: cristina.goston@terra.com.br

Tel. 25530791 - 25546400

LEILÃO JUDICIAL = Espólio de Isaura Henriques de Carvalho e Outra =

= ANDARAÍ =

CASA E RESPECTIVO TERRENO RUA PAULA BRITO Nº 531 Área de 121m2., dividida em: varanda, sala com dois ambientes, corredor, 02 quartos, banheiro, copa-cozinha, área e dependências de empregada.

VENDERÁ EM LEILÃO ÚNICO Dia 14 de Março de 2012 Às 16:00 hs., no Átrio do Forum/RJ. à Av. Erasmo Braga nº 115 – térreo (hall dos elevadores) – Castelo. CONDIÇÕES: Arrematação à vista, ou em até quinze dias mediante caução, acrescida da comissão ao Leiloeiro de 5%, do ISS. de 0,25% e das custas de Cartório de 1% até o máximo permitido.

Tel.: (21) 2533-7248 www.rodrigoportella.lel.br

54º Leilão Livros, Primeiras edições, Gravuras, Revistas, Postais, Autógrafos, Fotografias e Manuscritos

EXPOSIÇÃO 3 de Março de 2012, das 10h às 16h, 5, 6, 7 e 8 de Março, das 10h às 19h

LEILÃO

LEILÃO JUDICIAL

CENTRO

SALA / APARTAMENTO Nº 508

AV. CALÓGERAS, Nº 06 (Com entrada suplementar pela Av. Pres. Wilson, nº 188)

9 de Março, com continuação no dia 10, às 15:00 horas LOCAL: Na BABEL Livros

Sala/Apartamento posicionada de frente, (Sala, 3 quartos, banheiro social, cozinha, área de serviço, dependências completas de empregados e com duas entradas, social e serviço), com área edificada de 104 m².

Rua Pará, 340 - Praça da Bandeira - RJ

pela avaliação

Lances prévios

livros@babellivros.com.br

9365-4251

TELS.: 2497-1124 - 33263622 - Fax: 9964-3147 Catálogo e fotos www.raulbarbosa.lel.br www.babellivros.com.br

VENDERÁ EM LEILÃO 1ª Praça: 06/03/2012, às 15 horas

2ª Praça: 20/03/2012, às 15 horas pela melhor oferta Local: Átrio do Fórum da Capital, à Av. Erasmo Braga, 115 - Térreo - Hall dos elevadores.

Condições: À vista, comissão do Leiloeiro de 5%, ISS de 0,25% e custas de Cartório de 1% até o limite máximo permitido por Lei.

Tels. (21) 2497-1124 – 3326-3622 – 3326-3574 E-mail: raulbarbosa@raulbarbosa.lel.br

“A UNIÃO FAZ A FORÇA”- SINDICATO DOS LEILOEIROS DO RIO DE JANEIRO - COLEGA LEILOEIRO: FILIE-SE AO NOSSO SINDICATO. htpp:///www.sindicatodosleiloeirosrj.com.br


D-4

Jornal do Commercio

LEILÕES

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

JUÍZO DE DIREITO DA 6ª. VARA CÍVEL DA BARRA DA TIJUCA/RJ. EDITAL de 1a, 2a PRAÇA e INTIMAÇÃO, com o prazo de 05 (cinco) dias, extraído dos autos da Ação de Execução proposta por INVESTHOR FACTORING LTDA em face de MARCO ANTONIO BENTO DA CUNHA E KATIA MALHEIROS DA CUNHA, Processo n. 0006084-26.2007.8.19.0209 (2007.209.005808-3), na forma abaixo: A DRA. FLAVIA DE ALMEIDA VIVEIROS DE CASTRO, Juíza Titular da Sexta Vara Cível da Barra da Tijuca/RJ. FAZ SABER aos que o presente Edital, virem ou dele conhecimento tiverem e interessar possa, especialmente a MARCO ANTONIO BENTO DA CUNHA e sua mulher KATIA MALHEIROS DA CUNHA, na forma do § 5° do art. 687 do CPC, que no dia 15/03/2012 às 16:00 horas, no átrio do Fórum da Barra da Tijuca, à Av. Luiz Carlos Prestes, s/ nº - térreo (hall dos elevadores), Barra da Tijuca/RJ, pela Leiloeira Pública Oficial ANA LUCIA GOMES DE SÁ, será apregoado e vendido em 1ª. Praça, a quem mais der acima da avaliação, ou no dia 29/03/2012, em 2ª. Praça, no mesmo horário e local, a quem mais der independente da avaliação, conforme estabelece o art. 692 do CPC, o «Direito e Ação» do imóvel conforme termo de penhora as fls. 120 e intimação da penhora as fls. 122, descrito e avaliado às fls. 154. LAUDO DE AVALIAÇÃO: Apartamento n 112 do bloco 07, situado na Estrada do Rio Morto, Nº 95, Vargem Grande. De ocupação residencial, em estrutura de concreto armado e alvenaria de tijolos, coberto de laje. Condomínio fechado com treze blocos, com segurança vinte quatro horas, salão de festas, piscina, sauna e quadra de esporte, para uso comum. Constituído de três pavimentos, fachada texturizada e com telhado tipo colonial, No 1º. Pavimento: pequena varanda com piso em azulejo, sala com piso em granito, lavabo, cozinha com piso em cerâmica e área de serviço nos fundos com parte coberta. No 2º. Pavimento: acesso a duas suítes com piso em cerâmica, através de escada com estrutura em ferro e revestimento em madeira. No 3º. Pavimento, um quarto com piso em cerâmica, acesso através de escada de ferro revestida em madeira Encontra-se em regular estado de conservação. Área edificada de 72,00m², ano de construção 2007, direito a uma vaga de garagem descoberta. Inscrição Municipal 3.087.283-2. Avaliado em R$ 230.000,00 (Duzentos e trinta mil reais) em 04/08/2010 atualizada nesta data para R$ 258.683,00. Registrado no 9º Ofício do Registro de Imóveis, sob a matricula nº. 293.060 em nome de Marco Antonio Bento da Cunha e Kátia Malheiros da Cunha, através da Promessa de compra e venda, pela escritura de 17/06/2005 do 4º oficio de notas, livro 2828, fls.4 em caráter irrevogável e irretratável, com imissão de posse, feita por Belfus Incorporações e Construções Ltda em favor dos réus, pelo preço de R$ 150.000,00, pagável nas condições do título. De acordo com a certidão apresenta débito de IPTU referente a: 2008 de R$ 313,10 e 2012, R$ 192,00, total de R$ 505,51. Taxa de incêndio ano 2008 e 2011 em R$ 115,65. De acordo com as certidões do 1º, 2º, 3º, 4º e 9º Oficio de Distribuição constam outras ações contra os executados acima. As certidões serão lidas no ato do pregão. Ficam cientes os interessados que a venda se dará livre de débitos de impostos e taxas, sendo procedido na forma do § único do art. 130 do Código Tributário Nacional, bem como as cotas condominiais em atraso desde que o saldo do produto da hasta seja suficiente para quitá-lo. E para conhecimento de todos, foi expedido o presente edital, que será publicado e afixado no lugar de costume, cientes que a arrematação serão pagos: preço à vista ou no prazo de até 15 (quinze) dias, de acordo com o art. 690 do CPC, mediante caução de 30% sobre o lance ofertado, para garantia da aquisição, comissão da leiloeira de 5%, e, posteriormente, custas de 1% conforme tabela. Sendo devida a comissão da leiloeira em caso de adjudicação. Dado e passado nesta cidade do Rio de Janeiro, aos 01de fevereiro de 2012. Eu, Adriana Ottero Costa, mat. 01/23646, responsável pelo expediente subscreve e assina por ordem do MM.Dr. Juiz de Direito.

JUÍZO DE DIREITO DA SEGUNDA VARA CÍVEL REGIONAL DA ILHA DO GOVERNADOR – RJ EDITAL DE 1ª e 2ª PRAÇAS E INTIMAÇÃO a WANDYR DE CARVALHO JUNIOR, com o prazo de 05 (cinco) dias, extraído dos autos da EXECUÇÃO movida por GILMAR VINHA DARIUS E OUTRO contra WANDYR DE CARVALHO JUNIOR (Proc. 2004.207.006423-9, Atual 000607830.2004.8.19.0207), na forma a seguir: O Dr. MARCELLO RUBIOLI, Juiz de Direito da Segunda Vara Cível Regional da Ilha do Governador/RJ, FAZ SABER, por este Edital, ao devedor e demais interessados, que no dia 03/ 04/2012, às 15 horas, no Átrio do Fórum Regional da Ilha do Governador/ RJ, situado na Praia de Olaria s/nº - Aterro do Cocotá - pelo Leiloeiro Público SILAS BARBOSA PEREIRA, será apregoado e vendido a quem mais der acima da avaliação, ou no dia 13/04/2012, nos mesmos horário e local, a quem mais der independente da avaliação, o imóvel constituído pela casa duplex situada na Av. Verbo Divino nº 427, bairro Verbo Divino, Barra Mansa, com avaliação atualizada de R$1.278.681,10.O imóvel será vendido livre de débito de condomínio, IPTU e taxas, de acordo com o art. 130, parágrafo único do Código Tributário Nacional, desde que o produto da venda comporte, após satisfeito o crédito do autor. Caso contrário, fica ciente o arrematante que arcará com referidas dívidas.- Condições de venda: pagamento imediato do preço ou em até quinze dias mediante caução idônea; mais 5% de comissão ao Leiloeiro, 0,25% de ISS e custas de Cartório de 1% até o máximo permitido.- As certidões de praxe encontram-se nos autos e serão lidas no ato do pregão.- Caso o devedor não seja intimado por outra forma legal, fica pelo presente edital intimado das hastas públicas, suprida assim a exigência contida no § 5º do art. 687 do CPC.- Outro Edital, na íntegra, encontra-se afixado no Átrio do Fórum e nos autos.- RJ, 13/02/2012.- Eu, Renata Serber Tavares Verissimo, Escrivã(o)/RE, Matrícula nº 01/26748, o fiz digitar e subscrevo. (as) Dr. Marcello Rubioli, Juiz de Direito.

JUÍZO DE DIREITO DA 4ª VARA CÍVEL DA REGIONAL DA BARRA DA TIJUCA EDITAL DE INTIMAÇÃO Com o prazo de vinte dias O MM Juiz de Direito, Dr.(a) Carlos Alfredo Flores da Cunha - Juiz Titular do Cartório da 4ª Vara Cível da Regional da Barra da Tijuca, RJ, FAZ SABER aos que o presente edital com o prazo de vinte dias virem ou dele conhecimento tiverem e interessar possa, que por este Juízo, que funciona a Av. Luiz Carlos Prestes, s/nº 2º andar CEP: 22.775-055 - Barra da Tijuca - Rio de Janeiro - RJ Tel.: 3385-8700 e-mail: btj04vciv@tjrj.jus.br, tramitam os autos da Classe/assunto Procedimento Sumário - Cobrança, de nº 000487612.2004.8.19.0209 (2004.209.004870-8), movida por CONDOMÍNIO DO EDIFÍCIO PORTSALUT em face de TAMARA BOHADANA AMAR, objetivando INTIMAÇÃO. Assim, pelo presente edital INTIMA o réu TAMARA BOHADANA AMAR, que se encontra em lugar incerto e desconhecido, para CUMPRIMENTO DE SENTENÇA na forma do art. 475-B do CPC, acrescido pela Lei nº 11132/05, intime-se o devedor pessoalmente, para cumprimento da sentença. Não sendo o pagamento efetuado no prazo de 15 dias, a contar da juntada do mandado, será aplicada multa de 10% sobre o valor do débito, na forma do art. 475-J do CPC.. Dado e passado nesta cidade de Rio de Janeiro, Aos oito dias do mês de Fevereiro do ano de 2012. Eu, ___________ Adriana de Andrade Carvalho - Analista Judiciário - Matr. 01/24319, digitei. E eu, ______________ Andre Miranda da Rosa - Responsável pelo Expediente - Matr. 01/8027, o subscrevo.

SINDICATO DOS

LEILOEIROS DO RIO DE JANEIRO

Av. Graça Aranha 416, 4º - Centro Tel.: 2240-7105 - 2240-7120 Murilo Cardozo Chaves Av. Pres. Antonio Carlos, 607/1002 Centro - CEP 20020010 - Tels.: 25334430, 24730244 David C. Botelho Jr R. Teophilo Otoni, 135/Subsolo Centro - CEP 20090-080 Tels.: 2233-1573, 2283-1765 Luiz Tenorio de Paula Av. Almirante Barroso, 90/1103 Centro - CEP 20019-900 Telfax.: 25240545, 22204217 Tereza Brame Travessa do Paço, 23/1211 Centro - CEP 20010-170 Tel.: 25332400 Edgar de Carvalho Jr. Av. 13 de Maio, 47/912 Centro - CEP 20031-000 Telefax 22407858 Evandro Carneiro R. Saubara, 100 Itanhangá - Barra da TijucaCEP 22641-550 -Tel.: 24939686 Norma Maria Machado Av. Erasmo Braga, 227/704 Centro - CEP 20024-000 Tel.: 25337978 Maurício Antonio Karan R. Guimarães Rosa, 203/707 - Barra da Tijuca - CEP 22793620 Tel.: 3326-2041 Silvani Lopes Dias Av. 13 de Maio, 13/1801 Centro - CEP 20031-000 Tels.: 22201461, 22407229 Angela Maltarollo R. Cte. Julio de Moura, 188/304 Barra da Tijuca - CEP 22621-200 Tel.: 21562766 João Emílio de Oliveira Filho Estr. dos Bandeirantes, 10.639 Recreio - CEP 22783-111 Tel.: 3416-6350 / 3416-6351 Valdir Teixeira Praia de Botafogo, 430/1201 Bl 01 Botafogo - CEP 22250040 Tel.: 25374040

Amando da Fonseca Jr. Rua Presciliano da Silva, 576 - Joá - CEP 22.611-130 Tel.: 2493-7237 e 2493-2493 Rogério Menezes Nunes Rua do Feijão nº 47, Mercado de São Sebastião, Penha CEP 21011-050 Tel.: 2270-2270 e 2584-3804 Rodrigo Lopes Portella Av. Nilo Peçanha, 12/810 Centro - CEP 20020-100 Tel.: 2533-7248 Roberto Haddad R. Pompeu Loureiro, 27A Copacabana - CEP 22061-000 Tel.: 25487141 Fax 22553293 Carlos Alberto R. Barros Av. N S Copacabana, 540 sl. 902 - Copacabana - CEP 22020-000 Tels.: 25485850 / 25474573 Raul Barbosa Av. das Américas, 15.511/303 Recreio - CEP 22790-700 Tel.: 33263622 Fax 33263574 Paulo Roberto A. Botelho Av. Rio Branco, 151 - 5º andar - Centro - CEP 20040-007 Tel.: 2508-7007, 2509-2147 Alexandre Pereira da Costa R. Sete de Setembro, 55/2601 Centro - CEP 20050-004 Tels.: 22429547, 25079467 Fernando Moreira Braga Av. Rio Branco nº 114 - 16º andar - Centro - Cep 20.030000 - Tel 2224-7478 Jonas Rymer Rua do Carmo, 09 sl 701 - Centro - CEP 20011-020 Tel.: 25322266 Josimar de Azevedo Santos R. Pedro de Carvalho, 137/401 Méier - CEP 20725-230 Tels.: 25951033 / 39023460 Mario Ricart Av. Erasmo Braga nº 277, grupo 501 - CEP 20020-000 Tels.: 22151342, 25441484 Andrea Rosa Costa Av. Almirante Barroso, 90 sl. 1214 Centro - CEP 20031-005 Tels.: 22402268, 22407260 Horácio Ernani Rodrigues de Mello R. São Clemente, 385 Botafogo - CEP 22260-001 Tel.: 25390246 Fax 25399141 André Gil Gomes Av. Erasmo Braga, 277 grupo 709 Centro - CEP 20020-000 - Tel.: 2532-1935 - 1346

Maria Izabel Cunha de Aguiar R. Lopes Quintas, 74 ap 102 - Jardim Botânico - CEP 20.460-010. Tel.: 3502-0934 Valéria Pontes Braga Kahn Av Erasmo Braga, 227 sala 1107 - Centro - CEP 20020-000 - Tels.: 25444477 - 25444490 Alexandro da Silva Lacerda Rua da Assembléia, 93 sls. 501-502 - Centro - CEP 20011001 Tel.: 2292-2092, 2292-0478 Gustavo Portella Lourenço Av Erasmo Braga, 277 salas 511/512 - Centro - CEP 20020000 - Tels.: 2220-0863 Silas Barbosa Pereira Av. Rio Branco, 181 - Grupo 905 - Centro - CEP 20040-007 - Tel.: 2533-0307 Zilma Fernandes Barboza Ozella Rua Mario Albuquerque, 385 - B. da Tijuca - CEP 22793318 - Tel.: 3328-5860 Leonardo Schulmann Travessa do Paço, 23 - Sala 812 - Centro - CEP: 20010-170 - Tel.: 2532-1705 Cristina Maria Antunes Goston R. Pinheiro Machado, 25 - loja C - Laranjeiras - CEP: 22231090 -Tel.: 2553-0791 / 9974-4409 Rodrigo da Silva Costa Travessa do Paço, 23 sl. 601 - Centro - CEP 20010-170 Tel.: 2242-0807 Ana Lúcia Gomes de Sá Rua do Carmo nº 6 / 1.308 - Centro - CEP 20011-020 Tel.: 2532.7716 - 2532.9443 Daniele de Paula Ribas Av. Alm. Barroso nº 90 gr. 1103 - Centro CEP 20031-002 - Tel.: 2220-4217 Walmir Matos da Silva Rua Castro Alves nº 671 - C. Guinle - Teresópolis - Cep 25959-075 - Tel.: 2642.3803 Fabiola Porto Portella Av. Nilo Peçanha, nº 12 - gr. 812 - Centro Cep: 20.020-100 - Tel.: 2533-7248 Luciano Porto Portella Av. Nilo Peçanha, nº 12 - gr. 812 - Centro Cep: 20.020-100 - Tel.: 2533-7248 Fernanda Azevedo Cardoso Praça Olavo Bilac, nº 28, sl. 1412 - Centro - Cep: 20.041010 - Tel.: 2507-2813

Bianca Soares Pais Av. Pres. Antonio Carlos, 615 sl. 302- Centro - Cep: 20.020010 - Tel.: 2292-4749 Octavio H. Barbieri C. Vianna Av. Marechal C»amara, 271 sl. 804- Centro - Cep: 20.020010 - Tel.: 2262-0314 Anderson Carneiro Pereira Rua Carvalho Alvim, 73 apt 101 - Tijuca - Cep. 20.510-100 - Tel.: 2533-2804 Juliana Vettorazzo R. Barros Av. N S Copacabana, 540 sl. 902 - Copacabana - CEP 22020-000 Tels.: 2548-5850 / 2547-4573, Fax: 2255-8290. Sergio Luis Represas Cardoso Av. Treze de Maio, nº 45 sala 705 - Centro - CEP 20031007 Tel.: 2292-9486 Gustavo Pedro de Lima de Paula Av. Almirante Barroso, 90 sl. 1104 - Centro - RJ. CEP.: 20.031-002. Tel: 2524-0545 - 2220-4217 Sandra Regina Sevidanes de Araujo Av. Treze de Maio, 47 sl. 912 - Centro - RJ. CEP.: 20.031921. Tel: 2220-6452 Alexandre Mendes Gonzalez Rua Gago Coutinho, 28 ap 403, Laranjeiras. CEP: 22.221070. Tel. 2220-1461 e 2558-1335. Antonio Tavares da Rocha Av. Rio Branco, 156 sala 2521, Centro. CEP: 22.040-007. Tel. 2262-4065 Alan Machado Ribeiro Av. Beira Mar, 262 sala 203 - Centro. CEP: 22.021-060. Tel. 2544-4137 e 7804-2125 Jessualdo Fortuna Le Gentil Rua Augusto Nunes, 30 casa 13 - Outeiro das Pedras Itaboraí. CEP: 24.800-000. Tel.: 7841-0654. Antônio Carlos da Costa Ferreira Rua Barata Ribeiro, 383 sala 701 - Copacabana. Cep 22.040-000 - Tel. (21) 2257-0912. Rodrigo Adriano de Souza R. Estudante Eucira Oliveira Coutinho, 60 casa 01 - Porto da Roca - Saquarema. Cep 28.993-000. Tel.: (22) 2653-4782 Nilton Danni de Rezende Rua Barão de Mesquita, 587 apto 403 - Tijuca. Cep 20.540-001. Tel.: 9475-5260.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de mar莽o de 2012

Jornal do Commercio

Relat贸rio de

Atividades

E-1


cyan magenta amarelo preto

E-2

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA &RQVHOKRGH$GPLQLVWUDomR

'LUHWRULD([HFXWLYD

Guido Mantega

JosĂŠ Sergio Gabrielli de Azevedo

3UHVLGHQWH

3UHVLGHQWH

JosĂŠ Sergio Gabrielli de Azevedo

Almir Guilherme Barbassa

Francisco Roberto de Albuquerque

Renato de Souza Duque

Jorge Gerdau Johannpeter

Guilherme de Oliveira Estrella

Luciano GalvĂŁo Coutinho

Paulo Roberto Costa

Sergio Franklin Quintella

Maria das Graças Silva Foster

Marcio Pereira Zimmermann

Jorge Luiz Zelada

Miriam Aparecida Belchior JosuĂŠ Christiano Gomes da Silva

&RQVHOKR)LVFDO 7LWXODUHV Marcus Pereira AucĂŠlio CĂŠsar Acosta Rech Nelson Rocha Augusto Maria LĂşcia de Oliveira FalcĂłn Marisete FĂĄtima Dadald Pereira

0(16$*(0'235(6,'(17( A Petrobras mostrou que estå preparada para enfrentar a crise econômica internacional e fechou 2011 com um legado de solidez e crescimento. Foi um ano de superação. Apesar da volatilidade e incerteza no cenårio mundial, SURYDPRV QRVVD HVWDELOLGDGH RSHUDFLRQDO H FUHGLELOLGDGH ¿QDQFHLUD 6XVWHQWDGRV SRU QRVVDV FRPSHWrQFLDV tÊcnicas e tecnológicas e pela robustez do nosso portfólio e do nosso principal mercado – o Brasil –, mantivemos elevada geração de caixa, aumentamos nossa produção e avançamos em nossos projetos, principalmente no PrÊ-Sal. Nossa produção de petróleo no País cresceu 1%, impulsionada pela P-56 em Marlim Sul, que entrou em operação, e pela conexão de novos poços a plataformas instaladas em anos anteriores. Demos importantes passos nas duas principais frentes de expansão no setor: o PrÊ-Sal e a Bacia de Campos, onde, em curto prazo, espera-se forte contribuição dos novos sistemas e do projeto Varredura.

JDUDQWLXRHVFRDPHQWRGRJiVQDWXUDOGR3ROR3Up6DOGD%DFLDGH6DQWRV 336%6 2XWURPDUFRIRLDGHFODUDomR de comercialidade da segunda årea do PrÊ-Sal de Santos, Guarå, que deu origem ao campo de Sapinhoå. Seguindo com nosso ousado cronograma de projetos, anunciamos o afretamento de duas novas plataformas do tipo FPSO ()ORDWLQJ3URGXFWLRQ6WRUDJHDQG2IÀRDGLQJ SDUDRVSURMHWRVSLORWRVGH6DSLQKRi1RUWHH&HUQDPEL e a aquisição de quatro cascos de navios que serão convertidos em FPSOs para o desenvolvimento das åreas da &HVVmR2QHURVD7LYHPRVFRPLVVRDPDLRUVHTXrQFLDGHSURMHWRVGHXPDSHWUROHLUDHPXPD~QLFDUHJLmRGR PXQGR3DUDJDUDQWLUVXDH[HFXomR¿]HPRVDUHYLVmRDQXDOGR3ODQR'LUHWRUGR336%6 3ODQVDO TXHLQGLFRX uma redução de 32% nos investimentos necessårios para o desenvolvimento da årea em relação ao Plano anterior. Impulsionada pelo crescimento da economia brasileira, a venda de derivados no País aumentou 9%. A ampliação da demanda, associada ao aumento do preço do etanol – que fez com que muitos consumidores migrassem para a JDVROLQD¹H[LJLXTXHRSHUiVVHPRVFRPPi[LPDH¿FLrQFLD$VUH¿QDULDVGDFRPSDQKLDQR%UDVLOWUDEDOKDUDP com utilização mÊdia de 92% da capacidade. Mesmo assim, tivemos que elevar o índice da importação de derivados para garantir o abastecimento interno. É importante lembrar que o mercado brasileiro, um dos que mais cresce no mundo, Ê um pilar de estabilidade e desenvolvimento para a Petrobras. No setor do gås natural, consolidamos a estrutura de transporte e geração termelÊtrica. Agora, preparamo-nos SDUDRGHVD¿RGHJDUDQWLURHVFRDPHQWRHDPRQHWL]DomRGRJiVQDWXUDOGR3Up6DO3DUDLVVRHVWDPRVLQYHVWLQGR HPXPQRYRWHUPLQDOGH*1/ JiVQDWXUDOOLTXHIHLWR HHPIiEULFDVGHIHUWLOL]DQWHVTXHXVDUmRRJiVFRPRLQVXPR para a produção de ureia e amônia. 2VELRFRPEXVWtYHLVVH¿UPDUDPFRPRIRQWHUHQRYiYHOGHHQHUJLD$VGL¿FXOGDGHVGHRIHUWDHPIRUWDOHFHUDP nosso direcionamento estratÊgico de crescer no negócio do etanol, estabelecendo parcerias e construindo novas usinas. Sabemos que não podemos avançar sozinhos. Continuamos com iniciativas que visam ao fortalecimento da FDGHLDGHyOHRHJiVQR%UDVLO$WHQWRVjQHFHVVLGDGHGHPmRGHREUDTXDOL¿FDGDMiDSRLDPRVDTXDOL¿FDomR de cerca de 80 mil trabalhadores para a indústria e demos mais um passo inovador ao lançarmos o Programa 3URJUHGLUFRPRREMHWLYRGHUHGX]LURFXVWRGH¿QDQFLDPHQWRGHQRVVRVIRUQHFHGRUHV 7DPEpP SURVVHJXLPRV FRP D HVWUDWpJLD GH GLVSRQLELOL]DU HTXLSDPHQWRV H WHFQRORJLDVFKDYH SDUD R desenvolvimento de nossas operaçþes. Nos tornamos sócios da empresa Sete Brasil, responsåvel pelo primeiro lote de sete sondas a serem construídas no País. Grandes fornecedores internacionais anunciaram a instalação de centros de pesquisa no Brasil, fazendo do Rio de Janeiro um novo centro tecnológico da indústria petrolífera. )L]HPRV WXGR LVVR VHP GHVFXLGDU GD VD~GH ¿QDQFHLUD GD 3HWUREUDV *DUDQWLPRV TXH HVVHV SODQRV VHMDP UHDOL]DGRVFRPOLTXLGH]HVROYrQFLDFRPSURPHWLGRVFRPRJUDXGHLQYHVWLPHQWRHRUHODFLRQDPHQWRFRPR mercado. Prova disso foram os US$ 18,4 bilhþes captados no ano no mercado nacional e internacional e a PHOKRUDQDFODVVL¿FDomRGHULVFRGDQRVVDGtYLGD 7RGRV HVVHV DYDQoRV VHPSUH HVWLYHUDP SDXWDGRV SHOD VXVWHQWDELOLGDGH &RQVLGHUDPRV IXQGDPHQWDLV especialmente, os investimentos em tecnologia, segurança operacional, meio ambiente e recursos humanos, SRLVHOHVVmRDJDUDQWLDGHTXHQRVVRFDPLQKRFRQWLQXDUiVHQGRSHUFRUULGRFRPFRQ¿DQoDSDUDVXSHUDUGHVD¿RV e atingir os objetivos da companhia.

Ainda no PrÊ-Sal, continuamos avançando em ritmo acelerado. Implantamos o Piloto de Lula, que chegou a SURGX]LUPLOEDUULVGLiULRVGHyOHRHJiVFRQ¿UPDQGRRDOWRSRWHQFLDOGRVUHVHUYDWyULRV7DPEpPLQLFLDPRV RVWHVWHVGHORQJDGXUDomR 7/'V GH/XOD1RUGHVWHH&DULRFDHDRSHUDomRGRJDVRGXWR/XOD0H[LOKmRTXH

-RVp6HUJLR*DEULHOOLGH$]HYHGR Presidente da Petrobras

5(68/7$'26(*(67­2 $QiOLVHGRPHUFDGRGHSHWUyOHR O movimento dos preços do petrĂłleo, em 2011, foi condicionado por revoltas e quedas de governos em paĂ­ses GR1RUWHGDĂˆIULFDHGR2ULHQWH0pGLRFRQKHFLGDVFRPRÂł3ULPDYHUDĂˆUDEH´HSRUĂ€XWXDo}HVGDVFRQGLo}HV macroeconĂ´micas, especialmente nos paĂ­ses desenvolvidos. O preço do barril do Brent oscilou mais do que HPFRPYDORUPtQLPRGH86EEOHPi[LPRGH86EEO2YDORUPpGLRDQXDOÂżFRXHP86 111,27/bbl, com alta de 40% em relação Ă cotação mĂŠdia de 2010, e foi o maior valor nominal mĂŠdio registrado na sĂŠrie histĂłrica. O consumo de petrĂłleo apresentou alta moderada, impulsionado pelo crescimento em paĂ­ses nĂŁo membros da 2UJDQL]DomRSDUD&RRSHUDomRH'HVHQYROYLPHQWR(FRQ{PLFR 2&'( FRPRĂ‹QGLDH&KLQD$GHPDQGDGRV paĂ­ses desenvolvidos, ao contrĂĄrio, caiu no decorrer do ano pelo crescimento econĂ´mico limitado, aquĂŠm das SURMHo}HVLQLFLDLVGRVDQDOLVWDV2VSUREOHPDVÂżVFDLVQRV(VWDGRV8QLGRVHHPSDtVHVHXURSHXVGHSULPLUDP as expectativas quanto ao crescimento econĂ´mico e aumentaram o receio de uma nova recessĂŁo nos paĂ­ses desenvolvidos. A oferta de petrĂłleo foi afetada principalmente pela guerra civil na LĂ­bia e seus desdobramentos, que levaram Ă  perda de cerca de 1,6 milhĂŁo de bpd de Ăłleo leve e de baixo teor de enxofre, impulsionando os preços no primeiro semestre do ano. Com o objetivo de compensar a perda do petrĂłleo lĂ­bio, os paĂ­ses do Golfo PĂŠrsico decidiram, unilateralmente, DXPHQWDUVXDRIHUWDMiTXHRVSDtVHVGD2UJDQL]DomRGRV3DtVHV([SRUWDGRUHVGH3HWUyOHR 2SHS ÂąTXHGHVGH 2009 vinham produzindo acima de sua meta de 24,8 milhĂľes de bpd de Ăłleo – nĂŁo alcançaram um consenso VREUHDQHFHVVLGDGHGHXPQRYRWHWRGHSURGXomR$$JrQFLD,QWHUQDFLRQDOGH(QHUJLD $,( DQXQFLRXDOLEHUDomR de 60 milhĂľes de barris de seus estoques estratĂŠgicos para compensar a redução da oferta, medida sĂł adotada anteriormente duas vezes desde sua criação, em 1974. No Ăşltimo trimestre, o retorno da produção da LĂ­bia superou as expectativas e arrefeceu a pressĂŁo sobre os preços. (PUHODomRjRIHUWDGRVSDtVHVQmRLQWHJUDQWHVGD2SHSRFUHVFLPHQWRGDSURGXomRÂżFRXEHPDEDL[RGDV expectativas dos analistas, prejudicado por restriçþes Ă  produção no Mar do Norte, pelo alto nĂşmero de paradas GHPDQXWHQomRQmRSURJUDPDGDVHSHORVFRQĂ€LWRVHPSDtVHVFRPRR,rPHQHD6tULD'HVWDTXHSRVLWLYRIRLR crescimento da produção nĂŁo convencional onshore nos Estados Unidos. Este, somado a problemas logĂ­sticos QR0HLR2HVWHDPHULFDQRIH]FRPTXHR:7,SHWUyOHRGHUHIHUrQFLDQRV(VWDGRV8QLGRVIRVVHQHJRFLDGRFRP descontos recorde em relação ao Brent, alcançando uma diferença de US$ 29,70/bbl em setembro.

(VWUDWpJLD&RUSRUDWLYD A estratĂŠgia corporativa contempla a expansĂŁo de todos os negĂłcios da companhia e baseia-se nos seguintes fatores de sustentabilidade: crescimento integrado, rentabilidade e responsabilidade social e ambiental. O programa de investimentos para atingir as metas de crescimento do Plano de NegĂłcios 2011-2015 soma US$ ELOK}HVRTXHUHSUHVHQWDXPDPpGLDGH86ELOK}HVSRUDQR'HVVHWRWDO86ELOK}HV   GHVWLQDPVHDSURMHWRVQR%UDVLOH86ELOK}HV  DDWLYLGDGHVQRH[WHULRUFRPIRFRQRV(VWDGRV8QLGRV na AmĂŠrica Latina e no Oeste da Ă frica. 2VHJPHQWRGH([SORUDomRH3URGXomR ( 3 FRQFHQWUDDPDLRUSDUWHGRVLQYHVWLPHQWRV$RWRGRVHUmR86 127,5 bilhĂľes – 57% do total aprovado para o perĂ­odo –, dos quais US$ 53,4 bilhĂľes se destinam Ă exploração e desenvolvimento do PrĂŠ-Sal, cuja produção deverĂĄ atingir 543 mil bpd de Ăłleo em 2015. O Plano 2011-2015 SULRUL]DDSURGXomRGRPpVWLFDHSUHYrLQYHVWLPHQWRVHPSURMHWRVGD&HVVmR2QHURVDVRPDQGR86ELOK}HV A produção total de Ăłleo e gĂĄs natural deverĂĄ alcançar 3.993 mil boed em 2015, dos quais 3.688 mil boed no Brasil. 2 VHJPHQWR GH 5HÂżQR 7UDQVSRUWH H &RPHUFLDOL]DomR 57&  FRQWDUi FRP 86  ELOK}HV R HTXLYDOHQWH DGRVLQYHVWLPHQWRV6HUiPDQWLGDDHVWUDWpJLDGHDXPHQWDUDFDSDFLGDGHGHUHÂżQRSDUDDVVHJXUDUR abastecimento do mercado nacional de derivados. Os investimentos se concentrarĂŁo na melhoria da qualidade GRVFRPEXVWtYHLVHQDPRGHUQL]DomRHH[SDQVmRGDFDSDFLGDGHGRSDUTXHGHUHÂżQR$FDUJDSURFHVVDGDGH SHWUyOHRQR%UDVLOGHYHUiDWLQJLUPLOESGDWpFRPDHQWUDGDHPRSHUDomRGD5HÂżQDULD$EUHXH/LPDH GDSULPHLUDIDVHGR&RPSOH[R3HWURTXtPLFRGR5LRGH-DQHLUR &RPSHUM DPEDVHP 2VLQYHVWLPHQWRVHP*iV(QHUJLDH*iV4XtPLFD * ( GH86ELOK}HVGHVWLQDPVHjFRQFOXVmRGDDPSOLDomR da malha de transporte de gĂĄs natural e Ă  geração de energia termelĂŠtrica, alĂŠm de permitirem o escoamento do gĂĄs do PrĂŠ-Sal, a conversĂŁo do gĂĄs natural em ureia, amĂ´nia e metanol e a atuação na cadeia de GNL. O segmento de biocombustĂ­veis receberĂĄ US$ 4,1 bilhĂľes: US$ 1,9 bilhĂŁo para o negĂłcio de etanol, US$ 1,3 bilhĂŁo para a logĂ­stica de sua distribuição, US$ 0,6 bilhĂŁo para o biodiesel e US$ 0,3 bilhĂŁo para P&D. Pela primeira vez, a companhia incluiu em seu Plano de NegĂłcios um programa de desinvestimento, WRWDOL]DQGR86ELOK}HVQRSHUtRGR(VWHSURJUDPDYLVDjHÂżFLrQFLDQDJHVWmRGRVDWLYRVGD Petrobras e sua rentabilidade.

,QYHVWLPHQWRV A Petrobras investiu, em 2011, R$ 72,6 bilhþes, concentrados nas atividades exploratórias, de desenvolvimento da produção e em tecnologia. Para reforçar sua atuação como empresa integrada e verticalizada, realizou LQYHVWLPHQWRVQDFRQVWUXomRGHUH¿QDULDV¹D¿PGHDWHQGHUDRPHUFDGRGRPpVWLFR¹HQDFDGHLDGHGLVWULEXLomR Do total investido, 47% destinaram-se à årea de Exploração e Produção, que alocou 26% para exploração, 62% para o desenvolvimento da produção e 12% em demais investimentos. Estes investimentos visam ao desenvolvimento da produção do PrÊ-Sal, à manutenção de produção nos campos mais antigos e à infraestrutura logística e tecnológica.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-3

Minas e Energia

Petróleo Brasileiro S.A. CNPJ Nº 33.000.167/0001-01 - COMPANHIA ABERTA O destaque foi o início da operação, em agosto, da plataforma semissubmersível P-56, no campo de Marlim Sul, na Bacia de Campos, que atingirå no primeiro semestre de 2012 sua capacidade måxima de processamento de 100 mil bpd de óleo e 6 milhþes de m³/dia de gås. Em setembro, entrou em operação o gasoduto que liga o Campo de Lula à plataforma de Mexilhão, para o escoamento do gås natural das plataformas destinadas ao desenvolvimento da primeira fase do PrÊ-Sal da Bacia GH6DQWRV7DPEpPIRLLQLFLDGDDLQVWDODomRGRJDVRGXWR6XO1RUWH&DSL[DEDTXHDPSOLDUiDLQIUDHVWUXWXUDGH escoamento de gås natural, garantindo o incremento da produção de óleo e gås na região do Parque das Baleias, no litoral Sul do Espírito Santo.

$3HWUREUDVFRQWUDWRXD.30*$XGLWRUHV,QGHSHQGHQWHVSDUDDSUHVWDomRGH6HUYLoRV7pFQLFRV(VSHFLDOL]DGRV em Auditoria Contåbil nos exercícios sociais de 2006, 2007, 2008, desde abril de 2006. Em abril de 2009 o contrato foi prorrogado por mais dois anos, para os exercícios de 2009 e 2010. (PDEULOGHRFRQWUDWRIRLSURUURJDGRSRUPDLVXPDQRSDUDSUHVWDomRGH6HUYLoRV7pFQLFRV(VSHFLDOL]DGRV em Auditoria Contåbil do exercício de 2011. Durante o exercício de 2011, a KPMG Auditores Independentes prestou os seguintes serviços para a Petrobras e suas subsidiårias e controladas

Em novembro, chegou ao Rio de Janeiro o navio comprado para a conversĂŁo do casco da plataforma FPSO P-74, a primeira destinada aos campos da CessĂŁo Onerosa, no PrĂŠ-Sal da Bacia de Santos. Com o mesmo objetivo, RXWURVWUrVQDYLRVYLUmRGD0DOiVLDHPH$FRQYHUVmRGHWRGRVRVFDVFRV 33H3 VHUi realizada pelo Estaleiro InhaĂşma, no Rio.

50LO Auditoria ContĂĄbil .......................................................................................................................

24.879

Auditoria SOX .............................................................................................................................

2.659

0HUHFHPPHQomRRV7HVWHVGH/RQJD'XUDomR 7/'V GH/XOD1RUGHVWHH&DULRFD1RUGHVWHQD%DFLDGH6DQWRV e de AruanĂŁ, na Bacia de Campos.

Serviços adicionais relacionados à auditoria...............................................................................

1.446

Outros .........................................................................................................................................

100

Parte dos investimentos foi destinada às plataformas P-55, P-61 e P-63, que estão em fase de construção e que entrarão em produção nos anos de 2012 e 2013, garantindo o crescimento sustentåvel da produção.

7RWDOGRVVHUYLoRV .......................................................................................................................

29.084

2VLQYHVWLPHQWRVQDiUHDGH$EDVWHFLPHQWRUHVSRQViYHOSHORVVHJPHQWRVGHUH¿QRWUDQVSRUWHHFRPHUFLDOL]DomR somaram R$ 27,1 bilhþes. Com a crescente demanda do mercado brasileiro, estão sendo construídas quatro QRYDVUH¿QDULDV $EUHXH/LPD3UHPLXP,3UHPLXP,,H&RPSHUM TXHGHYHUmRHQWUDUHPSURGXomRDWp WRUQDQGRR%UDVLODXWRVVX¿FLHQWHQDSURGXomRGHGHULYDGRVGHSHWUyOHR Foram realizados investimentos em projetos de modernização, conversão e de melhoria de qualidade dos produtos, em especial o desenvolvimento de produtos mais tecnológicos, como o Diesel S-50, de nova geração. $ 7UDQVSHWUR UHFHEHX R QDYLR GH SURGXWRV &HOVR )XUWDGR SULPHLUD GDV  HPEDUFDo}HV GR SURJUDPD GH Modernização e Expansão da Frota, para fortalecimento do sistema logístico. A årea de Gås e Energia absorveu R$ 3,8 bilhþes. No segmento de gås natural, foi encerrado o ciclo de investimentos na ampliação da malha de transporte, com a conclusão dos gasodutos Gastau, que ampliou a oferta na Região 6XGHVWHH*DVSDO,,H*DVDQ,,TXHLQFUHPHQWDUDPDRIHUWDQDUHJLmRPHWURSROLWDQDGH6mR3DXOR7HYHLQtFLR DLPSOHPHQWDomRGR7HUPLQDOGH5HJDVHL¿FDomRGH*1/GD%DKLDTXHGDUiPDLVÀH[LELOLGDGHjRIHUWDGHJiV QDWXUDOQR3DtV(PMXOKRDDTXLVLomRGD*DV%UDVLOLDQR'LVWULEXLGRUD *%' SHUPLWLXDPSOLDUDSDUWLFLSDomRGD companhia no mercado paulista. 1RVHJPHQWRGHHQHUJLDKRXYHDLPSOHPHQWDomRGHTXDWURXVLQDVHyOLFDVHP*XDPDUp51DFRQYHUVmRGD87( -XL]GH)RUDSDUDELFRPEXVWtYHOHRIHFKDPHQWRGHFLFORGD87(/XLV&DUORV3UHVWHV 1RVHJPHQWRGHIHUWLOL]DQWHVLQYHVWLXVHQDLQVWDODomRGD8QLGDGHGH)HUWLOL]DQWHV1LWURJHQDGRV,,, 8)1,,, QR Mato Grosso do Sul, e na expansão da produção de amônia da Fafen, em Sergipe. Na Fafen da Bahia, concluiuse a primeira etapa do projeto ARLA 32 (solução de ureia utilizada nos novos veículos pesados a diesel para UHGXomRGHHPLVV}HV  Com o objetivo de manter a liderança no País e fazer da marca Petrobras a preferida dos consumidores brasileiros, a årea de Distribuição investiu R$ 1,1 bilhão, aplicados, principalmente, na ampliação da capacidade logística para suportar o crescimento do mercado domÊstico. Os recursos direcionados para Biocombustíveis somaram R$ 0,5 bilhão. Deste total, 78% foram investidos no segmento de etanol com o objetivo de aumentar a oferta deste produto, visando a um ganho de participação de mercado da Petrobras Biocombustíveis e seus parceiros. O segmento de biodiesel recebeu 22% dos recursos, dando prosseguimento ao plano de ampliar a capacidade instalada. A årea Internacional investiu R$ 4,4 bilhþes. A maior parte dos recursos, 89%, foi destinada à exploração e produção com foco no Golfo do MÊxico e na Costa Oeste da à frica. Com sua liderança global em operaçþes em åguas SURIXQGDVD3HWUREUDVXVDDH[SHULrQFLDHDWHFQRORJLDTXHGHVHQYROYHQR%UDVLOHPRSRUWXQLGDGHVQRH[WHULRU

*HUHQFLDPHQWRGHULVFRV A gestĂŁo de riscos da Petrobras ĂŠ exercida pela Diretoria Executiva, com base em polĂ­ticas e diretrizes HVSHFtÂżFDV

5LVFRVGHPHUFDGR A Petrobras estå exposta a uma sÊrie de riscos, principalmente os decorrentes de eventuais variaçþes nos preços de petróleo e derivados e nas taxas cambiais ou de juros, que podem afetar negativamente o valor dos ativos e SDVVLYRV¿QDQFHLURVRXVHXVOXFURVHÀX[RVGHFDL[DIXWXURV $FRPSDQKLDDGRWDXPD¿ORVR¿DGHJHVWmRLQWHJUDGDGHULVFRVVHJXQGRDTXDORIRFRGDJHVWmRQmRHVWiQRV riscos individuais – das operaçþes ou das unidades de negócio –, mas na perspectiva mais ampla e consolidada da FRUSRUDomRFDSWXUDQGRSRVVtYHLVSURWHo}HVQDWXUDLV6mRSUHIHULGDVDo}HVHVWUXWXUDLVFULDGDVHPGHFRUUrQFLD de uma gestão adequada do capital e do endividamento da empresa, em detrimento do uso de instrumentos ¿QDQFHLURVGHULYDWLYRV

6HJXURV Por meio da compra de seguros, a Petrobras transfere ao mercado segurador os riscos que podem gerar prejuízos VLJQL¿FDWLYRVjFRPSDQKLDHDRVTXHGHYHPVHUREULJDWRULDPHQWHVHJXUDGRVSRUGLVSRVLomROHJDORXFRQWUDWXDO Por sua capacidade de assumir parcela expressiva de riscos, a Petrobras contrata franquias que podem chegar a US$ 60 milhþes. A maior parte da malha de dutos em território brasileiro e os riscos relacionados a lucros FHVVDQWHV¹GHFRUUHQWHVGHDOJXPVLQLVWUR¹HDRFRQWUROHGHSRoRVQmRVmRVHJXUDGRV3ODWDIRUPDVUH¿QDULDVH outras instalaçþes são cobertas por apólices de riscos operacionais e de petróleo. A movimentação de cargas Ê protegida por apólices de transporte, e as embarcaçþes, por seguro de casco e måquinas. Responsabilidade civil HSROXLomRDPELHQWDOWrPDSyOLFHVHVSHFt¿FDV Os projetos e as instalaçþes em construção com potencial de dano måximo provåvel superior a US$ 60 milhþes são cobertos contra riscos de engenharia por seguros contratados pela própria Petrobras, preferencialmente, ou pelas empreiteiras. Com os investimentos previstos no Plano de Negócios 2011-2015, HVSHUDVHXPDXPHQWRVLJQL¿FDWLYRQRYROXPHGHSUrPLRVSDJRVSHODFRQWUDWDomRGHVHJXURVSDUDFREULURVULVFRV associados aos novos empreendimentos. Para fazer face a essa demanda, a Petrobras conta com duas apólices de seguro guarda-chuva, que cobrem os riscos de engenharia, uma para os projetos em terra, outra para os offshore.

Os investimentos corporativos referem-se a edifícios e instalaçþes administrativas, tecnologia da informação e telecomunicaçþes, softwares, entre outras atividades não operacionais.

Na contratação dos seguros, os ativos são avaliados a partir do seu custo de reposição. O limite måximo de LQGHQL]DomR /0, GDDSyOLFHGHULVFRVRSHUDFLRQDLVpGH86ELOKmR1RFDVRGDDSyOLFHGHULVFRVGRSHWUyOHR o limite chega a US$ 2,3 bilhþes e corresponde ao maior valor de reposição das plataformas da Petrobras. Em RSUrPLR¿QDOGDVSULQFLSDLVDSyOLFHVGDFRPSDQKLD ULVFRVRSHUDFLRQDLVHGHSHWUyOHR WRWDOL]RX86 milhþes, para um valor segurado dos ativos de US$ 101 bilhþes.

'HVHPSHQKRGDVDo}HV

&UpGLWR

2DQRGHIRLPDUFDGRSRULQFHUWH]DVH[WHUQDVFDXVDGDVSHODFULVH¿VFDOGHGLYHUVRVSDtVHVHXURSHXVHOHQWD recuperação da economia norte-americana. Nos Estados Unidos, apesar de grande instabilidade durante todo o ano, o índice Dow Jones fechou com valorização de 5,53%. Jå na Europa, as principais bolsas apresentaram expressiva queda no ano. O Ibovespa acompanhou o mercado europeu e encerrou o período com baixa de 18,11%, aos 56.754 pontos.

A polĂ­tica de crĂŠdito adotada pela Petrobras para concessĂŁo e revisĂŁo dos crĂŠditos de seus clientes segue as GLUHWUL]HVGD/HL6DUEDQHV2[OH\ 62; 'HSRLVGHDQDOLVDGRVRVFUpGLWRVVmRDSURYDGRVSHODV&RPLVV}HVGH &UpGLWRRXHPLQVWkQFLDVXSHULRUSHODVGLUHWRULDVÂżQDQFHLUDVHGHFRQWDWRFRPRVFOLHQWHV2YROXPHGHFUpGLWR concedido vem crescendo a cada ano, acompanhando a expansĂŁo da companhia e permitindo o incremento de vendas com o menor risco possĂ­vel, especialmente no exterior.

As ações da companhia seguiram a volatilidade e incerteza do cenário econômico mundial e fecharam o ano em TXHGD1R%UDVLODVDo}HVRUGLQiULDV 3(75 FDtUDPHDVSUHIHUHQFLDLV 3(75 1D%ROVD GH1RYD<RUN 1\VH RQGHVHQHJRFLDPRVUHFLERVRUGLQiULRV 3%5 HSUHIHUHQFLDLV 3%5$ DGHVYDORUL]DomR foi de 34,31% e 31,23%, respectivamente. Com a queda das cotações, a Petrobras encerrou 2011 com valor de mercado de US$ 158 bilhões.

O controle da utilização do crÊdito, dentro e fora do País, Ê centralizado, e os processos de controle e concessão de crÊditos são aprimorados constantemente, de modo a oferecer suporte ao desempenho cada vez mais sustentåvel da atividade comercial. Com isso, a companhia aproxima-se mais de seus clientes e amplia o uso do crÊdito como instrumento comercial.

*RYHUQDQoD&RUSRUDWLYD

)LQDQFLDPHQWRV

A Petrobras aprimora constantemente suas pråticas de governança corporativa e seus instrumentos de gestão. 3RUVHUXPDFRPSDQKLDGHFDSLWDODEHUWRHVWiVXMHLWDjVUHJUDVGD&RPLVVmRGH9DORUHV0RELOLiULRV &90 H GD%0 )%RYHVSD1RH[WHULRUFXPSUHDVQRUPDVGD6HFXULWLHVDQG([FKDQJH&RPPLVVLRQ 6(& HGD1\VH nos Estados Unidos; do Latibex da Bolsa de Madri, na Espanha; e da Bolsa de ComÊrcio de Buenos Aires e da &RPLVLyQ1DFLRQDOGH9DORUHV &19 QD$UJHQWLQD

)LQDQFLDPHQWRVFRUSRUDWLYRV

$HVWUXWXUDGHJRYHUQDQoDFRUSRUDWLYDGD3HWUREUDVpFRPSRVWDSRU&RQVHOKRGH$GPLQLVWUDomRHVHXVFRPLWrV 'LUHWRULD([HFXWLYD&RQVHOKR)LVFDO$XGLWRULD,QWHUQD2XYLGRULD*HUDO&RPLWrGH$XGLWRULD&RPLWrGH1HJyFLRV H&RPLWrVGH,QWHJUDomR

No mercado de capitais internacional, foram emitidos bĂ´nus no total de US$ 9,6 bilhĂľes; no mercado bancĂĄrio, DVFDSWDo}HVVRPDUDP86ELOKmRQRH[WHULRUH86ELOKmRQR%UDVLO7DPEpPIRUDPIHLWDVRSHUDo}HV GHDGPLQLVWUDomRGHSDVVLYRVGH86PLOK}HVFRPRREMHWLYRGHDORQJDURSHUÂżOGHHQGLYLGDPHQWRGD FRPSDQKLD1RVÂżQDQFLDPHQWRVSHODVECAs, a companhia captou US$ 1,39 bilhĂŁo.

O Conselho de Administração aprimorou os instrumentos de governança, formalizando, em seu Regimento Interno, a prĂĄtica de sessĂŁo executiva nas reuniĂľes do Conselho e a inclusĂŁo dos critĂŠrios de avaliação de desempenho do colegiado. Foi aprovada tambĂŠm a inclusĂŁo de item sobre avaliação de desempenho da Diretoria Executiva, em seu Regimento Interno. Em 2011, foi assegurado aos empregados o direito de indicar um membro do Conselho de Administração, a ser votado por seus pares, obedecendo ao regulamento eleitoral. Foi aprovado tambĂŠm o Regulamento da Auditoria ,QWHUQDFRPQRUPDVGLUHWUL]HVHSULQFtSLRVHVSHFtÂżFRVSDUDDXQLGDGH A companhia desenvolveu programas de treinamento em governança corporativa e societĂĄria, voltados para GLULJHQWHVJHVWRUHVHFRQVHOKHLURVÂżVFDLVHGHDGPLQLVWUDomRGD3HWUREUDVQDVVRFLHGDGHVGR6LVWHPD)RUDP realizadas palestras â&#x20AC;&#x201C; sobre os temas Empresas Estatais, Responsabilidades dos Administradores e GestĂŁo de Riscos Corporativos â&#x20AC;&#x201C; e desenvolvidos programas de capacitação com o objetivo de promover a conscientização e a difusĂŁo das melhores prĂĄticas adotadas no Brasil e no exterior.

&RQWUROHVLQWHUQRV $ 3HWUREUDV D 3HWUREUDV ,QWHUQDWLRQDO )LQDQFH &RPSDQ\ 3LI&R  H D 3HWUREUDV $UJHQWLQD FRQFOXtUDP VXDV &HUWL¿FDo}HVGH&RQWUROHV,QWHUQRVGRH[HUFtFLRGHHPDWHQGLPHQWRj6HomRGD/HL6DUEDQHV2[OH\ 62; Hj,QVWUXomR&902VUHODWyULRV¿QDQFHLURVFRQVROLGDGRVIRUDPFHUWL¿FDGRVVHPUHVVDOYDVSHORV DXGLWRUHVLQGHSHQGHQWHVUHSHWLQGRRr[LWRDOFDQoDGRQRVH[HUFtFLRVDQWHULRUHV (VVDVFHUWL¿FDo}HVVmRSODQHMDGDVHRSHUDFLRQDOL]DGDVSHODiUHDFRUSRUDWLYDGH&RQWUROHV,QWHUQRVGD3HWUREUDV e contemplam os principais processos da controladora, assim como os das subsidiårias e controladas que se enquadrem na categoria de relevantes, de acordo com os quesitos da SOX/CVM e suas regulamentaçþes. A VXSHUYLVmRGRVWUDEDOKRVpXPDDWULEXLomRGRV&RPLWrV&RUSRUDWLYRVGD'LUHWRULD)LQDQFHLUDHGR&RPLWrGH Auditoria do Conselho de Administração. 2SURFHVVRGHFHUWL¿FDomRDQXDOHVWiHVWUXWXUDGRHPWUrVHWDSDVDYDOLDomRGRVFRQWUROHVHPQtYHOGHHQWLGDGH (entity level SDUDGLDJQRVWLFDURDPELHQWHGHJRYHUQDQoDFRUSRUDWLYDDXWRDYDOLDomRSHORVJHVWRUHVGRGHVHQKR de processos empresariais e dos controles internos; e teste dos referidos controles pela Auditoria Interna.

,QIRUPDo}HVVREUHDSUHVWDomRGHRXWURVVHUYLoRVTXHQmR VHMDP GH DXGLWRULD H[WHUQD SHOR DXGLWRU LQGHSHQGHQWH Âą ,QVWUXomR&90 A Petrobras utiliza instrumentos de gestĂŁo empresarial pautada em seu cĂłdigo de Ă&#x2030;tica, CĂłdigo de Boas PrĂĄticas e Diretrizes de Governança Corporativa. O Estatuto Social da companhia, no artigo 29, determina que os auditores independentes nĂŁo poderĂŁo prestar VHUYLoRVGHFRQVXOWRULDj3HWUREUDVGXUDQWHDYLJrQFLDGRFRQWUDWRGHDXGLWRULD

A Petrobras realizou captaçþes para manter o grau de liquidez necessĂĄrio Ă execução de seu plano de investimentos. O UHFRQKHFLPHQWRGDTXDOLGDGHGRFUpGLWRGDFRPSDQKLDSRUEDQFRVDJrQFLDVRÂżFLDLVGHFUpGLWR Export Credit Agencies â&#x20AC;&#x201C; ECAs HLQYHVWLGRUHVUHĂ&#x20AC;HWLXVHHPFXVWRVHSUD]RVIDYRUiYHLVDRÂżQDQFLDPHQWRGHVXDVDWLYLGDGHV

)LQDQFLDPHQWRVHVWUXWXUDGRV &RPSOH[R6XDSH&RPSDQKLD,QWHJUDGD7r[WLOGH3HUQDPEXFR &LWHSH e &RPSDQKLD3HWURTXtPLFDGH 3HUQDPEXFR 3HWURTXtPLFD6XDSH ¹9LVDQGRjFRQVWUXomRGDVSODQWDVGH3(7 UHVLQDGHSROLHWLOHQRWHUHIWiOLFR  HGH32< ¿ODPHQWRVWr[WHLVGHSROLpVWHU D&LWHSHFRQWUDWRX¿QDQFLDPHQWRV¹OLQKDVGHFUpGLWRGH5 milhþes, e a PetroquímicaSuape, R$ 605 milhþes. 5H¿QDULD $OEHUWR 3DVTXDOLQL 5HIDS 6$  ¹ $ 5HIDS FRQWUDWRX ¿QDQFLDPHQWRV ¹ OLQKDV GH FUpGLWR GH R$ 1,11 bilhão, para a construção de uma unidade de hidrotratamento.

$ 3HWUREUDV FRQWUDWRX FRP R %1'(6 XP ÂżQDQFLDPHQWR Âą OLQKDV GH FUpGLWR GH 5  ELOKmR SDUD FREULU LQYHVWLPHQWRVQDSODWDIRUPDÂż[D30;/

)LQDQFLDPHQWRVDIRUQHFHGRUHVHFOLHQWHV A polĂ­tica de fomento aos fornecedores teve continuidade com o Programa de RecebĂ­veis e de Participação, o Programa de Financiamento aos Clientes e o recĂŠm-lançado Programa Progredir. O lançamento, em junho, do Programa Progredir foi o evento mais importante no que tange ao fomento da cadeia de fornecedores da Petrobras. O programa visa viabilizar a obtenção de capital de giro pelas empresas fornecedoras de bens e de serviços da companhia e por seus respectivos fornecedores, a um custo mais barato, visto que o risco de crĂŠdito assumido pelos bancos ĂŠ o risco da Petrobras. AtĂŠ 31 de dezembro, 157 empresas KDYLDPWRPDGRÂżQDQFLDPHQWRVQRPRQWDQWHGH5ELOKmR O Programa de RecebĂ­veis se consolidou a partir do desenvolvimento e acompanhamento dos Fundos de ,QYHVWLPHQWRVGH'LUHLWRV&UHGLWyULRV ),'&V &RPRDSRLRGD3HWUREUDVDVLQVWLWXLo}HVTXHRSHUDPQRPHUFDGR de capitais estruturaram os fundos, oferecendo taxas inferiores Ă s praticadas no mercado bancĂĄrio. Foram implementados oito FIDCs, pondo Ă  disposição dos fornecedores R$ 1,1 bilhĂŁo, dos quais R$ 70 milhĂľes jĂĄ aportados pela companhia. 23URJUDPDGH3DUWLFLSDomRGHVWLQDVHDRIRUWDOHFLPHQWRHFRQ{PLFRÂżQDQFHLURGDFDGHLDSURGXWLYDFRPIRFR HPHPSUHVDVTXHWHQKDPGLÂżFXOGDGHGHREWHQomRGHÂżQDQFLDPHQWRSDUDDVVXPLUFRQWUDWRVFRPD3HWUREUDV O aporte direto de patrimĂ´nio aos fornecedores da cadeia de Ăłleo e gĂĄs ĂŠ realizado por meio da estruturação de )XQGRVGH,QYHVWLPHQWRHP3DUWLFLSDo}HV ),3 2VWUrV),3VHPRSHUDomRVRPDUDPHPXP3DWULP{QLR /tTXLGR 3/  GH 5  ELOKmR (VVHV LQYHVWLPHQWRV SURSRUFLRQDP R DXPHQWR GD FDSDFLGDGH RSHUDFLRQDO H tecnolĂłgica das empresas e do nĂ­vel de suas garantias. 2 3URJUDPD GH )LQDQFLDPHQWR D &OLHQWHV YLVD PHOKRUDU D DGPLQLVWUDomR GR Ă&#x20AC;X[R GH FDL[D GRV FOLHQWHV GD companhia. Baseia-se em FIDC, que atua como intermediĂĄrio entre os clientes e a Petrobras. O fundo paga Ă  Petrobras Ă  vista e recebe dos clientes a prazo. Assim, os pagamentos das compras dos clientes sĂŁo feitos no tempo previsto, sem impacto no caixa da companhia. Foi estruturado, este ano, o primeiro FIDC voltado ao ÂżQDQFLDPHQWRGHFOLHQWHVQRFDVRD%UDVNHPFRPXPYROXPHGLVSRQtYHOGH5ELOKmR


cyan magenta amarelo preto

E-4

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA

5HFXUVRV+XPDQRV

3URGXomR

(PVHXVDQRVGHH[LVWrQFLDD3HWUREUDVVHPSUHIRLUHFRQKHFLGDSHODYDORUL]DomRGHVHXVHPSUHJDGRVH SHODLGHQWLÂżFDomRGRVEUDVLOHLURVFRPRVYDORUHVGDFRPSDQKLD6REYiULRVDVSHFWRVIRLHVSHFLDOSDUDVXD gestĂŁo de pessoas.

A Petrobras iniciou a operação de cinco projetos de produção de óleo: a plataforma P-56 (módulo 3 do campo de 0DUOLP6XO HTXDWUR7/'VTXHDOLDGRVDRDXPHQWRGHSURGXomRUHVXOWDQWHGDLQWHUOLJDomRGHQRYRVSRoRVHP GLYHUVDVSODWDIRUPDV 33)362&DSL[DED)362&LGDGHGH$QJUDGRV5HLV FRPSHQVDUDPRGHFOtQLR QDWXUDOHJDUDQWLUDPjFRPSDQKLDXPDXPHQWRGHQDSURGXomRQDFLRQDOGHyOHRHOtTXLGRGHJiVQDWXUDO /*1  A produção em 2011 atingiu 2.022 mil bpd.

Em pesquisa realizada pelo jornal Valor Econômico e pela consultoria Aon Hewitt, pela quarta vez consecutiva a Petrobras aparece no topo do rankingGDVHPSUHVDV³PDLVGHVHMDGDV´SDUDVHWUDEDOKDU7DPEpPVHPDQWHYHQR VHJXQGROXJDUQDSHVTXLVD(PSUHVDGRV6RQKRVGRV-RYHQVGD&LDGH7DOHQWRV¿FDQGRHQWUHDVGH]SULPHLUDV escolhas pela oitava vez seguida. Pelo sexto ano consecutivo, a Petrobras se manteve na lista das empresas mais sustentåveis do mundo, VHJXQGRRVFULWpULRVGR'RZ-RQHV6XVWDLQDELOLW\,QGH[ '-6, HDJHVWmRGRFDSLWDOKXPDQRWHYHSDSHO importante nessa conquista.

(YROXomRGRHIHWLYR O Sistema Petrobras encerrou o ano com 81.918 empregados, tendo aumentado 1,8% seu efetivo em relação a 2010. Em virtude da expansão dos negócios, foram realizados dois processos seletivos para a Petrobras Controladora, com cerca de 217 mil candidatos inscritos e 2.406 admitidos.

%HQHItFLRV A$VVLVWrQFLD0XOWLGLVFLSOLQDUGH6D~GH $06 GHXFREHUWXUDDPLOEHQH¿FLiULRVHPDSUR[LPDGDPHQWH mil pontos de atendimento. O gasto da Petrobras com consultas, exames e internações foi de R$ 814 milhões. Foram aplicados R$ 151,8 milhões em benefícios educacionais, contemplando 20.677 empregados com a concessão do auxílio a 29.443 dependentes.

&XVWRGHSHVVRDO 2 FXVWR GH SHVVRDO p FRPSRVWR SHOD UHPXQHUDomR Âż[D GRV HPSUHJDGRV VDOiULRV YDQWDJHQV DGLFLRQDLV H HQFDUJRV HSHODVGHVSHVDVUHIHUHQWHVDRVEHQHItFLRVHGXFDFLRQDLVGHSUHYLGrQFLDFRPSOHPHQWDUH$06(P 2011, esse gasto atingiu R$ 14,6 bilhĂľes na controladora, 18,3% superior ao do ano anterior. ContribuĂ­ram para esse aumento o reajuste salarial, com ganho real para os empregados de atĂŠ 3,25%, a expansĂŁo do efetivo e o FUHVFLPHQWRGDIROKDGHSDJDPHQWRHPYLUWXGHGHDQXrQLRVHSURJUHVVmRQDFDUUHLUD1R6LVWHPD3HWUREUDVR custo total de pessoal foi de aproximadamente R$ 18,5 bilhĂľes.

'HVHQYROYLPHQWRGH5HFXUVRV+XPDQRV )RUDPLQYHVWLGRV5PLOK}HVHPGHVHQYROYLPHQWRGRVSUR¿VVLRQDLVUHVXOWDQGRHPXPDPpGLDGH horas de treinamento por empregado em aproximadamente 227 mil participações em cursos de educação continuada, no País e no exterior, e em formação de novos empregados. No Brasil, os investimentos alcançaram R$ 185,6 milhões. &RPRLQWXLWRGHIRPHQWDUDPmRGHREUDSDUDDLQG~VWULDGHyOHRJiVHQHUJLDHELRFRPEXVWtYHLVRVFRQYrQLRV estabelecidos pelo Programa Petrobras de Formação de Recursos Humanos 3)5+ SHUPLWLUDPGHVWLQDUUHFXUVRV da Participação Especial para a concessão de bolsas de estudo a cursos ligados à carreira da indústria de óleo HJiV7DLVUHFXUVRVHVWmRSUHYLVWRVQDFOiXVXODGHSHVTXLVDHGHVHQYROYLPHQWRGRVFRQWUDWRVGHFRQFHVVmR FHOHEUDGRVHQWUH3HWUREUDVH$JrQFLD1DFLRQDOGR3HWUyOHR*iV1DWXUDOH%LRFRPEXVWtYHLV $13 2SURJUDPD iniciado em 2010, contempla 34 instituições participantes, com investimentos superiores a R$ 200 milhões e 11 mil bolsistas em cursos de nível técnico e superior, para graduação, mestrado, doutorado e pesquisador visitante.

2SURMHWR9DUUHGXUDÂąLPSOHPHQWDGRQD%DFLDGH&DPSRVHPFRPRREMHWLYRGHLGHQWLÂżFDURSRUWXQLGDGHV exploratĂłrias em ĂĄreas prĂłximas aos campos e infraestrutura existentes â&#x20AC;&#x201C; tambĂŠm deu excelentes resultados, atingindo produção mĂŠdia de 125 mil bpd em 2011. Esta produção veio das descobertas realizadas em 2010 QRVSURVSHFWRV%UDYD&DULPEpH7UDFDMiWRGDVQR3Up6DOUHVSHFWLYDPHQWHQDVFRQFHVV}HVGH0DUOLP Caratinga e Marlim Leste; e Jabuti e AruanĂŁ, no pĂłs-sal. (PIHYHUHLURWHYHLQtFLRR7/'GH6tGRQDWUDYpVGDSODWDIRUPD66TXHHVWDYDLQVWDODGDQDORFDomRGH7LUR SDUDDUHDOL]DomRGR7/'LQLFLDGRHP$VMD]LGDVGH7LURH6tGRQORFDOL]DPVHHPiJXDVUDVDVQRSyVVDO da porção sul da Bacia de Santos. (PDEULOFRPHoRXR7/'GDiUHDGH/XOD1RUGHVWHQD%DFLDGH6DQWRVQRDQWLJREORFRH[SORUDWyULR%06GR PrĂŠ-Sal, a cerca de 300 km da costa do Rio de Janeiro. O teste foi realizado pelo FPSO BW Cidade de SĂŁo Vicente, ancorado a 2.120 m de profundidade. A Petrobras ĂŠ a operadora, com 65% de participação, no consĂłrcio do qual WDPEpPSDUWLFLSDPR%**URXS  HD*DOS(QHUJLD  $VLQIRUPDo}HVREWLGDVQHVWHWHVWHVXEVLGLDUmRRV estudos para o desenvolvimento do segundo sistema piloto de produção, a ser instalado na ĂĄrea de Lula Nordeste. (PMXQKRIRLLQLFLDGRR7/'GH$UXDQmQRSyVVDOGDSRUomRVXOGD%DFLDGH&DPSRVDWUDYpVGRSRoR5-6 LQWHUOLJDGRDR)362&LGDGHGH5LRGDV2VWUDV2EORFRH[SORUDWyULR &0 HVWiORFDOL]DGRHQWUHRV FDPSRVGH3DPSRH(VSDGDUWHHQWUHPHPGHOkPLQDGÂśiJXD$VLQIRUPDo}HVREWLGDVVXEVLGLDUmRRV HVWXGRVSDUDPHOKRUFDUDFWHUL]DomRGDURFKDUHVHUYDWyULRGRVĂ&#x20AC;XLGRVHGRSRWHQFLDOSURGXWLYRGDVDFXPXODo}HV de petrĂłleo no bloco. Em agosto, entrou em produção, no campo de Marlim Sul, a plataforma semissubmersĂ­vel P-56, projetada para SURFHVVDUPLOESGHLQVWDODGDHPOkPLQDGÂśiJXDGHP$FRQVWUXomRGRVPyGXORVLQWHJUDGRV topside  GD3DSUHVHQWRXHOHYDGRtQGLFHGHFRQWH~GRORFDO  2FDVFRIRLFRQVWUXtGRLQWHJUDOPHQWHQR%UDVLORTXH demonstra capacidade da indĂşstria nacional para atender Ă s encomendas da Petrobras. (PRXWXEURDFRPSDQKLDLQLFLRXPDLVXP7/'QDiUHDGH&DULRFD1RUGHVWHDWUDYpVGR)362Dynamic Producer, RPHVPRTXHUHDOL]RXR7/'GH*XDUiWDPEpPQR%062SRoRIRLSHUIXUDGRHPOkPLQDG iJXDGHPD 275 km da costa de SĂŁo Paulo. A estimativa ĂŠ de que o sistema opere por cerca de seis meses. A Petrobras detĂŠm 45% dos interesses da ĂĄrea. Os demais parceiros do consĂłrcio sĂŁo o BG Group, com 30%, e a Repsol, com 25%.

3URGXomRGH*iV1DWXUDO A produção de gĂĄs natural totalizou 56,4 milhĂľes de mÂł/dia â&#x20AC;&#x201C; um aumento de 6,2% em relação ao ano anterior ÂąHPGHFRUUrQFLDGRERPGHVHPSHQKRGRVFDPSRVGH&DQDSX&DFKDORWH%DOHLD)UDQFDH3HURiHGRLQtFLR do escoamento de gĂĄs da P-57 no Parque das Baleias, no EspĂ­rito Santo. AlĂŠm disso, o tĂŠrmino da adequação GD8QLGDGHGH3URFHVVDPHQWRGH*iVGD5HÂżQDULD3UHVLGHQWH%HUQDUGHV 53%& SRVVLELOLWRXRLQFUHPHQWRGD produção do campo de Lagosta, na Bacia de Santos. (PDEULOD3HWUREUDVLQLFLRXDSURGXomRGDSODWDIRUPDÂż[DGH0H[LOKmR 30;/ LQVWDODGDQD%DFLDGH 6DQWRVDNPGDFRVWDHPOkPLQDGÂśiJXDGHP&RPPVHQGRPGHMDTXHWDD30;/pD PDLVDOWDSODWDIRUPDÂż[DGDFRPSDQKLDHWHPFDSDFLGDGHGHSURGXomRGHPLOK}HVGHP3/dia de gĂĄs natural.

7DPEpPWHYHFRQWLQXLGDGH RSURMHWR3URÂżVV}HVGH)XWXUR ZZZSURÂżVVRHVGHIXWXURFRPEU FXMRREMHWLYRp despertar nos estudantes do Ăşltimo ano dos nĂ­veis fundamental e mĂŠdio o interesse pelas carreiras tĂŠcnicas da indĂşstria de Ăłleo e gĂĄs.

Dando continuidade aos projetos previstos no PlangĂĄs na Bacia de Santos, iniciou-se o escoamento do gĂĄs dos FDPSRVGH8UXJXiH/XODRTXHFRQÂżUPDDWUDMHWyULDDVFHQGHQWHGDRIHUWDGRSURGXWRSDUDDWHQGHUjGHPDQGD do mercado.

)RLFULDGRR3URJUDPD$WUDomRGH7DOHQWRVGHHVWtPXORDRVHVWXGDQWHVXQLYHUVLWiULRVjSDUWLFLSDomRQRVSURFHVVRV seletivos da companhia. Com palestras em diversas instituiçþes de ensino e em eventos para estudantes, HPSUHJDGRVGD3HWUREUDVDSUHVHQWDUDPDRVMRYHQVDVGLYHUVDVRSRUWXQLGDGHVGHFDUUHLUDHPIDFHGRVGHVD¿RV oriundos do Plano de Negócios da Petrobras.

0HUHFH GHVWDTXH DLQGD D HOHYDomR VLJQLÂżFDWLYD GD HQWUHJD GH JiV DR PHUFDGR QD 5HJLmR 1RUWH FRP D progressiva conversĂŁo das tĂŠrmicas a diesel e Ăłleo para gĂĄs natural.

$WHQWDWDPEpPjQHFHVVLGDGHGHPmRGHREUDTXDOLÂżFDGDHPVXDFDGHLDGHIRUQHFHGRUHVD3HWUREUDVFRRUGHQD MXQWR FRP R *RYHUQR )HGHUDO H RXWUDV HQWLGDGHV R 3ODQR 1DFLRQDO GH 4XDOLÂżFDomR 3URÂżVVLRQDO 3143  (VWUXWXUDGRHPRSURJUDPDFDSDFLWDSRUPHLRGHFXUVRVJUDWXLWRVPLOKDUHVGHSURÂżVVLRQDLVHPWRGRV RVHVWDGRVGR3DtV$WpR3URPLQSTXDOLÂżFRXFHUFDGHPLOSHVVRDVHPFDWHJRULDVSURÂżVVLRQDLV atendendo 17 estados do Brasil, com investimentos de R$ 220 milhĂľes da Petrobras.

1(*�&,26 ([SORUDomRH3URGXomR Um ano para comemorar. Assim foi 2011, com descobertas de jazidas, implantação de novos projetos, ampliação da infraestrutura para escoamento de gås e aumento da produção de óleo e gås, inclusive no PrÊ-Sal. Foram contratadas sondas de perfuração e plataformas de produção e garantidas novas reservas.

([SORUDomR Em 2011, a Petrobras consolidou o sucesso da atividade exploratória nas seçþes PrÊ-Sal e pós-sal das bacias VHGLPHQWDUHVEUDVLOHLUDVHPHVSHFLDODVGR6XOHGR6XGHVWH (VStULWR6DQWR&DPSRVH6DQWRV $OpPGLVVR DYDQoRXQDVDWLYLGDGHVUHODWLYDVDRV3ODQRVGH$YDOLDomRGH'HVFREHUWD 3$' QHVWDVEDFLDVFRQ¿UPDQGRDV avaliaçþes iniciais das descobertas anteriores, sobretudo as de 2010. Este sucesso vem fortalecendo os alicerces para que a produção de petróleo no Brasil continue sua trajetória de crescimento, com sustentabilidade, ao longo das próximas dÊcadas.

&XVWRVGH([WUDomR Em 2011, o custo mĂŠdio de extração, sem participação governamental, foi de US$ 12,59/boe â&#x20AC;&#x201C; um aumento de 26% em relação ao ano anterior, devido ao maior nĂşmero de intervençþes em poços. Com participaçþes JRYHUQDPHQWDLVRFXVWRGHH[WUDomRFKHJRXD86ERHÂąDFLPDGRYHULÂżFDGRHPLQĂ&#x20AC;XHQFLDGR SULQFLSDOPHQWHSHODHOHYDomRGRSUHoRPpGLRGHUHIHUrQFLDGRSHWUyOHRQDFLRQDO Em reais, o custo mĂŠdio de extração foi de R$ 21,19/boe, superior em 21% a 2010. IncluĂ­das as participaçþes JRYHUQDPHQWDLVDWLQJLX5ÂąDFLPDGRH[HUFtFLRDQWHULRUQRYDPHQWHLQĂ&#x20AC;XHQFLDGRSHORFUHVFLPHQWR GHQRSUHoRPpGLRGHUHIHUrQFLDGRSHWUyOHRQDFLRQDOHPUHDLV

3Up6DO As expectativas para o PrÊ-Sal começaram a se tornar realidade em 2011, especialmente devido ao início da SURGXomRFRPHUFLDOGR3LORWRGH/XODTXHFRQ¿UPRXR3ROR3Up6DOGD%DFLDGH6DQWRVFRPRQRYDIURQWHLUD petrolífera, com alta produtividade. No PrÊ-Sal, o índice de sucesso exploratório permanece elevado, tendo sido perfurados 37 poços em 2011, todos encontrando a presença de hidrocarbonetos. Com a descoberta de Franco, Carioca Nordeste e Macunaíma, foram concluídas as perfuraçþes de 35 poços nas åreas licitadas, um poço na Cessão Onerosa e mais um para a ANP. Nestas atividades, utilizaram-se dez sondas de perfuração. Em 2012, a previsão Ê de que outras nove iniciem operação na årea.

Foram perfurados 123 poços exploratĂłrios, dos quais 76 em terra e 47 no mar â&#x20AC;&#x201C; destes, 17 tiveram como objetivo o PrĂŠ-Sal. O Ă­ndice de sucesso exploratĂłrio foi de 59%.

O primeiro Projeto de Antecipação de Produção de 2011 teve início em fevereiro, no poço 6-MLL-70, no reservatório GH7UDFDMi¹FDPSRGH0DUOLP/HVWHQD%DFLDGH&DPSRV(PDEULOFRPHoRXR3URMHWRGH$QWHFLSDomRGH Produção da årea de Brava, no campo de Marlim.

%$&,$'(&$0326

$LQGDHPDEULOFRPHoRXR7/'GH/XOD1RUGHVWHXWLOL]DQGRR)362&LGDGH6mR9LFHQWHTXHDWLQJLXDSURGXomR de 14,4 mil bpd em julho.

Dois novos poços exploratórios resultaram nas acumulações de Forno e Guanabara, a primeira no Pré-Sal do campo de Albacora, e a segunda, no pós-sal, 70 km a sudoeste do campo de Jubarte. A perfuração do prospecto *iYHD±NPDOHVWHGRVFDPSRVGH0DURPEDH3DSD7HUUDQRVXOGDEDFLDHPOkPLQDG¶iJXDGHP± UHVXOWRXHPPDLVXPDGHVFREHUWDQR3Up6DO2FRQVyUFLRpIRUPDGRSHOD5HSVRO6LQRSHF RSHUDGRUDFRP  D3HWUREUDV  HD6WDWRLO  

%$&,$'(6$1726 $VGHVFREHUWDVQmRVHOLPLWDUDPDR3Up6DO(PQRYHPEURSUy[LPRjViUHDVGH7LURH6tGRQKRXYHDGHVFREHUWD no prospecto Patola, de uma acumulação no pĂłs-sal, que contribui para consolidar um novo polo de produção na porção sudoeste desta bacia. No PrĂŠ-Sal, a perfuração do prospecto AbarĂŠ â&#x20AC;&#x201C; no bloco BMS-9, o mesmo que contĂŠm a acumulação de Carioca â&#x20AC;&#x201C; resultou em descoberta que pode elevar o potencial da ĂĄrea. EstĂĄ prevista a realização de um teste de formação no poço para avaliar a produtividade dos reservatĂłrios.

O poço 9-RJS-660 do Piloto de Lula, o primeiro a produzir comercialmente no PrĂŠ-Sal da Bacia de Santos, registrou o maior volume de produção da Petrobras em maio, alcançando a mĂŠdia de 28.436 bpd. O poço estĂĄ interligado ao FPSO Cidade de Angra dos Reis e ĂŠ o primeiro dos seis poços de produção a serem conectados DR)362&RQVLGHUDQGRVHDSURGXomRGHyOHRHGHJiVQDWXUDORYROXPHIRLGHERHGRTXHFRQÂżUPDR alto potencial dos reservatĂłrios do PrĂŠ-Sal brasileiro. Em abril, foi feita a conexĂŁo do primeiro poço injetor de gĂĄs. Em setembro, entrou em operação o gasoduto Lula-MexilhĂŁo, que viabiliza o escoamento do gĂĄs natural das plataformas destinadas ao desenvolvimento da primeira fase do PrĂŠ-Sal da Bacia de Santos e dĂĄ mais Ă&#x20AC;H[LELOLGDGHDRVXSULPHQWRGHJiVSDUDRPHUFDGRQDFLRQDO&RPFDSDFLGDGHSDUDHVFRDUDWpPLOK}HVGHPĂą dia, o gasoduto transporta o gĂĄs produzido no Piloto de Lula, ligando a plataforma Cidade Angra dos Reis Ă de 0H[LOKmR2JDVRGXWRVHUiXVDGRWDPEpPSDUDHVFRDURJiVQDWXUDOSURGX]LGRQRVSLORWRVGH6DSLQKRiH7XSL Nordeste, que entrarĂŁo em operação, respectivamente, em 2012 e 2013. (PRXWXEURFRPHoRXR7/'GH&DULRFD1RUGHVWHQR)362Dynamic Producer, que produziu 22 mil bpd em dezembro.

(PIHYHUHLURLQLFLRXVHRSODQRGHDYDOLDomRGDiUHDGH&DULRFD'RVWUrVSRoRVGHH[WHQVmRSURJUDPDGRVR &DULRFD1RUGHVWHMiIRLSHUIXUDGRHR6HODWHYHLQtFLRHPGH]HPEUR8P7HVWHGH/RQJD'XUDomR 7/' QR&DULRFD Nordeste indicou potencial de produção de 28 mil barris/dia.

Nos últimos meses do ano, entraram em operação mais dois poços produtores no Piloto de Lula. Com isso, o 3Up6DOFRQVLGHUDQGRDVEDFLDVGH6DQWRVHGH&DPSRVDWLQJLXXPDSURGXomR SDUFHOD3HWUREUDV GHPLO bpd em dezembro, o que representava 6,6% da produção nacional da companhia.

(PGH]HPEURDSHUIXUDomRGRVHJXQGRSRoRGHH[WHQVmRQR3$'GH*XDUiÂąTXHFRQÂżUPRXDFRQWLQXLGDGHGD DFXPXODomRQR3Up6DOÂąHDFRQFOXVmRGR7/'QRSRoRGHVFREULGRUSHUPLWLUDPDGHFODUDomRGHFRPHUFLDOLGDGH da ĂĄrea, dando origem ao campo de SapinhoĂĄ.

Vale destacar o afretamento de duas plataformas do tipo FPSO para os projetos-pilotos da årea de Sapinhoå Norte e Cernambi, ambos no Polo PrÊ-Sal da Bacia de Santos. A decisão estratÊgica dos consórcios visa antecipar a produção dessas åreas, cujos testes iniciais de vazão apresentaram bons resultados. Cada um dos FPSOs terå capacidade de produzir atÊ 150 mil bpd, e 6 e 8 milhþes de m³/dia de gås respectivamente. A previsão Ê de que entrem em operação em 2014.

%$&,$'2(63Ă&#x2039;5,726$172 (QWUHPDLRHDJRVWRDSHUIXUDomRGRVSURVSHFWRV%ULJDGHLUR3pGH0ROHTXHH4XLQGLPHPOkPLQDGÂśiJXDGH PUHVXOWRXQDVGHVFREHUWDVGHWUrVDFXPXODo}HVQRSyVVDO(ODVHVWmRORFDOL]DGDVDFHUFDGHNPD OHVWHGRFDPSRGH*ROÂżQKRHMXQWDPHQWHFRPDiUHDGH&RFDGD GHVFREHUWDHP YrPFRQVROLGDQGRDiUHD denominada Parque dos Doces, em que a Petrobras detĂŠm 65% da concessĂŁo. 2FRQVyUFLRIRUPDGRSHOD3HWUREUDV  HSHOD5HSVRO6LQRSHF  GHVFREULXJiVFRPDSHUIXUDomR do prospecto Malombe, cerca de 20 km a sudeste dos campos de PeroĂĄ e CangoĂĄ. SerĂĄ dada continuidade Ă exploração, com a proposta de perfuração de dois outros poços.

&RQFHVV}HV Não houve rodada de licitaçþes da ANP em 2011, mas a Petrobras aumentou sua participação em alguns contratos por meio de operaçþes de farm-in nos blocos sob concessão e fez as devoluçþes de blocos previstas. Com isso, o portfólio da companhia conta com 132 contratos de concessão, totalizando 119.132 km2 distribuídos em 194 blocos exploratórios, dos quais 31.068 km2 correspondem a 51 planos de avaliação de descoberta.

3ODQHMDPHQWR,QWHJUDGRGR3Up6DO Para que a Petrobras se planeje de forma integrada para os impactos advindos do desenvolvimento do PrÊ-Sal, IRLHVWUXWXUDGRR3ODQR'LUHWRUGR3ROR3Up6DOGD%DFLDGH6DQWRV 3ODQVDO FRPSDUWLFLSDomRGHGLYHUVDViUHDV corporativas e de negócios da companhia. Em abril, a projeção feita na revisão anual do Plansal indicou que os investimentos necessårios ao desenvolvimento da årea serão menores que os previstos nos planos anteriores. O esforço de otimização de custos realizado permitiu uma redução de 45% em relação ao Plano Diretor original, de 2008, e de cerca de 32% em relação ao de (VWHUHVXOWDGRpGHFRUUHQWHGRDXPHQWRGDSURGXWLYLGDGHGRVSRoRV GHPLOESGSDUDPLOESG HGD redução de 34% no tempo de perfuração. AtÊ 2015, os investimentos da Petrobras para o desenvolvimento dos projetos do PrÊ-Sal deverão alcançar US$ 53,4 bilhþes. Com esse esforço, espera-se ultrapassar, em 2017, a meta de produção de 1 milhão de bpd da Petrobras e parceiros, anteriormente divulgada.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-5

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA

6RQGDVGH3HUIXUDomR

&RPHUFLDOL]DomR

A Petrobras tem adotado uma estratÊgia de antecipação de suas demandas, estímulo à construção de novos equipamentos e contratação de longo prazo.

0HUFDGRLQWHUQR

(PXPDXQLGDGHĂ&#x20AC;XWXDQWHGHOkPLQDGÂśiJXDUDVDHQFHUURXRFRQWUDWRHHQWUDUDPHPRSHUDomRVRQGDVGH SHUIXUDomRPDUtWLPDVVHQGRVHLVSDUDRSHUDUHPOkPLQDGÂśiJXDDFLPDGHPLOPÂąRXWUDVWUrVHVWDYDPHPWHVWH GHDFHLWDomRQRÂżPGRDQR)RLDSURYDGDDFRQWUDWDomRSDUDFRQVWUXomRHDIUHWDPHQWRGRSULPHLURORWHGHVHWH novas sondas de perfuração marĂ­tima, que atenderĂŁo ao programa de perfuração de longo prazo. Esse lote faz parte dos processos de licitação destinados Ă contratação de atĂŠ 28 sondas de perfuração que serĂŁo construĂ­das QR%UDVLOSDUDRSHUDUHPOkPLQDGÂśiJXDGHPLOP (PDFRPSDQKLDUHFHEHUiVRQGDVGHSHUIXUDomRVHQGRVRQGDVĂ&#x20AC;XWXDQWHVSDUDRSHUDUHPOkPLQD GÂśiJXDDFLPDGHPLOPHGXDVjack-ups.

Como resultado do crescimento econĂ´mico do PaĂ­s, a companhia comercializou em 2011, no mercado interno, 2.131 mil bpd de derivados de petrĂłleo, volume 9% superior ao de 2010. 2YROXPHYHQGLGRGHGLHVHOFUHVFHXUHĂ&#x20AC;H[RGRDXPHQWRGR3,%GRERPGHVHPSHQKRGRYDUHMRGDPDLRU participação de mercado da Petrobras e do recorde na safra de grĂŁos em 2011. A comercialização de gasolina registrou o mais alto Ă­ndice de crescimento entre os principais derivados: 24%. As vendas foram impulsionadas, principalmente, pelo aumento da frota de veĂ­culos Ă&#x20AC;H[IXHO associado Ă vantagem do preço da gasolina frente ao do etanol. O GLP teve expansĂŁo de 3% nas vendas, enquanto a nafta se manteve estĂĄvel. JĂĄ as entregas de QAV cresceram 12% em função do aumento da oferta de voos das companhias aĂŠreas de mĂŠdio porte e regionais, do aquecimento da economia e da valorização do câmbio.

5HVHUYDV3URYDGDV

$VYHQGDVGHyOHRFRPEXVWtYHOWLYHUDPTXHGDGHGHYLGRjFRQFRUUrQFLDGHVXEVWLWXWRVHVSHFLDOPHQWHRJiV natural de uso tĂŠrmico e industrial.

As reservas provadas de óleo, condensado e gås natural da Petrobras no Brasil atingiram 15,706 bilhþes de boe em 2011 pelo critÊrio ANP/SPE, um aumento de 2,8% em relação ao ano anterior. Foi apropriado 1,242 bilhão de boe em reservas e produzidos 819 milhþes de boe, incorporando às reservas provadas da companhia 423 milhþes de boe.

([SRUWDo}HV[LPSRUWDo}HV

&RPHVVDLQFRUSRUDomRRĂ&#x2039;QGLFHGH5HSRVLomRGH5HVHUYDV ,55 IRLGHRTXHVLJQLÂżFDTXHSDUDFDGDEDUULO de Ăłleo equivalente produzido no ano foi acrescentado 1,52 barril de Ăłleo equivalente Ă s reservas. O indicador 5HVHUYD3URGXomR 53 DXPHQWRXSDUDDQRV Entre as principais apropriaçþes em 2011, estĂŁo: Â&#x2021;

Descoberta de SapinhoĂĄ, PrĂŠ-Sal da Bacia de Santos;

Â&#x2021;

'HVFREHUWDVGH7L]LXH3DWDWLYDQR5LR*UDQGHGR1RUWHH&HDUiH7DSLUDQJD1RUWHQD%DKLD

Â&#x2021;

Descobertas no campo de Albacora, na Bacia de Campos;

Â&#x2021;

Açþes de gerenciamento de reservatórios.

3URMHWRVH7/'VSDUD Principais sistemas que entrarĂŁo em produção: Â&#x2021;

%DOHLD$]XOâ&#x20AC;&#x201C; A 85 km do litoral sul do EspĂ­rito Santo, na porção Norte do PrĂŠ-Sal da Bacia de Campos, o FPSO Cidade de Anchieta tem capacidade para produzir atĂŠ 100 mil bpd de Ăłleo e 3,5 milhĂľes de mÂł/dia de gĂĄs;

Â&#x2021;

7LURH6tGRQÂą Localizado em ĂĄguas rasas da Bacia de Santos, com capacidade de 80 mil bpd de Ăłleo e 2 PLOK}HVGHPĂąGLDGHJiVR)362&LGDGHGH,WDMDtVHUiLQVWDODGRHPOkPLQDGÂśiJXDGHP

As exportaçþes de petróleo atingiram 435 mil bpd, apresentando redução de 12% em relação ao volume de 2010, HVSHFLDOPHQWHHPIXQomRGRSURFHVVDPHQWRGHPDLRUYROXPHGHyOHRQDFLRQDOQRSDUTXHGHUH¿QREUDVLOHLUR-i as vendas de derivados para o mercado externo somaram 217 mil bpd, um aumento de 9%, impulsionado pelo crescimento nas exportaçþes de óleo combustível. $VLPSRUWDo}HVGHSHWUyOHR¿FDUDPHPPLOESGRTXHUHSUHVHQWDXPDXPHQWRGHHDVGHGHULYDGRV somaram 387 mil bpd, um acrÊscimo de 29%. A importação de derivados claros, sobretudo gasolina e óleo diesel, aumentou devido à expansão do consumo no mercado interno, decorrente da quebra de safra e do aumento do preço do etanol para o consumidor. O volume de diesel importado atingiu 164 mil bpd, 15% superior ao de 2010; e o de gasolina, 43 mil bpd, um aumento de 378%. 2 VDOGR ¿QDQFHLUR GD EDODQoD FRPHUFLDO GD FRPSDQKLD HP  FDOFXODGR FRP EDVH QDV H[SRUWDo}HV H LPSRUWDo}HVGHSHWUyOHRHGHULYDGRVVHPFRQVLGHUDUJiVQDWXUDOJiVQDWXUDOOLTXHIHLWR *1/ HQLWURJHQDGRV DSUHVHQWRXGp¿FLWGH86ELOK}HV

3HWURTXtPLFD A atuação da Petrobras nesta årea Ê integrada aos demais negócios da companhia, de forma a ampliar a produção de petroquímicos e de biopolímeros, preferencialmente por meio de participaçþes societårias no Brasil e no exterior.

([SDQVmRGD%UDVNHP

Â&#x2021;

Â&#x2021;

*DVRGXWR6XO1RUWH&DSL[DED ¹ A construção do gasoduto marítimo GSNC, que irå interligar as porçþes sul e norte do Espírito Santo, escoarå o gås do PrÊ-Sal do Parque das Baleias atÊ Camarupim, para que seja SURFHVVDGRQD8QLGDGHGH7UDWDPHQWRGH*iVGH&DFLPEDV 87*&  3LORWRGH6DSLQKRi DQWLJR*XDUi ¹ Situado no PrÊ-Sal da Bacia de Santos, o FPSO Cidade de São Paulo terå capacidade de tratamento de óleo de 120 mil bpd e de processamento de gås natural de 5 milhþes de m3/dia.

6HUmRUHDOL]DGRVDLQGDTXDWUR7/'VQR3Up6DOGD%DFLDGH6DQWRVXWLOL]DQGRRV)362V&LGDGHGH6mR9LFHQWH e Dynamic Producer:/XOD iUHDGH,UDFHPD 6DSLQKRi iUHD1RUWH /XOD iUHDGH7XSL$OWR H)UDQFR1RSyVVDO GD%DFLDGH&DPSRVVHUmRIHLWRVGRLV7/'V 2OLYDH(VSDGDUWH FRPR)362&LGDGHGH5LRGDV2VWUDV

5HÂżQRH&RPHUFLDOL]DomR 5HÂżQR

A Braskem consolidou sua posição como a maior produtora de polipropileno nos Estados Unidos com a aquisição do negĂłcio deste produto da Dow Chemical: quatro plantas, duas naquele paĂ­s e duas na Alemanha. 2VDWLYRVQRV(8$WrPFDSDFLGDGHGHSURGXomRGHPLOWDQRRTXHUHSUHVHQWDXPDXPHQWRGHQD produção americana da Braskem, totalizando 1,4 milhĂŁo de t/ano. A capacidade de produção dos ativos na Alemanha ĂŠ de 545 mil t/ano. Em outubro, o BNDES aprovou um limite de crĂŠdito de R$ 2,46 bilhĂľes para a Braskem, que usarĂĄ esses recursos para apoiar o plano de investimentos em Alagoas, Bahia, Rio de Janeiro e Rio Grande do Sul. Em setembro, a Braskem iniciou no MĂŠxico a terraplenagem onde serĂĄ construĂ­do o Complexo Industrial do Projeto Etileno XXI, que produzirĂĄ 1,05 milhĂŁo de t/ano de polietileno para abastecer, principalmente, o mercado interno mexicano. Resultado de uma joint venture â&#x20AC;&#x201C; em que a Braskem tem participação de 65% e o grupo mexicano Idesa, de 35% â&#x20AC;&#x201C;, o Complexo Industrial custarĂĄ US$ 3 bilhĂľes e ĂŠ o principal projeto JUHHQÂżHOG da Braskem.

$TXLVLomRGD,QQRYD

EPDVUHÂżQDULDVGD3HWUREUDVQR%UDVLOSURFHVVDUDPPLOESGGHFDUJDIUHVFDFRPXWLOL]DomRPpGLD de 92% da capacidade, e produziram 1.896 mil bpd de derivados. Do volume total do petrĂłleo processado, 82% foram provenientes de campos brasileiros.

Em março, a Petrobras adquiriu 100% do capital da Innova S.A., antes controlada pela Petrobras Energia Internacional S.A..

$RORQJRGRDQRIRUDPUHDOL]DGDVSDUDGDVSURJUDPDGDVSDUDPDQXWHQomRQDVUHÂżQDULDV3UHVLGHQWH%HUQDUGHV 53%& /DQGXOSKR$OYHV 5/$0 'XTXHGH&D[LDV 5HGXF &ODUD&DPDUmR 53&& *DEULHO3DVVRV 5HJDS  /XEULÂżFDQWHVGR1RUGHVWH /XEQRU H3DXOtQLD 5HSODQ 

6LWXDGDQR3ROR3HWURTXtPLFRGH7ULXQIRD,QQRYDpDPDLRUSURGXWRUDQDFLRQDOGHHVWLUrQLFRVHXPDGDVSULQFLSDLV unidades petroquímicas de segunda geração do País. Sua aquisição demonstra a intenção da companhia de UHDOL]DULQYHVWLPHQWRVQRPHUFDGRLQWHUQRGHHVWLUrQLFRVFRPH[SHFWDWLYDGHGXSOLFDomRGDSURGXomRGD,QQRYD e de sinergias com unidades semelhantes, previstas para o Comperj.

23URJUDPDGH)OH[LELOL]DomRGR5HÂżQR 3UR)OH[ FRQWULEXLXSDUDDUHGXomRGHLPSRUWDomRGHPLOK}HVGH barris de derivados mĂŠdios.

3URMHWRV

A produção de gasolina atingiu recordes de modo a atender o expressivo crescimento da demanda nacional e aumentou 12% em relação a 2010.

Os investimentos no setor petroquĂ­mico previstos no Plano de NegĂłcios 2011-2015 somam US$ 3,8 bilhĂľes, equivalentes a cerca de 2% do total a ser realizado pela Petrobras. AlĂŠm do Comperj, destacam-se:

$SURGXomRDQXDOGH4$9 TXHURVHQHGHDYLDomR DWLQJLXPLOPñRTXHUHSUHVHQWDXPDXPHQWRGH em relação a 2010.

Â&#x2021;

A produção de diesel atingiu 43.249 mil m³, representando um aumento de 1,1% em relação a 2010.

&RPSDQKLD 3HWURTXtPLFD GH 3HUQDPEXFR 3HWURTXtPLFD6XDSH H &RPSDQKLD ,QWHJUDGD 7r[WLO GH 3HUQDPEXFR &LWHSH ± Responsáveis pela implementação do Complexo PetroquímicaSuape, produzirão PLOWDQRGHiFLGRWHUHIWiOLFRSXUL¿FDGR 37$ PLOWDQRGHUHVLQD3(7 SROLHWLOHQRWHUHIWDODWR HPLO WDQRGHSROtPHURVWr[WHLVH¿ODPHQWRVGHSROLpVWHU

(QWUDUDPHPRSHUDomRQRYDVXQLGDGHVSUHYLVWDVQRVSURMHWRVGHPRGHUQL]DomRGRSDUTXHGHUHÂżQRXPD GHKLGURWUDWDPHQWRGH'LHVHO 5HFDS GXDVGHKLGURWUDWDPHQWRGHQDIWDGHFRTXH 53%&H5HJDS WUrVGH KLGURGHVVXOIXUL]DomR GH QDIWD FUDTXHDGD 5HJDS 53%& H 5HGXF  XPD GH UHIRUPD FDWDOtWLFD QD 5HÂżQDULD +HQULTXH /DJH 5HYDS  VHLV DX[LOLDUHV FLQFR GH GLHWDQRODPLQD Âą 5HGXF 53%& 5HJDS H 5HSDU Âą H XPD JHUDGRUDGHKLGURJrQLRÂą5HFDS HXPDFRJHUDGRUDQD5HÂżQDULD&DSXDYD 5HFDS 7RGDVYLVDPjSURGXomRGH FRPEXVWtYHLVFRPEDL[RWHRUGHHQ[RIUHHHPFRQIRUPLGDGHFRPDVHVSHFLÂżFDo}HVUHVWULWLYDVTXHHQWUDUmRHP vigor nos prĂłximos anos.

$R¿QDOGHDXQLGDGHGH37$MiHVWDYDTXDVHFRQFOXtGDHFRPFRQWUDWRVGHVXSULPHQWRGHPDWpULDVSULPDV e insumos assinados. A Citepe jå iniciou a comercialização de produto texturizado próprio, atingindo mais de uma centena de clientes.

1RYRVHPSUHHQGLPHQWRV

7UDQVSRUWH

5HÂżQDULD$EUHXH/LPD

7UDQVSRUWHHDUPD]HQDPHQWR

$UHÂżQDULDWHUiFDSDFLGDGHSDUDSURFHVVDUPLOESGGHyOHRSHVDGRHSURGX]LUDWpPLOESGGHGLHVHOFRP EDL[RWHRUGHHQ[RIUH SSP HPFRQIRUPLGDGHFRPDVHVSHFLÂżFDo}HVLQWHUQDFLRQDLV3URGX]LUiWDPEpP*/3 nafta petroquĂ­mica, Ăłleo combustĂ­vel para navios e coque de petrĂłleo. O inĂ­cio das atividades operacionais estĂĄ previsto para junho de 2013.

$3HWUREUDV7UDQVSRUWH6$ 7UDQVSHWUR VXEVLGLiULDGD3HWUREUDVSDUDRVHJPHQWRGHWUDQVSRUWHHDUPD]HQDmento de petrĂłleo, derivados, biocombustĂ­vel e gĂĄs natural, opera 7.179 km de oleodutos, 7.327 km de gasodutos, 48 terminais â&#x20AC;&#x201C; 20 terrestres e 28 aquaviĂĄrios â&#x20AC;&#x201C; e 56 navios.

5H¿QDULDV3UHPLXP $3HWUREUDVFRQVWUXLUiGXDVUH¿QDULDVSDUDSURGX]LUGHULYDGRVpremium (de elevada qualidade e baixo teor de HQ[RIUH RWLPL]DQGRRXVRGRSHWUyOHRQDFLRQDO(VVDVUH¿QDULDVSURGX]LUmREDVLFDPHQWHGHVWLODGRVPpGLRV como diesel e querosene de aviação, e coque, que serå, em parte, consumido nas próprias unidades, para geração de vapor e energia. A Premium I serå construída em Bacabeira-MA, a cerca 60 km da capital, e terå capacidade para processar atÊ 600 mil bpd de petróleo. Seu objetivo Ê viabilizar o processamento de petróleo nacional para a produção de diesel S10 SSPWLSR(XUR9 GHHOHYDGDTXDOLGDGHHEDL[tVVLPRWHRUGHHQ[RIUH FRPHVSHFL¿FDo}HVLQWHUQDFLRQDLV$FRQVWUXomR serå feita em duas etapas de 300 mil bpd cada, com início das operaçþes em 2016 e 2019. O empreendimento contarå tambÊm com um terminal portuårio para receber, armazenar e expedir granÊis líquidos e sólidos. A Premium II, com início de operação previsto para 2017, serå construída em Caucaia-CE e terå capacidade para SURFHVVDUPLOESGGHyOHR$UH¿QDULDVHUiLQWHUOLJDGDDXPWHUPLQDOSRUWXiULRHP3HFpPSRUXPDIDL[DGH dutos de 11 km de extensão.

&RPSOH[R3HWURTXtPLFRGR5LRGH-DQHLUR &RPSHUM

$UHÂżQDULDGR&RPSHUMHVWiVHQGRFRQVWUXtGDHP,WDERUDt5-HHVWiSURJUDPDGDSDUDRSHUDUHPGXDVIDVHVD primeira, prevista para 2014, com capacidade de processamento de 165 mil bpd de Ăłleo, e a segunda, em 2018, elevando a capacidade para 330 mil bpd de Ăłleo. (VVDUHÂżQDULDSURGX]LUiGLHVHO*/34$9QDIWDyOHRFRPEXVWtYHOFRTXHHHQ[RIUHDÂżPGHVXSULURPHUFDGR nacional de derivados combustĂ­veis e fornecer matĂŠria-prima Ă s unidades petroquĂ­micas.

2&RPSOH[RVHUiRPDLRUSRORLQWHJUDGRGHSROLpVWHUGDV$PpULFDVUHWRPDQGRDSURGXomRQDFLRQDOGH37$ HGXSOLFDQGRDRIHUWDGH3(7QR%UDVLODOpPGHUHSUHVHQWDUDUHYLWDOL]DomRGRVHJPHQWRWr[WLOGHYLGRjRIHUWD LQWHUQDGHÂżRVFRPERDTXDOLGDGHHSUHoRFRPSHWLWLYR

Em 2011, 44,2 milhões de t de petróleo e derivados foram transportados por navio, volume 9,5% inferior ao de $7UDQVSHWURPRYLPHQWRXHPVHXVROHRGXWRVHWHUPLQDLVPLOK}HVGHPñGHOtTXLGRVPDLVGRTXH o ano anterior, além da média de 51,3 milhões de m³/dia de gás natural, volume 10% inferior ao do ano anterior. O pico de movimentação de gás natural foi de 63 milhões de m³/dia.

1RYRVQDYLRV 23URJUDPDGH0RGHUQL]DomRH([SDQVmRGD)URWD 3URPHI SUHYrDFRQVWUXomRGHQDYLRVTXHDFUHVFHQWDUmRPLOK}HVGHWRQHODGDVGHSRUWHEUXWR WSE jFDSDFLGDGHDWXDO7DPEpPSHUPLWLUiDLQFRUSRUDomRGHQRYDV WHFQRORJLDVjVHPEDUFDo}HVHIRLGHVHQYROYLGRFRPEDVHHPWUrVSUHPLVVDVFRQVWUXLURVQDYLRVQR%UDVLO DOFDQoDURQtYHOPtQLPRGHQDFLRQDOL]DomRGH QDSULPHLUDIDVH H QDVHJXQGD HWRUQDURVHVWDOHLURV competitivos internacionalmente. Em 2011, foram concluĂ­dos os processos de licitação dos oito navios do tipo Produtos (para transporte de GHULYDGRVGHSHWUyOHRPLOWSE TXHLQWHJUDPDVHJXQGDIDVHGRSURJUDPD O primeiro navio entregue pelo Promef â&#x20AC;&#x201C; Celso Furtado, destinado ao transporte de produtos derivados de SHWUyOHRGHPLOWSEÂąMiLQWHJUDDIURWDGRWUDQVSRUWHPDUtWLPR7DPEpPIRUDPDGLFLRQDGRVjIURWDWUrVQDYLRV FRQWUDWDGRVFRPFDSDFLGDGHWRWDOGHPLOWSEGRWLSR'3 SRVLFLRQDPHQWRGLQkPLFR  Foram convertidos para casco duplo quatro navios para abastecer os barcos de apoio da Petrobras nas bacias de Campos e de Santos. Somados aos convertidos em 2010, totalizam sete embarcaçþes para equacionar necessidades logĂ­sticas da produção de petrĂłleo. 3DUDHVWmRSUHYLVWRVDLQFRUSRUDomRGHVHLVHPEDUFDo}HV'HYHUmRVHUHQWUHJXHVWUrVGRVFRPERLRV Ă&#x20AC;XYLDLVFRQWUDWDGRVSHOD7UDQVSHWURSDUDDWHQGHUjGHPDQGDGHWUDQVSRUWHGHHWDQROSHODEDFLDKLGURJUiÂżFDGR 7LHWr3DUDQi


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

E-6

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA

7HUPLQDLVH2OHRGXWRV 9iULDVDo}HVIRUDPDGRWDGDVHPSDUDDPSOLDUDFDSDFLGDGHGD7UDQVSHWUR Â&#x2021;

Â&#x2021;

Â&#x2021;

Â&#x2021;

$XPHQWRGDPRYLPHQWDomRGHSHWUyOHRQR2OHRGXWR6mR6HEDVWLmR*XDUDUHPD 2VYDW Âą5HVSRQViYHOSHOR abastecimento da Revap e da Replan, aumentarĂĄ a vazĂŁo dos atuais 4.500 mÂł/h para a mĂŠdia de 5.100 mÂł/h, com mais duas estaçþes intermediĂĄrias no primeiro semestre de 2012; $XPHQWRGDPRYLPHQWDomRGHGHULYDGRVÂą22OHRGXWR6mR3DXOR%UDVtOLD 2VEUD PRYLPHQWRXHPPDUoR PĂąGHJDVROLQDDPDLVTXHVHX~OWLPRUHFRUGH1RPHVPRPrVR7HUPLQDOGH*XDUXOKRVWHYH aumento na entrega da gasolina, com a marca de 102.437 mÂł, superando em 15% o recorde anterior; Operaçþes ship to shipGHSHWUyOHRQR7HUPLQDO0DUtWLPRGD%DtDGH,OKD*UDQGH 7HELJ Âą)RLGHVHQYROYLGDXPD DOWHUQDWLYDGHWUDQVIHUrQFLDGLUHWDGHFDUJDHQWUHQDYLRV ship to ship TXHUHDOL]DRWUDQVERUGRVHPDRFXSDomR das instalaçþes dos terminais, aumentando a agilidade e reduzindo custos; $SRLRQDVEDVHVGHORJtVWLFDVSRUWXiULDVÂą(PVHXVWHUPLQDLVDTXDYLiULRVD7UDQVSHWURSDVVRXDRSHUDUEDVHV logĂ­sticas portuĂĄrias para apoio Ă ĂĄrea de E&P da Petrobras. Essas bases fazem gestĂŁo portuĂĄria e contratual, DUPD]HQDJHPXQLWL]DomRHPRYLPHQWDomRGHFDUJDVIRUQHFLPHQWRGHiJXDĂ&#x20AC;XLGRVHJUDQpLVVyOLGRVSDUD operação com poços e destinação de resĂ­duos.

2SHUDo}HVFRP*iV1DWXUDO &RQFOXtGRRFLFORGHLQYHVWLPHQWRVQDDPSOLDomRGRVJDVRGXWRVDPDOKDRSHUDGDHPDQWLGDSHOD7UDQVSHWUR alcançou 7.327 km. O aumento da capacidade de movimentação é obtido por meio de novas estações de compressão. Entraram em operação: gasodutos Gaspal II, Gasan II e trecho Caraguatatuba-SDV03 do Gastau e ramais de /DJRD3DUGDH&DWXHVWDo}HVGHFRPSUHVVmRGH&DPSRV(OtVHRV&DWX7DXEDWp&RDUL-XUXDQD3UDGR9DOH do Paraíba, Guararema, Aracruz e Piúma; e pontos de entrega Japeri II, Catu, Candeias-Residual e Veracel. $7UDQVSHWURRSHUDVHWHSODQWDVGHSURFHVVDPHQWRQR7HUPLQDOGH&DEL~QDV 7HFDE FRPFDSDFLGDGHGH milhões de m³/dia de gás natural e 4,5 mil m³/dia de condensado de gás natural, provenientes da Bacia de Campos. Em 2011, o volume médio processado foi de 11,6 milhões de m³/dia e 1,26 mil m³/dia, respectivamente.

'LVWULEXLomR $3HWUREUDV'LVWULEXLGRUDTXHFRPSOHWRXDQRVGHH[LVWrQFLDHPpDPDLRUGLVWULEXLGRUDGHFRPEXVWtYHLV GR%UDVLOHFKHJRXDR¿PGRDQRFRPDPDUFDGHPLOPñFRPHUFLDOL]DGRVYROXPHPDLRUTXHRUHJLVtrado no mesmo período do ano anterior. Com vendas médias acima de 4 milhões de m3, estabeleceu o recorde de vendas de 4.392 mil m3PrVHPDQWHYHDOLGHUDQoDQRPHUFDGRGRPpVWLFRGHFRPEXVWtYHLVFRPmarket share anual de 39,2%, equivalente a um crescimento de 0,4 p.p.. Com uma rede de 7.485 postos de serviços e 12 mil consumidores diretos, a empresa obteve uma receita operacional líquida de R$ 74 bilhões e lucro líquido de R$ 1,27 bilhão. Em linha com a estratégia de manter a liderança no mercado brasileiro de distribuição de derivados de petróleo e biocombustíveis, foram realizados investimentos diretos de R$ 1,157 bilhão no ano de 2011. 'HVVH WRWDO  5  PLOK}HV  GHVWLQDUDPVH j PDQXWHQomR H j DPSOLDomR GD LQIUDHVWUXWXUD ORJtVWLFD  5  PLOK}HV  DR GHVHQYROYLPHQWR H j PRGHUQL]DomR GD UHGH GH SRVWRV GH VHUYLoRV  5PLOK}HV jGLVWULEXLomRGHJiVHjFRPHUFLDOL]DomRGHHQHUJLD 5PLOK}HV DRVHJPHQWR GH DYLDomR H  5  PLOK}HV  DR PHUFDGR FRQVXPLGRU 3DUD D /LTXLJiV ± VXEVLGLiULD SDUD GLVWULEXLomR GH JiV OLTXHIHLWR GH SHWUyOHR ± IRUDP GHVWLQDGRV  5  PLOK}HV  SDUD PDQXWHQomR GD LQIUDHVWUXWXUDGHGLVWULEXLomRGH*/37DPEpPIRUDPLQYHVWLGRV5PLOK}HVHPWHFQRORJLDGDLQIRUPDomR R$ 17,5 milhões no segmento de produtos químicos e R$ 8,1 milhões no de produtos asfálticos. Dos investimentos realizados na Petrobras Distribuidora, destacam-se as obras de modernização e ampliação GDIiEULFDGHOXEUL¿FDQWHV 'XTXHGH&D[LDV5- HGHWHUPLQDLVHVWDEHOHFLPHQWRVHPpool e 28 bases de GLVWULEXLomRRLQtFLRGDFRQVWUXomRGHGXDVEDVHV &UX]HLURGR6XO$&H3RUWR1DFLRQDO72 HPHOKRULDVHPWRGRR %UDVLOQDLQIUDHVWUXWXUDRSHUDFLRQDOSDUDDPRYLPHQWDomRGRGLHVHO6 FRPEDL[RWHRUGHHQ[RIUH FRPHUFLDOL]DGR a partir de janeiro de 2012, e para o envase e distribuição do produto ARLA 32 (uma solução redutora de óxidos de QLWURJrQLRTXHGHYHVHUXWLOL]DGDHPDVVRFLDomRFRPRGLHVHO6 7DPEpPIRUDPLPSOHPHQWDGDVDGHTXDo}HVHP mais de 800 postos da rede para viabilizar a comercialização dos novos produtos. Foram adquiridos equipamentos para aeroportos e pools, viabilizando projetos importantes para o aumento de sua capacidade operacional. Na rede de postos de serviços, houve investimento de R$ 131 milhões em obras, HTXLSDPHQWRVHDGHTXDomRGHHOHPHQWRVGHLPDJHPDOpPGDLQVWDODomRGR&HQWUR7HFQROyJLFRGH/XEUL¿FDomR Automotiva Lubrax +. Outro destaque foi a expansão da rede de gás canalizado no Espírito Santo, com entrada em Linhares e aumento GDFDSDFLGDGHGHFRPHUFLDOL]DomRHP9LWyULD9LOD9HOKDH6HUUD,QYHVWLXVHDLQGDHPWUrVSURMHWRVGHH¿FLrQFLD HQHUJpWLFD FOLPDWL]DomR HHPFHQWUDLVGHJHUDomRQDSRQWD LPSODQWDomRGHXQLGDGHJHUDGRUDGHHQHUJLD DELRGLHVHORXDJiVQDWXUDOSDUDXWLOL]DomRQRKRUiULRGHSRQWDHRXHPHUJrQFLDYLVDQGRUHGX]LUFXVWRV FRP incremento na carteira de clientes. Para garantir a liderança no mercado cada vez mais competitivo de distribuição, foi revitalizada a marca Lubrax e PDQWLGRR3ODQR,QWHJUDGRGH0DUNHWLQJ 3,0 FRPIRFRQD¿GHOL]DomRGRVFRQVXPLGRUHV¿QDLVHFRQVHTXHQWH aumento das vendas.

*iV1DWXUDO Com a conclusĂŁo de importantes projetos voltados Ă infraestrutura de produção e escoamento, a oferta de gĂĄs natural, em 2011, superou a de 2010, atingindo 62,0 milhĂľes de m3/dia. A oferta domĂŠstica foi de 33,5 milhĂľes de m3/dia, descontados o gĂĄs liquefeito, o gĂĄs usado no processo produtivo, a injeção nos poços e as perdas. Da oferta total de gĂĄs natural ao mercado brasileiro, 26,8 milhĂľes de m3/dia foram disponibilizados atravĂŠs do JDVRGXWR%ROtYLD%UDVLO2YROXPHLPSRUWDGRGH*1/UHJDVHLÂżFDGRIRLGHPLOKmRGHP3/dia. O aumento do consumo em relação ao ano anterior decorreu principalmente do reaquecimento da economia, UHĂ&#x20AC;HWLGRQDPDLRUGHPDQGDLQGXVWULDO

7UDQVSRUWHGH*iV1DWXUDO A malha de gasodutos de transporte do Sistema Petrobras atingiu 9.251 km. Entraram em operação os seguintes dutos: Â&#x2021;

*DVWDXÂąCom 96 km de extensĂŁo e capacidade nominal de 20 milhĂľes de mÂł/dia, transporta o gĂĄs processado QD8QLGDGHGH7UDWDPHQWRGH*iVGH&DUDJXDWDWXEDRULXQGRGRVFDPSRVGH0H[LOKmRH8UXJXi7DPED~H do piloto de Lula no Polo PrĂŠ-Sal da Bacia de Santos, ampliando a oferta na RegiĂŁo Sudeste;

Â&#x2021;

*DVSDO,,Âą Com 54,5 km de extensĂŁo, ampliou, em conjunto com o Gasan II e a Estação de CompressĂŁo de Guararema, a capacidade de transporte do Sistema Guararema-RPBC â&#x20AC;&#x201C; de 12 milhĂľes de mÂł/dia para 17 milhĂľes de mÂł/dia â&#x20AC;&#x201C;, aumentando a oferta para a regiĂŁo metropolitana de SĂŁo Paulo;

Â&#x2021;

*DVDQ,,ÂąCom 39 km de extensĂŁo, integra o conjunto de projetos que ampliou a capacidade de transporte do Sistema Guararema-RPBC de 12 milhĂľes de mÂł/dia para 17 milhĂľes de mÂł/dia e permitiu desativar o trecho de 23 km do gasoduto Gasan I;

Â&#x2021;

9DULDQWHGR1RUGHVWmR Âą Com 31,7 km de extensĂŁo, interligou os quilĂ´metros 383,5 e 404 do gasoduto NordestĂŁo e permitiu elevar a pressĂŁo mĂĄxima operacional admissĂ­vel do NordestĂŁo, garantindo mais Ă&#x20AC;H[LELOLGDGHHFRQÂżDELOLGDGHDRVXSULPHQWRGH3HUQDPEXFR3DUDtEDH5LR*UDQGHGR1RUWH

*iV1DWXUDO/LTXHIHLWR (PD3HWUREUDVFRQWLQXRXDWXDQGRQRPHUFDGRGHJiVQDWXUDOOLTXHIHLWR *1/ &RPFRQVWDQWHGLYHUVLÂżFDomRGRSRUWIyOLRDWLQJLXDPDUFDGHFRQWUDWRVGRWLSRMaster Sales Agreement (MSA HHP realizou 14 operaçþes de compra de cargas â&#x20AC;&#x201C; 12 destinadas ao Brasil e duas revendidas no mercado externo. AlĂŠm disso, efetuou as primeiras operaçþes de reexportação de cargas, tendo exportado duas cargas. $3HWUREUDVLQLFLRXDLPSOHPHQWDomRGR7HUPLQDOGH5HJDVHLÂżFDomRGH*1/GD%DKLD 75%$ TXHVHUiFRQVWUXtGRQD%DtDGH7RGRVRV6DQWRVHWHUiFDSDFLGDGHSDUDUHJDVHLÂżFDUDWpPLOK}HVGHPĂąGLDGHJiVQDWXUDO 275%$WHUFHLURWHUPLQDOLQVWDODGRQR3DtVHQWUDUiHPDWLYLGDGHHP2QDYLRUHJDVHLÂżFDGRUGolar Winter

VHUiGHVORFDGRGR7HUPLQDOGH5HJDVHLÂżFDomRGD%DtDGH*XDQDEDUD 75%*8$ SDUDRSHUDUQR75%$3DUD VXEVWLWXtORIRLDVVLQDGRFRQWUDWRGHDIUHWDPHQWRGHXPQDYLRUHJDVHLÂżFDGRUTXHHVWiHPFRQVWUXomRQD&RUHLD GR6XOHSHUPLWLUiXWLOL]DUDFDSDFLGDGHSOHQDGR75%*8$GHPLOK}HVGHPĂąGLD

&RPHUFLDOL]DomRGH*iV1DWXUDO A Petrobras realizou novas rodadas de leilþes eletrônicos para venda de gås natural de curto prazo, com regras aperfeiçoadas em relação às estabelecidas em 2010, conforme editais publicados. 1HVVHVOHLO}HVDVGLVWULEXLGRUDVGHJiVFHOHEUDUDPFRQWUDWRVGHFXUWRSUD]R TXDWURPHVHV SDUDYROXPHVGH JiVQDWXUDOHPWUrVFHUWDPHVRSULPHLURHPPDUoRRVHJXQGRHPMXOKRHRWHUFHLURHPQRYHPEUR2YROXPH total comercializado foi de 8 milhþes de m³/dia, 8,1 milhþes de m³/dia e 8,8 milhþes de m³/dia, respectivamente. Com o objetivo de realocar volumes não consumidos pelo mercado termelÊtrico, a Petrobras iniciou, em abril, um novo tipo de venda de gås natural: o Mercado Secundårio. Esta modalidade de venda, em função da hidrologia favoråvel e do custo de oportunidade do gås natural, Ê ofertada a clientes do segmento industrial que não usam RJiVQDWXUDOFRPRSULQFLSDOFRPEXVWtYHO$R¿QDOGHH[LVWLDPQRYHFRQWUDWRVGHIRUQHFLPHQWRWRWDOL]DQGR 1,5 milhão de m3/dia, com as companhias CEG, BR-ES, Gasmig e Bahiagås.

'LVWULEXLomRGH*iV1DWXUDO 2YROXPHPpGLRGHJiVQDWXUDOFRPHUFLDOL]DGRSHODVGLVWULEXLGRUDVHPWRGRR%UDVLOHP¿FRXHP milhões de m3/dia, com redução de 3% em relação a 2010. A companhia passou a ter participação em 21 das 27 distribuidoras estaduais de todo o Brasil, com a conclusão da aquisição em julho da concessionária de distribuição de gás natural do noroeste paulista, Gas Brasiliano 'LVWULEXLGRUD *%' (PUHODomRDRSHU¿OGHSDUWLFLSDomRDFLRQiULDD3HWUREUDVPDQWHYHRSDGUmRGHFRP percentuais que variam de 24% a 100%. O consumo não térmico das distribuidoras em que a companhia tem participação aumentou 17% (de 17,3 milhões GHPñGLDSDUDPLOK}HVGHPñGLD HRFRQVXPRWpUPLFRGLPLQXLX GHPLOK}HVGHPñGLDSDUD PLOK}HVGHPñGLD WRWDOL]DQGRXPDUHGXomRGH GHPLOK}HVGHPñGLDSDUDPLOK}HVGHPñGLD 

(QHUJLD(OpWULFD A Petrobras gerou 653 0:PpGLRVSDUDR6LVWHPD,QWHUOLJDGR1DFLRQDO 6,1 SRUPHLRGDV87(VSUySULDVH alugadas que compĂľem seu parque gerador termelĂŠtrico, com capacidade instalada de 5.806 MW. A menor geração em relação ao ano anterior ĂŠ resultado das condiçþes hidrolĂłgicas extremamente favorĂĄveis no Brasil em 2011, quando os nĂ­veis dos reservatĂłrios das hidrelĂŠtricas se mantiveram elevados. As usinas da FRPSDQKLDRSHUDUDPDSHQDVSDUDDWHQGHUDFRPSURPLVVRVGHLQĂ&#x20AC;H[LELOLGDGHGDYHQGDGHHQHUJLDHPOHLOmR fornecimento de vapor aos clientes, despachos por razĂŁo elĂŠtrica para o SIN e exportação de energia para a Argentina e o Uruguai.

3URMHWRVHP(QHUJLD Com a entrada em operação de novas usinas, incluindo os empreendimentos nos quais a Petrobras tem participação, a capacidade instalada do parque gerador da companhia atingiu 6.533 MW. Projeto prĂłprio concluĂ­do em 2011: &RQYHUVmRGD87(-XL]GH)RUDSDUD%LFRPEXVWtYHO 0* â&#x20AC;&#x201C; ConversĂŁo para gĂĄs natural e etanol da segunda turbina, de 47 MW. Projetos com participação da Petrobras concluĂ­dos em 2011: 8((0DQJXH6HFR&DEXJL3RWLJXDUH-XULWL *XDPDUp51 â&#x20AC;&#x201C; Construção de quatro usinas eĂłlicas, com capacidade instalada de 26 MW cada.

(QHUJLD(yOLFD (PDFRPSDQKLD¿QDOL]RXDLPSOHPHQWDomRGHTXDWURXVLQDVHyOLFDVHP*XDPDUp510DQJXH6HFR Cabugi, Potiguar e Juriti. Esses projetos correspondem a 104 MW de capacidade instalada e 49 MW mÊdios vendidos. Os contratos de venda de energia oriunda das usinas foram ofertados no primeiro leilão de reserva de energia eólica, em dezembro de 2009, e são vålidos por 20 anos. O certame previa que a energia gerada pelas usinas seria disponibilizada para o Sistema Interligado Nacional em 1º de julho de 2012, mas a Petrobras antecipou o cronograma, e todo o parque eólico estå em operação comercial desde 1º de novembro de 2011.

&RPHUFLDOL]DomRGH(QHUJLD Em 2011, a Petrobras comercializou 2.385 MW mÊdios de energia elÊtrica no ambiente de comercialização livre $&/ REWHQGRXPDUHFHLWDEUXWDGH5ELOK}HVGHGX]LGRVLPSRVWRVHFXVWRGHOLTXLGDomRQRPHUFDGRGH curto prazo, gerando um resultado após impostos de R$ 1,4 bilhão.

)HUWLOL]DQWHV O parque produtor de fertilizantes da Petrobras Ê formado por duas fåbricas, na Bahia e em Sergipe. Os produtos comercializados são ureia, amônia, åcido nítrico, gås carbônico e ARLA 32, cuja primeira venda foi realizada em 2011. A årea teve faturamento recorde de R$ 1 bilhão no ano, 37% acima do resultado de 2010. Foram vendidas 831 mil t de ureia e 241 mil t de amônia. Devido à melhor performance operacional das fåbricas, foi alcançado o recorde histórico de produção de amônia, com 733 mil t, alÊm da produção de 836 mil t de ureia, a maior dos últimos 12 anos.

1RYRV3URMHWRV $3HWUREUDVHVWiFRQGX]LQGRDLQVWDODomRGHWUrVQRYDVXQLGDGHVGHIHUWLOL]DQWHVHGRLVSURMHWRVGHH[SDQVmRGDV fåbricas existentes. A estimativa de investimentos nesse segmento, no período 2011-2015, Ê de aproximadamente R$ 9,41 bilhþes. Destacaram-se em 2011: 8QLGDGHGH)HUWLOL]DQWHV1LWURJHQDGRV,,, 7UrV/DJRDV06 ¹ Em fase de execução, disponibilizarå 1.223 mil t/ano de ureia e 70 mil t/ano de amônia a partir de 2014; ([SDQVmRGD)DIHQ6( ¹ Uma planta de sulfato de amônio estå em fase de execução para ofertar ao mercado PLOWDQRGHDP{QLDDSDUWLUGRiFLGRVXOI~ULFRH[FHGHQWHSURGX]LGRSHOD5H¿QDULD$EUHXH/LPD 51(67 2 início da operação serå em 2013; $5/$QD)DIHQ%$¹7HUPLQRXHPRXWXEURDSULPHLUDHWDSDGHFRQVWUXomRGRSURMHWR$5/$FRPSURGXomR GHPLOPùDQR7UDWDVHGHXPDVROXomRGHXUHLDGLOXtGDHPiJXDGHVPLQHUDOL]DGDQDFRQFHQWUDomRGH que serå utilizada em veículos pesados a diesel, reduzindo a emissão de poluentes. A segunda fase serå concluída em outubro de 2012, ampliando a capacidade para 200 mil m³/ano.

%,2&20%867Ă&#x2039;9(,6 %LRGLHVHO A 3HWUREUDV%LRFRPEXVWtYHORSHUDWUrVXVLQDVGHELRGLHVHOHP&DQGHLDV%$4XL[DGi&(H0RQWHV&ODURV0* 'HVGHFRPDGXSOLFDomRGD8VLQDGH&DQGHLDVSDUDPLOPĂąDQRDFDSDFLGDGHWRWDOGHSURGXomRGDVWUrV unidades soma 434 mil mÂł/ano. Em julho de 2011, a companhia ingressou no capital social da empresa BSBIOS IndĂşstria e ComĂŠrcio de Biodiesel Sul Brasil, em Passo Fundo-RS, com aporte de R$ 75,6 milhĂľes, passando a deter 50% de suas açþes. A indĂşstria opera uma planta de biodiesel, com capacidade de produção de 160 mil mÂł/ ano e unidade de extração de Ăłleos vegetais. As duas empresas jĂĄ operavam, em parceria, a usina de MarialvaPR. Com a nova sociedade, passam a compartilhar a operação de um complexo industrial com capacidade produtiva total de 287 mil mÂł/ano de biodiesel. No ParĂĄ, estĂĄ em construção uma nova usina, com previsĂŁo de inĂ­cio de operação para 2013 e aumento da capacidade instalada de produção de biodiesel em 120 mil mÂł/ano. Como parte do Projeto BelĂŠm, foi constituĂ­da a BelĂŠm Bioenergia Brasil S.A., responsĂĄvel pelas atividades DJURLQGXVWULDLVQR3DtVHHPSHORSODQWLRGHKDGHSDOPDQRVPXQLFtSLRVGH7DLOkQGLDH7RPp$oX2


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

E-7

Minas e Energia

Petróleo Brasileiro S.A. CNPJ Nº 33.000.167/0001-01 - COMPANHIA ABERTA projeto possibilita a participação no mercado europeu de biocombustíveis, com a produção, em Portugal, de 250 mil t/ano de green diesel ELRGLHVHOGHVHJXQGDJHUDomR WHQGRFRPRPDWpULDSULPDRyOHRGHSDOPDSURGX]LGRQR3DUi

.LQWHURQL HDH[SORUDomRQRORWHTXHUHSUHVHQWDPXPDSRVVLELOLGDGHGHDXPHQWRGDSURGXomRLQWHUQDFLRQDO de gĂĄs da companhia.

Com esses empreendimentos, a capacidade total de produção de biodiesel da Petrobras Biocombustível deverå atingir 855 mil m³/ano em 2013.

Nos EUA, a Petrobras anunciou descobertas recentes nos projetos de Hadrian e Logan, no Golfo do MÊxico, HFRQWLQXDGHVHQYROYHQGRRVDWLYRVGHSURGXomRHP6W0DOR7LEHU6WRQHVH&DVFDGH &KLQRRNHSURMHWRV de exploração. A moratória das operaçþes de prospecção de petróleo no Golfo e a revisão das medidas de segurança, motivadas pelo acidente com derramamento de óleo, em 2010, em plataforma de outra companhia, postergaram o cronograma de alguns projetos da Petrobras, entre eles o início da produção de Cascade &

6XSULPHQWRDJUtFROD $V XVLQDV GD 3HWUREUDV %LRFRPEXVWtYHO WrP R 6HOR &RPEXVWtYHO 6RFLDO HP FRQIRUPLGDGH FRP DV GLUHWUL]HV GR 3URJUDPD1DFLRQDOGH3URGXomRH8VRGR%LRGLHVHO 313% $HPSUHVDWDPEpPPDQWpPFRQWUDWRVGHFRPSUDGH grĂŁos com 64.812 agricultores familiares, em 133.762 ha de ĂĄrea cultivada, dos quais 105.348 ha com mamona, 5.150 ha com girassol e 23.264 ha com soja. Para a safra 2010/2011, disponibilizou 449 t de sementes, sendo 413 t de mamona e 36 t de girassol, e adquiriu da agricultura familiar 58,9 mil t de grĂŁos, ao custo de R$ 49,9 milhĂľes.

([WUDomRGHyOHRYHJHWDO A Petrobras BiocombustĂ­vel detĂŠm 50% do capital social da BioĂłleo Industrial e Comercial S.A., em Feira de Santana-BA. A empresa tem capacidade para processar atĂŠ 65 mil t/ano de oleaginosas e armazenar 30 mil t de grĂŁos, alĂŠm de tancagem para 10 milhĂľes de litros de Ăłleo. EstĂŁo previstas melhorias operacionais que aumentarĂŁo a capacidade dHSURFHVVDPHQWRGHROHDJLQRVDVSDUDPLOWDQRFRPVHPLUUHÂżQRGHPLOWDQRGHyOHRV

(WDQRO Em conjunto, as coligadas da Petrobras Biocombustível encerrarão a safra 2011/2012 com uma moagem de 20,1 milhþes de t de cana-de-açúcar, produção de 769 mil m3 de etanol e 1,4 milhão de t de açúcar, com exportação de 490 GWh de energia elÊtrica excedente.

7RWDO$JURLQG~VWULD EmIRLIHLWRRDSRUWH¿QDOGH5PLOK}HV¹WRWDOL]DQGRRV5PLOK}HVSUHYLVWRV¹QRFDSLWDOVRFLDOGD7RWDO Agroindústria Canavieira S.A., usina de etanol em Bambuí-MG. Com isso, a companhia detÊm 43,58% na usina. 1RDQRD7RWDOLQYHVWLXPDLVGH5PLOK}HVQDH[SDQVmRGHFDQDYLDLVH5PLOK}HVQDFRPSUDGH equipamentos. Foram ainda iniciados investimentos de R$ 122 milhþes, referentes ao período 20112013, para a construção da segunda fase da usina, que dobrarå a capacidade de moagem de cana para 2,4 milhþes de t em 2013. Consequentemente, a capacidade de produção de etanol poderå atingir 200 mil m3, permitindo ampliar a exportação de energia dos atuais 30 para 86 GWh/ano.

*XDUDQL Em março de 2011, a Petrobras Biocombustível fez aporte de R$ 195,4 milhþes na Guarani S.A., passando a deter GDVDo}HVGDHPSUHVD$RSHUDomRGHFRUUHXGHDFRUGR¿UPDGRFRPD7HUHRV,QWHUQDFLRQDO6$SDUDD aquisição de 45,7% da Guarani, por meio de aportes de atÊ R$ 1,6 bilhão ao longo de cinco anos. Atualmente, a Guarani Ê proprietåria de sete unidades em São Paulo e uma em continente africano, em Moçambique. Na unidade de Moçambique, estuda-se a possibilidade de produzir etanol para abastecer o mercado local, estimado em 20 mil m3DQR2JRYHUQRPRoDPELFDQRDSURYRXDPLVWXUDGHGHHWDQROQDJDVROLQD (  a partir de 2012. Planeja-se que a destilaria da Guarani esteja pronta para atender à nova demanda quando a medida entrar em vigor. Estão sendo feitos investimentos de R$ 767 milhþes, aprovados em 2010 e 2011, para expandir a capacidade de processamento de cana-de-açúcar, produção de etanol e açúcar e cogeração de energia. Com eles, a Guarani elevarå sua capacidade de moagem de 21,3 milhþes de t/ano para 24,6 milhþes de t/ano, ampliando a produção de etanol para 888 mil m3/ano; a produção de açúcar para 1,7 milhão de t; e a exportação de energia para 1.200 GWh/ano. No segundo semestre de 2011, foi inaugurada a destilaria da Usina São JosÊ, ampliando em 110 mil m³ a capacidade de produção de etanol do grupo no Brasil.

Chinook, adiado para 2012.

Ă&#x2C6;IULFD A Costa Oeste da Ă frica ĂŠ uma das ĂĄreas estratĂŠgicas de atuação internacional da Petrobras. A produção na 1LJpULD FDPSRVGH$NSRH$JEDPL HHP$QJROD EORFR VRPDPLOESGGHyOHR$FRQWtQXDUHDYDOLDomRGR portfĂłlio da companhia motivou o reposicionamento em alguns dos ativos em Angola, com a venda de 50% da participação no bloco 26, a saĂ­da do bloco 15, pela venda da participação, e do bloco 34, pela devolução do bloco DRJRYHUQR$FRPSDQKLDDWXDWDPEpPHPH[SORUDomRQD7DQ]kQLDTXHVHHQFRQWUDHPIDVHGHSHUIXUDomRGH poços; na NamĂ­bia, onde detĂŠm o direito de operação do ativo e se prepara para a perfuração do primeiro poço; no Benin, onde realizou sĂ­smicas 3D; e no GabĂŁo, onde serĂĄ iniciada a aquisição de sĂ­smica 3D.

Ă&#x2C6;VLDH2FHDQLD $3HWUREUDVWHPXPDUHÂżQDULDQDLOKDGH2NLQDZDQR-DSmRFRPFDSDFLGDGHGHSURFHVVDPHQWRGHPLOERHG e desenvolve projetos exploratĂłrios na Nova Zelândia, com aquisição de sĂ­smica 2D. Na AustrĂĄlia, optou por nĂŁo prosseguir com o projeto localizado na Bacia de North Carnarvon, apĂłs as perfuraçþes terem indicado poço seco.

(XURSD Em Portugal, a companhia desenvolve projetos de exploração na Bacia do Peniche, com a continuidade de processamento e interpretação de dados, e na Bacia do Alentejo, com aquisiçþes de sísmicas 3D, alÊm de projetos relacionados à produção, ao desenvolvimento de tecnologias e ao comÊrcio de biocombustíveis, em parceria com empresas locais.

3HVTXLVD 'HVHQYROYLPHQWR Em 2011, a Petrobras aplicou R$ 2,4 bilhþes em P&D, um aumento de 41% em relação a 2010. A gestão destes recursos Ê coordenada pelo Centro de Pesquisas e Desenvolvimento Leopoldo AmÊrico Miguez de Mello &HQSHV RPDLRUFRPSOH[RGHSHVTXLVDGR+HPLVIpULR6XOHGHXVRH[FOXVLYRGD3HWUREUDVTXHFRQWDFRP empregados, dos quais 1.342 dedicados exclusivamente à pesquisa e desenvolvimento, e 314, à engenharia EiVLFDGRVSURMHWRVGDVLQVWDODo}HVLQGXVWULDLV(PWHUPRVGHTXDOL¿FDomRGHVHXVSHVTXLVDGRUHVSRVVXHP título de doutorado e 43% de mestrado. Os principais resultados obtidos em 2011 foram:

([SDQVmRGRVQHJyFLRV Â&#x2021;

Desenvolvimento de metodologia que possibilitou caracterizar diferentes tipos de petrĂłleo do PrĂŠ-Sal da Bacia GH6DQWRVRTXHSHUPLWLUiSODQHMDPHQWRPDLVHÂżFLHQWHGDSURGXomR

Â&#x2021;

Perfuração do primeiro poço, no mundo, com a tecnologia Liner Conveyed Gravel Pack, que reduz o tempo de perfuração de poços horizontais em campos maduros;

Â&#x2021;

'HPRQVWUDomRGDWHFQRORJLD*7/ gas to liquids FRPSDFWRSDUDSURGXomRGHyOHRVLQWpWLFRDSDUWLUGHJiV HOLPLQDQGRDTXHLPDGHJiVHP7HVWHVGH/RQJD'XUDomR 7/' 

Â&#x2021;

Instalação da estação protótipo de separação submarina ågua-óleo no campo de Marlim, em åguas profundas. $VLQWHUFRQH[}HVFRPRVLVWHPDGHSURGXomRGH0DUOLPVHUmR¿QDOL]DGDVHP(VWDWHFQRORJLDYLDELOL]D o aumento de produção em campos maduros offshore, com melhor aproveitamento do sistema de produção existente;

Â&#x2021;

3HUIXUDomRGHSRoRFRPÂ&#x17E;GHLQFOLQDomRÂżQDOQRVDO(VWDVROXomRWHFQROyJLFDHPGHVHQYROYLPHQWRSDUD perfuração de poços estendidos e horizontais no PrĂŠ-Sal, aumentarĂĄ a produção e reduzirĂĄ o nĂşmero de poços;

Â&#x2021;

4XDOLÂżFDomRGRVLVWHPDVXEPDULQRGHLQMHomRGHiJXDGRPDUSDUDDXPHQWRGDSURGXomRHPFDPSRVPDGXURV 7UrVGHVWHVVLVWHPDVHVWmRHPIDVHÂżQDOGHLQVWDODomRQRFDPSRGH$OEDFRUD

Â&#x2021;

Comprovação da tecnologia de risers rígidos para as plataformas do PrÊ-Sal, permitindo aumento de competitividade neste mercado e consequente redução de custos.

1RYD)URQWHLUD A Petrobras Biocombustível passou a deter 49% do capital social da Nova Fronteira Bioenergia S.A., com um DSRUWHGH5PLOK}HVFXPSULQGRRFRPSURPLVVRDVVXPLGRQR$FRUGRGH,QYHVWLPHQWRV¿UPDGRHP $1RYD)URQWHLUDDQXQFLRXLQYHVWLPHQWRVGH5PLOK}HVQD8VLQD%RD9LVWDQRVSUy[LPRVWUrVDQRV Os recursos serão aplicados na ampliação da unidade para uma capacidade de moagem estimada em até 8 milhões de t/ano, o que possibilitará elevar a produção anual de etanol dos atuais 176 mil m3 para 700 mil m3. A exportação de energia elétrica deverá passar de 135 GWh para 600 GWh/ano. A empresa assinou contrato com a Petrobras Distribuidora para venda de 50 mil m3/ano de sua produção de etanol anidro.

,17(51$&,21$/

9DORUL]DomRHGLYHUVLÂżFDomRGHSURGXWRV

$WXDomRLQWHUQDFLRQDO

Â&#x2021;

Início da produção de Diesel PodiumFRPSSPGHHQ[RIUH 6 QD5H¿QDULD+HQULTXH/DJH 5HYDS  antecipando em seis meses a oferta do produto ao mercado brasileiro;

Â&#x2021;

Conclusão do modelo de otimização dos sistemas de produção de mamona e girassol no semiårido, que possibilitarå ganhos expressivos de produtividade por meio de escolhas de densidade de plantio e variedades, controle de pragas e doenças, adubação e associação com culturas alimentícias;

Â&#x2021;

Produção de 12 t de polietileno diferenciado de alta densidade em unidade de demonstração da Braskem, SDUDSURGXomRGHFDERVGHDPDUUDomRGHSODWDIRUPDVGHSHWUyOHRFRPDOWDUHVLVWrQFLDĂ&#x20AC;XWXDELOLGDGHHPHQRU custo de aplicação.

A Petrobras atua em 24 paĂ­ses, alĂŠm do Brasil, com projetos em cinco continentes, e tem escritĂłrios de UHSUHVHQWDomRHP1RYD<RUN/RQGUHV7yTXLRH3HTXLP7DPEpPPDQWpPDFRUGRVGHFRRSHUDomRFRPGLYHUVRV parceiros, para desenvolvimento de tecnologia e negĂłcios. Os principais pilares estratĂŠgicos para a atuação internacional da companhia sĂŁo: Â&#x2021;

Â&#x2021;

$SURYHLWDPHQWR GD FDSDFLGDGH WpFQLFD H GH FRQKHFLPHQWR JHRFLHQWt¿FR GD 3HWUREUDV HP ( 3 QD FRVWD brasileira em åreas que apresentem características similares e com grande potencial de reservas, com foco em exploração na Costa Oeste da à frica e no Golfo do MÊxico; Conquista de mercados, crescimento em downstream e alinhamento do portfólio aos segmentos nacionais, de modo a aumentar a rentabilidade dos negócios e promover a integração da cadeia de produtos;

6XVWHQWDELOLGDGH Â&#x2021;

ConclusĂŁo de testes em sistema protĂłtipo, para redução de atĂŠ 50% dos particulados emitidos por unidades de FUDTXHDPHQWRFDWDOtWLFRHPOHLWRĂ&#x20AC;XLGL]DGR )&& 

Â&#x2021;

Ampliação dos negócios de gås natural para complementar o mercado brasileiro, cumprindo o compromisso de responsabilidade com a segurança energÊtica do País.

Â&#x2021;

ConclusĂŁo do primeiro teste mundial de oxicombustĂŁo em unidades de FCC, capaz de capturar 1 t/dia de CO2, alĂŠm de reduzir em atĂŠ 32% as emissĂľes de CO2HPUHÂżQDULDVDFXVWRLQIHULRU

No mercado internacional, a Petrobras encerrou 2011 com investimentos de R$ 4,4 bilhões, tendo produzido 147,5 mil bpd de óleo e 16,54 milhões de m³/dia de gás natural, totalizando 244,9 mil boed, além de ter processado PLOESGGHyOHRHPVXDVUH¿QDULDVFXMDFDSDFLGDGHGHSURFHVVDPHQWRDR¿QDOGRDQRIRLGHPLOESG proporcionando um fator de utilização de 67% ao ano. As reservas provadas internacionais somaram 0,706 bilhões de boe, volume 0,4% superior ao de 2010, resultando no índice de reposição de reservas de 104%. Esse volume corresponde a 4,3% das reservas totais da companhia, VHJXQGRRFULWpULR6RFLHW\RI3HWUROHXP(QJLQHHUV 63( 

Â&#x2021;

de informaçþes ambientais da regiĂŁo, alinhado Ă s polĂ­ticas pĂşblicas do MinistĂŠrio de Meio Ambiente; Â&#x2021;

A Petrobras investiu R$ 4,4 bilhĂľes em sua atuação internacional, para atender as estratĂŠgias de alinhamento ao portfĂłlio domĂŠstico da companhia, conquistar mercados e ampliar negĂłcios de gĂĄs natural, com foco na Costa 2HVWHGDĂ&#x2C6;IULFDH*ROIRGR0p[LFR'HVVHWRWDOIRUDPGHVWLQDGRVjVDWLYLGDGHVGHUHÂżQRSHWURTXtPLFD distribuição, gĂĄs e energia, e 90% Ă exploração e produção, dos quais 59% para o desenvolvimento da produção em projetos existentes.

$PpULFDV A Petrobras estå presente em 11 países do continente americano, alÊm do Brasil: Argentina, Bolívia, Chile, Colômbia, Curaçao, Estados Unidos, MÊxico, Paraguai, Peru, Uruguai e Venezuela. São 872 estaçþes de serviços e ativos de exploração e de produção em oito desses países, cuja produção foi de 89,7 mil bpd de óleo e 16,5 milhþes de m³/dia de gås natural, totalizando 187,1 mil boed.

,PSODQWDomRGHXQLGDGHGHWUDWDPHQWRELROyJLFRGHHĂ&#x20AC;XHQWHVVDOLQRVLQGXVWULDLVSDUDUHGXomRGHLPSDFWRV DPELHQWDLVQR7HUPLQDOGH6mR6HEDVWLmR63

Â&#x2021;

'HVHQYROYLPHQWRGHQHJyFLRV

)LQDOL]DomRGDFDUDFWHUL]DomRDPELHQWDOFLHQWtÂżFDGD%DFLDGH&DPSRVFRPSRQGRRPDLVFRPSOHWRFRQMXQWR

,QVWDODomRGHXQLGDGHGHWUDWDPHQWRHUH~VRGHHĂ&#x20AC;XHQWHVSRUVHSDUDomRSRUPHPEUDQDVQD5HYDSHGH WUDWDPHQWRHUH~VRGHHĂ&#x20AC;XHQWHVSRUHOHWURGLiOLVHUHYHUVDSDUDUHPRomRGHVDLVQD5HJDSDPEDVSDUDUHGXomR GHGHVFDUWHGHHĂ&#x20AC;XHQWHV

'HVWDFDVHDLQGDDLQWHQVL¿FDomRGDSDUFHULDFRPIRUQHFHGRUHVHDDFDGHPLDEUDVLOHLUDSULQFLSDOPHQWHQRV projetos relacionados ao PrÊ-Sal. Em 2011, foram aplicados cerca de R$ 500 milhþes em universidades e LQVWLWXLo}HVGHFLrQFLDHWHFQRORJLDQDFLRQDLVGHVWLQDGRVjUHDOL]DomRGHSURMHWRVGH3 'jTXDOL¿FDomRGH tÊcnicos e pesquisadores, e à ampliação da infraestrutura laboratorial, com a inauguração de 35 laboratórios, totalizando 10 mil m² de årea construída e reformada em 17 instituiçþes de 11 estados brasileiros. Com estímulo da companhia, 15 grandes fornecedores da indústria de óleo e gås construíram ou iniciaram a construção de centros de pesquisa no Brasil. Adicionalmente, em 2011 a companhia manteve 44 acordos de cooperação ou protocolo de intençþes com empresas nacionais e internacionais.

5(63216$%,/,'$'(62&,$/($0%,(17$/

1D$UJHQWLQDIRLFRQFOXtGDHPPDLRDYHQGDGDUH¿QDULDGH6DQ/RUHQ]RRTXHUHGX]LXHPPLOESGD FDSDFLGDGHGHSURFHVVDPHQWRGDFRPSDQKLDQRSDtVTXHSDVVDDVHUGHPLOESGGHyOHRQDUH¿QDULD5LFDUGR D. Eliçabe, localizada em Bahía Blanca.

*HVWmRHPUHVSRQVDELOLGDGHVRFLDO

Na Bolívia, a atuação da companhia produzindo gås natural dos campos de San Alberto e San Antonio contribui para o abastecimento desse mercado no Brasil, via transporte pelo gasoduto que liga os dois países. Durante o ano, a companhia adquiriu participação de 30% no campo de gås natural de Itaú.

trabalha para que seus programas de patrocínios resultem, de forma efetiva, em contribuição ao desenvolvimento

Em 2011, a companhia investiu R$ 640,9 milhþes em projetos sociais, culturais, ambientais e esportivos. A Petrobras VXVWHQWiYHO3DUDTXHKDMDLJXDOGDGHGHDFHVVRHPDLRUDEUDQJrQFLDGRVSURMHWRVVHOHFLRQDGRVDFRPSDQKLD realiza seleçþes públicas e incentiva os projetos escolhidos a terem metas para alcançar a viabilidade econômica e organizacional, de forma a garantir a continuidade dos benefícios gerados após o encerramento do contrato

No Peru, cuja produção do lote X gira em torno de 15 mil boed, seguem o desenvolvimento da produção do lote 57

de patrocĂ­nio.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

E-8

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA 3HOR VH[WR DQR FRQVHFXWLYR D FRPSDQKLD LQWHJUD R Ă&#x2039;QGLFH 'RZ -RQHV GH 6XVWHQWDELOLGDGH '-6,  R PDLV

Â&#x2021;

Aumento dos investimentos em biocombustĂ­veis;

Â&#x2021;

Estímulo ao uso racional dos combustíveis, por meio das açþes do Programa Nacional de Racionalização do

importante índice mundial relacionado ao tema. O DJSI avalia o desempenho econômico, social e ambiental de PDLVGHHPSUHVDVHVXDUHQRYDomRFRQVROLGDD3HWUREUDVHQWUHDTXHODVTXHWrPDVPHOKRUHVSUiWLFDVGH gestão no mundo. 1RHVWXGRHODERUDGRSHODFRQVXOWRULD0DQDJHPHQW ([FHOOHQFH 0 ( DFRPSDQKLDREWHYHDPHOKRUQRWDHP sustentabilidade. Na sÊtima edição do ranking Global 100, garantiu, pela segunda vez seguida, seu lugar entre as empresas mais sustentåveis do mundo.

8VRGRV'HULYDGRVGR3HWUyOHRHGR*iV1DWXUDO &RQSHW  1RV~OWLPRVFLQFRDQRVD3HWUREUDVLQYHVWLXPDLVGH5PLOK}HVHPSURMHWRVGHHÂżFLrQFLDHQHUJpWLFDTXH proporcionaram economia de cerca de 4.200 mil boed. O investimento total de 2010 a 2015 deverĂĄ somar US$ 976 milhĂľes.

2XWUD FRQTXLVWD Âą HVWD SHOD WHUFHLUD YH] FRQVHFXWLYD Âą IRL R 6HOR 3Uy(TXLGDGH GH *rQHUR RIHUHFLGR SHOD 6HFUHWDULDGH3ROtWLFDVSDUDDV0XOKHUHV 630 D2UJDQL]DomR,QWHUQDFLRQDOGR7UDEDOKR 2,7 QR%UDVLOHR)XQGR

A companhia ĂŠ responsĂĄvel pela Secretaria Executiva do Conpet. O programa propiciou, em 2011, uma economia

GH'HVHQYROYLPHQWRGDV1Do}HV8QLGDVSDUDD0XOKHU 8QLIHP (QWUHDVDo}HVQRkPELWRGRSURJUDPDHVWmR

GHPLOK}HVGHOLWURVGHGLHVHOFRPRVSURMHWRV(FRQRPL]DUH7UDQVSRUWDUHGHPLOPĂąGHJiVQRVHWRU

a adoção da licença-maternidade de 180 dias; a criação e instalação de quatro salas de apoio à amamentação

UHVLGHQFLDOSRUPHLRGHDo}HVGHHÂżFLrQFLDHQHUJpWLFDHGHHWLTXHWDJHPGHHTXLSDPHQWRV

em unidades da companhia; e a realização de cursos e seminårios de formação continuada, com temas como UHODo}HVGHJrQHURGLUHLWRGDVPXOKHUHVHGLYHUVLGDGHDOpPGRV(QFRQWURV5HJLRQDLVSDUDR)RUWDOHFLPHQWRGD

5HFXUVRVKtGULFRVHHĂ&#x20AC;XHQWHV

(TXLGDGHGH*rQHUR Com o objetivo de assegurar a sustentabilidade do abastecimento de ĂĄgua necessĂĄrio Ă s suas atividades, a 3DUDFHOHEUDURVDQRVGR'LD,QWHUQDFLRQDOGH&RPEDWHj9LROrQFLDFRQWUDD0XOKHUIRLODQoDGDDFDPSDQKD

Petrobras tem investido na racionalização do uso desse insumo em suas operaçþes.

QDFLRQDO³4XHP$PD$EUDoD´2SDWURFtQLRDRSURMHWRHVWiDOLQKDGRDR3ODQRGH$omR3Uy(TXLGDGHGH*rQHUR HjDGHVmRjTXDUWDHGLomRGR3URJUDPD3Uy(TXLGDGHGH*rQHURH5DoD

Em 2011, foram reutilizados quase 20,5 bilhĂľes de litros de ĂĄgua â&#x20AC;&#x201C; o que representa um aumento de cerca de

Depois de promover no Brasil, em 2010, o lançamento da ISO 26000 â&#x20AC;&#x201C; norma internacional de responsabilidade

HPUHODomRD$TXDQWLGDGHpVXÂżFLHQWHSDUDDEDVWHFHUQRSHUtRGRXPDFLGDGHGHPLOKDELWDQWHV

VRFLDOÂąD3HWUREUDVHPSDUFHULDFRPD$VVRFLDomR%UDVLOHLUDGH1RUPDV7pFQLFDV $%17 UHDOL]RXHYHQWRVQDV

A ågua reutilizada em 2011 foi capaz de suprir cerca de 10% do volume necessårio às operaçþes da companhia,

principais capitais do PaĂ­s para difundir o conhecimento e o conteĂşdo da norma, principalmente junto Ă indĂşstria

evitando sua captação em mananciais hídricos. Outros projetos, com conclusão prevista para 2012 e 2013,

nacional e ao movimento sindical.

permitirĂŁo Ă Petrobras uma economia anual adicional da ordem de 13,5 bilhĂľes de litros.

Em 2011, foi concluída a etapa de implantação de processos de Agenda 21 Local no entorno das obras do Comperj. Ao todo, 14 municípios receberam o plano de desenvolvimento local da Agenda 21, realizado a partir de

Estudos de cenĂĄrios de disponibilidade hĂ­drica para os prĂłximos 20 anos, realizados nas principais bacias

XPWUDEDOKRGHPRELOL]DomRMXQWRDRSRGHUS~EOLFR7HUFHLUR6HWRUHPSUHVDVHFRPXQLGDGH

KLGURJUiÂżFDVGDVUHJL}HVRQGHDWXDSHUPLWHPj3HWUREUDVSODQHMDUGHIRUPDHÂżFD]VXDVDWLYLGDGHV6mROHYDGRV HPFRQWDRHPSUHJRGHWHFQRORJLDVTXHSURPRYDPPDLRUHÂżFLrQFLDQRXVRGDiJXDSURMHWRVGHUHXWLOL]DomRGR

Como parte do processo de implementação do Programa Petrobras Agenda 21, foi realizada uma caravana

LQVXPRLGHQWLÂżFDomRGHIRQWHVGHVXSULPHQWRDOWHUQDWLYDVHDWpUHDORFDomRGHHPSUHHQGLPHQWRV

GHVHQVLELOL]DomRMXQWRjVXQLGDGHVHiUHDVGDFRPSDQKLD7DPEpPKRXYHDFDSDFLWDomRGDIRUoDGHWUDEDOKR diretamente envolvida no programa e das instituiçþes que vão operacionalizar as açþes.

6HJXUDQoD0HLR$PELHQWH(ÂżFLrQFLD(QHUJpWLFDH 6D~GH

5HVtGXRV Para reduzir a geração de resíduos sólidos e incentivar o reúso e a reciclagem, a Petrobras criou o Projeto GH0LQLPL]DomRGH5HVtGXRVTXHLGHQWL¿FDRSRUWXQLGDGHVHWHVWDWHFQRORJLDVPDLVOLPSDVHLQRYDGRUDVGH tratamento. Foram diagnosticadas possibilidades de minimização em diversas åreas de E&P e nas de distribuição,

$3HWUREUDVGHVSHQGHX5ELOK}HVHPDo}HVHPVHJXUDQoDPHLRDPELHQWHHVD~GH 606 HDSURYRXRV

ELRFRPEXVWtYHLVHXVLQDVWHUPHOpWULFDV$RPHVPRWHPSRVmRWHVWDGDVWHFQRORJLDVFRPRÂżWRUUHPHGLDomRXVR

,QGLFDGRUHV(VWUDWpJLFRVGH(ÂżFLrQFLD(QHUJpWLFDHGH,QWHQVLGDGHGH(PLVV}HVGH*DVHVGH(IHLWR(VWXID

de biossurfactantes em biorreatores, separação de fases de sedimentos e tratamento com plasma.

DVVLPFRPRDVPHWDVRVGHVD¿RVHVWUDWpJLFRVHRSRVLFLRQDPHQWRFRUSRUDWLYRUHODWLYRVDRWHPD Em 2011, a companhia reciclou 92 mil t de resíduos sólidos perigosos, correspondentes a 37% de todo o resíduo Para as åreas de negócio, foi determinado o detalhamento de suas carteiras de projeto, explicitando a contribuição para

sólido tratado, destacando-se nesse percentual a recuperação energÊtica.

D(¿FLrQFLD(QHUJpWLFDH5HGXomRGD,QWHQVLGDGHGH(PLVV}HVGH*DVHVGH(IHLWR(VWXIDHDFRQVWLWXLomRGHXPJUXSR GHWUDEDOKRFRRUGHQDGRSHODiUHDGH6HJXUDQoD0HLR$PELHQWH(¿FLrQFLD(QHUJpWLFDH6D~GH 60(6 SDUDDYDOLDUDV oportunidades de integração entre atividades, reduzindo ainda mais o consumo de energia. Foram investidos R$ 115 milhþes na racionalização do uso da energia e no aproveitamento da energia termossolar. )RL FRQFOXtGR R SODQHMDPHQWR GD )DVH ,, GR SURMHWR ([FHOrQFLD HP 606 UHIHUHQWH DR SHUtRGR  DVVHJXUDQGRVXDDGHTXDomRDRFUHVFLPHQWRHjGLYHUVL¿FDomRGRVQHJyFLRVGD3HWUREUDVQRVSUy[LPRVDQRV2

A quantidade gerada em 2011 de 281 mil t foi inferior ao LMA de 366 mil t estabelecido para o ano.

%LRGLYHUVLGDGH A Petrobras estå mapeando as åreas protegidas, sensíveis e vulneråveis existentes no interior e no entorno de suas instalaçþes. Para consolidar esse levantamento, a companhia dispþe do GeoPortal, um sistema de

projeto integra a Agenda EstratĂŠgica da companhia e congrega suas principais iniciativas na ĂĄrea.

LQIRUPDo}HVJHRJUiÂżFDVTXHSHUPLWHDLQWHJUDomRHRDFHVVRjVLQIRUPDo}HVDPELHQWDLV

6HJXUDQoDRSHUDFLRQDO

No Brasil e no exterior, a companhia participa de projetos e iniciativas que visam a consolidar informaçþes, orientar e reconhecer iniciativas voltadas à preservação da biodiversidade, como o Projeto Proteus, da ONU, a Lasting

Os indicadores de desempenho da Petrobras na årea de segurança mantiveram-se em níveis comparåveis aos

Initiative for Earth (Life)HR3URMHWRGH9DORUDomRGD%LRGLYHUVLGDGHH6HUYLoRV(FRVVLVWrPLFRVGHVHQYROYLGRSHOR

GDVPHOKRUHVUHIHUrQFLDVLQWHUQDFLRQDLVSDUDDLQG~VWULDGHyOHRHJiV$7D[DGH)UHTXrQFLDGH$FLGHQWDGRV

&RQVHOKR(PSUHVDULDO%UDVLOHLURSDUDR'HVHQYROYLPHQWR6XVWHQWiYHO &(%'6 

FRP$IDVWDPHQWR 7)&$ ÂżFRXHPDFLPDGR/LPLWH0i[LPR$GPLVVtYHO /0$ HVWDEHOHFLGRQR3ODQR de NegĂłcios 2011-2015. Esse resultado deveu-se, principalmente, a acidentes com afastamento nas atividades

$WXDomRHPHPHUJrQFLDV

de construção naval, na operação de sondas e em ĂĄreas administrativas. $VIDWDOLGDGHVQDIRUoDGHWUDEDOKR HPSUHJDGRVSUySULRVHWHUFHLUL]DGRV VXELUDPGHGH]HPSDUDHP HQTXDQWRD7D[DGH$FLGHQWDGRV)DWDLV 7$) ÂąHTXLYDOHQWHDRQ~PHURGHIDWDOLGDGHVSRUPLOK}HVGH homens-horas de exposição ao risco â&#x20AC;&#x201C; passou de 1,08 para 1,66 no mesmo perĂ­odo.

$3HWUREUDVGLVS}HGHHTXLSHVWUHLQDGDVHUHFXUVRVPDWHULDLVSDUDDRSHUDFLRQDOL]DomRGHSODQRVGHHPHUJrQFLD São 30 embarcaçþes de grande porte para recolhimento de óleo, 130 embarcaçþes de apoio, 150 mil metros de barreiras de contenção, 120 mil metros de barreiras absorventes, 400 recolhedores de óleo e 200 mil litros de dispersantes químicos, entre outros itens disponíveis nos dez Centros de Defesa Ambiental e em suas 13 bases

0HLRDPELHQWH A Petrobras buscou minimizar os impactos de suas atividades operacionais e de seus produtos sobre o meio DPELHQWHDÂżPGHUHGX]LURVHIHLWRVSROXHQWHVHRFRQVXPRGHUHFXUVRVQDWXUDLV

DYDQoDGDVHQRV&HQWURVGH5HVSRVWDD(PHUJrQFLDGLVWULEXtGRVHPPDLVGHFLGDGHVEUDVLOHLUDV

(P  D FRPSDQKLD UHDOL]RX  VLPXODGRV UHJLRQDLV GH FRPEDWH D HPHUJrQFLDV TXH HQYROYHUDP D Marinha do Brasil, a Defesa Civil, o Corpo de Bombeiros, a PolĂ­cia Militar, ĂłrgĂŁos ambientais, prefeituras e

(PGH]HPEURGHRVVLVWHPDVGHJHVWmRDPELHQWDOGHGDVXQLGDGHVFHUWLÂżFiYHLVQR%UDVLOHQRH[WHULRU

comunidades locais.

estavam em conformidade com a norma ISO 14001.

'HUUDPDPHQWRGHSHWUyOHRHGHULYDGRV

(ÂżFLrQFLD HQHUJpWLFD HPLVV}HV DWPRVIpULFDV H PXGDQoD GRFOLPD

Os derramamentos de petrĂłleo e derivados atingiram 234 m3, volume inferior em 61% ao LMA estabelecido para RDQRGHPĂą&RQWLQXDVHQGRPDQWLGDDWHQGrQFLDGHQtYHLVGHGHUUDPDPHQWRLQIHULRUHVDP3 por milhĂŁo de EDUULVGHSHWUyOHRSURGX]LGRVXPUHIHUHQFLDOGHH[FHOrQFLDQDLQG~VWULDPXQGLDOGHyOHRHJiV

1HVWDiUHDRGHVDÂżRHVWUDWpJLFRGD3HWUREUDVpPD[LPL]DUDHÂżFLrQFLDHQHUJpWLFDHUHGX]LUDLQWHQVLGDGHGH HPLVV}HVGHJDVHVGHHIHLWRHVWXID *(( GHIRUPDDDWLQJLUSDWDPDUHVGHH[FHOrQFLDQDLQG~VWULDGHyOHRHJiV e contribuir para a sustentabilidade do negĂłcio.

6D~GH $3HWUREUDVDFRPSDQKDRVUHVXOWDGRVQHVWDiUHDSRUPHLRGHLQGLFDGRUHVFRPRR3HUFHQWXDOGH7HPSR3HUGLGR

AtĂŠ 2015, a companhia deverĂĄ atingir as seguintes metas, tendo 2009 como ano-base: D UHGX]LUHPDLQWHQVLGDGHHQHUJpWLFDHPVXDVRSHUDo}HVGH5HÂżQRHHPQDVGH*iVH(QHUJLD XVLQDV WHUPHOpWULFDV  E UHGX]LUHPDLQWHQVLGDGHGDTXHLPDGHJiVQDWXUDOHPWRFKDQDVRSHUDo}HVGH([SORUDomRH3URGXomR F UHGX]LUHPHUHVSHFWLYDPHQWHDLQWHQVLGDGHGHHPLVV}HVGHJDVHVGHHIHLWRHVWXIDQDVVXDV RSHUDo}HVGH([SORUDomRH3URGXomRGH5HÂżQRHGH*iVH(QHUJLD XVLQDVWHUPHOpWULFDV 

373 UHIHUHQWHDRVDIDVWDPHQWRVGHHPSUHJDGRVSRUGRHQoDVRXDFLGHQWHV(PIRLUHJLVWUDGRXP373GH 2,33%, inferior ao LMA estabelecido para o ano, de 2,41%.

25*$1,=$d­2*(5$/'$3(752%5$6 Em 2011, em alinhamento ao Plano EstratÊgico, foram promovidas mudanças na estrutura organizacional da Petrobras, entre elas:

Ĺś

H3URGXWRVHDGHTXDomRGHXQLGDGHVGR( 3&RUSRUDWLYRHPIXQomRGDVQRYDVJHUrQFLDVH[HFXWLYDVGH

A Petrobras elabora o inventĂĄrio anual de suas emissĂľes atmosfĂŠricas, reunindo dados de mais de 30 mil fontes.

Construção de Poços Marítimos e de Projetos de Desenvolvimento da Produção.

2VUHVXOWDGRVVmRYHULÂżFDGRVSRUFRQVXOWRUHVLQGHSHQGHQWHV (QWUHDVSULQFLSDLVDo}HVDGRWDGDVHPHÂżFLrQFLDHQHUJpWLFDHJHVWmRGHHPLVV}HVGHJDVHVGHHIHLWRHVWXID

Ă&#x2C6;UHDGH1HJyFLRGH([SORUDomRH3URGXomR Âą&ULDomRGDJHUrQFLDJHUDOGH3URJUDPDomRGH5HFXUVRV

Ĺś

Ă&#x2C6;UHDGH6HUYLoRV

destacam-se: Ĺź Â&#x2021;

&HQSHVÂą$MXVWHVQDVDWULEXLo}HVHGHQRPLQDo}HVGHXQLGDGHVDOpPGDFULDomRGDVJHUrQFLDVJHUDLV

$SHUIHLoRDPHQWRGDJRYHUQDQoDQDiUHDGHHÂżFLrQFLDHQHUJpWLFDSRUPHLRGDFRQVWLWXLomRGD&RPLVVmRGH

GH*HRHQJHQKDULDHGH(QJHQKDULDGH3RoRHPDLVRLWRJHUrQFLDV7DLVDMXVWHVIRUDPPRWLYDGRVSHOR

(ÂżFLrQFLD(QHUJpWLFD(PLVV}HVH0XGDQoDGR&OLPDTXHVHUH~QHPHQVDOPHQWH

crescimento dos investimentos nas atividades de gĂĄs e energia, gĂĄs-quĂ­mica e bicombustĂ­veis; da FRPSOH[LGDGHGRVGHVDÂżRVWHFQROyJLFRVSDUDWUDWDPHQWRHUH~VRGHiJXDHHĂ&#x20AC;XHQWHVQDVLQVWDODo}HVHGRV

Â&#x2021;

GHVDÂżRVWHFQROyJLFRVQDH[SORUDomRHSURGXomRGRVUHVHUYDWyULRVGR3Up6DO

Redução da intensidade de emissão de GEE, com destaque para a diminuição em 50%, com relação a 2009, da intensidade da queima de gås natural em tocha nas operaçþes de Exploração e Produção; ş

Â&#x2021;

7HFQRORJLDGD,QIRUPDomRH7HOHFRPXQLFDo}HV 7,& â&#x20AC;&#x201C; Ajustes organizacionais na sede e nas unidades

$XPHQWRGDHÂżFLrQFLDHQHUJpWLFDQDVXQLGDGHVJUDoDVjLPSOHPHQWDomRGHSURMHWRVGHVHQYROYLGRVFRPR

GHVORFDGDV UHJLRQDLV YLVDQGRJDQKRVGHHVFDODHPHOKRUJRYHUQDQoDGRVSURFHVVRVH[HFXWDGRV)RUDP

apoio de 48 Comissþes Internas de Conservação de Energia;

UHDOL]DGRVDMXVWHVHPIXQomRGRVGHVDÂżRVGDH[SORUDomRGR3Up6DOHGDVQRYDVXQLGDGHVGR$EDVWHFLPHQWR DOWHUDQGRRSRUWHGDJHUrQFLDJHUDOGH7,&([SORUDomRH3URGXomRHGDJHUrQFLDJHUDOGH7,&$EDVWHFLPHQWR

Â&#x2021;

Plano de Otimização do Aproveitamento de GĂĄs na Bacia de Campos, que realizou 93 açþes em 24 plataformas; )XQomRVHJXUDQoDPHLRDPELHQWHHÂżFLrQFLDHQHUJpWLFDHVD~GHQDVĂ&#x2C6;UHDVGH1HJyFLRDesdobramento

Â&#x2021;

Investimentos em P&D visando à mitigação da mudança do clima, por meio de dois programas tecnológicos e

GRVSURFHVVRVGH(ÂżFLrQFLD(QHUJpWLFDH606DSDUWLUGD&DGHLDGH9DORUGD3HWUREUDVHDMXVWHGDHVWUXWXUD

uma rede envolvendo 12 universidades brasileiras;

organizacional das Ă reas de NegĂłcio, alinhando-as a estes processos.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-9

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA

$1Ă&#x2C6;/,6(),1$1&(,5$ 5HVXOWDGRV&RQVROLGDGRV

5HVXPR(FRQ{PLFR)LQDQFHLUR 5HVXPR(FRQ{PLFR)LQDQFHLUR 5PLOK}HV &RQVROLGDGR 3HWUREUDV     244.176 211.842 183.821 156.487

Â&#x2021;5HFHLWDGHYHQGDV ................................................................ Â&#x2021;/XFURDQWHVGRUHVXOWDGRÂżQDQFHLURGDV participaçþes e impostos ...................................................... Atividades prĂłprias ............................................................... SubsidiĂĄrias/Coligadas ......................................................... Â&#x2021;/XFUROtTXLGRDWULEXtYHODRVDFLRQLVWDVGD3HWUREUDV ............. Lucro lĂ­quido por ação 1 ........................................................ 0DUJHPEUXWD  ................................................................. 0DUJHPRSHUDFLRQDO   .................................................... 0DUJHPOtTXLGD  .............................................................. (%,7'$5PLOK}HV ........................................................... Â&#x2021;(QGLYLGDPHQWROtTXLGR 3 ........................................................ Â&#x2021;$WLYR7RWDO ............................................................................. Â&#x2021;,QYHVWLPHQWRVLPRELOL]DGRLQWDQJtYHOHGLIHULGR ................... Â&#x2021;3DWULP{QLR/tTXLGR ................................................................ Â&#x2021;5HODomR&DSLWDO3UySULR&DSLWDOGH7HUFHLURVOtTXLGR 4...........

45.403

46.394

31.474

36.554

32.927 386 33.313 2,55 32 19 14 62.246 103.022 599.150 436.799 332.224 61/39

34.604 585 35.189 3,57 36 22 17 59.391 61.007 516.846 373.226 309.828 67/33

27.293 5.808 33.101 2,54 32 17 18 43.493 19.369 494.181 362.673 330.475 72/28

27.997 7.039 35.036 3,55 39 23 22 45.835 10.541 466.655 319.013 307.317 73/27

&RPSRVLomRGR(ELWGD &RQVROLGDGR

&RQWURODGRUD





/XFURDQWHVGRUHVXOWDGR¿QDQFHLUR das participaçþes e impostos ......................







45.403

46.394

Participação de Empregados ........................







31.474





Depreciação/Amortização .............................

17.739

14.612

21

12.902

 3HUGDQDUHFXSHUDomRGHDWLYRV ................

664

76

774

412

(%,7'$ .........................................................









0DUJHP(%,7'$  ....................................





(QGLYLGDPHQWR/tTXLGR(%,7'$ ................









A Petrobras, suas SubsidiĂĄrias e Controladas apresentaram um lucro lĂ­quido consolidado de R$ 33.313 milhĂľes QRH[HUFtFLRVRFLDOÂżQGRHPDSyVDHOLPLQDomRGDVRSHUDo}HVLQWHUFRPSDQKLDVHDGHGXomRGD SDUWLFLSDomRGRVDFLRQLVWDVQmRFRQWURODGRUHV 5PLOK}HVHP  Esse resultado foi impactado por: Â&#x2021;

Aumento do lucro bruto em R$ 1.012 milhĂľes, devido:

Ĺź

0DLRUHV FRWDo}HV LQWHUQDFLRQDLV GR SHWUyOHR %UHQW   H GHULYDGRV UHĂ&#x20AC;HWLGDV VREUH RV SUHoRV GDV exportaçþes, vendas internacionais, operaçþes de trading e derivados comercializados no mercado interno atrelados Ă s cotaçþes internacionais;

Ĺź

Aumento dos preços da gasolina e do diesel no mercado interno em novembro, em 10% e 2%, respectivamente;

Ĺź

$XPHQWR GD GHPDQGD QR PHUFDGR LQWHUQR   SULQFLSDOPHQWH GD JDVROLQD   UHĂ&#x20AC;HWLQGR VXD PDLRU FRPSHWLWLYLGDGHIUHQWHDRHWDQROGLHVHO  H4$9  H

Ĺź

Ao incremento da produção de petróleo e gås de 2% no Brasil.

Parte desses efeitos foi compensada pelos maiores volumes importados de petróleo e derivados e maiores cotaçþes internacionais sobre as importaçþes de petróleo e derivados, operaçþes de trading e participaçþes governamentais.



Â&#x2021;

Aumento nas despesas em R$ 2.003 milhĂľes, destacando:

36.554



Ĺź





10.813

19

*HUDLVH$GPLQLVWUDWLYDV 5PLOK}HV GHYLGRDRVDXPHQWRVQRVJDVWRVFRP3HVVRDOGHFRUUHQWHGR $&7QDIRUoDGHWUDEDOKRQDVGHVSHVDVFRPIRUPDomRHDSHUIHLoRDPHQWRSURÂżVVLRQDOHFRPVHUYLoRV tĂŠcnicos contratados;

Ĺź

&XVWRVH[SORUDWyULRV 5PLOK}HV GHFRUUHQWHGRDXPHQWRGDDWLYLGDGHRSHUDFLRQDOHPDLRUHVEDL[DVGH poços secos no país;

Ĺź

3HVTXLVD H 'HVHQYROYLPHQWR 5  PLOK}HV  UHĂ&#x20AC;HWLQGR PDLRUHV JDVWRV FRP R 6LVWHPD GH 6HSDUDomR Submarina de Ă gua e Ă&#x201C;leo-SSAO e com a contratação de projetos junto a instituiçþes credenciadas pela ANP, conforme Regulamento ANP nÂş 5/2005; e

Ĺź

3HUGDQDUHFXSHUDomRGHDWLYRV 5PLOK}HV 





















(%,7'$QmRpXPLQGLFDGRUFDOFXODGRGHDFRUGRFRPDVSUiWLFDVFRQWiEHLVDGRWDGDVQR%UDVLOHSRVVLYHOPHQWH pode nĂŁo servir de base de comparação com indicadores com o mesmo nome, apresentados por outras empresas. 2(%,7'$QmRGHYHVHUFRQVLGHUDGRFRPRXPLQGLFDGRUVXEVWLWXWRSDUDPHGLUOXFURRSHUDFLRQDORXWDPEpP FRPRXPDPHOKRUIRUPDGHPHQVXUDomRGDOLTXLGH]HGRĂ&#x20AC;X[RGHFDL[DGDVDWLYLGDGHVRSHUDFLRQDLV2(%,7'$ ĂŠ uma informação adicional da capacidade de pagamento das dĂ­vidas, da manutenção de investimentos e da capacidade de cobrir necessidades de capital de giro. 1

Lucro líquido por ação calculado com base na mÊdia ponderada da quantidade de açþes. 3DUDRFiOFXORIRLFRQVLGHUDGRROXFURDQWHVGRUHVXOWDGR¿QDQFHLURGDVSDUWLFLSDo}HVHLPSRVWRV 3 ,QFOXLHQGLYLGDPHQWRFRQWUDtGRDWUDYpVGHDUUHQGDPHQWRVPHUFDQWLV¿QDQFHLURVHWtWXORVS~EOLFRV federais com vencimento superior a 90 dias. 4 &DSLWDOGHWHUFHLURVOtTXLGRGHFDL[DHDSOLFDo}HV¿QDQFHLUDV

Estes efeitos foram parcialmente compensados pela redução das perdas com processos judiciais e administrativos 5PLOK}HV HPUHODomRDHJDQKRVFRPSURFHVVRVMXGLFLDLVHDUELWUDLVHP 5PLOK}HV  relativos à recuperação de COFINS e à indenização da construção da P-48.

2

Â&#x2021;

5HFHLWDVÂżQDQFHLUDVOtTXLGDVGH5PLOK}HVLQIHULRUHVD 5 UHĂ&#x20AC;HWLQGR

Ĺź

'HSUHFLDomRFDPELDOGHVREUHRHQGLYLGDPHQWR DSUHFLDomRGHHP JHUDQGRXPDGHVSHVD FDPELDOGH5PLOK}HV UHFHLWDGH5PLOK}HVHP 

Ĺź

$XPHQWRGHUHFHLWDVFRPPDLRUHVDSOLFDo}HVÂżQDQFHLUDVQRSDtV 5PLOK}HV FRQIRUPHTXDGURD seguir:

3ULQFLSDLVLQGLFDGRUHVHFRQ{PLFRVFRQVROLGDGRV ([HUFtFLR  ,QGLFDGRUHV(FRQ{PLFRVH)LQDQFHLURV Â&#x2021;3HWUyOHR%UHQW 86EEO ........................................................ Â&#x2021;'yODUPpGLRGHYHQGD 5 .................................................... Â&#x2021;'yODUÂżQDOGHYHQGD 5 ....................................................... ,QGLFDGRUHVGH3UHoRV Â&#x2021;3UHoRGRVGHULYDGRVQRPHUFDGRLQWHUQR 5EEO ................. Preço mĂŠdio de venda - Brasil Â&#x2021;3HWUyOHR 86EEO  5 ............................................................... Â&#x2021;*iVQDWXUDO 86EEO  6 .......................................................... Preço mĂŠdio de venda - Internacional Â&#x2021;3HWUyOHR 86EEO .................................................................. Â&#x2021;*iVQDWXUDO 86EEO ............................................................



; 

111,27 1,67 1,88

79,47 1,76 1,67

40 

13

167,87

158,43

6

102,24 52,96

74,66 41,19

37 29

91,37 17,28

66,42 14,15

38 22

(PD&RPSDQKLDDGRWRXSUiWLFDFRQWiELOSUHYLVWDQR&3& 5 DSURYDGRSHOD'HOLEHUDomR&90 TXHSHUPLWHDXWLOL]DomRGRPpWRGRGHHTXLYDOrQFLDSDWULPRQLDOSDUDDYDOLDomRHGHPRQVWUDomRGHLQYHVWLPHQWRV em entidades controladas em conjunto. Anteriormente, esses investimentos eram consolidados em contas de ativo, passivo, receitas e despesas proporcionalmente à participação acionåria. Apesar da adoção do CPC 19 ter produzido alteraçþes em contas de ativo, passivo, receita e despesa, bem como em indicadores, o efeito foi nulo em termos do lucro líquido e do patrimônio líquido atribuíveis aos acionistas da Petrobras. Assim, para efeito de comparação, as informaçþes de períodos anteriores foram ajustadas retroativamente a 01.01.2010, conforme apresentado na nota explicativa nº 3 integrante das demonstraçþes contåbeis da Petrobras, em anexo. 5 6

0pGLDGDVH[SRUWDo}HVHGRVSUHoRVLQWHUQRVGHWUDQVIHUrQFLDGR( 3SDUDR$EDVWHFLPHQWR 3UHoRLQWHUQRGHWUDQVIHUrQFLDGR( 3SDUDR*iVH(QHUJLD

9ROXPHGH9HQGDV 9ROXPHGHYHQGDV0LOEDUULVGLD ([HUFtFLR 



Diesel.............................................................................................

880

809

Çť 9

Gasolina ........................................................................................

489

394

24

Ă&#x201C;leo combustĂ­vel ...........................................................................

82

100



Nafta ..............................................................................................

167

167

0

GLP ...............................................................................................

224

218

3

QAV ...............................................................................................

101

90

12 4

Outros......................................................................................

188

180

7RWDOGHGHULYDGRV





AlcoĂłis, nitrogenados renovĂĄveis e outros ....................................

86

99







GĂĄs natural ....................................................................................

304

312

7RWDOPHUFDGRLQWHUQR ....................................................................





Exportação ....................................................................................

655

698



5HFHLWDV¿QDQFHLUDV ...................................................... 'HVSHVDV¿QDQFHLUDV .................................................... Variaçþes monetårias e cambiais .................................. Resultado Financeiro Líquido ........................................

540

581



7RWDOPHUFDGRH[WHUQR







7RWDOJHUDO







O volume de vendas no mercado interno foi 6% superior a 2010, destacando-se os seguintes produtos:

9DULDomR ; 2.119 723 



 48 





(PGHSUHFLDomRFDPELDOGHVREUHRHQGLYLGDPHQWR (PDSUHFLDomRFDPELDOGHVREUHRHQGLYLGDPHQWR Â&#x2021;

(IHLWRSRVLWLYRQDSDUWLFLSDomRGRVDFLRQLVWDVQmRFRQWURODGRUHV 5PLOK}HV HPIXQomRGRVHIHLWRV FDPELDLVVREUHRHQGLYLGDPHQWRGDV6RFLHGDGHVGH3URSyVLWR(VSHFtÂżFR 63( 

Â&#x2021;

5HGXomRQDGHVSHVDFRPLPSRVWRGHUHQGDHFRQWULEXLomRVRFLDO 5PLOK}HV GHFRUUHQWHGDGLPLQXLomR do lucro em relação a 2010.

5HVXOWDGRSRUĂ&#x2C6;UHDGH1HJyFLR A Petrobras ĂŠ uma companhia que opera de forma integrada, sendo que a maior parte da produção de petrĂłleo e gĂĄs, oriunda da ĂĄrea de Exploração e Produção, ĂŠ transferida para outras ĂĄreas da companhia. Na apuração dos resultados, por ĂĄrea de negĂłcio, sĂŁo consideradas as transaçþes realizadas com terceiros e as WUDQVIHUrQFLDVHQWUHDViUHDVGHQHJyFLRVHQGRHVWDVYDORUDGDVSRUSUHoRVLQWHUQRVGHWUDQVIHUrQFLDGHÂżQLGRV entre as ĂĄreas e com metodologias de apuração baseadas em parâmetros de mercado. 5HVXOWDGRSRUiUHDGHQHJyFLR5PLOK}HV ([HUFtFLR  Exploração & Produção ........................................................... 40.594 Abastecimento ......................................................................... 

GĂĄs & Energia.......................................................................... 3.109 BiocombustĂ­vel ........................................................................  

Distribuição .............................................................................. 1.175 Internacional ............................................................................ 1.949 Corporativo .............................................................................. 



Eliminaçþes .............................................................................  /XFUR/tTXLGRDWULEXtYHODRVDFLRQLVWDVGD3HWUREUDV ........ Ć&#x201D;

 29.691 3.729 1.285  

1.276 1.277 

 



Çť 37 

142 71 

53 21 127 

([SORUDomRH3URGXomR

2 DXPHQWR GR OXFUR OtTXLGR GHFRUUHX GRV PDLRUHV SUHoRV GH YHQGDWUDQVIHUrQFLD GR SHWUyOHR QDFLRQDO H GR acrĂŠscimo no volume de produção de petrĂłleo e LGN, parcialmente compensados pela elevação dos custos com participaçþes governamentais. O spread entre o preço mĂŠdio do petrĂłleo nacional vendido/transferido e a cotação mĂŠdia do Brent aumentou de US$ 4,81/bbl em 2010 para US$ 9,03/bbl em 2011. Ć&#x201D;



Vendas internacionais..............................................................

([HUFtFLR   6.543 4.424 





1.341 122 2.620

$EDVWHFLPHQWR

2 UHVXOWDGR QHJDWLYR GHFRUUHX GH PDLRUHV FXVWRV FRP DTXLVLomRWUDQVIHUrQFLD GH SHWUyOHR H LPSRUWDomR GH GHULYDGRV %UHQWÂąDXPHQWRGHHP86EEO SDUFLDOPHQWHFRPSHQVDGRVSHORVPDLRUHVSUHoRVGHYHQGDGH derivados nos mercados interno e externo. Ć&#x201D;

*iVH(QHUJLD

O maior lucro lĂ­quido decorreu dos seguintes fatores:

Â&#x2021;

Ă?OHRGLHVHO DXPHQWRGH ÂąUHĂ&#x20AC;H[RGRFUHVFLPHQWRGDHFRQRPLDGRDXPHQWRGDVDIUDGHJUmRVHGDPHQRU colocação do produto por terceiros;

Â&#x2021;

aumento do preço mÊdio de realização do gås natural, devido à maior participação do segmento industrial no mix das vendas;

Â&#x2021;

*DVROLQD DXPHQWRGH ÂąPDLRUFRPSHWLWLYLGDGHGRSUHoRHPUHODomRDRHWDQROQDPDLRUSDUWHGRVHVWDGRV FUHVFLPHQWRGDIURWDGHYHtFXORVĂ&#x20AC;H[Ă&#x20AC;XHOHGLPLQXLomRGDFRORFDomRGRSURGXWRSRURXWURVSOD\HUV

Â&#x2021;

UHGXomRGRVFXVWRVGHDTXLVLomRWUDQVIHUrQFLDGRJiVQDWXUDOQDFLRQDODFRPSDQKDQGRRFRPSRUWDPHQWRGDV UHIHUrQFLDVLQWHUQDFLRQDLVHDDSUHFLDomRFDPELDO

Â&#x2021;

4$9 DXPHQWRGH ÂąFUHVFLPHQWRGDHFRQRPLDHPDLRURIHUWDGHY{RVGRPpVWLFRVHLQWHUQDFLRQDLVH

Â&#x2021;

Â&#x2021;

Ă?OHRFRPEXVWtYHO UHGXomRGH ÂąHPIXQomRGDVXEVWLWXLomRGHSDUWHGRFRQVXPRSRUJiVQDWXUDOWDQWR no segmento tĂŠrmico quanto no segmento industrial.

LQFUHPHQWRGDVUHFHLWDVÂż[DVSURYHQLHQWHVGRVOHLO}HVGHHQHUJLD DPELHQWHGHFRQWUDWDomRUHJXODGD FRPD HQWUDGDGHPDLVGXDV87(Â?V 8VLQDV7HUPHOpWULFDV 

Â&#x2021;

DXPHQWR QDV PDUJHQV GH YHQGD GH IHUWLOL]DQWHV UHĂ&#x20AC;HWLQGR R FUHVFLPHQWR GD GHPDQGD H GRV SUHoRV GDV commodities agrĂ­colas; e

Â&#x2021;

UHFRQKHFLPHQWRGHFUpGLWRVÂżVFDLV

O volume de vendas no mercado externo foi 7% inferior a 2010, devido: Â&#x2021;

Â&#x2021;

([SRUWDo}HV UHGXomRGH ±GHFRUUHGDPDLRUGHVWLQDomRGRyOHRSURGX]LGRDRUH¿QRQDFLRQDOREVHUYDQGR se que, em 2011, houve menor nível de atividade de paradas programadas de destilação, acréscimo de FDSDFLGDGH LQVWDODGD QD 5(3/$1 H LQYHVWLPHQWRV HP FRQ¿DELOLGDGH QR SDUTXH GH UH¿QR EHP FRPR GD necessidade de formação de estoque visando à parada para manutenção de duto de movimentação de óleo do sistema logístico de São Paulo, prevista para 2012; e 9HQGDVLQWHUQDFLRQDLV UHGXomR GHFRUUHXSULQFLSDOPHQWHGRPHQRUYROXPHGHWUDGLQJFRPGHVWDTXH para gasolina destinada ao mercado interno.

Ć&#x201D;

%LRFRPEXVWtYHO

$OXFUDWLYLGDGHGRVHWRUGHHWDQROQmRIRLVX¿FLHQWHSDUDVXSRUWDURVUHVXOWDGRVGRVHWRUGHELRGLHVHOFXMDV margens foram pressionadas por preços de venda desfavoråveis, em função do alto grau de competição, alÊm dos custos de aquisição e transporte de matÊria-prima e despesas operacionais.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

E-10

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA Ć&#x201D;

'LVWULEXLomR

,PSRVWRVH3DUWLFLSDo}HV*RYHUQDPHQWDLV

O resultado obtido com o crescimento de 6% no volume de vendas foi superado pela elevação das despesas comerciais, incluindo provisĂŁo para crĂŠdito de liquidação duvidosa, serviços de terceiros e pessoal. Ć&#x201D;

,PSRVWRVH&RQWULEXLo}HV&RQVROLGDGRV A contribuição econômica da Petrobras, medida por meio da geração de impostos, taxas e contribuiçþes sociais correntes, totalizou R$ 76.777 milhþes.

,QWHUQDFLRQDO

5PLOK}HV ([HUFtFLR

O aumento do resultado decorreu dos maiores preços das commodities no mercado internacional em 2011 (R$ PLOK}HV DOpPGDUHGXomRGRVJDVWRVH[SORUDWyULRVHEDL[DGHSRoRV 5PLOK}HV SDUFLDOPHQWH FRPSHQVDGRVSHODFREUDQoDGR³7D[2LO´QD1LJpULD 5PLOK}HV HPDLRUSURYLVmRSDUDUHGXomRDYDORUGH PHUFDGRGRVHVWRTXHVQR-DSmR(8$H$UJHQWLQD 5PLOK}HV 

'9$ A distribuição do valor adicionado da Petrobras alcançou, em 2011, R$ 181.081 milhþes, representando um aumento de 15% em relação ao ano anterior, quando distribuiu R$ 157.053 milhþes. A distribuição do valor DGLFLRQDGRSRGHVHUREVHUYDGDQRVJUi¿FRVDVHJXLU

&RQWULEXLomR(FRQ{PLFD3DtV ,&06 &,'( 3,6&2),16 ,PSRVWRGH5HQGDH&6VOXFUR 2XWURV 6XEWRWDO3DtV &RQWULEXLomR(FRQ{PLFD([WHULRU 7RWDO 10





36.763 7.488 14.685 9.822 2.369  5.650 

28.235 6.852 14.554 11.341 3.049  4.411 

; 

30 9 1 



11 28 12

Não inclui obrigaçþes com benefícios pós-emprego. Consulte nota explicativa nº 22 nas Demonstraçþes Contåbeis.

3DUWLFLSDo}HV*RYHUQDPHQWDLV 5PLOK}HV ([HUFtFLR

3DtV Royalties ............................................................................................... Participação Especial ........................................................................... Retenção de årea ................................................................................. 6XEWRWDO3DtV...................................................................................... ([WHULRU ................................................................................................ 7RWDO .....................................................................................................





;  

12.533 13.837 137  699 

9.505 10.165 140  504 

32 36 

34 39 34

As participaçþes governamentais no PaĂ­s, em 2011, aumentaram 34%, em relação ao ano anterior, devido DRDFUpVFLPRGHQRSUHoRPpGLRGHUHIHUrQFLDGRSHWUyOHRQDFLRQDOTXHDOFDQoRX5EEO 86 EEO FRQWUD5EEO 86EEO HPUHĂ&#x20AC;HWLQGRDVYDULDo}HVRFRUULGDVQDVFRWDo}HV internacionais de petrĂłleo no perĂ­odo

9%

$WLYRVH3DVVLYRVVXMHLWRVj9DULDomR&DPELDO Praticamente todas as receitas e despesas das atividades brasileiras são denominadas e pagas em Reais. Quando hå a depreciação do Real em relação ao dólar norte-americano, tal como ocorreu no exercício de 2011, com uma desvalorização de 12,6%, o resultado Ê basicamente o aumento de receitas e despesas expressas HPGyODUHVQRUWHDPHULFDQRV7RGDYLDDGHSUHFLDomRGR5HDOHPUHODomRDRGyODUQRUWHDPHULFDQRDIHWDGH diferentes maneiras os itens analisados abaixo.

(QGLYLGDPHQWR 2HQGLYLGDPHQWRUHIHUHQWHDHPSUpVWLPRVHÂżQDQFLDPHQWRVQRSDtVHQRH[WHULRUDWLQJLX5PLOK}HV conforme demonstrado a seguir: 5PLOK}HV 



Çť

(QGLYLGDPHQWRFXUWRSUD]R







(QGLYLGDPHQWRORQJRSUD]R







7RWDO







 'LVSRQLELOLGDGHV







 7tWXORVS~EOLFRVIHGHUDLV YHQFLPHQWRVXSHULRUDGLDV 







'LVSRQLELOLGDGHVDMXVWDGDV







(QGLYLGDPHQWROtTXLGR







(QGLYLGDPHQWROtTXLGR (QGLYLGDPHQWROtTXLGR3DWULP{QLROtTXLGR 







3DVVLYR7RWDOOtTXLGR







(VWUXWXUDGHFDSLWDO FDSLWDOGHWHUFHLURVOtTXLGRSDVVLYRWRWDO 







86PLOK}HV 



Çť

(QGLYLGDPHQWRFXUWRSUD]R







(QGLYLGDPHQWRORQJRSUD]R















7RWDO 

2HQGLYLGDPHQWROtTXLGRGR6LVWHPD3HWUREUDVHP5HDLVDXPHQWRXHPUHODomRDHPGHFRUUrQFLD

$7,92 &LUFXODQWH ............................................................................................................ Disponibilidades ................................................................................................. Outros ativos circulantes .................................................................................... 1mR&LUFXODQWH .................................................................................................... Recursos aplicados no exterior via controladas, no segmento internacional, em equipamentos de E&P para uso no Brasil e nas atividades comerciais .......... Outros RealizĂĄveis a longo prazo ....................................................................... 7RWDOGR$WLYR ...................................................................................................... 3$66,92 &LUFXODQWH ............................................................................................................ Financiamentos.................................................................................................. Fornecedores ..................................................................................................... Outros passivos circulantes ............................................................................... 1mR&LUFXODQWH .................................................................................................... Financiamentos.................................................................................................. Outros exigĂ­veis a longo prazo ........................................................................... 7RWDOGR3DVVLYR ................................................................................................. $WLYR 3DVVLYR /tTXLGRHP5HDLV..........................................................................  (PSUpVWLPRV),1$0(HPUHDLVLQGH[DGRDRGyODU ........................................  (PSUpVWLPRV%1'(6HPUHDLVLQGH[DGRDRGyODU .......................................... $WLYR 3DVVLYR /tTXLGRHP5HDLV ......................................................................

5PLOK}HV     6.284 10.708 1.757 2.044   8.759 17.348 1.726 1.401   5PLOK}HV   



































    







de captaçþes de longo prazo e do impacto da depreciação cambial de 12,6%.

3DWULP{QLR/tTXLGR

2QtYHOGHHQGLYLGDPHQWRPHGLGRDWUDYpVGRtQGLFHGDGtYLGDOtTXLGD(%,7'$DXPHQWRXGHHP

(PGHGH]HPEURGHR3DWULP{QLR/tTXLGRGD3HWUREUDV &RQWURODGRUD DWLQJLXRPRQWDQWHGH5 milhões, correspondendo a R$ 25,33 por ação.

SDUDHPFRPRGHFRUUrQFLDGHFDSWDo}HVGHORQJRSUD]RUHDOL]DGDVDWUDYpVGHRIHUWDGHWtWXORV DOpPGRLPSDFWRGDYDULDomRFDPELDOGRVÂżQDQFLDPHQWRV$HVWUXWXUDGHFDSLWDOHVWiUHSUHVHQWDGDSRUGH

O valor de mercado da Companhia alcançou R$ 291.564 milhþes.

participação de capitais de terceiros.

D $XPHQWRGR&DSLWDO6RFLDO Estå sendo proposta à AssemblÊia Geral Extraordinåria, a incorporação ao capital de parte de reservas de LQFHQWLYRV¿VFDLVUHIHUHQWHDRLQFHQWLYRSDUDVXEYHQomRGHLQYHVWLPHQWRVQRkPELWRGD68'$0H68'(1( no montante de R$ 12 milhþes, em atendimento ao artigo 35 parågrafo 1º, da Portaria nº 2.091/07 do Ministro do Estado da Integração Nacional, sem a emissão de novas açþes.

5HPXQHUDomRDRV$FLRQLVWDV Aos acionistas Ê garantido um dividendo e/ou juros sobre o capital próprio de pelo menos 25% do lucro líquido do exercício ajustado, calculado nos termos do artigo 202 da Lei das Sociedades por Açþes. $VDo}HVSUHIHUHQFLDLVWrPSULRULGDGHQRFDVRGHUHHPEROVRGRFDSLWDOHQRUHFHELPHQWRGRVGLYLGHQGRVQR mínimo, de 3% do valor do patrimônio líquido da ação, ou de 5% calculado sobre a parte do capital representada por essa espÊcie de açþes, prevalecendo sempre o maior.

,QFOXLDUUHQGDPHQWRVPHUFDQWLVÂżQDQFHLURV 5PLOK}HVHPH5PLOK}HVHP  (QGLYLGDPHQWR7RWDOÂą'LVSRQLELOLGDGHV 9 3DVVLYRWRWDOOtTXLGRGHFDL[DDSOLFDo}HVÂżQDQFHLUDV 7 8

2EULJDo}HVFRQWUDWXDLV A tabela a seguir resume nossas obrigações contratuais e os compromissos pendentes em 31.12.2011: 3DJDPHQWRVFRPYHQFLPHQWRSRU3HUtRGR 7RWDO





HPGLDQWH

Obrigaçþes de dívida ..........................................

143.327

6.921

47.730

88.676

&RPWUDQVIHUrQFLDGHEHQHItFLRVULVFRV e controles de bens ...........................................

265

39

74

152

7RWDOGRVLWHQVGREDODQoRSDWULPRQLDO .............

143.592

6.960

47.804

88.828

2EULJDo}HVFRQWUDWXDLV ,WHQVGREDODQoRSDWULPRQLDO

2XWURVFRPSURPLVVRVFRQWUDWXDLVD  ORQJRSUD]R GĂĄs natural ship or pay .......................................

9.054

1.199

3.980

3.875

Serviço de contrato .............................................

161.901

69.111

70.184

22.606

Contratos de fornecimento de gĂĄs natural...........

21.316

3.002

10.838

7.476

6HPWUDQVIHUrQFLDGHEHQHItFLRVULVFRV e controles de bens ...........................................

104.132

24.044

55.156

24.932

Compromissos de compra ..................................

38.975

15.135

14.905

8.935

Compromissos de compra internacionais ...........

29.599

11.443

9.713

8.443

7RWDOGHRXWURVFRPSURPLVVRVDORQJRSUD]R ......

364.977

123.934

164.776

76.267

7RWDO ..............................................................









A proposta do dividendo relativo ao exercício de 2011, que estå sendo encaminhada pela Administração da Petrobras à aprovação dos acionistas na Assembleia Geral Ordinåria de 2012, no montante de R$ 12.001, atende aos direitos garantidos estatutariamente às açþes preferenciais e estå sendo proposto indistintamente às açþes ordinårias e preferenciais. Esse dividendo proposto alcançou 38,25% do lucro båsico porque os direitos dos preferencialistas, de prioridade de 3% da parcela do patrimônio líquido representativa das açþes preferenciais, ¿FRXVXSHULRUDRGLYLGHQGRPtQLPRHTXLYDOHQWHDVREUHROXFUREiVLFR  'DWDGH 'DWDGH DSURYDomR SDJDPHQWR 5PLOK}HV 1ª parcela de JCP ............................................................. 29.04.2011 31.05.2011 2.609 2ª parcela de JCP ............................................................. 22.07.2011 31.08.2011 2.609 3ª parcela de JCP ............................................................. 28.10.2011 30.11.2011 2.609 11 2.609 4ª parcela de JCP ............................................................. 22.12.2011 12 1.565 Dividendos ........................................................................ 09.02.2012  11 Serå disponibilizada atÊ 30 de março de 2012. 12 'DWDDVHU¿[DGDHP$VVHPEOHLD*HUDO2UGLQiULD Os dividendos propostos para o exercício de 2011, no montante de R$ 12.001 milhþes (equivalente a 5SRUDomRRUGLQiULDHSUHIHUHQFLDO LQFOXHPDSDUFHODGHMXURVVREUHRFDSLWDOSUySULRQRPRQWDQWHGH5 PLOK}HV HTXLYDOHQWHD5SRUDomRRUGLQiULDHSUHIHUHQFLDO GRVTXDLVVHUmRGHVFRQWDGRVRVMXURV sobre o capital próprio pagos antecipadamente no montante de R$ 7.827 milhþes, sujeitos à retenção de imposto de renda na fonte de 15%, exceto para acionistas imunes e isentos, e corrigidos pela taxa SELIC desde as datas GRVSDJDPHQWRVDWp$SDUFHOD¿QDOGRVMXURVVREUHRFDSLWDOSUySULRMXQWDPHQWHFRPRVGLYLGHQGRV no valor de R$ 3.878 milhþes, líquido da atualização monetåria das antecipaçþes dos juros sobre o capital próprio, terå seu valor atualizado monetariamente, a partir de 31.12.2011 atÊ a data de início do pagamento, de acordo com a variação da taxa SELIC. No exercício de 2010, no dividendo proposto, indistintamente às açþes ordinårias e preferenciais, equivalente a 35,50% do lucro båsico, prevaleceu o critÊrio de 5% da parcela do capital social representativa das açþes preferenciais, tambÊm em atendimento aos direitos estatutårios dos preferencialistas.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-11

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA

%DODQoR3DWULPRQLDO

([HUFtFLRVÂżQGRVHPGHGH]HPEURGHH (Em milhĂľes de reais) &RQVROLGDGR $WLYR

1RWD



&RQVROLGDGR

&RQWURODGRUD





3DVVLYR



1RWD

&RQWURODGRUD









 &LUFXODQWH

 &LUFXODQWH Caixa e equivalentes de caixa .............

5

35.747

29.416

18.858

19.995

  7tWXORVHYDORUHVPRELOLiULRV.................

6

16.808

26.013

23.625

33.731

Contas a receber, lĂ­quidas ..................

7.1

22.053

18.069

21.068

Estoques ..............................................

8

28.447

19.675

22.434

Fornecedores ..................................................

15

22.252

17.374

22.601

23.747

Financiamentos ...............................................

16

18.884

14.915

12.252

17.439

  $UUHQGDPHQWRVPHUFDQWLQVÂżQDQFHLURV...........

17.1

82

175

1.922

3.149

17.701

Impostos, contribuiçþes e participaçþes ........

20.2

10.969

10.060

9.258

7.837

15.199

Dividendos propostos......................................

23.5

3.878

3.595

3.878

3.595

3.182

2.551

2.720

2.174

SalĂĄrios, fĂŠrias e encargos..............................

Impostos, contribuiçþes e participaçþes ....................................

20.1

Adiantamento a fornecedores .............. Outros ativos circulantes ......................

12.846

8.767

9.372

5.911

Participação nos lucros ou resultados ............

22

1.560

1.691

1.295

1.428

1.389

1.309

1.040

1.048

Planos de pensĂŁo e saĂşde..............................

21

1.427

1.303

1.341

1.209

1.673

Outras contas e despesas a pagar .................

5.978

4.284

1.669

1.863









3.874 

2.653

1.647





  1mR&LUFXODQWH

 1mRFLUFXODQWH

Financiamentos ..............................................

 5HDOL]iYHODORQJRSUD]R Contas a receber, lĂ­quidas ...................

7.1

6.103

5.432

12.843

31.029

  7tWXORVHYDORUHVPRELOLiULRV.................

6

5.747

5.198

5.219

4.749

DepĂłsitos judiciais ..............................

9

2.955

2.790

2.564

2.426

Impostos e contribuição social diferidos ..............................................

17.256

17.038

9.505

11.790

Adiantamento a fornecedores ..............

20.3

5.892

4.964

1.011

964

Outros ativos realizĂĄveis a longo prazo........................................

3.234

2.296

2.322

1.426







136.405

100.667

43.055

36.430

  $UUHQGDPHQWRVPHUFDQWLQVÂżQDQFHLURV...........

17.1

16

183

191

7.422

14.976

Impostos e contribuição social diferidos ........

20.3

33.268

25.898

29.408

21.808

Planos de pensĂŁo e saĂşde..............................

21

16.653

15.278

15.352

14.162

ProvisĂŁo para processos judiciais ...................

28

1.361

1.265

437

425

ProvisĂŁo para desmantelamento de ĂĄreas .....

19

8.839

6.505

8.241

6.072

Outras contas e despesas a pagar .................

2.005

1.266

2.855

3.024









Capital social realizado ...................................

205.380

205.357

205.380

205.357



Contribuição adicional de capital ....................

563 122.623

 3DWULP{QLROtTXLGR

23

 ,QYHVWLPHQWRV.........................................

11.2 e 11.4

12.248

11.592

57.239

50.955

Reservas de lucros .........................................

 ,PRELOL]DGR ............................................

12

342.267

280.095

227.302

189.775

Ajustes de avaliação patrimonial.....................

 ,QWDQJtYHO ................................................

13

82.284

81.539

77.886

78.042

246

241

 'LIHULGR ................................................... 















 3DUWLFLSDomRGRVDFLRQLVWDVQmR  FRQWURODGRUHV .................................................... 

 

101.324

 

859 122.963

101.876

1.273

90

1.273

90









2.385

3.063

















As notas explicativas são parte integrante das demonstraçþes contåbeis.

'HPRQVWUDomRGH5HVXOWDGRV

'HPRQVWUDomRGH5HVXOWDGRV$EUDQJHQWHV

([HUFtFLRV¿QGRVHPGHGH]HPEURGHH (Em milhþes de reais, exceto o lucro por ação)

5HFHLWDGHYHQGDV ............................................. Custo dos produtos e serviços vendidos ............. /XFUREUXWR ........................................................ 5HFHLWDV GHVSHVDV  Vendas ................................................................ Gerais e administrativas ...................................... Custos exploratórios para extração de petróleo e gås .................................................... Custos com pesquisa e desenvolvimento tecnológico......................................................... 7ULEXWiULDV............................................................ Outras receitas e despesas operacionais, líquidas..... /XFURDQWHVGRUHVXOWDGR¿QDQFHLUR  SDUWLFLSDomRHLPSRVWRV.................................. 5HVXOWDGR¿QDQFHLUROtTXLGR ................................ Resultado de participaçþes em investimentos .... Participação nos lucros ou resultados ................. /XFURDQWHVGRVLPSRVWRV ............................... Imposto de renda e contribuição social ............... /XFUROtTXLGR ...................................................... $WULEXtYHODRV Acionistas da Petrobras...................................... Acionistas não controladores .............................

1RWD 24 25

&RQVROLGDGR       

 

25 25

26

27 22 20.5

([HUFtFLRVÂżQGRVHPGHGH]HPEURGHH (Em milhĂľes de reais)

&RQWURODGRUD     



 

&RQVROLGDGR

/XFUROtTXLGR ................................................................... 2XWURVUHVXOWDGRVDEUDQJHQWHV

&RQWURODGRUD

















1.123

 





 

 

 

 

 

 

 

 

Ajustes acumulados de conversĂŁo ...................................

1.423

Custo atribuĂ­do de coligada ..............................................

10

11

10

11

 

 

 

 

Resultados nĂŁo realizados em tĂ­tulos disponĂ­veis para a venda

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Reconhecido no patrimĂ´nio lĂ­quido ..................................

136

309

136

309

7UDQVIHULGRSDUDRUHVXOWDGR............................................

26

45.403 122 386  

  



46.394 2.620 585  

  



31.474 5.581 5.808  

  



36.554 1.634 7.039  

  



33.313 35.189 33.101  

692    /XFUREiVLFRHGLOXtGRSRUDomR HP5  23.6    As notas explicativas são parte integrante das demonstrações contábeis.

 

 

26

13

 

 

Resultados nĂŁo realizados no hedge GHĂ&#x20AC;X[RGHFDL[D Reconhecido no patrimĂ´nio lĂ­quido ................................  7UDQVIHULGRSDUDRUHVXOWDGR..........................................

 

 

8

8

13  

 

 

 

 



 













Acionistas da Petrobras ....................................................

34.516

35.368

34.304

35.215

Acionistas nĂŁo controladores ............................................

97

491

5HVXOWDGRDEUDQJHQWHWRWDO............................................    As notas explicativas são parte integrante das demonstraçþes contåbeis.



Imposto de renda e contribuição social diferidos ...............

5HVXOWDGRDEUDQJHQWHWRWDO............................................ $WULEXtYHODRV

35.036  

'HPRQVWUDomRGDV0XWDo}HVGR3DWULP{QLR/tTXLGR ([HUFtFLRVÂżQGRVHPGHGH]HPEURGHH

(Em milhĂľes de reais) &RQWULEXLomR DGLFLRQDOGHFDSLWDO

&DSLWDO VXEVFULWR *DVWRVFRP HLQWHJUDOL HPLVVmRGH Do}HV ]DGR 6DOGRVHPÂ&#x17E;GHMDQHLURGH ..........................



Aumento de capital com reservas ..........................

6.141

Aumento de capital com emissão de açþes ...........

120.249

0XGDQoD GHSDUWLFL SDomRHP FRQWUR ODGDV 

5HVHU YDVGH FDSLWDO

$MXVWHDYDOLDomR SDWULPRQLDO

$MXVWHDFX ,QFHQ PX WLYRV ODGRGH ÂżVFDLV FRQYHUVmR 



2XWURV UHVXO WDGRV DEUDQ JHQWHV 

5HVHUYDVGHOXFURV

(VWDWX /HJDO WiULD 



 

,QFHQ WLYRV 5HWHQomR ÂżVFDLV GHOXFURV  



7RWDOGR SDWULP{QLR 3DUWLFLSD OtTXLGR omRGRV 7RWDOGR DWULEXtYHODRV DFLRQLVWDV SDWULP{QLR /XFURV DFLRQLVWDVGD QmRFRQ OtTXLGR DFXPX FRQWURODGRUD $WLYR WURODGRUHV FRQVROLGD ODGRV &3& GLIHULGR ,)56  GR ,)56









119.772 

Mudança de participação em controladas..............







119.772



Lucro lĂ­quido do exercĂ­cio .......................................

35.036

35.036

291 152

692



35.880

Outros resultados abrangentes: 

Ajuste acumulado de conversĂŁo..........................



Resultados nĂŁo realizados em tĂ­tulos disponĂ­veis para a venda e hedgeGHĂ&#x20AC;X[RGHFDL[D......

201

Realização de custo atribuído de coligada ..........





201



201

11

Destinaçþes: Apropriaçþes do lucro líquido em reservas..........

1.752

1.027

250

19.043





Dividendos ........................................................... 6DOGRVHPGHGH]HPEURGH....................



Aumento de capital com reservas ..........................

23



















132 









865





22

212



33.110

300

1.423



Mudança de participação em controladas..............

865

Lucro lĂ­quido do exercĂ­cio .......................................

33.101

33.101

Outros resultados abrangentes: Ajuste acumulado de conversĂŁo..........................

1.123

1.123

Resultados nĂŁo realizados em tĂ­tulos disponĂ­veis para a venda e hedgeGHĂ&#x20AC;X[RGHFDL[D......

70

Realização de custo atribuído de coligada ..........



70

70

10

Destinaçþes: Apropriaçþes do lucro líquido em reservas..........

1.655

1.027

81

18.347



Dividendos ........................................................... 205.380 6DOGRVHPGHGH]HPEURGH....................









1.336

927

346

14.309

2.449

1.405

   As notas explicativas são parte integrante das demonstrações contábeis.

104.800 







330.475



2.385

332.224










cyan magenta amarelo preto

E-12

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA

'HPRQVWUDomRGR9DORU$GLFLRQDGR

'HPRQVWUDomRGRV)OX[RVGH&DL[D

([HUFtFLRVÂżQGRVHPGHGH]HPEURGHH (Em milhĂľes de reais)

([HUFtFLRVÂżQGRVHPGHGH]HPEURGHH (Em milhĂľes de reais) &RQVROLGDGR  

&RQWURODGRUD  

)OX[RVGHFDL[DGDVDWLYLGDGHVRSHUDFLRQDLV Lucro lĂ­quido atribuĂ­vel aos acionistas da Petrobras ................ 33.313 35.189 33.101 $MXVWHVSDUD Resultado dos acionistas nĂŁo controladores .......................... 

692 Resultado de participaçþes em investimentos ........................ 





Depreciação, depleção e amortização .................................... 17.739 14.612 12.902 Perda na recuperação de ativos ............................................. 1.824 690 744 Baixa de poços secos ............................................................. 2.504 2.121 2.243 Valor residual de bens baixados de natureza permanente ...... 885 312 195 9DULDo}HVFDPELDLVPRQHWiULDVHHQFDUJRV¿QDQFHLURV  VREUH¿QDQFLDPHQWRVHRSHUDo}HVGHP~WXRHRXWUDV operaçþes .......................................................................... 6.238 14 

Imposto de renda e contribuição social diferidos, líquidos .......... 6.157 5.784 7.208 5HGXomR DXPHQWR GHDWLYRV Contas a receber ..................................................................... 





Estoques ................................................................................. 





Outros ativos ........................................................................... 

3 

$XPHQWR UHGXomR GHSDVVLYRV Fornecedores .......................................................................... 4.112 542 

Impostos, taxas e contribuiçþes .............................................. 





Planos de pensĂŁo e de saĂşde................................................. 1.483 1.381 1.321 Outros passivos ...................................................................... 2.451 1.121 

5HFXUVRVOtTXLGRVJHUDGRVSHODVDWLYLGDGHVRSHUDFLRQDLV ......    $WLYLGDGHVGHLQYHVWLPHQWRV CessĂŁo onerosa - Direitos Adquiridos ..................................... 

/LTXLGDomRIHLWDSRU/)7V ........................................................ 67.816 Liquidação feita por caixa e equivalentes a caixa ................... 

Demais investimentos em exploração e produção ................ 





Investimentos em exploração e produção ............................. 





Investimentos em abastecimento ............................................ 





Investimentos em gĂĄs e energia ............................................. 





Investimento no segmento internacional................................. 





Investimentos em distribuição ................................................. 



Investimentos em biocombustĂ­vel ........................................... 





Outros investimentos .............................................................. 





Investimentos em tĂ­tulos e valores mobiliĂĄrios ........................ 11.606 

13.030 Dividendos recebidos .............................................................. 680 401 2.434 )OX[RGHFDL[DXVDGRQDVDWLYLGDGHVGHLQYHVWLPHQWRV ......  



)OX[RGHFDL[DGHDWLYLGDGHVGHÂżQDQFLDPHQWR Aumento de capital ................................................................. 120.249 $SRUWHHP/)7V ...................................................................... 

Aporte em caixa e equivalentes a caixa.................................. 52.433 Gastos com emissão de ações ...............................................  

Aquisição de participação de acionistas não controladores........ 46  

Financiamentos e operações de mútuo, líquidos Captações .............................................................................. 40.433 36.966 55.928 Amortizações de principal ......................................................      

Amortizações de juros ...........................................................  

 

 

CessĂľes de direitos creditĂłrios - FIDC-NP ............................  

Dividendos pagos a acionistas................................................ 

 



5HFXUVRVOtTXLGRVJHUDGRV XWLOL]DGRV QDVDWLYLGDGHV  GHÂżQDQFLDPHQWRV ................................................................    

(IHLWRGHYDULDomRFDPELDOVREUHFDL[DHHTXLYDOHQWHV  GHFDL[D..................................................................................   

9DULDomROtTXLGDGHFDL[DHHTXLYDOHQWHVGHFDL[DQR  H[HUFtFLR ................................................................................    

&DL[DHHTXLYDOHQWHVGHFDL[DQRLQtFLRGRH[HUFtFLR .........    &DL[DHHTXLYDOHQWHVGHFDL[DQRÂżPGRH[HUFtFLR .............    ,QIRUPDo}HVDGLFLRQDLVDRVĂ&#x20AC;X[RVGHFDL[D 9DORUHVSDJRVHUHFHELGRVGXUDQWHRH[HUFtFLR Juros recebidos sobre operaçþes de mĂştuos.......................... 764 Imposto de renda e contribuição social ................................... 3.438 4.680  

Imposto de renda retido na fonte de terceiros ......................... 3.963 2.909  

    

7UDQVDo}HVGHLQYHVWLPHQWRVH¿QDQFLDPHQWRVTXH  QmRHQYROYHPFDL[D Aquisição de imobilizado a prazo ............................................ 17 53 &RQWUDWRFRPWUDQVIHUrQFLDGHEHQHItFLRVULVFRVH controles de bens.................................................................. 35 342 Aumento de capital com títulos governamentais, utilizados para aquisição de direitos de exploração   FHVVmRRQHURVD ................................................................ 67.816 Constituição de provisão para desmantelamento de åreas ...... 2.303 1.698 2.382 As notas explicativas são parte integrante das demonstraçþes contåbeis.

35.036 

10.813 

1.495 40 

5.149 









1.292 954  

67.816 

















1.916 

&RQVROLGDGR   5HFHLWDV Vendas de produtos e serviços e outras receitas ........................................ Perdas em crÊditos de liquidação duvidosa .................................. Receitas relativas à construção de ativos para uso .....................................

67.816 1.600



64

50.440 258.001































9DORUDGLFLRQDGREUXWR ................................ 190.971 5HWHQo}HV Depreciação, depleção e amortização................................................ 

9DORUDGLFLRQDGROtTXLGR  SURGX]LGRSHOD&RPSDQKLD...................... 173.232 9DORUDGLFLRQDGRUHFHELGRHP  WUDQVIHUrQFLD Resultado de participaçþes em investimentos ............................................. 386 5HFHLWDV¿QDQFHLUDVLQFOXL variaçþes monetåria e cambial ................. 6.543 920 AluguÊis, royalties e outros .......................... 7.849 9DORUDGLFLRQDGRDGLVWULEXLU....................... 







165.677







155.734



33 

135.561







151.065

142.832

124.748

585

5.808

7.039

4.424 979 5.988 

8.570 728 15.106 

4.547 783 12.369 

,QVXPRVDGTXLULGRVGH  WHUFHLURV Materiais consumidos Custo das mercadorias para revenda ...................................................... Energia, serviços de terceiros e outros....................................................... &UpGLWRV¿VFDLVVREUHLQVXPRV adquiridos de terceiros .............................. Perda na recuperação de ativos..................

%HQHItFLRV Vantagens .............................................. Plano de aposentadoria e pensĂŁo ......... Plano de saĂşde ...................................... )*76 .......................................................

8.188



22

207.721

49.939 295.796

75.560 

 

1.615  

710 2.520 2.804 

245.793

67.591 337.697

120.249 

52.433  

  

270.313

66.853 379.716

'LVWULEXLomRGRYDORUDGLFLRQDGR 3HVVRDOHDGPLQLVWUDGRUHV 5HPXQHUDomRGLUHWD Salårios .................................................. Participaçþes nos lucros ou resultados.....



312.841

&RQWURODGRUD  

7ULEXWRV Federais* ................................................ Estaduais ............................................... Municipais .............................................. No exterior* ............................................

13.513 1.560 15.073 823 1.526 2.181 861 20.464

9DORUDGLFLRQDGRGLVWULEXtGR............. * Inclui participaçþes governamentais.

1% 1% 10% 34% 20%

11.782 1.691 13.473

8% 1%

10.213 1.295 11.508

6% 1%

831 1.373 1.828 745 18.250

1% 1% 1% 1% 13%

528 1.395 1.976 746 16.153

35% 18%

57.033 22.367 79

36% 10%

49.571 15.281 86

36% 10%

3% 56%

79.479

46%

64.938

46%

1% 2% 10%

8.765 1.428 10.193 579 1.264 1.660 648 14.344

6% 1%

1% 2% 10%

61.098 36.358 186 6.340 103.982

4% 58%

55.512 28.148 180 4.915 88.755

13.781 9.744 23.525

8% 5% 13%

6.580 7.587 14.167

4% 5% 9%

8.813 20.392 29.205

5% 11% 17%

7.162 15.637 22.799

5% 11% 17%

10.436 1.565

6% 1%

10.163 1.565

6% 1%

10.436 1.565

7% 1%

10.163 1.565

7% 1%

,QVWLWXLo}HV¿QDQFHLUDVHIRUQHFHGRUHV Juros, variaçþes cambiais e monetårias ..... Despesas de aluguÊis e afretamento..... $FLRQLVWDV Juros sobre capital próprio ..................... Dividendos ............................................. Resultado dos acionistas não controladores ........................................ Lucros retidos .........................................

7% 1%



692 21.312 12% 23.461 15% 21.100 17% 23.308 17% 33.110 19% 35.881 22% 33.101 26% 35.036 26%  100%  100%  100%  100%

As notas explicativas são parte integrante das demonstraçþes contåbeis.

'HPRQVWUDomRGD6HJPHQWDomRGH1HJyFLRV FRQVROLGDGR  ([HUFtFLRVÂżQGRVHPGHGH]HPEURGHH (Em milhĂľes de reais)



5HFHLWDGHYHQGDV ............................................................................................ Intersegmentos ............................................................................................... 7HUFHLURV......................................................................................................... Custo dos produtos vendidos ............................................................................. /XFUREUXWR ....................................................................................................... 5HFHLWDV GHVSHVDV ......................................................................................... Vendas, gerais e administrativas ..................................................................... Custos exploratórios p/ extração de petróleo ................................................... Pesquisa e desenvolvimento ............................................................................ 7ULEXWiULDV......................................................................................................... Outras ............................................................................................................... /XFURDQWHVGRUHVXOWDGR¿QDQFHLURGDVSDUWLFLSDo}HVHLPSRVWRV .......... 5HVXOWDGR¿QDQFHLUROtTXLGR Resultado de participaçþes em investimentos ................................................. Participação nos lucros ou resultados .............................................................. /XFURDQWHVGRVLPSRVWRV ............................................................................... Imposto de renda/contribuição social ............................................................... /XFUROtTXLGR ..................................................................................................... $WULEXtYHODRV Acionistas da Petrobras...................................................................................... Acionistas não controladores .............................................................................

( 3  123.165 863 

 













$EDVWHFLPHQWR  63.833 134.683 







*iV (QHUJLD  2.182 14.113 

 



































,QWHUQDFLRQDO  6.320 22.054 

 













74 

 









5.051 

398 

 



26 



94 

9 

 



40 

 











122 4 



6.920 

40.594 









3.109 29 



1.175 











1.949 18 

&RUSRUDWLYR

(OLPLQDomR

7RWDO

 

 

  211.842  

  

 

 

 

 

 

%LRFRPEXVWtYHO  482 53 







'LVWULEXLomR  1.223 72.410 

 



&RUSRUDWLYR 





(OLPLQDomR 



193.624 

 300





1.116 



7RWDO  244.176 

 











 122 386 

 

 33.313 



 ( 3

$EDVWHFLPHQWR

*iV (QHUJLD

%LRFRPEXVWtYHO

'LVWULEXLomR

,QWHUQDFLRQDO

5HFHLWDGHYHQGDV ............................................................................................ Intersegmentos ................................................................................................  7HUFHLURV .......................................................................................................... Custo dos produtos vendidos ............................................................................. /XFUREUXWR ....................................................................................................... 5HFHLWDV GHVSHVDV ......................................................................................... Vendas, gerais e administrativas....................................................................... Custos exploratórios p/ extração de petróleo .................................................... Pesquisa e desenvolvimento ............................................................................. 7ULEXWiULDV.......................................................................................................... Outras ................................................................................................................

 95.026 425  

  

 

 

 

 

 

 57.228 115.016  

  

 

 1.761 13.175  

  

 

 418 60  

 

 

 

 1.263 64.305  

  

 

 

 

 

 

 

 

 

 

 

 

 

 4.916 18.861  

  

 

 

 

 

 

/XFURDQWHVGRUHVXOWDGR¿QDQFHLURGDVSDUWLFLSDo}HVHLPSRVWRV .......... 5HVXOWDGR¿QDQFHLUROtTXLGR .............................................................................. Resultado de participaçþes em investimentos ..................................................







 





322

305

 

7

Participação nos lucros ou resultados ............................................................... /XFURDQWHVGRVLPSRVWRV ............................................................................... Imposto de renda/contribuição social ................................................................

 

  

 

  

 

  

/XFUROtTXLGR ..................................................................................................... $WULEXtYHODRV Acionistas da Petrobras...................................................................................... Acionistas nĂŁo controladores .............................................................................





29.691  





  

 

 

 

 

158.874  

 247

47

 

 

2.620  

 

 2.620 585

 

43

 

  

 

  

 

 

6.043

 

490

 

  



 





 

 



3.729 67

1.285  

 

1.276

1.277 121

 

675

 

35.189 692





 





 

 




cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-13

Minas e Energia

Petróleo Brasileiro S.A. CNPJ Nº 33.000.167/0001-01 - COMPANHIA ABERTA

'HPRQVWUDomRGD6HJPHQWDomRGH1HJyFLRV FRQVROLGDGR  ([HUFtFLRV¿QGRVHPGHGH]HPEURGHH (Em milhões de reais)

*iV $WLYR ( 3 $EDVWHFLPHQWR (QHUJLD %LRFRPEXVWtYHO 'LVWULEXLomR ,QWHUQDFLRQDO &RUSRUDWLYR (OLPLQDomR 7RWDO &LUFXODQWH .........................................................................................................         

 1mRFLUFXODQWH ..................................................................................................         

 Realizável a longo prazo ................................................................................... 7.766 7.910 3.050 32 1.243 5.465 16.351  

 Investimento ...................................................................................................... 23 6.306 2.160 1.612 84 1.873 190  Imobilizado ........................................................................................................ 169.833 102.473 41.208 536 4.709 17.842 5.666  Intangível ........................................................................................................... 76.542 293 732 799 2.987 931   .........................................................................................................         

 &LUFXODQWH .........................................................................................................         

 1mRFLUFXODQWH ..................................................................................................         

 Realizável a longo prazo ................................................................................... 6.268 6.006 2.679 13 960 3.919 18.143  

 Investimento ...................................................................................................... 6.482 2.012 1.116 73 1.736 173  Imobilizado ........................................................................................................ 138.519 76.016 40.014 546 4.005 14.523 6.472  Intangível ........................................................................................................... 76.681 267 377 1 683 2.564 966  .........................................................................................................         

 $SDUWLUGHRVQHJyFLRVFRPELRFRPEXVWtYHLVHVWmRDSUHVHQWDGRVHPiUHDSUySULD$QWHULRUPHQWHHVWDVLQIRUPDo}HVHVWDYDPLQVHULGDVQRJUXSRGHyUJmRVFRUSRUDWLYRV5HFODVVL¿FDPRVDVLQIRUPDo}HVGRH[HUFtFLRDQWHULRU SDUD¿QVGHFRPSDUDomR As notas explicativas são parte integrante das demonstrações contábeis.

'HPRQVWUDomRGD6HJPHQWDomRGH1HJyFLRV FRQVROLGDGR ,QWHUQDFLRQDO ([HUFtFLRV¿QGRVHPGHGH]HPEURGHH (Em milhões de reais)

*iV (QHUJLD

 'LVWULEXLomR

 3.585 10.656  

 

 39 870  

 45 8.275  

( 3 $EDVWHFLPHQWR

*iV (QHUJLD

 'LVWULEXLomR

   5.259 3.767 78 1.315 9.421 886       ( 3 $EDVWHFLPHQWR *iV (QHUJLD

 58 7.196   'LVWULEXLomR

 

 

( 3 $EDVWHFLPHQWR

'HPRQVWUDomRGRUHVXOWDGR 5HFHLWDGHYHQGDV ............................................................................................................................................. Intersegmentos .................................................................................................................................................. 7HUFHLURV............................................................................................................................................................ /XFUR SUHMXt]R DQWHVGRUHVXOWDGR¿QDQFHLURGDVSDUWLFLSDo}HVHLPSRVWRV .......................................... /XFUROtTXLGRDWULEXtYHODRVDFLRQLVWDVGD3HWUREUDV .................................................................................... 'HPRQVWUDomRGRUHVXOWDGR 5HFHLWDGHYHQGDV ............................................................................................................................................. Intersegmentos .................................................................................................................................................. 7HUFHLURV............................................................................................................................................................ /XFUR SUHMXt]R DQWHVGRUHVXOWDGR¿QDQFHLURGDVSDUWLFLSDo}HVHLPSRVWRV .......................................... /XFUROtTXLGRDWULEXtYHODRVDFLRQLVWDVGD3HWUREUDV ....................................................................................

 6.373 2.242  

$WLYRWRWDO   (P .................................................................................................................................................... (P ....................................................................................................................................................   As notas explicativas são parte integrante das demonstrações contábeis.

&RUSRUDWLYR

(OLPLQDomR

7RWDO

 

 

 

 

11  

 

 6.320 22.054  

&RUSRUDWLYR

(OLPLQDomR

7RWDO

 

 

&RUSRUDWLYR

 

 

43  

 

(OLPLQDomR

 4.916 18.861   7RWDO

 

 

 

 





%DODQoRVRFLDO

([HUFtFLRV¿QGRVHPGHGH]HPEURGHH (Em milhões de reais, exceto quando indicado em contrário) %DVHGH&iOFXOR 5HFHLWDGHYHQGDV&RQVROLGDGD 5/

/XFURDQWHVGDVSDUWLFLSDo}HVHLPSRVWRV&RQVROLGDGR 52

Folha de pagamento bruta consolidada ,QGLFDGRUHV6RFLDLV,QWHUQRV L

Alimentação Encargos sociais compulsórios 3UHYLGrQFLDSULYDGD Saúde Segurança e saúde no trabalho Educação Cultura &DSDFLWDomRHGHVHQYROYLPHQWRSUR¿VVLRQDO Creches ou auxílio-creche Participação nos lucros ou resultados Outros 7RWDO,QGLFDGRUHVVRFLDLVLQWHUQRV

 244.176 45.911 13.026 9DORU PLO

VREUH)3% 845 6,49% 6.477 49,72% 328 2,52% 2.427 18,63% 180 1,38% 133 1,02% 11 0,09% 418 3,21% 90 0,69% 1.560 11,98% 76 0,58%  

VREUH5/ 0,35% 2,65% 0,13% 0,99% 0,07% 0,05% 0,00% 0,17% 0,04% 0,64% 0,03% 

,QGLFDGRUHV6RFLDLV([WHUQRV L

*HUDomRGH5HQGDH2SRUWXQLGDGHGH7UDEDOKR (GXFDomRSDUDD4XDOL¿FDomR3UR¿VVLRQDO Garantia dos Direitos da Criança e do Adolescente ,

Cultura Esporte Outros 7RWDOGDVFRQWULEXLo}HVSDUDDVRFLHGDGH 7ULEXWRV H[FOXtGRVHQFDUJRVVRFLDLV

7RWDO,QGLFDGRUHVVRFLDLVH[WHUQRV

9DORU PLO

48 57 70 182 80 33  97.826 

VREUH52 0,10% 0,12% 0,15% 0,40% 0,17% 0,07%  213,08% 

,QGLFDGRUHV$PELHQWDLV L

Investimentos relacionados com a produção/operação da empresa Investimentos em programas e/ou projetos externos 7RWDOGRVLQYHVWLPHQWRVHPPHLRDPELHQWH

9DORU PLO

2.550 172 2.722

VREUH52 5,55% 0,37% 5,93%

Quanto ao estabelecimento de “metas anuais” para minimizar resíduos, o consumo em geral na SURGXomRRSHUDomRHDXPHQWDUDH¿FiFLDQDXWLOL]DomRGHUHFXUVRVQDWXUDLVDHPSUHVD

9DORU PLO

741 5.475 350 2.064 114 118 10 366 6 1.691 71 

 211.842 49.599 11.462 VREUH)3% 6,46% 47,77% 3,05% 18,01% 0,99% 1,03% 0,09% 3,19% 0,05% 14,75% 0,62% %

VREUH5/ 0,35% 2,58% 0,17% 0,97% 0,05% 0,06% 0,00% 0,17% 0,00% 0,80% 0,03% 

VREUH5/ 0,02% 0,02% 0,03% 0,07% 0,03% 0,00%  40,06% 

9DORU PLO

44 56 79 170 81 20  82.971 

VREUH52 0,09% 0,11% 0,16% 0,34% 0,16% 0,04%  167,28% 

VREUH5/ 0,02% 0,03% 0,04% 0,08% 0,04% 0,01%  39,17% 

VREUH5/ 1,04% 0,07% 1,11%

9DORU PLO

2.165 258 2.423

VREUH52 4,37% 0,52% 4,89%

VREUH5/ 1,02% 0,12% 1,13%

 QmRSRVVXLPHWDV

 FXPSUHGHD

 QmRSRVVXLPHWDV

 QmRSRVVXLPHWDV

 FXPSUHGHD

; FXPSUHGHD

 FXPSUHGHD

; FXPSUHGHD

,QGLFDGRUHVGR&RUSR)XQFLRQDO L

1žGHHPSUHJDGRV DV DR¿QDOGRSHUtRGR Nº de admissões durante o período 1žGHHPSUHJDGRV DV GHHPSUHVDVSUHVWDGRUDVGHVHUYLoRV 1žGHHVWDJLiULRV DV  1žGHHPSUHJDGRV DV DFLPDGHDQRV Nº de mulheres que trabalham na empresa GHFDUJRVGHFKH¿DRFXSDGRVSRUPXOKHUHV 1žGHQHJURV DV TXHWUDEDOKDPQDHPSUHVD ,,,

GHFDUJRVGHFKH¿DRFXSDGRVSRUQHJURV DV  ,9

1žGHSRUWDGRUHV DV GHGH¿FLrQFLDRXQHFHVVLGDGHVHVSHFLDLV 9

 81.918 3.447 328.133 1.825 35.927 13.860 14,4% 18.468 24,9% 1.104

 80.492 4.353 291.606 1.402 34.504 13.408 13,3% 16.447 25,3% 1.093

,QIRUPDo}HVUHOHYDQWHVTXDQWRDRH[HUFtFLRGDFLGDGDQLDHPSUHVDULDO L



0HWDV

Relação entre a maior e a menor remuneração na empresa

20,22

20,22

653

487

Número total de acidentes de trabalho 2VSURMHWRVVRFLDLVHDPELHQWDLVGHVHQYROYLGRVSHODHPSUHVDIRUDPGH¿QLGRVSRU

 GLUHomR

2VSDGU}HVGHVHJXUDQoDHVDOXEULGDGHQRDPELHQWHGHWUDEDOKRIRUDPGH¿QLGRVSRU

; GLUHomRH JHUrQFLDV

4XDQWRjOLEHUGDGHVLQGLFDODRGLUHLWRGHQHJRFLDomRFROHWLYDHjUHSUHVHQWDomRLQWHUQDGRV DV  WUDEDOKDGRUHV DV DHPSUHVD $SUHYLGrQFLDSULYDGDFRQWHPSOD

 QmRVHHQYROYH  GLUHomR

A participação dos lucros ou resultados contempla:

 GLUHomR

Na seleção dos fornecedores, os mesmos padrões éticos e de responsabilidade social e ambiental adotados pela empresa: 4XDQWRjSDUWLFLSDomRGHHPSUHJDGRV DV HPSURJUDPDVGHWUDEDOKRYROXQWiULRDHPSUHVD

 QmRVmR considerados

1~PHURWRWDOGHUHFODPDo}HVHFUtWLFDVGHFRQVXPLGRUHV DV  9, 

na empresa 11.230 na empresa 93,8%

% de reclamações e críticas atendidas ou solucionadas: 9,  9DORUDGLFLRQDGRWRWDODGLVWULEXLU FRQVROLGDGR YDORU 'LVWULEXLomRGR9DORU$GLFLRQDGR '9$ 

 QmRVHHQYROYH

; GLUHomRH JHUrQFLDV  WRGRV DV  HPSUHJDGRV DV

 VHJXHDVQRUPDV GD2,7  GLUHomRH JHUrQFLDV  GLUHomRH JHUrQFLDV  VmRVXJHULGRV

 WRGRV DV  HPSUHJDGRV DV

 DSyLD

; RUJDQL]DH incentiva na Justiça 17 na Justiça 29,4%

no Procon 5 no Procon 80%

 WRGRV DV &LSD ; LQFHQWLYDHVHJXH D2,7 ; WRGRV DV  HPSUHJDGRV DV

; WRGRV DV  HPSUHJDGRV DV

; VmRH[LJLGRV

(P JRYHUQRFRODERUDGRUHV DV  7% acionistas 13% terceiros 12% retido

 GLUHomR ; GLUHomRH JHUrQFLDV  QmRVH envolverá  GLUHomR  GLUHomR  QmRVHUmR considerados  QmRVH envolverá na empresa 5.138 na empresa 99,1%

; GLUHomRH JHUrQFLDV  WRGRV DV  HPSUHJDGRV DV

 VHJXLUiDV QRUPDVGD2,7  GLUHomRH JHUrQFLDV  GLUHomRH JHUrQFLDV  VHUmRVXJHULGRV

 WRGRV DV  HPSUHJDGRV DV

 DSRLDUi

; RUJDQL]DUi e incentivará na Justiça 8 na Justiça 87,5%

no Procon 4 no Procon 100%

 WRGRV DV &LSD ; LQFHQWLYDUiH VHJXLUiD2,7 ; WRGRV DV  HPSUHJDGRV DV

; WRGRV DV  HPSUHJDGRV DV

; VHUmRH[LJLGRV

(P JRYHUQRFRODERUDGRUHV DV

7% acionistas 9% terceiros 15% retido

2XWUDV,QIRUPDo}HV 



, ,, ,,, ,9 9 9,

A Companhia não utiliza mão-de-obra infantil ou trabalho escravo, não tem envolvimento com prostituição ou exploração sexual de criança ou adolescente e não está envolvida com corrupção. A Companhia valoriza e respeita a diversidade interna e externamente.

,QFOXL5GHUHSDVVHDR)XQGRSDUDD,QIkQFLDHD$GROHVFrQFLD ),$  Informações do Sistema Petrobras no Brasil relativas às admissões por processo seletivo público. ,QIRUPDo}HVGHUHODWLYDVDRVHPSUHJDGRVGD3HWUREUDV&RQWURODGRUD3HWUREUDV'LVWULEXLGRUD7UDQVSHWUR/LTXLJiVH5HIDSTXHVHDXWRGHFODUDPQHJURV FRUSDUGDHSUHWD  'RWRWDOGRVFDUJRVGHFKH¿DGD3HWUREUDV&RQWURODGRUDRFXSDGRVSRUHPSUHJDGRVTXHLQIRUPDUDPFRUUDoDVmRH[HUFLGRVSRUSHVVRDVTXHVHDXWRGHFODUDUDPQHJUDV FRUSDUGDHSUHWD  ,QIRUPDo}HVUHODWLYDVj3HWUREUDV&RQWURODGRUD3HWUREUDV'LVWULEXLGRUDH7UDQVSHWURTXHFRUUHVSRQGHPDGRHIHWLYRQRVFDUJRVHPTXHpSUHYLVWDDUHVHUYDGHYDJDVSDUDSHVVRDVFRPGH¿FLrQFLD $VLQIRUPDo}HVQDHPSUHVDLQFOXHPRTXDQWLWDWLYRGHUHFODPDo}HVHFUtWLFDVUHFHELGDVSHOD3HWUREUDV&RQWURODGRUDHGD3HWUREUDV'LVWULEXLGRUD$VPHWDVSDUDQmRFRQWrPDVHVWLPDWLYDVGR6$&HGD3HWUREUDV Distribuidora. L ,QIRUPDomRQmRDXGLWDGD


cyan magenta amarelo preto

E-14

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA

1RWDVH[SOLFDWLYDVjVGHPRQVWUDo}HVFRQWiEHLV &RQVROLGDGDVHGD&RQWURODGRUD  (Em milhĂľes de reais, exceto quando indicado em contrĂĄrio)



$&RPSDQKLDHVXDVRSHUDo}HV

As variaçþes cambiais sobre os investimentos em controladas e coligadas, com moeda funcional distinta da Controladora, são registradas no patrimônio líquido, como ajuste acumulado de conversão, sendo transferidas para o resultado quando da realização dos investimentos.

A Petróleo Brasileiro S.A. - Petrobras dedica-se, diretamente ou por meio de suas subsidiårias e controODGDV GHQRPLQDGDVHPFRQMXQWR³3HWUREUDV´RXD³&RPSDQKLD´ jSHVTXLVDODYUDUH¿QDomRSURFHVsamento, comÊrcio e transporte de petróleo proveniente de poço, de xisto ou de outras rochas, de seus

 8VRGHHVWLPDWLYDV

GHULYDGRVGHJiVQDWXUDOHGHRXWURVKLGURFDUERQHWRVĂ&#x20AC;XLGRVDOpPGDVDWLYLGDGHVYLQFXODGDVjHQHUJLD podendo promover pesquisa, desenvolvimento, produção, transporte, distribuição e comercialização de

Na elaboração das demonstraçþes contåbeis Ê necessårio utilizar estimativas para certos ativos, pas-

WRGDVDVIRUPDVGHHQHUJLDEHPFRPRTXDLVTXHURXWUDVDWLYLGDGHVFRUUHODWDVRXDÂżQV$VHGHVRFLDOGD

sivos e outras transaçþes. Essas estimativas incluem: reservas de petróleo e gås, passivos de planos

Companhia estĂĄ localizada no Rio de Janeiro - RJ.

de pensão e de saúde, depreciação, exaustão e amortização, custos de abandono, provisþes para SURFHVVRVMXGLFLDLVYDORUGHPHUFDGRGHLQVWUXPHQWRV¿QDQFHLURVDMXVWHVDYDORUSUHVHQWHGHFRQWDVD



%DVHGHDSUHVHQWDomRGDVGHPRQVWUDo}HVFRQWiEHLV

receber e a pagar das transaçþes relevantes, imposto de renda e contribuição social. Embora a Administração utilize premissas e julgamentos que são revisados periodicamente, os resultados reais podem

As demonstraçþes contåbeis incluem: 'HPRQVWUDo}HVFRQWiEHLVFRQVROLGDGDV

divergir dessas estimativas.



%DVHGHFRQVROLGDomR

As demonstraçþes contåbeis consolidadas estão sendo apresentadas de acordo com os padrþes inter-

As demonstraçþes contåbeis consolidadas abrangem informaçþes da Petrobras e de suas subsidiårias,

QDFLRQDLVGHGHPRQVWUDo}HVFRQWiEHLV ,)56 HPLWLGRVSHORInternational Accounting Standards Board

FRQWURODGDVHVRFLHGDGHVGHSURSyVLWRVHVSHFtÂżFRVFXMDVSUiWLFDVFRQWiEHLVHVWmRDGHUHQWHVjVDGRWD-

- IASB e tambĂŠm de acordo com prĂĄticas contĂĄbeis adotadas no Brasil.

das pela Companhia. As empresas consolidadas sĂŁo as seguintes: 3DUWLFLSDomR QRFDSLWDO 6XEVFULWR LQWHJUDOL]DGR HYRWDQWH

'HPRQVWUDo}HVFRQWiEHLVLQGLYLGXDLV As demonstraçþes contåbeis individuais estão sendo apresentadas de acordo com as pråticas contåbeis adotadas no Brasil, em observância às disposiçþes contidas na Lei das Sociedades por Açþes, e incorporam as mudanças introduzidas por intermÊdio das Leis 11.638/07 e 11.941/09, complementadas

6XEVLGLiULDVHFRQWURODGDV

3DtV





SHORVSURQXQFLDPHQWRVLQWHUSUHWDo}HVHRULHQWDo}HVGR&RPLWrGH3URQXQFLDPHQWRV&RQWiEHLV&3&

Petrobras QuĂ­mica S.A. - Petroquisa e suas controladas .....................

Brasil

100,00

100,00

aprovados por resoluçþes do Conselho Federal de Contabilidade - CFC e por normas da Comissão de

Petrobras Distribuidora S.A. - BR e suas controladas...........................

Brasil

100,00

100,00

Valores MobiliĂĄrios - CVM. %UDVSHWUR2LO6HUYLFHV&RPSDQ\%UDVRLOHVXDVFRQWURODGDV L .........

Ilhas Cayman

100,00

100,00

Os pronunciamentos, interpretaçþes e orientaçþes do CPC, aprovados por resoluçþes do CFC e por nor-

%UDVSHWUR2LO&RPSDQ\%2& L ..........................................................

Ilhas Cayman

99,99

99,99

mas da CVM, estão convergentes às normas internacionais de contabilidade emitidas pelo IASB. Dessa forma, as demonstraçþes contåbeis individuais não apresentam diferenças em relação às consolidadas

Petrobras International Braspetro B.V. - PIBBV e suas  FRQWURODGDV L  LL .................................................................................

Holanda

100,00

100,00

HP,)56H[FHWRSHODPDQXWHQomRGRDWLYRGLIHULGRFRQIRUPHSUHYLVWRQR&3& 5 DSURYDGRSHOD

3HWUREUDV&RPHUFLDOL]DGRUDGH(QHUJLD/WGD3%(1 LLL ....................

Brasil

100,00

100,00

Deliberação CVM 651/10. As reconciliaçþes do patrimônio líquido e resultado da controladora com o con-

3HWUREUDV1HJyFLRV(OHWU{QLFRV6$(3HWUR LY ...............................

Brasil

100,00

100,00

Petrobras GĂĄs S.A. - Gaspetro e suas controladas .............................

Brasil

99,99

99,99

Petrobras International Finance Company - PifCo e  VXDVFRQWURODGDV L .............................................................................

Ilhas Cayman

100,00

100,00

3HWUREUDV7UDQVSRUWH6$7UDQVSHWURHVXDVFRQWURODGDV .................

Brasil

100,00

100,00

O Conselho de Administração da Companhia, em reunião realizada em 9 de fevereiro de 2012, autorizou

Downstream Participaçþes Ltda. e sua controlada ...............................

Brasil

99,99

99,99

a divulgação destas demonstraçþes contåbeis.

3HWUREUDV1HWKHUODQGV%931%9HVXDVFRQWURODGDV L ..................

Holanda

100,00

100,00

5283 Participaçþes Ltda. .......................................................................

Brasil

100,00

100,00

solidado estão na nota explicativa 3.1. As demonstraçþes contåbeis foram preparadas utilizando o custo histórico como base de valor, exceto SHODYDORUL]DomRGHDOJXQVDWLYRVHSDVVLYRVQmRFLUFXODQWHVHLQVWUXPHQWRV¿QDQFHLURV

 5HODWyULRVSRUVHJPHQWRGHQHJyFLR

)$)(1(QHUJLD6$HVXDFRQWURODGD Y .............................................

Brasil

$VLQIRUPDo}HVFRQWiEHLVSRUVHJPHQWRRSHUDFLRQDO iUHDGHQHJyFLR GD&RPSDQKLDVmRHODERUDGDV

Baixada Santista Energia Ltda. .............................................................

Brasil

100,00

100,00

com base em itens atribuĂ­veis diretamente ao segmento, bem como aqueles que podem ser alocados em

Sociedade Fluminense de Energia Ltda. - SFE ....................................

Brasil

100,00

100,00

bases razoĂĄveis.

7HUPRULR6$ Y ....................................................................................

Brasil

7HUPRFHDUi/WGD ..................................................................................

Brasil

100,00

100,00

7HUPRPDFDp/WGD ................................................................................

Brasil

100,00

100,00

7HUPRPDFDp&RPHUFLDOL]DGRUDGH(QHUJLD/WGD .................................

Brasil

100,00

100,00

Na apuração dos resultados segmentados são consideradas as transaçþes realizadas com terceiros e DVWUDQVIHUrQFLDVHQWUHDViUHDVGHQHJyFLRVHQGRHVWDVYDORUDGDVSRUSUHoRVLQWHUQRVGHWUDQVIHUrQFLD GH¿QLGRVHQWUHDViUHDVHFRPPHWRGRORJLDVGHDSXUDomREDVHDGDVHPSDUkPHWURVGHPHUFDGR As informaçþes por årea de negócio na Companhia estão segmentadas de acordo com o modelo de organização vigente, contendo as seguintes åreas: D ([SORUDomRH3URGXomRDEUDQJHDVDWLYLGDGHVGHH[SORUDomRGHVHQYROYLPHQWRGDSURGXomRHSURGXomRGHSHWUyOHR/*1 OtTXLGRGHJiVQDWXUDO HJiVQDWXUDOQR%UDVLOREMHWLYDQGRDWHQGHUSULRULWDULDPHQWH DVUH¿QDULDVGRSDtVHDLQGDFRPHUFLDOL]DQGRQRVPHUFDGRVLQWHUQRHH[WHUQRRH[FHGHQWHGHSHWUyOHR

8VLQD7HUPHOpWULFDGH-XL]GH)RUD6$ Y ...........................................

Brasil

Fundo de Investimento ImobiliĂĄrio RB LogĂ­stica - FII ............................

Brasil

100,00

100,00

100,00 99,00

99,00

7HUPREDKLD6$....................................................................................

Brasil

98,85

98,85

Petrobras BiocombustĂ­vel S.A. ..............................................................

Brasil

100,00

100,00

5HÂżQDULD$EUHXH/LPD6$ .................................................................

Brasil

100,00

100,00

&RUGRED)LQDQFLDO6HUYLFHV*PEK&)6HVXDFRQWURODGD L ..............

Ă ustria

100,00

100,00

Companhia Locadora de Equipamentos PetrolĂ­feros S.A. â&#x20AC;&#x201C; CLEP ..........

Brasil

100,00

100,00

bem como derivados produzidos em suas plantas de processamento de gĂĄs natural. E $EDVWHFLPHQWRFRQWHPSODDVDWLYLGDGHVGHUHÂżQRORJtVWLFDWUDQVSRUWHHFRPHUFLDOL]DomRGHGHULYDGRV

&RPSHUM3HWURTXLPRV%iVLFRV6$ Y ...................................................

Brasil

100,00

e petróleo, exportação de etanol, extração e processamento de xisto, alÊm das participaçþes em empre-

&RPSHUM3(76$ Y .............................................................................

Brasil

100,00

sas do setor petroquĂ­mico no Brasil.

Comperj Participaçþes S.A....................................................................

Brasil

100,00

100,00

&RPSHUM(VWLUrQLFRV6$.......................................................................

Brasil

100,00

100,00

Comperj MEG S.A. ................................................................................

Brasil

100,00

100,00

assim como as participaçþes societårias em transportadoras e distribuidoras de gås natural e em termoe-

&RPSHUM3ROLROHÂżQDV6$ ......................................................................

Brasil

100,00

100,00

lĂŠtricas no Brasil, alĂŠm de ser responsĂĄvel pelos negĂłcios com fertilizantes.

Breitener EnergĂŠtica S.A. e suas controladas .......................................

Brasil

65,00

65,00

&D\PDQ&DELXQDV,QYHVWPHQW&2 L ...................................................

Ilhas Cayman

100,00

100,00

G %LRFRPEXVWtYHOFRQWHPSODPDVDWLYLGDGHVGHSURGXomRGHELRGLHVHOHVHXVFRSURGXWRVHDVDWLYLGDGHV

Ibiritermo S.A. ........................................................................................

Brasil

50,00

50,00

Innova S.A. ............................................................................................

Brasil

100,00

Companhia de Desenvolvimento de Plantas Utilidades S.A.  &'38 YL ................................................................................................

Brasil

100,00

Companhia de Recuperação SecundĂĄria S.A. â&#x20AC;&#x201C; CRSEC .....................

Brasil

100,00

F *iVH(QHUJLDHQJOREDDVDWLYLGDGHVGHWUDQVSRUWHHFRPHUFLDOL]DomRGRJiVQDWXUDOSURGX]LGRQRSDtV ou importado, de transporte e comercialização de GNL, de geração e comercialização de energia elÊtrica,

de etanol, atravÊs de participaçþes acionårias, da produção e da comercialização de etanol, açúcar e o excedente de energia elÊtrica gerado a partir do bagaço da cana-de-açúcar. H 'LVWULEXLomRUHVSRQViYHOSHODGLVWULEXLomRGHGHULYDGRVHWDQROHJiVQDWXUDOYHLFXODUQR%UDVLOUHSUHsentada pelas operaçþes da Petrobras Distribuidora.

L (PSUHVDVVHGLDGDVQRH[WHULRUFRPGHPRQVWUDo}HVFRQWiEHLVHODERUDGDVHPPRHGDHVWUDQJHLUD I ,QWHUQDFLRQDODEUDQJHDVDWLYLGDGHVGHH[SORUDomRHSURGXomRGHSHWUyOHRHJiVGHDEDVWHFLPHQWR

LL 3DUWLFLSDomRGHHP HP GD3DUWLFLSDo}HV/WGD

de gås e energia e de distribuição, realizadas no exterior, em diversos países das AmÊricas, à frica,

LLL 3DUWLFLSDomRGHGD3HWUREUDV*iV6$*DVSHWUR

Europa e Ă sia.

LY 3DUWLFLSDomRGHGD'RZQVWUHDP Y (PSUHVDVLQFRUSRUDGDVSHOD3HWUyOHR%UDVLOHLUR6$

No grupo de ĂłrgĂŁos corporativos sĂŁo alocados os itens que nĂŁo podem ser atribuĂ­dos Ă s demais ĂĄreas,

YL 3DUWLFLSDomRGHGR&RPSHUM3DUWLFLSDo}HV6$

QRWDGDPHQWHDTXHOHVYLQFXODGRVjJHVWmR¿QDQFHLUDFRUSRUDWLYDRoverhead relativo à Administração Central e outras despesas, inclusive as atuariais referentes aos planos de pensão e de saúde destinados DRVDSRVHQWDGRVHEHQH¿FLiULRV

 'HPRQVWUDomRGRYDORUDGLFLRQDGR As demonstrações do valor adicionado - DVA apresentam informações relativas à riqueza criada pela entidade e a forma como tais riquezas foram distribuídas. Essas demonstrações foram preparadas de acordo FRPR&3&'HPRQVWUDomRGR9DORU$GLFLRQDGRDSURYDGRSHOD'HOLEHUDomR&90HSDUD¿QV

6RFLHGDGHVGH3URSyVLWRV(VSHFtÂżFRV63(

3DtV

$WLYLGDGH SULQFLSDO

&KDUWHU'HYHORSPHQW//&Âą&'& L  .........................................................................

E.U.A

Exploração e Produção

Companhia de Desenvolvimento e Modernização de Plantas Industriais â&#x20AC;&#x201C; CDMPI .

Brasil

5HÂżQR

1RYD7UDQVSRUWDGRUDGR1RUGHVWH6$Âą171 ..........................................................

Brasil

LogĂ­stica

1RYD7UDQVSRUWDGRUDGR6XGHVWH6$Âą176 ...........................................................

Brasil

LogĂ­stica

3'(72IIVKRUH6$ ...................................................................................................

Brasil

Exploração e Produção

Fundo de Investimento em Direitos CreditĂłrios NĂŁo-padronizados do Sistema Petrobras ....................................................................................................................

Brasil

Corporativo

de IFRS, são apresentadas como informação adicional.

 %DODQoRVRFLDO O balanço social demonstra os indicadores sociais, ambientais, o quantitativo funcional e informaçþes relevantes quanto ao exercício da cidadania empresarial. Algumas informaçþes foram obtidas por meio de registros auxiliares e informaçþes gerenciais da Companhia. Esse balanço Ê apresentado como informação adicional.

L Empresas sediadas no exterior com demonstraçþes contåbeis elaboradas em moeda estrangeira.

 0RHGDIXQFLRQDO O processo de consolidação das contas patrimoniais e de resultado corresponde à soma dos saldos das contas de A moeda funcional da Petrobras, assim como a de suas controladas brasileiras, Ê o real. A moeda funcional

ativo, passivo, receitas e despesas, segundo a sua natureza, complementada com as eliminaçþes das operaçþes

GHDOJXPDVFRQWURODGDVHVRFLHGDGHVGHSURSyVLWRHVSHFtÂżFRTXHDWXDPHPDPELHQWHHFRQ{PLFRLQWHU-

realizadas entre empresas consolidadas, bem como dos saldos e resultados nĂŁo realizados economicamente

nacional ĂŠ o dĂłlar norte-americano e a moeda funcional da Petrobras Argentina S.A. ĂŠ o peso argentino.

entre as referidas empresas.

$VGHPRQVWUDo}HVGRUHVXOWDGRHGRĂ&#x20AC;X[RGHFDL[DGDVLQYHVWLGDVHPDPELHQWHHFRQ{PLFRHVWiYHOFRP

$&RPSDQKLDSDVVRXDUHFRQKHFHUHPVXDVGHPRQVWUDo}HVFRQWiEHLVGRVH[HUFtFLRVÂżQGRVHPGHGH]HPEUR

moeda funcional distinta da Controladora, são convertidas para reais pela taxa de câmbio mÊdia mensal,

GHHRVLQYHVWLPHQWRVHPHPSUHVDVFRQWURODGDVHPFRQMXQWRDYDOLDGRVSHORPpWRGRGHHTXLYDOrQFLD

RVDWLYRVHSDVVLYRVVmRFRQYHUWLGRVSHODWD[DÂżQDOHRVGHPDLVLWHQVGRSDWULP{QLROtTXLGRVmRFRQYHUWLGRV

patrimonial e nĂŁo mais consolidados proporcionalmente, em conformidade com a alternativa prevista no IAS 31

pela taxa histĂłrica.

HVHXFRUUHVSRQGHQWH&3& 5 DSURYDGRSHOD'HOLEHUDomR&90


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-15

Minas e Energia

Petróleo Brasileiro S.A. CNPJ Nº 33.000.167/0001-01 - COMPANHIA ABERTA Essa alteração foi aplicada retroativamente a 1º de janeiro de 2010, com a alteração dos saldos conforme a seguir: D Balanço patrimonial consolidado  (IHLWRGDFRQVROLGDomR SURSRUFLRQDO 



2.272 









'LYXOJDGR

74.374 34.923 5.772 227.079 8.271  55.161 128.363 164.317 2.578 

Ativo circulante ............................................................................................................ Ativo realizåvel a longo prazo...................................................................................... Investimento ................................................................................................................ Imobilizado .................................................................................................................. Intangível ..................................................................................................................... Passivo circulante........................................................................................................ Passivo não circulante................................................................................................. Patrimônio líquido atribuível aos acionistas da Petrobras ........................................... Participação de acionistas não controladores .............................................................





6DOGRLQLFLDOUHDSUH VHQWDGR 73.440 34.349 8.044 224.647 6.789  54.093 126.710 164.317 2.149 

 (IHLWRGDFRQVROLGDomR SURSRUFLRQDO 



2.713 















'LYXOJDGR

106.685 38.470 8.879 282.838 83.098  56.834 152.911 306.766 3.459 

5HDSUHVHQWDGR 105.902 37.718 11.592 280.095 81.539  55.948 151.070 306.765 3.063 

'LYXOJDGRQDVGHPRQVWUDo}HVFRQWiEHLVGRH[HUFtFLR¿QGRHPGHGH]HPEURGH b) Demonstração de resultados consolidado

5HFHLWDGHYHQGD ................................................................................................................................................................................................................................. Custo dos produtos e serviços vendidos ............................................................................................................................................................................................... /XFUREUXWR .......................................................................................................................................................................................................................................... Despesas............................................................................................................................................................................................................................................... /XFURDQWHVGRUHVXOWDGR¿QDQFHLURSDUWLFLSDo}HVHWULEXWRV ....................................................................................................................................................... 5HVXOWDGR¿QDQFHLUROtTXLGR .................................................................................................................................................................................................................. Resultado de participação em investimento .......................................................................................................................................................................................... Participação de empregados e administradores ................................................................................................................................................................................... /XFURDQWHVGRVWULEXWRVVREUHROXFUR............................................................................................................................................................................................. Imposto renda/contribuição social ......................................................................................................................................................................................................... /XFUROtTXLGR ........................................................................................................................................................................................................................................ $WULEXtYHODRV Acionistas da Petrobras........................................................................................................................................................................................................................ Acionistas não controladores ...............................................................................................................................................................................................................

'LYXOJDGR 213.274  

  

 2.563 208  

48.137  



 (IHLWRGDFRQVROLGDomR SURSRUFLRQDO  

435  

334  

57 377  

209  

35.189 712 

 

 

5HDSUHVHQWDGR 211.842  

  

 2.620 585  

47.908  

 35.189 692 

F 'HPRQVWUDomRGRVĂ&#x20AC;X[RVGHFDL[DFRQVROLGDGR

Caixa gerado pelas atividades operacionais ......................................................................................................................................................................................... Caixa utilizado em atividades de investimentos .................................................................................................................................................................................... &DL[DJHUDGRSHODVDWLYLGDGHVGH¿QDQFLDPHQWR .................................................................................................................................................................................. Efeito de variação cambial sobre o caixa e equivalente caixa .............................................................................................................................................................. 9DULDomROtTXLGDGHFDL[DGRH[HUFtFLR .............................................................................................................................................................................................. &DL[DHHTXLYDOHQWHVGHFDL[DQRLQtFLRGRH[HUFtFLR ...................................................................................................................................................................... &DL[DHHTXLYDOHQWHVGHFDL[DQR¿QDOGRH[HUFtFLR ........................................................................................................................................................................

 5HFRQFLOLDomRGRSDWULP{QLROtTXLGRHOXFUROtTXLGRGRFRQVROLGD GRFRPRGDFRQWURODGRUD 3DWULP{QLROtTXLGR



'LYXOJDGR 53.435  

53.858  

1.289 29.034 

 (IHLWRGDFRQVROLGDomR SURSRUFLRQDO  

383  

143  

 

 

5HDSUHVHQWDGR 52.871  

53.777  

1.170 28.246 

,QVWUXPHQWRVÂżQDQFHLURVGHULYDWLYRVHRSHUDo}HVGHKHGJH 7RGRVRVLQVWUXPHQWRVÂżQDQFHLURVGHULYDWLYRVIRUDPUHFRQKHFLGRVQREDODQoRGD&RPSDQKLD

/XFUROtTXLGR

tanto no ativo quanto no passivo, e sĂŁo mensurados pelo valor justo, determinado com base &RQVROLGDGR,)56 ...............................................................

















 

PatrimĂ´nio de acionistas nĂŁo controladores............................

 

Despesas diferidas lĂ­quidas de IR ...........................................

636

552

&RQWURODGRUDDMXVWDGRDRVSDGU}HVLQWHUQDFLRQDLVGH FRQWDELOLGDGH &3& ..............................................................





203

 

 

 



em cotaçþes de fechamento de mercado, quando disponíveis. Nas operaçþes com derivativos, para proteção das variaçþes nos preços de petróleo e derivados e de moeda, os ganhos e perdas decorrentes das variaçþes do valor justo são UHJLVWUDGRVQRUHVXOWDGR¿QDQFHLUR

 Para as operaçþes de hedgeGHĂ&#x20AC;X[RGHFDL[DRVJDQKRVHSHUGDVGHFRUUHQWHVGDVYD-



6XPiULRGDVSULQFLSDLVSUiWLFDVFRQWiEHLV

riaçþes do valor justo são registrados em ajustes de avaliação patrimonial, no patrimônio líquido, atÊ a sua liquidação.

$VSUiWLFDVFRQWiEHLVGHVFULWDVDEDL[RWrPVLGRDSOLFDGDVGHPDQHLUDFRQVLVWHQWHSHOD&RPSDQKLDQDV demonstraçþes contåbeis individuais e consolidadas apresentadas.

 5HFRQKHFLPHQWRGHUHFHLWDVFXVWRVHGHVSHVDV



&DSLWDOVRFLDO 2FDSLWDOVRFLDOHVWiUHSUHVHQWDGRSRUDo}HVRUGLQiULDVHSUHIHUHQFLDLVTXHVmRFODVVL¿FDdas como patrimônio líquido. Os gastos com a emissão de açþes são apresentados como

A receita de vendas compreende o valor da contraprestação recebida ou a receber pela comercialização

dedução do patrimônio líquido, como contribuição adicional de capital, líquido de efeitos

de produtos e serviços, líquida das devoluçþes, descontos e encargos sobre vendas.

tributĂĄrios.

Â&#x2021; $UHFHLWDGHYHQGDVGHSHWUyOHREUXWRHVHXVGHULYDGRVpUHFRQKHFLGDQRUHVXOWDGRTXDQGRWRGRVRV

$VDo}HVSUHIHUHQFLDLVWrPSULRULGDGHQRFDVRGHUHHPEROVRGRFDSLWDOHQRUHFHELPHQWRGRV

riscos e benefĂ­cios inerentes ao produto sĂŁo transferidos para o comprador, o que geralmente ocorre na

dividendos, no mínimo, de 3% do valor do patrimônio líquido da ação, ou de 5% calculado

sua entrega.

sobre a parte do capital representada por essa espÊcie de açþes, prevalecendo sempre o maior, participando, em igualdade com as açþes ordinårias, nos aumentos do capital social

Â&#x2021; $UHFHLWDGHYHQGDGHVHUYLoRVGHIUHWHVHRXWURVpUHFRQKHFLGDHPIXQomRGHVXDUHDOL]DomR

decorrentes de incorporação de reservas e lucros. As açþes preferenciais não asseguram direito de voto e não são conversíveis em açþes ordinårias e vice-versa.

2UHVXOWDGRÂżQDQFHLUROtTXLGRLQFOXLSULQFLSDOPHQWHUHFHLWDVGHMXURVVREUHDSOLFDo}HVÂżQDQFHLUDVH WtWXORVS~EOLFRVGHVSHVDVFRPMXURVVREUHÂżQDQFLDPHQWRVJDQKRVHSHUGDVFRPDYDOLDomRDYDORU

2VGLYLGHQGRVPtQLPRVREULJDWyULRVDWHQGHPDRVOLPLWHVGHÂżQLGRVQRHVWDWXWRGD&RPSD-

MXVWRGHDFRUGRFRPDFODVVLÂżFDomRGRWtWXORDOpPGDVYDULDo}HVFDPELDLVHPRQHWiULDVOtTXLGDV

nhia e sĂŁo reconhecidos como passivo.

$VUHFHLWDVFXVWRVHDVGHVSHVDVVmRFRQWDELOL]DGDVSHORUHJLPHGHFRPSHWrQFLD

 $WLYRVHSDVVLYRV¿QDQFHLURV  &DL[DHHTXLYDOHQWHVGHFDL[D Estão representados por aplicaçþes de alta liquidez, que são prontamente conversíveis em QXPHUiULRFRPYHQFLPHQWRHPDWpWUrVPHVHVGDGDWDGHDTXLVLomR

 7tWXORVHYDORUHVPRELOLiULRV $&RPSDQKLDFODVVLÂżFDRVWtWXORVHYDORUHVPRELOLiULRVQRUHFRQKHFLPHQWRLQLFLDOFRPEDVH

(VWRTXHV Os estoques estĂŁo demonstrados da seguinte forma: Â&#x2021;$VPDWpULDVSULPDVFRPSUHHQGHPSULQFLSDOPHQWHRVHVWRTXHVGHSHWUyOHRTXHHVWmRGHPRQVWUDGRV pelo valor mĂŠdio dos custos de importação e de produção, ajustados, quando aplicĂĄvel, ao seu valor de realização; Â&#x2021;2VGHULYDGRVGHSHWUyOHRHiOFRROHVWmRGHPRQVWUDGRVDRFXVWRPpGLRGHUHÂżQRRXGHFRPSUDDMXVWDGRV quando aplicĂĄvel, ao seu valor de realização; Â&#x2021;2VPDWHULDLVHVXSULPHQWRVHVWmRGHPRQVWUDGRVDRFXVWRPpGLRGHFRPSUDTXHQmRH[FHGHDRGHUHSRVLomRHDVLPSRUWDo}HVHPDQGDPHQWRGHPRQVWUDGDVDRFXVWRLGHQWLÂżFDGR

nas estratÊgias da Administração para esses títulos, sob as seguintes categorias:

 ,QYHVWLPHQWRVVRFLHWiULRV Â&#x2021;2VWtWXORVSDUDQHJRFLDomRVmRPHQVXUDGRVDRYDORUMXVWR2VMXURVHDWXDOL]DomRPRQHtĂĄria e as variaçþes decorrentes da avaliação ao valor justo sĂŁo registrados no resultado

6mRDYDOLDGRVSHORPpWRGRGDHTXLYDOrQFLDSDWULPRQLDORVLQYHVWLPHQWRVHPFRQWURODGDVFRQWURODGDVHP

quando incorridos.

FRQMXQWRHWDPEpPHPFROLJDGDVQRVTXDLVDDGPLQLVWUDomRWHQKDLQĂ&#x20AC;XrQFLDVLJQLÂżFDWLYDHHPRXWUDV sociedades que façam parte de um mesmo grupo ou estejam sob controle comum.

Â&#x2021;2VWtWXORVGLVSRQtYHLVSDUDYHQGDVmRPHQVXUDGRVDRYDORUMXVWR2VMXURVHDWXDOL]DomR monetĂĄria sĂŁo registrados no resultado, quando incorridos, enquanto que as variaçþes decorrentes da avaliação ao valor justo sĂŁo registradas em ajustes de avaliação patrimonial,



 &RPELQDomRGHQHJyFLRVHJRRGZLOO A anålise da aquisição Ê feita caso a caso para determinar se a transação representa uma combinação

no patrimĂ´nio lĂ­quido, sendo transferidos para o resultado do exercĂ­cio, quando de sua

GHQHJyFLRVRXXPDFRPSUDGHDWLYRV7UDQVDo}HVHQWUHHPSUHVDVVREFRQWUROHFRPXPQmRFRQÂżJXUDP

liquidação.

uma combinação de negócios.

Â&#x2021;2VWtWXORVPDQWLGRVDWpRYHQFLPHQWRVmRPHQVXUDGRVSHORFXVWRGHDTXLVLomRDFUHVFLGRV

Os ativos e passivos adquiridos numa combinação de negócios são contabilizados em consonância com

por juros e atualização monetåria que são registrados no resultado quando incorridos.

o mÊtodo de aquisição, sendo reconhecidos pelos seus respectivos valores justos. Qualquer excesso do

&RQWDVDUHFHEHU

FXVWRGHDTXLVLomRVREUHRYDORUMXVWRGRVDWLYRVOtTXLGRVDGTXLULGRV DWLYRVLGHQWLÂżFiYHLVHSDVVLYRVDG-

São contabilizadas inicialmente pelo valor da contraprestação a ser recebida e subse-

TXLULGRVOtTXLGRV pUHFRQKHFLGRFRPRgoodwill no ativo intangível. Quando o custo de aquisição for menor que o valor justo dos ativos líquidos adquiridos, Ê reconhecido um ganho na demonstração de resultado.

quentemente pelo custo amortizado, sendo deduzidas das perdas em crÊdito de liquidação duvidosa.

As mudanças de participaçþes em controladas que não resultem em perda de controle são reconhecidas diretamente no patrimônio líquido, como contribuição adicional de capital, pela diferença entre o preço



(PSUpVWLPRVHÂżQDQFLDPHQWRV

pago/recebido e o valor contåbil da participação adquirida/vendida.

São reconhecidos inicialmente pelo valor justo menos os custos de transação incorridos

1DVDTXLVLo}HVGHSDUWLFLSDomRHPFROLJDGDVHFRQWURODGDVHPFRQMXQWRDSHVDUGHQmRFRQÂżJXUDUHPXPD

e, apĂłs o reconhecimento inicial, sĂŁo mensurados pelo custo amortizado utilizando-se do

combinação de negócios, os ativos líquidos adquiridos tambÊm são reconhecidos pelo valor justo, sendo

mĂŠtodo da taxa de juros efetiva.

que o goodwill ĂŠ apresentado no investimento.


cyan magenta amarelo preto

E-16

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA  ,PRELOL]DGR

(VWHYDORUGHXVRpHVWLPDGRFRPEDVHQRYDORUSUHVHQWHGHĂ&#x20AC;X[RVGHFDL[DIXWXURVUHVXOWDGRGDVPHOKRUHVHVWLPDWLYDVGD&RPSDQKLD2VĂ&#x20AC;X[RVGHFDL[DGHFRUUHQWHVGRXVRFRQWtQXRGRVDWLYRVUHODFLRQDGRV VmRDMXVWDGRVSHORVULVFRVHVSHFtÂżFRVHXWLOL]DPDWD[DGHGHVFRQWRSUpLPSRVWR(VWDWD[DGHULYDGDWD[D SyVLPSRVWRHVWUXWXUDGDQR&XVWR0pGLR3RQGHUDGRGH&DSLWDO :$&& $VSULQFLSDLVSUHPLVVDVGRV Ă&#x20AC;X[RVGHFDL[DVmRSUHoRVEDVHDGRVQR~OWLPRSODQRHVWUDWpJLFRGLYXOJDGRFXUYDVGHSURGXomRDVVRFLDdas aos projetos existentes no portfĂłlio da Companhia, custos operacionais de mercado e investimentos necessĂĄrios para realização dos projetos.

Mensuração EstĂĄ demonstrado pelo custo de aquisição ou custo de construção, que representa os custos para colocar RDWLYRHPFRQGLo}HVGHRSHUDomRFRUULJLGRPRQHWDULDPHQWHGXUDQWHSHUtRGRVKLSHULQĂ&#x20AC;DFLRQiULRVGHduzido da depreciação acumulada e perda por redução ao valor recuperĂĄvel de ativos (impairment). Os direitos que tenham por objetos bens corpĂłreos destinados Ă manutenção das atividades da Companhia, GHFRUUHQWHVGHRSHUDo}HVTXHWUDQVÂżUDPRVEHQHItFLRVULVFRVHFRQWUROHVGHVVHVEHQVHVWmRGHPRQVWUDdos pelo valor justo ou, se inferior, pelo valor presente dos pagamentos mĂ­nimos do contrato.

(VVDVDYDOLDo}HVVmRHIHWXDGDVDRPHQRUQtYHOGHDWLYRVSDUDRVTXDLVH[LVWDPĂ&#x20AC;X[RVGHFDL[DLGHQWLÂżFiveis. Os ativos vinculados a exploração e desenvolvimento da produção de petrĂłleo e gĂĄs sĂŁo revisados DQXDOPHQWHFDPSRDFDPSRSDUDLGHQWLÂżFDomRGHSRVVtYHLVSHUGDVQDUHFXSHUDomRFRPEDVHQRĂ&#x20AC;X[R de caixa futuro estimado.

Os custos incorridos com exploração, desenvolvimento e produção de petróleo e gås são contabilizados de acordo com o mÊtodo dos esforços bem sucedidos. Esse mÊtodo determina que os custos de desenvolvimento de todos os poços de produção e dos poços exploratórios bem sucedidos, vinculados às reservas economicamente viåveis, sejam capitalizados, enquanto os custos de geologia e geofísica sejam contabilizados como despesas no período em que são incorridos e os custos com poços exploratórios secos e os YLQFXODGRVjVUHVHUYDVQmRFRPHUFLDLVVHMDPUHJLVWUDGRVQRUHVXOWDGRTXDQGRVmRLGHQWL¿FDGRVFRPRWDO Os gastos relevantes com manutenção das unidades industriais e dos navios, que incluem peças de UHSRVLomRVHUYLoRVGHPRQWDJHPHQWUHRXWURVVmRUHJLVWUDGRVQRLPRELOL]DGR2VHQFDUJRV¿QDQFHLURV de emprÊstimos obtidos, quando diretamente atribuíveis à aquisição ou à construção de ativos, são caSLWDOL]DGRVFRPRSDUWHGRVFXVWRVGHVVHVDWLYRV2VHQFDUJRV¿QDQFHLURVTXHQmRHVWHMDPGLUHWDPHQWH relacionados aos ativos são capitalizados com base numa taxa mÊdia de captação sobre o saldo de obras em andamento. Esses custos são amortizados ao longo das vidas úteis estimadas ou pelo mÊtodo de unidades produzidas dos respectivos ativos. Depreciação

A reversão de perdas reconhecidas anteriormente Ê permitida, exceto com relação à redução no valor do ågio por expectativa de rentabilidade futura.

 $UUHQGDPHQWRVPHUFDQWLV $VREULJDo}HVGHFRQWUDWRVGHDUUHQGDPHQWRVFRPWUDQVIHUrQFLDGHEHQHItFLRVULVFRVHFRQWUROHGRVEHQV VmRUHFRQKHFLGDVQRSDVVLYRFRPRDUUHQGDPHQWRVPHUFDQWLVÂżQDQFHLURV1RVFDVRVHPTXHD&RPSDnhia ĂŠ arrendadora, esses contratos sĂŁo reconhecidos como recebĂ­veis no ativo. Os demais contratos de DUUHQGDPHQWRVVmRFODVVLÂżFDGRVFRPRRSHUDFLRQDLVHRVSDJDPHQWRVVmRUHFRQKHFLGRVFRPRGHVSHVD no resultado durante o prazo do contrato.

 $EDQGRQRGHSRoRVHGHVPDQWHODPHQWRGHiUHDV

Os equipamentos e instalaçþes relacionados à produção de petróleo e gås dos poços desenvolvidos são depreciados de acordo com o volume de produção mensal em relação às reservas provadas e deVHQYROYLGDVGHFDGDFDPSRSURGXWRU(VVDVUHVHUYDVVmRHVWLPDGDVSRUSUR¿VVLRQDLVHVSHFLDOL]DGRVGD &RPSDQKLDGHDFRUGRFRPDVGH¿QLo}HVHVWDEHOHFLGDVSHODSecurities and Exchange Commission -SEC, HUHYLVDGDVDQXDOPHQWHRXHPXPLQWHUYDORPHQRUFDVRKDMDLQGtFLRGHDOWHUDo}HVVLJQL¿FDWLYDV3DUDRV ativos com vida útil menor do que a vida do campo ou que são vinculados a campos com diversas fases de desenvolvimento da produção Ê utilizado o mÊtodo linear. Os terrenos não são depreciados. Os demais bens do imobilizado são depreciados pelo mÊtodo linear com base nas seguintes vidas úteis estimadas: &ODVVHGHDWLYRV (GL¿FDo}HVHEHQIHLWRULDV......................................................... Equipamentos e outros bens ....................................................

A obrigação futura com abandono de poços e desmantelamento de årea de produção estå contabilizada pelo seu valor presente, descontada a uma taxa livre de risco, sendo registrada integralmente no momento da declaração de comercialidade de cada campo, como parte dos custos dos ativos relacionados (ativo LPRELOL]DGR HPFRQWUDSDUWLGDjSURYLVmRUHJLVWUDGDQRSDVVLYRTXHVXSRUWDUiWDLVJDVWRV2VMXURVLQFRUULGRVSHODDWXDOL]DomRGDSURYLVmRHVWmRFODVVL¿FDGRVFRPRGHVSHVDV¿QDQFHLUDV

 ,PSRVWRGHUHQGDHFRQWULEXLomRVRFLDO Esses tributos são calculados e registrados com base nas alíquotas de 25% para imposto de renda e 9% para contribuição social sobre o lucro tributåvel. Os impostos e contribuiçþes sociais diferidos são recoQKHFLGRVHPIXQomRGDVGLIHUHQoDVWHPSRUiULDVSUHMXt]R¿VFDOHEDVHQHJDWLYDGDFRQWULEXLomRVRFLDO quando aplicåvel.

9LGD~WLOPpGLDSRQGHUDGD DQRV DQRV

DQRV DQRV

3DUD¿QVGHDSXUDomRGRLPSRVWRGHUHQGDHGDFRQWULEXLomRVRFLDOVREUHROXFURFRUUHQWHD&RPSDQKLDDGRWRXR5HJLPH7ULEXWiULRGH7UDQVLomR577FRQIRUPHSUHYLVWRQD/HLRXVHMDQD determinação do lucro tributåvel considerou os critÊrios contåbeis da Lei 6.404/76, antes das alteraçþes da Lei 11.638/07. Os impostos sobre diferenças temporårias, geradas pela adoção da nova lei societåria, foram registrados como impostos e contribuiçþes diferidos ativos e passivos.

As paradas para manutenção ocorrem em intervalos programados em mÊdia de 4 anos, e os respectivos gastos são depreciados como custo da produção atÊ o início da parada seguinte.

 ,QWDQJtYHO EstĂĄ demonstrado pelo custo de aquisição, deduzido da amortização acumulada e perdas por impairment. Ă&#x2030; composto por direitos e concessĂľes que incluem, principalmente, bĂ´nus de assinatura pagos

 %HQHItFLRVFRQFHGLGRVDHPSUHJDGRV

pela obtenção de concessþes para exploração de petróleo ou gås natural, cessão onerosa de direitos de exploração em blocos da årea do prÊ-sal, concessþes de serviços públicos, alÊm de marcas e patentes,

2VFRPSURPLVVRVDWXDULDLVFRPRVSODQRVGHEHQHItFLRVGHSHQVmRHDSRVHQWDGRULDHRVGHDVVLVWrQFLD mÊdica são provisionados com base em cålculo atuarial elaborado anualmente por atuårio independente, de acordo com o mÊtodo da unidade de crÊdito projetada, líquido dos ativos garantidores do plano, quando aplicåvel, sendo os custos referentes ao aumento do valor presente da obrigação, resultante do serviço prestado pelo empregado, reconhecidos durante o período laborativo dos empregados.

softwares e ågio por expectativa de rentabilidade futura (goodwill) decorrente de aquisição de participação com controle. O ågio decorrente de aquisição de participação em coligadas, controladas e controladas em conjunto Ê apresentado no investimento. Os bônus de assinatura são amortizados pelo mÊtodo de unidade produzida em relação às reservas provadas totais, enquanto que os demais intangíveis são amortizados linearmente pela vida útil estimada, exceto o goodwill que não Ê amortizado.

O mÊtodo da unidade de crÊdito projetada considera cada período de serviço como fato gerador de uma XQLGDGHDGLFLRQDOGHEHQHItFLRTXHVmRDFXPXODGDVSDUDRF{PSXWRGDREULJDomR¿QDO$GLFLRQDOPHQWH VmRXWLOL]DGDVRXWUDVSUHPLVVDVDWXDULDLVWDLVFRPRHVWLPDWLYDGDHYROXomRGRVFXVWRVFRPDVVLVWrQFLD mÊdica, hipóteses biológicas e econômicas e, tambÊm, dados históricos de gastos incorridos e de contribuição dos empregados.

A cessão onerosa de direitos de exploração tambÊm serå amortizada pelo o mÊtodo de unidades produzidas.

2VJDQKRVHSHUGDVDWXDULDLVGHFRUUHQWHVGHDMXVWHVFRPEDVHQDH[SHULrQFLDHQDVPXGDQoDVGDVSUHmissas atuariais, são incluídos ou excluídos, respectivamente, na determinação do compromisso atuarial líquido e são amortizados ao longo do período mÊdio de serviço remanescente dos empregados ativos de acordo com o mÊtodo corredor.

 'LIHULGR A Companhia manteve o saldo do ativo diferido de 31 de dezembro de 2008 no individual, que continuarå a ser amortizado em atÊ 10 anos, sujeito ao teste de redução ao valor recuperåvel de ativos impairment,

A Companhia tambÊm contribui para os planos nacionais de pensão e de seguridade social das controlaGDVLQWHUQDFLRQDLVFRPFDUDFWHUtVWLFDVGHFRQWULEXLomRGH¿QLGDFXMRVSHUFHQWXDLVVmREDVHDGRVQDIROKD de pagamento, sendo essas contribuiçþes levadas ao resultado quando incorridas.

em conformidade com a Lei 11.941/09.

 5HGXomRDRYDORUUHFXSHUiYHOGHDWLYRV,PSDLUPHQW $&RPSDQKLDDYDOLDRVDWLYRVGRLPRELOL]DGRGRLQWDQJtYHOFRPYLGD~WLOGHÂżQLGDHGRGLIHULGR LQGLYLGXDO  TXDQGRKiLQGLFDWLYRVGHQmRUHFXSHUDomRGRVHXYDORUFRQWiELO2VDWLYRVTXHWrPXPDYLGD~WLOLQGHÂżQLGD FRPRRiJLRSRUH[SHFWDWLYDGHUHQWDELOLGDGHIXWXUDWrPDUHFXSHUDomRGRVHXYDORUWHVWDGDDQXDOPHQWH independentemente de haver indicativos de perda de valor.

 6XEYHQo}HVHDVVLVWrQFLDVJRYHUQDPHQWDLV

Na aplicação do teste de redução ao valor recuperåvel de ativos, o valor contåbil de um ativo ou unidade geradora de caixa Ê comparado com o seu valor recuperåvel. O valor recuperåvel Ê o maior valor entre o valor líquido de venda de um ativo e seu valor em uso. Considerando-se as particularidades dos ativos da Companhia, o valor recuperåvel utilizado para avaliação do teste de redução ao valor recuperåvel Ê o YDORUHPXVRH[FHWRTXDQGRHVSHFL¿FDPHQWHLQGLFDGR

As subvençþes governamentais para investimentos sĂŁo reconhecidas como receita ao longo do perĂ­odo, confrontada com as despesas que pretende compensar em uma base sistemĂĄtica, aplicando-se na Petrobras da seguinte forma: Â&#x2021;6XEYHQo}HVFRPUHLQYHVWLPHQWRVQDPHVPDSURSRUomRGDGHSUHFLDomRGREHPH Â&#x2021;6XEYHQo}HVGLUHWDVUHODFLRQDGDVDROXFURGDH[SORUDomRGLUHWDPHQWHQRUHVXOWDGR 2VYDORUHVDSURSULDGRVQRUHVXOWDGRVHUmRGHVWLQDGRVjUHVHUYDGHLQFHQWLYRVÂżVFDLVQRSDWULP{QLROtTXLGR

1RYDVQRUPDVHLQWHUSUHWDo}HV Durante o exercĂ­cio de 2011, as seguintes normas, emitidas pelo IASB entraram em vigor, mas nĂŁo impactaram as demonstraçþes contĂĄbeis da Companhia: Â&#x2021;9HUVmRUHYLVDGDGR,$6Âł'LYXOJDo}HVGH3DUWHV5HODFLRQDGDV´ Related Party Disclosures  Â&#x2021;,)5,&Âł([WLQJXLQGR3DVVLYRV)LQDQFHLURVFRP,QVWUXPHQWRVGH3DWULP{QLR´ Extinguishing Financial Liabilities with Equity Instruments  Â&#x2021;(PHQGDGR,)5,&Âł3UpSDJDPHQWRVGH5HTXHULPHQWRVGH$SRUWHV0tQLPRV´ Prepayments of a Minimum Funding Requirement  Â&#x2021;(PHQGDGR,$6Âł&ODVVLÂżFDomRGH(PLVVmRGH'LUHLWRV´ &ODVVLÂżFDWLRQRI5LJKWV,VVXHV  As normas emitidas pelo IASB que ainda nĂŁo entraram em vigor e nĂŁo tiveram sua adoção antecipada pela Companhia atĂŠ 31 de dezembro de 2011 sĂŁo as seguintes: 1RUPDV

'HVFULomR

9LJrQFLD

Emenda ao IFRS 7

³'LYXOJDo}HV7UDQVIHUrQFLDVGH$WLYRV)LQDQFHLURV´ Disclosures: Transfers of Financial Assets 

Emenda ao IAS 12

â&#x20AC;&#x153;Impostos Diferidos: Recuperação de Ativos Subjacentesâ&#x20AC;? (Deferred Tax: Recovery of Underlying Assets (VWDEHOHFHFULWpULRVSDUDDSXUDomRGDEDVHÂżVFDOGHXPDWLYR

1Âş de janeiro de 2012

IFRS 10

â&#x20AC;&#x153;Demonstraçþes ContĂĄbeis Consolidadasâ&#x20AC;? (Consolidated Financial Statements (VWDEHOHFHRVSULQFtSLRVSDUDDSUHSDUDomRHDSUHVHQWDomRGHGHPRQVWUDo}HVFRQWiEHLV consolidadas, quando uma entidade controla uma ou mais outras entidades.

1Âş de janeiro de 2013

IFRS 11

â&#x20AC;&#x153;Acordos Conjuntosâ&#x20AC;? (Joint Arrangements (VWDEHOHFHRVSULQFtSLRVSDUDGLYXOJDomRGHGHPRQVWUDo}HVFRQWiEHLVGHHQWLGDGHVTXHVHMDPSDUWHVGHDFRUGRVFRQMXQWRV

1Âş de janeiro de 2013

IFRS 12

â&#x20AC;&#x153;Divulgaçþes de Participaçþes em Outras Entidadesâ&#x20AC;? (Disclosure of Interests in Other Entities &RQVROLGDWRGRVRVUHTXHULPHQWRVGHGLYXOJDo}HVTXHXPDHQWLGDGHGHYH fazer quando participa em uma ou mais outras entidades.

1Âş de janeiro de 2013

IFRS 13

â&#x20AC;&#x153;Mensuração a Valor Justoâ&#x20AC;? (Fair Value Measurement 'HÂżQHYDORUMXVWRH[SOLFDFRPRPHQVXUiORHGHWHUPLQDRTXHGHYHVHUGLYXOJDGRVREUHHVVDIRUPDGH mensuração.

1Âş de janeiro de 2013

Emenda ao IAS 1

â&#x20AC;&#x153;Apresentação de Itens dos Outros Resultados Abrangentesâ&#x20AC;? (Presentation of Items of Other Comprehensive Income $JUXSDPHP2XWURV5HVXOWDGRV$EUDQJHQWHVRV LWHQVTXHSRGHUmRVHUUHFODVVLÂżFDGRVSDUDOXFURVRXSUHMXt]RVQDGHPRQVWUDomRGHUHVXOWDGRGRH[HUFtFLR

1Âş de janeiro de 2013

Emenda ao IAS 19

â&#x20AC;&#x153;BenefĂ­cios a Empregadosâ&#x20AC;? ((PSOR\HH%HQHÂżWV (OLPLQDRPpWRGRGRFRUUHGRUSDUDUHFRQKHFLPHQWRGHJDQKRVRXSHUGDVDWXDULDVVLPSOLÂżFDDDSUHVHQWDomRGH YDULDo}HVHPDWLYRVHSDVVLYRVGHSODQRVGHEHQHItFLRVGHÂżQLGRVHDPSOLDRVUHTXHULPHQWRVGHGLYXOJDomR

1Âş de janeiro de 2013

Emenda ao IFRS 7

â&#x20AC;&#x153;Divulgaçþes â&#x20AC;&#x201C; Compensando Ativos e Passivos Financeirosâ&#x20AC;? (Disclosures â&#x20AC;&#x201C; Offesetting Financial Assets and Financial Liabilities (VWDEHOHFHUHTXHULPHQWRVGH GLYXOJDomRGHDFRUGRVGHFRPSHQVDomRGHDWLYRVHSDVVLYRVÂżQDQFHLURV

1Âş de janeiro de 2013

Emenda ao IFRS 9

³'DWD2EULJDWyULDGH(QWUDGDHP9LJRUGR,)56H'LYXOJDo}HVGH7UDQVLomR´ Mandatory Effective Date of IFRS 9 and Transition Disclosures 3RVWHUJDPDGDWDGH entrada em vigor do IFRS 9 para 2015. Eliminam tambÊm a obrigatoriedade de republicação de informaçþes comparativas e requerem divulgaçþes adicionais sobre a transição para o IFRS 9.

1Âş de janeiro de 2015

1Âş de julho de 2011

1RUPDVYLJHQWHVDSDUWLUGHH[HUFtFLRVLQLFLDGRVHPRXDSyVHVVDVGDWDV $&RPSDQKLDHVWiDYDOLDQGRRVLPSDFWRVGDHPHQGDDR,$6HPVXDVGHPRQVWUDo}HVFRQWiEHLV4XDQWRjVGHPDLVHPHQGDVHQRYDVQRUPDVOLVWDGDVDFLPDD&RPSDQKLDHVWLPDTXHVXDVDGRo}HVQmRWUDUmRLPSDFWRVVLJQL¿FDQWHV em suas demonstraçþes contåbeis.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-17

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA 

&DL[DHHTXLYDOHQWHVGHFDL[D

 $TXLVLo}HVHYHQGDVGHDWLYRV &RQVROLGDGR   3.731 3.294

Caixa e bancos .................................................... $SOLFDo}HVÂżQDQFHLUDV - No PaĂ­s Fundos de investimentos DI ........................... Outros fundos de investimentos .....................

&RQWURODGRUD   672 437

Companhia de Desenvolvimento de Plantas Utilidades S.A - CDPU Em 23 de dezembro de 2011, a Petrobras adquiriu 80% da Companhia de Desenvolvimento de Plantas Utilidades S.A - CDPU por R$ 20. Com essa transação a Companhia passa a deter 100% da CDPU.

10.301 4.275  17.440  

- No Exterior ..................................................... 7RWDOGDVDSOLFDo}HVÂżQDQFHLUDV ........................ 7RWDOGHFDL[DHHTXLYDOHQWHVGHFDL[D ............

11.262 1.750  13.110  

9.210 2.623  6.353  

10.119 325  9.114  

$VDSOLFDo}HV¿QDQFHLUDVQRSDtVVmRUHSUHVHQWDGDVSRUIXQGRVGHLQYHVWLPHQWRVFXMRVUHFXUVRVHVWmRDSOLFDGRV HPWtWXORVS~EOLFRVIHGHUDLVHDSOLFDo}HVHPTXRWDVGRIXQGRGHLQYHVWLPHQWRHPGLUHLWRVFUHGLWyULRV ),'& GR Sistema Petrobras. As aplicaçþes no exterior são compostas de time deposits com prazos de atÊ 3 meses e outros instrumentos de UHQGD¿[DGHFXUWRSUD]RUHDOL]DGDVFRPLQVWLWXLo}HVGHSULPHLUDOLQKD



 &RPELQDomRGHQHJyFLRV

7tWXORVHYDORUHVPRELOLiULRV &RQVROLGDGR  

&RQWURODGRUD  

Para negociação...............................................

16.785

25.651

16.785

25.588

DisponĂ­veis para venda .................................... Mantidos atĂŠ o vencimento...............................

5.479 291 

5.303 257 

5.210 6.849 

5.125 7.767 

&LUFXODQWH ........................................................

16.808

26.013

23.625

33.731

1mRFLUFXODQWH .................................................

5.747

5.198

5.219

4.749

2VWtWXORVGLVSRQtYHLVSDUDYHQGDLQFOXHP1RWDVGR7HVRXUR1DFLRQDO6pULH%QRYDORUGH5 5 QD&RQWURODGRUD HPGHGH]HPEURGHLQGH[DGDVDR,3&$FRPSDJDPHQWRGHFXSRQVVHPHVWUDLVGH DDHYHQFLPHQWRVHPHHHVWmRDSUHVHQWDGDVQRDWLYRQmRFLUFXODQWH3DUWHGHVVDV171%IRL

A CDPU ĂŠ uma central de utilidades que concentra as unidades de geração de energia elĂŠtrica e vapor, tratamento GHiJXDHGHHĂ&#x20AC;XHQWHVLQGXVWULDLVSDUDR&RPSOH[R3HWURTXtPLFRGR5LRGH-DQHLUR&203(5- Gas Brasiliano Distribuidora S.A. Em 29 de julho de 2011, a Petrobras GĂĄs S.A.- Gaspetro adquiriu 100% das açþes da Gas Brasiliano Distribuidora 6$*%'SRU5 HTXLYDOHQWHVD86PLOK}HV $DYDOLDomRGRYDORUMXVWRGRVDWLYRVHSDVVLYRVQmRIRL concluĂ­da, portanto, preliminarmente foi reconhecido um ĂĄgio de R$ 19. $RSHUDomRIRLDXWRUL]DGDSHODDJrQFLDUHJXODGRUDGH6mR3DXORHPDEULOGHHRDGLWLYRDRFRQWUDWRGH concessĂŁo da GBD foi assinado em julho de 2011, atendendo as condiçþes previstas no contrato celebrado com a Ente Nazionale Idrocarburi S.p.A. - ENI em 2010. A GBD possui a concessĂŁo do serviço de distribuição de gĂĄs natural na regiĂŁo noroeste do Estado de SĂŁo Paulo e o contrato de concessĂŁo teve inĂ­cio em dezembro de 1999 com duração de 30 anos, podendo ser prorrogado por mais 20 anos.

 $TXLVLomRGHSDUWLFLSDo}HVHPFRQWURODGDVHPFRQMXQWRHFR OLJDGDV BSBios Indústria e ComÊrcio de Biodiesel Sul Brasil S.A. Em 1º de julho de 2011, a Petrobras Biocombustível S.A. adquiriu 50% de participação societåria na BSBios Indústria e ComÊrcio de Biodiesel Sul Brasil S.A. mediante pagamento de R$ 133 da seguinte forma: R$ 76 em moeda corrente e aporte de R$ 57 referente a participação na BSBios Marialva Indústria e ComÊrcio de Biodiesel S.A. Avaliação dos ativos líquidos a valor justo - Nova Fronteira, Bioóleo, Braskem, Guarani e Total Canavieira Em 2010, a Companhia celebrou acordos de investimentos para ingresso no capital social das empresas Nova Fronteira %LRHQHUJLD6$%LRyOHR,QG~VWULDOH&RPHUFLDO/WGD%UDVNHP6$*XDUDQL6$H7RWDO$JURLQG~VWULD&DQDYLHLUD6$ Em 2011, as avaliaçþes dos ativos líquidos adquiridos a valor justo foram concluídas, conforme a seguir:

GDGDHPJDUDQWLDj3HWURVHPDSyVDVVLQDWXUDGR7HUPRGH&RPSURPLVVR)LQDQFHLURFRQIRUPHGHVFULWR

&RQWURODGDVHP FRQMXQWR

na Nota 21.

&ROLJDGDV

Os títulos para negociação referem-se principalmente a investimentos em títulos governamentais com prazos de vencimentos superiores a 90 dias e estão apresentados no ativo circulante considerando a expectativa de

1RYD )URQWHLUD

realização no curto prazo. Os títulos mantidos atÊ o vencimento na Controladora incluem investimentos no FIDC-NP relativo a direitos creditórios não performados de suas atividades operacionais no valor de R$ 6.840 em 31 de dezembro de 2011 e estão apresentados no ativo circulante.



&RQWDVDUHFHEHU

 &RQWDVDUHFHEHUOtTXLGDV &RQVROLGDGR   Clientes 7HUFHLURV................................................................. 3DUWHVUHODFLRQDGDV 1RWD

Subsidiårias, controladas e coligadas ................ Recebíveis do setor elÊtrico ............................... &RQWDVSHWUyOHRHiOFRRO671 .......................... Outras Perdas em crÊditos de liquidação duvidosa ............... &LUFXODQWH .................................................................. 1mRFLUFXODQWH ...........................................................

&RQWURODGRUD  

20.048

16.428

3.207

3.199

1.549 2.952 832 5.565  

  

1.116 3.145 822 4.671  

  

26.146 1.099 832 3.029  

  

40.127 2.315 822 2.733  

  

 0RYLPHQWDomRGDVSHUGDVHPFUpGLWRVGHOLTXLGDomRGXYLGRVD &RQVROLGDGR 6DOGRLQLFLDO.....................................................

&RQWURODGRUD

















Adiçþes .........................................................

586

356

 

Baixas/ ReversĂľes ........................................

238

 

 

169  

6DOGRÂżQDO ........................................................









&LUFXODQWH .........................................................

1.685

1.715

402

466

1mRFLUFXODQWH .................................................. 1.105 966  Inclui variação cambial sobre perdas em crÊditos de liquidação duvidosa constituída em empresas no exterior.

Contraprestação transferida pela compra .................................... Participação no valor justo dos ativos líquidos adquridos................. à gio por expectativa de rentabilidade futura - goodwill .................... Participação adquirida do capital  WRWDO  ...........................................

%LRyOHR

%UDVNHP

432

18

2.805

 

 

 

*XDUDQL 878  

7RWDO $JURLQ G~WULD &DQD YLHLUD

7RWDO

155



 



7

2

565

79

66

49,00%

50,00%

10,69%

31,44%

43,58%



A participação no valor justo dos ativos líquidos adquiridos inclui mais valia de imobilizado e intangível no montante GH5TXHHVWiFODVVL¿FDGDQRJUXSRGHLQYHVWLPHQWRVDVVLPFRPRRgoodwill no montante de R$ 719.

 $TXLVLomRGHSDUWLFLSDo}HVGHQmRFRQWURODGRUHV 6RFLHGDGHVGH3URSyVLWRV(VSHFtÂżFRV 63(

A Companhia exerceu opção de compra de SPE durante o exercício de 2011 que resultou num aumento de R$ 910 no patrimônio líquido atribuível aos seus acionistas, como contribuição adicional de capital, conforme a seguir: &RQWULEXLomR DGLFLRQDOGH 'DWDGDRSomR 5D]mRVRFLDOGD63( FDSLWDO 12/01/2011 Companhia Mexilhão do Brasil - CMB 112 11/11/2011 7UDQVSRUWDGRUD*DVHQH6$*DVHQH 789 09/12/2011 Companhia de Recuperação Secundåria - CRSec 9 910 $SDUWLUGHVVDRSomRGHFRPSUDD*DVHQH3DUWLFLSDo}HV/WGDDQWLJDFRQWURODGRUDGD7UDQVSRUWDGRUD*DVHQH deixou de ser consolidada na Petrobras. GDV Do}HV 100% 100% 100%

Innova S.A. Em 31 de março de 2011, a Petrobras passou a deter diretamente 100% do capital social da Innova, empresa SHWURTXtPLFDORFDOL]DGDQR3RORGH7ULXQIR 56 TXHHUDLQGLUHWDPHQWHFRQWURODGDSHOD3HWUREUDV$UJHQWLQD 3HVD 2YDORUGDRSHUDomRIRLGH86PLOK}HV HTXLYDOHQWHVD5 VHQGR86PLOK}HVSDJRV em abril de 2011 e US$ 104 milhþes com vencimento em 30 de outubro de 2013, corrigidos pela LIBOR (12 PHVHV DSDUWLUGDGDWDGDDVVLQDWXUDGRGRFXPHQWRGHFRPSUDHYHQGDGHDo}HV 63$ (VVDWUDQVDomRUHVXOWRX numa redução de R$ 90 no patrimônio atribuível aos acionistas da Petrobras, como resultado da redução da participação de não controladores neste empreendimento.

 9HQGDGHDWLYRVHRXWUDVLQIRUPDo}HV Cia EnergĂŠtica Suape II

&RQWDVDUHFHEHUYHQFLGRV &RQVROLGDGR

A Petrobras possui 20% de participação na EnergÊtica Suape II S.A, cujo objetivo Ê a construção de usina WHUPRHOpWULFDQRPXQLFtSLRGH&DERGH6DQWR$JRVWLQKR3(FRPSRWrQFLDGH0:2UHVWDQWHGDSDUWLFLSDomR  SHUWHQFHD1RYD&LEH(QHUJLD6$

&RQWURODGRUD









AtĂŠ 3 meses.................................

1.411

817

800

500

De 3 a 6 meses ...........................

215

162

82

56

De 6 a 12 meses .........................

264

211

64

41

Acima de 12 meses .....................

2.982

3.017

447

570



(VWRTXHV

Em 31 de maio de 2011, a Petrobras efetuou o depósito de R$ 48,4 referente às açþes não subscritas pela Nova Cibe, cujo exercício da opção de compra ocorreu em 5 de maio de 2011, conforme previsto no Acordo de Acionistas de Suape II. A Petrobras mantÊm o depósito como direito sobre aquisição de participação acionåria, no grupo investimentos, DWpUHVROXomRGDGLYHUJrQFLDHPVHGHGHDUELWUDJHP Albacora Japão Petróleo Ltda.

&RQVROLGDGR

&RQWURODGRUD









Em 6 de maio de 2011, a Petrobras exerceu a opção de compra dos ativos de produção de petróleo da SPE Albacora Japão Petróleo Ltda. pelo valor de R$ 10 mil. A partir desta opção de compra, a SPE deixou de ser consolidada na Petrobras, em função do cumprimento das obrigaçþes contratuais relacionadas.

Derivados de petrĂłleo ................................................

9.166

6.254

7.550

4.957

9HQGDGD5HÂżQDULDGH6DQ/RUHQ]RHSDUWHGDUHGHGHGLVWULEXLomRQD$UJHQWLQD

Ă lcool .........................................................................

782

477

289

123

9.948

6.731

7.839

5.080

MatĂŠrias-primas, principalmente petrĂłleo bruto .........

14.847

9.504

11.718

7.300

Materiais e suprimentos para manutenção ................

3.369

3.253

2.911

2.864

Produtos:

(PGHPDLRGHD&RPSDQKLDYHQGHXDWLYRVGHUHÂżQRHGLVWULEXLomRQD$UJHQWLQDj2LO&RPEXVWLEOHV6$ por US$ 102 milhĂľes, conforme acordo assinado em 2010. A operação, que estĂĄ sujeita a aprovação do ĂłrgĂŁo UHJXODGRUDUJHQWLQRFRPSUHHQGHXXPDUHÂżQDULDVLWXDGDHP6DQ/RUHQ]RQDSURYtQFLDGH6DQWD)pXPDSODQWD Ă&#x20AC;XYLDOUHGHGHFRPHUFLDOL]DomRGHFRPEXVWtYHLVYLQFXODGDjUHÂżQDULD DSUR[LPDGDPHQWHSRVWRVGHYHQGDH FOLHQWHVDWDFDGLVWDVDVVRFLDGRV EHPFRPRRVHVWRTXHVGHSHWUyOHRHGHULYDGRV

367

261

33

14









Logum LogĂ­stica S.A.

&LUFXODQWH ....................................................................

28.447

19.675

22.434

15.199

1mRFLUFXODQWH ............................................................. Inclui importaçþes em andamento.

84

74

67

59

Em 01 de março de 2011, a razĂŁo social da PMCC Soluçþes LogĂ­stica de Etanol S.A. foi alterada para Logum LogĂ­stica S.A., conforme acordo de acionistas, cuja composição acionĂĄria ĂŠ a seguinte: Petrobras - 20%; &RSHUVXFDU6$5Dt]HQ(QHUJLD6$2GHEUHFKW7UDQVSRUW3DUWLFLSDo}HV6$&DPDUJR Correa Ă&#x201C;leo e GĂĄs S.A.- 10%; e Uniduto LogĂ­stica S.A.- 10%.

Outros ...........................................................................



'HSyVLWRVMXGLFLDLV

A Logum serå responsåvel pela construção de um sistema logístico multimodal para transporte e armazenagem de etanol, desenvolvimento e operação do sistema que envolverå poliduto, hidrovias, rodovias e cabotagem.

Os depĂłsitos judiciais sĂŁo apresentados de acordo com a natureza das correspondentes causas: &RQVROLGDGR

Incorporação de Subsidiårias

&RQWURODGRUD

$WLYRQmRFLUFXODQWH









7UDEDOKLVWDV .................................

1.131

928

1.087

888

Fiscais .....................................

1.264

1.192

963

912

CĂ­veis ......................................

455

596

416

558

Outros ..........................................

105

74

98

68

   LĂ­quido de depĂłsito relacionado a processo judicial provisionado, quando aplicĂĄvel.



No exercício de 2011, as Assembleias Gerais Extraordinårias da Petrobras aprovaram a incorporação de subsidiårias ao seu patrimônio, sem aumento de capital, conforme a seguir: 'DWDGD$*( 31/01/2011 04/04/2011 19/12/2011

5D]mRVRFLDO &RPSHUM3HWURTXtPLFRV%iVLFRV6$H&RPSHUM3(76$ Companhia MexilhĂŁo do Brasil - CMB 7HUPRULR6$8VLQD7HUPHOpWULFDGH-XL]GH)RUD6$H)DIHQ(QHUJLD6$

(VVDVLQFRUSRUDo}HVYLVDPVLPSOLÂżFDUDHVWUXWXUDVRFLHWiULDHPLQLPL]DUFXVWRV


cyan magenta amarelo preto

E-18

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

Minas e Energia

Petróleo Brasileiro S.A. CNPJ Nº 33.000.167/0001-01 - COMPANHIA ABERTA  ,QYHVWLPHQWRV  ,QIRUPDo}HVVREUHDVVXEVLGLiULDVFRQWURODGDVFRQWURODGDVHPFRQMXQWRHFROLJDGDV 0LOKDUHVGHDo}HVTXRWDV &DSLWDO VXEVFULWRHP GHGH]HPEUR GH 6XEVLGLiULDVH&RQWURODGDV Petrobras Netherlands B.V. - PNBV ....................................................................................................................... Petrobras Gås S.A. - Gaspetro............................................................................................................................... Petrobras Distribuidora S.A. - BR ........................................................................................................................... Petrobras Química S.A. - Petroquisa ..................................................................................................................... 3HWUREUDV7UDQVSRUWH6$7UDQVSHWUR ................................................................................................................. 5H¿QDULD$EUHXH/LPD6$ ................................................................................................................................... Petrobras Biocombustível S.A. .............................................................................................................................. Companhia Locadora de Equipamentos Petrolíferos S.A. - CLEP ......................................................................... Petrobras International Finance Company - PifCo ................................................................................................. Downstream Participaçþes Ltda. ........................................................................................................................... 7HUPRPDFDp/WGD................................................................................................................................................. &RPSHUM3ROLROH¿QDV6$ ...................................................................................................................................... Petrobras International Braspetro - PIB BV ............................................................................................................ INNOVA S.A. ......................................................................................................................................................... 7HUPRFHDUi/WGD .................................................................................................................................................. Petrobras Comercializadora de Energia Ltda. - PBEN ........................................................................................... Baixada Santista Energia Ltda. .............................................................................................................................. Braspetro Oil Services Company - Brasoil ............................................................................................................. 7HUPRPDFDp&RPHUFLDOL]DGRUDGH(QHUJLD/WGD ................................................................................................... Sociedade Fluminense de Energia Ltda. - SFE ...................................................................................................... &RPSHUM(VWLUrQLFRV6$ ....................................................................................................................................... Comperj MEG S.A. ................................................................................................................................................ 5283 Participaçþes Ltda. ....................................................................................................................................... Breitener EnergÊtica S.A. ...................................................................................................................................... Cordoba Financial Services GmbH ........................................................................................................................ 7HUPREDKLD6$ .................................................................................................................................................... Petrobras Negócios Eletrônicos S.A. - E-Petro ...................................................................................................... Companhia de Desenvolvimento de Plantas Utilidades S.A. - CDPU..................................................................... Fundo de Investimento Imobiliårio RB Logística - FII ............................................................................................. Companhia de Recuperação Secundåria S.A. - CRSEC ....................................................................................... Comperj Participaçþes S.A. ................................................................................................................................... Braspetro Oil Company - BOC ............................................................................................................................... Cayman Cabiunas Investment Co. ........................................................................................................................

7.223 6.615 5.153 3.788 2.464 2.889 1.902 827 531 1.227 634 651 6 307 275 217 297 351 78 56 87 77 1.423 160 5 312 21 25 1 18

&RQWURODGDVHPFRQMXQWR 87(1RUWH)OXPLQHQVH6$ ................................................................................................................................... 7HUPRDoX6$ ....................................................................................................................................................... Logum Logística S.A. ............................................................................................................................................. Brasil PCH S.A....................................................................................................................................................... Cia EnergÊtica Manauara S.A. ............................................................................................................................... Ibiritermo S.A. ........................................................................................................................................................ Brasympe Energia S.A........................................................................................................................................... Participaçþes em Complexos BioenergÊticos S.A. - PCBIOS ................................................................................ 5H¿QDULDGH3HWUyOHR5LRJUDQGHQVH6$............................................................................................................... Eólica Mangue Seco 4 - Geradora e Comercializadora de Energia ElÊtrica S.A. .................................................... Eólica Mangue Seco 3 - Geradora e Comercializadora de Energia ElÊtrica S.A. .................................................... Eólica Mangue Seco 2 - Geradora e Comercializadora de Energia ElÊtrica S.A. .................................................... Brentech Energia S.A. ........................................................................................................................................... Eólica Mangue Seco 1 - Geradora e Comercializadora de Energia ElÊtrica S.A. .................................................... GNL do Nordeste Ltda. .......................................................................................................................................... &ROLJDGDV Braskem ................................................................................................................................................................ BRK - Investimentos Petroquímicos ...................................................................................................................... UEG Araucåria Ltda. .............................................................................................................................................. Fundo de Investimento em Participaçþes de Sondas............................................................................................. Sete Brasil Participaçþes S.A. ............................................................................................................................... 7HUPRHOpWULFD3RWLJXDU6$7(3 ......................................................................................................................... EnergÊtica SUAPE II.............................................................................................................................................. EnergÊtica Camaçari Muriçy I Ltda. ....................................................................................................................... Companhia EnergÊtica Potiguar S.A. .................................................................................................................... Arembepe Energia S.A. ......................................................................................................................................... BioenergÊtica Britarumã S.A..................................................................................................................................

$o}HV 2UGLQiULDV TXRWDV 26.057 3.103 42.853.453 13.508.637 2.464.466 2.889.240 190.239 180.000 300.050 1.226.500 634.015 65.108 2.837 57.600 275.226 216.852 297.136 106.210 77.599 55.556 8.739 7.696 1.422.603 160.000 1 52 21.000 25.001 117.127 43.456 1.771 1 100

$o}HV SUHIHUHQFLDLV

3DWULP{QLR OtTXLGR SDVVLYRD GHVFREHUWR  14.376 10.573 10.095 4.515 3.241 2.998 1.477 1.473 

1.146 743 651 461 374 319 270 241 216 115 104 87 77 55 46 42 41 28 25 11 9 8

775 12.978.886

5.747

481 700 300 109 45 8 26 63 15 40 39 35 39 34 1

481.432 699.737 430.556 94.188 45.000 7.652 260.000 62.850 5.158 39.918 38.911 35.353 25.901 35.433 7.507

8.043 2.432 707 259 270 37 140 67 8 90

451.669 269.193 707.440

261.573

16.500 6.159 139.977 67.260 1 90.218 110

/XFUROtTXLGR SUHMXt]R  GRH[HUFtFLR 3.666 823 1.267 

629 









177 1.255 39 41 45 



70 108

143 

7 2 8 

106

25.500 1.008 726 264 164 143 95 78 62 52 42 41 38 35 34

14.844

10.138

549 15 

50 27 35 8 

17 3 4 4 2

9.928

5.120 638 256 212 92 56 22 21 11

349.997











4 



11 

4XRWDV 4XDQWLGDGHGHDo}HVHPXQLGDGHV 'DGRVUHODWLYRVDĂ&#x2019;OWLPRVGLVSRQLELOL]DGRVDRPHUFDGR

 ,QYHVWLPHQWRV &RQVROLGDGR

 ,QYHVWLPHQWRVHPHPSUHVDVFRPDo}HVQHJRFLDGDVHPEROVDV 

&ROLJDGDVH&RQWURODGDVHPFRQMXQWR BRK Investimentos Petroquimicos S.A. ........................................................... Outros Investimentos PetroquĂ­micos ............................................................... Distribuidoras de GĂĄs ...................................................................................... Guarani S.A. .................................................................................................... 7HUPRDoX6$ ................................................................................................. Petroritupano - Orielo....................................................................................... Nova Fronteira Bionergia S.A. ......................................................................... Petrowayu - La ConcepciĂłn ............................................................................. Distrilec S.A. .................................................................................................... PetrokariĂąa - Mata ........................................................................................... UEG AraucĂĄria................................................................................................. 7UDQVLHUUD6$................................................................................................. Demais empresas coligadas e controladas em conjunto.................................. 2XWURV,QYHVWLPHQWRV ....................................................................................



&RWDomRHPEROVDGH YDORUHV 5SRUDomR

/RWHGHPLODo}HV 3.098 3.128 1.056 847 538 458 434 330 216 195 128 122 1.468  230 

3.271 3.224 960 680 524 413 243 327 228 212 128 101 1.098  183 

(PSUHVD





7LSR









678.396

678.396

ON

2,70

4,46

1.832

3.026





&RQWURODGDV Petrobras Argentina ............ &ROLJDGDV Braskem ..............................

212.427

212.427

ON

11,78

17,80

2.502

3.781

Braskem ..............................

75.793

75.793

PNA

12,80

20,37

970

1.544

46.049

PN





Quattor PetroquĂ­mica ........

6,99

322

Em 03 de fevereiro de 2011, ocorreu o cancelamento do registro na CVM de companhia aberta em função da incorporação das açþes pela Braskem. 2 YDORU GH PHUFDGR SDUD HVVDV Do}HV QmR UHĂ&#x20AC;HWH QHFHVVDULDPHQWH R YDORU GH UHDOL]DomR GH XP ORWH representativo de açþes.

 0XWDomRGRVLQYHVWLPHQWRV

5HVXOWDGR 6DOGRHP 

6XEVLGLiULDVHFRQWURODGDV PNBV ................................................................................................................................. Gaspetro ............................................................................................................................ Petrobras Distribuidora ...................................................................................................... Petroquisa ......................................................................................................................... 7UDQVSHWUR ......................................................................................................................... 5HÂżQDULD$EUHXH/LPD ...................................................................................................... CLEP ................................................................................................................................. PBIO .................................................................................................................................. Downstream ...................................................................................................................... 7HUPRPDFDp/WGD.............................................................................................................. &203(5-3ROLROHÂżQDV ...................................................................................................... PIBBV ................................................................................................................................ INNOVA ............................................................................................................................. 7HUPRFHDUi ....................................................................................................................... PBEN ................................................................................................................................. Baixada Santista ................................................................................................................ SFE.................................................................................................................................... &203(5-(VWLUrQLFRV....................................................................................................... COMPERJ MEG ................................................................................................................ 7HUPRULR ............................................................................................................................ &203(5-3(7 ................................................................................................................. 87(-XL]GH)RUD ............................................................................................................... FAFEN ............................................................................................................................... COMPERJ PetroquĂ­micos ................................................................................................. Outras Controladas............................................................................................................ &RQWURODGDVHP&RQMXQWR ............................................................................................... &ROLJDGDV .........................................................................................................................

9DORUGH PHUFDGR

                           

$TXLVLomR HDSRUWHGH FDSLWDO 1.726

&RQWULEXLomR $GLFLRQDO GH&DSLWDO

%DL[DSRU LQFRUSRUDomR 5HGXomR GHFDSLWDO

(TXLYDOrQFLD SDWULPRQLDO

2XWURV UHVXOWDGRV DEUDQJHQWHV

3.524 824 1.267 

624 







177

705

915 392 1.721 506

'LYLGHQGRV

1.617 4 20 18





96 

3 



342 551

550 39 41 45 

108



14









11

37 112  

120 

 

SubsidiĂĄrias, controladas em conjunto e coligadas.................................................................................................................................................. Ă gio .......................................................................................................................................................................................................................... Lucros nĂŁo realizados da Controladora.................................................................................................................................................................... Outros investimentos ................................................................................................................................................................................................ 7RWDOGRVLQYHVWLPHQWRV ........................................................................................................................................................................................













 



300 36 87 1 196 118 

  55.323 3.056 

200 



34 













6DOGRHP                               49.715 2.242 

148 


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-19

Minas e Energia

Petróleo Brasileiro S.A. CNPJ Nº 33.000.167/0001-01 - COMPANHIA ABERTA  ,QIRUPDo}HVFRQWiEHLVUHVXPLGDVGHFRQWURODGDVHPFRQMXQWRHFROLJDGDV $&RPSDQKLDLQYHVWHHPFRQWURODGDVHPFRQMXQWRHFROLJDGDVQRSDtVHH[WHULRUFXMDVDWLYLGDGHVHVWmRUHODFLRQDGDVDHPSUHVDVSHWURTXtPLFDVGLVWULEXLGRUDVGHJiVELRFRPEXVWtYHLVWHUPRHOpWULFDVUH¿QDULDVHRXWUDV$VLQIRUPDçþes contåbeis resumidas são as seguintes:

Ativo circulante ........................................................................................................................................................................................................... Ativo realizåvel a longo prazo...................................................................................................................................................................................... Imobilizado ................................................................................................................................................................................................................. Outros ativos não circulantes ...................................................................................................................................................................................... Passivo circulante ....................................................................................................................................................................................................... Passivo não circulante ................................................................................................................................................................................................ Patrimônio líquido ....................................................................................................................................................................................................... Participação dos acionistas não controladores ........................................................................................................................................................... Receita operacional líquida......................................................................................................................................................................................... Lucro líquido do exercício ........................................................................................................................................................................................... Percentual de participação - %....................................................................................................................................................................................

 &RQWURODGDVHPFRQMXQWR 3DtV ([WHULRU 4.520 1.235 1.497 382 7.653 2.345 131 832   3.107 2.073 3.747 1.485 6.927 1.049 20 187   9.243 3.276 1.418 231 10% a 83% 33% a 51%

&ROLJDGDV 3DtV 12.181 3.967 23.017 4.390  10.253 20.546 12.539 217  36.033 

10% a 44%

([WHULRU 3.358 752 2.243  3.187 373 2.793  1.765 433 22% a 36%

 ,PRELOL]DGR  3RUWLSRGHDWLYRV &RQVROLGDGR

6DOGRHPÂ&#x17E;GHMDQHLURGH........................................................................................................ Adiçþes .............................................................................................................................................. Juros capitalizados ............................................................................................................................ Combinação de negĂłcios .................................................................................................................. Baixas ................................................................................................................................................ 7UDQVIHUrQFLDV ................................................................................................................................... Depreciação, amortização e depleção ............................................................................................... Impairment - constituição ................................................................................................................... Impairment - reversĂŁo ........................................................................................................................ Ajuste acumulado de conversĂŁo ........................................................................................................ 6DOGRHPGHGH]HPEURGH.................................................................................................. Custo ................................................................................................................................................. Depreciação, amortização e depleção acumulada............................................................................. 6DOGRHPGHGH]HPEURGH.................................................................................................. Adiçþes .............................................................................................................................................. Juros capitalizados ............................................................................................................................ Combinação de negĂłcios .................................................................................................................. Baixas ................................................................................................................................................ 7UDQVIHUrQFLDV ................................................................................................................................... Depreciação, amortização e depleção ............................................................................................... Impairment - constituição ................................................................................................................... Impairment - reversĂŁo ........................................................................................................................ Ajuste acumulado de conversĂŁo ........................................................................................................ 6DOGRHPGHGH]HPEURGH.................................................................................................. Custo ................................................................................................................................................. Depreciação, amortização e depleção acumulada............................................................................. 6DOGRHPGHGH]HPEURGH.................................................................................................. 7HPSRGHYLGD~WLOPpGLRSRQGHUDGRHPDQRV ..............................................................................

7HUUHQRV HGLÂżFDo}HV HEHQIHLWRULDV  220

(TXLSDPHQWRV HRXWURVEHQV  2.827

87 

1.886 

100 

34.207 



131 

 160.543 

 2.730

31  12.412 

 169 

4.205 

3 66  16.865  

  D  H[FHWRWHUUHQRV

&RQWURODGRUD

*DVWRVFH[SORUDomRH GHVHQY3URGXomR GHSHWUyOHRHJiV $WLYRVHP FDPSRVSURGXWRUHV

FRQVWUXomR

  57.546 3.157 5.508 25 





7.899 



408 



  138.578 77.555 

  53.690 3.139 7.325 24 





14.812 





66 1.733 789   158.559 97.671 

  MĂŠtodo da unidade produzida



31.283 



27 3.548  195.977 

  D

7RWDO  63.750 5.508 212 

4.992 

 

539 

 389.088 

 59.728 7.325 24 

10.006 



96 6.136  469.072 



7RWDO  49.506 4.223 





 

538  271.824 

 42.222 5.788 

4.531 



61  321.469 



Inclui ativos de exploração e desenvolvimento da produção de petróleo e gás. (P  GH GH]HPEUR GH  R LPRELOL]DGR GR &RQVROLGDGR H GD &RQWURODGRUD LQFOXL EHQV GHFRUUHQWHV GH FRQWUDWRV GH DUUHQGDPHQWR TXH WUDQV¿UDP RV EHQHItFLRV ULVFRV H FRQWUROHV QR PRQWDQWH GH 5  H GH 5UHVSHFWLYDPHQWH 5H5HPGHGH]HPEURGH 

 $EHUWXUDSRUWHPSRGHYLGD~WLOHVWLPDGD&RQVROLGDGR (GLÂżFDo}HVHEHQIHLWRULDVHTXLSDPHQWRVHRXWURVEHQV 9LGD~WLOHVWLPDGD atĂŠ 5 anos 6 - 10 anos 11 - 15 anos 16 - 20 anos 21 - 25 anos 25 - 30 anos 30 anos em diante MĂŠtodo da Unidade Produzida (GLÂżFDo}HVHEHQIHLWRULDV Equipamentos e outros bens

&XVWR 8.088 33.005 3.347 39.665 44.826 41.072 5.086 36.152  15.264 195.977

6DOGRHP GHGH]HPEURGH 3.360 16.855 1.765 23.723 33.786 35.286 1.749 18.715  10.758 124.481

'HSUHFLDomR$FXPXODGD 





















 'HSUHFLDomR &RQVROLGDGR  Parcela absorvida no custeio: De bens ................................................................................................................................................................................................ De gastos de exploração e produção .................................................................................................................................................... Custo para abandono de poços capitalizado/ provisionado................................................................................................................................ Parcela registrada diretamente no resultado.........................................................................................................................................

9.165 6.126 440  1.403 17.134

&RQWURODGRUD 

 7.130 5.344 386  1.138 13.998

5.890 5.112 396  946 12.344

 4.752 4.326 327  744 10.149

 5HGXomRDRYDORUUHFXSHUiYHOGHDWLYR ([SORUDomRH3URGXomR A avaliação de recuperabilidade dos ativos resultou em uma perda de R$ 473 que estå relacionada, principalmente, aos ativos em produção no Brasil. Os campos de Petróleo e Gås Natural que apresentaram perdas encontram-se no estågio de maturidade de sua vida útil e, considerando os níveis de suas produçþes futuras e as suas estruturas de custos, indicaram a necessidade de redução ao seu valor recuperåvel. Esta avaliação tambÊm apontou que a perda por desvalorização, reconhecida em períodos anteriores para alguns Campos de Petróleo e Gås Natural, diminuiu ou deixou de existir, considerando, principalmente, o gerenciamento de reservatório que resultou em incremento da recuperação dos reservatórios, o que resultou em uma reversão no montante de R$ 61. $EDVWHFLPHQWR Face à redução das margens dos produtos no Complexo Petroquímica Suape em seus mercados de atuação, bem como ao aumento no investimento total dos projetos, o valor contåbil do imobilizado foi determinado como maior que o seu valor recuperåvel e um ajuste para redução ao valor recuperåvel de R$ 109 em Petroquímica Suape e R$ 167 em Citepe foi reconhecido.

 ,QWDQJtYHO  3RUWLSRGHDWLYRV &RQVROLGDGR 6RIWZDUHV

6DOGRHPÂ&#x17E;GHMDQHLURGH........................................................................................................................................... Adição................................................................................................................................................................................... Direito de exploração de petrĂłleo - CessĂŁo onerosa ............................................................................................................. Aquisição por combinação de negĂłcios Juros capitalizados ............................................................................................................................................................... Baixa..................................................................................................................................................................................... 7UDQVIHUrQFLDV ...................................................................................................................................................................... Amortização.......................................................................................................................................................................... "Impairment" - constituição ................................................................................................................................................... Ajuste acumulado de conversĂŁo ........................................................................................................................................... 6DOGRHPGHGH]HPEURGH..................................................................................................................................... Adição................................................................................................................................................................................... Aquisição por combinação de negĂłcios ................................................................................................................................ Juros capitalizados ............................................................................................................................................................... Baixa..................................................................................................................................................................................... 7UDQVIHUrQFLDV ...................................................................................................................................................................... Amortização.......................................................................................................................................................................... "Impairment" - constituição ................................................................................................................................................... Ajuste acumulado de conversĂŁo ........................................................................................................................................... 6DOGRHPGHGH]HPEURGH ..................................................................................................................................... 7HPSRGHYLGD~WLOHVWLPDGRDQRV ...................................................................................................................................

'LUHLWRVH &RQFHVV}HV  310 74.808

$GTXLULGRV  88

'HVHQYROYLGRV ,QWHUQDPHQWH  321

 

234  

 

 

 829







26  

32  



 110

 336

 

22  

 

277  25



19 

36  

 

 

6  5

 5

&RQWURODGRUD Ă&#x2C6;JLRFRP H[SHFWDWLYD GHUHQWD ELOLGDGHIXWXUD  ÂłJRRGZLOO´



84

 

 19 4

 

24  ,QGHÂżQLGD

7RWDO  719 74.808 26 

339 





 1.294 4 36 

1 



307 

7RWDO  455 74.808 25  

14  

 411 36  

 

 




cyan magenta amarelo preto

E-20

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA  'HYROXomRj$13GHiUHDVQDIDVHGHH[SORUDomR

 'LUHLWRGHH[SORUDomRGHSHWUyOHR&HVVmRRQHURVD

1RH[HUFtFLRGHRVGLUHLWRVVREUHRVEORFRVH[SORUDWyULRVGHYROYLGRVSDUDD$JrQFLD1DFLRQDOGR 3HWUyOHR*iV1DWXUDOH%LRFRPEXVWtYHLV$13WRWDOL]DUDP5 5HP HVmRRVVHJXLQWHV Â&#x2021;%ORFRV&RQFHVVmRH[FOXVLYDGD3HWUREUDV

Em 31 de dezembro de 2011, o ativo intangĂ­vel da Companhia inclui contrato de cessĂŁo onerosa no valor GH5FHOHEUDGRHPFRPD8QLmR)HGHUDOFHGHQWHHD$JrQFLD1DFLRQDOGH3HWUyOHR*iV 1DWXUDOH%LRFRPEXVWtYHLV$13UHJXODGRUDHÂżVFDOL]DGRUDUHIHUHQWHDRGLUHLWRGHH[HUFHUDWLYLGDGHV

%DFLDGR5LRGR3HL[H5,237 - Bacia de Santos: S-M-613, S-M-1356, S-M-1480. - Bacia de Pelotas Mar: P-M-1267, P-M-1349. %DFLDGR3RWLJXDU3277

GHSHVTXLVDHODYUDGHSHWUyOHRGHJiVQDWXUDOHRXWURVKLGURFDUERQHWRVĂ&#x20AC;XLGRVORFDOL]DGRVHPEORFRVQD iUHDGR3Up6DO )UDQFR)ORULP1RUGHVWHGH7XSL(QWRUQRGH,DUD6XOGH*XDUiH6XOGH7XSL OLPLWDGR Ă produção de cinco bilhĂľes de barris equivalentes de petrĂłleo em atĂŠ 40 anos.

Â&#x2021;%ORFRVHPSDUFHULD GHYROYLGRVSHOD3HWUREUDVRXSHORVVHXVRSHUDGRUHV 

Em 8 de fevereiro de 2012, a Companhia concluiu a perfuração do primeiro poço da cessão onerosa, cujos

- Bacia de Santos: S-M-1227. S-M-792, S-M-791, S-M-1162, S-M-320, S-M-1163, S-M-731. - Bacia do EspĂ­rito Santo 7HUUD(67

resultados comprovaram a extensão dos reservatórios de óleo localizados a noroeste do poço descobridor da årea de Franco. Em seguida a Petrobras realizarå um teste de formação para avaliar a produtividade e darå continuidade às atividades e investimentos previstos no contrato. O contrato de concessão dos direitos estabelece que na Êpoca da declaração de comercialidade das

 'HYROXomRj$13GHFDPSRVGHSHWUyOHRHJiVQDWXUDORSHUDGRV SHOD3HWUREUDV

reservas haverå revisão de volumes e preços, baseada em laudos tÊcnicos independentes.

No exercĂ­cio de 2011, a Petrobras devolveu Ă ANP o Campo de Mutum, localizado na Bacia de Sergipe/ Alagoas.

Caso a revisão venha determinar que os direitos adquiridos alcancem um valor maior do que o inicialmente pago, a Companhia poderå pagar a diferença à União Federal, reconhecendo essa diferença como um

 &RQFHVVmRGHVHUYLoRVGHGLVWULEXLomRGHJiVQDWXUDOFDQDOL]DGR

ativo intangĂ­vel ou reduzir o volume total adquirido nos termos do contrato. Se a revisĂŁo determinar que os direitos adquiridos resultem em um valor menor do que o inicialmente pago pela Companhia, a UniĂŁo

Em 31 de dezembro de 2011, o ativo intangível inclui contratos de concessão de distribuição de gås natural canalizado no Brasil no total de R$ 456, com prazos de vencimentos entre 2029 e 2043, podendo VHUSURUURJDGR$VFRQFHVV}HVSUHYrHPDGLVWULEXLomRSDUDRVVHWRUHVLQGXVWULDOUHVLGHQFLDOFRPHUFLDO veicular, climatização, transportes e outros.

Federal irå reembolsar a diferença, em moeda corrente ou títulos, sujeito às leis orçamentårias. Quando os efeitos da referida revisão se tornarem provåveis e mensuråveis, a Companhia efetuarå os

A remuneração pela prestação de serviços consiste, basicamente, na combinação de custos e despesas operacionais e remuneração do capital investido. As tarifas cobradas pelo volume de gås distribuído estão sujeitas a reajustes e revisþes periódicas com o órgão regulador estadual.

respectivos ajustes aos preços de aquisição. 2FRQWUDWRSUHYrDLQGDFRPSURPLVVRVPtQLPRVTXDQWRjDTXLVLomRGHEHQVHVHUYLoRVGHIRUQHFHGRUHV brasileiros nas fases de exploração e desenvolvimento da produção que serão objeto de comprovação

$R¿QDOGDVFRQFHVV}HVRVFRQWUDWRVSUHYrHPLQGHQL]DomRj&RPSDQKLDGRVLQYHVWLPHQWRVYLQFXODGRV a bens reversíveis, conforme levantamentos, avaliaçþes e liquidaçþes a serem realizadas com o objetivo de determinar o valor.

junto à ANP. No caso de descumprimento, a ANP poderå aplicar sançþes administrativas e pecuniårias previstas no contrato.

 $WLYLGDGHVGHH[SORUDomRHDYDOLDomRGHUHVHUYDGHSHWUyOHRHJiV $VDWLYLGDGHVGHH[SORUDomRHDYDOLDomRDEUDQJHPDEXVFDSRUUHVHUYDVGHSHWUyOHRHJiVGHVGHDREWHQomRGRVGLUHLWRVOHJDLVSDUDH[SORUDUXPDiUHDHVSHFtÂżFDDWpDGHFODUDomRGDYLDELOLGDGHWpFQLFDHFRPHUFLDOGDVUHVHUYDV Os montantes envolvidos nessas atividades sĂŁo os seguintes: &RQVROLGDGR 

&RQWURODGRUD 





6DOGRVFDSLWDOL]DGRVQRDWLYR IntangĂ­vel ............................................................................................................................................................................................................................................ Imobilizado.......................................................................................................................................................................................................................................... 7RWDOGRDWLYR.......................................................................................................................................................................................................................................

78.167 19.623 

78.400 15.729 

75.990 11.145 

76.221 9.309 

&XVWRVH[SORUDWyULRVUHFRQKHFLGRVQRUHVXOWDGR Despesas com geologia e geofĂ­sica ....................................................................................................................................................................................................  3URMHWRVVHPYLDELOLGDGHHFRQ{PLFD LQFOXLSRoRVVHFRVHE{QXVGHDVVLQDWXUD ................................................................................................................................ Outras despesas exploratĂłrias ........................................................................................................................................................................................................... 7RWDOGDVGHVSHVDVQRH[HUFtFLR .......................................................................................................................................................................................................

1.723 2.504 170 

1.421 2.081 302 

1.400 2.243

1.113 1.495





&DL[DXWLOL]DGRQDVDWLYLGDGHV Operacionais....................................................................................................................................................................................................................................... Investimentos...................................................................................................................................................................................................................................... 7RWDOGRFDL[DXWLOL]DGRQRH[HUFtFLR .................................................................................................................................................................................................

1.856 10.736 

1.395 15.600 

1.400 8.942 

1.113 14.297 

 )RUQHFHGRUHV &RQVROLGDGR

&RQWURODGRUD









7.418

3DVVLYRFLUFXODQWH 7HUFHLURV PaĂ­s ...............................................................................................................................................................................................................................................

12.259

10.200

9.252

Exterior ..........................................................................................................................................................................................................................................

9.159

6.511

3.016

2.150

3DUWHVUHODFLRQDGDV 1RWD ........................................................................................................................................................................................................

834

663

10.333

14.179









 )LQDQFLDPHQWRV &RQVROLGDGR &LUFXODQWH  1RH[WHULRU ,QVWLWXLo}HV¿QDQFHLUDV ..................................................................................................................... Obrigaçþes ao portador - Notes, Global Notes e Bonds .................................................................. 7UXVW&HUWL¿FDWHVSenior/Junior ..................................................................................................... Outros ............................................................................................................................................... 1R3DtV Notas de CrÊdito à Exportação ........................................................................................................ BNDES ............................................................................................................................................. 'HErQWXUHV ....................................................................................................................................... FINAME ............................................................................................................................................ CÊdula de CrÊdito Bancårio ............................................................................................................. &HVV}HVGHGLUHLWRVFUHGLWyULRVQmRSHUIRUPDGRV¹),'&13 1RWD ....................................... Outros ...............................................................................................................................................

-XURVVREUHÂżQDQFLDPHQWRV.............................................................................................................. 3DUFHODFLUFXODQWHGRVÂżQDQFLDPHQWRVGHORQJRSUD]R SULQFLSDO ................................................... Financiamentos de curto prazo ........................................................................................................

13.641 803



&RQWURODGRUD 1mR&LUFXODQWH  

&LUFXODQWH 



1mR&LUFXODQWH  

37.590 39.441 5 190 

29.368 19.252 318 167 

344

201 747

13.163 2.182

11.973

12 

10.623 1.045 117 2 









135 1.719 1.853 79 51

110 2.048 315 71 53

12.982 37.385 993 731 3.606

10.489 32.282 2.377 387 3.606

135 303 1.700 79 52 9.639

110 182 141 71 54 15.933

12.982 10.224 167 731 3.606

10.495 8.254 1.715 387 3.606

591   1.648 6.921 10.315 

531   1.448 4.782 8.685 

3.482  

2.421  

  514 2.099 9.639 

  592 914 15.933 

 

 

 9HQFLPHQWRVGRSULQFLSDOHMXURVGRVÂżQDQFLDPHQWRV QRSDVVLYRQmRFLUFXODQWH

 7D[DVGHMXURVGRVÂżQDQFLDPHQWRVQRSDVVLYRQmRFLUFXODQWH &RQVROLGDGR 

 &RQVROLGDGR

&RQWURODGRUD

2013........................................................................

4.477

2.716

2014........................................................................

8.324

1.851

2015........................................................................

10.041

2.843

2016........................................................................

24.887

12.878

2017 em diante .......................................................

88.676

22.767

7RWDO .......................................................................





1RH[WHULRU AtĂŠ 6% ................................. De 6 a 8% ............................ De 8 a 10% .......................... De 10 a 12% ........................ Acima de 12% ...................... 1R3DtV AtĂŠ 6% ................................. De 6 a 8% ............................ De 8 a 10% .......................... De 10 a 12% ........................ Acima de 12% ......................



&RQWURODGRUD 



59.202 15.729 2.211 63 21 

36.705 10.817 1.366 55 162 

14.709 636

11.912 61





5.383 32.311 3.621 17.672 192  

3.907 29.999 986 16.670

465 9.559 1.098 16.588

387 8.254 234 15.582

 

 

 

 6DOGRVSRUPRHGDVQRSDVVLYRQmRFLUFXODQWH

DĂłlar norte-americano ........................................................................................................................................................................................ Iene..................................................................................................................................................................................................................... Euro .................................................................................................................................................................................................................... 5HDO ................................................................................................................................................................................................................ Outras .................................................................................................................................................................................................................

&RQVROLGDGR  68.012 2.897 4.681 58.824 1.991 

 46.440 2.734 214 51.183 96 

&RQWURODGRUD  14.451 72

 11.852 122

28.532

24.456





(PGHGH]HPEURGHLQFOXL5GH¿QDQFLDPHQWRVHPPRHGDQDFLRQDOSDUDPHWUL]DGRjYDULDomRGRGyODUHWDPEpPXP¿QDQFLDPHQWRQRH[WHULRUHPUHDLVSDUDPHWUL]DGRjYDULDomRGR,*30 As operaçþes de hedge, contratadas para cobertura de Notes emitidos no exterior em moedas estrangeiras, e o valor justo dos emprÊstimos de longo prazo estão divulgados nas Notas 31 e 32 respectivamente.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-21

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA 7D[DPpGLDSRQGHUDGDGDFDSLWDOL]DomRGHMXURV $WD[DPpGLDSRQGHUDGDGRVHQFDUJRVÂżQDQFHLURVGDGtYLGDXWLOL]DGDSDUDFDSLWDOL]DomRGHMXURVVREUHRVDOGRGHREUDVHPDQGDPHQWRIRLGHDDHP DDHP 

&DSWDo}HV 2VHPSUpVWLPRVH¿QDQFLDPHQWRVVHGHVWLQDPSULQFLSDOPHQWHDRGHVHQYROYLPHQWRGHSURMHWRVGHSURGXomRGHyOHRHJiVjFRQVWUXomRGHQDYLRVHGHGXWRVEHPFRPRjDPSOLDomRGHXQLGDGHVLQGXVWULDLV As principais captaçþes de longo prazo realizadas em 2011 são as seguintes: D 1RH[WHULRU 9DORU 5PLOK}HV HTXLYDOHQWHV

(PSUHVD

'DWD

9HQFLPHQWR

PifCo ..................................................................

jan/11

10.029

2016, 2021 e 2041

Charter...............................................................

jan/11

1.264

2018

PNBV .................................................................

mar/11

1.079

2015 e 2021

PNBV .................................................................

jun/11

3.175

2018

PNBV .................................................................

ago/11

1.027

2016 e 2023

PNBV .................................................................

dez/11

459

PifCo ..................................................................

dez/11

4.485

PifCo ..................................................................

dez/11

2018

(PSUpVWLPRFRP%DQN2I7RN\R0LWVXELVKLQRPRQWDQWHGH86PLOK}HV/LERUPDLVDDHFRP Banco Santander S.A., HSBC Bank PLC, HSBC Bank USA, N.A. e SACE S.P.A. no montante de US$ 500 milhĂľes - Libor mais 1,10% a.a. EmprĂŠstimos com Banco Santander S.A. e Grand Cayman Branch de US$ 1,500 milhĂľes - Libor mais DDHFRPR%DQNRI7RN\R0LWVXELVKLGH86PLOK}HV/LERUPDLVDD EmprĂŠstimos com Banco JP Morgan Chase Bank,N.A, Export-Import Bank of the United States no montante de US$ 300 milhĂľes - Libor mais 0,45% a.a.; e com Banco Citibank International PLC no montante de US$ 343 milhĂľes - Libor mais 0,85% a.a. EmprĂŠstimo com o Banco Export Development CanadĂĄ de US$ 250 milhĂľes - Libor mais 1,40% a.a.

2018 e 2022

1.990 

'HVFULomR Global notes nos montantes de US$ 2,500 milhĂľes, US$ 2,500 e US$ 1,000 milhĂľes com cupom de 3,875% a.a., 5,375% a.a., e 6,75% a.a. respectivamente. EmprĂŠstimo com Standard Shatered no montante de US$ 750 milhĂľes - Libor mais 1,5% a.a.

2026

Global notes nos montantes de â&#x201A;Ź 1.250 milhĂľes e â&#x201A;Ź 600 milhĂľes com cupom de 4,875% a.a., e 5,875% a.a. respectivamente. Global notes no montante de Â&#x2026; 700 milhĂľes com cupom de 6,25% a.a.

E 1RSDtV (PSUHVD PetroquĂ­micas Citepe e Suape ......................... Petrobras .........................................................

'DWD maio/11 a dez/11 jul/11

9DORU 1.056 1.023

Fundo de Invest. ImobiliĂĄrio - FII FCM .............

out/11

444

2023

Petrobras ..........................................................

nov/11

2.500

2018

Financiamento obtido com a Caixa Econômica Federal, atravÊs da emissão de Notas de CrÊdito à Exportação, com taxa de 111,29% da mÊdia do CDI.

Refap ................................................................

mar/11 a dez/11

2018 e 2022

)LQDQFLDPHQWRVFRPR%1'(6GH57-/3PDLVDDHDDHVXEVFULomRGHGHErQWXUHV de R$ 202 - 1,96% a.a. acima da cesta de moedas do BNDES.

487

9HQFLPHQWR 2022 e 2023 2022

'HVFULomR )LQDQFLDPHQWRVFRPR%1'(6SDUDLPSODQWDomRGHXQLGDGHLQGXVWULDO7-/3PDLVDDHDD )LQDQFLDPHQWRFRPR%1'(6GHVWLQDGRDFRQVWUXomRGDSODWDIRUPDGH0H[LOKmR7-/3PDLVDD (PLVVmRGHFpGXODVGHFUpGLWRLPRELOLiULRVSDUDFRQVWUXomRGHQRYDVEDVHVHDPSOLDomRGDIiEULFDGHOXEULÂżcantes da BR Distribuidora â&#x20AC;&#x201C; IPCA mais 2,1%a.a.



)LQDQFLDPHQWRVFRPDJrQFLDVRÂżFLDLVOLQKDVGHFUpGLWR D 1RH[WHULRU (PSUHVD $JrQFLD Petrobras ......................................................... China Development Bank PNBV ............................................................... Citibank International PLC

9DORUHP86PLOK}HV &RQWUDWDGR 8WLOL]DGR 10.000 7.000 686 343

6DOGR 3.000 343

'HVFULomR Libor mais 2,8%a.a. Libor mais 0,85%a.a.

&RQWUDWDGR

8WLOL]DGR

6DOGR

9.005

568

8.437

1.109 300 1.166

285

824 300 110

'HVFULomR 3URJUDPD GH 0RGHUQL]DomR H ([SDQVmR GD )URWD 3520()  Âą 7-/3 PDLV  DD SDUD equipamentos nacionais e 3% a.a. para equipamentos importados. 7-/3PDLVDDHDD CĂŠdula de CrĂŠdito BancĂĄrio â&#x20AC;&#x201C; 110% da MĂŠdia do CDI. ,PSODQWDomRGHXQLGDGHLQGXVWULDOÂą7-/3PDLVDDHDD

E 1RSDtV (PSUHVD 7UDQVSHWUR



$JrQFLD

.................................................... BNDES

Refap ............................................................... BNDES Petrobras ......................................................... Caixa EconĂ´mica Federal PetroquĂ­micas Citepe e Suape ........................ BNDES

1.056

 )RUDPDVVLQDGRVFRQWUDWRVGHFRPSUDHYHQGDGHQDYLRVHFRPERLRVFRPHVWDOHLURVQDFLRQDLVQRPRQWDQWHGH5VHQGRÂżQDQFLDGRVSHOR%1'(6%DQFRGR%UDVLOH&DL[D(FRQ{PLFD

*DUDQWLDV $VLQVWLWXLo}HVÂżQDQFHLUDVQRH[WHULRUQmRUHTXHUHPJDUDQWLDVj3HWUREUDV2VÂżQDQFLDPHQWRVFRQFHGLGRVSHOR%1'(6HVWmRJDUDQWLGRVSHORVEHQVÂżQDQFLDGRV WXERVGHDoRFDUERQRSDUDR*DVRGXWR%ROtYLD%UDVLOHHPEDUFDo}HV  2VHPSUpVWLPRVREWLGRVSRU6RFLHGDGHVGH3URSyVLWRV(VSHFtÂżFRV63(HVWmRJDUDQWLGRVSHORVSUySULRVDWLYRVGRVSURMHWRVEHPFRPRSHQKRUGHGLUHLWRVFUHGLWyULRVHDo}HVGDV63(

 $UUHQGDPHQWRVPHUFDQWLV 5HFHELPHQWRVSDJDPHQWRVPtQLPRVGHDUUHQGDPHQWRPHUFDQWLOÂżQDQFHLUR FRPWUDQVIHUrQFLDGHEHQHItFLRVULVFRVHFRQWUROHV

 &RQVROLGDGR 5HFHELPHQWRV0tQLPRV 257 1.249 4.067   

 225 2.848  117 2.719 

2012.......................................................................................................................................................................... 2013 - 2016 .............................................................................................................................................................. 2017 em diante ......................................................................................................................................................... 5HFHELPHQWRVSDJDPHQWRVGHFRPSURPLVVRVHVWLPDGRV ................................................................................ Menos montante dos juros anuais ........................................................................................................................... 9DORUSUHVHQWHGRVUHFHELPHQWRVSDJDPHQWRVPtQLPRV ................................................................................... Circulante ................................................................................................................................................................. NĂŁo circulante........................................................................................................................................................... (PGH]HPEURGH ....................................................................................................................................... Circulante ................................................................................................................................................................. NĂŁo circulante........................................................................................................................................................... (PGHGH]HPEURGH..................................................................................................................................

&RQWURODGRUD 3DJDPHQWRV0tQLPRV 2.212 6.606 2.988   

 1.922 7.422  3.149 14.976 

3DJDPHQWRV0tQLPRV 82 157 322   

 82 183  175 191 

 3DJDPHQWRVPtQLPRVGHDUUHQGDPHQWRPHUFDQWLORSHUDFLRQDO VHPWUDQVIHUrQFLDGHEHQHItFLRVULVFRVHFRQWUROHV

 &RQVROLGDGR 24.044 55.156 24.932  

2012........................................................................................................................................................................................................................................... 2013 - 2016 ............................................................................................................................................................................................................................... 2017 em diante .......................................................................................................................................................................................................................... (PGHGH]HPEURGH................................................................................................................................................................................................... (PGHGH]HPEURGH...................................................................................................................................................................................................

&RQWURODGRUD 32.291 78.252 83.337  

1RH[HUFtFLRGHD&RPSDQKLDSDJRXXPPRQWDQWHGH5QR&RQVROLGDGR 5QD&RQWURODGRUD UHFRQKHFLGRFRPRGHVSHVDGRSHUtRGR

 3DUWHVUHODFLRQDGDV 7UDQVDo}HVFRPHUFLDLVHRXWUDVRSHUDo}HV $VRSHUDo}HVFRPHUFLDLVGD3HWUREUDVFRPVXDVVXEVLGLiULDVFRQWURODGDVVRFLHGDGHVGHSURSyVLWRHVSHFt¿FRHFROLJDGDVVmRHIHWXDGDVDSUHoRVHFRQGLo}HVQRUPDLVGHPHUFDGR(PGHGH]HPEURGHHQmR eram esperadas perdas na realização das contas a receber.

3RUHPSUHVD &RQWURODGRUD  6XEVLGLiULDVHFRQWURODGDV

BR Distribuidora ......................................................................................... PifCo ........................................................................................................... PIB-BV ........................................................................................................ Gaspetro ..................................................................................................... Downstream .............................................................................................. 7UDQVSHWUR .................................................................................................. PBEN .......................................................................................................... Brasoil ........................................................................................................ 7HUPRHOpWULFDV ............................................................................................ PNBV .......................................................................................................... Outras controladas ..................................................................................... 6RFLHGDGHGH3URSyVLWR(VSHFtÂżFR63( CDMPI ........................................................................................................ 3'(72II6KRUH.......................................................................................... 171 ............................................................................................................ 176 ............................................................................................................ &ROLJDGDV...................................................................................... ............. ,QFOXLVXDVFRQWURODGDVHFRQWURODGDVHPFRQMXQWR

5HVXOWDGR 67.527 10.945 13.418 5.208 2.420 565 554 228 213 

432  









 

&LUFXODQWH 2.579 168 7.320 1.490 141 342 134

$WLYR 1mRFLUFXODQWH 124 3 5.874 786 145

155 38 716 

3.519 226 16 972 

7RWDO 2.703 171 13.194 2.276 286 342 134 3.519 381 54 1.688 

495 475   

61 72 35   

61 567 510   

&LUFXODQWH 





































3DVVLYR 1mRFLUFXODQWH 









7RWDO 
























































cyan magenta amarelo preto

E-22

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

Minas e Energia

Petróleo Brasileiro S.A. CNPJ Nº 33.000.167/0001-01 - COMPANHIA ABERTA  3RUFRQWD &RQWURODGRUD  5HVXOWDGR 5HVXOWDGR 5HFHLWDVRSHUDFLRQDLVSULQFLSDOPHQWHSRUYHQGDV ......................................................... 9DULDo}HVPRQHWiULDVHFDPELDLVOtTXLGDV ....................................................................... 5HFHLWDV GHVSHVDV ¿QDQFHLUDVOtTXLGDV ......................................................................... $WLYR &RQWDVDUHFHEHU ................................................................................................................. Contas a receber, principalmente por vendas ..................................................................... Dividendos a receber........................................................................................................... Operaçþes de mútuo ........................................................................................................... Adiantamento para aumento de capital ............................................................................... Valores vinculados à construção de gasoduto .................................................................... Ressarcimento a receber .................................................................................................... Outras operaçþes ................................................................................................................ 3DVVLYR $UUHQGDPHQWRVPHUFDQWLV¿QDQFHLURV .............................................................................. )LQDQFLDPHQWRVVREUHRSHUDo}HVGHFUpGLWRV ................................................................. )RUQHFHGRUHV ....................................................................................................................... Compras de petróleo, derivados e outras ............................................................................ Afretamento de plataformas ................................................................................................. Adiantamento de clientes ..................................................................................................... Outros ................................................................................................................................... 2XWUDVRSHUDo}HV ................................................................................................................. (P ............................................................................................................... (P ...............................................................................................................

&LUFXODQWH

$WLYR 1mRFLUFXODQWH

7RWDO

 13.584 722



9.908 317 786 383 446

 13.584 722 9.908 317 786 383 446 

  

As operaçþes de mútuo são realizadas de acordo com as condiçþes de mercado e legislação aplicåvel, conforme a seguir: &RQWURODGRUD ,QGH[DGRU   LIBOR + 1 a 3%a.a. ........................................................................ 5.807 24.174 2% a.a. ............................................................................................ 3.150 3.011 1,7% a.a. ......................................................................................... 145 183 IGPM + 6%a.a. ................................................................................ 153 146 101% do CDI ................................................................................... 108 115 545 456 2XWUDV7D[DV ...................................................................................  

 )XQGRGHLQYHVWLPHQWRHPGLUHLWRVFUHGLWyULRVQmRSDGURQL]D GRV),'&13 A Controladora mantÊm recursos investidos no FIDC-NP que são destinados preponderantemente à aquisição de direitos creditórios performados e/ou não performados de operaçþes realizadas por subsidiårias e controladas do Sistema Petrobras. Os valores investidos em títulos públicos do FIDC-NP estão registrados em caixa e equivalentes de caixa e títulos e valores mobiliårios, em função dos seus respectivos prazos de realização. 2VHQFDUJRV¿QDQFHLURVDDSURSULDUVREUHDVRSHUDo}HVGHYHQGDGHGLUHLWRVFUHGLWyULRVSHUIRUPDGRV e/ou não performados estão registrados como outros ativos circulantes. $VFHVV}HVGHGLUHLWRVFUHGLWyULRVSHUIRUPDGRVHVWmRFODVVL¿FDGDVFRPRRXWURVDWLYRVFLUFXODQWHVHQquanto não compensados. As cessþes de direitos creditórios não performados estão registradas como ¿QDQFLDPHQWRVQRSDVVLYRFLUFXODQWH  2.474 6.840 153 

 



210 



 2 06 7 .758 4 26 

 



1 84 



*DUDQWLDVFRQFHGLGDV A Petrobras tem como procedimento conceder garantias Ă s subsidiĂĄrias e controladas para algumas RSHUDo}HVÂżQDQFHLUDVUHDOL]DGDVQRH[WHULRU As garantias oferecidas pela Petrobras sĂŁo efetuadas com base em clĂĄusulas contratuais que suportam DVRSHUDo}HVÂżQDQFHLUDVHQWUHDVVXEVLGLiULDVHWHUFHLURVJDUDQWLQGRDFRPSUDGDGtYLGDHPFDVRGH LQDGLPSOrQFLDSRUSDUWHGDVVXEVLGLiULDVHFRQWURODGDV (PGHGH]HPEURGHDVRSHUDo}HVÂżQDQFHLUDVUHDOL]DGDVSRUHVWDVVXEVLGLiULDVHJDUDQWLGDV pela Petrobras apresentam os seguintes saldos a liquidar:  'DWDGH 9HQFLPHQWR GDV2SHUDo}HV 2011 2012 2013 2014 2015 2016 2017 em diante

31%9

3LI&R

3.126 80 463 2.264 3.428 17.288 

4.877 702 1.149 7.785 30.617 

3,%%9

  

  

  

















9.773 

7$*

7RWDO

11.736 

8.003 782 1.612 2.264 11.213 70.493 

7RWDO 8.108 1.532 730 1.784 4.140 2.103 37.635 

Em 31 de dezembro de 2011, as subsidiĂĄrias PifCo e Brasoil mantinham recursos investidos em fundo de investimento no exterior, que detinha, entre outros, tĂ­tulos de dĂ­vidas de empresas do Sistema 3HWUREUDVHGH6RFLHGDGHGH3URSyVLWR(VSHFtÂżFRUHODFLRQDGRVDSURMHWRVGD&RPSDQKLDSULQFLSDOPHQWHDRVSURMHWRV&/(30DOKDVH0DUOLP/HVWH 3 H*DVHQHHTXLYDOHQWHVD5 5 HPGHGH]HPEURGH (VVHVYDORUHVUHIHUHQWHVjVHPSUHVDVTXHVmRFRQVROLGDGDV IRUDPFRPSHQVDGRVQRVDOGRGHÂżQDQFLDPHQWRVQRVSDVVLYRVFLUFXODQWHHQmRFLUFXODQWH

 7UDQVDo}HVFRPFRQWURODGDVHPFRQMXQWRFROLJDGDVHQWLGDGHV JRYHUQDPHQWDLVHIXQGRVGHSHQVmR $VWUDQVDo}HVVLJQLÂżFDWLYDVUHVXOWDUDPQRVVHJXLQWHVVDOGRV

(QWLGDGHVJRYHUQDPHQWDLVHIXQGRVGHSHQVmR ..................... 7tWXORV*RYHUQDPHQWDLV ............................................................... %DQFRGR%UDVLO6$ %% ............................................................ 'HSyVLWRVYLQFXODGRVSDUDSURFHVVRVMXGLFLDLV &()H%% ......... 6HWRU(OpWULFR QRWD .............................................................. Conta de petrĂłleo e ĂĄlcool - crĂŠditos junto ao Governo Federal QRWD .................................................................................... BNDES ......................................................................................... &DL[D(FRQ{PLFD)HGHUDO &() .................................................. $JrQFLD1DFLRQDOGR3HWUyOHR*iV1DWXUDOH%LRFRPEXVWtYHLV ... Governo Federal - Dividendos Propostos e JCP.......................... 3HWURV )XQGRGH3HQVmR ........................................................... Outros ...........................................................................................



























&RQVROLGDGR   $WLYR 3DVVLYR $WLYR 3DVVLYR   1 2.079 5.424 1 6.785 25.525 4 .268 4.355 1 34 140   8 32 822 5 .638 5.177 3 .175 2.468 3 37 196   4.726 3.667 1.848 1.596 5.103 3.700   56.786 47.634 115 124    

$WLYR&LUFXODQWH .................................................................... Caixa e equivalentes de caixa ................................................ 7tWXORVHYDORUHVPRELOLiULRV ................................................... Contas a Receber, lĂ­quidas .................................................... Outros ativos circulantes ........................................................ 1mR&LUFXODQWH ...................................................................... &RQWDSHWUyOHRHiOFRRO671 ................................................ 7tWXORVHYDORUHVPRELOLiULRV ................................................... DepĂłsitos judiciais .................................................................. Outros ativos realizĂĄveis a longo prazo.................................. 3DVVLYR&LUFXODQWH ............................................................... Financiamentos ...................................................................... Dividendos propostos ............................................................. Outros passivos circulantes.................................................... 3DVVLYR1mR&LUFXODQWH........................................................ Financiamentos ...................................................................... Outros passivos nĂŁo circulantes.............................................

5HFHEtYHLVGRVHWRUHOpWULFR A Companhia possui recebíveis do setor elétrico relacionados ao fornecimento de combustíveis a usinas de geração termoelétrica, controladas diretas ou indiretas da Eletrobrás, localizadas na região norte do país. Parte dos custos do fornecimento de combustível para essas térmicas são suportados pelos recursos da Conta de Consumo de Combustível - CCC, gerenciada pela Eletrobrás. A Companhia também fornece combustível para os Produtores Independentes de Energia - PIE, empreVDVFULDGDVFRPD¿QDOLGDGHGHSURGX]LUHQHUJLDH[FOXVLYDPHQWHSDUDD$PD]{QLD'LVWULEXLGRUD6$ - ADESA, controlada direta da Eletrobrás, cujos pagamentos de fornecimento de combustível dependem diretamente do repasse de recursos da ADESA para aqueles PIE. O saldo desses recebíveis em 31 de dezembro de 2011 era R$ 2.952 (R$ 3.145 em 31 de dezembro de  GRVTXDLV5HVWDYDPYHQFLGRV 5HPGHGH]HPEURGH  A Companhia tem feito cobranças sistemáticas aos devedores e à própria Eletrobrás e pagamentos SDUFLDLVWrPVLGRUHDOL]DGRV

&RQWDVSHWUyOHRHiOFRRO671 (PGHGH]HPEURGHRVDOGRGDFRQWDHUDGH5 5HPGHGH]HPEURGH H SRGHUiVHUTXLWDGRSHOD8QLmRSRUPHLRGDHPLVVmRGHWtWXORVGR7HVRXUR1DFLRQDOGHYDORULJXDODR VDOGRÂżQDOGRHQFRQWURGHFRQWDVFRPD8QLmRGHDFRUGRFRPRSUHYLVWRQD0HGLGD3URYLVyULDQÂ&#x17E; de 24 de agosto de 2001, ou mediante compensação com outros montantes que a Petrobras porventura estiver devendo ao Governo Federal, na ĂŠpoca, inclusive os relativos a tributos ou uma combinação das operaçþes anteriores. Visando concluir o encontro de contas com a UniĂŁo, a Petrobras prestou todas as informaçþes requeULGDVSHOD6HFUHWDULDGR7HVRXUR1DFLRQDO671SDUDGLULPLUDVGLYHUJrQFLDVDLQGDH[LVWHQWHVHQWUH as partes. Considerando-se esgotado o processo de negociação entre as partes, na esfera administrativa, a Companhia decidiu pela cobrança judicial do referido crĂŠdito tendo, para isto, ajuizado ação em julho de 2011.

5HPXQHUDomRGHHPSUHJDGRVHGLULJHQWHV

)XQGRGHLQYHVWLPHQWRQRH[WHULRUGHVXEVLGLiULDV

&RQWURODGDVHPFRQMXQWRHFROLJDGDV...................................... Distribuidoras de gĂĄs .................................................................... Braskem e suas controladas ........................................................ Outras empresas controladas em conjunto e coligadas...............







5HÂżQDULD $EUHXH/LPD

1.079 

7RWDO

  

 7D[DVGHRSHUDo}HVGHP~WXR

$SOLFDo}HVÂżQDQFHLUDV .............................................................................................. 7tWXORVHYDORUHVPRELOLiULRV ..................................................................................... (QFDUJRVÂżQDQFHLURVDDSURSULDU.............................................................................. CessĂľes de direitos performados ............................................................................. 7RWDOFODVVLÂżFDGRQRDWLYRFLUFXODQWH................................................................... CessĂľes de direitos nĂŁo performados ...................................................................... 7RWDOFODVVLÂżFDGRQRSDVVLYRFLUFXODQWH.............................................................. 5HFHLWDÂżQDQFHLUD ..................................................................................................... 'HVSHVDÂżQDQFHLUD ................................................................................................... 5HVXOWDGRÂżQDQFHLUROtTXLGR .................................................................................

3DVVLYR 1mRFLUFXODQWH

&LUFXODQWH

23ODQRGH&DUJRVH6DOiULRVHGH%HQHItFLRVH9DQWDJHQVGD3HWUREUDVHDOHJLVODomRHVSHFt¿FDHVtabelecem os critÊrios para todas as remuneraçþes atribuídas pela Companhia a seus empregados e dirigentes. As remuneraçþes de empregados, incluindo os ocupantes de funçþes gerenciais, e dirigentes da PetroEUDVUHODWLYDVDRPrVGHGH]HPEURGHHIRUDPDVVHJXLQWHV ([SUHVVRHPUHDLV   5HPXQHUDomRSRUHPSUHJDGR Menor remuneração ................................................................................... Remuneração mÊdia .................................................................................. Maior remuneração .................................................................................... 5HPXQHUDomRSRUGLULJHQWHGD3HWUREUDV PDLRU ....................................

2.024,49 10.652,30 67.494,48 81.289,05

1.801,35 9.522,21 60.965,12 69.539,03

O total da remuneração de benefícios de curto prazo para a administração da Petrobras durante o exercíFLRGHIRLGH5 5HP UHIHUHQWHVDVHWHGLUHWRUHVHQRYHFRQVHOKHLURV Os honorários da diretoria e do conselho de administração em 2011 no consolidado totalizaram R$ 45,0 5HP  A Petrobras iniciou o processo de eleição do representante de seus empregados para o Conselho de Administração, conforme estabelecido Lei Federal 12.353/2010. Desta forma, o Conselho passará a ter dez PHPEURVHDQRPHDomRVHUiUDWL¿FDGDSHORVDFLRQLVWDVQDSUy[LPD$VVHPEOHLD*HUDO2UGLQiULD

 3URYLV}HVSDUDGHVPDQWHODPHQWRGHiUHDV &RQVROLGDGR   $WLYR 3DVVLYR $WLYR 3DVVLYR     876 3 55 8 17 4 07 163 1 34 1 62 1 03 275 2 94 3 03 2 04

 26.486 8.066 3 .175 2 .952 832 7 1

415 

 11.822

4 0.891 8 .184 3.869 1.119 353 1 .557 

 31.098 5.067 2.466 3.145 822 3 2

222 

 9.415

3DVVLYRQmRFLUFXODQWH 6DOGRLQLFLDO..................................................................... Revisão de provisão ......................................................... Utilização por pagamentos ............................................... Atualização de juros ......................................................... Outros ............................................................................... 6DOGR¿QDO .......................................................................

&RQWURODGRUD     2.288 1.594 



209 217 



 ,PSRVWRVFRQWULEXLo}HVHSDUWLFLSDo}HV ,PSRVWRVDUHFXSHUDU

3 6.320 5 .662 2.568 1.118 501 423 

$WLYRFLUFXODQWH Impostos no país: ICMS........................................................................ PIS/COFINS ............................................................ CIDE ........................................................................ Imposto de renda..................................................... Contribuição social .................................................. Outros impostos ...................................................... Impostos no exterior ....................................................

Os saldos HVWmRFODVVLÂżFDGRVQR%DODQoR3DWULPRQLDOFRQIRUPHDEDL[R

&RQVROLGDGR     2.455 1.795  

 

210 229 157 173  

&RQVROLGDGR   3.186 5.146 144 2.251 615 422 11.764 1.082 

2.634 3.407 66 1.442 333 397 8.279 488 

&RQWURODGRUD   2.016 4.766 144 1.692 521 233 9.372

1.662 3.021 66 748 189 225 5.911






cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-23

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA  ,PSRVWRVHFRQWULEXLomRVRFLDOGLIHULGRV

 ,PSRVWRVFRQWULEXLo}HVHSDUWLFLSDo}HVDUHFROKHU &RQVROLGDGR   2.178 1.954 579 1.119 477 7 49 5.190 3.618 831 657 494 858 1 .220 1 .105  

3DVVLYRFLUFXODQWH ICMS............................................................................................ PIS/COFINS ................................................................................ CIDE ............................................................................................ Participação especial/Royalties ................................................... Imposto de renda e contribuição social retidos na fonte ............. Imposto de renda e contribuição social correntes ....................... Outras taxas ................................................................................

&RQWURODGRUD   1.945 1.622 483 848 472 684 5.142 3.583 787 640 429 

&RQVROLGDGR   8.042 6.365 2.199 2.394 6.543 8.048 472 231  

$WLYRQmRFLUFXODQWH Imposto de renda e contribuição social diferidos ........................ ICMS diferido ............................................................................... PIS e COFINS diferidos............................................................... Outros .......................................................................................... 3DVVLYRQmRFLUFXODQWH Imposto de renda e contribuição social diferidos ........................ Outros ..........................................................................................

460 

33.230 38 

25.863 35 

&RQWURODGRUD   3.171 2.951 1.742 2.005 4.592 6.834 



29.408

21.808





 ,PSRVWRVHFRQWULEXLomRVRFLDOGLIHULGRVQmRFLUFXODQWH Os fundamentos e as expectativas para realização estão apresentados a seguir: a)

Movimentação do imposto de renda e da contribuição social diferidos 0RYLPHQWDomRGHLPSRVWRVGLIHULGRVOtTXLGRV &RQVROLGDGR

&RQWURODGRUD

,PRELOL]DGR

(PÂ&#x17E;GHMDQHLURGH ............................................... Reconhecido no resultado do exercĂ­cio ........................... Reconhecido no patrimĂ´nio lĂ­quido .................................. Ajuste acumulado de conversĂŁo ...................................... Outros ............................................................................... (PGHGH]HPEURGH.......................................... Reconhecido no resultado do exercĂ­cio ........................... Reconhecido no patrimĂ´nio lĂ­quido .................................. Ajuste acumulado de conversĂŁo ...................................... Outros ............................................................................... (PGHGH]HPEURGH

b)

&XVWRFRP SURVSHFomR  

 

2XWURV  

 

&RQWDVDUHFHEHU SDJDUHPSUpVWLPRV HÂżQDQFLDPHQWRV  

 

 

 

52 40  

 

1 72  

815

 

 

186  

 

246  

5HDOL]DomRGRLPSRVWRGHUHQGDHGDFRQWULEXLomRVRFLDOGLIHULGRV $$GPLQLVWUDomRFRQVLGHUDTXHRVFUpGLWRVÂżVFDLVGLIHULGRVDWLYRVVHUmRUHDOL]DGRVQDSURSRUomRGDUHDOL]DomRGDVSURYLV}HVHGDUHVROXomRÂżQDOGRVHYHQWRVIXWXURVDPERVEDVHDGRVHPSURMHo}HVHIHWXDGDV $H[SHFWDWLYDGHUHDOL]DomRGRVDWLYRVHSDVVLYRVÂżVFDLVGLIHULGRVpDVHJXLQWH

$UUHQGDPHQWRV PHUFDQWLV ÂżQDQFHLURV  

264

3URYLVmR SDUD SURFHVVRV MXGLFLDLV  155

3UHMXt]RV ÂżVFDLV  229

(VWRTXHV   

-XURV VREUH FDSLWDO SUySULR  396

51 88  150

 

7   

 349

 133

15  



32  







24  

 

44  

 

2XWURV   

 

 

 

  

 

 

554  

7RWDO  

 

 

35 21  

 

 

 

608  

7RWDO  

 

 

Impostos diferidos ativos ........................................ Impostos diferidos passivos ................................... (PGHGH]HPEURGH................................ Impostos diferidos ativos ........................................ Impostos diferidos passivos ................................... (PGHGH]HPEURGH................................

6.365  

 

8.042  

 

2.951  

 

3.171  

 

 

 

 

 

 

 

 3ODQRVGHSHQVmRQRSDtV%HQHItFLRGH¿QLGRHFRQWULEXLomR YDULiYHO $)XQGDomR3HWUREUDVGH6HJXULGDGH6RFLDO 3HWURV IRLFRQVWLWXtGDSHOD3HWUREUDVFRPRXPDSHVVRD MXUtGLFDGHGLUHLWRSULYDGRVHP¿QVOXFUDWLYRVFRPDXWRQRPLDDGPLQLVWUDWLYDH¿QDQFHLUD a) Plano Petros - Fundação Petrobras de Seguridade Social

,PSRVWRGH5HQGDH&6//GLIHULGRV &RQVROLGDGR &RQWURODGRUD $WLYRV 3DVVLYRV $WLYRV 3DVVLYRV 3.217 4.135 1.846 3.057 591 2.494 13 2.149 557 2.681 4 2.185 607 2.320 47 2.033 1.062 2.506 636 2.264 316 2.417 6 2.211 630 2.931 20 1.879 1.062 13.746 599 13.630 8.042 33.230 3.171 29.408 1.563 9.605 33.230 3.171 29.408

2012......................................................... 2013......................................................... 2014......................................................... 2015......................................................... 2016......................................................... 2017......................................................... 2018......................................................... 2019 em diante ........................................ Parcela registrada contabilmente ............ Parcela nĂŁo registrada contabilmente ...... 7RWDO.........................................................

23ODQR3HWURVpXPSODQRGHSUHYLGrQFLDGHEHQHItFLRGH¿QLGRLQVWLWXtGRSHOD3HWUREUDVHPMXOKRGH TXHDVVHJXUDDRVSDUWLFLSDQWHVXPDFRPSOHPHQWDomRGREHQHItFLRFRQFHGLGRSHOD3UHYLGrQFLD Social, e é direcionado aos empregados da Petrobras e de subsidiárias. O plano está fechado aos empregados admitidos a partir de setembro de 2002. A avaliação do plano de custeio da Petros é procedida por atuários independentes, em regime de capitalização, para a maioria dos benefícios. As patrocinadoras efetuam contribuições regulares em YDORUHVLJXDLVDRVYDORUHVGDVFRQWULEXLo}HVGRVSDUWLFLSDQWHV HPSUHJDGRVDVVLVWLGRVHSHQVLRQLVWDV  ou seja, de forma paritária. 1DDSXUDomRGHHYHQWXDOGp¿FLWQRSODQRGHEHQHItFLRGH¿QLGRHVWHGHYHUiVHUHTXDFLRQDGRSRUSDUticipantes e patrocinadores, conforme Emenda Constitucional nº 20/1998 e Lei Complementar nº 109/2001, observada a proporção quanto às contribuições normais vertidas no exercício em que for apurado aquele resultado.

Em 31 de dezembro de 2011, a Companhia possuía crÊditos tributårios não registrados no montante de R$ 1.563 5HPGHGH]HPEURGH GHFRUUHQWHVGHSUHMXt]RV¿VFDLVDFXPXODGRVRULXQGRVSULQFLSDOPHQWH das atividades de exploração e produção de óleo e gås nos Estados Unidos no valor de R$ 1.199 (US$ 639 PLOK}HV FXMRSUD]RGHSUHVFULomRpGHDQRVDSDUWLUGDGDWDGHVXDFRQVWLWXLomR

(PGHGH]HPEURRVVDOGRVGRV7HUPRVGH&RPSURPLVVR)LQDQFHLUR7&)DVVLQDGRVHP SHOD&RPSDQKLDHD3HWURVWRWDOL]DYDP5 5QD&RQWURODGRUD GRVTXDLV5 5 QD&RQWURODGRUD GHMXURVYHQFHPHP2VFRPSURPLVVRVGRV7&)WrPSUD]RGHYHQFLPHQWRHP 20 anos com pagamento de juros semestrais de 6% a.a. sobre o saldo a pagar atualizado. As Notas do 7HVRXUR1DFLRQDOGHORQJRSUD]RPDQWLGDVQDFDUWHLUDFRPRJDUDQWLDGRV7&)WRWDOL]DYDP5 5QD&RQWURODGRUD 

 5HFRQFLOLDomR GR LPSRVWR GH UHQGD H FRQWULEXLomR VRFLDO VREUHROXFUR

$VFRQWULEXLo}HVHVSHUDGDVGDVSDWURFLQDGRUDVSDUDVmRGH5 5QD&RQWURODGRUD 

A reconciliação dos impostos apurados conforme alíquotas nominais e o valor dos impostos registrados nos exercícios de 2011 e 2010 estão apresentados a seguir:

Lucro antes dos impostos....................................................... Imposto de renda e contribuição social Ă s alĂ­quotas  QRPLQDLV  ............................................................................ Ajustes para apuração da alĂ­quota efetiva: Â&#x2021;&UpGLWRHPUD]mRGDLQFOXVmRGH-&3FRPR despesas operacionais ................................................... Â&#x2021;5HVXOWDGRGHHPSUHVDVQRH[WHULRUFRP alĂ­quotas diferenciadas ................................................... Â&#x2021;,QFHQWLYRVÂżVFDLV................................................................ Â&#x2021;3UHMXt]RV)LVFDLV................................................................ Â&#x2021;([FOXV}HV $GLo}HV SHUPDQHQWHVOtTXLGDV* ..................... Â&#x2021;&UpGLWRVÂżVFDLVGHHPSUHVDVQRH[WHULRUHPIDVH exploratĂłria...................................................................... Â&#x2021;2XWURV ............................................................................... Despesa com imposto de renda e contribuição social ........... Imposto de renda e contribuição social diferidos ................... Imposto de renda e contribuição social correntes .................. AlĂ­quota efetiva de imposto de renda e contribuição social ...........

&RQVROLGDGR   44.351 47.908

&RQWURODGRUD   41.568 43.799

b) Plano Petros 2 - Fundação Petrobras de Seguridade Social O Plano Petros 2 foi implementado em julho de 2007, na modalidade de contribuição variåvel, pela Petrobras e controladas que assumiram o serviço passado das contribuiçþes correspondentes ao período em que os participantes estiveram sem plano, a partir de agosto de 2002, ou da admissão posterior, atÊ 29 de agosto de 2007. O plano estå aberto para novas adesþes, mas não haverå o pagamento de serviço passado.









Os desembolsos do serviço passado são realizados, mensalmente, durante o mesmo número de meses HPTXHRSDUWLFLSDQWH¿FRXVHPSODQR

3.548

3.455

3.548

3.455

622 386  

 

601 157  

 

87

131

1.528

2.153

 

337 

 

 



25,3%

 

384 

 

 



25,1%

$SDUFHODGHVVHSODQRFRPFDUDFWHUtVWLFDGHEHQHItFLRGH¿QLGRUHIHUHVHjFREHUWXUDGHULVFRFRPLQYDlidez e morte, garantia de um benefício mínimo e renda vitalícia, sendo que os compromissos atuariais relacionados estão registrados de acordo com o método da unidade de crédito projetada. A parcela do SODQRFRPFDUDFWHUtVWLFDGHFRQWULEXLomRGH¿QLGDGHVWLQDVHjIRUPDomRGHUHVHUYDSDUDDSRVHQWDGRULD programada, cujas contribuições são reconhecidas no resultado de acordo com o pagamento. Em DFRQWULEXLomRGD&RPSDQKLDSDUDSDUFHODGHFRQWULEXLomRGH¿QLGDWRWDOL]RX5 5QD &RQWURODGRUD 

503 

 

 

 

20,4%

390 

 

 

 

20,0%

As contribuiçþes esperadas das patrocinadoras para 2012 são de R$ 510, sendo R$ 106 referenWHDSDUFHODGHEHQHItFLRGH¿QLGRH5UHIHUHQWHDSDUFHODGHFRQWULEXLomRGH¿QLGD 5H 5UHVSHFWLYDPHQWHQD&RQWURODGRUD 

3ODQRVGHSHQVmRQRH[WHULRU%HQHItFLRGH¿QLGR $&RPSDQKLDWDPEpPSDWURFLQDSODQRVGHSHQVmRQRH[WHULRUFRPFDUDFWHUtVWLFDVGHEHQHItFLRGH¿QLGRSRUPHLRGHFRQWURODGDVQD$UJHQWLQD-DSmRHRXWURVSDtVHV$PDLRULDGRVSODQRVp¿QDQFLDGD onde os ativos são mantidos em trustes, fundaçþes ou entidades similares que são regidas pelas regulamentaçþes locais. Em 2011, as contribuiçþes da Companhia para estes planos totalizaram o montante equivalente a R$ 8.

,QFOXLHTXLYDOrQFLDSDWULPRQLDO

 %HQHItFLRVFRQFHGLGRVDHPSUHJDGRV Os saldos relativos a benefĂ­cios concedidos a empregados estĂŁo representados a seguir: &RQVROLGDGR  3DVVLYR Planos de pensĂŁo ............... Planos de saĂşde ................. &LUFXODQWH .......................... 1mRFLUFXODQWH ...................

5.059 13.021  1.427 16.653

 4.795 11.786  1.303 15.278

$WLYRVGRVSODQRVGHSHQVmR

&RQWURODGRUD  4.568 12.125  1.341 15.352

 4.377 10.994  1.209 14.162

$HVWUDWpJLDGHLQYHVWLPHQWRVSDUDDWLYRVGRVSODQRVGHEHQHItFLRVpUHĂ&#x20AC;H[RGHXPDYLVmRGHORQJR prazo, de uma avaliação dos riscos inerentes Ă s diversas classes de ativos, bem como da utilização da GLYHUVLÂżFDomRFRPRPHFDQLVPRGHUHGXomRGHULVFRGDFDUWHLUD$FDUWHLUDGHDWLYRVGRSODQRGHYHUi REHGHFHUjVQRUPDVGHÂżQLGDVSHOR&RQVHOKR0RQHWiULR1DFLRQDO2VIXQGRVGHUHQGDÂż[DGHWpPDPDLRU concentração de investimentos, distribuĂ­dos principalmente em tĂ­tulos pĂşblicos e privados. A meta da GLVWULEXLomRGHDWLYRVSDUDRSHUtRGRHQWUHHpGHDHPUHQGDÂż[DDHP renda variĂĄvel, de 1,5% a 8% em imĂłveis, 0% a 15% em emprĂŠstimos a participantes, 2,5% a 12% em projetos estruturados e de 0% a 3% em investimentos no exterior.

Os ativos dos planos de pensão, segregados por nível de mensuração, são os seguintes: 

&DWHJRULDGR$WLYR 5HQGDÂż[D ...........................................................................................................

3UHoRVFRWDGRVHP PHUFDGRDWLYR 1tYHO



7tWXORVSULYDGRV .................................................................................................... 7tWXORVS~EOLFRV.....................................................................................................



9DORUDomRVHPRXVR GHSUHoRVREVHUYiYHLV 1tYHO

 7.075

16.158

Outros investimentos ............................................................................................

165

5HQGDYDULiYHO .................................................................................................... Açþes à vista ........................................................................................................ Fundos de Private Equity ..................................................................................... Outros investimentos ............................................................................................

 13.023

,PyYHLV ...............................................................................................................



(PSUpVWLPRVDSDUWLFLSDQWHV.....................................................................................

9DORUDomRVXSRUWDGD SRUSUHoRVREVHUYiYHLV 1tYHO

9DORUMXVWRWRWDO 1tYHLVH



9DORUMXVWRWRWDO  1tYHLVH











7.075

8.755

16.158

15.800

165





2.948 145

6.585 1





 13.023 9.533 146

122 

 10.456 7.780 38











  

97%  

  

98%  


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

E-24

Minas e Energia

Petróleo Brasileiro S.A. CNPJ Nº 33.000.167/0001-01 - COMPANHIA ABERTA Em 31 de dezembro de 2011, os investimentos incluem açþes ordinårias e preferenciais da Petrobras no valor de R$ 846 e de R$ 696, respectivamente, e imóveis alugados pela Companhia no valor de R$ 347.

A rentabilidade esperada dos investimentos, baseada nas expectativas de mercado, ĂŠ de 8% a.a. para DWLYRVGHUHQGDYDULiYHOHDDSDUDDWLYRVGHUHQGDÂż[DHSDUDRXWURVLQYHVWLPHQWRVUHVXOWDQGRQXPD taxa de juros mĂŠdia de 6,49% a.a..

Os ativos de emprĂŠstimos concedidos a participantes sĂŁo avaliados ao custo amortizado, o que se aproxima do valor de mercado.

3ODQRGH6D~GH$VVLVWrQFLD0XOWLGLVFLSOLQDUGH6D~GH $06

$PRYLPHQWDomRGRYDORUMXVWRGHDWLYRVDYDOLDGRVFRPRHPSUHJRGHĂ&#x20AC;X[RGHFDL[DGHVFRQWDGRFODVVLÂżFDGRVFRPR1tYHOpDVHJXLQWH 0RYLPHQWDomRGR1tYHO )XQGRVGH Private 2XWURV ,PyYHLV LQYHVWLPHQWRV 7RWDO Equity (PGHGH]HPEURGH.........     Rentabilidade dos ativos ................. 859 14 873 Compras e vendas, lĂ­quidas ............ 104 324 428     (PGHGH]HPEURGH.........

$3HWUREUDVHVXEVLGLiULDVPDQWrPXPSODQRGHDVVLVWrQFLDPpGLFD $06 TXHFREUHWRGRVRVHPSUHJDGRVGDVHPSUHVDVQR%UDVLO DWLYRVHLQDWLYRV HGHSHQGHQWHV2SODQRpDGPLQLVWUDGRSHODSUySULD &RPSDQKLDHRVHPSUHJDGRVFRQWULEXHPFRPXPDSDUFHODPHQVDOSUpGH¿QLGDSDUDFREHUWXUDGHJUDQGH risco e com uma parcela dos gastos incorridos referentes às demais coberturas, ambas estabelecidas conforme tabelas de participação baseadas em determinados parâmetros, incluindo níveis salariais, DOpPGREHQHItFLRIDUPiFLDTXHSUHYrFRQGLo}HVHVSHFLDLVQDDTXLVLomRHPIDUPiFLDVFDGDVWUDGDV distribuídas em todo o território nacional, de certos medicamentos. 2SODQRGHDVVLVWrQFLDPpGLFDQmRHVWiFREHUWRSRUDWLYRVJDUDQWLGRUHV2SDJDPHQWRGRVEHQHItFLRVp efetuado pela Companhia com base nos custos incorridos pelos participantes.

 2EULJDo}HVHGHVSHVDVOtTXLGDVDWXDULDLVFDOFXODGRVSRU DWXiULRVLQGHSHQGHQWHVHYDORUMXVWRGRVDWLYRVGRVSODQRV $VLQIRUPDo}HVGHWRGRVRVSODQRVGHEHQHItFLRVGHÂżQLGRVQRSDtVHQRH[WHULRUIRUDPDJUHJDGDVXPDYH]TXHFRQWpPSUHPLVVDVVLPLODUHVHRWRWDOGHDWLYRVHREULJDo}HVGHSODQRVGHSHQVmRQRH[WHULRUQmRpVLJQLÂżFDWLYR 7RGRVRVSODQRVGHSHQVmRWrPDFXPXODGRREULJDo}HVGHEHQHItFLRVHPH[FHVVRDRVDWLYRVGRVSODQRV

D  0RYLPHQWDomRGDVREULJDo}HVDWXDULDLVGRYDORUMXVWRGRVDWLYRVHGRVYDORUHVUHFRQKHFLGRVQREDODQoRSDWULPRQLDO  &RQVROLGDGR 3ODQRGH3HQVmR %HQHItFLR &RQWULEXLomR 3ODQR 'HÂżQLGR 9DULiYHO GH6D~GH 0RYLPHQWDomRGRYDORUSUHVHQWHGDVREULJDo}HVDWXDULDLV Obrigação atuarial no inĂ­cio do exercĂ­cio ...................................... Custo dos juros: Ä &RPWHUPRGHFRPSURPLVVRÂżQDQFHLUR.................................... ¡ Atuarial .................................................................................... Custo do serviço corrente.............................................................. BenefĂ­cios pagos ........................................................................... *DQKR 3HUGDDWXDULDOVREUHDREULJDomRDWXDULDO ....................... Outros ............................................................................................ 2EULJDomRDWXDULDOQRÂżPGRH[HUFtFLR .......................................... 0RYLPHQWDomRQRYDORUMXVWRGRVDWLYRVGRSODQR Ativo do plano no inĂ­cio do exercĂ­cio ............................................. Rendimento esperado dos ativos do plano ................................... Contribuiçþes recebidas pelo fundo .............................................. 5HFHELPHQWRVYLQFXODGRVDRWHUPRGHFRPSURPLVVRÂżQDQFHLUR .. BenefĂ­cios pagos ........................................................................... *DQKR 3HUGD DWXDULDOVREUHRVDWLYRVGRSODQR .......................... Outros ............................................................................................ $WLYRVGRSODQRQRÂżPGRH[HUFtFLR ............................................... 9DORUHVUHFRQKHFLGRVQREDODQoRSDWULPRQLDO Valor presente das obrigaçþes com fundo constituĂ­do..................  9DORUMXVWRGRVDWLYRVGRSODQR ................................................ Valor presente das obrigaçþes em excesso ao valor justo dos ativos do plano .............................................................................. Valor presente das obrigaçþes sem fundo constituĂ­do.................. *DQKRV 3HUGDV DWXDULDLVQmRUHFRQKHFLGDV ............................... Custo do serviço passado nĂŁo reconhecido.................................. 3DVVLYRDWXDULDOOtTXLGRHPGHGH]HPEUR ............................ 0RYLPHQWDomRGRSDVVLYRDWXDULDOOtTXLGR 6DOGRHPÂ&#x17E;GHMDQHLUR ................................................................  &XVWRVLQFRUULGRVQRH[HUFtFLR .................................................  3DJDPHQWRGHFRQWULEXLo}HV ....................................................  3DJDPHQWRGRWHUPRGHFRPSURPLVVRÂżQDQFHLUR .................... Outros ............................................................................................ 6DOGRHPGHGH]HPEUR ..........................................................

55.242

733

605 5.589 334 

2.352 8 62.073

83 334 

317 1 1.464

&RQWURODGRUD

13.777

1.551 244 

514 15.475

 &RQVROLGDGR 3ODQRGH3HQVmR %HQHItFLR &RQWULEXLomR 3ODQR 'HÂżQLGR 9DULiYHO GH6D~GH

7RWDO

7RWDO

69.752

65.151

47.495

605 7.223 912 

3.183 9 79.012

571 6.747 820 

2.728 73.499

509 4.737 405 

3.885 

55.242

42.748 5.231 1.387 274 



39.482 4.469 896 258 

1.993

201 28

7RWDO

7RWDO

59.981

55.997

509 6.124 707 

4.746 

69.752

479 5.719 631 

4.488 65.151

39.683 4.497 1.419 258 

1.996

37.220 4.223 1.301 239 

1.928

46.022

45.315

229

45.544

42.748

55.975 

52.356 

10.431 13.777 





9.608 12.795 





 2.513 







 2.298 



525

59 104 

48 733

11.961

1.328 198 

813 13.777

45.315 5.532 819 290 



4 49.015

229 36 64

326

45.544 5.568 1.494 290 



4 49.341

62.073 

1.464 

63.537 

73.499 

55.242 

733 

13.058

1.138

14.196 15.475 





27.477

9.927

504



















 2.893 



21 

 2.635 



3 

 837 







 143

 1.533 





2 

611



1















15.475 





 686 



18 

 361 

 1.846 

3 



&RQWURODGRUD

523 

3



13.777 







E  &RPSRQHQWHVGDVGHVSHVDVOtTXLGDV

Custo do serviço corrente.............................................. Custo dos juros: Ä &RPWHUPRGHFRPSURPLVVRÂżQDQFHLUR..................... ¡ Atuarial ....................................................................... Rendimento estimado dos ativos do plano.................... $PRUWL]DomRGH JDQKRV SHUGDVDWXDULDLV .................... Contribuiçþes de participantes ...................................... Custo do serviço passado ............................................ Outros ............................................................................ &XVWROtTXLGRQRH[HUFtFLR.......................................... Relativa a empregados ativos: Absorvida no custeio das atividades operacionais ......... Diretamente no resultado ........................................... Relativa aos inativos...................................................... &XVWROtTXLGRQRH[HUFtFLR..........................................

 &RQVROLGDGR 3ODQRGH3HQVmR %HQHItFLR &RQWULEXLomR 3ODQR 'HÂżQLGR 9DULiYHO GH6D~GH 334 334 244 605 5.589 

6 

24

7RWDO 912

7RWDO 820 571 6.747 

42 

33 

 688 508 1.439 



83 

3 

8 





605 7.223 

56 

36 



219 108 359 

152 203 6 

355 301 1.190 

726 612 1.555 

1.551 47 4

 &RQVROLGDGR 3ODQRGH3HQVmR %HQHItFLR &RQWULEXLomR 3ODQR 'HÂżQLGR 9DULiYHO GH6D~GH 405 104 198

&RQWURODGRUD

509 4.737 

3 

23

&RQWURODGRUD

7RWDO 707

7RWDO 631 479 5.719 

1 

34

530 314 1.454 

59 

1

1.328

7

509 6.124 

5 

34 2  553 408 1.552 

1





4 2 

185 141 511 

72 69 2 

296 198 1.039 



F  9DULDo}HVHQWUHYDORUHVHVWLPDGRVHLQFRUULGRV As variaçþes entre os valores estimados e os efetivamente incorridos, nos últimos 3 anos, foram os seguintes:

 *DQKRV 3HUGDV GRV3ODQRVGH3HQVmR Obrigação Atuarial ..................................................................................................................... Ativos de Planos de Pensão ...................................................................................................... *DQKRV 3HUGDV GRV3ODQRVGH6D~GH Obrigação Atuarial .......................................................................................................................

&RQVROLGDGR 





1 .320

118 1.996 414







3.423

109 

663

1.232

&RQWURODGRUD 

 

3.357

28 1.928 406

637

G  9DULDomRQRVFXVWRVFRPDVVLVWrQFLDPpGLFD A variação de 1% nas premissas de custos mÊdicos teria os seguintes impactos:

Obrigação atuarial ..................................................................................................................................................................... Custo do serviço e juros ............................................................................................................................................................

&RQVROLGDGR GH DFUpVFLPR 2.305 299

GH UHGXomR 



&RQWURODGRUD GH DFUpVFLPR 2.125 274

GH UHGXomR 



H  3UHPLVVDVDWXDULDLVDGRWDGDVQRFiOFXOR 7D[DGHGHVFRQWR ............................................................................................................................................... 7D[DGHFUHVFLPHQWRVDODULDO .............................................................................................................................. 7D[DGHUHWRUQRHVSHUDGDGRVDWLYRVGHSODQRVGHSHQVmR .............................................................................. 7D[DGHURWDWLYLGDGHGRVSODQRVGHVD~GH ......................................................................................................... 7D[DGHURWDWLYLGDGHGRVSODQRVGHSHQVmR ....................................................................................................... 7D[DGHYDULDomRGHFXVWRVPpGLFRVHKRVSLWDODUHV .......................................................................................... 7iEXDGHPRUWDOLGDGH......................................................................................................................................... 7iEXDGHLQYDOLGH] ............................................................................................................................................. 7iEXDGHPRUWDOLGDGHGHLQYiOLGRV..................................................................................................................... 

 ,QĂ&#x20AC;DomRDDD  + Juros: 5,58% a.a 

,QĂ&#x20AC;DomRDDD  + 2,080% a 3,188% a.a ,QĂ&#x20AC;DomRDD-XURVDD 0,652% a.a 

Nula 8,96% a 4,34% a.a 

$7HVSHFtÂżFDSRUVH[R 7$6$=LPPHUPDQQDMXVWDGD 

$7HVSHFtÂżFDSRUVH[R

 ,QĂ&#x20AC;DomRDDD  + Juros: 5,91% a.a 

,QĂ&#x20AC;DomRDDD  + 2,220% a.a ,QĂ&#x20AC;DomRDD-XURVDD 0,660% a.a 

Nula 7,89% a 4,3% a.a 

$7HVSHFtÂżFDSRUVH[R 7$6$=LPPHUPDQQDMXVWDGD 

$7HVSHFtÂżFDSRUVH[R

,QĂ&#x20AC;DomROLQHDUPHQWHGHFUHVFHQWHQRVSUy[LPRVDQRVTXDQGRVHWRUQDFRQVWDQWH $&RPSDQKLDXWLOL]DXPDPHWRGRORJLDSDUDDSXUDomRGHXPDWD[DUHDOHTXLYDOHQWHDSDUWLUGDFXUYDIXWXUDGHUHWRUQRGRVWtWXORVGHPDLVORQJRSUD]RGRJRYHUQRFRQVLGHUDQGRVHQRFiOFXORGHVWDWD[DRSHUÂżOGHPDWXULGDGHGDV obrigaçþes de pensĂŁo e saĂşde. 

Rotatividade mÊdia que varia de acordo com a idade e tempo de serviço. 

&XVWRVPpGLFRVHKRVSLWDODUHVWD[DGHFUHVFHQWHDWLQJLQGRQRVSUy[LPRVDQRVDH[SHFWDWLYDGHLQĂ&#x20AC;DomRSURMHWDGDGHORQJRSUD]R 

7iEXDGHLQYDOLGH]=LPPHUPDQQDMXVWDGDSDUDR3ODQR3HWURV 


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-25

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA 2XWURVSODQRVGHFRQWULEXLomRGHÂżQLGD A Petrobras por meio de suas controladas no paĂ­s e no exterior tambĂŠm patrocina planos de aposentaGRULDDRVHPSUHJDGRVGHFRQWULEXLomRGHÂżQLGD$VFRQWULEXLo}HVSDJDVQRH[HUFtFLRGHUHFRQKHcidas no resultado, totalizaram R$ 24.

 3DUWLFLSDomRQRVOXFURVRXUHVXOWDGRV $SDUWLFLSDomRGRVHPSUHJDGRVQRVOXFURVRXUHVXOWDGRV 3/5 WHPSRUEDVHDVGLVSRVLo}HVOHJDLVYLgentes, bem como as diretrizes estabelecidas pelo Departamento de Coordenação e Governança das (PSUHVDV(VWDWDLV'(67GR0LQLVWpULRGR3ODQHMDPHQWR2UoDPHQWRH*HVWmRHSHOR0LQLVWpULRGH Minas e Energia, estando relacionada ao lucro líquido consolidado antes da participação de empregados e administradores e do resultado atribuível aos acionistas não controladores. 1RH[HUFtFLRGHD&RPSDQKLDIXQGDPHQWDGDQDVSUHPLVVDVVREUHIHUrQFLDSURYLVLRQRX5 GH3/5 5HP FRQIRUPHDVHJXLU

Lucro líquido atribuível aos acionistas da Petrobras ..................................... Resultado atribuível aos não controladores .................................................. Participação nos lucros ou resultados ........................................................... /XFURDQWHVGDVSDUWLFLSDo}HVEDVHGHFiOFXOR ..................................... Percentual estabelecido ................................................................................ 3DUWLFLSDomRQRVOXFURVRXUHVXOWDGRV .....................................................

 33.313 

1.560  4,5% 

 35.189 712 1.691  4,5% 

No exercício de 2010, no dividendo proposto, indistintamente às açþes ordinårias e preferenciais equivalente a 35,50% do lucro, prevaleceu o critÊrio de 5% da parcela do capital social representativa das açþes preferenciais, tambÊm em atendimento aos direitos estatutårios dos preferencialistas.

Demonstração do lucro båsico para cålculo dos dividendos: /XFUROtTXLGRGRH[HUFtFLR &RQWURODGRUD ...................................................................... Apropriação: Reserva legal............................................................................................................... 5HVHUYDGHLQFHQWLYRV¿VFDLV ...................................................................................... Outras reversþes/adiçþes:.............................................................................................. /XFUREiVLFRSDUDGHWHUPLQDomRGRGLYLGHQGR ......................................................... Dividendos propostos, equivalente a 38,25 % do lucro båsico - R$0,92 por ação HP5SRUDomR FRPSRVWRGH Juros sobre o capital próprio ....................................................................................... Dividendos ................................................................................................................... 7RWDOGHGLYLGHQGRVSURSRVWRV ................................................................................... Menos: Juros sobre o capital próprio pagos antecipadamente ................................................ Atualização dos juros sobre o capital próprio antecipados ......................................... 6DOGRGHGLYLGHQGRVSURSRVWRV ..................................................................................

 33.101

 35.036





10 31.375





33.034

10.436 1.565 12.001

10.163 1.565 11.728













Os dividendos propostos em 31 de dezembro de 2011, no montante de R$ 12.001 incluem juros sobre capital próprio no total de R$ 10.436, aprovados pelo Conselho de Administração da seguinte forma:

Resultado atribuível aos não controladores divulgado em 2010, base para determinação da PLR. A participação dos administradores nos lucros ou resultados serå objeto de deliberação pela Assembleia Geral Ordinåria, de 2012, na forma disposta pelos artigos 41 e 56 do Estatuto Social da Companhia e pelas QRUPDVIHGHUDLVHVSHFt¿FDV

 3DWULP{QLROtTXLGR &DSLWDOVRFLDOUHDOL]DGR Em 31 de dezembro de 2011, o capital subscrito e integralizado no valor de R$ 205.380 estå representado por 7.442.454.142 açþes ordinårias e 5.602.042.788 açþes preferenciais, todas nominativas, escriturais e sem valor nominal. $XPHQWRGHFDSLWDOFRPUHVHUYDVHP A Assembleia Geral Extraordinåria, realizada em conjunto com a Assembleia Geral Ordinåria de Acionistas, em 28 de abril de 2011, aprovou o aumento do capital social da Companhia de R$ 205.357 para 5PHGLDQWHDFDSLWDOL]DomRGHSDUWHGDUHVHUYDGHOXFURVGHLQFHQWLYRV¿VFDLVFRQVWLWXtGD em 2010, no montante de R$ 23, em atendimento ao artigo 35, parågrafo 1º, da Portaria nº 2.091/07 do Ministro do Estado da Integração Nacional. Essa capitalização foi efetivada sem a emissão de novas açþes, de acordo com o artigo 169, parågrafo 1º, da Lei nº 6.404/76. $XPHQWRGHFDSLWDOFRPUHVHUYDVHP A Administração da Petrobras estå propondo à Assembleia Geral Extraordinåria, a ser realizada em conjunto com a Assembleia Geral Ordinåria de Acionistas de 2012, o aumento do capital social da Companhia de R$ 205.380 para R$ 205.392, mediante a capitalização de parte de reservas de lucros de LQFHQWLYRV¿VFDLVFRQVWLWXtGDHPQRPRQWDQWHGH5

&RQWULEXLomRDGLFLRQDOGHFDSLWDO a) Gastos com emissão de açþes A oferta global de açþes, realizada no exercício de 2010, gerou custo de captação no montante de R$ 477, líquido de impostos. b) Mudança de participação em controladas Inclui o valor das diferenças entre o valor pago e o montante contåbil decorrentes das variaçþes de participaçþes em controladas que não resultem em perda de controle, considerando que se tratam de transaçþes de capital, ou seja, transaçþes com os acionistas, na qualidade de proprietårios.

5HVHUYDVGHOXFURV a) Reserva legal

3DUFHOD 1ÂŞ. parcela JCP 2ÂŞ. parcela JCP 3ÂŞ. parcela JCP 4ÂŞ. parcela JCP Dividendos

'DWDDSURYDomR &RQVHOKR $GPLQLVWUDomR 29.04.2011 22.07.2011 28.10.2011 22.12.2011 09.02.2012

'DWDSRVLomR DFLRQiULD 11.05.2011 02.08.2011 11.11.2011 02.01.2012

ConstituĂ­da mediante a apropriação do lucro lĂ­quido de cada exercĂ­cio de um montante equivalente a, no PtQLPRGRFDSLWDOVRFLDOLQWHJUDOL]DGRQRÂżPGRH[HUFtFLRHGHVWLQDVHDRFXVWHLRGRVSURJUDPDV de pesquisa e desenvolvimento tecnolĂłgico. O saldo desta reserva nĂŁo pode exceder a 5% do capital social integralizado, de acordo com o artigo 55 do Estatuto Social da Companhia. F 5HVHUYDGHLQFHQWLYRVÂżVFDLV eFRQVWLWXtGDPHGLDQWHGHVWLQDomRGHSDUFHODGRUHVXOWDGRGRH[HUFtFLRHTXLYDOHQWHDRVLQFHQWLYRVÂżVcais, decorrentes de doaçþes ou subvençþes governamentais, em conformidade com o artigo 195-A da Lei das Sociedades por Açþes. Essa reserva somente poderĂĄ ser utilizada para absorção de prejuĂ­zos ou aumento de capital social. No exercĂ­cio de 2011, foram destinados do resultado R$ 81, referentes ao incentivo para subvenção de LQYHVWLPHQWRVQRkPELWRGDV6XSHULQWHQGrQFLDVGH'HVHQYROYLPHQWRGR1RUGHVWH 68'(1( HGD$PD]{QLD 68'$0 GRVTXDLV5UHIHUHPVHjUHDOL]DomRGHSDUWHGRVGHSyVLWRVSDUDUHLQYHVWLPHQWRV com recursos do imposto de renda. d) Reserva de retenção de lucros Ă&#x2030; destinada Ă aplicação em investimentos previstos em orçamento de capital, principalmente nas atividades de exploração e desenvolvimento da produção de petrĂłleo e gĂĄs, em conformidade com o artigo 196 da Lei das Sociedades por Açþes. O Conselho de Administração estĂĄ propondo a manutenção no patrimĂ´nio lĂ­quido, em reserva de retenção de lucros, do montante de R$ 18.347, sendo R$ 18.337 proveniente do lucro do exercĂ­cio de 2011 e R$ 10 do saldo remanescente de lucros acumulados, que se destina a atender parcialmente o programa anual de investimentos estabelecidos no orçamento de capital do exercĂ­cio de 2012, a ser deliberado em Assembleia Geral de Acionista de 2012.

Os juros sobre o capital próprio estão sujeitos à retenção de imposto de renda na fonte de 15%, exceto para os acionistas imunes e isentos, conforme estabelecido na Lei nº 9.249/95. Esses juros foram imputados aos dividendos do exercício, na forma prevista no Estatuto Social da Companhia, contabilizados QRUHVXOWDGRRSHUDFLRQDOFRQIRUPHUHTXHULGRSHODOHJLVODomR¿VFDOHIRUDPUHYHUWLGRVFRQWUDOXFURV acumulados, conforme determina a Deliberação CVM nº 207/96, resultando em um crÊdito tributårio de LPSRVWRGHUHQGDHFRQWULEXLomRVRFLDOQRPRQWDQWHGH5 5HP 

/XFURSRU$omR &RQVROLGDGR  Lucro lĂ­quido atribuĂ­vel aos acionistas da Petrobras .................. MĂŠdia ponderada da quantidade de açþes ordinĂĄrias e preferenciais em FLUFXODomR QÂ&#x17E;$o}HV ........................ Lucro lĂ­quido bĂĄsico e diluĂ­do por ação ordinĂĄria e preferencial (R$ SRUDomR ........................................

Incluem as diferenças de conversĂŁo para real das demonstraçþes contĂĄbeis das empresas com moeda funcional diferente da Controladora. b) Outros resultados abrangentes ,QFOXHPDVYDULDo}HVGHYDORUMXVWRHQYROYHQGRDWLYRVÂżQDQFHLURVGLVSRQtYHLVSDUDYHQGDKHGJHGHĂ&#x20AC;X[R de caixa e os ajustes por adoção do custo atribuĂ­do do setor petroquĂ­mico na data de transição.

'LYLGHQGRV Aos acionistas Ê garantido um dividendo e/ou juros sobre o capital próprio de pelo menos 25% do lucro líquido do exercício ajustado, calculado nos termos do artigo 202 da Lei das Sociedades por Açþes. $VDo}HVSUHIHUHQFLDLVWrPSULRULGDGHQRFDVRGHUHHPEROVRGRFDSLWDOHQRUHFHELPHQWRGRVGLYLGHQGRV no mínimo, de 3% do valor do patrimônio líquido da ação, ou de 5% calculando sobre a parte do capital representada por essa espÊcie de açþes, prevalecendo sempre o maior. A proposta do dividendo relativo ao exercício de 2011, que estå sendo encaminhada pela Administração da Petrobras à aprovação dos acionistas na Assembleia Geral Ordinåria de 2012, no montante de R$ 12.001, atende aos direitos garantidos estatutariamente às açþes preferenciais e estå sendo proposto indistintamente às açþes ordinårias e preferenciais. Esse dividendo proposto alcançou 38,25% do lucro båsico porque os direitos dos preferencialistas, de prioridade de 3% da parcela do patrimônio OtTXLGRUHSUHVHQWDWLYDGDVDo}HVSUHIHUHQFLDLV¿FRXVXSHULRUDRGLYLGHQGRPtQLPRHTXLYDOHQWHD sobre o lucro båsico.

&RQWURODGRUD 





33.313

35.189

33.101

35.036

13.044.496.930

9.872.826.065

13.044.496.930

9.872.826.065

2,55

3,57

2,54

3,55

 5HFHLWDGHYHQGDV

5HFHLWDEUXWDGHYHQGDV ............................ Encargos de vendas ..................................... 5HFHLWDGHYHQGDV ......................................

&RQVROLGDGR   306.234 266.060 



 

&RQWURODGRUD   241.042 204.595 



 

 'HVSHVDVSRUQDWXUH]D

MatÊria-prima / produtos adquiridos ................... Serviços contratados, fretes, aluguÊis e encargos gerais ............................................... Participação governamental ............................... Despesas com pessoal e benefícios ................. Depreciação, depleção e amortização ............... Custo do produto vendido .................................. Despesas com vendas ....................................... Despesas gerais e administrativas .....................

&RQVROLGDGR   







































&RQWURODGRUD   







































 2XWUDVGHVSHVDVRSHUDFLRQDLVOtTXLGDV Planos de pensão e saúde .................................................................... Paradas não programadas e gastos prÊ-operacionais.......................... Relaçþes institucionais e projetos culturais ........................................... Gastos com segurança, meio ambiente e saúde .................................. Ajuste ao valor de mercado dos estoques ............................................ $FRUGRV&ROHWLYRVGH7UDEDOKR ............................................................. Perdas com processos judiciais e administrativos ................................ Ganhos com processos judiciais e arbitrais .......................................... Despesas operacionais c/ termelÊtricas ................................................ Perda no valor de recuperação de ativos - Impairment......................... 6XEYHQo}HVHDVVLVWrQFLDVJRYHUQDPHQWDLV......................................... Resultado com alienação / baixa de ativos ........................................... Gastos / Ressarcimentos com operaçþes em parcerias de E&P .......... Incentivo para aquisição de açþes da Petrobras................................... Outros ....................................................................................................

$MXVWHGHDYDOLDomRSDWULPRQLDO a) Ajuste acumulado de conversĂŁo

9DORUEUXWRSRU DomR 21H31   5

0,20 0,20 0,20 0,20 0,12 

9DORUGD SDUFHOD 2.609 2.609 2.609 2.609 1.565 

As parcelas dos juros sobre o capital próprio distribuídas antecipadamente em 2011 serão descontadas dos dividendos propostos para este exercício, corrigidas pela taxa SELIC desde a data de seu pagaPHQWRDWpGHGH]HPEURGH$SDUFHOD¿QDOGHMXURVVREUHRFDSLWDOSUySULRVHUiGLVSRQLELOL]DGD DWpGHPDUoRGHHRVGLYLGHQGRVVHUmRSDJRVQDGDWDTXHYLHUDVHU¿[DGDHP$VVHPEOHLD*HUDO Ordinåria de Acionistas, e terão os seus valores atualizados monetariamente, a partir de 31 de dezembro de 2011 atÊ a data de início do pagamento, de acordo com a variação da taxa SELIC.

Ă&#x2030; constituĂ­da mediante a apropriação de 5% do lucro lĂ­quido do exercĂ­cio, em conformidade com o artigo 193 da Lei das Sociedades por Açþes. b) Reserva estatutĂĄria

'DWDGH SDJDPHQWR 31.05.2011 31.08.2011 30.11.2011

&RQVROLGDGR    





 













 

883 







615 377 12 65 16 46 

405 

 

&RQWURODGRUD    





 













 

688 





104 187 360 



16 46 

317 89  

 5HVXOWDGRÂżQDQFHLUROtTXLGR

Variação cambial sobre caixa e equivalentes de caixa ............. 9DULDomRFDPELDOVREUHHQGLYLGDPHQWRV .............................. 9DULDomRFDPELDOVREUHHQGLYLGDPHQWROtTXLGR ................... 9DULDomRPRQHWiULDVREUHHQGLYLGDPHQWRV .......................... Despesa com endividamento .................................................... 5HFHLWDFRPDSOLFDo}HV¿QDQFHLUDV .......................................... Receita com títulos públicos federais para negociação ............ 'HVSHVD¿QDQFHLUDVOtTXLGDV ................................................. 5HVXOWDGR¿QDQFHLURVREUHHQGLYLGDPHQWROtTXLGR ............. (QFDUJRV¿QDQFHLURVFDSLWDOL]DGRV ........................................... HedgeVREUHRSHUDo}HVFRPHUFLDLVH¿QDQFHLUDV..................... Receita com títulos disponíveis para venda .............................. 5HFHLWD GHVSHVD FRPWtWXORVPDQWLGRVDWpRYHQFLPHQWR ...... 2XWUDVGHVSHVDVHUHFHLWDV¿QDQFHLUDVOtTXLGDV ....................... Outras variaçþes cambiais e monetårias líquidas ..................... 5HVXOWDGR¿QDQFHLUROtTXLGR .................................................. 5HVXOWDGR¿QDQFHLUR Receitas..................................................................................... Despesas................................................................................... Variaçþes cambiais e monetårias, líquidas ...............................

&RQVROLGDGR   971 



1.683 

 







2.788 1.645 2.118 529 







7.361 5.262 

9 594 524 

119 



585 626   6.543 





4.424 

1.341 

&RQWURODGRUD   924 



1.271 

 







2.303 1.155 2.118 529 







5.823 4.249 

24 576 510 532 451 619 1.641 1.809 50   6.025 





4.312 

282 

 ,QFOXLYDULDomRPRQHWiULDVREUHÂżQDQFLDPHQWRVHPPRHGDQDFLRQDOSDUDPHWUL]DGDjYDULDomRDRGyODU


cyan magenta amarelo preto

E-26

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA  3URFHVVRVMXGLFLDLVHFRQWLQJrQFLDV

 &RQWLQJrQFLDVGHSDUFHULDVRSHUDFLRQDLV&DPSRGH)UDGH

A Companhia possui diversos processos judiciais de natureza tributåria, cível, trabalhista e ambiental, resultantes GRFXUVRQRUPDOGHVXDVRSHUDo}HV$FODVVL¿FDomRGDVDo}HVGHDFRUGRFRPDH[SHFWDWLYDGHSHUGDFRPR provåvel, possível ou remota, assim como seus valores estimados Ê elaborada com base em pareceres de seus assessores jurídicos e melhor julgamento da Administração.

Em novembro de 2011, ocorreu um derramamento de óleo no campo de Frade, localizado na Bacia de Campos, que Ê operado pela Chevron Brasil. A promotoria pública federal estå conduzindo uma investigação e iniciou um processo reivindicando R$ 20 bilhþes de indenização, contra a Chevron Brasil, Chevron Latin America Marketing //&H7UDQVRFHDQ%UDVLO/WGDHVWH~OWLPRRSHUDGRUGDSODWDIRUPDQDRFDVLmRGRGHUUDPDPHQWR$DYDOLDomRGRV nossos advogados considerou que o valor reivindicado não Ê razoåvel e Ê desproporcionalmente alto em relação à extensão dos danos causados.

3URFHVVRVMXGLFLDLVSURYLVLRQDGRV $&RPSDQKLDFRQVWLWXLXSURYLV}HVHPPRQWDQWHVX¿FLHQWHSDUDFREULUDVSHUGDVFRQVLGHUDGDVSURYiYHLV e razoavelmente estimåveis. Dentre as quais, as principais são referentes à imposto de renda retido na fonte pela emissão de títulos no exterior, perdas e danos pelo desfazimento de operação de cessão GHFUpGLWRSUrPLRGH,3,HLQGHQL]DomRDRVSHVFDGRUHVSHORGHUUDPDPHQWRGHyOHRQR5LRGH-DQHLUR ocorrido em janeiro de 2000. O MinistÊrio Público Federal e o MinistÊrio Público Estadual do Estado do Paranå ajuizaram uma ação FRQWUDD3HWUREUDVUHODWLYDjLQGHQL]DomRSRUGDQRVPRUDLV¿QDQFHLURVHUHVWDXUDomRDPELHQWDOHP IXQomRGHXPGHUUDPDPHQWRGHyOHRRFRUULGRQR7HUPLQDO6mR)UDQFLVFRGR6XO5H¿QDULD3UHVLGHQWH Vargas em 16 de julho de 2000. Com base em estudos realizados em 2011, considerando a proporção dos danos causados, a CompaQKLDUHDYDOLRXDH[SHFWDWLYDGHSHUGDGDDomRUHFODVVL¿FDQGRDGHSRVVtYHOSDUDSURYiYHOHHVWLPRXR valor a ser incorrido no montante de R$ 62, não obstante persista a pretensão dos Autores pela condenação da ordem de R$ 6.765. Os valores provisionados, líquidos dos depósitos judiciais, são os seguintes:

3DVVLYRQmRFLUFXODQWH Reclamaçþes trabalhistas .............................. 3URFHVVRV¿VFDLV ........................................... Processos cíveis ........................................... Outros processos ...........................................

6DOGRLQLFLDO ................................................... Adição de provisão ......................................... Utilização por pagamentos ............................. 7UDQVIHUrQFLDVSRUGHSyVLWRVMXGLFLDLV ............ Atualização de juros ....................................... Outros ............................................................. 6DOGR¿QDO ......................................................

&RQVROLGDGR   290 193 661 607 298 357 112 108  

&RQWURODGRUD   202 88 12 68 161 269 62  

&RQVROLGDGR     534 1.422 







87 9 

 

&RQWURODGRUD     336 845 







86 9 

 

3URFHVVRVMXGLFLDLVQmRSURYLVLRQDGRV &RQVROLGDGR 1DWXUH]D Fiscal ...................................................................................................................... CĂ­vil - Geral ............................................................................................................. CĂ­vil - Ambiental ...................................................................................................... Outras .....................................................................................................................

(VWLPDWLYD 34.137 8.858 989 1.560 

2VTXDGURVDVHJXLUGHWDOKDPDVSULQFLSDLVFDXVDVGHQDWXUH]DÂżVFDOHFtYHOFXMDVH[SHFWDWLYDVGHSHUGDV HVWmRFODVVLÂżFDGDVFRPRSRVVtYHO

A Petrobras possui participação de 30% do consórcio de Frade. Embora não seja parte do processo, em razão GDSDUWLFLSDomRD3HWUREUDVSRGHVHUFRQWUDWXDOPHQWHREULJDGDDDUFDUFRPGRWRWDOGHFRQWLQJrQFLDV relacionadas ao campo de Frade. Caso a Chevron seja responsabilizada legalmente, a Petrobras pode estar sujeita contratualmente ao pagamento de atÊ 30% dos custos referentes à indenização.

 &RQWLQJrQFLDV$WLYDV 5HFXSHUDomRGHFXVWRVGHPDQXWHQomR%DUUDFXGD &D UDWLQJD Em 2006, a Petrobras, na qualidade de representante da Barracuda & Caratinga Leasing Company B.V.- BCLC, recorreu ao processo arbitral no exterior contra a Kellog, Brown, Root, LLC- KBR para obtenção de indenização por custos de manutenção realizado nas linhas Ă&#x20AC;H[tYHLVGRFDPSRGH%DUUDFXGDH&DUDWLQJDQRSHUtRGRFREHUWRSRUJDUDQWLDFRQWUDWXDO (PGHVHWHPEURGHR7ULEXQDODUELWUDOGHXJDQKRGHFDXVDj%&/&GHIRUPDGHÂżQLWLYD condenando a KBR a indenizĂĄ-la em R$ 339, pleiteados na arbitragem, acrescidos de custos internos da Petrobras na condução da arbitragem, alĂŠm de honorĂĄrios advocatĂ­cios e custas GRSURFHVVDPHQWRDUELWUDO$SyVGHFLVmRGHÂżQLWLYDD3HWUREUDVUHFRQKHFHXRYDORUGH5 no ativo nĂŁo circulante.

5HFXSHUDomRGH3,6H&2),16 A Petrobras e subsidiĂĄrias ajuizaram açþes ordinĂĄrias contra a UniĂŁo referentes Ă recuperação, SRUPHLRGHFRPSHQVDomRGRVYDORUHVUHFROKLGRVDWtWXORGH3,6VREUHUHFHLWDVÂżQDQFHLUDV e variaçþes cambiais ativas, no perĂ­odo compreendido entre fevereiro de 1999 e novembro de 2002, e COFINS compreendido entre fevereiro de 1999 a janeiro de 2004, considerando a inconstitucionalidade do §1Âş do art. 3Âş da Lei 9.718/98. (P  GH QRYHPEUR GH  R 6XSUHPR 7ULEXQDO )HGHUDO FRQVLGHURX LQFRQVWLWXFLRQDO R respectivo §1Âş do art. 3Âş da Lei 9.718/98. (PGHQRYHPEURR6XSHULRU7ULEXQDOGH-XVWLoDMXOJRXSURFHGHQWHDDomRGD Petrobras, ajuizada em 2006 para recuperar os valores de COFINS do perĂ­odo de janeiro de 2003 a janeiro de 2004. ApĂłs o trânsito em julgado da ação, a Companhia reconheceu R YDORU GH 5  5  QD &RQWURODGRUD  FRPR LPSRVWRV D UHFXSHUDU QR DWLYR QmR circulante. (PGHGH]HPEURGHD&RPSDQKLDSRVVXL5 5QD&RQWURODGRUD  UHODWLYRVDHVWDVDo}HVTXHDLQGDQmRHVWmRUHĂ&#x20AC;HWLGRVQDVLQIRUPDo}HVFRQWiEHLVHPYLUWXGH GDDXVrQFLDGHGHFLVmRIDYRUiYHOGHÂżQLWLYD

$omRMXGLFLDOQRV(VWDGRV8QLGRV3H3

D  3URFHVVRVGHQDWXUH]DÂżVFDO 'HVFULomR1DWXUH]D)LVFDO (VWLPDWLYD $XWRU6HFUHWDULDGD5HFHLWD)HGHUDOGR%UDVLO , $XWRVGHLQIUDomRSRULQGHGXWLELOLGDGHGH,53-Âą&6//H0XOWDVREUHDUHSDFWXDomRGR3ODQR Petros. 3.139 ,,  )DOWD GH DGLomR j EDVH GH FiOFXOR GR ,53- H &6// GH OXFURV DXIHULGRV SHODV HPSUHVDV controladas e coligadas domiciliadas no exterior, nos exercĂ­cios de 2005, 2006 e 2007. 1.989 ,,, 1mRUHFROKLPHQWRGH,53-H&6//VREUHRLQFHQWLYRÂżQDQFHLURDRVHPSUHJDGRVSHODUHSDF1.499 tuação do Plano Petros em 2007. $XWRU'HOHJDFLDGD5HFHLWD)HGHUDOGR5LRGH-DQHLUR Auto de infração referente ao Imposto de Renda Retido na Fonte sobre remessas para pagamentos de afretamentos de embarcaçþes referente ao perĂ­odo de 1999 a 2002. 4.684 $XWRU6HFUHWDULDGD)D]HQGDGR(VWDGRGR5LRGH-DQHLUR , ,&06Âą$XWRVGHLQIUDomRHPRSHUDo}HVGHVDtGDGH/*1VHPHPLVVmRGHGRFXPHQWRÂżVFDO no âmbito do estabelecimento centralizador. 2.491 ,, 1RWDVGH/DQoDPHQWRGHFRUUHQWHGHGLIHUHQoDGHDOtTXRWDGH,&06QDVRSHUDo}HVGH venda de QAV, em razĂŁo da declaração de inconstitucionalidade do Decreto 36.454 de 2004. 1.410 $XWRU6HFUHWDULDGD5HFHLWD)HGHUDOGR%UDVLO , 1mRUHFROKLPHQWRGD&,'(SHOD3HWUREUDVHPRSHUDo}HVGHLPSRUWDomRGH1DIWDUHYHQGLGD Ă Braskem. 2.793 ,, 1mRUHFROKLPHQWRQRSHUtRGRGHPDUoRGHDRXWXEURGHGD&,'(FRPEXVWtYHLVHP REHGLrQFLDjVRUGHQVMXGLFLDLVREWLGDVSRU'LVWULEXLGRUDVH3RVWRVGH&RPEXVWtYHLVLPXQL]DQGR1.235 RVGDUHVSHFWLYDLQFLGrQFLD $XWRU6HFUHWDULDGD)D]HQGDGR(VWDGRGH6mR3DXOR ,  $XWR GH LQIUDomR UHODWLYR D DIDVWDPHQWR GH FREUDQoD GH ,&06 H PXOWD SRU GHVFXPSULmento de obrigação acessĂłria sobre importação. AdmissĂŁo temporĂĄria de sonda de peIXUDomRHP6mR3DXORHGHVHPEDUDoRQR5LRGH-DQHLUR &RQYrQLR,&06QÂ&#x17E;  2.184 ,, $IDVWDPHQWRGHFREUDQoDGH,&06HPXOWDVREUHLPSRUWDomR $GPLVVmR7HPSRUiULDÂą6RQGD GH3HUIXUDomRÂąDGPLVVmR6mR3DXORGHVHPEDUDoRQR5LRGH-DQHLUR  1.657 $XWRU3UHIHLWXUDV0XQLFLSDLVGH$QFKLHWD$UDFUX]*XDUDSDUL,WDSHPLULP0DUDWDt]HV /LQKDUHV9LOD9HOKDH9LWyULD Falta de retenção e recolhimento de ISS na atividade de prestação de serviços em ĂĄguas marĂ­timas. Alguns municĂ­pios localizados no Estado do EspĂ­rito Santo lavraram autos de infração contra a Petrobras, pela suposta falta de retenção do ISSQN incidente sobre serviços prestados em ĂĄguas marĂ­timas.A Petrobras reteve esse ISSQN, porĂŠm o recolheu aos cofres dos municĂ­pios onde estĂŁo estabelecidos os respectivos prestadores, em conformidade com a Lei Complementar nÂş 116/03.

1.624 1.181

$XWRU6HFUHWDULDGD5HFHLWD)HGHUDOGR%UDVLO IRRF - Remessas ao exterior para pagamento de importação de petróleo

Em 21 de julho de 2006, a Justiça Americana proferiu decisão executiva, condicionando o SDJDPHQWRGRVYDORUHVGHYLGRVj%UDVRLODRHQFHUUDPHQWRGH¿QLWLYRGHDo}HVFRPLGrQWLFR objeto em curso perante a Justiça Brasileira, o que vem sendo providenciado pelas partes. O valor da indenização pleiteado Ê de aproximadamente US$ 245 milhþes.

 &RPSURPLVVRGHFRPSUDGHJiVQDWXUDO A Petrobras assinou contrato com a Yacimientos PetrolĂ­feros Fiscales Bolivianos â&#x20AC;&#x201C; YPFB, tendo por REMHWLYRDFRPSUDGHXPWRWDOGHELOK}HVGHPGHJiVQDWXUDODRORQJRGHVXDYLJrQFLDFRPSURmetendo-se a comprar volumes mĂ­nimos anuais a um preço calculado segundo fĂłrmula atrelada ao preço GRyOHRFRPEXVWtYHO2FRQWUDWRWHPYLJrQFLDLQLFLDODWpTXHVHUiSURUURJDGDDWpTXHWRGRRYROXPH contratado seja consumido. Em 31 de dezembro de 2011, o compromisso de compra mĂ­nima para o perĂ­odo de 2012 atĂŠ 2019 ĂŠ de aproximadamente 70,3 bilhĂľes de m3 de gĂĄs natural equivalente a 24,06 milhĂľes de m3 por dia, que corresponde a um valor total estimado de US$ 15,2 bilhĂľes.

 *DUDQWLDVDRVFRQWUDWRVGHFRQFHVVmRSDUDH[SORUDomRGHSHWUyOHR $3HWUREUDVFRQFHGHXJDUDQWLDVj$JrQFLD1DFLRQDOGH3HWUyOHR$13QRWRWDOGH5SDUDRV Programas Exploratórios Mínimos previstos nos contratos de concessão das åreas de exploração, permanecendo em vigor R$ 5.429 líquidos dos compromissos jå cumpridos. Desse montante, 5FRUUHVSRQGHPDRSHQKRUGRSHWUyOHRGHFDPSRVSUHYLDPHQWHLGHQWL¿FDGRVHMiHPIDVHGH produção e R$ 2.043 referem-se a garantias bancårias.

 ,QVWUXPHQWRV ÂżQDQFHLURV GHULYDWLYRV SURWHomR SDWULPRQLDO KHGJHHDWLYLGDGHVGHJHUHQFLDPHQWRGHULVFRV

$XWRU6HFUHWDULDGD5HFHLWD)HGHUDOGR%UDVLO IOF crÊdito sobre operaçþes de mútuos

Em 2002, a Brasoil e a Petrobras venceram, em primeira instância, perante a Justiça norteamericana, açþes conexas movidas pelas seguradoras United States Fidelity & Guaranty Company e American Home Assurance Company, as quais tentavam obter, desde 1997, HP IDFH GD SULPHLUD %UDVRLO  GHFODUDomR MXGLFLDO TXH DV LVHQWDVVHP GD REULJDomR GH SDJDURYDORUGRVHJXURGHFRQVWUXomR SHUIRUPDQFHERQG GDVSODWDIRUPDV3H3 HHPIDFHGDVHJXQGD 3HWUREUDV EXVFDYDPUHVVDUFLPHQWRGHTXDLVTXHUTXDQWLDVTXH viessem a ser condenadas no processo de execução da perfomance bond.

924

$3HWUREUDVHVWiH[SRVWDDXPDVpULHGHULVFRVGHFRUUHQWHVGHVXDVRSHUDo}HV7DLVULVFRVHQYROYHPSULQcipalmente o fato de que eventuais variaçþes nos preços de petrĂłleo e derivados, nas taxas cambiais ou GHMXURVSRGHPDIHWDUQHJDWLYDPHQWHRYDORUGRVDWLYRVHSDVVLYRVÂżQDQFHLURVRXĂ&#x20AC;X[RVGHFDL[DIXWXURV e lucros da Companhia.

 2EMHWLYRVHHVWUDWpJLDVGHJHUHQFLDPHQWRGHULVFRV

$XWRU6HFUHWDULDVGD)D]HQGDGRV(VWDGRVGR5LRGH-DQHLURHGH6HUJLSH Aproveitamento indevido de crĂŠditos de ICMS de brocas de perfuração e de produtos quĂ­micos XWLOL]DGRVQDIRUPXODomRGHĂ&#x20AC;XLGRGHSHUIXUDomRHDXWRVGHLQIUDomRSRUHQWHQGHUTXHFRQVWLWXHP material de uso e consumo, cujo aproveitamento do crĂŠdito somente seria permitido a partir do perĂ­odo seguinte. 2XWURVSURFHVVRVGHQDWXUH]DÂżVFDO 7RWDOGRVSURFHVVRVGHQDWXUH]DÂżVFDO

817  

E 3URFHVVRVGHQDWXUH]DFtYHO*HUDO 'HVFULomR1DWXUH]D&tYHO

(VWLPDWLYD

$XWRU3RUWR6HJXUR,PyYHLV/WGD A Porto Seguro, acionista minoritåria da Petroquisa, ajuizou ação contra a Petrobras, relativa a alegados prejuízos decorrentes da venda da participação acionåria da Petroquisa em diversas empresas petroquímicas. A indenização estimada a ser paga a Petroquisa Ê R$ 22.461 em 31.12.2011. Como a Petrobras detÊm 100% do capital social da Petroquisa parte da indenização estimada em R$ 14.824 "líquida de imposto" não representa desembolso efetivo do Sistema Petrobras. Adicionalmente, a Petrobras teria que indenizar a Porto Seguro, autora da ação, DWtWXORGHSUrPLRHD/RER ,EHDV$GYRJDGRVDWtWXORGHKRQRUiULRVDGYRFDWtFLRV

A política de gestão de riscos da Petrobras visa contribuir para um balanço adequado entre os seus objetivos de crescimento e retorno e seu nível de exposição a riscos, quer inerentes ao próprio exercício das suas atividades, quer decorrentes do contexto em que ela opera, de modo que, atravÊs da alocação efetiva GRVVHXVUHFXUVRVItVLFRV¿QDQFHLURVHKXPDQRVD&RPSDQKLDSRVVDDWLQJLUVXDVPHWDVHVWUDWpJLFDV A gestão de riscos da Petrobras Ê realizada por seus diretores, segundo uma política corporativa de gerenFLDPHQWRGHULVFRV'HVGHPDUoRGHIRLLQVWLWXtGRSHOD'LUHWRULD([HFXWLYDR&RPLWrGH,QWHJUDomR )LQDQFHLUDFRPSRVWRSRUWRGRVRVJHUHQWHVH[HFXWLYRVGDiUHD¿QDQFHLUDVHQGRFRQYRFDGRVSDUDGLVFXVV}HVGHWHPDVHVSHFt¿FRVRVJHUHQWHVH[HFXWLYRVGDViUHDVGHQHJyFLRV'HQWUHDVUHVSRQVDELOLGDGHVGR&RPLWrGH,QWHJUDomR)LQDQFHLUDHVWiDGHDYDOLDUDVH[SRVLo}HVDULVFRVHHVWDEHOHFHUGLUHWUL]HV para medir, monitorar e gerenciar o risco relacionado às atividades da Companhia, cabendo à Diretoria Executiva decidir sobre os temas. $3HWUREUDVDGRWDXPD¿ORVR¿DGHJHVWmRLQWHJUDGDGHULVFRVVHJXQGRDTXDORIRFRGDJHVWmRQmRHVWiQRV riscos individuais - das operaçþes ou das unidades de negócio - mas na perspectiva mais ampla e consolidaGDGDFRUSRUDomRFDSWXUDQGRSRVVtYHLVSURWHo}HVQDWXUDLV3DUDDJHVWmRGHULVFRVGHPHUFDGR¿QDQFHLUR VmRDGRWDGDVDo}HVSUHIHUHQFLDOPHQWHHVWUXWXUDLVFULDGDVHPGHFRUUrQFLDGHXPDJHVWmRDGHTXDGDGR FDSLWDOHGRHQGLYLGDPHQWRGDHPSUHVDHPGHWULPHQWRGDXWLOL]DomRGHLQVWUXPHQWRV¿QDQFHLURVGHULYDWLYRV

 5LVFRGHYDULDomRGRVSUHoRVGHSHWUyOHRHGHULYDGRV 5.615

$XWRU$JrQFLD1DFLRQDOGH3HWUyOHR$13

D *HUHQFLDPHQWRGHULVFRGHSUHoRVGHSHWUyOHRHGHULYDGRV A Petrobras mantÊm, preferencialmente, a exposição ao ciclo de preços, não utilizando derivativos SDUDDSURWHomRGHRSHUDo}HVVLVWrPLFDV FRPSUDRXYHQGDGHPHUFDGRULDVFRPRREMHWLYRGHDWHQGHU jVQHFHVVLGDGHVRSHUDFLRQDLVGD&RPSDQKLD 

Diferenças no pagamento de participação especial dos campos de Albacora, Carapeba, Cherne, Espadarte, Marimba, Marlim, Marlim Sul, Namorado, Pampo e Roncador â&#x20AC;&#x201C; Bacia de Campos, utilizando contrato de locação de bens com a Companhia Locadora de Equipamentos PetrolĂ­feros â&#x20AC;&#x201C; CLEP, em desacordo com Ă portaria ANP nÂş 10/99 e multa por descumprimento dos programas ExploratĂłrios mĂ­nimos â&#x20AC;&#x201C; â&#x20AC;&#x153;Rodada Zeroâ&#x20AC;?.

1.212

2XWURVSURFHVVRVGHQDWXUH]DFtYHO

2.031

7RWDOGRVSURFHVVRVGHQDWXUH]DFtYHO



Não obstante, as deliberaçþes referentes a este tema são periodicamente revisadas e recomenGDGDVDR&RPLWrGH,QWHJUDomR)LQDQFHLUD&DVRVHMDLQGLFDGDDSURWHomRHPFHQiULRVFRPSUREDELOLGDGHVLJQL¿FDWLYDGHHYHQWRVDGYHUVRVDHVWUDWpJLDGHSURWHomRSDWULPRQLDOhedge deve ser H[HFXWDGDFRPRLQWXLWRGHSURWHJHUDVROYrQFLDHDOLTXLGH]GD&RPSDQKLDFRQVLGHUDQGRXPD anålise integrada de todas as suas exposiçþes a risco da Companhia, e assegurar a execução do plano corporativo de investimentos.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-27

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA Os quadros abaixo representam o valor justo do derivativo embutido e anĂĄlise de sensibilidade para 31 de dezembro de 2011:

E 3ULQFLSDLVWUDQVDo}HVHFRPSURPLVVRVIXWXURVSURWHJLGRVSRURSHUDo}HVFRPGHULYDWLYRV As principais operaçþes destinam-se à proteção dos resultados esperados das transaçþes realizadas

9DORUGH 5HIHUrQFLD  1RFLRQDO

HPPLOP

no exterior. &RPHVVHREMHWLYRDVRSHUDo}HVFRPLQVWUXPHQWRV¿QDQFHLURVGHULYDWLYRVVmRXVXDOPHQWHGHFXUWR &RQWUDWRD7HUPR Posição comprada............................................ ...........

prazo, acompanhando os prazos das operaçþes comerciais. Os instrumentos utilizados são contratos futuros, a termo, swaps e opçþes. As operaçþes são realizadas nas Bolsas NYMEX - New York Mercantile Exchange e ICE - Intercontinental Exchange, bem como no mercado de balcão internacional.

'HULYDWLYRV (PEXWLGRV

F  3DUkPHWURVXWLOL]DGRVSDUDRJHUHQFLDPHQWRGHULVFRV Swap Nafta x Etanol

5LVFR Queda no spread Nafta x Etanol

9DORU-XVWR

715

9HQFLPHQWR

49

2016

&HQiULR3URYi YHOHP

&HQiULR3RVVtYHO UGH

&HQiULR5HPRWR UGH

49

40

32

Os principais parâmetros utilizados na gestĂŁo de risco para variaçþes de preços de petrĂłleo e derivaGRVGD3HWUREUDVVmRRĂ&#x20AC;X[RGHFDL[DRSHUDFLRQDOHPULVFR &)$5 R9DORUHP5LVFR Value at risk

2GHULYDWLYRIRLPHQVXUDGRDYDORUMXVWRSRUPHLRGRUHVXOWDGRHFODVVLÂżFDGRQRQtYHOQDKLHUDUTXLDGD

9D5 HStop Loss.

mensuração do valor justo.

A carteira de operaçþes comerciais realizadas no exterior, bem como as operaçþes de proteção patrimonial associadas à sua carteira por meio de derivativos de petróleo e derivados, apresentava, em 31

A Companhia determinou o valor justo deste contrato baseado em prĂĄticas utilizadas no mercado, em que

de dezembro de 2011, uma perda mĂĄxima estimada para um dia (VaR - Value at risk FDOFXODGDDXP

se apura a diferença entre os spreads de nafta e etanol. O preço de venda do etanol no contrato Ê referente

QtYHOGHFRQÂżDQoDGHGHDSUR[LPDGDPHQWH86PLOK}HV

DRPHUFDGREUDVLOHLUR (6$/4 2VSDUkPHWURVXWLOL]DGRVQRFiOFXORWLYHUDPVHXVYDORUHVREWLGRVGDV FRWDo}HVGHPHUFDGRGRSUHoRGRHWDQROHGDQDIWDQRPHUFDGRIXWXURGD&%27 &KLFDJR%RDUGRI7UDGH  QR~OWLPRGLD~WLOGRSHUtRGRGDVGHPRQVWUDo}HVÂżQDQFHLUDV

G 9DORUGHUHIHUrQFLD QRFLRQDO HYDORUMXVWRGRVLQVWUXPHQWRVGHULYDWLYRV

2VJDQKRVDSXUDGRVHVWmRDSUHVHQWDGRVQDGHPRQVWUDomRGRUHVXOWDGRFRPRUHFHLWDÂżQDQFHLUD

'HULYDWLYRVGHSHWUyOHRHGHULYDGRV &RQVROLGDGR 9DORUGH5HIHUrQFLD 9DORUMXVWR 1RFLRQDO HPPLOEEO FRQWDELOL]DGR 



&RQWUDWRV)XWXURV ...................





Compromissos de compra.........

30.193

19.921

Compromissos de venda ...........





&RQWUDWRVGH2So}HV ..............









&RPSUD .....................................









3RVLomR7LWXODU ...........................

6.728



&RQWURODGRUD 9DORUMXVWRFRQ WDELOL]DGR

9HQFL PHQWR









2ULVFRFDPELDOpXPGRVULVFRV¿QDQFHLURVDTXHD&RPSDQKLDHVWiH[SRVWDVHQGRHVWHRULXQGRGHPRvimentos nos níveis ou na volatilidade de taxas de câmbio que referenciam posiçþes ativas e passivas.





2012

5LVFRFDPELDO

$VRVFLODo}HVQDVWD[DVGHFkPELRSRGHPWHUXPLPSDFWRQHJDWLYRQDFRQGLomRÂżQDQFHLUDHUHVXOWDGRV



operacionais da Petrobras, jĂĄ que a maioria das receitas estĂĄ predominantemente em reais enquanto a maioria dos passivos estĂĄ em moeda estrangeira.

2012

D  *HUHQFLDPHQWRGHULVFRVFDPELDLV 1RTXHVHUHIHUHDRJHUHQFLDPHQWRGHULVFRVFDPELDLVD3HWUREUDVEXVFDLGHQWLÂżFiORVHWUDWi-

1.646

Posição Lançadora ....................





9HQGD ........................................





3RVLomR7LWXODU ...........................

3.990

2.070

Posição Lançadora ....................





&RQWUDWRVDWHUPR....................





Posição Comprada ....................

275

979

ORVGHIRUPDLQWHJUDGDYLVDQGRJDUDQWLUDORFDomRHÂżFLHQWHGRVUHFXUVRVGHVWLQDGRVjSURWHomR 

patrimonial.



Aproveitando-se de atuar de forma integrada no segmento de energia, a empresa busca, primeira



PHQWHLGHQWLÂżFDURXFULDUSURWHo}HVQDWXUDLV hedgeVQDWXUDLV RXVHMDEHQHÂżFLDUVHGDVFRUUHODo}HV

2012

HQWUHVXDVUHFHLWDVHGHVSHVDV1RFDVRHVSHFt¿FRGDYDULDomRFDPELDOLQHUHQWHDRVFRQWUDWRVHP que o custo e a remuneração envolvem moedas distintas, esta proteção se då atravÊs da alocação das



Posição Vendida........................

aplicaçþes do caixa entre real, dólar ou outra moeda.

7RWDOUHJLVWUDGRHPRXWURV DWLYRVHSDVVLYRVFLUFXODQWHV ...









O gerenciamento de riscos Ê feito para a exposição líquida. São elaboradas anålises periódicas do risco cambial subsidiando as decisþes da Diretoria Executiva. A estratÊgia de gerenciamento de riscos cambiais pode

9DORUGH5HIHUrQFLD 1RFLRQDO QHJDWLYRUHSUHVHQWDSRVLomRYHQGLGD

HQYROYHURXVRGHLQVWUXPHQWRVÂżQDQFHLURVGHULYDWLYRVSDUDPLQLPL]DUDH[SRVLomRFDPELDOGHFHUWDVREULJD-

** Os valores justos negativos foram contabilizados no passivo e os positivos no ativo.

çþes da Companhia.

Principais contrapartes nas operaçþes: NYMEX, ICE, Morgan Stanley, BNP Paribas, BP North America Chicago, 6KHOO 6WDVFR 

E 3ULQFLSDLVWUDQVDo}HVHFRPSURPLVVRVIXWXURVSURWHJLGRVSRURSHUDo}HVFRPGHULYDWLYRV

H  *DQKRVHSHUGDVQRSHUtRGR

&RQWUDWRVGHSwap &RQVROLGDGR   



'HULYDWLYRVGHSHWUyOHRHGHULYDGRV ................................... *DQKR SHUGD UHJLVWUDGRQRUHVXOWDGR ..................................

&RQWURODGRUD   

24

,HQH['yODU Em setembro de 2006, a Companhia contratou uma operação de proteção patrimonial hedge denominada

I  9DORUHWLSRGHPDUJHQVGDGDVHPJDUDQWLD

cross currency swap para cobertura dos BondsHPLWLGRVHPLHQHVGHIRUPDD¿[DUHPGyODUHVRVFXVWRVGHVWD operação. No cross currency swap ocorre uma troca de taxas de juros em diferentes moedas. A taxa de câmbio

As garantias dadas como colaterais se constituem, em geral, em depĂłsitos.

GRLHQHSDUDGyODUQRUWHDPHULFDQRp¿[DGDQRLQtFLRGDWUDQVDomRHSHUPDQHFH¿[DGXUDQWHVXDH[LVWrQFLD$ Companhia não tem intenção de liquidar tais contratos antes do prazo de vencimento. Para essa relação entre o

&RQVROLGDGR

&RQWURODGRUD

GHULYDWLYRHRHPSUpVWLPRTXDOLÂżFDGDFRPRhedgeGHĂ&#x20AC;X[RGHFDL[DIRLDGRWDGDPHWRGRORJLDGHFRQWDELOL]DomR









168

367

22

170

de operaçþes de hedge (hedge accounting  Na contratação do hedgeHGXUDQWHDVXDYLJrQFLDHVSHUDVHTXHRPHVPRVHMDDOWDPHQWHH¿FD]$VDOWHUD-

J $QiOLVHGHVHQVLELOLGDGHGHGHULYDWLYRVGHSHWUyOHRHGHULYDGRV

o}HVQRYDORUMXVWRQDPHGLGDGDHÂżFiFLDGDRSHUDomRWHVWDGDWULPHVWUDOPHQWHVmRFRQWDELOL]DGDVHPRXWURV lucros abrangentes acumulados, atĂŠ que o resultado do item objeto de hedge seja realizado.

O cenĂĄrio provĂĄvel ĂŠ o valor justo em 31 de dezembro 2011, os cenĂĄrios possĂ­vel e remoto consi'yODU[&',

deram a deterioração dos preços na variåvel de risco de 25% e 50%, respectivamente, em relação a mesma data.

A Companhia contratou uma operação de swapFDPELDOUHODFLRQDGRDXP¿QDQFLDPHQWRGHLPSRUWDomR ),1,03 SDUDDTXLVLomRGHSHWUyOHR

&RQVROLGDGR 'HULYDWLYRVGH 0HUFDGRGHSHWUyOHR HGHULYDGRV

&HQiULR 3URYiYHO HP

&HQiULR 3RVVtYHO UGH

&HQiULR 5HPRWR UGH

5LVFR

Brent ......................................

Alta do PetrĂłleo Brent







A Petrobras se posiciona vendida em taxas futuras de câmbio atravÊs de NDFs (Contrato a termo de moeda

Gasolina ................................

Baixa da Gasolina

3

16

28

VHPHQWUHJDItVLFD QRPHUFDGRGHEDOFmREUDVLOHLUR2SUD]RGHH[SRVLomRpGHPHVHVHPPpGLDHDRSHUDomR

Ă&#x201C;leo CombustĂ­vel ..................

Alta do Ă&#x201C;leo CombustĂ­vel







:7, ........................................

$OWDGR:7,

-

2



Diesel.....................................

Baixa do Diesel

6





Etanol ....................................

Alta do Etanol

1





Nafta ......................................

Alta da Nafta

-





Dubai .....................................

Alta do PetrĂłleo Dubai

2





LLS ........................................

Baixa do PetrĂłleo LLS

-





&RQWUDWRVDWHUPR 'yODU

pUHDOL]DGDFRPRREMHWLYRGH¿[DUHJDUDQWLUDPDUJHPGDFRPHUFLDOL]DomR Nenhuma das operaçþes exigiu depósitos de margens em garantia. F 9DORUGHUHIHUrQFLD QRFLRQDO HYDORUMXVWRGRVLQVWUXPHQWRVGHULYDWLYRV A tabela a seguir resume as informaçþes sobre os contratos de derivativos vigentes. &RQVROLGDGR 9DORUGH5HIHUrQFLD 1RFLRQDO  HPPLOK}HV

9DORUMXVWR    

As posiçþes indicadas por hífen representam valores inferiores a R$ 500 mil. K 'HULYDWLYRVHPEXWLGRV OVSURFHGLPHQWRVSDUDLGHQWL¿FDomRGHLQVWUXPHQWRV¿QDQFHLURVGHULYDWLYRVHPFRQWUDWRVYLVDPRUHconhecimento tempestivo, controle e adequado tratamento contåbil a ser empregado, sendo aplicåveis às unidades da Petrobras e às suas subsidiårias e controladas. Os contratos com possíveis clåusulas de instrumentos derivativos ou títulos e valores mobiliårios a serem realizados são comunicados para que haja orientação a respeito da realização eventual dos testes de efetividade, estabelecimento da política contåbil a ser adotada e da metodologia para cålculo do valor justo. 2VGHULYDWLYRVHPEXWLGRVLGHQWL¿FDGRVQRSHUtRGRIRUDP 9HQGDGHHWDQRO 2FRQWUDWRFRQVLVWHHPYHQGDGHHWDQROKLGUDWDGRSRUXPDIyUPXODGHSUHoRGH¿QLGDQRPRPHQWRGD DVVLQDWXUDGRFRQWUDWR$GH¿QLomRGHSUHoRGHFDGDFDUUHJDPHQWRGHHWDQROKLGUDWDGRHQWUHJXHQHVWH FRQWUDWRHQYROYHGXDVFRWDo}HVGHUHIHUrQFLDGLVWLQWDVHWDQROHQDIWD $IyUPXODGHSUHoRHPTXHVWmRXWLOL]DFRPRXPDGHVXDVUHIHUrQFLDVDFRWDomRGHXPDcommodity que não mantÊm estrita relação de custo ou valor de mercado com o bem transacionado no contrato,

&RQWUDWRVDWHUPRGHGyODU 3RVLomR9HQGLGD .................................................... &RQWUDWRVGHswaps ................................................ 3RVLomRDWLYD Moeda estrangeira dĂłlar ........................................... 3RVLomRSDVVLYD CDI reais ................................................................... Cross Currency Swap............................................. 3RVLomRDWLYD 7D[D0pGLDGHUHFHELPHQWR -3<  DD ......... 3RVLomRSDVVLYD 7D[D0pGLDGH3DJDPHQWR 86'  DD .......... 7RWDO5HJLVWUDGRHPRXWURVDWLYRVHSDVVL  YRVFLUFXODQWHV ...................................................... **

86' USD 87

86' USD 61





 4

 USD 127

241

BRL 199



JPY 35.000

JPY 35.000

USD 298

USD 298

9HQFL PHQWR

2012 2012





926

783





272

196

2016

Os valores negativos foram contabilizados no passivo e os positivos no ativo.

Principais contrapartes nas operaçþes: Citibank, HSBC, Bradesco e Itaú As posiçþes indicadas por hífen representam valores inferiores a R$ 500 mil. G *DQKRVHSHUGDVQRSHUtRGR &RQVROLGDGR

segundo os critÊrios do pronunciamento tÊcnico CPC 38 - Instrumentos Financeiros: Reconhecimento e Mensuração. Assim sendo, conforme orientaçþes dessa norma, a parcela referente ao derivativo em-

'HULYDWLYRVGHPRHGDHVWUDQJHLUD

butido deve ser destacada do contrato original e registrada nas informaçþes contåbeis intermediårias

*DQKR SHUGD UHJLVWUDGRQRUHVXOWDGR .................................

25

VHJXLQGRDVPHVPDVUHJUDVDSOLFiYHLVDRVGHPDLVLQVWUXPHQWRVÂżQDQFHLURVGHULYDWLYRV

*DQKR SHUGD UHJLVWUDGRQRSDWULP{QLROtTXLGR ....................

8



&RQWURODGRUD 





7

-

-

-

-

 


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

E-28

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA H 9DORUHWLSRGHPDUJHQVGDGDVHPJDUDQWLD

$V&RPLVV}HVGH&UpGLWRWrPSRU¿QDOLGDGHDQDOLVDUDVTXHVW}HVYLQFXODGDVjJHVWmRGRFUpGLWRWDQWRQR que diz respeito à sua concessão, quanto à sua administração; promover a integração entre as unidades TXHDVFRPS}HPHLGHQWL¿FDUDVUHFRPHQGDo}HVDVHUHPDSOLFDGDVQDVXQLGDGHVHQYROYLGDVRXVXEPH-

As operaçþes existentes de derivativos de moeda estrangeira não exigem depósito de margem de garantia.

tidas à apreciação das instâncias superiores. I $QiOLVHGHVHQVLELOLGDGHGHPRHGDHVWUDQJHLUDGHULYDWLYRVHPSUpVWLPRVHDSOLFDo}HV¿QDQFHLUDV O cenårio provåvel Ê o valor justo em 31 de dezembro de 2011, os cenårios possível e remoto consideram a de-

A política de gestão de risco de crÊdito faz parte da política global de gestão de riscos da Companhia e visa conciliar a necessidade de minimizar a exposição ao risco de crÊdito e de maximizar o resultado das

terioração na variåvel de risco de 25% e 50%, respectivamente, em relação à mesma data.

YHQGDVHRSHUDo}HVÂżQDQFHLUDVPHGLDQWHSURFHVVRGHDQiOLVHFRQFHVVmRHJHUHQFLDPHQWRGRVFUpGLWRV GHIRUPDHÂżFLHQWH

&RQVROLGDGR

'HULYDWLYRVGH0RHGD (VWUDQJHLUD

&HQiULR &HQiULR &HQiULR 3URYiYHO 3RVVtYHO 5HPRWR HP UGH UGH  



5LVFR



Contratos a termo de dĂłlar

Valorização do Dólar frente ao Real

Cross Currency Swap ........

Desvalorização do lene frente ao Dólar

Contratos de Swap ............

Valorização do Real frente ao Dólar





243

58



32





1

&HQiULR &HQiULR &HQiULR 3URYi 3RVVtYHO 5HPRWR YHOHP UGH UGH  



5LVFR

Real ..................................

Valorização do Dólar frente ao Real

26.621

6.655

13.311

DĂłlar ..................................

Valorização do Dólar frente ao Real

68.012

17.003

34.006

Euro ...................................

Valorização do Euro frente ao Real

4.681

1.170

2.340

Yen ....................................

Valorização do Yen frente ao Real

2.897

724

1.448







1

Financiamentos em moeda nacional parametrizados à variação do dólar.

em moeda estrangeira .......

&HQiULR &HQiULR &HQiULR 3URYi 3RVVtYHO 5HPRWR YHOHP UGH UGH  



5LVFR Valorização do Real frente ao Dólar

$FDUWHLUDGHFUpGLWRFRPHUFLDOGD&RPSDQKLDTXHVXSHUD86ELOK}HVpEDVWDQWHGLYHUVLÂżFDGDHVWDQdo os crĂŠditos concedidos divididos entre clientes do mercado interno do paĂ­s e de mercados do exterior. Entre os principais clientes encontram-se as grandes empresas do mercado de petrĂłleo, consideradas

$VLQVWLWXLo}HV¿QDQFHLUDVVmREHQH¿FLiULDVGHDSUR[LPDGDPHQWH86ELOK}HVGLVWULEXtGRVHQWUHRV SULQFLSDLVEDQFRVLQWHUQDFLRQDLVFRQVLGHUDGRVSHODVFODVVL¿FDGRUDVLQWHUQDFLRQDLVGHULVFRVFRPR*UDX de Investimento e os mais importantes bancos brasileiros. *DUDQWLDVXWLOL]DGDVQRJHUHQFLDPHQWRGHULVFRVGHFUpGLWR 6RPHQWHVmRDFHLWDVJDUDQWLDVHPLWLGDVSRULQVWLWXLo}HV¿QDQFHLUDVTXHGLVSRQKDPGHFUpGLWRGLVSRQtYHO conforme os parâmetros adotados pela Companhia. As vendas a prazo para clientes considerados de alto risco só são efetuadas atravÊs do recebimento de JDUDQWLDV3DUDWDQWRD3HWUREUDVDFHLWDFDUWDVGHFUpGLWRHPLWLGDVQRH[WHULRU¿DQoDVEDQFiULDVHPLWLGDV

&RQVROLGDGR

$SOLFDomRÂżQDQFHLUD

A Petrobras utiliza, na gestão de riscos de crÊdito, parâmetros quantitativos e qualitativos adequados a cada um dos segmentos de mercado em que atua.

majors.

&RQVROLGDGR

'tYLGDGH0RHGD(VWUDQ JHLUD

3DUkPHWURVXWLOL]DGRVSDUDRJHUHQFLDPHQWRGHULVFRVGHFUpGLWR

17.440



 

 $ DQiOLVH GH VHQVLELOLGDGH LVRODGD GRV LQVWUXPHQWRV ÂżQDQFHLURV QmR UHSUHVHQWD D H[SRVLomR OtTXLGD GD Companhia ao risco cambial. Considerando o equilĂ­brio entre passivos, ativos, receitas e compromissos futuros HPPRHGDHVWUDQJHLUDRLPSDFWRHFRQ{PLFRGHSRVVtYHLVYDULDo}HVFDPELDLVQmRpFRQVLGHUDGRVLJQLÂżFDWLYR

QR%UDVLOKLSRWHFDVHFDXo}HV3DUDFOLHQWHVFRQVLGHUDGRVGHPpGLRULVFRWDPEpPVmRDFHLWDV¿DQoDVH avais dos sócios das empresas, tanto pessoas físicas quanto jurídicas. A tabela abaixo representa a exposição måxima ao risco de crÊdito para:

*DUDQWLDV ......................................................................................................................... 'HULYDWLYRV. ...................................................................................................................... $SOLFDo}HV)LQDQFHLUDV ...................................................................................................

 4.019 344 16.247

A exposição måxima ao risco de crÊdito de contas a receber Ê representada pelo saldo descrito na Nota 7.

5LVFRGHOLTXLGH]

5LVFRGHWD[DGHMXURV O risco da taxa de juros a que a Companhia estå exposta Ê em função de sua dívida de longo prazo e, em PHQRUHVFDODGHFXUWRSUD]R6HDVWD[DVGHMXURVGRPHUFDGR SULQFLSDOPHQWH/,%25 VXELUHPDVGHV-

A Petrobras utiliza seus recursos principalmente com despesas de capital, pagamentos de dividendos e UHÂżQDQFLDPHQWRGDGtYLGD+LVWRULFDPHQWHDVFRQGLo}HVVmRDWHQGLGDVFRPUHFXUVRVJHUDGRVLQWHUQD-

SHVDVÂżQDQFHLUDVDXPHQWDUmRRTXHSRGHUiFDXVDUXPLPSDFWRQHJDWLYRQRVUHVXOWDGRVRSHUDFLRQDLVH SRVLomRÂżQDQFHLUD$GtYLGDDWD[DVGHMXURVĂ&#x20AC;XWXDQWHVGHPRHGDHVWUDQJHLUDHVWiVXMHLWDSULQFLSDOPHQWH

PHQWHGtYLGDVGHFXUWRHORQJRSUD]RVÂżQDQFLDPHQWRGHSURMHWRVWUDQVDo}HVGHYHQGDVHDUUHQGDPHQWR(VWDVRULJHQVGHUHFXUVRVVRPDGDVjIRUWHSRVLomRÂżQDQFHLUDGD&RPSDQKLDFRQWLQXDUmRDSHUPLWLU

jĂ&#x20AC;XWXDomRGDOLERUHDGtYLGDDWD[DVGHMXURVĂ&#x20AC;XWXDQWHVH[SUHVVDHPUHDLVHVWiVXMHLWDSULQFLSDOPHQWHj Ă&#x20AC;XWXDomRGDWD[DGHMXURVGHORQJRSUD]R 7-/3 GLYXOJDGDSHOR%DQFR&HQWUDOGR%UDVLO

o cumprimento dos requisitos de capital estabelecidos. *HUHQFLDPHQWRGHULVFRGHOLTXLGH]

*HUHQFLDPHQWRGHULVFRVGHWD[DGHMXURV $3HWUREUDVFRQVLGHUDTXHDH[SRVLomRjVĂ&#x20AC;XWXDo}HVGDVWD[DVGHMXURVQmRDFDUUHWDLPSDFWRUHOHYDQWHGHIRUPD TXHSUHIHUHQFLDOPHQWHQmRXWLOL]DLQVWUXPHQWRVÂżQDQFHLURVGHULYDWLYRVSDUDJHUHQFLDUHVVHWLSRGHULVFRH[FHWR

$SROtWLFDGHJHUHQFLDPHQWRGHULVFRGHOLTXLGH]DGRWDGDSHOD&RPSDQKLDSUHYrDFRQWLQXLGDGHGR DORQJDPHQWRGRSUD]RGHYHQFLPHQWRGHQRVVDVGtYLGDVH[SORUDQGRDFDSDFLGDGHGH¿QDQFLDPHQWRGR mercado domÊstico e desenvolvendo uma forte presença no mercado internacional de capitais, atravÊs

HPIXQomRGHVLWXDo}HVHVSHFtÂżFDVDSUHVHQWDGDVSRUHPSUHVDVGRVLVWHPD3HWUREUDV

GDDPSOLDomRGDEDVHGHLQYHVWLGRUHVHPUHQGDÂż[D

D 3ULQFLSDLVWUDQVDo}HVHFRPSURPLVVRVIXWXURVSURWHJLGRVSRURSHUDo}HVFRPGHULYDWLYRV

$3HWUREUDVÂżQDQFLDRFDSLWDOGHJLURDVVXPLQGRGtYLGDVGHFXUWRSUD]RQRUPDOPHQWHUHODFLRQDGDVDR QRVVRĂ&#x20AC;X[RFRPHUFLDOFRPRQRWDVGHFUpGLWRGHH[SRUWDomRHDGLDQWDPHQWRVGHFRQWUDWRVGHFkPELR

&RQWUDWRVGHSwap

2VLQYHVWLPHQWRVHPDWLYRVQmRFLUFXODQWHVVmRÂżQDQFLDGRVSRUPHLRGHGtYLGDVGHORQJRSUD]RFRPR HPLVVmRGHE{QXVQRPHUFDGRLQWHUQDFLRQDODJrQFLDVGHFUpGLWRÂżQDQFLDPHQWRHSUpSDJDPHQWRGH

7D[DGHMXURVĂ&#x20AC;XWXDQWH /LERU86' [7D[DÂż[D 86'

exportação, bancos de desenvolvimento do Brasil e do exterior e linhas de crÊdito com bancos comerciais nacionais e internacionais.

A Companhia contratou uma operação denominada swap de taxa de juros, com o objetivo de transformar um ÂżQDQFLDPHQWRDWUHODGRDXPDWD[DĂ&#x20AC;XWXDQWHHPWD[DÂż[DGHIRUPDDHOLPLQDURGHVFDVDPHQWRHQWUHRVĂ&#x20AC;X[RV de caixa ativos e passivos de projeto de investimento. A Companhia nĂŁo tem intenção de liquidar a operação antes de seu vencimento e, para tanto, adotou a metodologia de contabilização de operaçþes de hedge (hedge accounting SDUDDUHODomRHQWUHRÂżQDQFLDPHQWRHRGHULYDWLYR 7D[DGHMXURVĂ&#x20AC;XWXDQWH (XULERU [7D[DÂż[D (85

$&RPSDQKLDFRQWUDWRXXPDRSHUDomRGHVZDSSDUDÂż[DomRGDWD[DGHMXURVUHODFLRQDGDDXPÂżQDQFLDPHQWR E 9DORUGHUHIHUrQFLD QRFLRQDO HYDORUMXVWRGRVLQVWUXPHQWRVGHULYDWLYRV &RQVROLGDGR 9DORUGH5HIHUrQFLD 1RFLRQDO  HPPLOK}HV  



USD 478

USD 487

9HQFL PHQWR

9DORUMXVWR  



 

14

 

&RQWUDWRVGHSwap ........................

9HQFLPHQWR

&RQVROLGDGR

&RQWURODGRUD

2012........................................................................................................

26.220

5.750

2013........................................................................................................

16.802

3.934

2014........................................................................................................

18.844

5.182

2015........................................................................................................

21.045

5.925

2016........................................................................................................

35.615

15.768

2017........................................................................................................

21.176

7.573

2018 em diante .......................................................................................

111.893

21.151

6DOGRHPGHGH]HPEURGH.......................................................





6DOGRHPGHGH]HPEURGH.......................................................





 $SOLFDo}HVÂżQDQFHLUDV RSHUDo}HVFRPGHULYDWLYRV

&RQWUDWRVGHSwap 3RVLomRSDVVLYD .............................

)OX[RQRPLQDOGHSULQFLSDOHMXURVGRVÂżQDQFLDPHQWRV

2020 2015

As operaçþes com derivativos, tanto no mercado interno quanto no mercado externo, destinam-se exclusivamente Ă troca de indexadores dos ativos que compĂľem as carteiras, e tem o objetivo de dar maior Ă&#x20AC;H[LELOLGDGHDRVDGPLQLVWUDGRUHVQDEXVFDSHODHÂżFLrQFLDQRJHUHQFLDPHQWRGDVGLVSRQLELOLGDGHV

3RVLomRDWLYD Euribor 1M .......................................

EUR20

1

-

 

-

A tabela a seguir representa os valores de mercado das operaçþes com derivativos contidas nos fundos de investimento exclusivos em 31 de dezembro de 2011.

3RVLomRSDVVLYD 7D[DÂż[DGH ..........................

EUR20



7RWDOUHJLVWUDGRHPRXWURV  DWLYRVHSDVVLYRVFLUFXODQWHV ........  ** Os valores justos foram contabilizados no passivo e os positivos no ativo. As posiçþes indicadas por hífen representam valores inferiores a R$ 500 mil.

 

&RQWUDWR



',)XWXUR ............................

F $QiOLVHGHVHQVLELOLGDGHGRVGHULYDWLYRVGHWD[DGHMXURV &RQVROLGDGR 'HULYDWLYRVGH 0RHGD(VWUDQJHLUD

5LVFR

Contratos de Swap ................

Diminuição da taxa Libor

Contratos de Swap ................

Diminuição da taxa Euribor

&HQiULR 3URYiYHOHP 

&HQiULR 3RVVtYHO GH

&HQiULR 5HPRWR GH













5LVFRGHFUpGLWR

4XDQWLGDGH 

9DORUGH5HIHUrQFLD 1RFLRQDO

9DORU-XVWR





9HQFLPHQWR

Posição comprada ..............

31.724

2.652

1

2012 Ă 2014

Posição vendida ..................

 

 



2012 Ă 2014

'yODU)XWXUR .......................







Posição comprada ..............

312

29

-

Posição vendida ..................





-

2012

As posiçþes indicadas por hífen representam valores inferiores a R$ 500 mil.

 9DORUMXVWRGRVDWLYRVHSDVVLYRVÂżQDQFHLURV

$3HWUREUDVHVWiH[SRVWDDRULVFRGHFUpGLWRGHFOLHQWHVHGHLQVWLWXLo}HV¿QDQFHLUDVGHFRUUHQWHGHVXDV RSHUDo}HVFRPHUFLDLVHGDDGPLQLVWUDomRGHVHXFDL[D7DLVULVFRVFRQVLVWHPQDSRVVLELOLGDGHGHQmR recebimento de vendas efetuadas e de valores aplicados, depositados ou garantidos por instituiçþes ¿QDQFHLUDV 2EMHWLYRVHHVWUDWpJLDVGHJHUHQFLDPHQWRGHULVFRVGHFUpGLWR

Os valores justos sĂŁo determinados com base em cotaçþes de preços de mercado, quando disponĂ­veis, RXQDIDOWDGHVWHVQRYDORUSUHVHQWHGHĂ&#x20AC;X[RVGHFDL[DHVSHUDGRV2VYDORUHVMXVWRVGHFDL[DHHTXLYDOHQtes a caixa, de contas a receber de clientes, da dĂ­vida de curto prazo e de contas a pagar a fornecedores sĂŁo equivalentes aos seus valores contĂĄbeis. Os valores justos de outros ativos e passivos de longo prazo QmRGLIHUHPVLJQLÂżFDWLYDPHQWHGHVHXVYDORUHVFRQWiEHLV

$JHVWmRGRULVFRGHFUpGLWRQD3HWUREUDVID]SDUWHGRJHUHQFLDPHQWRGRVULVFRV¿QDQFHLURVTXHpUHDOL]Ddo pelos diretores da Companhia. As Comissþes de CrÊdito são compostas, a partir de decisão da DiretoULD([HFXWLYDSRUWUrVPHPEURVVHQGRSUHVLGLGDSHOR*HUHQWH([HFXWLYRGR3ODQHMDPHQWR)LQDQFHLURH Gestão de Riscos e os demais membros são o Gerente Executivo de Finanças e o Gerente Executivo da iUHDFRPHUFLDOGHFRQWDWRFRPRFOLHQWHRXFRPD,QVWLWXLomR¿QDQFHLUD

O valor justo estimado para os emprĂŠstimos de longo prazo da Controladora e do Consolidado, em 31 de dezembro de 2011, era, respectivamente, R$ 44.097 e R$ 137.239 calculado a taxas de mercado vigentes, considerando natureza, prazo e riscos similares aos dos contratos registrados, e pode ser comparado com o valor contĂĄbil de R$ 43.055 e R$ 136.405.


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-29

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA $KLHUDUTXLDGRVYDORUHVMXVWRVGRVDWLYRVHSDVVLYRVÂżQDQFHLURVUHJLVWUDGRVDYDORUMXVWRHPEDVHUHFRU-

As informaçþes principais sobre a cobertura de seguros vigente em 31 de dezembro de 2011 podem ser

rente estĂĄ demonstrada a seguir:

assim demonstradas: 9DORUMXVWRPHGLGRFRPEDVHHP 7pFQLFDGHYDOR 7pFQLFDGHYD 7RWDOGR ORUDomRVHPR YDORU 3UHoRVFRWD UDomRVXSRUWDGD SRUSUHoRVRE XVRGHSUHoRV MXVWR GRVHPPHU REVHUYiYHLV FRQWDELOL FDGRDWLYR VHUYiYHLV 1tYHO ,,

1tYHO,,,  ]DGR 1tYHO,

$WLYR

Instalaçþes, equipamentos e produtos em estoque .... Navios-tanque e embarcaçþes auxiliares ................... 3ODWDIRUPDVÂż[DVVLVWHPDVĂ&#x20AC;XWXDQWHVGHSURGX ção e unidades de perfuração marĂ­timas .................. 7RWDO...........................................................................

$WLYRV ................................................. 7tWXORVHYDORUHVPRELOLiULRV .................

22.264

Derivativos de Moeda Estrangeira .......

32

Derivativos de commodities .................

66

6DOGRHPGHGH]HPEURGH....



6DOGRHPGHGH]HPEURGH....



22.264 243

275 49

115













7LSRVGH FREHUWXUD ,QFrQGLRULVFRVRSHracionais e riscos de engenharia Cascos

,PSRUWkQFLDVHJXUDGD &RQVR &RQWUR OLGDGR ODGRUD

Riscos de petrĂłleo

237.491 4.290

147.878

52.547 

18.498 

A Petrobras não faz seguros de lucros cessantes, controle de poços e da malha de dutos no Brasil.

 (YHQWRVVXEVHTXHQWHV Incorporação da Petroquisa e cisão parcial da BRK

3DVVLYRV  

Derivativos de Moeda Estrangeira .......  

Derivativos de commodities .................

Em 27 de janeiro de 2012, a Assembleia Geral Extraordinåria da Petrobras aprovou a incorporação da Petrobras Química S.A. - Petroquisa e a cisão parcial da BRK Investimentos Petroquímicos S.A. - BRK com versão da parcela cindida ao patrimônio da Petrobras, sem aumento do capital social.





Derivativos de juros .............................

 

6DOGRHPGHGH]HPEURGH....

 

 







6DOGRHPGHGH]HPEURGH....

 

 





Captações da PifCo Em 6 de fevereiro de 2012, a Petrobras International Finance Company - PifCo, concluiu a oferta títulos do tipo Global Notes no mercado internacional, resultando no recebimento de recursos no montante de 86ELOK}HVTXHVHUmRXWLOL]DGRVSDUDR¿QDQFLDPHQWRGRVLQYHVWLPHQWRVGD&RPSDQKLD$RSHUDomR foi constituída pela emissão de títulos com vencimento em 2015 e 2017 e pela reabertura dos títulos com vencimento em 2021 e 2041, cujas taxas de juros anuais são de 2,875%, 3,50%, 5,375% e 6,75%, respectivamente, e pagamento semestral de juros.

 6HJXURV 3DUDSURWHomRGRVHXSDWULP{QLRD3HWUREUDVWHPSRUÂżORVRÂżDEiVLFDWUDQVIHULUDWUDYpVGDFRQWUDWDomR

Os custos de emissão foram de aproximadamente US$ 22 milhões, deságio de US$ 16 milhões (séries de H HiJLRQDVUHDEHUWXUDVGRVWtWXORVGH86PLOK}HV VpULHVGHH UHVXOWDQGR em taxas de juros anuais efetivas de 3,15%, 3,69%, 4,84% e 5,95%, respectivamente. Os Global Notes constituem-se em obrigações não garantidas e não subordinadas da PifCo e contam com a garantia completa e incondicional da Petrobras.

GHVHJXURVRVULVFRVTXHQDHYHQWXDOLGDGHGHRFRUUrQFLDSRVVDPDFDUUHWDUSUHMXt]RVTXHLPSDFWHP VLJQL¿FDWLYDPHQWHRSDWULP{QLRGD&RPSDQKLDEHPFRPRRVULVFRVVXMHLWRVDVHJXURREULJDWyULRVHMD por disposiçþes legais ou contratuais. Os demais riscos são objeto de autosseguro, com a Petrobras, LQWHQFLRQDOPHQWHDVVXPLQGRRULVFRLQWHJUDOPHGLDQWHDXVrQFLDGHVHJXUR$&RPSDQKLDDVVXPHSDU-

Acordo de Investimentos para parceria na GĂĄs Brasiliano Distribuidora

cela expressiva de seu risco, contratando franquias que podem chegar ao montante equivalente a US$ 60 milhĂľes.

Em 8 de fevereiro de 2012, a Petrobras GĂĄs S.A. â&#x20AC;&#x201C; Gaspetro, a GĂĄs Brasiliano Distribuidora S.A. - GBD HD&RPSDQKLD(QHUJpWLFDGH0LQDV*HUDLVÂą&HPLJDVVLQDUDPXP$FRUGRGH,QYHVWLPHQWRVTXHSUHYr o ingresso da Cemig no capital social da GBD, resultando em uma sociedade com 60% de participação da Gaspetro e 40% da Cemig. Atualmente a GBD ĂŠ 100% controlada pela Gaspetro.

As premissas de risco adotadas não fazem parte do escopo de uma auditoria de demonstraçþes contå-

A implementação desse Acordo estå sujeita a aprovação dos órgãos reguladores competentes e a con-

beis. Consequentemente, nĂŁo foram examinados pelos nossos auditores independentes.

clusão da operação estå prevista para ocorrer durante o ano de 2012.

,QIRUPDomR&RPSOHPHQWDUVREUH$WLYLGDGHVGH([SORUDomR H3URGXomRGH3HWUyOHRH*iV 1mR$XGLWDGDV

(Em milhþes de reais, exceto quando indicado em contrårio) ,QIRUPDo}HVVREUHUHVHUYDV As atividades de exploração, desenvolvimento e produção das reservas de petróleo e de gås natural no Brasil eram exercidas, exclusivamente, sob a modalidade de concessão atÊ a promulgação da Lei 12.351, de 22 de dezembro de 2010,que introduziu o regime de partilha de produção onde åreas do PrÊ-Sal e outras consideradas estratÊgicas passam a ser contratadas pela União. No exterior, a Companhia detÊm a maior parte de seus contratos sob a modalidade de concessão. Portanto, nos ativos da Companhia são apresentados os gastos incorridos para explorar e desenvolver a produção e não o volume de reservas monetizadas. As reservas de petróleo e gås provadas correspondem às quantidades estimadas de petróleo bruto, gås natural e condensado que pela anålise dos dados de geo-engenharia, podem ser estimados com razoåvel certeza, consideUDGRVFRPHUFLDLVGHXPUHVHUYDWyULRFRQKHFLGRVREFRQGLo}HVHFRQ{PLFDVGH¿QLGDVPpWRGRVGHRSHUDomRFRQKHFLGRVHVREDVFRQGLo}HVUHJXODWyULDVYLJHQWHVQXPDGHWHUPLQDGDGDWD As reservas provadas desenvolvidas correspondem às quantidades de hidrocarbonetos que se espera recuperar nos projetos existentes de explotação de óleo e gås atravÊs de poços, equipamentos e mÊtodos operacionais existentes. As reservas provadas não desenvolvidas correspondem aos volumes de hidrocarbonetos que se esperam recuperar em função de investimentos futuros em perfuração de poços, em equipamentos adicionais. A estimativa de reservas possui incertezas inerentes ao negócio, e assim sendo alteraçþes podem ocorrer à medida que se amplia o conhecimento, a partir da aquisição de novas informaçþes. $VUHVHUYDVGHSHWUyOHRHJiVSURYDGDVOtTXLGDVHVWLPDGDVSHOD&RPSDQKLDGHDFRUGRFRPRVFULWpULRVGH¿QLGRVSHODSecurities and Exchange Commission - SEC, são as seguintes: 3HWUyOHR ELOK}HVGHEEO 

*iV ELOK}HVGHPĂą 

3HWUyOHR*iV ELOK}HVGHERH 

%UDVLO

,QWHUQDFLRQDO

7RWDO

%UDVLO

,QWHUQDFLRQDO

7RWDO

%UDVLO

,QWHUQDFLRQDO

7RWDO

Saldo em 31 de dezembro de 2010 ............................................

10,379

0,345

10,724

279,651

37,600

317,251

12,139

0,566

12,705

Variação das reservas ...............................................................

0,737

0,066

0,803

31,677

2,544

34,221

0,936

0,081

1,017

Produção ...................................................................................



 





 









Saldo em 31 de dezembro de 2011 ............................................

10,411

0,364

10,775

293,242

36,839

330,081

12,256

0,580

12,836

Saldo em 31 de dezembro de 2010 ............................................

-

0,033

0,033

-

1,691

1,691

-

0,043

0,043

Saldo em 31 de dezembro de 2011 ............................................

-

0,030

0,030

-

1,231

1,231

-

0,037

0,037

Saldo em 31 de dezembro de 2010 ............................................

6,931

0,183

7,114

184,822

15,855

200,677

8,094

0,276

8,370

Saldo em 31 de dezembro de 2011 ............................................

6,974

0,181

7,155

181,134

14,506

195,640

8,113

0,267

8,380

Reserva de empresas nĂŁo consolidadas ...................................

Reservas provadas e desenvolvidas .........................................

1mRDXGLWDGR 1DVUHVHUYDVSURYDGDVLQWHUQDFLRQDLVQmRHVWmRVHQGRLQFOXtGDVDVUHVHUYDVGD%ROtYLDDWHQGHQGRjH[LJrQFLDGD1RYD&RQVWLWXLomR3ROtWLFDGR(VWDGR 1&3( TXHSURtEHDDQRWDomRHUHJLVWURGDVUHVHUYDVGHyOHRHJiVSRUHPSUHVDV privadas no paĂ­s.

&216(/+2'($'0,1,675$d­2(',5(725,$(;(&87,9$ &216(/+2'($'0,1,675$d­2 *8,'20$17(*$ Presidente )5$1&,6&252%(572'($/%848(548( Conselheiro

0Ă&#x2C6;5&,23(5(,5$=,00(50$11 Conselheiro

-25*(*(5'$8-2+$113(7(5 Conselheiro

-268e&+5,67,$12*20(6'$6,/9$ Conselheiro

0,5,$0$3$5(&,'$%(/&+,25 Conselheira

-26e6(5*,2*$%5,(//,'($=(9('2 Conselheiro

/8&,$12*$/9­2&287,1+2

6e5*,2)5$1./,148,17(//$

Conselheiro

Conselheiro

',5(725,$(;(&87,9$ -26e6(5*,2*$%5,(//,'($=(9('2 Presidente $/0,5*8,/+(50(%$5%$66$ Diretor Financeiro e de Relaçþes com Investidores

0$5,$'$6*5$d$66,/9$)267(5 Diretora de GĂĄs e Energia

*8,/+(50('(2/,9(,5$(675(//$ Diretor de Exploração e Produção

3$8/252%(572&267$ Diretor de Abastecimento

-25*(/8,==(/$'$ Diretor Internacional

5(1$72'(628=$'848( Diretor de Serviços 0$5&26$1721,26,/9$0(1(=(6 Contador - CRC-RJ 35.286/O-1


cyan magenta amarelo preto

E-30

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio

Minas e Energia

PetrĂłleo Brasileiro S.A. CNPJ NÂş 33.000.167/0001-01 - COMPANHIA ABERTA

5(/$7Ă?5,2'26$8',725(6,1'(3(1'(17(662%5($6'(021675$dÂŽ(6&217Ă&#x2C6;%(,6 Ao

2SLQLmRVREUHDVGHPRQVWUDo}HVFRQWiEHLVFRQVROLGDGDV

Conselho de Administração e aos Acionistas da Petróleo Brasileiro S.A. - Petrobras 7.

Rio de Janeiro - RJ

Em nossa opinião, as demonstraçþes contåbeis consolidadas acima referidas apresentam adequadamente, HPWRGRVRVDVSHFWRVUHOHYDQWHVDSRVLomRSDWULPRQLDOH¿QDQFHLUDFRQVROLGDGDGD3HWUyOHR%UDVLOHLUR

1.

Examinamos as demonstraçþes contåbeis individuais e consolidadas da Petróleo Brasileiro S.A. - Petrobras

S.A. - Petrobras e suas controladas em 31 de dezembro de 2011, o desempenho consolidado de suas

³&RPSDQKLD´ LGHQWL¿FDGDVFRPR&RQWURODGRUDH&RQVROLGDGRUHVSHFWLYDPHQWHTXHFRPSUHHQGHPRED-

RSHUDo}HVHRVVHXVĂ&#x20AC;X[RVGHFDL[DFRQVROLGDGRVSDUDRH[HUFtFLRÂżQGRQDTXHODGDWDGHDFRUGRFRP

lanço patrimonial em 31 de dezembro de 2011 e as respectivas demonstraçþes do resultado, do resultado DVQRUPDVLQWHUQDFLRQDLVGHUHODWyULR¿QDQFHLUR ,)56 HPLWLGDVSHORInternational Accounting Standards

DEUDQJHQWHGDVPXWDo}HVGRSDWULP{QLROtTXLGRHGRVĂ&#x20AC;X[RVGHFDL[DSDUDRH[HUFtFLRÂżQGRQDTXHODGDWD

2.

assim como o resumo das principais prĂĄticas contĂĄbeis e demais notas explicativas.

Board - IASB e as prĂĄticas contĂĄbeis adotadas no Brasil.

5HVSRQVDELOLGDGHGDDGPLQLVWUDomRVREUHDVGHPRQVWUDo}HVFRQWiEHLV

Ă&#x2021;QIDVH

A administração da Companhia Ê responsåvel pela elaboração e adequada apresentação das demonstraçþes contåbeis individuais de acordo com as pråticas contåbeis adotadas no Brasil e

8.

Conforme descrito na Nota Explicativa nº 2, as demonstraçþes contåbeis individuais foram elaboradas

das demonstraçþes contåbeis consolidadas de acordo com as normas internacionais de relatório

de acordo com as prĂĄticas contĂĄbeis adotadas no Brasil. No caso da PetrĂłleo Brasileiro S.A. - Petrobras

ÂżQDQFHLUR ,)56 HPLWLGDVSHORInternational Accounting Standards Board - IASB, e de acordo com as

essas pråticas diferem do IFRS, aplicåvel às demonstraçþes contåbeis separadas, somente no que se

prĂĄticas contĂĄbeis adotadas no Brasil, assim como pelos controles internos que ela determinou como

refere à avaliação dos investimentos em controladas, coligadas e controladas em conjunto pelo mÊtodo

necessårios para permitir a elaboração dessas demonstraçþes contåbeis livres de distorção relevante,

GHHTXLYDOrQFLDSDWULPRQLDOHQTXDQWRTXHSDUDÂżQVGH,)56VHULDFXVWRRXYDORUMXVWRHSHODRSomRSHOD

independentemente se causada por fraude ou erro.

manutenção do saldo de ativo diferido, existente em 31 de dezembro de 2008, que vem sendo amortizado. 5HVSRQVDELOLGDGHGRVDXGLWRUHVLQGHSHQGHQWHV 3.

Nossa opinião não estå ressalvada em função desse assunto.

Nossa responsabilidade Ê a de expressar uma opinião sobre essas demonstraçþes contåbeis com base 2XWURVDVVXQWRV

em nossa auditoria, conduzida de acordo com as normas brasileiras e internacionais de auditoria. Essas QRUPDVUHTXHUHPRFXPSULPHQWRGHH[LJrQFLDVpWLFDVSHORVDXGLWRUHVHTXHDDXGLWRULDVHMDSODQHMDGDH executada com o objetivo de obter segurança razoåvel de que as demonstraçþes contåbeis estão livres

'HPRQVWUDo}HVGRYDORUDGLFLRQDGRGDVHJPHQWDomRGHQHJyFLRVHGREDODQoRVRFLDO

de distorção relevante. 4.



8PD DXGLWRULD HQYROYH D H[HFXomR GH SURFHGLPHQWRV VHOHFLRQDGRV SDUD REWHQomR GH HYLGrQFLD D respeito dos valores e divulgaçþes apresentados nas demonstraçþes contåbeis. Os procedimentos selecionados dependem do julgamento do auditor, incluindo a avaliação dos riscos de distorção relevante nas demonstraçþes contåbeis, independentemente se causada por fraude ou erro. Nessa avaliação de riscos, o auditor considera os controles internos relevantes para a elaboração e adequada apresentação das demonstraçþes contåbeis da Companhia para planejar os procedimentos de auditoria que são DSURSULDGRV QDV FLUFXQVWkQFLDV PDV QmR SDUD ¿QV GH H[SUHVVDU XPD RSLQLmR VREUH D H¿FiFLD GHVVHV controles internos da Companhia. Uma auditoria inclui, tambÊm, a avaliação da adequação das pråticas contåbeis utilizadas e a razoabilidade das estimativas contåbeis feitas pela administração, bem como a avaliação da apresentação das demonstraçþes contåbeis tomadas em conjunto.



([DPLQDPRVWDPEpPDVGHPRQVWUDo}HVLQGLYLGXDLVHFRQVROLGDGDVGRYDORUDGLFLRQDGR '9$ UHIHUHQWHV DRH[HUFtFLR¿QGRHPGHGH]HPEURGHFXMDDSUHVHQWDomRpUHTXHULGDSHODOHJLVODomRVRFLHWiULD brasileira para companhias abertas, as demonstraçþes consolidadas da segmentação de negócios e as informaçþes contåbeis consolidadas contidas no balanço social, elaboradas sob a responsabilidade da administração da Companhia, como informação suplementar pelas IFRS, que não requerem a apresentação da DVA e balanço social. Essas demonstraçþes foram submetidas aos mesmos procedimentos de auditoria descritos anteriormente e, em nossa opinião, estão adequadamente apresentadas, em todos os seus aspectos relevantes, em relação às demonstraçþes contåbeis tomadas em conjunto.

$FUHGLWDPRVTXHDHYLGrQFLDGHDXGLWRULDREWLGDpVXÂżFLHQWHHDSURSULDGDSDUDIXQGDPHQWDUQRVVDRSLQLmR Rio de Janeiro, 9 de fevereiro de 2012 2SLQLmRVREUHDVGHPRQVWUDo}HVFRQWiEHLVLQGLYLGXDLV

6.

Em nossa opiniĂŁo, as demonstraçþes contĂĄbeis individuais acima referidas apresentam adequadamente, em WRGRVRVDVSHFWRVUHOHYDQWHVDSRVLomRSDWULPRQLDOHÂżQDQFHLUDGD3HWUyOHR%UDVLOHLUR6$3HWUREUDVHP GHGH]HPEURGHRGHVHPSHQKRGHVXDVRSHUDo}HVHRVVHXVĂ&#x20AC;X[RVGHFDL[DSDUDRH[HUFtFLRÂżQGR

KPMG Auditores Independentes

Bernardo Moreira Peixoto Neto

naquela data, de acordo com as prĂĄticas contĂĄbeis adotadas no Brasil.

CRC SP-014428/O-6 F-RJ

Contador CRC RJ-064887/O-8

3$5(&(5'2&216(/+2),6&$/ 1.



O Conselho Fiscal da Petróleo Brasileiro S.A. - Petrobras, no exercício de suas funçþes legais e

parcela que cabe aos administradores da Companhia relativamente à participação nos lucros ou resultados

estatutĂĄrias, em reuniĂŁo realizada nesta data, examinou os seguintes documentos emitidos pela

3/5 GRH[HUFtFLRGHHE DVHUVXEPHWLGDjGHOLEHUDomRGD$VVHPEOHLD*HUDO([WUDRUGLQiULDÂą

Petrobras: I- o Relatório Anual da Administração - Exercício de 2011; II- o Balanço Patrimonial e as demais

$*($SURYDUDLQFRUSRUDomRDRFDSLWDOGHSDUWHGDUHVHUYDGHLQFHQWLYRVÂżVFDLVUHIHUHQWHDRLQFHQWLYR

'HPRQVWUDo}HV&RQWiEHLVUHODWLYRVDRH[HUFtFLRÂżQGRHPGHGH]HPEURGHH,,,R2UoDPHQWRGH

para subvenção de investimentos no âmbito da SUDAM e SUDENE, no montante de R$ 12 milhþes, sem

Capital para o exercĂ­cio de 2012.

a emissão de novas açþes, e a conseqßente alteração do artigo 4º do Estatuto Social da Companhia.

)RUDP YHULÂżFDGDV DV VHJXLQWHV SURSRVWDV TXH HVWmR VHQGR HQFDPLQKDGDV SHOD $GPLQLVWUDomR GD



&RP EDVH QRV H[DPHV HIHWXDGRV FRQVWDWDQGRVH TXH RV UHIHULGRV GRFXPHQWRV VRFLHWiULRV UHĂ&#x20AC;HWHP

&RPSDQKLD j DSURYDomR GRV DFLRQLVWDV D  D VHUHP VXEPHWLGDV j GHOLEHUDomR GD $VVHPEOHLD *HUDO

DGHTXDGDPHQWH HP WRGRV RV DVSHFWRV UHOHYDQWHV D VLWXDomR SDWULPRQLDO H ÂżQDQFHLUD GD 3HWUREUDV

2UGLQiULDÂą$*2Â? $SURYDUR5HODWyULR$QXDOGD$GPLQLVWUDomR([HUFtFLRÂ? $SURYDUR%DODQoR

e Ă vista do parecer da KPMG Auditores Independentes, de 09/02/2012, apresentado sem ressalva,

3DWULPRQLDOHDVGHPDLV'HPRQVWUDo}HV&RQWiEHLVGD3HWUREUDV &RQWURODGRUDH&RQVROLGDGDV Âą([HUFtFLR

o Conselho Fiscal opina favoravelmente à aprovação das referidas propostas a serem submetidas à

Â? $SURYDUDUHWHQomRGHOXFURUHPDQHVFHQWHGRH[HUFtFLRGHQRPRQWDQWHGH5

discussão e votação nas Assembleias Gerais Ordinåria e Extraordinåria dos Acionistas da Petrobras.

milhĂľes, sendo R$ 18.337 milhĂľes proveniente do lucro do exercĂ­cio de 2011 e R$ 10 milhĂľes provenientes de saldo remanescente de lucros acumulados, que se destina a atender parcialmente o programa anual de

Rio de Janeiro, 09 de fevereiro de 2012

investimentos estabelecido no Orçamento de Capital de 2012, e a retenção de R$ 81 milhþes em reserva 0DUFXV3HUHLUD$XFpOLR Presidente

GHLQFHQWLYRV¿VFDLV� $SURYDUR2UoDPHQWRGH&DSLWDO¹([HUFtFLRQRPRQWDQWHGH5 PLOK}HV 5HFXUVRV3UySULRV5PLOK}HVH5HFXUVRVGH7HUFHLURV5PLOK}HV � $SURYDU a destinação do resultado que considera a distribuição do dividendo do exercício de 2011 no montante de

&pVDU$FRVWD5HFK Conselheiro

0DULD/~FLDGH2OLYHLUD)DOFyQ Conselheira

0DULVHWH)iWLPD'DGDOG3HUHLUD Conselheira

1HOVRQ5RFKD$XJXVWR Conselheiro

5PLOK}HV 5SRUDomRRUGLQiULDHSUHIHUHQFLDO HTXLYDOHQWHDGROXFUREiVLFRH inclui a parcela de R$ 10.436 milhþes de juros sobre o capital próprio (equivalente a R$ 0,80 por ação RUGLQiULDHSUHIHUHQFLDO H� $SURYDUHPDWHQGLPHQWRDR$UWLJRGR(VWDWXWR6RFLDOGD3HWUREUDVD


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de marรงo de 2012

Jornal do Commercio E-31


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de marรงo de 2012

Jornal do Commercio

E-32

Continuaรงรฃo

Minas e Energia

RELATร“RIO DA ADMINISTRAร‡รƒO A Petrobras Distribuidora S.A. โ€“ BR, lรญder no mercado de distribuiรงรฃo de combustรญveis, com ampla atuaรงรฃo em todo o paรญs, no cumprimento das prescriรงรตes legais e estatutรกrias, apresenta o Relatรณrio de Administraรงรฃo e as Demonstraรงรตes Contรกbeis da Companhia, acompanhadas do parecer dos auditores independentes e do &RQVHOKR)LVFDOUHIHUHQWHVDRH[HUFtFLRVRFLDOยฟQGRHPGHGH]HPEURGH

MENSAGEM DO PRESIDENTE (PQRYHPEURGHD%5FRPSOHWRXDQRVGHH[LVWrQFLDHDFUHGLWDPRVWHUPXLWRVPRWLYRVSDUDQRVRUJXOKDU desta nossa jornada. /tGHUGRVHWRUFRPXPIDWXUDPHQWRUHFRUGHGH5ELOK}HVHDSUHVHQWDQGRXPPDUNHWVKDUHGH DHPSUHVDFKHJDDRยฟPGHFRPDPDUFDGHPLOPรฑFRPHUFLDOL]DGRVYROXPHPDLRUTXHR UHJLVWUDGRQRDQRDQWHULRU&RPYHQGDVPpGLDVPHQVDLVDFLPDGRVPLOK}HVGHP, cuja barreira foi ultrapassada HPHVWDEHOHFHXQRYRUHFRUGHGHYHQGDVPLOP. &RPXPPHUFDGRSXMDQWHTXHFUHVFHDWD[DVPDLRUHVTXHRFUHVFLPHQWRGR3,%DHPSUHVDWHPLQYHVWLGR PDFLoDPHQWHHPVXDLQIUDHVWUXWXUDRSHUDFLRQDOHYDUHMLVWDWHQGRUHDOL]DGR5ELOKmRHPLQYHVWLPHQWRVHP ยฑVXSHULRUDRUHDOL]DGRQRDQRDQWHULRUUHIRUoDQGRRFRPSURPLVVRGHOHYDUFRPEXVWtYHLVGHTXDOLGDGH DRVTXDWURVFDQWRVGR%UDVLOFRPGHVWDTXHSDUDRVLQYHVWLPHQWRVUHDOL]DGRVQDSUHSDUDomRGDLQIUDHVWUXWXUD RSHUDFLRQDOSDUDDPRYLPHQWDomRGRGLHVHOFRPEDL[RWHRUGHHQ[RIUH 6H6 HPWRGRR%UDVLODSDUWLUGH HDPSOLDomRHPRGHUQL]DomRGRSDUTXHRSHUDFLRQDOLQFOXLQGRRLQtFLRGDFRQVWUXomRGHGXDVQRYDV EDVHVDDPSOLDomRGDIiEULFDGHOXEULยฟFDQWHVHP'XTXHGH&D[LDV5-VHPGHL[DUGHFLWDURVLQYHVWLPHQWRV efetuados no segmento de aviaรงรฃo de forma a atender a crescente demanda do setor.

GOVERNANร‡A CORPORATIVA E ORGANIZAร‡รƒO GERAL 1DHVWUXWXUDJHUDOGHRUJDQL]DomRGD%5R&RQVHOKRGH$GPLQLVWUDomRpRyUJmRGHRULHQWDomRHGLUHomR VXSHULRUGD&RPSDQKLDFRPSHWLQGROKHยฟ[DUDRULHQWDomRJHUDOGRVVHXVQHJyFLRVGHยฟQLQGRVXDPLVVmRH VHXVREMHWLYRVHVWUDWpJLDVHGLUHWUL]HV$'LUHWRULD([HFXWLYDIXQFLRQDFRPRyUJmRFROHJLDGRHH[HUFHDJHVWmR GRVQHJyFLRVGD&RPSDQKLDGHDFRUGRFRPDPLVVmRRVREMHWLYRVDVHVWUDWpJLDVHGLUHWUL]HVยฟ[DGDVSHOR Conselho de Administraรงรฃo. $%5FRQWDDLQGDFRPXP&RQVHOKR)LVFDOGHFDUiWHUSHUPDQHQWHTXHFRPS}HVHGHDWp FLQFR PHPEURV HIHWLYRVHLJXDOQ~PHURGHVXSOHQWHVHOHLWRVSHOD$VVHPEOpLD*HUDO2UGLQiULD&RPSHWHDHVVHFRQVHOKRยฟVFDOL]DURVDWRVGRVDGPLQLVWUDGRUHVHYHULยฟFDURFXPSULPHQWRGRVVHXVGHYHUHVOHJDLVHHVWDWXWiULRVRSLQDUVREUHR UHODWyULRDQXDOGDDGPLQLVWUDomRH[DPLQDUDVGHPRQVWUDo}HVยฟQDQFHLUDVGRH[HUFtFLRVRFLDOHVREUHHODVRSLQDU entre outras. $HVWUXWXUDJHUDOpFRPSRVWDGDVXQLGDGHVRUJDQL]DFLRQDLVGLUHWDPHQWHVXERUGLQDGDVj'LUHWRULD([HFXWLYD DOpPGD$XGLWRULD,QWHUQDUHVSRQViYHOSHORPRQLWRUDPHQWRDYDOLDomRHDGHTXDomRGRDPELHQWHGHFRQWUROHV LQWHUQRVH2XYLGRULDSDUDDFROKHURSLQL}HVFUtWLFDVUHFODPDo}HVHGHQ~QFLDVJDUDQWLQGRFRQยฟGHQFLDOLGDGHD VHXVXVXiULRVHSURPRYHQGRDVDSXUDo}HVHSURYLGrQFLDVQHFHVViULDVDPEDVYLQFXODGDVDR&RQVHOKRGH$GPLQLVWUDomRHLQWHJUDQWHVGDiUHDGHFRQWDWRGR3UHVLGHQWH23UHVLGHQWHpUHVSRQViYHOSHODGLUHomRHFRRUGHQDomR dos trabalhos da Diretoria Executiva e pela gestรฃo das funรงรตes corporativas da Companhia. Conforme artigo 9ยบ do Estatuto Social da BR, o Conselho de Administraรงรฃo da Companhia รฉ composto pelos

)RUDPLQ~PHURVRVSUrPLRVHUHFRQKHFLPHQWRVUHFHELGRVSHOD&LDVHMDSRUDo}HVGHFDUiWHUVRFLDOVHMDSHOD VXDUHOHYkQFLDQRPHUFDGRGHGLVWULEXLomRGRVTXDLVWHPRVRUJXOKRGHGHVWDFDU

PHVPRVPHPEURVGR&RQVHOKRGH$GPLQLVWUDomRGDFRQWURODGRUD 3HWUREUDV H[FHWRFRPUHODomRDRUHSUH-

ย‡

HPSUHJDGRVDWLYRVGD3HWUREUDV'LVWULEXLGRUD6$%5REVHUYDGDVHPWRGRVRVFDVRVDVH[FHo}HVSUHYLVWDV

ย‡ ย‡

9HQFHGRUDGRSUrPLRยณ$VHPSUHVDVPDLV$GPLUDGDVQR%UDVLOยดQDFDWHJRULDยณ'LVWULEXLGRUHVGH&RPEXVWtYHLVRX'HULYDGRVGH3HWUyOHRยด 3UrPLR,QWDQJtYHO%UDVLO 3,% QDFDWHJRULDยณ$WDFDGRH/RJtVLWLFDยด 8PDGDVHPSUHVDVGRVHWRUDXWRPRWLYRFHUWLยฟFDGDVQR723&RQVXPLGRUยฑ([FHOrQFLDQDV5HODรงรตes de Consumo e Respeito ao Meio-Ambiente.

-iTXHHVWDPRVIDODQGRHPGHVWDTXHQmRSRGHPRVGHL[DUGHPHQFLRQDUTXHHPLQDXJXUDPRVRยณ3RVWR GR)XWXUR3HWUREUDVยดLQLFLDWLYDSLRQHLUDQRSDtVTXHPLVWXUDWpFQLFDVGHUHDSURYHLWDPHQWRGHUHFXUVRVFRP HTXLSDPHQWRVTXHLGHQWLยฟFDPPRQLWRUDPHSHUPLWHPFXVWRPL]DURDWHQGLPHQWRDRVFOLHQWHVGDUHGH5H~QH as mais novas tecnologias de interatividade com o consumidor e de energias alternativas com a implantaรงรฃo de XPDHVWDomRHOpWULFDTXHSURGX]HQHUJLDSRUERELQDVHyOLFDVDOpPGRVLVWHPDGHUHDSURYHLWDPHQWRGHGD iJXDXWLOL]DGDQDODYDJHPGRVYHtFXORV (QmRSDUDSRUDtYDPRVGREUDUQRVVRVLQYHVWLPHQWRVHPORJtVWLFDDWpSDUDDFRPSDQKDURFUHVFLPHQWRGR consumo interno, inclusive nos aeroportos, de olho no aumento dos seus movimentos, nรฃo sรณ pelo crescimento GRSRGHUDTXLVLWLYRPDVSRUHYHQWRVFRPRD&RSDGR0XQGRH2OLPStDGDV

VHQWDQWHGRVHPSUHJDGRVRTXDOpVXEVWLWXtGRQD%5SHORUHSUHVHQWDQWHGRVHPSUHJDGRVHVFROKLGRVHQWUHRV QR'HFUHWRQยžGHGHPDUoRGH 2&RQVHOKRGH$GPLQLVWUDomRGD%5DSURYRXD(VWUXWXUD2UJDQL]DFLRQDOGD&RPSDQKLDHR3ODQR%iVLFRGH 2UJDQL]DomRFRQIRUPH$WD%5LWHPGH3DXWDQยž 2DUWLJRLWHP,GR(VWDWXWR6RFLDOHVWDEHOHFHTXHFRPSHWHSULYDWLYDPHQWHDR&RQVHOKRGH$GPLQLVWUDomR GHOLEHUDUVREUHR3ODQR%iVLFRGH2UJDQL]DomR(PUHODomRjDSURYDomRGD(VWUXWXUD%iVLFDGRVyUJmRVGD &RPSDQKLDHGHVXDVUHVSHFWLYDV1RUPDVGH2UJDQL]DomRGHDFRUGRFRPDUWLJRLWHP,,OHWUDJGR(VWDWXWR 6RFLDODFRPSHWrQFLDpGD'LUHWRULD([HFXWLYD $HVWUXWXUDJHUDOGHRUJDQL]DomRGD%5pDVVLPFRQยฟJXUDGD

)RUDP  DQRV HP TXH QmR QRV IDOWDUDP D SDUFHULD FRP IRUQHFHGRUHV FOLHQWHV  H HVSHFLDOPHQWH QRVVD DJXHUULGDIRUoDGHWUDEDOKR6RPRVXPDHPSUHVDFRQVROLGDGDOtGHUGHVHXVHJPHQWRTXHDWXDFRPHยฟFLrQFLD e responsabilidade socioambiental. ([SUHVVRRVPHXVDJUDGHFLPHQWRVSHODFRQยฟDQoDHDSRLRUHFHELGRDWRGRVIRUQHFHGRUHVFOLHQWHVFRQVHOKHLURV e forรงa de trabalho.

Josรฉ Lima da Andrade Neto Presidente da Petrobras Distribuidora

PERFIL $%5IRLFULDGDQRGLDGHQRYHPEURGHFRPRVXEVLGLiULDGD3HWUyOHR%UDVLOHLUR6$ยฑ3HWUREUDVeXPD sRFLHGDGHDQ{QLPDGHFDSLWDOIHFKDGRTXHDWXDQDFRPHUFLDOL]DomRHGLVWULEXLomRGHGHULYDGRVGHSHWUyOHRJiV natural, etanol e biocombustรญveis para todo o Brasil. 2VSURSyVLWRVDUD]mRGHVHUHRVFRPSURPLVVRVHVVHQFLDLVGD%5HVWmRGHยฟQLGRVHPVXD0LVVmREDVHGHVXD FRQVWUXomRHVWUDWpJLFDยณ'LVWULEXLULQGXVWULDOL]DUHFRPHUFLDOL]DUGHULYDGRVGHSHWUyOHRHVHXVFRUUHODWRVFRP FRPSHWLWLYLGDGHUHQWDELOLGDGHHUHVSRQVDELOLGDGHVRFLDOHDPELHQWDOยด

$'LUHWRULDGD5HGHGH3RVWRVGH6HUYLoR '536 pUHVSRQViYHOSRUFRQGX]LUHREWHURVPHOKRUHVUHVXOWDGRV UHODWLYRVDRVQHJyFLRVUHDOL]DGRVFRPD5HGH$XWRPRWLYDDWHQGLGDSHOD%5XWLOL]DQGRVXDiUHDGHFRQWDWR $'LUHWRULDGH0HUFDGR&RQVXPLGRU '0&2 pUHVSRQViYHOSRUFRQGX]LUHREWHURVPHOKRUHVUHVXOWDGRVDWUDYpV

$VDo}HVHQHJyFLRVGD%5VHRULHQWDPSHORVVHJXLQWHV9DORUHVTXHVmRFRPSDUWLOKDGRVSRUWRGRVQD&RPSDQKLD2UJXOKRGHVHU3HWUREUDV'HVHQYROYLPHQWR6XVWHQWiYHO,QWHJUDomR5HVXOWDGRV3URQWLGmRSDUD0XGDQoDV(PSUHHQGHGRULVPRH,QRYDomReWLFDH7UDQVSDUrQFLD5HVSHLWRj9LGD'LYHUVLGDGH+XPDQDH&XOWXUDO Pessoas.

GDJHVWmRLQWHJUDGDGDV*HUrQFLDV([HFXWLYDV&RPHUFLDLVGHVXDiUHDGHFRQWDWRTXHFRPS}HPRGHQRPLQDGR

A BR, por meio de duas grandes รกreas comerciais, atua no Mercado de Rede de Postos de Serviรงos e no MercaGR&RQVXPLGRU20HUFDGRGH5HGHGH3RVWRVFRPSUHHQGHDUHYHQGDGHFRPEXVWtYHLVGHULYDGRVGHSHWUyOHR OXEULยฟFDQWHVJiVQDWXUDOYHLFXODUHELRFRPEXVWtYHLVDOpPGDFRPHUFLDOL]DomRGHSURGXWRVGHFRQYHQLrQFLDH SUHVWDomRGHVHUYLoRVDJUHJDGRVQRVSRVWRVGHVHUYLoRHQDVORMDVGHFRQYHQLrQFLD(VVH0HUFDGRWHPFRPR FOLHQWHV3RVWRV5HYHQGHGRUHVH)UDQTXHDGRV3RUVXDYH]R0HUFDGR&RQVXPLGRUFRPSUHHQGHDFRPHUFLDOL]DomRยณSRUDWDFDGRยดGHFRPEXVWtYHLVOXEULยฟFDQWHVSURGXWRVHVSHFLDLVDVIDOWRVHHPXOV}HVHHQHUJLDHWHP FRPRFOLHQWHVLQG~VWULDVJUDQGHVHVWDEHOHFLPHQWRVFRPHUFLDLVRXGHVHUYLoRVHPSUHVDVDpUHDVHDYLDomR H[HFXWLYDJRYHUQRVHPSUHVDVGHWUDQVSRUWH3HWUREUDV6HWRU$JUtFROD7UDQVSRUWDGRUHV5HYHQGHGRUHV5HWDOKLVWDV 755V HQWUHRXWURV

GHLDGH6XSULPHQWR/RJtVWLFD2SHUDo}HVรˆUHD,QGXVWULDO6HUYLoRVFRPSDUWLOKDGRVGD%5H(QJHQKDULD6D~GH

2VSULQFLSDLVSURGXWRVFRPHUFLDOL]DGRVSHOD%5SRGHPVHUFODVVLยฟFDGRVFRPR ย‡&RPEXVWtYHLV&ODURVJDVROLQDV FRPXPDGLWLYDGDHSUHPLXP yOHRVGLHVHO FRPXPELRGLHVHOPDUtWLPRDGLWLYDGRHSDUDItQLFR TXHURVHQHGHDYLDomR4$9HWDQROKLGUDWDGRHJDVROLQDGHDYLDomR ย‡&RPEXVWtYHLV(VFXURVyOHRVFRPEXVWtYHLVHFRTXHGHSHWUyOHR ย‡รOHRVH*UD[DV/XEULยฟFDQWHVDXWRPRWLYRVLQGXVWULDLVPDUtWLPRVIHUURYLiULRVDYLDomR

mercado consumidor da BR. $'LUHWRULDGH2SHUDo}HVH/RJtVWLFD ',2/ pUHVSRQViYHOSHODJHVWmRLQWHJUDGDGDVDWLYLGDGHVUHODWLYDVjFDMeio-ambiente e Seguranรงa. (D'LUHWRULD)LQDQFHLUD '),1 FRPDUHVSRQVDELOLGDGHSHODVDWLYLGDGHVGH)LQDQoDVH7HFQRORJLDGD,QIRUPDomRFRQFHQWUDQGRHVIRUoRVQDJHVWmRGRVUHFXUVRVยฟQDQFHLURVGD&RPSDQKLD

PLANEJAMENTO ESTRATร‰GICO $%5QRUWHLDDJHVWmRGHVHXVQHJyFLRVDSRLDGDHPXP3ODQR(VWUDWpJLFRHXP3ODQRGH1HJyFLRVDSURYDGRV pelo Conselho de Administraรงรฃo e alinhados aos da Petrobras, porรฉm com foco no ambiente da Distribuiรงรฃo. 2VSULQFLSDLVREMHWLYRVPHWDVHSURMHWRVGD%5HVWmRFRQWHPSODGRVQR3ODQR(VWUDWpJLFRHFRQVHTXHQWHPHQWH QR3ODQRGH1HJyFLRVTXHpRVHXGHWDOKDPHQWRTXDQWLWDWLYRDPERVDSURYDGRVSHOR&RQVHOKRGH$GPLQLVWUDomR e alinhados ao Plano Estratรฉgico da Petrobras. 1R3ODQR(VWUDWpJLFRHVWmRGHยฟQLGRVD0LVVmRGHยณ'LVWULEXLULQGXVWULDOL]DUHFRPHUFLDOL]DUGHULYDGRVGHSHWUyOHR HVHXVFRUUHODWRVFRPFRPSHWLWLYLGDGHUHQWDELOLGDGHHUHVSRQVDELOLGDGHVRFLDOHDPELHQWDOยดHD9LVmRGHORQJR

ย‡*iV1DWXUDOLQGXVWULDOHYHLFXODU *19H*1&  ย‡2XWURV3URGXWRVDVIDOWRVROYHQWHVTXHURVHQHร€XLGRVHVSHFLDLVSDUDยฟQDVHSURGXWRVGHVXSSO\KRXVH &RPRLQWXLWRGHDWUDLUHREWHUยฟGHOLGDGHD%5SURFXUDDJUHJDUYDORUDRVVHXVSURGXWRVRIHUHFHQGRVROXo}HVVHUYLoRVjVQHFHVVLGDGHVGHVHXVFOLHQWHVSDUFHLURVHIRUQHFHGRUHV2VSULQFLSDLVVHUYLoRVSUHVWDGRVGLUHWDPHQWH SHOD%5RXGHVHQYROYLGRVSHOD%5HFRORFDGRVjGLVSRVLomRGRVFRQVXPLGRUHVVmR&DUWmR3HWUREUDV&7) &RQWUROH7RWDOGH)URWDV /XEUD[&HQWHU/XEUD[6HUYLoRVGH&RQYHQLrQFLD%50DQLD3URJUDPDยณ'H2OKRQR &RPEXVWtYHOยด%5$YLDWLRQ&HQWHU%5$YLDWLRQ&DUG&$,6 &HQWUDO$YDQoDGDGH,QVSHomRH6HUYLoRV 6HUYLoRV $VIiOWLFRV*HUDomRGH(QHUJLDQR+RUiULRGH3RQWD(ยฟFLrQFLD(QHUJpWLFD&OLPDWL]DomR/DYDPDQLD$QiOLVHV GH/XEULยฟFDQWHV6LJD%HP%5$YLDWLRQ&OXE6HUYLoRVGH&RJHUDomRH*HUDomR'HGLFDGDHQWUHRXWURV -iD/RJtVWLFDRXWUDiUHDIXQGDPHQWDOSDUDD%5DWLQJLUVXDVPHWDVHVWUDWpJLFDVpUHVSRQViYHOSHODVDVDWLYLGDGHVTXHHQYROYHPDFDGHLDGHVXSULPHQWRORJtVWLFDRSHUDo}HViUHDLQGXVWULDOVHUYLoRVFRPSDUWLOKDGRVGD%5 e engenharia, saรบde, meio ambiente e seguranรงa.

SUD]RTXHpDGHยณ6HUOtGHUQRPHUFDGRQDFLRQDOGHGLVWULEXLomRGHGHULYDGRVGHSHWUyOHRHELRFRPEXVWtYHLV LQWHJUDGDQDFDGHLDORJtVWLFDHDSUHIHULGDSHORVQRVVRVS~EOLFRVGHLQWHUHVVHยด 23ODQRGH1HJyFLRVFRPRSDUWHLQWHJUDQWHGR3ODQR(VWUDWpJLFR%5GHWDOKDTXDQWLWDWLYDPHQWHRVSUy[LPRV DQRVGDHPSUHVDGHยฟQLQGRRVUHVXOWDGRVHVSHUDGRVHRVUHFXUVRVQHFHVViULRVSDUDDLPSOHPHQWDomRGDV GLUHWUL]HVHVWUDWpJLFDVGHยฟQLGDV(QWUHDVVXDVSULQFLSDLVPHWDVยฟJXUDRDOFDQFHHPGHXPDSDUWLFLSDomR GHQRPHUFDGRGHGLVWULEXLomR 3DUDHIHWLYDUDVPHWDVHVWDEHOHFLGDVQR3ODQRGH1HJyFLRVD%5GHYHUiLQYHVWLUGHIRUPDGLUHWDRX DWUDYpVGHVXDVFRQWURODGDVHFROLJDGDVQRKRUL]RQWHGHRYDORUGH5%LOK}HVFRPDVHJXLQWH GLVWULEXLomR

3UHVHQWHHPWRGRRWHUULWyULRQDFLRQDOD%5FKHJRXDRยฟQDOGHFRPXPDUHGHGHSRVWRVGHVHUYLoRGRV TXDLVVmRSUySULRVVHQGRSRVWRVHVFRODHGHUHYHQGHGRUHV$LQIUDHVWUXWXUDORJtVWLFDTXHVHFRQVWLWXL XPLPSRUWDQWHGLIHUHQFLDOFRPSHWLWLYRSDUDDHPSUHVDpFRPSRVWDSRUWHUPLQDLVHEDVHVHFHQWURVFROHWRUHVGH iOFRROSHUID]HQGRXPDWDQFDJHPWRWDOSUySULDGHPLOKmRGHPรฑ3UHVHQWHHPPDLVGHDHURSRUWRVD&RPSDQKLDFRQWDDLQGDFRPXPDIiEULFDGHOXEULยฟFDQWHVGHSyVLWRVGHOXEULยฟFDQWHVGHSyVLWRVGHSURGXWRVTXtPLFRV IiEULFDVGHDVIDOWRH&HQWUDLV$YDQoDGDVGH,QVSHomRH6HUYLoRV 1R0HUFDGRGHGLVWULEXLomRGH*/3D%5DWXDDWUDYpVGD/LTXLJiV'LVWULEXLGRUD6$HPSUHVDHPTXHSRVVXL GRFDSLWDOVRFLDOHTXHIRLDGTXLULGDHP1RPHUFDGRGHFRPHUFLDOL]DomRGHDVIDOWRD%5SRVVXL GD6WUDWXUD$VIDOWRV6$HPSUHVDDGTXLULGDDWUDYpVGDDTXLVLomRGHSDUWHGRVDWLYRVGD&RPSDQKLD%UDVLOHLUD GH3HWUyOHR,SLUDQJDUHDOL]DGDHP $%5GHWpPDLQGDSDUWLFLSDomRVRFLHWiULDQD&'*1ยฑ&RPSDQKLD'LVWULEXLGRUDGH*iV1DWXUDO  6HIDJHO 6$  (%/ยฑ&RPSDQKLDGH(ยฟFLrQFLD(QHUJpWLFD6$  %UDVLO6XSSO\  H%UDVLO&DUERQRV6$  (PD%5FRQVWLWXLXSDUWLFLSDomRGHQD%5)%/XEULยฟFDQWHVFXMRREMHWRVRFLDOpFRQVWUXomRH RSHUDomRGHSODQWDGHUHUUHยฟQRGHyOHROXEULยฟFDQWHXVDGRRXFRQWDPLQDGR 2/8&  Continua...


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de marรงo de 2012

Jornal do Commercio E-33

Continuaรงรฃo

Minas e Energia

RECURSOS HUMANOS $OLQKDGDjRULHQWDomRHVWUDWpJLFDGHREWHUH[FHOrQFLDHP5HFXUVRV+XPDQRVD%5WHPPDQWLGRVXDSROtWLFDGH DWUDomRHUHWHQomRPDQXWHQomRGDTXDOLGDGHGHYLGDVDWLVIDomRHHOHYDomRGRQtYHOGHFDSDFLWDomRGRHIHWLYR 1HVVHFRQWH[WRD%5HQFHUURXRDQRGHFRPHPSUHJDGRVUHSUHVHQWDQGRXPFUHVFLPHQWRGH HPUHODomRD2DFUpVFLPRREVHUYDGRHPGHHPSUHJDGRVGHYHXVHjGLIHUHQoDHQWUHDGPLVV}HVGHFRUUHQWHVGHFRQFXUVRS~EOLFRHGHVOLJDPHQWRV

2YROXPHWRWDOQHJRFLDGRGHyOHRGLHVHODWLQJLXELOK}HVGHOLWURVXPDDOWDGH-iRYROXPHYHQGLGR GHJDVROLQD&IRLGHELOK}HVGHOLWURVDPDLVTXHHP2FUHVFLPHQWRGHVVHPHUFDGRSDUDR consumo de gasolina e etanol tem forte respaldo no aumento de renda da populaรงรฃo, sobretudo da classe C, e QDHQWUDGDGHFHUFDGHPLOK}HVGHYHtFXORVQRYRVSRUDQR$VREUDVGHLQIUDHVWUXWXUDHVWLPXODPWDPEpPD demanda por diesel. 'LVWLQWDPHQWHDVYHQGDVGHHWDQROKLGUDWDGRFDtUDPHVWHDQRSDUDELOK}HVGHOLWURV2DXPHQWRGR SUHoRGRHWDQROQDV~OWLPDVVDIUDVIH]PLJUDURFRQVXPRSDUDDJDVROLQDFHQiULRTXHSRGHUiVHPDQWHUQRVSUy[LPRVDQRVGHYLGRjVSRVVtYHLVYDULDo}HVGHSUHoRVQRHWDQROQRSHUtRGRHjVLQFHUWH]DVGHRIHUWDGRSURGXWRR TXHSRGHUiOHYDURFRQVXPLGRUDFRPSUDUPDLVRXPHQRViOFRRO A crescente substituiรงรฃo do รณleo combustรญvel pelo gรกs natural em tรฉrmicas e no segmento industrial levou a uma TXHGDGHQDVYHQGDVGHVVHSURGXWRTXHSDVVDUDPGHELOK}HVGHOLWURVHPSDUDELOKmR GHOLWURVHP )LQDOPHQWHYDOHUHVVDOWDURFUHVFLPHQWRGHGRPHUFDGRGHDYLDomR 4$9*$9 FRPGHVWDTXHSDUD R4$9FXMRFRQVXPRPHQVDOQR%UDVLOpGHFHUFDGHPSRUPrV$GHPDQGDSHORWUDQVSRUWHDpUHR GRPpVWLFRFUHVFHX(PUHODomRDRPHUFDGRLQWHUQDFLRQDORSHUDGRSRUHPSUHVDVEUDVLOHLUDVIRLUHJLVWUDGR FUHVFLPHQWRDQXDOGHGHPDQGDGHHPQDFRPSDUDomRFRPVHQGRDQRYDFODVVHPpGLDD SULQFLSDOUHVSRQViYHOSHORFUHVFLPHQWRQDVYHQGDVGHSDVVDJHQVDpUHDVTXHFRPSUDPVXDVSDVVDJHQVFRP DQWHFHGrQFLDHSHUPDQHFHPSRUPDLVWHPSRQRVGHVWLQRVHVFROKLGRV$H[SHFWDWLYDpTXHDGHPDQGDSRU combustรญveis de aviaรงรฃo no Brasil deverรก manter a trajetรณria de alta, impulsionada pela expansรฃo do consumo LQWHUQRHSRUHYHQWRVFRPRD&RSDGR0XQGRHPHDV2OLPStDGDVHP

DESEMPENHO COMERCIAL 2tQGLFHGHURWDWLYLGDGH WXUQRYHU IRLGHQRDQRDSUHVHQWDQGRFUHVFLPHQWRGHSSHPUHODomRDR ano anterior. Esse crescimento รฉ decorrente, principalmente, dos ingressos de novos empregados oriundos do SURFHVVRVHOHWLYRS~EOLFRHPYLJRUSDUDDWHQGHUjVQHFHVVLGDGHVGDVJHUrQFLDV QRYDVGHPDQGDVHUHSRVLo}HV GHHPSUHJDGRVGHVOLJDGRV -iRVGHVOLJDPHQWRVRFRUUHUDPHPVXDPDLRULDSRULQWHUHVVHGRHPSUHJDGRH aposentadoria.

(PD%5DYDQoRXQDOLGHUDQoDGRPHUFDGREUDVLOHLURGHFRPEXVWtYHLVยฟQDOL]DQGRRDQRFRPXPPDUNHW VKDUHJOREDOGHVXSHUDQGRHPSSDPDUFDGH2YROXPHFRPHUFLDOL]DGRIRLVXSHULRUjV YHQGDVGRDQRDQWHULRUWRWDOL]DQGRPLOK}HVPรฑ6LJQLยฟFDWLYRFUHVFLPHQWRQDVYHQGDVGHJDVROLQD   FRPEXVWtYHLVGHDYLDomR  yOHRGLHVHO  JiVQDWXUDOFDQDOL]DGR  HFRTXH  IRUDP determinantes para o alcance deste resultado. 1RVHJPHQWRGH5HGHGH3RVWRVD%5DOFDQoRXGHPDUNHWVKDUHDFXPXODGRDRORQJRGRDQRSSDFLPD GRDQRGH$%5FKHJRXDRยฟQDOGHFRPSRVWRVGRVTXDLVSUySULRVVHQGRSRVWRVHVFROD HGHWHUFHLURV1RVHJPHQWR&RQVXPLGRUTXHFRQWRXFRPFOLHQWHVDWHQGLGRVHPRPDUNHW VKDUHDOFDQoDGRHPIRLGHRTXHUHSUHVHQWDXPDTXHGDGHSSHPUHODomRjPDUFDGRDQRDQterior. Essa reduรงรฃo รฉ decorrente principalmente da migraรงรฃo de volume de รณleo combustรญvel para o gรกs natural, preponderantemente no mercado das termelรฉtricas. ,PSRUWDQWHUHVVDOWDUTXHD%5PDQWHYHRSDWDPDUGHYHQGDVPpGLDVDFLPDGHELOK}HVGHOLWURVFRPHUFLDOL]DGRV EDUUHLUDXOWUDSDVVDGDSHODSULPHLUDYH]HPDJRVWRGHFRPELOK}HV RXPLOP HPDJRVWRGH HVWDEHOHFHQGRXPQRYRUHFRUGHKLVWyULFRGHYHQGDV

&RPRREMHWLYRGHGHVHQYROYHUDIRUoDGHWUDEDOKRSDUDTXHVHMDPDWLQJLGDVDVRULHQWDo}HVHGLUHWUL]HVGHยฟQLGDV QR3ODQHMDPHQWR(VWUDWpJLFRGD&RPSDQKLDIRUDPLQYHVWLGRV5PLOK}HVHPWUHLQDPHQWRHGHVHQYROYLPHQWREHQHยฟFLDQGRHPSUHJDGRVUHSUHVHQWDQGRXPFUHVFLPHQWRGHHPUHODomRDRDQRDQWHULRU2 Q~PHURWRWDOGHKRUDVGHWUHLQDPHQWRFKHJRXDKRUDVHP $RVUHFpPDGPLWLGRVDOpPGRSURFHVVRGHDPELHQWDomRTXHDSUHVHQWDD&RPSDQKLDHVHXVSULQFLSDLVSURFHVVRVD%5LPSODQWRXHPR3URJUDPDGH'HVHQYROYLPHQWRGH1RYRV(PSUHJDGRVVHPHOKDQWHDR&XUVRGH Formaรงรฃo da Petrobras. Durante o programa, sรฃo fornecidos conhecimentos relacionados ao negรณcio da BR e jiUHDGHDWXDomRGRSURยฟVVLRQDOREMHWLYDQGRDVVLPDFHOHUDURGHVHQYROYLPHQWRGHVVHVHPSUHJDGRVHUHGX]LU RWHPSRGHDGDSWDomRj&RPSDQKLD Alรฉm disso, a BR tambรฉm investiu na formaรงรฃo de gerentes e supervisores, atravรฉs da continuidade do Programa GH'HVHQYROYLPHQWRGH*HUHQWHVH6XSHUYLVRUHVWUDEDOKDQGRDVSHFWRVUHODFLRQDGRVjOLGHUDQoDGHSHVVRDVH ao negรณcio da BR. -iQDHVWUXWXUDomRGHFDUUHLUDIRLยฟQDOL]DGDDLPSOHPHQWDomRGD&DUUHLUDHP< (VSHFLDOLVWDV XPDIRUPDGH UHFRQKHFHUHUHWHURVHPSUHJDGRVTXHWrPXPDOWRQtYHOGHFRQKHFLPHQWRHQmRVHJXLUDPDFDUUHLUDJHUHQFLDO $GLFLRQDOPHQWHIRLUHPRGHODGDDIXQomRVXSHUYLVmRYROWDGDSDUDiUHDVRSHUDFLRQDLVTXDOLยฟFDQGROtGHUHVTXH FXLGDPGHHTXLSHVQDVEDVHVDHURSRUWRVHIiEULFDV $$VVLVWrQFLD0pGLFD6XSOHWLYD $06 SODQRGHDVVLVWrQFLDjVD~GHGRVHPSUHJDGRVDSRVHQWDGRVHSHQVLRQLVWDVGD%5HVHXVUHVSHFWLYRVGHSHQGHQWHVGHXFREHUWXUDDEHQHยฟFLiULRVHPTXHFRQWDPFRP XPDUHGHFUHGHQFLDGDHPWRUQRGHSURยฟVVLRQDLVGLYLGLGRVHPSHVVRDItVLFDHMXUtGLFDHPWRGR%UDVLO $SUHRFXSDomRGD%5FRPDVD~GHHTXDOLGDGHGHYLGDGHVHXVHPSUHJDGRVHGHSHQGHQWHVVHH[SUHVVDWDPEpP DWUDYpVGRVSURJUDPDVGHVHQYROYLGRVFRPRR3URJUDPD$OLPHQWDomR6DXGiYHO&DPSDQKDGH9DFLQDomR$QWLJULSDO3URJUDPDGH$SRLRj*HVWDQWHH$OHLWDPHQWR0DWHUQRยฑ*(67$/6D~GHGD0XOKHU3URJUDPDGH$WHQomR DR8VR$EXVRH'HSHQGrQFLDGHรˆOFRRO7DEDFRH2XWUDV'URJDV3URJUDPDGH3UHSDURSDUDD$SRVHQWDGRULD 33$ HQWUHRXWURV 9LVDQGRjPDQXWHQomRGDTXDOLGDGHGHYLGDGRVHPSUHJDGRVGD%5D&RPSDQKLDRIHUHFHSODQRGHSUHYLGrQFLD FRPSOHPHQWDUSDUDVXSOHPHQWDomRDRVEHQHItFLRVFRQFHGLGRVSHOR,1662SODQRTXHpDGPLQLVWUDGRSHOD )XQGDomR3HWUREUDVGH6HJXULGDGH6RFLDOยฑ3HWURVRIHUHFHDRVHPSUHJDGRVSDUWLFLSDQWHVHVHXVEHQHยฟFLiULRV XPDVpULHGHYDQWDJHQVFRPRVXSOHPHQWDomRGDDSRVHQWDGRULDSRULQYDOLGH]SRULGDGHSRUWHPSRGHVHUYLoR suplementaรงรฃo da aposentadoria especial e do auxรญlio-doenรงa, alรฉm de suplementaรงรฃo da pensรฃo e pecรบlio por morte do participante. 1DJHVWmRGHSHVVRDOD%5XWLOL]DWUrVLPSRUWDQWHVIHUUDPHQWDVR*HUHQFLDPHQWRGH'HVHPSHQKRGH3HVVRDO *'3 R*HUHQFLDPHQWRGH'HVHPSHQKRGH/tGHU *'/ HD3HVTXLVDGH$PELrQFLD2UJDQL]DFLRQDO 2GHVHPSHQKRGRVHPSUHJDGRVpPHGLGRSRUPHLRGR*HUHQFLDPHQWRGH'HVHPSHQKRGH3HVVRDO *'3 FRP IRFRQDVPHWDVHFRPSHWrQFLDVLQGLYLGXDLV-iRVWLWXODUHVGHIXQomRJHUHQFLDOWrPVHXGHVHPSHQKRDYDOLDGR SRUPHLRGR*HUHQFLDPHQWRGH'HVHPSHQKRGH/tGHU *'/ TXHFRQVLGHUDDYLVmRGHSDUHVFOLHQWHVLQWHUQRV empregados, alรฉm da auto-avaliaรงรฃo e a do gerente imediato. $QXDOPHQWHpUHDOL]DGDDSHVTXLVDGH$PELrQFLD2UJDQL]DFLRQDOTXHSHUPLWHj%5FRQKHFHURJUDXGHVDWLVIDomRGHVHXVHPSUHJDGRVGHPRGRDIRUQHFHULQIRUPDo}HVTXHIDFLOLWHPDWRPDGDGHGHFLV}HVHWUDJDP PHOKRULDVjVSUiWLFDVHDRVSURFHVVRVRUJDQL]DFLRQDLV $SHVTXLVDUHDOL]DGDHPFRQWRXFRPDSDUWLFLSDomRGHGRVHPSUHJDGRVHJHURXR3ODQR&RUSRUDWLYR GH0HOKRULDVGH$PELrQFLDDOpPGRVSODQRVVHWRULDLV21tYHOGH&RPSURPHWLPHQWRGR(PSUHJDGR 1&( H 1tYHOGH&RPSURPHWLPHQWRFRPD5HVSRQVDELOLGDGH6RFLDO 1&56 IRUDPGHHUHVSHFWLYDPHQWH2 ร‹QGLFHGH6DWLVIDomRGR(PSUHJDGR ,6( DOFDQoRXSHUFHQWXDOUHIHUrQFLDSDUDR6LVWHPD3HWUREUDV Assim, a BR procura atrair e reter seus empregados, mantendo uma polรญtica competitiva de mercado atravรฉs de LQLFLDWLYDVFRPRD3URJUHVVmRGD&DUUHLUD-~QLRUHOHYDomRGRVLQGLFDGRUHVGH7 'DGPLVVmRGHQRYRVHPSUHJDGRVUHVXOWDQGRHPXPDUHQRYDomRJUDGDWLYDGRHIHWLYR(VWDVPHGLGDVWrPUHVXOWDGRHPXPDPDLRUVDWLVIDomR GRVHPSUHJDGRVFRQIRUPHSRGHVHUSHUFHELGRQRVDOWRVSHUFHQWXDLVGRVtQGLFHV1&(H,6(TXHVmRUHIHUrQFLD para o Sistema Petrobras.

1DEXVFDGHGHVHQYROYLPHQWRFRQWtQXRSUH]DQGRSHODTXDOLGDGHHH[FHOrQFLDQRDWHQGLPHQWRGHVHXVFOLHQWHVH QXPPHUFDGRFDGDYH]PDLVFRPSHWLWLYRHPD%5FRPSOHWRXDQRVGR3URJUDPDยณ'H2OKRQR&RPEXVWtYHOยดFRPSRVWRVFHUWLยฟFDGRV2SURJUDPDIRLIRUPDWDGRSDUDTXHDOpPGHUHDOL]DUWHVWHVHPFDPSRQD JDVROLQDQRyOHRGLHVHOHQRHWDQROKLGUDWDGRYHQGLGRVQRVSRVWRV3HWUREUDVRVWpFQLFRVTXtPLFRVGRSURJUDPD FDSDFLWDVVHPRVUHVSRQViYHLVQRVSRVWRVSDUDTXHHOHVPHVPRVSXGHVVHPPRQLWRUDUDTXDOLGDGHGRVSURGXWRV +RMHDFHUWLยฟFDomRpSUpUHTXLVLWRSDUDDSDUWLFLSDomRGRSRVWRHPRXWUDVDo}HVGDHPSUHVDยฑFRPRDGHVmRDR 3ODQR,QWHJUDGRGH0DUNHWLQJ 3,0 DR&RQWUROH7RWDOGH)URWD &7) HDRFUHGHQFLDPHQWRGR&DUWmR3HWUREUDV FRPHUFLDOL]DomRGHSURGXWRV3RGLXPHWF ,QRYRXFRPDLQDXJXUDomRGR3RVWRGR)XWXURXPSURMHWRLPSODQWDGRHPSDUFHULDFRPXPFRQVyUFLRGHVHWH HPSUHVDVSDUDRIHUHFHUDRVFOLHQWHVRTXHKiGHPDLVPRGHUQRHPWHFQRORJLDHLQWHUDWLYLGDGHDSOLFDGDDRV negรณcios. Alรฉm das soluรงรตes hight tech presentes no atendimento ao cliente e no gerenciamento do negรณcio, R3RVWRGH)XWXURWDPEpPpXPPRGHORGHVXVWHQWDELOLGDGHDPELHQWDO1HOHIRUDPLPSODQWDGDVLQRYDo}HVTXH SHUPLWHPPDLRUHยฟFLrQFLDHQHUJpWLFDFRPUHDSURYHLWDPHQWRHHFRQRPLDGHUHFXUVRVQDWXUDLVHWDPEpPRXVR GHHQHUJLDVDOWHUQDWLYDV23RVWRGR)XWXURFRQVROLGDXPQRYRFRQFHLWRGHVHUYLoRDWUHODGRjVQRYDVWHFQRORJLDV HjTXHVWmRDPELHQWDO (PDJRVWRGHD&LDLQLFLRXDLPSODQWDomRHPWRGRRSDtVGDVXDSUySULDUHGHGHDGTXLUrQFLDยฑXPVLVWHPD GHFDSWXUDSURFHVVDPHQWRHOLTXLGDomRGHWUDQVDo}HVHOHWU{QLFDVGHSDJDPHQWRVFRPFDUW}HVยฑWRUQDQGRVH UHVSRQViYHOSHODJHVWmRGDVWD[DVHSHODVPiTXLQDV326HPFHUFDGHPLOSRVWRV$OpPGHHQJOREDUDVWUDQVDo}HV ยฟQDQFHLUDVDVQRYDVPiTXLQDVVmRIXQGDPHQWDLVSDUDDo}HVGHPDUNHWLQJSRLVFDSWXUDPLQIRUPDo}HVSDUDR QRYRSURJUDPDGHยฟGHOLGDGHGDUHGHGHSRVWRVR3URJUDPDGH)LGHOLGDGH3HWUREUDV3UHPPLDTXHLQLFLDUiHP HSUHWHQGHUHIRUoDUDSDUFHULDFRPRVFOLHQWHVYDORUL]DQGRTXHPDGTXLUHSURGXWRVHVHUYLoRVQRVSRVWRVGH FRPEXVWtYHOQDVORMDV%50DQLDQR/XEUD[RXQR/XEUD[&HQWHUQRTXDOGHDFRUGRFRPRYDORUGRFRQVXPRR FOLHQWHDFXPXODUiSRQWRVTXHSRGHUmRVHUWURFDGRVSRUGHVFRQWRVQDFRPSUDGHSURGXWRVHVHUYLoRVQRV3RVWRV Petrobras credenciados ou na loja de comรฉrcio eletrรดnico Premmia. 1RVHJPHQWRGHDYLDomRIRLUHJLVWUDGRQDGDPHQRVTXHWUrVUHFRUGHVGHYROXPHVGHYHQGDVUHIRUoDQGRDSRVLomR GHOLGHUDQoDQDFLRQDOFRPVKDUHGHSSDFLPDGRUHDOL]DGRHP(VVHUHVXOWDGRVHGHYHWDPEpP DRDXPHQWRGRQ~PHURGHY{RVRIHUHFLGRVSHODVFRPSDQKLDVDpUHDVUHJLRQDLVDVVLPFRPRDSUHVHQoDFDGDYH] mais forte da BR no mercado, com a entrada em novos aeroportos, onde atende companhias aรฉreas nacionais HHVWUDQJHLUDVHFOLHQWHVGHGLYHUVRVVHJPHQWRVGDDYLDomRFLYLO1HVVHFRQWH[WRD%5LQDXJXURXPDLVWUrVHVSDoRV%5$YLDWLRQTXHFRQVLVWHHPXPDVDOD9,3QRVDHURFOXEHVFOLPDWL]DGDRQGHRVSLORWRVWrPDFHVVRD79 internet, meteorologia on-line, mapas de navegaรงรฃo e facilidades de comunicaรงรฃo para elaboraรงรฃo de planos e QRWLยฟFDo}HVGHY{RQRVDHURFOXEHVGH3HUQDPEXFR*RLiVH8EHUOkQGLD$GLFLRQDOPHQWHIRUDPLQDXJXUDGRV WDPEpPWUrV%5$YLDWLRQ&HQWHUQRVDHURSRUWRVGH,WLUDSLQD630DULQJi35H7HUUDYLVWD%$2%5$YLDWLRQ&HQWHUpXPFHQWURFRPSOHWRGHSUHVWDomRGHVHUYLoRVSDUDRVFOLHQWHVGDDYLDomRH[HFXWLYDFRPVDOD9,3EXVLQHVV FHQWHUVDODGHUHXQLmR,QWHUQHWH79DFDER1HOHRSLORWRGLVS}HGHFRPSXWDGRUHVSDUDHIHWXDURSODQRGHY{R alรฉm de possuir, em algumas unidades, sala de repouso. Alรฉm de abastecimento, a aeronave recebe todos os FXLGDGRVQHFHVViULRVFRPRKDQJDUDJHPSROLPHQWROLPSH]DLQWHUQDHH[WHUQD*38HWUDWRU(ยฟQDOPHQWHIRL LQDXJXUDGRQRDHURSRUWRGH0DULQJi35RSULPHLUR%5$YLDWLRQ$XWR&HQWHUTXHpXPFHQWURGHSUHVWDomRGH VHUYLoRVjVIURWDVDXWRPRWLYDVGDVHPSUHVDVHVWDEHOHFLGDVQRVDHURSRUWRVWDLVFRPRDEDVWHFLPHQWRODYDJHP OXEULยฟFDomRERUUDFKDULDFDOLEUDJHPSHTXHQRVUHSDURVHPDQXWHQomR Alinhada com os planos de investimentos na infraestrutura nacional, a BR inaugurou o Laboratรณrio Central de 3DYLPHQWDomR%5 /&3%5 ยฑSULPHLURFHQWURGHUHIHUrQFLDFULDGRSRUXPDGLVWULEXLGRUDSDUDRGHVHQYROYLPHQWR GHSHVTXLVDVTXHOHYHPDRDXPHQWRGDGXUDELOLGDGHHGRGHVHPSHQKRGRDVIDOWRXWLOL]DGRQRSDtV2/DERUDWyULR TXHFRQWDFRPXPDiUHDGHPรฐHVWiLQVWDODGRQR3DUTXH7HFQROyJLFRGD,OKDGR)XQGmRFDPSXVGD8QLYHUVLGDGH)HGHUDOGR5LRGH-DQHLUR3DUDD%5TXHMipOtGHUQRVHJPHQWRHVVHSURMHWRHPSUHHQGHGRUDGHVWDFD IUHQWHDRVFRQFRUUHQWHVPRVWUDQGRDQRVVDFDSDFLGDGHGHLQRYDomRDOpPGHWUD]HUPHOKRULDVQRDWHQGLPHQWR FRPPDLVHยฟFLrQFLDHDOWRSDGUmR 1RVHJPHQWRGHFRPEXVWtYHLVVyOLGRVFRPHUFLDOL]DPRVXPYROXPHUHFRUGHGHPLOK}HVGHWRQHODGDVGH &RTXH9HUGHGH3HWUyOHR &93 HUHIRUoDPRVQRVVDDWXDomRQRQHJyFLRDWUDYpVGRLQtFLRGDVRSHUDo}HVGD %UDVLO&DUERQRV6$HPSUHVDFROLJDGDUHVSRQViYHOSHODLPSODQWDomRHRSHUDomRGHSODQWDVGHDUPD]HQDJHP HEHQHยฟFLDPHQWRGH&93 2XWURGHVWDTXHIRLDH[SDQVmRGDUHGHGHJiVFDQDOL]DGRQR(VStULWR6DQWRFRPLQtFLRGDVREUDVHP/LQKDUHVH DPSOLDomRGDFDSDFLGDGHGHFRPHUFLDOL]DomRHP9LWyULD$OpPGLVVRIRLDSUHVHQWDGRjVRFLHGDGHFDSL[DEDR3ODQR GH,QYHVWLPHQWRVHP5HGHVGH'LVWULEXLomRQR(6FRQWHPSODQGRSURMHWRVQRVPXQLFtSLRVGH$UDFUX] &RODWLQD*XDUDSDUL/LQKDUHV6mR0DWHXV6HUUD6RRUHWPDH9LOD9HOKD

AMBIENTE DO MERCADO DE DISTRIBUIร‡รƒO

DESEMPENHO ECONร”MICO-FINANCEIRO

'XUDQWHRDQRGHDHFRQRPLDEUDVLOHLUDH[SHULPHQWRXGHVDFHOHUDomRIUHQWHDRIRUWHFUHVFLPHQWRVHQWLGR QRDQRGH2DQRFRPHoRXFRPERDVH[SHFWDWLYDVPDVDFULVHQD(XURSDHRDXPHQWRGDVLQFHUWH]DVHP UHODomRjHFRQRPLDDPHULFDQDDOWHUDUDPRVUXPRVGDHFRQRPLDPXQGLDOSURYRFDQGRGLPLQXLomRGRULWPRTXH GDYDVHTXrQFLDjUiSLGDUHFXSHUDomRRFRUULGDGHSRLVGDFULVHGRVPHUFDGRVยฟQDQFHLURVPXQGLDLVTXHDIHWDUDP DHFRQRPLDJOREDOGHPDQHLUDJHQHUDOL]DGDHPPHDGRVGHH

$UHFHLWDRSHUDFLRQDOEUXWDGD%5DWLQJLX5PLOK}HVRTXHUHSUHVHQWDXPFUHVFLPHQWRGHVREUHR DQRDQWHULRU$PHVPDWD[DGHFUHVFLPHQWRIRLREVHUYDGDQDUHFHLWDRSHUDFLRQDOOtTXLGDTXHDOFDQoRX5 PLOK}HVHPFRPDXPHQWRGH

$SHVDUGRFHQiULRGHGHVDFHOHUDomRHFRQ{PLFDDSUHVHQWDGRHPRPHUFDGRGHGLVWULEXLomRGHFRPEXVWtYHLV QR%UDVLOPDQWHYHDOWDVWD[DVGHFUHVFLPHQWRIUHQWHDR3,%IDYRUHFLGRSHODH[SDQVmRGDHFRQRPLDEUDVLOHLUDTXH IRLHVWLPXODGDSHODPHOKRULDGDVFRQGLo}HVGHUHQGDHFUpGLWRFRPUHร€H[RVREUHDDPSOLDomRGHFRQVXPLGRUHVH GLYHUVLยฟFDomRGRVKiELWRVGHFRQVXPRFRPGHVWDTXHSDUDDVDPSOLDo}HVGHYHQGDVGHYHtFXORVHGDGHPDQGD por passagens aรฉreas.

2OXFURRSHUDFLRQDODSUHVHQWRXXPDUHGXomRGHFKHJDQGRD5PLOK}HVHPHPIXQomR SULQFLSDOPHQWH GD SHUGD GH YHQGDV SDUD DV WpUPLFDV GD 5HJLmR 1RUWH GHFRUUHQWH GD VXEVWLWXLomR GR yOHR FRPEXVWtYHOSHORJiVQDWXUDOFRPXPHIHLWRGH5PLOK}HVQR/XFUR%UXWREHPFRPRSHODUHGXomRGR UHVXOWDGRยฟQDQFHLUROtTXLGR

(PR/XFUR%UXWRIRLGH5PLOK}HVFUHVFLPHQWRGHHPUHODomRDRV5PLOK}HVGH

&RPLVVRDPDUJHPRSHUDFLRQDOIRLSSPHQRUHPUHODomRDRDQRDQWHULRU 'HVWDIRUPDIRUDPFRPHUFLDOL]DGRVELOK}HVGHOLWURVGHFRPEXVWtYHLVQRDQRGHXPDXPHQWRGH IUHQWHD2yOHRGLHVHOUHVSRQGHXSRUGHVVHWRWDOVHJXLGRSHODJDVROLQDFRPRHWDQRO KLGUDWDGRFRPFRPEXVWtYHLVGHDYLDomRFRPyOHRFRPEXVWtYHOFRPH*19FRP

2(%,7'$DOFDQoRX5PLOK}HVUHGX]LGRHPFRPSDUDWLYDPHQWHD4XDQWRDROXFUROtTXLGRIRL LQIHULRUDRREWLGRHPDWLQJLQGR5ELOKmRQRDQR Continua...


cyan magenta amarelo preto

E-34

Sexta-feira e fim de semana, 2, 3 e 4 de marรงo de 2012

Jornal do Commercio Continuaรงรฃo

Minas e Energia

1RTXDGURUHVXPRDEDL[RSRGHVHUREVHUYDGDDHYROXomRGDUHFHLWDHGROXFURQR~OWLPRH[HUFtFLRHPUHODomR ao ano anterior.

RESPONSABILIDADE SOCIAL E AMBIENTAL $UHVSRQVDELOLGDGHVRFLDOHDPELHQWDOpXPGRVWUrVSLODUHVHVWUDWpJLFRVGDDWXDomRGD%5MXQWRFRPFUHVFLPHQWR

Indicadores Financeiros (R$ milhรตes)

2011

2010

%

e rentabilidade, sendo contemplada tambรฉm em sua missรฃo e valores. Para reforรงar seu compromisso com a UHVSRQVDELOLGDGHVRFLDOD%5DGRWRXD3ROtWLFDGH5HVSRQVDELOLGDGH6RFLDOTXHGHยฟQHUHVSRQVDELOLGDGHVRFLDO

5HFHLWD2SHUDFLRQDO%UXWD

87.412

77.238



5HFHLWD2SHUDFLRQDO/tTXLGD

71.243

63.008



os pรบblicos de interesse, promovendo os direitos humanos e a cidadania, respeitando a diversidade humana e

Lucro Bruto

5.266

4.906



Margem Bruta

7,4%

7,8%

SS 

cultural, nรฃo permitindo a discriminaรงรฃo, o trabalho degradante, o trabalho infantil e escravo, contribuindo para o desenvolvimento sustentรกvel e para a reduรงรฃo da desigualdade social.

/XFUR2SHUDFLRQDO

1.964

2.135



0DUJHP2SHUDFLRQDO

2,8%

3,4%

SS

(%,7'$

1.971

2.018



/XFUR/tTXLGR

1.267

1.406



como a forma de gestรฃo integrada, รฉtica e transparente dos negรณcios e atividades e das suas relaรงรตes com todos

$SyVUHFHEHUR6HOR3Uy(TXLGDGHGH*rQHURHPVXDSULPHLUDSDUWLFLSDomRHPHPD%5DGHULXjยHGLomRGR6HORFRQFHGLGRSHOR*RYHUQR)HGHUDOHPSDUFHULDFRPD8QLIHP )XQGRGH'HVHQYROYLPHQWRGDV1Do}HV 8QLGDVSDUDD0XOKHU HD2,7 2UJDQL]DomR,QWHUQDFLRQDOGR7UDEDOKR 26HORpRUHFRQKHFLPHQWRGRHVIRUoRIHLWR SHODRUJDQL]DomRQDLPSOHPHQWDomRHPVHXFRWLGLDQRGHSUiWLFDVGHHTXLGDGHFRQVWLWXLQGRVHQXPLQVWUXPHQWR TXHHYLGHQFLDUiSXEOLFDPHQWHRFRPSURPLVVRGDHPSUHVDFRPDHTXLGDGHGHJrQHURHUDoDQDSURPRomRGDFLGDdania e difusรฃo de prรกticas exemplares no mundo do trabalho.

INVESTIMENTOS 'HVGHD&RPSDQKLDpVLJQDWiULDGR3DFWR1DFLRQDOSHOD(UUDGLFDomRGR7UDEDOKR(VFUDYRHPDQWpPHP (P$3HWUREUDV'LVWULEXLGRUDUHDOL]RXLQYHVWLPHQWRVGDRUGHPGH5ELOKmRGRVTXDLV5PLOK}HV HPORJtVWLFDHLQIUDHVWUXWXUD5QRVHJPHQWRDXWRPRWLYR5PLOK}HVQRVHWRUDHURYLiULR5 PLOK}HVQRVHJPHQWRGHFRPHUFLDOL]DomRGHJiVHGLVWULEXLomRGHHQHUJLD5PLOK}HVHPWHFQRORJLDGD LQIRUPDomRHREUDVHPLQVWDODo}HVDGPLQLVWUDWLYDV5PLOK}HVQRVHJPHQWRGHJUDQGHVFRQVXPLGRUHV5 PLOK}HVQRVHJPHQWRGHSURGXWRVTXtPLFRVH5PLOK}HVQRVHJPHQWRDVIiOWLFR 6RPDGRVHVVHVLQYHVWLPHQWRVUHSUHVHQWDPXPDHYROXomRGHIUHQWHDHIUHQWHD

WRGRVRVVHXVFRQWUDWRVFOiXVXODTXHSURtEHDXWLOL]DomRGHWUDEDOKRGHJUDGDQWHHLQIDQWLODOpPGHQmRUHDOL]DU FRPHUFLDOL]DomRFRPHPSUHVDVLQWHJUDQWHVGRFDGDVWURGHHPSUHJDGRUHVDXWXDGRVSRUH[SORUDomRGRWUDEDOKR HVFUDYRGLYXOJDGRSHOR0LQLVWpULRGR7UDEDOKRH(PSUHJReXPDยณ(PSUHVD$PLJDGD&ULDQoDยดVHJXQGRD)XQGDomR$EULQTSHORVFRPSURPLVVRVDVVXPLGRVHPSUROGDLQIkQFLDHDGROHVFrQFLD $OJXPDVGDVSULQFLSDLVLQLFLDWLYDVGHUHVSRQVDELOLGDGHVRFLDOVmRRVSURMHWRV&LGDGmR&DSD]DGDSWDomRGHSRVWRV3HWUREUDVSDUDGDUFRQGLo}HVGHDFHVVLELOLGDGHDSHVVRDVFRPGHยฟFLrQFLDยฑTXHHQFHUURXFRPSRVWRVDGDSWDGRVHWUDEDOKDGRUHVFRPGHยฟFLrQFLDHPSUHJDGRV3RVWR(VFRODยฑTXDOLยฟFDomRSDUDSURยฟVVLRQDLV GHOXEULยฟFDomRSURPRWRUHVGHORMDVGHFRQYHQLrQFLDHSURยฟVVLRQDLVGHDEDVWHFLPHQWRยฑHPSRVWRVGHVHUYLoR 'DQoDQGRSDUDQmR'DQoDUยฑHQVLQRGHEDOpSDUDFULDQoDVHMRYHQVGHFRPXQLGDGHGR5LRGH-DQHLURยฑRQGH DWXDOPHQWHVmRDWHQGLGDVFULDQoDVHMRYHQVGHFRPXQLGDGHVHRVLQYHVWLPHQWRVQRV)XQGRVSDUDD,QIkQFLDH$GROHVFrQFLDTXHGHVGHMiGLVSRQLELOL]RXPDLVGH5PLOK}HVSDUDSROtWLFDVS~EOLFDVYROWDGDV DFULDQoDVHDGROHVFHQWHVVRFLDOPHQWHH[FOXtGRVEHQHยฟFLDQGRXPWRWDOGHSURMHWRVVHQGRGHOHVHP $OpPGRVSURMHWRVDFLPDD%5LQYHVWHQRGHVHQYROYLPHQWRVXVWHQWiYHOGDVFRPXQLGDGHVHPVXDViUHDVGHLQร€XrQFLDSRUPHLRGR3URJUDPD3HWUREUDV$JHQGD2SURJUDPDDSyLDDFULDomRGHIyUXQVFRPXQLWiULRVEDVHDGRV em um diรกlogo permanente entre diversos atores sociais, estimulando o execรญcio da cidadania. $FDSLODULGDGHDOFDQoDGDSHOD%5JDUDQWHRVXFHVVRGDSURPRomRGDFDPSDQKDGHDSRLRHGLYXOJDomRGRยณ'LD 1DFLRQDOGH&RPEDWHDR$EXVRHj([SORUDomR6H[XDOGH&ULDQoDVยดHGDFDPSDQKDยณ'LDVGH$WLYLVPRSHOR )LPGD9LROrQFLDFRQWUDDV0XOKHUHVยดHVWD~OWLPDHPSDUFHULDFRPD6HFUHWDULDGH3ROtWLFDVSDUDDV0XOKHUHV

2009

2010

2011

Como princรญpio bรกsico, todas as aรงรตes da BR sรฃo norteadas pela sua polรญtica em Seguranรงa, Meio Ambiente H6D~GH 606 (VVDVSUiWLFDVWrPVLGRUHVSDOGDGDVHPYROXPHVFUHVFHQWHVGHLQYHVWLPHQWRTXHHP DWLQJLUDP5PLOK}HVDFLPDGRUHDOL]DGRHPFRPrQIDVHQDVLQVWDODo}HVRSHUDFLRQDLVDOpP

(VVHFHQiULRHYROXWLYRpIRUWHPHQWHPDUFDGRSHODSUHRFXSDomRGD&LDFRPRPHLRDPELHQWHRTXHWDPEpP PRWLYRXXPDJUDQGHPXGDQoDQRPHUFDGRGHFRPEXVWtYHLVTXHRFRUUHDSDUWLUGHMDQHLURGHDHQWUDGD HPFLUFXODomRGR'LHVHO6ยฑGLHVHOFRPWHRUGHHQ[RIUHPi[LPRGHSSP SDUWHVSRUPLOKmR HGR$UOD FRPHUFLDOL]DGRFRPRQRPH)OXD ยฑXPDVROXomRUHGXWRUDGHy[LGRVGHQLWURJrQLRHPWRGRRWHUULWyULRQDFLRQDO 3DUDWDQWRDRORQJRGRDQRGHD&LDGHXFRQWLQXLGDGHDRVLQYHVWLPHQWRVLQLFLDGRVHPSDUDDDGDSWDomRGHDSUR[LPDGDPHQWHSRVWRVGDUHGHTXHIRUDPVHOHFLRQDGRVSULRUL]DQGRDDEUDQJrQFLDQDFLRQDO FREULQGRDVSULQFLSDLVHVWUDGDVHPXQLFtSLRVGRSDtV7DPEpPIRUDPHIHWXDGRVLQYHVWLPHQWRVSDUDDDGDSWDomR GRVWHUPLQDLVHEDVHVGD&LDGHIRUPDDDGHTXDUDLQIUDHVWUXWXUDH[LVWHQWHjHVWRFDJHPHQYDVHHGLVWULEXLomR dos produtos. 3DUDDPSOLDomRHPHOKRULDGDFDSDFLGDGHORJtVWLFDHRSHUDFLRQDOD%5LQYHVWLX5PLOK}HVTXHIRUDP DSOLFDGRVHPWRGRVRV7HUPLQDLVTXHDHPSUHVDSRVVXLQDJUDQGHPDLRULDGDVEDVHVFRPRWDPEpPQD )iEULFDH'HSyVLWRVGH/XEULยฟFDQWHV)RUDPVLJQLยฟFDWLYRVRVLQYHVWLPHQWRVUHDOL]DGRVQDDPSOLDomRHPHOKRULD GDVXQLGDGHVRSHUDFLRQDLVWDQWRSUySULDVFRPRFRPSDUWLOKDGDVDWUDYpVGHSRROFRPGHVWDTXHSDUDDVREUDVGR WHUPLQDOGH6mR/XtV0$'XTXHGH&D[LDV5-HGDEDVHGH*XDPDUp517DPEpPVHLQYHVWLXIRUWHPHQWHQD DXWRPDomRGRVWHUPLQDLVGHGDVEDVHVH[LVWHQWHV3RROVH&$,6FRPGHVWDTXHSDUDRVLQYHVWLPHQWRV UHDOL]DGRVQR7HUPLQDOGH&DQRDV56$OpPGLVVRIRUDPDGTXLULGRVHTXLSDPHQWRVSDUDHVWDEHOHFLPHQWRV HP3RROHLQYHVWLXVHHP6HJXUDQoDH3UHYHQomRGH$FLGHQWHVSDUDHVWDEHOHFLPHQWRV 3DUDDXPHQWDUDFDSDFLGDGHGHDUPD]HQDJHPGD&RPSDQKLDD%5HVWiFRQVWUXLQGRGXDVQRYDVXQLGDGHVDV TXDLVHQWUDUmRHPDWLYLGDGHQRDQRGH8PDGHODVยฟFDQR$FUHDEDVHGH&UX]HLURGR6XOD%$68/HWHUi FDSDFLGDGHGHWDQFDJHPGHPLOPรฑ1HODHVWmRVHQGRLQYHVWLGRVPDLVGH5PLOK}HVGRVTXDLV5 HP$RXWUDEDVHDEDVHGH3RUWR1DFLRQDOD%$321TXHpPDLRUREUDGD%5QRSDtVVHORFDOL]DHP 7RFDQWLQVHFRPXPLQYHVWLPHQWRGH5PLOK}HVGRVTXDLV5IRUDPUHDOL]DGRVHP$EDVHLQWHJUDUiWUDQVSRUWHIHUURYLiULRHURGRYLiULRHVHFRQHFWDUiFRPRSRUWRGH6mR/XtV2FRPEXVWtYHOVHUiGLVWULEXtGR QmRVyHP7RFDQWLQVPDVWDPEpPSDUDRRHVWHGD%DKLDVXOGR0DUDQKmRQRUGHVWHGR0DWR*URVVRHSDUWHGR 3DUi$%$321HQWUDUiHPDWLYLGDGHHPHHVWLPDVHTXHLQLFLHFRPXPDPRYLPHQWDomRGHPLOPรฑPrV $OpPGDFRQVWUXomRGDVQRYDVEDVHVD%5SRVVXLPDLVGRLVSURMHWRVHPDQGDPHQWR8PGHOHVpDDPSOLDomRH PRGHUQL]DomRGD3ODQWDGH/XEULยฟFDQWHVORFDOL]DGDQRHVWDGRGR5LRGH-DQHLUR2RXWURpDSODQWDGHHQYDVHGR $UODHP&DPDoDUL%$$REUDQD3ODQWDGH/XEULยฟFDQWHVH[LJLXXPLQYHVWLPHQWRGH5PLOK}HVGRVTXDLV 5UHDOL]DGRVHPHWHPDFRQFOXVmRSUHYLVWDSDUD6HUmRFRQVWUXtGRVXPQRYRSUpGLRDGPLQLVWUDWLYRXPDUPD]pPYHUWLFDOHQRYRVWDQTXHV$OpPGLVVRRSURFHVVRSURGXWLYRVHUiPRGHUQL]DGR(VSHUDVH XPDXPHQWRGDFDSDFLGDGHGHSURGXomRGHPLOPรฑPrVSDUDPLOPรฑPrV2RXWURSURMHWRยฟFDQD%DKLDHP &DPDoDULHDWUDYpVGHOHD%5LPSODQWDUiDSULPHLUDSODQWDGHHQYDVHGR$JHQWH5HGXWRU/tTXLGR$XWRPRWLYRR $UOD(VVHSURGXWRVHUiXVDGRQRVYHtFXORVSHVDGRVDGLHVHOIDEULFDGRVDSDUWLUGHMDQHLURGHYLVDQGR UHGX]LUDSROXLomRPHOKRUDQGRDTXDOLGDGHGRDU$SODQWDGH&DPDoDULWHUiFDSDFLGDGHGHSURGXomRGHDWp PLOPรฑGH$UODHDWHQGHUiSULRULWDULDPHQWHRPHUFDGR1RUGHVWH 7DPEpPIRUDPHIHWXDGRVLQYHVWLPHQWRVGHLQIUDHVWUXWXUDQDIiEULFDGHOXEULยฟFDQWHVRVTXDLVIRUDPDSOLFDGRV QDPHOKRULDGDVOLQKDVGHHQYDVDPHQWRGHEDOGHHWDPERUQR3URMHWRGHHQHUJLDHOpWULFD 9RLSH,QVWDODomRGH JHUDGRU QDDPSOLDomRGHEDQKHLURVQDVREUDVQRQRYRQ~FOHRDVVLVWHQFLDOHQDUHFXSHUDomRGRFDOoDPHQWR)RL HIHWXDGDDLQVWDODomRGRVLVWHPDGHHPHUJrQFLDQR&'HDDTXLVLomRGHHTXLSDPHQWRVSDUDPRGHUQL]DomRGDV OLQKDVGHHQYDVHGH/HPOHGHWUDQVSDOHWHLUDVHOpWULFDV$GLFLRQDOPHQWHKRXYHFRQVWUXomRGHFREHUWXUD HSODWDIRUPDSDUDR'HSyVLWRGH/XEULยฟFDQWHVGRWHUPLQDOGH$UDXFiULD35 &RQWULEXLQGRSDUDYDORUL]DomRGDPDUFD3HWUREUDVIRUDPLQYHVWLGRV5PLOK}HVQDPDQXWHQomRHDPRGHUQL]DomRGD5HGHGH3RVWRVGH6HUYLoRV2VUHFXUVRVIRUDPGHVWLQDGRVSDUDUHIRUPDVVHUYLoRVDTXLVLomRH LQVWDODomRSDUDVXEVWLWXLomRGHHTXLSDPHQWRVHDGHTXDo}HVGHLPDJHQVGHSRVWRVVHQGRTXHSRVWRV SHUWHQFHPjUHGHGHSRVWRVSUySULRVLQFOXVLYHSRVWRVHVFRODHVmRSRVWRVGHWHUFHLURV 1RDWHQGLPHQWRDR0HUFDGR&RQVXPLGRUIRUDPDSOLFDGRV5PLOK}HV(VVHVUHFXUVRVIRUDPGHVWLQDGRV jDTXLVLomRHLQVWDODomRGHHTXLSDPHQWRVDOpPGDH[HFXomRGHREUDVGHFRQVWUXomRHDGHTXDomRQDVXQLGDGHV GRVFOLHQWHVFRQVXPLGRUHVTXHREMHWLYDPRDXPHQWRQRYROXPHGHYHQGDVGDFRPSDQKLDFRPGHVWDTXHSDUDDV DGHTXDo}HVHIHWXDGDVHPUHYHQGDVHXQLGDGHVRSHUDFLRQDLVGHDHURSRUWRVDOpPGHREUDVQDVLQVWDODo}HV HPSRROFRPRDVGRVDHURSRUWRVGH*XDUXOKRV*DOHmR&RQยฟQVH3RUWR$OHJUH1HVWHVHJPHQWRLQYHVWLXVH WDPEpPQDDGHTXDomRHPRGHUQL]DomRGDV8QLGDGHV$EDVWHFHGRUDVGH$HURQDYHV 8$$ HPRSHUDomRQD DTXLVLomRGH&DPLQK}HV7DQTXHV$EDVWHFHGRUHV&DYDOR0HFkQLFRHFKDVVLVGHFDPLQK}HV 3DUDRVHJPHQWRGHSURGXWRVTXtPLFRVIRLHVWUXWXUDGRXPQRYRGHSyVLWRGH6XSSO\+RXVHHP-DSDUDWXED 6(HIRUDPDGTXLULGRVQRYRVFRQWHQWRUHVSDUDRSHUDo}HVGHWUDQVSRUWHHHPEDUTXHGHSURGXWRVTXtPLFRV QDVXQLGDGHVPDUtWLPDVGR( 33DUDRVHJPHQWRDVIiOWLFRIRUDPDGTXLULGRVPyGXORVGHDEDVWHFLPHQWRVSDUD DWHQGLPHQWRDHPSUHHQGLPHQWRVUHODFLRQDGRVDR3$&FRPRD8VLQDGH%HOR0RQWHH),2/HQWUHRXWUDVREUDV 0LQHURGXWR$WHUUR6DQLWiULRVHWF  'HXVHFRQWLQXLGDGHDGLYHUVRVSURMHWRVMiFRQVROLGDGRVHHPDQGDPHQWRWDLVFRPRRSURMHWR&RQWUROH7RWDOGH )URWDV &7) SURMHWRVGH*HUDomRGH(QHUJLDUHODWLYRVj&OLPDWL]DomRH*HUDomRQD3RQWDHQD5HGHGH*iV &DQDOL]DGRQR(VStULWR6DQWRFRQFHGLGDj3HWUREUDV'LVWULEXLGRUDSDUDGLVWULEXLomRGH*iV1DWXUDOGHVGHGH]HPEURGH'HVWDTXHSDUDRVLQYHVWLPHQWRVQDUHGHGHGLVWULEXLomRGHJiVFDQDOL]DGRQRHVWDGRGR(VStULWR Santo, necessรกrios para a expansรฃo e cumprimento do contrato de concessรฃo.

dos clientes consumidores e dos postos de serviรงo. $SROtWLFDGH606DGRWDGDSHOD%5YLVDDOpPGRSHUPDQHQWHDWHQGLPHQWRjOHJLVODomRDUHDOL]DomRGDVPHOKRUHVSUiWLFDVGRPHUFDGRGHGLVWULEXLomRVHPSUHHPDOLQKDPHQWRFRPDH[FHOrQFLDHP606GR6LVWHPD3HWUREUDV HEXVFDQGRDPHOKRULDFRQWtQXDGRVLQGLFDGRUHVGHGHVHPSHQKRQHVWDiUHD23URJUDPDGH*HVWmRHP606 YLVDFRQVROLGDUDLPSOHPHQWDomRGDTXLQ]HGLUHWUL]HVFRUSRUDWLYDVGHVHJXUDQoDPHLRDPELHQWHHVD~GHDWUDYpV GHDo}HVHVSHFtยฟFDVSDUDFDGDiUHDGD&RPSDQKLD 2VSULQFLSDLVLQGLFDGRUHVGH606DOFDQoDUDPUHVXOWDGRVVDWLVIDWyULRVHPPDQWHQGRVHGHQWURGHVHXV UHVSHFWLYRV/LPLWHV0i[LPRV$GPLVVtYHLV /0$V FRQIRUPHDEDL[R

1DEXVFDSHODH[FHOrQFLDHP6HJXUDQoD0HLR$PELHQWHH6D~GH 606 D%5HVWDEHOHFHXFRPRXPDGHVXDV PHWDVDFHUWLยฟFDomRGHVXDVXQLGDGHVGHDFRUGRFRPQRUPDVLQWHUQDFLRQDLVGHJHVWmRGH606$VVLPDRยฟQDO GHD%5SRVVXtDXQLGDGHVFHUWLยฟFDGDVQDQRUPD1%5,62*HVWmRGR0HLR$PELHQWHH XQLGDGHVFHUWLยฟFDGDVQDQRUPD2+6$6*HVWmRGD6HJXUDQoDH6D~GH2FXSDFLRQDO(VVDVFHUWLยฟFDo}HVID]HPSDUWHGRPRGHORGHFHUWLยฟFDomR~QLFDVHQGRDVDXGLWRULDVH[WHUQDVUHDOL]DGDVSHODFHUWLยฟFDGRUD %XUHDX9HULWDV&HUWLยฟFDWLRQ %9& 9DOHUHVVDOWDUTXHHVWHPRGHORHQJOREDDLQGDXQLGDGHVFHUWLยฟFDGDVSHOD QRUPD1%5,62*HVWmRGD4XDOLGDGH 81,'$'(&(57,),&$'$

(6&232'$&(57,),&$dยญ2

TERMINAIS (13 sites) 7()257(9(/7(3/$17(0$17(%5$67(/,67(9,77(0$7 7(63$7(%(77(/(07($3(7(*21 BASES (5 sites) %$-$ร‹%$-2,%$)/2%$-8,%$81$ POSTOS ESCOLA (3 sites) 6DOYDGRU9LWyULD&RQWDJHP

1%5,62 2+6$6 1%5,62

AEROPORTOS (4 sites) *$63*$5,2*$6$/*$%5$

TERMINAIS (3 sites) 7(12$67(&8%7('8& POSTOS ESCOLA (1 site) 1DWDO

POSTOS ESCOLA (1 site) Maracanรฃ

1%5,62 1%5,62

2+6$6 1%5,62

1DDXGLWRULDpYHULยฟFDGRVHDWHQGHPRVRVUHTXLVLWRVH[LJLGRVSHODVQRUPDVFLWDGDVDFLPDVHVHJXLPRVRVSURcedimentos da BR, se a legislaรงรฃo aplicรกvel a nรญvel nacional, estadual e municipal estรก sendo cumprida e se os registros previstos estรฃo sendo gerados e controlados. 9DOHGHVWDFDUTXHDOpPGDVXQLGDGHVPHQFLRQDGDVDFLPDVmRFHUWLยฟFDGDVQDVQRUPDV1%5,62 2+6$6H1%5,62VHPID]HUSDUWHGRPRGHORGHFHUWLยฟFDomR~QLFDR7(9$3 7HUPLQDO GR9DOHGR3DUDtED HD*(, *HUrQFLD,QGXVWULDO SHUID]HQGRXPWRWDOGH8QLGDGHVFHUWLยฟFDGDVHPWRGDD%5 AGRADECIMENTOS )LQDOL]DQGRDSURYHLWDPRVDRSRUWXQLGDGHSDUDUHJLVWUDUQRVVRVDJUDGHFLPHQWRVDRVQRVVRVHPSUHJDGRVHGHmais colaboradores, pelo comprometimento e dedicaรงรฃo. Aos nossos Revendedores, Clientes e Fornecedores DJUDGHFHPRVSHORDSRLRHFRQยฟDQoDGLVSHQVDGRV Continua...


cyan magenta amarelo preto

Sexta-feira e fim de semana, 2, 3 e 4 de março de 2012

Jornal do Commercio E-35

Continuação

Minas e Energia

Balanço patrimonial

([HUFtFL