Issuu on Google+

CMYK

RADAR TEGAL Harian Pertama Kebanggaan Wong Tegal

RABU, 23 OKTOBER 2013

Rp. 2.500,-

Pilwalkot Diprediksi Satu Putaran PETA POLITIK PILWALKOT (Berdasarkan Survei Radar TegalParameter

Ikmal dan Bunda Sitha Bersaing Ketat TEGAL - Hasil survei ketiga yang dilakukan Radar Tegal bekerja sama dengan Lembaga Survei Parameter, diprediksi hanya berlangsung satu putaran saja. Hal ini terlihat dari perolehan suara hasil survei yang dilakukan sepekan sebelum Pilwalkot digelar. Direktur Eksekutif Parameter, Agus Aribowo mengatakan, berdasarkan data survei ketiga ini, dua pasang calon bersaing ketat, yakni pasangan nomor urut 1 dan pasangan nomor urut 3. Masing-masing calon itu memperoleh dukungan di atas 40 persen. Sementara dua pasangan calon lainnya, dibawah 10 persen. Pasangan nomor urut 1, Ikmal Jaya-Edi Suripno meraih dukungan 46,3 persen dan pasangan nomor urut 3, Siti Masitha Soeparno-Nursholeh meraih dukungan 44,3 persen. Sementara pasangan nomor urut 2, Muh Jumadi-Muh Wahyudi didukung oleh 6,0 persen responden dan pasangan nomor urut 4, Hendria Priatmana-Endang Sutarsih hanya ke hal 7 kol 1

Airin Bisa Susul Suami di KPK

Interupsi Dewan Jadi PR Sutarman

JAKARTA - Kasus suap dalam sidang sengketa pilkada di Mahkamah Konstitusi (MK) yang melibatkan Tubagus Chaery Wardhana alias Wawan merembet ke dugaan korupsi di Pemkot Tangerang Selatan (Tangsel). KPK saat ini membuka penyelidikan baru mengenai dugaan korupsi pengadaan alat kesehatan (alkes) di kota yang dipimpin istri Wawan, Airin Rachmi Diany, tersebut. Kemarin sejumlah penyelidik KPK disebutkan meminta keterangan kepada sejumlah orang di Dinas Kesehatan Tangsel. Ada beberapa tempat yang didatangi KPK. Selain kantor dinkes, personel KPK disebutkan mendatangi sebuah rumah sakit di Tangsel. Juru Bicara KPK Johan Budi membenarkan adanya kegiatan tersebut. Menurut dia, tindakan

JAKARTA - Setelah lolos uji kepatutan dan kelayakan (fit and proper test) di Komisi III DPR, Komjen Sutarman akhirnya ditetapkan sebagai Kapolri terpilih dalam rapat paripurna DPR kemarin (22/10). Selanjutnya, Sutarman yang kini masih menjabat Kabareskrim itu tinggal menunggu pelantikan oleh presiden. Laporan hasil fit and proper test yang dibacakan Ketua Komisi III Pieter C. Zulkifli diterima tanpa ada keberatan dari anggota dewan peserta rapat paripurna. Interupsi baru muncul setelah Wakil Ketua DPR Priyo Budi Santoso yang memimpin rapat mengetuk palu

ke hal 7 kol 5

MUHAMAD ALI/ JAWAPOS

KETERANGAN PERS - Ketua DPR, Marzuki Alie memberi keterangan pers usai diperiksa KPK, Jakarta, Selasa (22/ 10).

Marzuki Ali Diperiksa KPK JAKARTA - Jejak-jejak korupsi Mantan Ketua Umum Partai Demokrat (PD) Anas Urbaningrum terus ditelisik KPK. Lembaga antirasuah itu kini mulai mengarahkan adanya aliran dana dari proyek Hambalang ke Kongres PD saat anas maju ketua umum. Mantan rival Anas, Marzuki Alie kemarin diperiksa KPK terkait hal

tersebut. Ketua DPR RI itu memenuhi panggilan KPK sebelum pukul 10. Namun menjelang pukul 12, Marzuki telah dari lembaga pimpinan Abraham Samad tersebut. Pada wartawan yang mencegatnya di pintu keluar gedung KPK, Marzuki mengaku dia ditanyai penyidik seputar Kongres Partai Demokrat

2010 di Bandung. “Saya cuma ditanyai soal kongres, tapi saya tidak tahu karena saya sudah mundur sebagai Sekjen,� jelas politisi kelahiran Palembang itu. Lantaran sudah tidak menjabat Sekjen itu, Marzuki mengaku tidak tahu bagaimana persiapan kongres berlangsung. ke hal 7 kol 1

ke hal 7 kol 1

MUSTAFA RAMLI/JAWAPOS

CALON KAPOLRI - Calon Kapolri, Komjen Pol, Sutarman (kanan) usai rapat paripurna DPR RI, Selasa (22 Okt 2013) di Gedung Parlemen di Jakarta.

Menelisik Asal Usul Aksara Korea Hangeul di Komunitas Suku Cia-Cia (1)

Bahasa Ibu Mulai Punah, Aksara Hangeul Jadi Pengganti Suku Cia-Cia di Kota Bau-Bau, Sulawesi Tenggara, menghadapi problem serius. Bahasa ibu mereka kini terancam punah karena jumlah penuturnya yang terus tergerus. Menariknya, untuk menyiasati problem itu, suku CiaCia menggunakan aksara bahasa Korea sebagai aksara bahasa mereka. Kok bisa? SEKARING RATRI A., Bau-Bau DEMAM K-Pop ternyata tidak hanya menjangkiti anak-anak muda di kota-kota besar seperti Jakarta

SEKARING RATRI/JAWA POS

DITERIMA - Abidin di depan sekolahnya, SMAN 6 Bau-Bau. Papan sekolah itu sebagian menggunakan aksara Hangeul untuk menyebut nama sekolah.

atau Surabaya. Budaya dari dataran Korea Selatan itu juga melanda kota kecil bernama Bau-Bau di Kepulauan Buton, Sulawesi Tenggara (Sultra). Bedanya, bukan hanya K-Pop-nya yang digandrungi, tapi juga aksara Korea, Hangeul, yang diterapkan dalam bahasa asli suku Cia-Cia di Bau-Bau. Mayoritas suku Cia-Cia yang berada di Kota Bau-Bau bermukim di Kecamatan Sorawalio. Kecamatan itu berjarak sekitar 1,5 jam perjalanan darat dari pusat kota. Jalannya cukup menantang: naik turun

gunung dan bergelombang. Kecamatan Sorawolio dikelilingi hutan dan lembah. Rumah-rumah penduduk berdampingan dengan lahan pertanian. Meski belum banyak tersentuh modernisasi, nama-nama jalan, nama sekolah, atau instansi pemerintah lainnya ditulis dengan dua aksara. Yakni, latin dan Hangeul. Misalnya, Sekolah Dasar Negeri Karya Baru dan SMA Negeri 6 BauBau. Bagaimana mungkin kota terpencil di Sulteng itu bisa welcome ke hal 7 kol 5

Pilwalkot Diprediksi Satu Putaran * Daripada anggaran mengko nambah? Marzuki Ali Diperiksa KPK * Aja nusul kanca-kancane oh!

CMYK


OPINI

2

RABU 23 OKTOBER 2013

RADAR TEGAL

Brebes Membaca, Kurangi Buta Huruf

Hari Tenang Oleh: M Riza Pahlevi SETELAH berkampanye selama beberapa hari, saatnya memasuki hari tenang. Semua atribut kampanye calon kepala daerah harus diturunkan. Tidak ada lagi hiruk pikuk peserta kampanye, tidak ada lagi perang gambar dan tidak ada lagi iklan di media massa. Semuanya harus menaati aturan hari tenang itu. Di Kabupaten Tegal dan Kota Tegal, Kamis (24/10) besok adalah hari tenang setelah masa kampanye. Masyarakat di kedua daerah itu diberi ketenangan selama tiga hari. Di hari tenang itu harapannya masyarakat pemilih diberi waktu untuk menentukan pilihan. Mana yang terbaik dan mana yang akan dipilih. Tentu, mereka akan berpikir dengan jernih, setelah melihat masa kampanye sebelumnya. Yang harus dicermati, bahwa hari tenang ini benar-benar tenang atau tenang-tenang saja dalam arti yang lain. Sudah seharusnya, masing-masing calon kepala daerah itu memberikan ketenangan hati dan batin kepada para pemilihnya di hari tenang ini. Bukan sebaliknya, memanfaatkan hari tenang untuk gusrak-gusruk mencari suara. Apalagi dengan cara-cara yang tidak benar, yakni melakukan politik uang. Semua pihak harus waspada selama hari tenang ini, khususnya penyelenggara pemilu, baik KPU maupun Panwaslu, termasuk juga aparat keamanan. Agar jangan sampai hari tenang ini menjadi hari yang tidak tenang. Karena adanya perang opini, hingga perang uang dan ancaman. Masing-masing tim kampanye, pada hari tenang ini harus benar-benar tenang. Melakukan evaluasi dan analisis atas pelaksanaan kampanye yang sudah berlalu. Jangan sampai menjadikan hari tenang ini sebagai puncak kampanye. Seperti melakukan intimidasi kepada warga pemilih, hingga bagi-bagi uang maupun barang untuk mempengaruhi pemilih. Sudah bukan saatnya lagi memaksa warga untuk memilih calon tertentu. Bukan pula zamannya mempengaruhi pemilih dengan uang. Kini adalah saatnya memilih dengan suara hati, memilih dengan cerdas, memilih dengan hati yang tenang setelah hari tenang. (*)

Oleh: Kustoro WHY SIP KABUPATEN Brebes merupakan daerah terluas nomor dua di Tawa Tengah setelah Kabupaten Cilacap. Jumlah penduduk berdasar data KPU tahun 2012 mencapai 1.764.041. Sedangkan Indeks Pembagunan Manusia ( IPM ) berada di urutan 35 dari 35 kabupaten/kota di Jawa Tengah. Angka buta aksara yang sangat tinggi, yakni 110 ribu orang atau ranking 6 tingkat nasional dari bawah. Hal tersebut merupakan pekerjaan rumah Pemerintah Kabupaten Brebes yang sangat berat. Angka lama sekolah (kelulusan) rata-rata 5,7 tahun (tidak lulus sekolah Dasar). Sementara jumlah Pusat Kegiatan Belajar Masyarakat ( PKBM ) 31 lembaga, jumlah Taman Baca Masyarakat (TBM) 52 Lembaga. Artinya jika pemerintah hanya fokus pada pendidikan formal saja, maka tingkat pendidikan dan melek huruf akan tetap tertinggal. Untuk itu pemerintah daerah harus mendorong tumbuh kembang dan memperhatikan pengelola PKBM dan TBM. Pengelola Taman Baca Masyarakat (TBM) diharapkan mampu mengikuti perkembangan dan dinamika yang berkembang pesat di masyarakat. Di mana alat dan sistem komunikasi sekarang merupakan basic need/kebutuhan dasar di masyarakat. Kultur budaya membaca yang masih sangat rendah di masyarakat, diperparah dengan masuknya teknologi komunikasi yang pesat membuat tantangan bagi pengelola TBM semakin berat. Pengelola TBM dituntut menyelesaikan beban berat yang dihadapi dalam menjaga eksistensi sebagai media alternatif masyarakat untuk belajar dan bersosialisasi. TBM harus menjadi tempat yang menarik untuk dikunjungi masyarkat. Tempat yang mampu memberi inspirasi munculnya inisiatif, kreativitas

dan tanggung jawab. Budaya Membaca Masalah pendidikan nasional adalah penyebab sejumlah masalah yang dihadapi dalam menumbuh-kembangkan minat, kegemaran, dan kebiasaan membaca. Membaca itu dianggap membudaya apabila kegiatan membaca telah menjadi kebiasaan yang dilakukan secara berkelanjutan dan bagian dari kebutuhan hidup sehari-hari. Belum meratanya kesempatan memperoleh layanan pendidikan mengakibatkan belum meratanya juga kesempatan mengembangkan kemampuan membaca, yang artinya juga belum menjadikan membaca suatu kegiatan apalagi kebiasaan. Kemampuan dan keterampilan membaca mempunyai pengaruh yang luar biasa terhadap hasil belajar. Dengan demikian, rendahnya mutu pendidikan menunjukan indikasi rendahnya kemampuan dan keterampilan membaca peserta didik di masyarakat. Belum berkembangnya budaya membaca di masyarakat Indonesia secara umum dan Kabupaten Brebes secara khusus, antara lain dapat disebabkan masalah-masalah berikut. Pertama, keterbatasan layanan perpustakaan dan TBM. Jumlah dan sebaran perpustakaan serta TBM belum menjangkau semua desa/kelurahan sehingga masih banyak masyarakat yang tidak mempunyai akses terhadap layanan bahan bacaan. Di samping itu, koleksi bahan bacaannya juga belum dapat memenuhi berbagai kebutuhan masyarakat penggunanya. Saat ini terdapat dua unit perpustakaan yang dikelola Pemkab, dan 52 TBM dan ini sangat jauh dari kata ideal dibanding dengan luas wilayah dan kepadatan penduduk. Kedua, keadaan ekonomi masyarakat secara umum masih

belum memungkinkan untuk menyediakan dana khusus pembelian bahan-bahan bacaan. Masih banyak anggota masyarakat yang berada dalam garis kemiskinan, sehingga yang menjadi prioritas adalah kebutuhan untuk mempertahankan hidup. Buku belum menjadi kebutuhan untuk segera dipenuhi, karena buku masih tergolong “barang mahal “ dibanding dengan benda/ barang lain yang memilki manfaat secara langsung untuk pemilik/pengguna. Ketiga, proses belajar dan pembelajaran di lembaga-lembaga pendidikkan belum mampu memberikan kemampuan dan ketrampilan membaca yang unggul serta membentuk peserta didik yang gandrung membaca. Akibatnya, kegiatan membaca yang seyogyanya merupakan salah satu ciri kepribadian seorang pelajar dan pengajar, ternyata masih belum tampak setelah peserta didik menyelesaikan kegiatan studinya dan meninggalkan lembaga pendidikan. Keempat, kondisi sosial budaya. Pada umumnya masyarakat masih lebih terbiasa berkomunikasi secara lisan dalam pergaulan hidup sehari-hari. Penggunaan bahasa tulis atau budaya menulis dan membaca masih belum menjadi salah satu kebutuhan hidup sehari-hari. Kelima, masih cukup banyak masyarakat yang masih buta aksara. Tercatat dalam data di Kabupaten Brebes bahwa 110 ribu warga masih berstatus buta aksara. Masyarakat belum menganggap kegiatan membaca sebagai salah satu kegiatan belajar yang dapat mengembangkan pengetahuan, kemampuan dan keterampilan untuk meningkatkan kualitas diri dan hidupnya secara tuntas. Keenam, upaya pemerintah dan masyarakat masih kurang

gencar dalam mempromosikan pengembangan budaya baca ke seluruh lapisan masyarakat secara berkesinambungan melalui berbagai media komunikasi. Berbagai masalah/hambatan yang dikemukakan itu merupakan tantangan yang perlu ditanggapi dan diatasi dalam meningkatkan minat baca masyarakat sehingga menjadi suatu kebiasaan yang kemudian menjadi gandrung membaca. Kompleksnya masalah memerlukan pendekatan multidisiplin yang sistemik sehingga dapat diatasi secara tuntas. Upaya atau pemecahan masalah secara parsial dan kurang terencana nampaknya tidak akan dapat mengatasi masalah secara tuntas. Ketujuh, Teknologi Informasi dan Komunikasi (TIK) yang berkembang cepat dengan potensinya yang mampu menyajikan berbagai informasi dalam tampilan pandang dengar yang menarik sehingga sangat berpeluang untuk menjauhkan minat banyak masyarakat dari kegiatan membaca sabagai cara untuk memperoleh informasi. Minat dan kegemaran membaca masih belum tumbuh dan berkembang secara mapan disaat teknologi komunikasi pandang dengar mulai berkembang pesat merasuk ke tengah-tengah kehidupan masyarakat. Solusi yang ditawarkan untuk membudayakan membaca pada masyarakat antara lain menambah akses layanan Literacy dan TBM (book corner /sudut baca). Pemkab perlu membuat program “Brebes Membaca” dengan implemtasi program book corner/pojok baca. Hal tersebut untuk masyarakat disemua fasilitas publik (Kantor pemerintah, dinas, badan, sekolah, masjid/ musholla serta fasilitas publik lainya, di wilayah Brebes). Hal tersebut dalam rangka penam-

Ratapan Seorang Ibu

Kustoro WHY SIP, Ketua DPD Forum Taman Baca Masyarakat Kabupaten Brebes

calon guru wiyata bakti? Pendidikan ora njalur ko ingin generasi murid yg pinter? Aneh.. 087730343035

INI kisah tragis seorang ibu meratapi kematian anaknya di atas jmbatan Kagok Slawi terlindas bis smentara sang sopir dngan tenang mlarikan diri. Apa salah sopir atau pengendara motor. Yg saya amati pngndara kurang berhti2 dlam mlintas areal jmbtan kagok dngan kondisi jln yg smpit dan tidak rata. Seharusnya pihk berwenang membri rambu2 lalu lintas mengingat di spanjang Jl Kagok sampai jurug menikung dan bnyak lobang jln trsbut sudh bnyk memakan korbn di imbau pda pengndara slalu brhati2 dlm mlintas jaln trsbut dan kmi brharap phak brwenang menperbaiki jln trsbut. Roy Sintoro 085641894146

PemilihanBupati NYONG pan ngresula kye Jon. Kye minggu ngesuk pan piliHan bupati. Tapi nyong sing dadi PPDP (Petugas Pemutakhiran Data Pemilih). Wis nyambut gawe, tapi ka nembe dibayar sawulan bayarane 140.000 + 40.000. Sing wis2 bayarane ping loro. Kye ka nembe dibayar sawulan. Tulung kuwe, wong KPU Negara Tegal dijelasna maring PPDP Pilbup. Sabenere pan dibayar pirang wulan, swaulan apa 2 wulan. Tulung Jon dimuat ya.. 087730540627

Untuk Kita Renungkan ORANG yg ingin jabatan di negeri ini harus berkampanye, melakukan pencitraan terlebih dahulu, dan itu semua tentunya tidak murah, banyak caleg, dan calon eksekutif (bupati, walikota, gubernur, presiden) yg tentunya dg dukungan dari konglomerat hitam, pasti mengeluarkan biaya RATUSAN hingga MILYARAN rupiah agar terpilih. Nah... begitu terpilih sudah pasti target utama dan pertama adalah BALIK MODAL, krn pastinya dg berharap GAJI RESMI, TUNJANGAN doang, dg masa jabatan 5 tahun tdk mungkin cukup utk itu, maka kemudian mereka menghalalkan sgala cara, termasuk juga korupsi, trus konglomerat hitam td akan MENAGIH JANJI dg cara minta proyek2 yg ada dg kong kalingkong serta pengelembungan anggaran, HANCUR SUDAH NEGARA KITA DI ATUR OLEH ORANG2 seperti ini, maka dari itu, kita harus MENOLAK utk memilih orang2 seperti ini. 087730404474

bahan jumlah dan sebaran bahan literacy/bahan baca terhadap masyarakat. Sehingga bahan baca bisa di akses oleh masyarakat dengan mudah dan murah bahkan gratis. Pojok Buku adalah solusi untuk masyarakat dalam keadaan ekonomi yang rendah untuk menikmati buku bacaan secara gratis. Selain di instansi pemerintah, juga perlu pojok buku di sekolah untuk menguatkan proses pembelajaran. Proses belajar dam pembelajaran di lembaga-lembaga pendidikan belum mampu memberikan kemampuan dan keterampilan membaca yang unggul serta membentuk peserta didik yang gandrung membaca. Pojok buku juga perlu ada di fasilitas publik, seperti terminal, pasar, rumah sakit, Puskesmas dan tempat lain. Perlu diingat, bahwa membaca merupakan perintah Allah SWT yang diajarkan kepada Nabi Muhammad SAW melalui malaikat Jibril dengan ayat yang turun pertama yaitu “Iqro” yang artinya “Bacalah.!” Artinya jika kita ingin lebih memiliki derajat dan martabat yang baik maka dengan membaca. Budaya baca di Kabupaten Brebes wajib digalakkan sehingga tidak terkenal dengan buta hurufnya. Budaya baca harus disosialisasikan ke seluruh masyarakat di segala tingkatan, sehingga membaca menjadi kebutuhan masyarakat dan nilai derajat masyarakat Kabupaten Brebes menjadi lebih baik dan lebih bermartabat. Sukses Program Brebes Membaca diharapakan mampu merubah status Brebes dari Kota Buta Huruf. Ayoo membaca, untuk Brebes lebih baik. (*)

Kampanye Ndadekna Macet ASLM. Om Rateg ngapurane nyong pan melu usul dongene yen pan kampanye calon bupati aja ganggu pengguna jalan sing liyane, wingi wis dalane cilik neng Kaliwadas tim ora bisa ngatur kendaraan sing pan lewat akhire nyong sing Tegal pan balik ngidul macet muter Kaliwadas ngulon anjog sejam luwih. Tolong sapa bae tim kampanye calon bupati Tegal ben bisa ngatur lalulintas yen lg pawe kerjasama karo polisi juga, siji maning aja gawani cah cilik melas panas2an mbokan tiba juga soale ora pd helman, maturnuwun Om Rateg. 089688845550 dumane ak pn tkune ces ra kridit, sh apa hubngane ya kang radar, wong pd” konsmen ka bs sg d utmakna sg kridit. Terus terang ak sangat kcewa ma Yamaha, ana wong pn tku mtor ka d angel”. Sepisan maning ak sngat kcewa sekali gro Yamaha. Trims kang Radar. 085920758283

Ngutamakan Kredit

Lebih Baik Buat Pemerataan

KANG radar ak pn mlu ngresula kye, tlg d muat y ben bos” sing due deler Yamaha Tegal-Pemalang-Brebes pd maca, ak pn tku mtor new vixen sg edisi mto GP ws psen awt sdurunge puasa nympe saiki drung olih”, alesane

UNTUK Disdik Kab Brebes. Saya mrasa prihatin dgn knerja guru swasta Brebes, kbanyakn kerjanya tdk ssuai dgn tunjangan INPASING (pnytaraan gaji ssuai gol PNS) yg sdh didapat. Meski sy pun dpt tunjgn tsb

tp sy mrsa bsalah & malu krn sy kerja blum maksa & brgkt srg telat, apa mgkn krn tdk ada pngawasan dr dinas kab ya? Tlg dtinjau lg, mndg bwt pmrataan stfkasi guru yg blum kbwa trutm yg sdh tua2/bwt rkyt Brebes yg mknya nasi aking. 085786657796

Pendidikan Ora Njalur YANG lucu adalah ada guru wiyata lulusan S1 jurusan ekonomi mengajar sbg guru kelas di SD negeri, apakah UPTD Dikpora Suradadi tidak mengawasi ijasah tiap

Pengumuman KEPADA para pengirim SMS Ngresula, kami mohon maaf, karena kendala teknis, nomor Ngresula yang lama mengalami kerusakan. Sebagai gantinya, nomor Ngresula yang baru sebagai berikut: 085225272499. Harap maklum dan mohon maaf. Silahkan sampaikan kritik, unek-unek dan saran melalui SMS Ngresula Radar Tegal.

Anda pernah merasa tidak puas dengan pelayanan publik? Anda pernah kecewa karena mendapatkan pelayanan yang tidak semestinya dari instansi tertentu? Layangkan perasaan Anda ke rubrik Ngresula ini via SMS ke 085225272499, email rateg2000@yahoo.com atau melalui surat ke Radar Tegal Jalan Perintis Kemerdekaan No. 32 Tegal. Tulis dengan bahasa yang sopan atau bisa juga menggunakan Bahasa Tegal. Dapatkan Kaos Ngresula, yang berisi SMS Ngresula pilihan (hanya Rp 60.000/pcs).

Pendiri: H. Mahtum Mastoem (Alm), Penasihat: Dahlan Iskan, Komisaris Utama: HM Alwi Hamu, Komisaris: Lukman Setiawan, Dwi Nurmawan, Dirut: Yanto S. Utomo, Direktur: Moh. Sukron Pemimpin Umum: Moh. Sukron. Pemimpin Redaksi: M. Abduh. Wakil Pemimpin Redaksi: Wawan Setiawan. Redaktur Pelaksana: Iman Teguh Supriyono. Redaktur: Zuhlifar Arrisandy, Moch. Arifin, M. Riza Pahlevi, Khikmah Wati, Arief Nur Rahardian Sidiq. Sekretaris Redaksi/Persh: Yully Trieyani. Kota Tegal: M Saekhun, Laela Nurchayati, Rohman Gunawan, Abidin Abror, Agus Wibowo, Adi Mulyadi. Brebes: Hervianto, Ismail Fuad. Bumiayu: Teguh Supriyanto. Slawi: Iman Teguh Supriyono (Kepala Perwakilan), Hermas Purwadi, Yeri Novelli, M. Harian Pertama Kebanggaan Wong Tegal Ghoni, M. Fatkhurrohman. Pemalang: Embong Sriyadi (Kepala Perwakilan), Agus Pratikno, Moh. Khasanudin. Pekalongan: Ade Asep Syarifuddin. Pracetak: Feri Setiawan, M Yahya, Dedy Irawan, Dwi Nanda P, Asep Ariadi S, Novian Setyo W. Desain Iklan: A.Sekhudin. Iklan: Hesti Prastyani, Kharisma Dewi, Arifudin Yunianto, Riyanto Harjo, Teguh Widodo Nawawi, Agus Mutaalimin, Indani Dwi Oktina, Wahyudi. Pemasaran: Sunarjo (Manager), Umaman Sahareka, Muslih, Zaenal Muttaqin, Wahyu, Rokhim. Keuangan: Yela Ramadiah (Manager), Dwi Titi Lestari, Lita Rahmiati, Astri Prayudita, Syafriani Maulidah, Mubin, Djuhaeri Effendi, Moh. Erlin, Imron Rosyadi. Promosi (Off Print): Taufiq Ismail. Alamat Redaksi/Pemasaran/Tata Usaha: Jl. Perintis Kemerdekaan Tegal telp. (0283) 340900 (hunting), fax (0283) 340004. Semarang: M. Yusuf Abadi. Jakarta: Ferdinansyah, Eko Suprihatmoko. Alamat: Komp. Widuri Indah Blok A-3 Jl. Palmerah Barat No 353, Jakarta 12210 Telp (021) 5330976, 5333321 Fax: (021) 5322629. Eceran: Rp 2.500/eks. Percetakan: PT Wahana Java Semesta Intermedia Kompleks LIK Dampyak -Tegal. Semua wartawan Radar Tegal dilengkapi tanda pengenal/ Tarif Iklan: Umum/Display: Rp 25.000/mm kolom, Sosial/Keluarga: Rp 17.000/mm kolom, Iklan Baris Laris: Rp 17.000/baris, Iklan Colour: Rp 37.000/mm kolom. surat tugas dan tidak dibenarkan meminta/menerima Iklan halaman 1 (depan): Rp 75.000/ mmk. Tarif + 200%, Creative ad: Tarif + 50%. NPWP: No: 01.994.052.7-511.000. imbalan dalam bentuk apapun dari narasumber. Bank: Bank Mandiri Cab. Tegal a.n. PT Wahana Semesta Tegal No. Rek: 139.0002152787. Bank Jateng Cab. Tegal No. Rek: 1.004.02598.5 a.n. PT Wahana Semesta Tegal


CMYK

ADVERTORIAL

RABU 23 OKTOBER 2013

3

RADAR TEGAL

Dari Habib Soleh sampai Gus Nuril SEJAK pukul 09.00, depan halaman GOR Tri Sanja, kemarin (22/ 10), dipadati puluhan ribuan massa yang datang dari berbagai wilayah. Mereka merupakan pendukung Pasangan Calon BupatiWakil Bupati Tegal, Dokter H Muhammad Edi Utomo-Drs H Abasari MHum (DOA) ini, bergerombol dan duduk di bawah pohon hutan kota. Sementara sebelah kirinya, petugas sound system tengah mengerjakan tugasnya. Pergerakan massa tidak terhindarkan lagi. Dengan menggunakan truk, pick up hingga bus, puluhan ribu orang meluber, dan merangsek ke depan panggung. Demikian pula dengan mereka yang memakai sepeda motor, mulai merapat ke halaman GOR Tri Sanja. Namun, agar massa yang memadati lokasi terhibur, grup Band Galawi mulai menyapa dengan lagu-lagu kondang. Tembang Tegalan dengan judul ‘Kacang Asin,’ mulai dinyanyikan empat vokalis langsung. Rupanya, massa yang berkumpul di tempat itu, hafal betul dengan lirik lagu ‘Kacang Asin.’ Sehingga ikut berdendang, bersama-sama para penyanyi yang berada di atas panggung. Bahkan untuk membakar semangat, lagu dengan judul ‘DOA’ dilantunkan. Sehingga histeris massa yang memadati panggung hiburan terdengar nyata. Bahkan,

ketika hujan mengguyur Kota Slawi, massa yang berkumpul di depan halaman GOR Tri Sanja, tidak mau beranjak hingga sampai hujan reda. Pukul 13.00, dari kejauhan terdengar sirine tanda para tamu undangan, meluncur memasuki lapangan kampanye terbuka Pasangan DOA. Kemudian yang pertama datang, rombongan keluarga Calon Bupati Dokter H Muhammad Edi Utomo, disusul keluarga Pasangan Wakilnya, Drs H Abasari MHum. Lima belas menit berselang, mantan panglima pasukan berani mati Gus Dur, Gus Nuril, tiba dikawal beberapa orang. Gus Nuril berjalan menerobos kerumunan massa, sambil bersalaman. Lima menit kemudian, disusul rombongan Habib Soleh Bin Tolib Al Attas tiba dan naik ke atas panggung. Mantan Ketua Dewan Syuro PKB Kabupaten Tegal tersebut, mengajak seluruh masyarakat memenangkan pasangan nomor lima. Habib Soleh berterus terang kenapa dirinya mendukung Pasangan DOA. Karena menurutnya, Calon Bupati-Wakil Bupati Edi-Abasari, tidak pernah menjelek-jelekkan pasangan lain. Bahkan mengajak tim sukses, pendukung serta simpatisannya, bersama-sama menjaga kondusifitas Kabupaten Tegal. (guh)

YERI NOVEL/RADAR SLAWI

ORASI - Ketua Dewan Pendekar Pagar Nusa Nahdlatul Ulama pusat, DR KH Nuril Arifin MBA, menyampaikan tausiyah pada puluhan ribu massa pendukung pasangan DOA.

YERI NOVEL/RADAR SLAWI

PIDATO - Mantan Ketua Dewan Syuro PKB Kabupaten Tegal, Habib Soleh Bin Tolib Al Attas, didampingi Calon Wakil Bupati Drs H Abasari MHum (kiri), dan Calon Bupati Dokter H Muhammad Edi Utomo (kanan), sedang menyapa massa.

YERI NOVEL/RADAR SLAWI

SALAMAN - Calon Bupati Tegal Dokter Haji Muhammad Edi Utomo, bersalaman dengan para pendukungnya saat kampanye terbuka.

YERI NOVEL/RADAR SLAWI YERI NOVEL/RADAR SLAWI YERI NOVEL/RADAR SLAWI

SAPA MASSA - Calon Bupati Tegal Dokter Haji Muhammad Edi Utomo (kedua dari kanan), melambaikan tangan menyapa pendukungnya.

LAMBAIKAN TANGAN - Calon Wakil Bupati Drs Haji Abasari MHum, menyapa massa pendukung pasangan DOA yang berada di GOR Tri Sanja.

JABAT TANGAN - Ketua Dewan Pendekar Pagar Nusa Nahdlatul Ulama pusat, DR KH Nuril Arifin MBA, diajak bersalaman oleh massa pendukung pasangan DOA, saat akan naik ke atas panggung.

TERSENYUM Calon Bupati Tegal Dokter Haji Muhammad Edi Utomo (kiri), tersenyum di depan puluhan ribu massa pendukungnya.

YERI NOVEL/RADAR SLAWI

YERI NOVEL/RADAR SLAWI

YERI NOVEL/RADAR SLAWI

DIALOG - Ketua Dewan Pendekar Pagar Nusa Nahdlatul Ulama pusat, DR KH Nuril Arifin MBA, berdialog dengan massa didampingi Hajah Rukayah.

MEMBLUDAK - Puluhan ribu massa pendukung pasangan DOA, membludak memadati halaman GOR Tri Sanja, ketika kampanye terbuka.


INTERMEZO

4

RABU 23 OKTOBER 2013

RADAR TEGAL

Hamil, Tetap Goyang

TELEPON PENTING 1. Pemadam Kebakaran

(0283) 325429

2. Pelayanan Gangguan PLN

(0283) 342245

3. Polresta Tegal

(0283) 356115

4. Rumah Sakit Umum Kardinah

(0283) 356067 / 341938

5. Pelayanan Gangguan PDAM

(0283) 356175 / 358316

6. Stasiun Besar Tegal

(0283) 353018

7. Terminal Bis Tegal

(0283) 354696 / 354695

SEBAGAI penyanyi, Ayu Ting Ting sangat memperhatikan penampilannya. Saat kehamilannya semakin membesar, pelantun Alamat Palsu itu tetap berusaha tampil modis. Tengok saja penampilannya saat mengisi acara Persembahan Cinta dari MNCTV di kawasan Pondok Gede, Jakarta Timur, Senin dini hari (21/10). Dia tampil cantik berbalut strapless paduan hijau dan hitam bermotif bunga, plus platform pump hitam sebagai alas kaki. Ya, kehamilan tak lantas membuat Ayu melupakan sepatu hak tinggi. ”Pakai sepatu heels-nya kalau sudah sampai di panggung. Sebelumnya, ditenteng dulu,” ungkapnya mengenai cara mensiasati agar tidak kelelahan memakai heels. Bertubuh tak terlalu tinggi, memakai heels dirasanya penting untuk menunjang penampilannya. Namun, kenyamanan t e t a p menjadi pertimbangannya. Dia mengaku baru

Hotel dan Hiburan Hotel Bahari Inn Tegal (0283) 343399 Hotel Karlita (0283) 358050 Orange Karaoke (0283) 322022 Riez Palace Hotel (0283) 353773, hunting (0283) 358978 Flash Family Karaoke & Cafe (0283) 321284 Ajam Goreng Spesial Lombok Idjo - Jl. Karanganyar No. 21A Kejambon (0283) 342331 - d’POSO resto

(0283) 342330 (0283) 6144277

- Anggraeni Hotel

(0283) 881011

Jl. Ahmad Yani No. 159 Ketanggungan - Brebes

AGENDA HOTEL HOTEL KARLITA Rabu dan Sabtu, Show DJ and Dancer Performance pukul 23.0003.00 WIB di Zodiak Discotheque dan VIP Karaoke. HOTEL BAHARI INN Tegal - Setiap Hari Live Musik di Cafe Nelayan, Mulai Jam 19.00 WIB - Sabtu Happy Our di Musro Diskotik, Jam 20.00 - 03.00 WIB

RIEZ PALACE HOTEL - Senin sampai Sabtu Pick up service Gratis. Layanan antar jemput gratis setiap hari kerja. Dari atau ke Stasiun KA & Terminal Bus Tegal Spesial menu “Afternoon Tea” tiap pukul 17.00-19.00 WIB di Abunawas Resto lt.4

akan berhenti memakainya kalau sudah mendekati tanggal persalinan. ”Saya masih belum berubah, masih pakai heels. Nggak apa-apa, nggak masalah. Nanti beberapa bulan nggak pakai lagi, ya kira-kira pas mau melahirkan lah,” tuturnya. Hanya saja, pemilik nama lengkap Ayu Rosmalina itu mengurangi goyangannya untuk menjaga kesehatan janin di dalam perutnya. ”Ya pastinya, gerakannya begitu-begitu saja. Nggak bisa terlalu aktif,” katanya. ”Pastinya merasa bersyukur karena merasa beda, sudah nggak sendiri. Jadinya harus lebih hati-hati,” sambung Ayu lalu tersenyum. Saat di panggung, perempuan kelahiran Depok, Jawa Barat, 20 Juni 1992 itu sempat dibuat terharu dengan kehadiran orangtuanya, Hendri B Hendarso dan Umi Kulsum, yang baru saja pulang dari Tanah Suci. ”Senang ya, ayah sama ibu bisa nemenin. Tadi sempat jemput ke bandara, habis itu langsung ke sini. Sebenarnya saya nggak maksain, mereka yang mau datang. Saya senang. Kalau mau istirahat nggak apa-apa,” terangnya. Ayu pun mengajak sang ibu ke atas panggung, dan menyanyikan lagu Muara Kasih Ibu untuknya. Umi tak bisa menahan air matanya, terlebih saat Ayu meminta maaf dan memeluknya. Entah maaf untuk apa, tetapi rumah tangganya dengan Enji yang bermasalah, memang membuat keluarganya sedih. (ash/jpnn)

- Sabtu malam Minggu, jam: 20.00 - 23.00 WIB

Fatin Shidqia Lubis

Live Music

Dibuat Malu Ariel dan Afgan

Pandji Pragiwaksono

Pengalaman Terbatas KEMAMPUAN berstand up comedy mengantarkan Pandji Pragiwaksono ke dunia akting. Bersama tujuh stand up comedian lainnya, dia membintangi film Comic 8 yang saat ini memasuki tahap syuting. Menurutnya, tak ada alasan menolak tawaran berlakon dalam film besutan Anggy Umbara itu. ”Film ini menarik, karena belum ada film action comedy yang seperti ini. Walaupun ini film komedi, tetapi banyak pesan positif dan mengangkat isu-isu yang sedang terjadi saat ini,” ungkapnya yang beradu akting dengan Nirina Zubir dan Kiki Fatmala. Belum terbiasa, syuting film dirasanya cukup menguras tenaga. Tetapi keinginan lamanya untuk main film yang akhirnya terwujud, memecut semangat pria kelahiran Singapura, 18 Juni 1979 itu untuk menunjukkan aksi terbaiknya. ”Sejauh ini prosesnya menyenangkan. Tantangannya adalah ada banyak adegan ekstrim yang menuntut stamina. Apalagi pengalaman akting kami semua masih terbatas,” kata pelantun Demokrasi Kita dan Indonesia Free itu. (ash/jpnn)

Shareena

Terus Asah Akting SHAREENA terbilang baru di dunia film. Perempuan kelahiran Jakarta, 11 Oktober 1983 itu baru membintangi empat film yakni Kick n’Love (2008), Perahu Kertas (2012), Perahu Kertas 2 (2012), dan Cinta Dalam Kardus (2013). Dan dia berhasil mengantongi perhargaan sebagai Pendatang Baru Terbaik Indonesia Movie Awards 2013. ”Dari awal saya berkarir di dunia entertainment, nggak pernah kepikiran berkarya demi sebuah piala. I love my job. Bagi saya piala itu bonus. Setiap seniman pasti bahagia jika karyanya dihargai orang lain,” katanya. ”Jadi, bukan merasa terbebani dengan ekspektasi penikmat film Indonesia, saya justru termotivasi memberikan yang terbaik dalam peran apa pun yang saya mainkan,” sambung pacar aktor Ryan Delon itu lalu tersenyum. Sebelum membintangi film layar lebar, Shareena cukup kaya pengalaman akting berkat sederet film televisi (FTV). Sejauh ini, tak kurang dari 40 judul FTV sudah dibintanginya. ”Saya nggak pernah berhenti belajar berakting, dan tidak ada kelulusan di ‘sekolah’ ini. Selalu ada hal baru untuk dipelajari,” tuturnya. (ash/jpnn)

Ayu Ting Ting Shireen Sungkar

Undang Adly Ke Pernikahan NOVEMBER mendatang, rencananya Shireen Sungkar dan Teuku Wisnu akan menggelar pernikahan. Di hari berbahagianya itu, Shireen bakal mengundang beberapa teman dekatnya. Dari beberapa teman spesial Shireen, nama Adly Fairuz juga masuk ke dalam daftar tamu undangan. Seperti diketahui, Shireen dan Adly sempat berpacaran. “Teman-teman lama diundang, mantan diundang semua. Orang mantannya sudah pada kawin, hehehe. Adly diundang kok, eh Adly belum kawin ya,” ujar Shireen setengah bercanda. Pesinetron Cinta Fitri ini juga mengaku telah siap untuk dipersunting Wisnu. Selain persiapan acara pernikahan, Shireen juga telah menyiapkan mentalnya jelang hari berbahagianya tersebut. “Mental siap-siapin saja lah, sudah 90 persen juga persiapan semuanya. Untuk saksi, nanti dari pihak aku satu dan dari temannya papa satu,” tuturnya. Tak lupa, personel duo The Sisters ini pun meminta doa yang terbaik demi kelancaran pernikahannya nanti. “Ya harapannya, mudah-mudahan lancar hingga hari H. Kesiapannya lahir batin saja,” harapnya. Minggu lalu, Shireen dan Wisnu baru melangsungkan foto pre-weddingnya di sebuah hotel berbintang di Jakarta. Uniknya, mereka rela basah-basahan di kolam renang. Sesuai dengan temanya foto â•?underwater”, Shireen enjoy menjalani sesi pemotretan. “Iya kemarin pre-wedding namanya orang mau menikah, konsepnya terserah forografernya, mereka maunya underwater. Ya sudah kami coba,” beber putri Mark Sungkar ini. Melakoni foto bawah air, Shireen sempat kesulitan. Apalagi ia merasa kurang puas karena beberapa hasil foto menampilkan mata Shireen yang kemasukan air. “Iya aku kan nggak pernah ya foto di bawah air, susah banget, tapi nggak apa-apa sama pacar ini. Sebenarnya agak jelek, tapi kebanyakan meremnya soalnya kan di air ya, kemasukan air,” jelasnya. (mer/jpnn)

FATIN Shidqia Lubis tak bisa menutupi rasa gugupnya saat sepanggung dengan Ariel ‘Noah’ dalam Persembahan Cinta dari MNCTV di kawasan Pondok Gede, Jakarta Timur, Senin (21/10) dini hari. Membawakan lagu Yang Terdalam, jawara X Factor Indonesia itu akhirnya mengetahui penyebab teman duetnya itu digilai banyak perempuan. Menurutnya, Ariel punya daya tarik yang membuat siapapun yang berada di dekatnya merasa nyaman. ”Dia punya aura sendiri. Semua cewek-cewek kayaknya tergila-gila sama dia. Buat aku, pertama kali ketemu juga beda, kayaknya gimana gitu. Tapi dia profesional sih,” kata Fatin. Sempat salah tingkah, dia tampil apik diiringi permainan gitar Ariel. ”Enak (duet bareng Ariel), nyaman banget. Kita benar-benar di suasana nyaman, duduk masing-masing, terus akustikan. Aku kayak kebawa sama auranya dia,” ungkapnya diiringi senyum. Sebelum bertemu langsung, Fatin sempat mengira Ariel sosok yang jutek dan sombong. Dia menilainya seperti itu, karena Ariel selalu terlihat dingin. Tetapi kemarin dia mengakui kesalahannya dalam menilai mantan pacar Luna Maya tersebut. ”Dia kan cool gitu, jadi aku kira jutek. Tahu-tahu pas kenal, dia suka nanyananya sama aku,” tuturnya. Perempuan berhijab itu semakin mengagumi Ariel karena tidak pelit ilmu. Sebagai pendatang baru di industri musik tanah air, masukan yang diberikan Ariel sebagai senior dinilainya penting dan sangat membantu. ”Orangnya menyenangkan,” terang Fatin. Duet itu, kata dia, tak akan terlupakan. Dia masih ingat betul saatsaat menyaksikan Ariel bersama Peterpan (kini Noah) menghiasi layar kaca. ”Aku anak baru banget, tetapi sudah duet bareng sama (musisi) yang sudah lama ba-

nget (berkarir di panggung musik). Benar-benar nggak berasa aku duet sama yang aku lihat (di televisi) beberapa tahun lalu,” ucapnya. Selain Ariel, malam itu Fatin pun berkolaborasi dengan Afgan. Sama halnya dengan Ariel, Afgan membuatnya salah tingkah. Bahkan, pemilik hits Aku Memilih Setia itu tidak berani memandang mata Afgan. ”Dia itu selalu membuat cewek-cewek yang ada di hadapannya malu,” katanya. ”Dia itu kalau eye contact, kayak langsung jleb gitu. Walaupun dia pakai kacamata, aku yang kayak, sudah dong sudah, nggak bisa ngomong. Nggak bisa lihat dia lebih dari 10 detik,” ujar putri pasangan Bahari Lubis dan Nurseha itu lalu tertawa. Namun, dia berkilah sekadar berakting saat wajahnya yang tersipu malu tertangkap kamera. Menurutnya, itu gimmick untuk membuat aksinya malam itu lebih seru. Apalagi, itu bukan kali pertama dia duet dengan Af-

gan di atas panggung. J a d i , chemistry-nya dengan Afgan sudah terbangun. ”A k u nggak kagok, karena sudah kenal. Jadi, lebih improve dari yang kemarin. Kalau soal malumalu, aku tadi akting. Akting aku memang profesional,” kilah gadis kelahiran 30 Juli 1996 itu. (ash/jpnn)


5

RABU, 23 OKTOBER 2013

Mandiri

Tanpa Tanda Penyakit, Pria Ini “Menangis Darah” PRIA muda asal Tennessee, Amerika Serikat, mengalami kondisi kesehatan yang cukup mengkhawatirkan. Tanpa adanya tanda penyakit, dia mengeluarkan darah dari matanya. Kondisi tersebut membuat pria itu seperti “menangis darah”. Bahkan, pria itu telah membuat para dokter terbaik kebingungan atas penyakit yang dideritanya. Pria itu adalah Michael Spann, yang pada usia 22 tahun berjalan dari tangga rumahnya di daerah Antioch, Tennessee. Saat itu, dia merasa sakit yang sangat parah pada kepalanya. Setelahnya, Spann pun sadar, darah segar keluar dari mata, hidung, dan mulutnya. “Saat itu aku merasa kepalaku habis dipukul dengan palu yang besar,” katanya. Kini, tujuh tahun berlalu sejak kejadian itu. Sakit kepala dan “menangis darah” merupakan kondisi rutin yang dialaminya. Paling tidak dalam seminggu, kondisi itu datang sekali atau dua kali. Meksipun tidak memiliki asuransi kesehatan yang memadai, Spann diminta oleh para dokter di Claveland Clinic, Tennessee, untuk menjalani serangkaian pemeriksaan kesehatan. Namun hingga sekarang, para dokter belum juga dapat menemukan pengobatan yang tepat bagi Spann. Fenomena “menangis darah” juga dialami oleh Calvino Inman di tahun 2009. Saat sedang di kamar mandi, dia melihat cermin dan begitu terkejut menemukan darah mengalir dari matanya. “Aku melihat diriku di cermin, dan aku pikir aku akan mati,” katanya. Kemudian, dia pun dilarikan ke unit gawat darurat, tetapi dokter belum dapat mendiagnosis penyakitnya. Sejumlah pemeriksaan seperti CT Scan

Sebagai

dan MRT (magnetic resonance imaging), dan USG tidak memberikan petunjuk apa pun. Para ahli pun menamai kondisi yang menjadi misteri selama berabad-abad ini sebagai haemolacria. Di abad ke-16, dokter asal Italia Antonio Brassavola menemukan seorang biarawati yang tidak hanya mengeluarkan darah menstruasi, dia juga mengeluarkan darah dari mata dan telinganya setiap bulan. Sementara itu, pada tahun 1951, dokter asal Flandria Rembert Dodoens memeriksa seorang gadis usia 16 tahun yang mengalirkan darah dari matanya. Dr Barret G Haik, direktur University of Tennessee’s Hamilton Eye Institute di Memphis, menulis tinjauan empat kasus haemolacria, mengatakan, “menangis darah” merupakan kondisi medis yang sangat jarang terjadi. Namun, biasanya kondisi ini sembuh sendiri tanpa pengobatan. Menurut Haik, haemolacria terjadi karena cedera kepala dan trauma lainnya, tetapi pada kasus Inman dan Spann, penyebabnya tidak diketahui. “Jika tidak diketahui penyebab aslinya, maka belum dapat dilakukan eliminasi kemungkinan apa pun,” ujarnya. Sebelum “menangis darah”nya sembuh, Spann yang berprofesi sebagai artis dan berharap dapat memiliki karier di desain fashion ini masih harus berjuang dalam hidupnya. Pasalnya, dia harus kehilangan pekerjaannya begitu penyakitnya kambuh. “Jelas, aku tidak bekerja di tempat umum jika masih mengalami kondisi ini. Aku juga selalu dengar komentar miring tentang diriku dari tetangga. Aku sungguh tak ingin mengalami penderitaan lebih dari ini,” ratapnya. (hkc)

Single Parent MEMBESARKAN anak seorang diri tanpa dukungan sosok suami atau istri tentu bukan perkara mudah. Memberikan perhatian kepada anak, memberi nafkah dan sebagainya harus dilakukan sendiri. Pengalaman inilah yang membuat Dewi Hastuti menjadi semakin mandiri dalam membesarkan putrinya yang kini baru menginjak usia 2 tahun. Pengalaman ditinggal suami setahun silam akibat kecelakaan hingga saat ini masih membekas dalam ingatannya. Meski awalnya dia mengaku sulit menerima keadaan ini, tetapi begitu melihat tawa riang dan senyum polos putrinya, dia kembali bangkit dari keterpurukan. Beruntung, dia masih memiliki saudara dan keluarga besar yang selalu memberikan dukungan, baik dalam bentuk moril maupun finansial. Pengalaman sebelum menikah sebagai seorang biduanita ternyata memberi manfaat. Dari profesi itulah dia bisa mendapatkan rejeki halal untuk membiayai semua kebutuhan dia dan anaknya. Dia juga tidak menampik saat ini banyak pria yang melakukan pendekatan kepada dirinya. Tetapi rasa cinta yang masih melekat kuat di relung sanubari terdalamnya kepada sang suami membuat dia tidak bisa menerima itu. Saat ini semua dia anggap sebagai teman, meskipun sebagian diantara mereka ada yang serius dan sisanya sekedar main-main. “Awalnya memang berat, tetapi hidup harus terus berjalan seperti biasa,” ujarnya. Di sisi lain, sebagai seorang single parent, tentu dia tidak bisa melakukan semuanya sendiri. Saat ada job di suatu acara, si kecil selalu dia titipkan kepada

Rutin Olahraga Dewi Hastuti Tingkatkan Prestasi Akademik Si Kecil Bantuan 130 Juta Dolar untuk Tanggulangi AIDS, Malaria dan TB

MANFAAT olahraga bagi kesehatan tak terbantahkan. Jika dilakukan secara teratur, olahraga dapat mencegah datangnya penyakit-penyakit denegeratif. Selain itu, olahraga juga ternyata bermanfaat dalam meningkatkan prestasi akademik si kecil di sekolah. Sebuah studi baru asal Inggris menemukan, olahraga moderat hingga berat yang dilakukan setiap hari dapat meningkatkan prestasi akademik di sekolah. Semakin tinggi intensitas olahraganya, semakin besar dampaknya, terutama untuk mata pelajaran bahasa, matematika, dan sains. Meskipun demikian, para peneliti masih belum dapat menunjukkan hubungan antara keduanya. “Banyak dugaan yang menjelaskan hubungan keduanya, misalnya aktivitas fisik meningkatkan waktu mereka di ruang kelas atau berdampak pada kepercayaan diri mereka,” ujar peneliti studi Josephine Booth, dosen di University of Dundee, Skonlandia. Menurut Booth, mungkin ada penjelasan biologis terkait hal itu. Penelitian lain, kata dia, telah menemukan kurangnya akti-

vitas fisik dapat berdampak negatif pada struktur dan fungsi otak, sehingga berpengaruh terhadap performa intelektual. Studi yang dipublikasi dalam British Journal of Sports Medicine tersebut menganalisa data dari hampir 5.000 siswa. Para peneliti mengukur durasi dan intensitas aktivitas fisik harian selama tiga hingga tujuh hari saat siswa-siswa tersebut berusia 11 tahun. Mereka juga memasangkan peserta dengan sebuah alat seperti sabuk yang dapat mengukur aktivitas yang dilakukan. Hasilnya, siswa yang melakukan aktivitas fisik yang paling banyak memiliki performa yang lebih baik dalam tiga pelajaran, yaitu bahasa, matematika, dan sains. Uniknya, hubungan tersebut masih ditemukan beberapa tahun kemudian, saat mereka berusia 13, 15, dan 16. Dalam studi ini, para peneliti telah memperhitungkan pula faktor-faktor lainnya yang bisa mempengaruhi pretasi akademik, antara lain status ekonomi, berat lahir, usia ibu saat melahirkan, dan kebiasaan merokok ibu saat hamil. Namun ternyata, hubungan tersebut masih berlaku. (hkc)

INDONESIA kembali menerima dana bantuan dari Global Fund untuk penanggulangan AIDS, malaria, dan tuberkulosis. Dana sebesar 130 juta dollar AS tersebut akan diberikan mulai 2014 hingga 2019. Dana ini akan digunakan untuk upaya pencegahan maupun pengobatan 3 penyakit dengan angka infeksi tertinggi di Indonesia tersebut . Sebelumnya pada 2003, Indonesia telah bekerja sama dengan Global Fund menangani penyakit yang sama. Pada 2003 sejumlah provinsi menerima bantuan dari Global Founds. Untuk pengobatan TB, semua propinsi di Indonesia memberoleh bantuan obat. Bantuan diberikan sampai proses pengobatan selesai, selama kurang lebih 6 bulan. Sementara untuk penanggulangan AIDS, pasien yang terinfeksi virus HIV mendapat suntikan anti retroviral. Sedangkan untuk malaria, bantuan diberikan sebagai upaya pencegahan dalam bentuk kelambu berinsektisida. Sejak 2003 hingga Oktober 2013 tercatat 1,3 juta kasus baru TBC telah dideteksi dan diobati. Sebanyak 8,8 juta orang menerima bantuan kelambu berinsektisida. Selain itu, sejumlah 29 ribu orang mendapat suntikan ART.

Pemberian bantuan dinilai efektif mengendalikan 3 penyakit tersebut. “Angka penularan AIDS, malaria, dan TBC berhasil ditekan, sehingga kerjasama ini dilanjutkan,” kata Menteri Kesehatan RI yang juga Ketua Dewan Global Found, Nafsiah Mboi, pada konferensi pers di Jakarta, kemarin. Penurunan paling besar terjadi pada angka infeksi penyakit TBC. Setelah sebelumnya penyakit ini memiliki sebaran 450 per 100 ribu penduduk, pada 2012 jumlah ini menjadi 285 per 100 ribu penduduk. Sementara untuk malaria rata-rata angka sebaran adalah 1,75 per 100 ribu penduduk. Untuk AIDS jumlah penderita yang terdata sejak 2003-2012 adalah 43.600 jiwa. Untuk bantuan Global Fund yang akan dikucurkan pada 2014, belum ditentukan program ataupun pencanangan targetnya. “Penanganan AIDS, malaria, dan TBC untuk dana 2014 belum dibahas. Perencanaan ini akan disesuaikan dengan perencanaan strategis nasional yang kita miliki. Namun mungkin ada beberapa yang tetap,” kata Kepala Badan Pengembangan dan Pemberdayaan Sumber Daya Manusia Kesehatan (BPPSDMK) Kementrian Kesehatan RI, Untung Suseno Sutarjo. (hkc)

BIODATA Nama

: Dewi Hastuti

TTL

: Pekalongan, 17 Januari 1984

Anak

: Nurul Widyawati

Hobi

: Menyanyi dan memasak

saudaranya. Meski banyak cibiran dari beberapa tetangganya dengan profesi yang dia lakoni sekarang. Tetapi dengan keyakinan diri dan selalu membedakan antara yang baik dan buruk. Dia bisa bertahan sekuat tenaga dan selalu mencari sesuap nasi dengan cara yang halal. Saat sedang sepi job, dalam sebulan dia mengaku bisa sama sekali tidak mendapatkan pemasukan. Di saat kritis seperti ini, dengan terpaksa dia mulai menjual beberapa perhiasan peninggalan suaminya serta meminjam kepada saudara. Meski awalnya malu, dengan niat baik dan selalu mengembalikan tepat waktu, justru banyak dari keluarga besarnya yang sengaja datang untuk memberikan bantuan secara materi. Saat ini, harapan ke depan yang dia inginkan adalah dapat memebsarkan putrinya serta menyekolahkan setinggi mungkin agar kelak bisa menjadi anak yang sholekhah serta berguna bagi keluarga, bangsa dan negara. Meski sedikit, dia juga rajin menyisihkan sebagian rejeki yang diterima untuk ditabung demi masa depan si buah hati. Putaran roda kehidupan dari suka dan duka semua pernah dia alami. Berbekal tekad yang kuat, dia optimis bisa mencapai asa tersebut agar dapat melihat anaknya selalu riang dan ceria seperti anak-anak pada umumnya yang masih memiliki orang tua lengkap. “Single parent membutuhkan tenaga yang ekstra, karena saya merangkap menjadi ibu sekaligus ayah buat anak saya,” tandasnya. (gun)

Banyak Remaja Kena Kanker Paru, Rokok dan Makanan Berminyak Pemicunya DATA Pusat Kanker Nasional RS Kanker Dharmais (RSKD) menyebutkan penderita kanker paru terus meningkat, utamanya pada perokok. Lima tahun terakhir juga muncul tren, perokok perempuan meningkat sehingga risiko terkena kanker paru pun tinggi. Perokok remaja juga mengalami peningkatan. Pasien kanker paru pada remaja pun tendensinya terus naik. “Pasien kanker paru paling banyak di atas usia 40. Tapi perokok usia SMP/SMA tendensinya naik. Semakin muda usia penderitanya, kanker paru semakin ganas dan peluang hidupnya kecil,” terang spesialis paru dan pernapasan yang juga Ketua Tim Kerja Paru RSKD, dr A Mulawarman Jayusman, SpP(K) kepada Kompas Health di Jakarta. Mulawarman mengatakan kanker paru pada usia muda cenderung agresif karena pertumbu-

han sel kanker lebih cepat menyebar. Kanker bisa menyebar ke bagian atas tubuh juga bagian bawah. Bukan hanya di paru, tapi juga ke tulang, kelenjar, otak, liver, ginjal. Ia mengungkapkan, penelitian di China oleh Prof Tony Shu Kam Mok, BMSc, MD, FRCPC, FHKCP, FHKAM (Medicine) yang juga adalah Presiden International Association for the Study of Lung Cancer, peningkatan kanker paru pada usia muda juga dipengaruhi faktor pola makan. “Kanker paru pada usia muda meningkat karena banyak menggunakan minyak goreng, yang menyebabkan kanker. Pola makan sebagai penyebab kanker di usia dini juga belum banyak disadari,” ungkapnya. Hasil pengamatan di RS Kanker Dharmais menunjukkan remaja penderita kanker paru, setelah mendapatkan diagnosa, hanya bisa bertahan 4 bulan. (hkc)


ADVERTORIAL

6

RADAR TEGAL

Target hanya Satu Putaran PULUHAN ribu simpatisan, dan pendukung Pasangan Calon Bupati-Wakil Bupati, Dokter HM Edi Utomo-Drs H Abasari MHum, tumplek blek di halaman GOR Tri Sanja, Selasa (22/10). Sebagian besar ibu-ibu yang memeriahkan kampanye terbuka Pasangan DOA, dihadiri mantan Ketua Dewan Syuro PKB Kabupaten Tegal, Habib Soleh Bin Tolib Al Athos, dan Ketua Dewan Pendekar Pagar Nusa Nahdlatul Ulama pusat, DR KH Nuril Arifin MBA. Habib Soleh Bin Tolib Al Athos mengatakan dalam orasinya, kenapa dirinya mendukung pasangan DOA. Karena pasangan ini calon yang tidak pernah menjelek-jelekkan pasangan lain. “Alhamdulillah, mesti pasangan tersebut dihujat, difitnah, tapi tidak pernah mau membalas. Bahkan mengajak para pendukungnya bersama-sama menjaga kundusifitas di Kabupaten Tegal,” ucapnya. Selain itu, pasangan dokter Edi-Abasari paling ideal. Calon bupatinya pengusaha, sedang-

CMYK

kan calon wakil bupatinya birokrat murni. Dengan perpaduan inilah, diyakini mampu membawa Kabupaten Tegal lebih baik lima tahun ke depan. “Tolong jangan salah pilih. Karena menentukan lima tahun ke depan. Jangan ragu, coblos pasangan nomor lima,” imbuhnya. Sementara Dr H Moh Edi Utomo mengaku, dirinya ingin mengabdi pada masyarakat Kabupaten Tegal. Sehingga memutuskan maju mencalonkan diri sebagai bupati. Putra pasangan H Ismail dan Hajah Rukayah, merasa tertantang membenahi Kabupaten Tegal yang Indeks Pembangunan Manusianya masih rendah. “Saya melihat keprihatinan Kabupaten Tegal. Kabupaten Tegal yang IPM-nya rendah itu kan tantangan buat saya. Bagaimana saya bisa mewujudkan, tentunya untuk perubahan,” ujar Edi yang lulusan Fakultas Kedokteran Universitas Islam Sultan Agung. “Untuk target suara, saya optimis menang satu putaran,” tegas Edi. (guh)

RABU 23 OKTOBER 2013


SAMBUNGAN

RABU 23 OKTOBER 2013

7

RADAR TEGAL

Penyuap Eks Pegawai Pajak Komisaris PT Surabaya Agung JAKARTA - Penanganan kasus suap terhadap dua mantan pegawai Ditjen Pajak, Denok Taviperiana dan Totok Hendriyatno, yang diciduk Senin (21/10) lalu ternyata sudah lama dilakukan. Skandal suap itu terbongkar setelah PPATK menemukan transaksi mencurigakan di rekening Denok dan Totok yang tercatat dalam kurun 2005-2007. Pengirimnya diduga komisaris PT Surabaya Agung Industri Pulp Kertas Tbk berinisial IRN alias Berty. PT Surabaya Agung merupakan salah satu perusahaan wajib pajak besar. Kasus itu terbongkar berdasar laporan hasil analisis (LHA) Pusat Pelaporan dan Analisis Transaksi Keuangan (PPATK). Laporan tersebut masuk ke meja Itjen Kemenkeu dan Direktorat Tindak Pidana Ekonomi Khusus (Dittipideksus) Bareskrim Mabes Polri pada 2010. Berdasar keterangan yang diperoleh Jawa Pos, Berty merupakan komisaris PT Surabaya Agung yang baru diputus pailit April lalu. Perusahaan ini berkantor di Jalan Kedungdoro No 60 lantai 8-10 Surabaya. Sesuai surat ke Bursa Efek Indonesia (BEI), PT Surabaya Agung diputus pailit oleh Pengadilan Niaga Surabaya pada 16 April 2013. BEI juga sudah menghentikan sementara perdagangan efek (suspensi) perusahaan ini pada 18 April 2013 setelah menerima pemberitahuan kepailihan oleh tim kurator. Wakil Direktur Tipideksus Bareskrim Mabes Polri Kombes

MOHAMAD QORI/RM

DUGAAN KASUS SUAP PAJAK - Dari kiri, Kepala Bagian Penerangan Umum Divisi Humas Mabes Polri, Kombes Pol Agus Rianto, Wakil Direktur Tindak Pidana Ekonomi Khusus (Wadir Eksus) Bareskrim Polri, Kombes Pol Rahmat Sunanto dan Inspektur Bidang Investigasi Inspektorat Jenderal Kementerian Keuangan, Rahman Ritza memberikan keterangan kepada wartawan terkait kasus dugaan suap pajak di Mabes Polri, Jakarta, Selasa (22/10).

Rahmat Sunanto mengatakan, Berty menyuap demi mendapatkan restitusi pajak untuk perusahaan kertas tersebut. Berty juga ditangkap saat hendak mengirimkan dokumen di Jakarta. Dia kini mendekam di Rutan Bareskrim Mabes Polri. Rahmat menjelaskan, upaya suap sudah dilakukan sejak 2004. Saat itu, PT Surabaya Agung mengajukan restitusi (keringanan) atas pajak yang telah dibayarkan. Pada 2005 restitusi untuk PT Surabaya Agung cair sebesar Rp 21 miliar. Hampir bersamaan dengan cairnya uang tersebut, Berty mentransfer sejumlah uang ke rekening Totok dan Denok. “Jumlah suap dalam

rekening kedua tersangka totalnya Rp 1,6 miliar. Di rekening T (Totok) ada sembilan kali transaksi, sedangkan untuk D (Denok) ada tujuh transaksi,” urainya di Mabes Polri kemarin. Transaksi tersebut dilakukan antara 2005 sampai 2007. Rahmat menjelaskan, karena pasal utama yang disangkakan kepada kedua pegawai pajak itu adalah tindak pidana pencucian uang (TPPU), polisi segera melakukan asset tracing. Yakni, mencari aset-aset para tersangka yang pembeliannya diduga berasal dari TPPU. Saat ini, penyidik telah memeriksa sedikitnya 29 saksi ditambah empat saksi ahli di bi-

dang TPPU, pajak, dan tipikor. Sedangkan, untuk barang bukti, penyidik baru menyita beberapa dokumen. Di antaranya, dokumen ekspor-impor, dokumen transaksi keuangan, dan dokumen blokir transaksi. Ya, polisi memang memblokir rekening milik ketiga tersangka, yang menjadi sarana untuk menyuap. Sementara itu, Inspektur Bidang Investigasi pada Itjen Kemenkeu Rahman Ritza menyatakan, baik Totok maupun Denok sudah dipecat dari Ditjen Pajak. “Mereka sudah bukan lagi pegawai Ditjen Pajak sejak Desember 2012,” terangnya pada media. (byu/agm)

Pilwalkot Diprediksi Satu Putaran of error dalam survei ini sebesar dari halaman 1 4 persen. Kedua calon itu, Ikmal meraih dukungan 3,2 persen. dan Bunda Sitha bakal bersaing “Dari data yang didapat dalam ketat untuk memenangi Pilwalsurvei ketiga ini, dapat dipasti- kot yang akan digelar pada Mingkan Pilwakot Tegal terjadi dalam gu, 27 Oktober 2013 mendatang. satu putaran. Namun melihat “Namun kecenderungan untuk selisih suara pasangan calon memenangi Pilwakot ini ada panomor 1 sebesar 46,3 persen dan da pasangan calon nomor urut nomor 3 sebesar 44,3 persen yang 1,” jelasnya menambahkan. berarti tipis, maka keduanya Namun perlu diingat, bahwa memiliki peluang yang sama un- tingkat keyakinan responden tuk memenangi Pilkada,” papar dalam memilih pasangan calon Agus. hanya 88,6 persen. 11,4 persen Ditegaskan dia, bahwa margin lainnya belum yakin akan pili-

hannya tersebut. Sementara berdasarkan tingkat pengetahuan pemilih atas empat pasangan calon yang ada, pasangan Ikmal Jaya-Edy Suripno paling tinggi, yakni 70,2 persen. Disusul Siti Masitha SNursholeh sebesar 24 persen dan pasangan Muh Jumadi-Muh Wahyudi sebesar 3,8 persen dan pasangan Hendria PriatmananEndang Sutarsih sebesar 1,9 persen. Pada hasil survei responden terhadap tingkat kesenangan

kepada pasangan calon, tidak berbeda jauh dengan tingkat keterpilihan pasangan calon yang ada. Pasangan Ikmal Jaya-Edy Suripno meraih 46,7 persen. Disusul Siti Masitha S-Nursholeh sebesar 44,7 persen dan pasangan Muh Jumadi-Muh Wahyudi sebesar 5,4 persen dan pasangan Hendria Priatmanan-Endang Sutarsih sebesar 3,0 persen. Sedangkan dua persen responden menyatakan tidak menyenangi maupun memilih keempat pasangan calon yang ada. (tim)

ketua DPC Tegal), Bambang Susilo (mantan ketua DPC Blora), dan Tety Indarti (pelaksana tugas ketua DPC Wonogiri Saat ini Anas telah ditetapkan sebagai tersangka setelah penyidik mengantongi dua alat bukti yang terkait dengan dugaan penerimaan hadiah atau janji semasa dia menjadi anggota DPR pada 2009. Hadiah itu menyangkut proses penganggaran, perencanaan, dan pelaksanaan pembangunan proyek sport center Hambalang. Di luar kasus gratifikasi, KPK saat ini juga menyelidiki dugaan penggunaan dana proyek Hambalang untuk dana pemenangan Anas sebagai ketua umum dalam kongres Demokrat di Bandung pada 2010. Anas diduga juga menerima pemberian terkait proses pengadaan sarana dan prasarana Hambalang. Perkara itu juga tengah diselidiki KPK. Sehingga ada tiga perkara yang mungkin bakal dihadapi pendiri organisasi Perhimpunan Pergerakan Indonesia (PPI) itu. Adanya banyak dugaan keterlibatan Anas dalam penerimaan gratifikasi itu membuat KPK belum berencana menahan Anas. Kemungkinan tersangka Hambalang yang lebih dulu menyusul Andi Mallarangeng ke tahanan ialah bos PT Adhi Karya

Teuku Bagus Muhammad Noor. Meski begitu, Anas mengaku 1000 persen siap ditahan KPK. Pernyataan itu disampaikan Anas saat dia mengadakan diskusi di kediamannya Jumat lalu (18/10). Menurutnya siapa saja boleh disangka melakukan tindak pidana korupsi. Namun mantan Ketua KPU itu berpandangan, penyandangan status tersangka itu harus didasarkan atas bukti-bukti kuat bahwa orang tersebut memang layak dijadikan tersangka. Terpisah, Juru Bicara KPK, Johan Budi mengatakan pemeriksaan terhadap perkara yang membelit Anas terus dilakukan KPK. “Hampir setiap hari kan ada yang diperiksa. Tapi kalau urusan penahanan itu penyidik yang tahu kapan seseorang tersangka harus ditahan. Sebab penahanan itu ada batas waktunya,” ujar Johan. Terkait pemeriksaan Marzuki yang berjalan cepat tidak seperti saksi lainnya, Johan mengatakan mungkin tidak terlalu banyak informasi yang dibutuhkan penyidik dari penulis buku Marketing Politic itu. “Namun tidak menutup kemungkinan nanti kalau dibutuhkan lagi keterangannya, yang bersangkutan akan dipanggil lagi,” terang Johan. (gun)

Marzuki Ali Diperiksa KPK juga pernah memeriksa Andi dari halaman 1 Zulkarnaen Mallarangeng atau Meski begitu, Marzuki menga- Choel Mallarangeng sebagai sakku dirianya memang pernah si. Adik tersangka kasus Hammendengar perihatl aliran dana balang, Andi Alfian Mallarake partainya. Oleh karena itu dia ngeng itu diperiksa Rabu pekan menyampaikan ke penyidik bah- lalu (16/10). wa yang dia tahu hanya sekedar Ketika itu Choel mengaku didesas-desusnya saja. tanyai penyidik KPK dalam kaSaat ditanya perihal adanya pasitas dia sebagai tim sukses isu pembagian voucher yang pemenangan kakaknya, Andi diberikan kontraktor proyek Mallarangeng. Seperti diketahui, Hambalang, PT Adhi Karya, Mar- saat kongres 2010 itu Andi gagal zuki juga mengelak. “Saya tidak melaju ke putaran kedua. Perpernah menerima itu. Saya juga tarungan kemudian hanya metidak tahu voucher itu ada atau libatkan Anas dan Marzuki. tidak,” terang ,” ucap pria kelahirSelain Choel, sejumlah saksi an 6 November 1955 tersebut. diperiksa untuk Anas dalam kaitKabarnya PT Adhi Karya me- an penerimaan gratifikasi. Meremang sempat membagi-bagian ka antara lain adalah Ignatius gratifikasi untuk Anas dan se- Mulyono (anggota DPR), Angejumlah anggota DPR. Gratifikasi lina Sondakh (mantan anggota itu berupa voucher dengan no- DPR), M. Nazaruddin (mantan minal Rp 250 juta serta furniture. Bendahara Umum PD), Eva OmNah, furniture itulah diduga ter- pita (Sekretaris Fraksi Partai Demasuk yang disita dari rumah ang- mokrat), dan Neneng Sri Wahgota DPR, Olly Dondokambey. yuni (istri Nazaruddin). Di antara KPK memeriksa Marzuki yang empat saksi tersebut, Tri dan pertama kalinya pada hari ini. Dia Bambang mangkir dari panggilan. diperiksa sebagai saksi untuk Para loyalis Anas dalam kongmantan Ketua Umum Partai De- res lalu juga tak luput dari pememokrat, Anas Urbaningrum yang riksaan KPK. Beberapa mantan ditetapkan sebagai tersangka dan pimpinan dewan pimpinan atas dugaan menerima gratifi- cabang (DPC) Demokrat yang kasi terkait proyek Hambalang sempat dipanggil menjadi saksi. dan proyek lainnya. Mereka antara lain, Tri Dianto Terkait aliran dana ke Kongres (mantan ketua DPC Demokrat Partai Demokrat 2010 lalu, KPK Cilacap), Eko Kusnomo (mantan

Interupsi Dewan Jadi PR Sutarman dari halaman 1 untuk menetapkan Sutarman sebagai Kapolri terpilih. Anggota Fraksi PDI Perjuangan Rieke Diah Pitaloka membuka gelombang interupsi dengan menyoroti persoalan demonstrasi buruh yang menuntut pengupahan di Jawa Tengah. Menurut dia, berdasar instruksi presiden, Kapolri juga mendapat tugas dalam proses pengawasan. “Kami meminta Kapolri untuk bisa menjamin jangan sampai ada tindakan represif terhadap buruh,” tegas anggota Komisi IX

DPR tersebut. Interupsi Rieke itu mengundang anggota dewan lain untuk berbicara. Anggota Fraksi Partai Golkar Nudirman Munir mempersoalkan BlackBerry yang beroperasi di Indonesia sejak 2006, namun tidak membayar pajak. Dia berharap ada langkah yang dilakukan Polri, apalagi dengan rencana pembentukan Densus Antikorupsi. “Ini uang rakyat. Kami meminta Kapolri bisa memberikan perhatian dengan melakukan penyelidikan dan penyidikan,” kata Nudirman. Anggota Fraksi

PKS juga bersuara dengan menyoroti adanya surat edaran Kapolri yang melarang satpam dan petugas sekuriti berserikat. Dia meminta edaran tersebut dicabut karena bertentangan dengan kebebasan berserikat dan berkumpul setiap warga negara. Satu interupsi yang cukup menarik datang dari anggota FPKS Ansori Siregar yang meminta Sutarman memperhatikan praktik judi togel. Dia mengusulkan, mantan Kapolda Metro Jaya itu berkomunikasi dengan mantan Kapolri Sutanto yang dinilai cukup bisa menga-

tasi persoalan tersebut. “Segera berkomunikasi dengan Pak Sutanto bagaimana caranya memberantas judi togel itu,” katanya. Menurut Ansori, dalam kasus judi togel tersebut, ditengarai ada beking dari aparat sehingga menyulitkan pemberantasannya. Ditemui setelah penetapan, Sutarman menyatakan akan melakukan upaya penegakan hukum dengan profesional. Baik itu terhadap kasus korupsi, terorisme, narkotika, maupun kejahatan lain yang meresahkan masyarakat. (fal/c7/fat)

Bahasa Ibu Mulai Punah, Aksara ... Seoul. Bahkan, mereka langsung dari halaman 1 belajar di SNU. Kebetulan berterhadap salah satu budaya dari tepatan dengan musim dingin. Negeri Ginseng tersebut” Bah- Keduanya pun sangat tersiksa kan, aksara Korea sampai diman- dengan kondisi cuaca yang amat faatkan untuk menuliskan ba- dingin itu. Mereka juga bermasahasa suku Cia-Cia di Bau-Bau. lah dengan makanan Korea. Itu semua, rupanya, bermula “Kami terheran-heran dengan dari hubungan kerja sama antara musim dingin di sana. MakananPemerintah Kota Bau-Bau dan nya tidak ada yang cocok deKota Seoul, ibu kota Korsel. Dua ngan perut kami. Serbasusah pekota tersebut menyepakati nota nyesuaiannya pada awalnya,” kesepahaman yang menjadikan kenang guru 38 tahun itu. mereka sister city (kota kembar). Kesulitan beradaptasi terMenurut Abidin, salah se- sebut ternyata berlangsung agak orang perintis aksara Korea di lama. Bahkan, kawan Abidin Sorawolio, pada 2005 Wali Kota akhirnya tumbang. Dia tidak Bau-Bau (kala itu) Amirul Tamim kuat dengan cuaca dingin yang bertemu Prof Chun Thai Yun menusuk tulang. Bahkan, dia dalam Simposium Penaskahan tidak bisa makan hingga badanBudaya Internasional. Kepada nya kurus kering. Chun Thai, Amirul bercerita “Badannya sampai kurus sebahwa suku Cia-Cia di Bau-Bau kali. Melihat kondisinya, saya jadi terancam kehilangan bahasa ibu khawatir. Dia bilang, kalau terus mereka. Mereka juga tidak me- di Korea, dia bisa game (over),” miliki aksara untuk menuliskan kata Abidin. bahasa pergaulan masyarakat Kawan Abidin itu akhirnya itu. hanya bisa bertahan selama 45 “Mendengar soal bahasa Cia- hari. Jadilah Abidin sendirian di Cia tersebut, Prof Chun Thai Yun Korea. “Kalau dibilang ingin putertarik untuk mempelajarinya,” lang, ya memang ingin. Tapi, saya papar guru bahasa Inggris di SMA kasihan kepada Pak Wali Kota Negeri 6 Bau-Bau tersebut, Se- karena beliau yang merintis prolasa (22/10). gram itu. Saya tidak ingin memAncaman kepunahan bahasa buat malu wali kota,” papar ayah Cia-Cia itu kemudian dicerita- tiga anak tersebut. kan guru besar di Hankuk UniAbidin pun meneruskan penversity for Foreign Studies ter- didikan bahasa Korea-nya desebut kepada kawan-kawan aka- ngan segala upaya. Meski didemisinya di Korsel. Antara lain, ngin, dia makin giat dan antusias. seorang ahli fonetik di Seoul Na- Selain Prof Chun Thai Yun, guru tional University Prof Lee Ho besar Prof Lee Ho Young dari Young. Singkat cerita, setelah itu, SNU tampak sangat tertarik terDesember 2008, Prof Chun Thai hadap upaya pelestarian bahasa Yun mulai melakukan penelitian Cia-Cia. soal kebahasaan tersebut di KeJadilah Abidin sebagai salah camatan Sorawolio. seorang objek penelitian Lee Ho Berkat bantuan Prof Chun Young. Setiap minggu dia diminThai Yun, sebuah yayasan non- ta mengucapkan ribuan kata daprofit di Korsel, Hunmingjonge- lam bahasa Cia-Cia, lalu direum Institute, bersedia memberi- kam. Abidin juga membantu mekan beasiswa pendidikan ba- nerjemahkan ribuan kata bahasa hasa Korea selama enam bulan Cia-Cia ke dalam bahasa Inggris. kepada guru sekolah di Bau-Bau. “Akhirnya, dia beri kesimpulWali Kota Amirul pun diminta an bahwa bahasa Cia-Cia bisa mengirimkan dua guru asli Cia- menggunakan aksara Hangeul. Cia untuk belajar bahasa di Seoul Saya pun senang sekali kalau National University (SNU). bahasa Cia-Cia akan terdoku“Yang dipilih adalah dua guru mentasikan dan bisa dilestaribahasa Inggris, saya, dan seorang kan dengan aksara Hangeul,” teman dari SMA Negeri 1,” ujar paparnya. Abidin. Namun, Abidin sadar, aksara Pada 1 Desember 2008, Abidin Hangeul tidak bisa sepenuhnya dan kawannya sudah berada di diadopsi untuk bahasa Cia-Cia.

Karena itu, dia melakukan sejumlah penyesuaian. Dia menguraikan, aksara Hangeul memiliki 40 karakter yang terdiri atas 19 konsonan dan 21 vokal. Sementara itu, yang dinilai sesuai dengan bahasa Cia-Cia hanya 27 karakter. “Jadi, kami tidak mengadopsi, tapi mengadaptasi. Sebab, tidak bisa persis sama,” jelas Abidin. Guna memudahkan pelajaran aksara Hangeul untuk bahasa Cia-Cia, Abidin bersama Lee Ho Young (kawan Prof Chun Thai Yun) dan dibantu seorang asisten, Ho Young, membikin buku pelajaran bahasa Cia-Cia dengan aksara Korea tersebut. Karena itu, begitu kembali ke Indonesia pada 2009, Abidin langsung mengajar. Di SMA Negeri 6 Bau-Bau, Abidin mulai mengajarkan bahasa Korea kepada para siswa. Sementara itu, untuk pengajaran aksara Hangeul, dia menularkannya kepada para siswa di SD Negeri Karya Baru. Ternyata, setelah diperkenalkan, para pelajar, khususnya siswa SD Negeri Karya Baru, mudah menyerap pelajaran tersebut. Hanya dalam 2"3 pertemuan mereka sudah bisa membaca dan menulis bahasa Cia-Cia dengan aksara Hangeul. “Mungkin karena sehari-hari mereka terbiasa berbahasa CiaCia di rumah. Jadi, ada kemudahan buat anak-anak untuk proses transfer huruf Hangeulnya,” ujar Abidin. Setahun kemudian, permintaan dari berbagai sekolah berdatangan. Yakni, dari SD Negeri Bugi 1 dan SD Negeri Bugi 2 untuk diajari huruf Hangeul. Hal tersebut didukung penuh komunitas Cia-Cia yang bermukim di Kecamatan Sorawolio. Namun, Abidin mulai kewalahan karena dirinya juga memiliki jadwal mengajar full di SMA Negeri 6 Bau-Bau. Karena itu, dia pun menggelar pelatihan penulisan aksara Hangeul untuk bahasa Cia-Cia bagi beberapa guru SD dan SMP. “Saya mengajar mereka satu minggu dua kali pertemuan. Saya minta mereka membantu saya mengajar di sekolah-sekolah,” ujarnya. (ken/c5/ari/ )

Airin Bisa Susul Suami di KPK dari halaman 1 itu dilakukan untuk mengumpulkan barang bukti dan keterangan (pulbaket) perkara alkes di Dinas Kesehatan Tangsel. “Penyelidikan itu terkait pengadaan alkes tahun anggaran 2010 sampai 2012,” ujar Johan dalam konferensi pers di gedung KPK kemarin (22/10). Sayangnya, Johan tidak membeberkan detail penyelidikan tersebut. Alasannya belum mendapatkan informasi. “Soal nilai proyeknya berapa, saya juga belum diberi tahu,” ujar Johan. Johan menambahkan, penyelidikan itu dibuka setelah KPK mendapatkan informasi yang cukup akurat melalui pengaduan masyarakat (dumas). Menurut dia, setelah perkara tangkap tangan kasus suap dalam sengketa pilkada di MK yang melibatkan Akil Mochtar dan

Wawan, sejumlah informasi masuk melalui dumas. Seperti diketahui, Wawan ditetapkan sebagai tersangka lantaran diduga menyuap Akil Mochtar (ketua MK nonaktif ) sebesar Rp 1 miliar. Suap itu diduga berkaitan dengan sengketa pilkada Lebak, Banten, yang ditangani MK. Setelah penetapan Wawan sebagai tersangka, KPK menggeledah sejumlah perusahaan adik Gubernur Banten Ratu Atut itu. Perusahaan yang digeledah KPK, antara lain, terletak di Mega Kuningan, Jakarta, dan Serang, Banten. KPK menduga, Wawan dan istrinya memiliki sejumlah perusahaan yang kemudian terlibat dalam proyek-proyek infrastruktur di Banten. Terutama di kota-kota yang pemimpinnya merupakan dinasti Ratu Atut. Johan mengatakan, tidak tertutup kemungkinan istri Wa-

wan, Airin, akan diperiksa terkait dengan penyelidikan alkes tersebut. Sementara itu, dalam perkara suap sengketa pilkada di MK, KPK kemarin memeriksa istri Akil Mochtar, Ratu Rita. Perempuan yang diduga digunakan sebagai sarana pencucian uang yang dilakukan Akil itu tidak memberikan keterangan apa pun sesudah diperiksa sekitar pukul 15.00. Bahkan, sejumlah wartawan yang berupaya mewawancarai Rita sampai harus bersitegang dengan pengacaranya. KPK kemarin juga meminta keterangan kepada Wakil Bupati Lebak Amir Hamzah. Sesudah diperiksa, pria yang maju dalam pilkada Lebak bersama anggota DPR Banten, Kasmin, itu mengaku, antara lain, ditanyai penyidik tentang pertemuan Akil dan Wawan saat menonton F1 di Singapura. (gun/c1/agm)


CMYK

BISNIS

RABU, 23 OKTOBER 2013

8

RADAR TEGAL

Auto Rep, Body Repair & Oven Painting

Beri Solusi Pemilik Mobil ADIWERNA – Auto Rep, Body Repair&Oven Painting di Jalan Raya Singkil No 9, Adiwerna Kabupaten Tegal hadir memberikan solusi bagi pemilik mobil yang membutuhkan perbaikan body hingga pengecatan. Meski baru beroperasi di lokasi tersebut selama dua bulan sejak grand opening, tetapi sejumlah pelanggan terus berdatangan baik dari dalam maupun luar kota. HESTI PRASTYANI/ RADAR TEGAL

GORESAN WARNA - Peserta Goresan Warna untuk 31 Tahun Yogya Group serius mengikuti lomba mewarnai yang digelar Toserba Yogya Losari, Minggu (20/10) di Area Promosi Toserba Yogya Losari, Jalan Jendral Sudirman No. 21 Losari Kabupaten Brebes.

Toserba Yogya Losari

Peduli Kebutuhan Anak

USIA DINI

MEMASUKI usianya yang ke31, Yogya Group terus mempersembahkan yang terbaik untuk kebutuhan beragam generasi. Termasuk melayani kebutuhan anak-anak usia dini. Salah satu wujud kepedulian Yoyga Group kepada dunia pendidikan anak-anak usia dini, dengan menggelar Lomba Mewarnai ’Goresan Warna untuk 31 Tahun Yogya Group’ yang digelar Toserba Yogya Losari, Minggu (20/10). Event ini digelar Toserba Yogya Losari bekerjasama dengan Frisian Flag di Area Promosi Toserba Yogya Losari, Jalan Jendral Sudirman No. 21 Losari Kabupaten Brebes. Lomba yang ini diikuti oleh anak-anak usia 4 sampai 6 tahun ini pun menuai antusiasme masyarakat serta pengunjung Toserba Yogya Losari. ’’Di HUT Yogya Group yang ke31 ini, Toserba Yogya Losari berharap dapat senantiasa melayani kebutuhan setiap generasi. Termasuk melayani kebutuhan anak-anak usia dini,’’ tandas Customer Relations dan Promotion Staff Toserba Yogya Losari Saras Putri Utami kepada Radar. ’’Melalui lomba mewarnai ini, kami mencoba memperkenalkan nilai-nilai sportivitas dan semangat juang kepada anakanak,’’ lanjutnya. Lebih lanjut Saras mengatakan, peserta lomba mewarnai ini berjumlah 174 orang yang ber-

CMYK

HESTI PRASTYANI/ RADAR TEGAL

PEMENANG – Pemenang Lomba Mewarnai Goresan Warna untuk 31 Tahun Yogya Group berpose bersama pihak penyelenggara, usai penyerahan hadiah.

asal dari berbagai Taman KanakKanak (TK) dan Pendidikan Anak Usia Dini (PAUD) se-Kecamatan Losari. ’’Acara lomba mewarnai juga bertujuan untuk menyediakan media pembelajaran yang kreatif dan menyenangkan bagi anak, serta sebagai sarana terapi agar anak dapat menampilkan bakat, minat, serta kreativitasnya,’’ jelas Saras. Event ini pun mendapatkan respon positif dari tenaga pendidik dan orangtua siswa. ’’Acara lomba mewarnai seperti ini sangat bagus, karena dapat melatih kemandirian anak. Dan, menurut saya acara-acara seperti ini akan lebih baik jika

sering-sering diselenggarakan Toserba Yogya. Bukan hanya saat ulang tahun Yogya,’’ ungkap Iik, salah seorang guru PAUD Izzis Pangabean, Losari. Iik menyarankan agar Toserba Yogya Losari semakin memperluas area belanja agar peserta lomba dan pengunjung semakin nyaman berada di Toserba Yogya Losari. ’’Melalui lomba mewarnai seperti ini anak dapat berkreativitas, belajar mandiri, dan dapat dijadikan sebagai ajang bergaul atau bersosialisasi untuk anakanak dengan teman sebayanya,’’ ujar Muhmi, salah seorang orangtua siswa peserta lomba mewarnai. (hesti prastyani/iklan)

H

al ini diungkapkan oleh Husni Thamrin didampingi Yanto dari Auto Rep. Menurutnya, kehadiran Auto Rep diharapkan bisa lebih mendekatkan diri dengan masyarakat Slawi, Tegal, Brebes dan sekitarnya. Selain melayani pelanggan perorangan yang membutuhkan perbaikan body mobil hingga pengecatan dengan oven, Auto Rep juga menerima klaim perbaikan dari sejumlah asuransi ternama sehingga pemilik kendaraan bisa mendapatkan beragam kemudahan.

KUALITAS TERJAGA Auto Rep hadir dengan dukungan tenaga ahli serta peralatan modern untuk menjawab kebutuhan pelanggan. ROCHMAN GUNAWAN/RATEG

Dengan didukung peralatan modern dan canggih serta tenaga handal yang berpengalaman di bidangnya, setiap pekerjaan akan dilakukan dengan baik agar didapatkan sebuah hasil akhir yang memberikan kepuasan bagi pelanggan. Auto Rep juga memberikan garansi pengecetan selama 3 bulan serta kendaraan milik pelanggan yang membutuhkan perbaikan dapat diambil agar lebih memudahkan bagi me-

reka yang sibuk dengan aktivitas kerja. Dengan dibukanya Auto Rep di sini, maka persoalan akan perbaikan body mobil, pengecatan dan sebagainya diharapkan bisa terpecahkan sekaligus lebih dekat dengan konsumen. Dengan jam operasional mulai pukul 08.00 hingga 17.00 WIB, semua kebutuhan tersebut akan dilayani dengan profesional dan pelayanan yang ramah. (gun)


CMYK

RABU, 23 OKTOBER 2013

METROPOLIS RADAR TEGAL

Yuuuhhh

Nyoblos!!

27 Oktober 2013

4 HARI 47 HARILAGI LAGI

9

Tak akan Ubah DPT Pilwalkot WALAUPUN ada masukan terkait warga Kota Tegal, yang belum masuk Daftar Pemilih Tetap (DPT). KPU memastikan DPT Pilwalkot tak akan berubah. Karena telah ditetapkan 196.339 pemilih, melalui rapat pleno. Bagi masyarakat yang

tak terdaftar dalam DPT, tetap bisa menggunakan hak pilihnya, dengan memakai KTP. Menurut anggota KPU setempat, Arisandi Kurniawan SPd, pihaknya tak mengubah DPT Pilwalkot. Sebab sudah ditetapkan

melalui rapat pleno, tanggal 17 September 2013, dengan dihadiri KPU, PPK, Panwaslu, dan Forkompinda. Bahkan dinyatakan tak ada masalah. Kalau pun ada warga yang belum terdaftar dalam DPT, tetap bisa menggunakan hak

suaranya dalam pilwalkot, Minggu (27 Oktober 2013), tanpa mengubah DPT. “Penetapan DPT final. Kami tak akan mengubah. Bagi masyarakat yang tak masuk DPT, dapat menggunakan hak suaranya dengan

memakai KTP. Penggunaan hak suara di TPS terdekat, sesuai alamat dalam KTP. Waktu masyarakat masuk DPT, dari jam 12.00 sampai 13.00. Petugas KPPS bakal melayaninya.” ke hal 15 kol 1

ZUHLIFAR ARRISANDY/RADAR TEGAL ZUHLIFAR ARRISANDY/RADAR TEGAL

LAUTAN MERAH - Lapangan Buniwah, Bojong menjadi lautan merah saat ROJIKIN ber BUDI melakukan kampanye terbuka yang dihadiri 100 ribu lebih massa.

DUKUNG RIDHO - Pengasuh Pondok Pesantren AtTauhidiyah Cikura-Giren, KH Ahmad (tengah), mendukung penuh Rojikin-Budiharto menjadi bupati dan wakil bupati Tegal 2014-2019.

ZUHLIFAR ARRISANDY/RADAR TEGAL

PILIH ROJIKIN - Pengurus Pondok Pesantren AtTauhidiyah Cikura-Giren, KH Abdul Hamid, meminta warga tak ragu-ragu untuk memilih pasangan RojikinBudiharto, Minggu (27/10) mendatang.

CMYK

Zuhlifar Arrisandy/RADAR TEGAL

DIELU-ELUKAN MASSA - Calon Bupati Tegal Rojikin AH SE SH dielu-elukan 100-an ribu pendukungnya yang memadati Lapangan Buniwah, Bojong.


PEMALANG

10

RABU 23 OKTOBER 2013

RADAR TEGAL

NGENDONG

Cikungunya Serang Warga

Terapkan IHT DALAM rangka meningkatkan kualitas pendidikan dan sumber daya manusia utamanya untuk para guru, SMP Negeri 02 Randudongkal sudah mempersiapkan guru di tingkat sekolah tersebut dengan menerapkan In House Training (IHT) yaitu pelatihan implementasi kurikulum 2013. Pelatihan tersebut dimaksudkan agar para guru dapat memahami isi kurikulum 2013 kemudian mengimplementasikan dan diterapkan ke dalam kegiatan beDOK. lajar mengajar. Muhammad Mirzah SPd Sehingga adanya kurikulum tersebut dapat menjadikan guru agar lebih mengerti, memahami dan menjadi seorang guru yang berkualitas dalam dunia pendidikan. “IHT tersebut sudah 2 kali dilaksanakan dan akan terus ditindak lanjuti pada setiap Jumat,” ungkap Kepala SMP Negeri 02 Randudongkal Muhammad Mirzah SPd, Selasa (22/10). Guru yang professional memang diharapkan untuk setiap sekolah yang mampu untuk mengimplementasikan kurikulum tersebut, karena nantinya akan menggerakan serta menerapkan untuk siswanya dengan memberikan pelajaran dan ilmu pengetahuan. Salah satunya adalah guru sehingga adanya kurikulum tersebut tidak sia-sia dan tepat sasaran. “Sosialisasi IHT ini sangat dibutuhkan untuk para guru dan berperan penting untuk meningkatkan kinerja serta menjadi tenaga pendidik yang lebih baik lagi,” ungkapnya. Dia berharap, IHT yang dilaksanakan akan meningkatkan prestasi dalam dunia pendidikan dan kinerja guru yang berimbas pada peningkatan prestasi siswanya. Selain itu, diharapkan seorang guru juga bisa menjadi tenaga pendidik yang berkualitas dan professional. (maf)

PEMALANG - Puluhan warga Desa Wanamulya Kecamatan Pemalang terserang penyakit cikungunya. Penyakit akibat gigitan nyamuk itu menyebar ke sejumlah wilayah desa, bahkan hampir merata di tiga RT. Meskipun tidak memakan korban jiwa namun wabah penyakit tercebut cukup meresahkan bagi warga, karena terus menyerang warga. Ironisnya, meski kades setempat sudah melaporkannya ke Dinkes, namun terkesan tidak merespon sehingga langsung melapor ke bupati. Serangan penyakit cikungunya di Desa Wanamulya ini dibilang cukup parah, karena mewabah bahkan berjalan hampir sebulan. Sehingga banyak warga yang terserang penyakit tersebut. Banyaknya warga yang terjangkit penyakit itu membuat mereka tak berdaya, karena membuat badan dan seluruh bagian tubuhnya terasa sakit yang luar biasa. Salah satunya yang dialami keluarga Rustono baru ini, awalnya penyakit itu menyerang ibunya yaitu Sari menderita sakit. Saat itu badan terasa dingin dan panas serta terasa sakit di tubuh, utamanya di semua bagian persendian.

AGUS P/RADAR PEMALANG

TAK BERDAYA – Rustono, warga RT 6 Desa Wanamulya tergolek tak berdaya lantaran terserang cikungunya.

Namun dengan pengobatan tiga hari sembuh tiba-tiba istrinya Makhlikhatin juga ikut terserang penyakit tersebut bahkan gejala penyakit itu masih terasa. Setelah sejumlah anggotanya keluarganya terserang cikungunya, tiba-tiba Rustono sendiri yang juga anggota BPD desa setempat ikut terserang. Dengan kondisi yang sama seluruh badannya terasa sakit bahkan hingga saat ini belum sembuh dan membuatnya tak berdaya ter-

geletak diatas alas tidur. Munurutnya penyakit itu menyerangnya tiba-tiba. Awalnya, badan terasa dingin menggigil dan panas suhu badangnya. Selain itu semua bagian tubuh terasa sakit ketika dipengang dan tidak bisa bergerak karena tubuh terasa kaku serta kulit berbitik merah dan gatal Kondisi serupa sebelumnya dialami oleh sejumlah warga yang terserang cikungunya. Kebanyakan warga yang terserang rata-

rata dewasa dan satu diantaranya anak berumur sembilan tahun yaitu Firda Syaina warga RT 5. Kepala Desa Wanamulya Ribut Triyono mengatakan, warga desanya sedang dilanda keresahan adanya wabah penyakit cikungunya. Kejadian itu sudah berlangsung hampir sebulan. Berdasarkan pendataan yang telah dilakukan awalnya ada 60 orang yang menderita cikungunya, tersebar di tiga RT yaitu RT 5, 6, dan RT 8. Kondisi terparah di RT 6, karena hampir setiap rumahnya ada warga yang terserang cikungunya. “Namun hingga saat ini terus menyebar, sehingga jumlah korbannya terus bertambah,” katanya, Selasa (22/10) kemarin. Melihat keresahan warga desanya, pemerintah desa tanggap dan meloporkanya ke Dinas Kesehatan melalui Puskesmas Pembantu setempat. Namun upaya penanganan tidak kunjung dilakukan. Sehingga membuat warga desanya semakin resah. Menurutnya upaya penangan yang diinginkan oleh warga adanya tindak fogging atau penyemprotan di lingnkugan rumah warga. Namun ketika laporan masuk ke Dinas Kesehatan, justru dinilainya penyebaran wabah pe-

nyakit cikungunya merupakan hal yang biasa . Sehingga terkesan disepelekan tanpa adanya sebUah tindakan yang membuat tenang hati masyarakat. Karena warga semakin resah, akhirnya Kepala Desa Wanamulya yang pas kebetulan menghadiri Rapat Kordinasi Kepala Desa lansung melaporkannya kepada Bupati Pemalang dalam sebuah forum rapat tersebut. Dan masalah itu ditanggapi oleh bupati dan langsung memerintahkan kepada dinas terkait untuk segera menindaklanjut memberikan pencegahan melalui penyemprotan atau fogging. “Jawaban bupati tehadap laporan itu, membuat hati Kepala Desa Wanamulya merasa gembira dan lega karena tindakan cepat semacam itu sangat diharapkan oleh warga desanya. Perintah bupati untuk penyemprotan sesuai rencana akan dilakukan Kamis (24/11) mendatang," papar dia. Hingga berita ini diturunkan berdasarkan data terakhir warga Desa Wanamulya yang menderita penyakit cikungunya kurang lebih mencapai 96 orang. Diperkirakan jumlahnya akan terus bertambah, jika tidak segera mendapat penanganan. (apt)

Rekreasi Murah, Ya di Pantai

PENTOL RAH

AGUS P/RADAR PEMALANG

PIMPIN RAKOR – Bupati Pemalang H Junaedi memimpin langsung rakor bersama kepala desa di RM Bojongresto kemarin.

M RIDWAN/RADAR PEMALANG

JUARA TIGA – Rihadatul Aisyl (15), siswi SMP 7 Pemalang, berhasil meraih juara 3 dalam lomba karya tulis ilmiah di Sasana Bhakti Praja, Sabtu (19/10) lalu.

Ais Berhasil di Peringkat Tiga PEMALANG – Rihadatul Aisyl atau lebih sering dipanggil Ais, siswi kelas IX SMP Negeri 7 Pemalang berhasil meraih juara 3 lomba karya tulis ilmiah yang diselenggarakan Kantor Bappermas KB Kabupaten Pemalang di gedung Sasana Bhakti Praja, Sabtu (19/10) lalu. Ais adalah satu-satunya siswi yang dikirim mewakili sekolahnya untuk mengikuti ajang lomba karya tulis ilmiah tingkat SMP di Kabupaten Pemalang, dibanding sekolah lainnya yang mengirimkan lebih dari satu, tetapi akhirnya Ais memperoleh juara. Lomba penulisan dan pemaparan naskah tentang kesejahteraan dan pelrindungan anak dengan tema Mewujudkan Pemalang Kota Layak Anak di Bidang Pendidikan melalui Sekolah Ramah Anak tersebut diikuti oleh 24 siswa tingkat SMP se-Kabupaten Pemalang. “Kesannya ya buat pengalaman, karena sebelumnya belum pernah mengikuti lomba seperti ini,” kata Ais, Selasa (22/10) kemarin. Disampaikan Ais, sebelumnya memang belum pernah mengikuti lomba yang sama persis dilaksankaan bebarapa hari sebelumnya walaupun sudah pernah mengikuti jenis lomba yang lain. Motivasinya adalah untuk menambah pengalaman serta mencari teman disamping karena saran dan dorongan dari guru pembimbingnya. Materi tentang kabupaten Pemalang yang diwujudkan sebagai kota layak anak dengan sekolah ramah anak tersebut ia kumpulkan dari beberapa sumber, buku-buku, dan literature serta dari internet. Dengan bimbingan dari guru pembimbing akhirnya ia berhasil mempresentasikan hasil karyanya sendiri di depan juri. Dia berharap prestasinya bisa lebih meningkat dan bisa mengembangkan bakat dan kemampuannya. Terpisah Kepala SMP Negeri 7 Pemalang, Wiwik Sri Sutaminingsih SPd menyampaikan, sesuatu memang harus dilaksankaan secara optimal dan sungguh-sungguh. "Karena jika sungguh-sungguh maka akan memperoleh hasilnya, tetapi jika hanya asal maka akan sia-sia saja," papar dia. Disampaikan pula, anak-anak jangan ditarget harus memperoleh juara, yang penting jika sudah dilakukan secara optimal dan sungguh-sungguh apapun hasilnya harus disyukuri. "Dan seandainya tidak maka tidak akan menjadi beban bagi anak-anak tersebut," terangnya. (rid)

LINTAS 44 Desa Belum Bersekdes PEMALANG – Sedikitnya ada 44 desa di Kabupaten Pemalang masih mengalami kekosongan jabatan sekretaris desa (Sekdes). Sehingga Pemkab Pemalang saat ini sedang berupaya untuk segera melakukan pengisian sekdes yang di desa-desa tersebut. Sesuai hasil usulan dari pemerintah desa setempat. Terkait masalah Sekdes, Badan Kepegawaian Daerah (BKD) sudah melakukan pengisian sekdes di 15 desa. “Karena sekdes merupakan komponen di pemerintah desa sehingga harus bisa segera dipenuhi,” katanya. Dalam pelaksanaan teknis proses pengisian atau penempatan Sekdes idealnya sebelum ada penempatan agar dikonfirmasikan terlibih dulu dengan pihak kepala desa setempat, Sehingga diharapkan orang yang ditugasi menjadi Sekdes di desa itu sesuyai harapan dan akan dapat bekerjasama dengan baik. Kepala BKD Pemalang H Agung Puntodewo menjelaskan, proses pengisian Sekdes yang ideal itu di awali dari pemerintah desa untuk mengusulkan kepada Pemkab dengan persetujuan oleh BPD. Mengenai syarat –syaratnya juga harus dipenuhi. Menurut Agung Puntodewo, dari sejumlah usulan yang disampaikan oleh pemerintah desa yang masuk ada yang tidak memenuhi syarat. Seperti untuk syarat pendidikan minimal SLTA dan golongan II A. Soal tempat tinggal sekdes yang akan ditempatkan meskipun bukan warga setempat masih bisa ditolerir, asalkan masih dalam lingkup kecamtan setempat. (apt)

Bahas Pemerintahan Desa Ketika Bupati Rapat Koordinasi (Rakor) dengan Kepala Desa PEMERINTAH Kabupaten Pemalang bersama seluruh kepala desa dan lurah di dua eks-Kawedanan Pemalang dan Comal di RM Bojongresto, Selasa (22/10), menggelar rapat koordinasi (rakor) bersama. Rakor kali ini berbeda dengan biasanya, karena dilaksanakan di luar pendopo agar tidak terkesan kaku. Rapat dipimpin langsung oleh Bupati Pemalang H Junaedi didampingi Asisten I Setda Rifqi Jaya dan jajaran kepala dinas dan instansi Pemkab Pemalang lainnya termasuk seluruh camat di dua eks-kawedanan tadi. Bupati Pemalang H Junaedi menyampaikan, berbagai hal penting yang terkait dalam soal urusan pemerintahan. Pemerintahan, menurut bupati, adalah Pemeritahan Republik Indonesia, sehingga secara langsung pemerintahan itu mulai pemerintah pusat, provinsi, kabupaten hingga pemerintah desa. Artinya, bahwa kebijakan yang diambil oleh semua yang ada di pemerintahan itu harus nyambung dengan RPJMN, RPJMD Provinsi, RPJMD Kabupaten, dan RPJM Des. “Sehingga dalam melaksanakannya harus

satu dalam koridor yang utuh, tegak lurus dengan pemerintah pusat hingga desa dan itu sebagai acuan,”katanya. Rakor ini, lajut bupati, dalam rangka mensinkronkan dan suksesnya RPJMD Kabupaten Pemalang 2011-2016. Menyingung tentang suskses pembangunan, bahwa pembangunan akan sukses kalau semua dalam satu kata, satu barisan dan satu tujuan yaitu salah satunya adalah mengenai Pendapatan Asli Daerah (PAD). Karena jika dibandingkan dengan DAU dan DAK jauh tidak sebanding sebab hanya mencapai 7 persen. Bupati menjelaskan salah satu PAD yang ada adalah pajak bumi dan bangunan (PBB). Karena PAD Pemalang hanya 7 persen, padahal anggaran mencapi Rp 1,6 triliun maka hanya kurang lebih Rp 129 miliar untuk PAD Pemalang . “Sehingga apabila sudah otonomi penuh dan tidak ada lagi bantuan pusat maupun propinsi maka otonomi kita tidak akan berjalan,” jelasnya. Dalam kesempatan itu, bupati meminta kepada seluruh kepala desa untuk komitmen dalam rangka meningkatan PAD yaitu salah satunya PBB agar terus di dorong dan ditingkatkan. Mengingat kemampuan anggaran Pemkab Pemalang yang terbatas. Selain itu bupati juga meminta kepada camat untuk terus men-

dorong suksesnya PBB di wilayah kerjanya masing-masing karena salah satu evaluasi kinerja camat adalah bagaimana keberhasilan PBB nya dan keberhasilan itu sebagai tolak ukur dalam penilaian kinerja. Bupati menyebutkan hasil laporan kerja terkait PBB untuk Kecamatan Pemalang baru mencapai 64 persen, Taman 66 persen, Ulujami 62 persen, Bodeh 73 persen, Ampelgading 70 persen, Petarukan 54 persen dan Comal 68 persen. Sementara Asisten I Setda Pemalang Rifqi Jaya melaporkan permasalahan yang ada di pemerintahan desa yaitu masih banyaknya desa yang terlambat pencairan Alokasi Dana Desa (ADD). Hingga saat ini ada 89 desa yang terlambat mencairkan ADD dan 31 desa di antaranya belum mencairkan ADD-nya. Selain itu soal SPj yang juga belum selesai ada 6 desa. Dan banyak lagi masalah yang terjadi di desa termasuk masih banyak desa yang belum ada sekdesnya, masalah banyaknya tanah kas desa yang digunakan untuk sekolah impress belum ada gantinya dan msalah PBB yang juga masih banyak desa belum lunas pembayarannya. Acara rakor ini juga diisi dengan dialog interaktif, dalam acara dialog banyak kades yang menyampaikan aspirasi kepada bupati. (apt)

Kembangkan Proses Pembelajaran Menyeluruh RANDUDONGKAL - Sebagai sekolah yang sudah berstandar nasional SMP Negeri 02 Randudongkal terus meningkatkan upaya dalam rangka menuju sekolah yang lebih maju, baik di bidang akademik maupun non akademik. Tentunya harus didukung oleh semua komponen pendidikan baik dari para guru, masyarakat maupun orang tua dan dari siswa sendiri. Menurut Kepala SMP Negeri 02 Randudongkal Muhammad Mirzah SPd, adanya kelebihan yang dimiliki suatu sekolah bukan berarti harus berhenti sampai disitu melainkan memerlukan pengembangan yang lebih baik lagi. Sehingga menjadi se-

kolah yang mencapai kemajuan. “Masyarakat maupun anak kadang lebih memilih untuk bersekolah yang dibilang favorit, namun bukan berarti sekolah lain tidak diminati, pada kenyataanya justru sekolah tersebut memiliki punya banyak siswa,” ungkapnya, Selasa (22/10). SMP Negeri 02 Randudongkal mengalami peningkatan jumlah siswa setiap tahunnya dan saat sekarang tercatat ada 920 siswa, di mana jumlah tersebut diperkirakan akan terjadi peningkatan kembali. Hal ini menunjukan bahwa sekolah memiliki peminat yang banyak disamping adanya prestasi yang diraihnya antara lain pada lomba pramuka mau-

pun SH yang sering mendapat penghargaan. Selain itu juga banyak prestasi lain yang didapat terbukti dengan adanya beberapa piagam penghargaan yang terpajang di sekolah tersebut. Berbagai kedisiplinan juga diterapkan di sekolah tersebut yang diharapkan ada peningkatan yang signifikan berkaitan dengan penerapan budi pekerti dan pendidikan karakter seperti berbaris dan membaca asmaul husna selam 10 menit, doa sebelum kelas dimulai, salat dhuha, dan salat dhuhur berjamaah. Karena itu diharapkan masyarakat agar bisa memberikan kontribusi nyata. (maf)

BANYAK tempat-tempat wisata atau rekreasi dijajakan oleh para pengusaha wisata atau hiburan. Mereka menawarkan berbagai fasilitas yang ada mulai dari kolam renang, tempat mainan sampai dengan ruang bilas yang bersih dan berair panas. Semua itu diharapkan agar pengunjung bisa tertarik dan mau mengunjungi tempat wisata tersebut. Tidak masalah memang bagi masyarakat yang berkantong tebal, apapun fasilitas dan kelengkapan yang ada di tempat rekreasi, mereka berharap bisa seluruhnya menikmati dan melepaskan kepenatan setelah sebelumnya disibukkan dengan berabagai aktivitas pekerjaan yang mereka lakukan. Bagi yang berpenghasilan menengah ke bawah tentu lain lagi, mereka akan mengunjungi tempat rekreasi atau wisata yang sudah barang pasti disesuaikan dengan isi kantongnya. Sangat cocok bagi mereka dengan melakukan rekreasi di tempat-tempat sederhana seperti pantai. Dengan keindahan alamnya yang masih perawan, desiran angin sepoi-sepoi yang menerpa ke setiap pengunjung yang datang serta rindangnya pepohonan di sekeliling pantai dengan hamparan ombak putih yang menggulung-gulung menambah suasana menjadi indah dan menyenangkan. Dengan tatanan tempat duduk di pinggir pantai, sangat cocok bagi seseo-

rang yang sedang merenung dan melepas kepenatan. Sesekali anak-anak kecil berlari-lari di tepi pantai, diikuti oleh anak-anak yang lain dan juga seluruh keluarga turun ke pantai dan merendamkan kakinya ke dalam air laut, tidak lama juga ada yang berendam untuk mandi menambah kesegaran tersendiri bagi penikmatnya. Itulah gambaran tentang rekreasi murah dan meriah yang bisa kita temui di setiap pantai di wilayah kabupaten Pemalang. Dengan merogoh kocek beberapa ribu untuk karcis tanda masuk mereka sudah bisa masuk dan menikmati keindahan alam di pantai tersebut tanpa harus membayar dan mengeluarkan uang lagi untuk ini dan itu. Apalagi jika mereka membawa bekal sendiri dari rumah, suasana akan menjadi tambah ramai dan meriah. Yanti (21) misalnya, dengan membawa adik-adiknya ke Pantai R Jaka Tingkir Desa Nyamplungsari Kecamatan Petarukan, dia sudah merasa senang bisa terhibur sekaligus bisa mengajak adik-adiknya ikut berekreasi. Dia yang seorang karyawan sebuah perusahaan garment di Pemalang dengan menggunakan sepeda motor sengaja mengunjungi obyek wisata pantai tersebut untuk berekreasi bersama keluarga dan adik-adiknya. “Senang, tidak keluar banyak uang puas lagi,” kata Yanti. (rid)

M RIDWAN/RADAR PEMALANG

BERMAIN AIR – Salah satu keluarga sedang menikmati rekreasi alami murah meriah di Obyek Wisata R Jaka Tingkir Desa Nyamplungsari Kecamatan Petarukan.


RADAR BREBES

14

RABU 23 OKTOBER 2013

RADAR TEGAL

TELEPON PENTING RSUD Brebes

(0283) 671431

RSU Bhakti Asih

(0283) 671279 / 673481

RSIA Mutiara Bunda Tanjung Brebes

(0283) 877222

RS Dera As Syifa Banjarharjo Brebes

(0283) 889588/ 889548

Hotel Dedy Jaya Brebes

(0283) 673133 / 673158

RS Dedy Jaya

(0283) 672145/ 672525

PEMERINTAHAN Empat Desa Siap Gelar Pilkades PAGUYANGAN - Empat desa di Kecamatan Paguyangan bersiap melaksanakan Pemilihan Kepala Desa (Pilkades) yang akan digelar secara serempak pada bulan Januari 2014 mendatang. Empat desa tersebut masing-masing Desa Kedungoleng, Pakujati, Paguyangan dan Ragatunjung. “Seluruh desa sedang bersiap memulai tahapan pelaksanaan, di mana pembentukan panitia akan mulai dilaksanakan 4 hingga 6 November,” kata Kasie Pemerintahan Kecamatan Paguyangan, Drs Sutarko, Selasa (22/10). Dikatakan Sutarko, Pilkades akan digelar pada tanggal 6 Januari 2014 mendatang, seiring dengan habisnya masa jabatan Kades pada bulan Februari 2014, di samping juga mengisi kekosongan di beberapa desa, setelah Kades maju dalam pemilihan legislatif. “Tiga desa memang habis masa jabatanya pada 13 Februari, kecuali Desa Pakujati yang memang kekosongan karena Kades maju dalam Pemilihan Legislatif,” jelasnya. Tahapan dimulai dengan pembentukan panitia, dilanjutkan pendaftaran bakal calon (balon) mulai 18 hingga 25 November diikuti penetapan bakal calon menjadi calon kades dan undian nomor urut pada 16 Desember. “Memang dibutuhkan kerja keras dari panitia pelaksanaan, mengingat waktu pelaksanaan mulai dari tahapan hingga pengambilan suara terbilang cukup pendek yakni sekitar dua bulan. Namun kita berharap semua bisa berjalan dengan lancar,” ungkap Sutarko. Dia berharap pelaksanaan pilkades nanti akan memberikan hasil yang baik dan berdampak pada pembangunan desa, sesuai dengan harapan masyarakat. “Untuk itu kami tekankan kepada pelaksana pilkades, baik pantia maupun BPD agar mampu menjaga netralitasnya. Di antaranya dengan tidak mengikuti kegiatan dari masing-masing calon yang ada,” kata Sutarko. (pri)

AJIB AH...

HARVIYANTO/RADAR BREBES

MENYERAHKAN - Warga penerima program Prona di Desa Pebatan, Wanasari tengah menerima sertifikat dari Kantor Pertanahan Kabupaten Brebes yang dilangsungkan di kantor desa setempat.

Kantor Pertanahan Brebes Bagikan Sertifikat Prona BREBES - Kantor Pertanahan Kabupaten Brebes Senin (21/10) membagikan sertifikat kepemilikan lahan di Desa Pebatan Kecamatan Wanasari dari program Proyek Operasi Nasional Agraria (Prona) Tahun 2013. Secara simbolis penyerahan sertifikat diserahkan langsung oleh Staf BPN Brebes, Joko Sumarjono atas nama Kepala Kantor Pertanahan Kabupaten Brebes kepada warga penerima program dengan disaksikan langsung oleh PJs Kades Pebatan, Ali Rosidin. Staf Kantor Pertanahan Kabupaten Brebes, Joko Sumarjono kepada Radar menjelaskan, untuk saat ini penyerahan sertifikat dari program Prona sudah terus dilakukan. Di Desa Pebatan sendiri, lanjut dia, ada 200 bidang tanah yang sudah dibuatkan sertifikat dan sudah dibagikan kepada para pemiliknya. Sebelumnya, penyerahan sertifikat dari program Prona juga dilakukan di sejumlah desa penerima program. Di antaranya di Desa Gunung Sugih, Kecamatan Salem sebanyak 125 bidang yang dilakukan pada 28 September. Serta Desa Jagalempeni, Kecamatan Wanasari sebanyak 355 bidang yang dilakukan pada 11 Oktober 2013.“Penyerahan yang sama juga dilakukan di Desa Kalierang, Kecamatan Bumiayu sebanyak 213 bidang pada 17 Oktober kemarin,” terang Joko Sumarjono. Secara keseluruhan, tambah dia, pembuatan sertifikat Prona untuk tahun 2013 sudah hampir terselesaikan sesuai dengan target yang ada. Pjs Kades Pebatan, Ali Rosidi mengaku, warga di desanya sangat terbantu dengan adanya penerbitan sertifikat dari program Prona. Pasalnya, dengan adanya program itu warga di desanya kini sudah semakin menyadari dan mengerti terhadap arti pentingnya sertifikat kepemilikan lahan. Sebelumnya, pada tahun 2010 lalu didesanya juga mendapatkan program yang sama dengan kuota sebanyak 210 bidang. (har)

LELANG Pemkab Lelang Bibit Bawang BREBES - Pemkab Brebes melalui Dinas Pertanian dan Tanaman Pangan (DPTPH) setempat tengah melaksanaan pengadaan bibit bawang merah. Pengadaan tersebut dilakukan secara lelang di LPSE Kabupaten Brebes. Kegiatan ini terbilang langka dan baru pertama di Kota Bawang. “Besok (hari ini-red) pengumuman pemenang lelang untuk kegiatan pengadaan bibit bawang merah,” kata ketua LPSE Brebes, Drs Edy Kusmartono, Selasa (22/10). Dia mengungkapkan berdasarkan dokumen yang ada, pengadaan bibit bawang merah ini nilai pagu Rp 750 juta. Sejak dibuka hingga kemarin, sebanyak 26 rekanan telah mengajukan pendaftaran lelang, namun dari jumlah tersebut baru dua yang mengajukan penawarannya. “Untuk spesifikasi dan peruntukannya saya kurang tahu detail, karena itu kegiatan di Dinas Pertanian,” jelasnya. Kepala DPTPH Kabupaten Brebes Ir Budhiarso DH mengatakan, pengadaan bibit bawang itu merupakan tindaklanjut dari dari program pemerintah pusat berupa fasilitasi bantuan pengembangan kawasan bawang merah. Daerahnya dipilih menjadi daerah demplot untuk pengembangan agribisnis bawang merah di Indonesia yang dibiayai APBN di lahan seluas 50 hektare. “Volume yang dibutuhkan itu sekitar 50 ton bibit bawang merah. Nanti akan dijadikan projek percontohan bagi pengembangan agribisnis bawang merah, kami sudah menyiapkan lahannya di Kecamatan Bulakamba 25 hektare dan di Tanjung 25 hektare,” terang dia. (ism)

Setoran Raskin Nunggak Rp 4,7 M Kades Galau, Rakor Memanas BREBES - Setoran untuk pembagian beras untuk warga miskin (raskin) di wilayah Kabupaten Brebes ternyata macet di tengah jalan. Hingga bulan terakhir, sedikitnya Rp 4,7 milliar itu masih mandeg di tingkat desa. “Tunggakan untuk pembayaran raskin Kabupaten Brebes kepada kami itu mencapai Rp 4,7 miliar,” ujar Kepala Kasubdivre Bulog Pekalongan Iwan Nurwansyah saat rakor bersama Pemkab, aparatur hukum dan kades se Kabupaten Brebes di ruang OR Setda Brebes, Selasa (22/10). Berdasarkan data yang ada, tunggakan tersebut diakumulasi sejak bulan Agustus hingga sekarang dan nyaris merata di seluruh kecamatan. “Kami setiap bulannya mestinya Rp 3,9 M dari total beras yang terdistribusikan,” kata Iwan. Pemkab sendiri menghimbau kades untuk segera melunasi tunggakan tersebut. Jangan sampai uang setoran itu digunakan untuk kepentingan pribadi. “Program ini berhasil jika 6 indikator terpenuhi, tepat sasaran, tepat jumlah, tepat harga, tepat waktu, tepat administrasi, dan tepat mutu,” ingat Asisten II, M Iqbal sambil melanjutkan dengan penjelasan juklak dan juknis. Sementara itu, rakor sempat memanas. Berawal dari sejumlah keluhan kades yang masih mengkhawatirkan program raskin ini riskan menyeret ke ranah hukum seperti yang marak terjadi. Mereka berkeluh kesah terkait dengan beratnya beban tanggung jawab itu jika

ISMAIL FUAD/RADAR BREBES

RAKOR – Pemkab menggelar rakor dengan isntasi terkait, membahasa masalah raskin.

harus menuruti aturan yang ada. Mereka menganggap posisi kades dalam dilematika yang tinggi antara teori dan praktik, antara mengikuti aturan atau mengikuti kultur dan kondisi masyarakat-

nya. Antara hukum dan kondusivitas wilayah. Keluhan kades tersebut rupanya ditanggapi dingin oleh perawakilan Kejaksaan Negeri (Kejari) Brebes yang tetap mengharapkan semua realisasi

Petani Bersih-Bersih Irigasi SALEM- Puluhan petani dari sejumlah pedukuhan di Desa Ciputih, Kecamatan Salem menggelar kerj abakti membersihkan dan menata saluran irigasi maupun drainase jalan. Hal itu sebagai antisipasi menghadapi musim hujan agar saluran air tidak tersumbat akibat sampah maupun endapan meterial. Kegiatan warga tersebut dilakukan untuk menjaga kemungkinan tersumbatnya saluran oleh sampah. Selain itu warga juga melakukan pengerukan terhadap endapan lumpur yang selama ini terbawa air, serta meninggikan aliran sungai agar air bisa naik ke dalam saluran. “Kegiatan ini sebagai bentuk pemeliharaan lingkungan, serta mengatasipai kemungkinan terhambatnya pasokan air menuju sawah. Sehingga kita berupaya melakukan penataan di sepanjang irigasi mulai dari aliran sungai hingga ke areal pertanian,” kata Kades Ciputih, Slamet Becho, Selasa (22/10). Dikatakan, semenjak musim kemarau lalu beberapa titik saluran irigasi mengalami kerusakan. Untuk itu, bersama para petani kemarin pihaknya mengadakan

TEGUH SUPRIYANTO/RADAR BREBES

ANTISIPASI - warga dan petani tengah membersihkan saluran irigasi di wilayahnya untuk mengantisipasi terhambatnya pengairan menuju lahan.

kerja bakti.“Dengan adanya penataan ini diharapkan suuplay air ke areal pesawahan bisa lancar,” jelasnya. Selain mengadakan normalisasi saluran air, pemerintah desa juga senantiasa mensosialisakin kepada masyarakat untuk memperhatikan kondisi saluransaluran air di wilayah pemukimannya. Diharapkan dengan kondisi lingkungan yang terjaga,

maka akan meminimalkan kemungkinan terjadinya wabah penyakit. “Dengan memperhatikan dan menjaga kondisi lingkungan, diharapkan dapat terhindar dari kemungkinan yang terjadi sebagai dampak dari musim hujan. Sebab desa kami sendiri beberapa wilayah termasuk daerah rawan terjadi bencana longsor,” urainya. (pri)

TEGUH SUPRIYANTO/RADAR BREBES

Ratusan Usaha Tak Berijin BUMIAYU - Satuan Polisi Pamong Praja (Satpol PP) Kecamatan Bumiayu mengingatkan kepada para pelaku usaha atau pemilik tempat usaha untuk mengurus perijinan. Hal itu menyusul hasil temuan di lapangan, di mana hanya sebagian kecil pelaku maupun pemilik usaha yang memiliki perijinan tempat usaha baik ijin undang-undang gangguan (HO) maupun non HO. “Dari data yang ada di catatan kami, dari sekitar 200 usaha pertokoan yang ada di Bumiayu, hanya separo yang bisa menunjukan surat perijinan utamanya HO. Usaha Galian C juga sama, hanya 2 lokasi galian yang berizin dari belasan lokasi yang ada di

Jembatan Pemali Baru 80 Persen Kemacetan Kerap Terjadi

DIWARNING - Satpol PP mengingatkan kepada para pemilik maupun pengelola usaha di Kecamatan Bumiayu untuk mengurus perijinan.

Satpol PP Berikan Warning

berjalan sesuai aturan. Silang pendapat sempat memanas ketika terjadi kesalahpahaman antara penjelasan pihak Kejari dengan para kades dalam menginterpretasikan aturan. (ism)

Bumiayu. Terparah adalah jenis usaha Warnet, dimana dari 40 warnet, hanya 20 persen saja yang berijin,” jelas Kepala Satpol PP umiayu Farikin SH. Menurut dia, perijinan tidak hanya diberlakukan pada usaha berskala besar saja, namun usaha kecil juga membutuhkan adanya surat izin usaha perdagangan agar usaha yang dijalankan mendapatkan pengakuan dan pengesahan dari pihak pemerintah. “Ijin usaha merupakan legalitas yang dikeluarkan pemerintah, dengan memilikinya maka akan sangat berguna sebagai payung hukum jika terjadi masalah yang dapat mengganggu perkembangan usaha,” kata Farikhin. Dikatakan, ijin-ijin usaha pedagang dilakukan berkaitan dengan peraturan daerah (Perda). Untuk itu, pemilik usaha diimbau

tertib dalam administrasi dan perijinan. “Kita tindaklanjuti dengan imbauan yang dilakukan secara resmi melalui surat edaran, di mana isinya meminta kepada para pemilik usaha baik yang masa perijinannya sudah habis atau belum memiliki untuk segera mengurusnya,” jelas Farikhin. Menurutnya, mengurus ijin usaha merupakan sebuah kewajiban dan tanggung jawab sebagai warga negara yang baik dan taat hukum. Perijinan usaha telah diatur dalam undang-undang dan merupakan peraturan resmi dari pemerintah yang harus dijalankan oleh siapa pun. “Surat izin dari pemerintah tersebut dibutuhkan oleh pelaku usaha perseorangan maupun pelaku usaha yang telah berbadan hukum,” tandasnya. (pri)

BREBES – Perbaikan jembatan Pemali yang direncanakan selesai pada November mendatang, hingga kini baru selesai 85 persen. Pemasangan beton sebagai lantai jembatan sudah selesai, tinggal menyelesaikan penyambungan antarbeton dan selanjutnya pengaspalan. Supervisi Pengawasan Bina Marga Provinsi Jawa Tengah Awaludin ditemui di sekitar lokasi jembatan Selasa (22/10) mengakui pekerjaan jembatan Kali Pemali sudah sampai 85 persen. Sehingga dalam waktu dekat ini jembatan sudah bisa difungsikan sebagaimana mestinya. Untuk proses sejanjutnya, tambah dia, dalam waktu dua atau tiga hari mendatang akan dilakukan proses pengaspalan jembatan. Dengan demikian, ditargetkan pada awal bulan November nanti jembatan sudah bisa dilewati oleh kendaraan. “Insya Allah, awal bulan nanti jembatan sudah selesai dan bisa dilalui kendaraan,” ungkapnya. Sementara itu, akibat belum selesainya pekerjaan jembatan, kemacetan panjang kembali terjadi di jalur pantura Brebes. Kendaraan terjebak macet hingga ruas pantura Klampok, Kecamatan Wanasari. Untuk mengurangi kemacetan yang lebih panjang lagi, Satuan Lalu Lintas Polres Brebes akhirnya memberlakukan sistem buka tutup bagi

kendaraan yang akan melintas jembatan Kali Pemali dari arah barat maupun sebaliknya. Kasatlantas Polres Brebes,AKP Wahyudi SH Sik melalui Kanit Turjawali IPDA Heru Irawan SH ditemui di lokasi kemacetan Selasa mengatakan, padatnya kendaraan yang melintas dari arah Jakarta) membuat arus kendaraan menumpuk dan menyebabkan kemacetan cukup panjang. “Tadi kemacetan terjadi hingga sampai Klampok, Wanasari,” ujarnya. Untuk mengurai kemacetan itu, sejumlah personil Satlantas kemudian melakukan rekayasa jalan dengan memberlakukan sistem buka tutup dengan durasi waktu lama. Kendaraan yang melintas dari arah timur melalui Jalan Jendral Sudirman terpaksa distop untuk memberikan kesempatan kendaraan dari arah barat melintas terlebih dulu. Untuk menghindari kendaraan yang nyerobot saat diberlakukan sistem buka tutup, polisi kemudian menyilangkan kendaraan operasional patroli pantura di pertigaan Pasar Induk Brebes. Sejumlah kendaraan dari arah timur terpaksa harus bersabar untuk menunggu giliran melintas di jembatan Kali Pemali. Ia mengaku, terjadinya kemacetan lantaran saat ini masih ada aktifitas kerja terhadap perbaikan jembatan. “Saat ini pekerjaan tinggal menyambung beton jembatan,” tambah dia. (har)


TEGAL METROPOLIS

RABU 23 OKTOBER 2013

15

RADAR TEGAL

Master Limbad Hipnotis Masyarakat Kampanye Hj Bunda SithaKang Nur BERBAGAI atraksi mendebarkan, dipertunjukkan Master Limbad, di hadapan Pasangan Calon (Paslon) nomor urut 3, Hj Siti Masitha Soeparno-Drs HM Nursholeh MMPd, atau Hj Bunda Sitha-Kang Nur. Ketika kampanye terbuka, di lapangan kompleks GOR Wisanggeni Tegal, kemarin (22/10) siang. Mereka juga dihibur pementasan musik artis dari Semarang dan Cirebon. Master Limbad mempertontonkan atraksi memakan paku, dilanjutkan menguji kekuatan badan, serta mengangkat orang dengan kertas koran. Lalu memecah buah semangka berisikan stiker paslon nomor urut 3, Hj Bunda Sitha. Kemudian menyiram air keras, dan pertunjukan

M SAEKHUN/RATEG

UNJUK KEBOLEHAN - Master Limbad unjuk kebolehan, di hadapan puluhan ribu pendukung paslon nomor urut 3, Hj Bunda SithaKang Nur.

mengerikan yang membuat jantung berdebar-debar lainnya. Ribuan peserta kampanye paslon nomor urut 3, sengaja mendekat ke panggung, untuk bisa melihat atraksi langsung, yang dilakukan Master Limbad.

Selama ini, hanya dapat menyaksikan Master Limbad melalui televisi. Di hadapan puluhan ribu pendukung, Calon Wali Kota Tegal Hj Bunda Sitha menyatakan, misi Paslon ‘Tegal BERSINAR’ (BER-

sama hj bunda SItha dan kang Nur mengAbdi Rakyat), mengoptimalkan pelayanan pada masyarakat, dalam kerangka tata kelola pemerintah yang baik dan bersih (good and clean governance), serta bebas KKN, mewu-

judkan SDM berkualitas, berbudi pekerti luhur, dan bertakwa kepada Tuhan Yang Maha Esa. Selain mewujudkan perekonomian daerah yang berdaya saing, berbasis keunggulan potensi lokal, mewujudkan infra-

struktur memadai dan kelestarian lingkungan, untuk pembangunan beekelanjutan (sustainable development). Selain mewujudkan kesatuan sosial, ketentraman, dan ketertiban masyarakat, yang mendorong pemberdayaan dan partisipasi masyarakat. “Program prioritas kami, antara lain penerapan reformasi birokrasi, untuk mengoptimalkan sumber daya birokrasi, dalam pelayanan kepada masyarakat. Penerapan perencanaan dan penganggaran yang partisipatif, transparan, dan akuntabel. Kemudian peningkatan akses dan kualitas layanan pendidikan dan kesehatan, khususnya perluasan kesempatan memperoleh pendidikan formal dan nonformal, bagi warga kurang mampu.” Tak ketinggalan, tandasnya, pemberdayaan usaha mikro kecil dan menengah, sebagai pelaku ekonomi yang berperan pen-

ting dalam menggerakkan perekonomian rakyat. Peningkatan kepariwisataan berbasis potensi budaya local. “Penanganan lingkungan kumuh dan rumah tidak layak huni. Peningkatan ketersediaan infrastruktur berbasis kebutuhan masyarakat, serta masih banyak program prioritas yang bertujuan peningkatan kesejahteraan masyarakat,” papar Calon Wali Kota nomor urut 3, Hj Bunda Sitha. Lebih lanjut dia mengungkapkan, untuk bisa mewujudkan visi dan misi, serta program prioritas yang dicanangkan. Hj Bunda Sitha terus blusukan dan silaturahmi pada masyarakat, tokoh agama, tokoh masyarakat, tokoh pemuda, dan semua elemen. Tanpa ada komunikasi, program prioritas yang bakal dilaksanakan kurang mengena. Pihaknya tidak memiliki kepentingan apapun, kecuali mengabdikan diri. (hun)

Paslon Dilarang Bawa Massa Saat Istighotsah Akbar Pilwalkot

ABIDIN ABROR/RATEG

EMPAT JARI - Beberapa warga yang ditemui Paslon Hendria-Endang, menunjukkan empat jari tanda dukungannya.

Hendria-Endang Terus Galang Dukungan PASANGAN Calon Wali KotaWakil Wali Kota Tegal, Hendria Priatmana SE-Hj Endang Sutarsih SH, terus menggalang dukungan masyarakat. Dari pintu ke pintu, keduanya semangat menemui warga di berbagai kelurahan. Setelah sebelumnya menyambangi Kecamatan Tegal Barat. Hari berikutnya, paslon nomor empat tersebut, menemui masyarakat Kelurahan Sumurpanggang Kecamatan Margadana. Dari wilayah paling barat Kota Tegal, kedua pasangan calon melanjutkan kampanye di Kecamatan Tegal Selatan. Selanjutnya, Hendria-Endang silaturahmi kepada warga di Kecamatan Tegal Timur. Tepatnya Kelurahan Panggung dan Kelurahan Mangkukusuman. Kemarin (22/10), pasangan calon wali kota-wakil wali kota, menemui masyarakat di Kelurahan Randugunting. Di daerah yang menggunakan nama-nama burung, baik jalan maupun gang, maka Hendria Priatmana-Endang Sutarsih bersama tim kampanyenya, bertemu dengan warga setempat. Sambil bersilaturahmi, keduanya tidak lupa mohon doa restu dan dukungan. Dalam kunjungan di Kelurahan Randugunting, kedua pasangan calon menyerap aspirasi. Termasuk menemui

Dia menambahkan, sesuai hasil rapat pleno, jumlah DPT Pilwalkot ada 196.339 pemilih. Terdiri atas 97.935 laki-laki, dan 98.404 perempuan. Jumlah itu tersebar di 27 kelurahan serta 4 kecamatan. Sesuai data, DPT Pilwalkot Kecamatan Tegal Selatan 46.651. Meliputi laki-laki 23.268, dan perempuan 23.383, jumlah TPS ada 99. DPT Kecamatan Margadana ada 44.353. Terdiri dari laki-laki

M SAEKHUN/RATEG

RAPAT KOORDINASI - KPU bersama sekretariat menggelar rapat, mempersiapkan istighotsah akbar dan salat tasbih berjamaah.

atau parpol, masuk ke dalam Masjid Agung, mengikuti istighotsah akbar serta salat tasbih berjamaah. Kami berkoordinasi dengan aparat kepolisian, disamping menyiapkan petugas di pintu masuk,” imbuhnya. Lebih lanjut dia menjelaskan, tujuan acara tersebut supaya pilwalkot berjalan lancar, aman, tanpa kendala apapun. Maka KPU minta semua pihak, termasuk paslon supaya menaati aturan yang disiapkan. “Jangan sampai ada massa salah satu paslon masuk, dan membuat suasana kurang nyaman. Karena kami sedang berdoa. Sehingga memerlukan kekhusukan,” papar Saefur Rokhim. Dia menguraikan, istighotsah, pembacaan Asmaul Husna, istighfar, Rotib Al-Hahad, Al-Athos dan dilanjutkan salat tasbih berjamaah, dipimpin serta diimami langsung oleh Habib Thorir Al Kaff. Pembacaan Surat Yasin dipimpin Ketua KPU KH Saifu-

din Zuhri Madrais SAg, diikuti semua peserta istighotsah akbar maupun salat tasbih berjamaah. “Kami targetkan peserta sekitar lima ribu orang. Karena diikuti penyelenggaran pemilu dan masyarakat. Kami berharap, doa yang dipanjatkan terkabul.” Di tempat sama, Ketua KPU KH Saifudin Zuhri Madrais SAg menjelaskan, disamping istighotsah akbar dan salat tasbih berjamaah, pilwalkot berlangsung lancar, aman, tanpa ada kendala apapun. Sehingga pesta demokrasi terlaksana dengan sukses tanpa ekses. Maka berbagai upaya bakal ditempuh KPU. “Kami akan berusaha maksimal, agar suasana kondusif. Kami mengimbau pada paslon dan tim kampanyenya, menjaga kondusifitas. Jangan mudah terpancing isu-isu, yang membuat suasana panas. Masalah dapat diselesaikan dengan musyawarah, demi terwujudnya pesta demokrasi lancar dan aman.” (hun)

’Bejo’ dan ’Candi Ngempon’ Jawara

ABIDIN ABROR/RATEG

DUKUNGAN - Tim Kampanye Hendria-Endang, mengingatkan warga agar mendukung paslon nomor urut empat, pada Pilwalkot Tegal, Minggu (27 Oktober 2013).

warga yang sedang sakit prostat. Prihatin atas penderitaan yang diderita, Calon Wakil Wali Kota Hj Endang Sutarsih, meminta anggota timnya membawa ke rumah sakit. Selanjutnya, Hendria-Endang meneruskan perjalanan ke lokasi lain. Setiap warga yang ditemui, baik di gang kecil atau pinggir jalan, pasangan ini tidak lupa bersalaman mohon dukungan. Selama kunjungan, anggota tim kampanye menggunakan megaphone, tak lupa mengingatkan masyarakat untuk memilih paslon nomor urut

empat. “Ibu-ibu.... Jangan lupa dengan pasangan nomor empat, yang akan membawa Kota Tegal lebih bermartabat.” Berdasarkan pengamatan Radar, selama berkunjung ke sejumlah tempat, tidak sedikit warga meminta kaos, dan ada yang mengira mau bag-bagi amplop. Dijelaskan anggota tim, kedatangan mereka tidak untuk itu. Namun semata-mata bersilaturami dengan warga. “Katanya tak kenal tak sayang. Kami sengaja datang ke rumah ibu, sekaligus memperkenalkan diri,” tutur Hendria.

Mendengar penjelasan sang calon wali kota, seorang ibu menyambutnya penuh hangat, dan mempersilakan kedua pasangan calon kepala daerah, bertandang ke rumah warga. Atas permintaan warga, Hendria-Endang bertandang ke rumah mereka. Seperti kunjungan di kelurahan lain, kedua pasangan calon tersebut, banyak menerima aspirasi. Menurut Hendria, kunjungan menemui masyarakat di berbagai pelosok kelurahan merupakan pilihannya. (din)

Tak akan Ubah DPT Pilwalkot dari halaman 9

WALAUPUN mengundang pasangan calon (paslon) wali kota-wakil wali kota, yang bakal mengikuti pilwalkot. Namun paslon dilarang membawa massa pendukung, ketika istighotsah akbar, dan salat tasbih berjamaah, yang digelar KPU, Jumat (25/10) malan, di Masjid Agung Kota Tegal. Menurut Divisi Sosialisasi, Hubungan Partisipasi Masyarakat, Data Informasi, Pendidikan Pemilih, dan SDM KPU, Saefur Rokhim, agar pilwalkot berjalan lancar, aman, dan tanpa kendala apapun. Sehingga pelaksanaannya sukses tanpa ekses. Sebelum pencoblosan, KPU berkerja sama dengan Jamiyah Rotibayen pimpinan Habib Thohir Al Kaff, akan membuat acara istighotsah dan salat tasbih berjamaah. “Paslon wali kota-wakil wali kota akan diundang. Tapi tidak boleh membawa massa. Selain dilarang menggunakan atribut paslon ataupun parpol. Selama kegiatan tersebut, paslon akan bergabung bersama masyarakat.” Dia menambahkan, selain warga Kota Tegal, dalam acara itu dihadiri penyelenggara pemilu. Baik KPU bersama sekretariatnya, PPK, PPS, dan KPPS. Termasuk Forum Komunikasi Pemerintah Daerah (Forkompinda). Untuk bersama-sama berdoa, berzikir kepada Allah SWT, demi kesuksesan pilwalkot. “Kami akan tegas melarang massa paslon maupun masyarakat, yang memakai atribut paslon

23.268, perempuan 23.383, dan jumlah TPS 92. DPT Kecamatan Tegal Barat 44.353, terdiri atas laki-laki 22.419, perempuan 21.934, serta jumlah TPS 102. DPT Kecamatan Tegal Timur 57.125, terdiri dari laki-laki 28.208, perempuan 28.917, dan jumlah TPS 127. “Kami telah melantik KPPS, yang akan bertugas di 420 TPS. Tersebar di semua Kota Tegal. KPPS akan memulai pencoblosan jam 07.00, dan berakhir jam 13.00. Masyarakat yang datang lebih dari jam 13.00, bakal

ditolak, dan tidak bisa menggunakan hak pilihnya,” tutur Arisandi. Secara terpisah, Divisi Hukum dan Kampanye KPU, Agus Wijanarko SH mengungkapkan, pihaknya telah berkoordinasi dengan rumah sakit, terkait penggunaan hak bagi karyawan RSU, yang sedang betugas. Disamping pasien dan keluarganya di rumah sakit, ketika hari pencoblosan pilwalkot, Minggu (27/ 10) besok. Pihaknya mengimbau, supaya karyawan, pasien,

dan keluarganya yang akan menggunakan hak suaranya, membawa formulir C6 atau surat undangan. “TPS terdekat rumah sakit akan proaktif, agar dapat menggunakan hak suaranya. Kami akan maksimal, supaya tingkat partisipasi pemilih pilwalkot maksimal. Sehingga petugas KPPS yang terdekat di rumah sakit akan proaktif. Asalkan yang bersangkutan membawa formulir C6 atau surat undangan,” paparnya. (hun)

FILM dokumenter berjudul ‘Candi Ngempon’ dan film fiksi bertajuk ‘Bejo’ dinobatkan sebagai juara dalam ajang Festival Film Tingkat Jateng 2013. Pengumuman pemenang ajang bergengsi ini digelar di Aula Puspita Poltran Kota Tegal, Senin (21/10) malam kemarin. Hadir dalam malam penganugerahan penghargaan festival film se-Jateng antara lain, perwakilan Dinas Kebudayaan dan Pariwisata (Dinbudpar) Jateng. Kemudian Plt Kepala Dinas Pemuda Olah Raga Seni Budaya dan Pariwisata (Disporabudpar) Kota Tegal, Mohammad Ali Rosyidi. Kepala Dinas Pendidikan (Disdik) Kota Tegal serta sejumlah tamu undangan lainnya. Menurut Kasi Perfilman Bidang Budaya Dinbudpar Jateng, Agus Kristianto Sos, ada 102 karya fil yang masuk dalam ajang ini. Dari jumlah total tersebut muncul sebagi nominasi film dokumenter terbaik sebanyak 6 judul. Di antaranya ‘Petuah Terpendam dari Batu yang Diam’, ‘Gugur Gunung’, ‘Candi Ngempon’, ‘Air’, ‘Mandiling Surya Muda’, dan ‘Trasa Ning Ati’. Sedangkan nominasi fil fiksinya antara lain ‘Bejo’, ‘Dakocan’, ‘Kunci Bengkel’, ‘Copet’, ‘Mengejar Mimpi’, dan ‘Budaya Gila Budaya’. “12 judul film inilah yang lolos menjadi nominasi dari seluruh karya yang masuk.” Setelah dilakukan penjurian terakhir, sambung dia, fil dokumenter berjudul ‘Air’ menjadi juara harapan III. Juara harapan II diraih film ‘Petuah Terpendam dari Batu yang Diam’ dan harapan I ‘Mandiling Surya Muda’. Untuk juara pertamanya diraih

ADI MULYADI/RATEG

TERIMA PENGHARGAAN – Para perwakilan juara festival film tingkat Jateng menerima penghargaan dari penyelenggara.

film ‘Candi Ngempon’, juara II ‘Trasa Ning Ati’ dan juara III ‘Gugur Gunung’. “Narator terbaiknya dari film ‘Gugur Gunung’. Penata kamera dan sutradara terbaiknya dari film ‘Candi Ngempon’,” jelasnya. Selanjutnya pemenang film fiksi berjudul ‘Bejo’, juara II ‘Dakocan’ dan juara III ‘Kunci Bengkel’. Juara harapan III ‘Budaya Gila Budaya’, harapan II ‘Mengejar Mimpi’ dan harapan I ‘Copet’. Untuk sutradara terbaik dari film ‘Bejo’ serta penata kamera terbaik dari film ‘Dakocan’. Lebih jauh disampaikan, maksud kegiatan ini adalah sebagai tolok ukur perkembangan film di Jateng. Meningkatan kreartivitas penggiat film di Jateng serta merupakan ajang silaturahmi insan perfilman. “Tujuannya antara lain untuk memberi penghargaan hasil karya dan peningkatan apresiasi penggiat film. Selain itu juga mengangkat budaya lokal lewat film. Total hadiah

yang diperebutkan Rp 67,5 juta serta piala dan piagam.” Sementara itu, Plt Disporabudpar Kota Tegal, Mohammad Ali Rosyidi menuturkan, ini merupakan hajat dari Propinsi. Kota Tegal menjadi tuan rumah pelaksanaan penganugerahan penghargaannya. Selain itu, juga sebagai lanjutan dari pelatihan sinematografi yang telah dilaksanakan beberapa hari lalu, untuk mengajak pelajar ikut membuat film. “Tingkat kota, festival film pelajar puncaknya digelar 19 November mendatang. Kegiatan ini juga menjadi momen inspirasi untuk kemajuan perfilman Kota Tegal.” Perwakilan tim pembuat film dokumenter ‘Candi Ngempon’, Lutfi kukuh Prasetyo mengatakan, ide pembuatan film ini dari seorang teman yang menceritakan adanya sebuah candi yang belum banyak dikenal masyarakat di Semarang. (adi)


ADVERTORIAL

RABU 23 OKTOBER 2013

16

RADAR TEGAL

LAUTAN MANUSIA - Puluhan ribu pendukung paslon nomor urut 3, Hj Bunda Sitha-Kang Nur, memadati lapangan kompleks GOR Wisanggeni Tegal

Kampanye Terbuka Paslon Hj Bunda Sitha-Kang Nur

M SAEKHUN/RATEG

ORASI POLITIK - Calon Wali Kota Tegal nomor urut 3, Hj Bunda Sitha, menyampaikan orasi politik, di hadapan puluhan ribu pendukung.

PULUHAN ribu masyarakat, yang memadati lapangan GOR Wisanggeni, sejak awal kampanye dimulai, mengeluelukan kehadiran tokoh wanita, yang siap melakukan perubahan untuk Kota Tegal. Jeritan dan tangisan histeris peserta kampanye, yang mayoritas kaum wanita, begitu menggelegar ketika kampanye Pasangan Calon (Paslon) nomor urut 3, Hj Siti Masitha SoeparnoDrs HM Nursholeh MMPd, atau Hj Bunda Sitha-Kang Nur, kemarin (22/10) siang. Sejak pukul 12.30, ribuan orang berdatangan memadati lapangan GOR Wisanggeni. Sambil menantikan kedatangan paslon nomor urut 3, Hj Bunda Sitha-Kang Nur, masyarakat yang sudah memadati lokasi, dihibur dengan pementasan musik serta atraksi Master Limbad. Terikan dukungan untuk melakukan perubahan, terus dipekikkan tim kampanye, diikuti puluhan ribu warga yang berasal dari 27 kelurahan. Tepat pukul 13.45, paslon nomor urut 3, Hj Bunda Sitha-Kang Nur, memasuki lapangan komplek GOR Wisanggeni. Ikut mengiringi kedatangan Bunda Sitha, irama musik drum band, rebana, serta ratusan Tim Kampanye ‘Tegal BERSINAR’ (BERsama hj bunda SItha dan kang Nur mengAbdi Rakyat). Jeritan dan tangisan histeris para ibu,

memecah suasana kampanye terbuka, menyambut kedatangan Hj Bunda Sitha dan Kang Nur. Mereka langsung bergegas mendekati tokoh wanita, yang siap melakukan perubahan Kota Tegal ke arah lebih baik. Sebelum naik ke atas panggung, Bunda Sitha dan Kang Nur, menyempatkan keliling dan bersalaman dengan puluhan ribu pendukung, yang menyatakan siap memenangkan dalam Pilwalkot Tegal, Minggu (27 Oktober 2013). Selanjutnya, kedua paslon langsung naik ke atas panggung, menyampaikan orasi politiknya. Di hadapan puluhan ribu pendukung paslon nomor urut 3, Koordinator Divisi Kampanye Tim Pemenangan Tegal BERSINAR, Drs A Firdaus Muhtadi memaparkan, kehadiran Hj Bunda Sitha dan Kang Nur, semata-mata melakukan perubahan Kota Tegal ke arah lebih baik. Sebab niat awalnya mengabdi kepada masyarakat, dan beribadah kepada Allah SWT. Keduanya bertekad melakukan perubahan Kota Tegal ke arah lebih baik. Itu bukan sekadar janji, namun akan dibuktikan setelah dipercaya memimpin. “Kami mengajak pada masyarakat untuk melakukan perubahan, dengan mencoblos paslon nomor urut 3, Hj Bunda Sitha-Kang Nur, pada pilwalkot, Minggu (27 Oktober 2013),” papar Firdaus. Calon Wakil Wali Kota Tegal, Kang Nur menandaskan, sudah saatnya masyarakat memiliki pemimpin amanah, dan siap mengabdi pada masyarakat.

Jangan mau dijejali dengan janji-janji. Nyatanya tidak ada yang terealisasi. Sehingga harus memilih calon pemimpin, siap melakukan perubahan Kota Tegal ke arah lebih baik. Hal itu hanya ada pada paslon nomor urut 3, Hj Bunda Sitha-Kang Nur. “Kami mengajak masyarakat mencoblos paslon nomor urut 3, demi terwujudnya perubahan Kota Tegal ke arah lebih baik,” paparnya. Di tempat sama, Calon Wali Kota Hj Bunda Sitha, d ihadapan puluhan ribu pendukungnya, berjanji mengabdikan jiwa dan raganya, untuk masyarakat Kota Tegal, demi terwujudnya perubahan ke arah lebih baik. Dirinya bersama Kang Nur bukan untuk menjadi penguasa. Tapi pemimpin masyarakat. Sehingga akan menjadi abdi atau pelayan, bukan malah dilayani. “Kami sudah siapkan program prorakyat. Bila dipercaya memimpin untuk 5 tahun ke depan. Jangan gadaikan nasib masyarakat, hanya karena tergiur janji-jani ‘palsu,’ dan sudah terbukti. Kami mengajak masyarakat untuk mencoblos paslon nomor urut 3, Hj Bunda Sitha-Kang Nur, untuk terwujudnya perubahan,” tegasnya. Salah seorang peserta kamapanye, Dariyah (39), menyatakan dukungannya pada Hj Bunda Sitha-Kang Nur, demi terwujudnya perubahan Kota Tegal menjadi lebih baik. “Saya memilih Hj Bunda Sitha-Kang Nur bukan tanpa alasan. Saya ingin perubahan yang lebih nyata untuk masyarakat.” (hun/adv)

M SAEKHUN/RATEG

M SAEKHUN/RATEG

M SAEKHUN/RATEG

ORASI POLITIK - Calon Wakil Wali Kota Tegal nomor urut 3, Kang Nur, menyampaikan orasi politik, di hadapan puluhan ribu pendukung.

SIAP MEMENANGKAN - Puluhan ribu pendukung paslon nomor urut 3, Hj Bunda Sitha dan Kang Nur, yang mengikuti kampanye terbuka menyatakan siap untuk memenangkannya.

SALAMI PENDUKUNG - Calon Wali Kota Tegal nomor urut 3, Hj Bunda Sitha menyalami pendukungnya.

M SAEKHUN/RATEG

M SAEKHUN/RATEG

M SAEKHUN/RATEG

BEREBUT SALAMAN - Para pendukung Hj Bunda Sitha-Kang Nur, berebut untuk bersalaman, ketika keduanya memasuki lapangan GOR Wisanggeni.

HIKMAT - Paslon nomor urut 3, Hj Bunda Sitha-Kang Nur, dengan hikmat menyanyikan Indonesia Raya, pada awal kampanye terbuka.

HIBUR PENDUKUNG - Paslon nomor urut 3, Hj Bunda Sitha-Kang Nur, menghibur puluhan ribu pendukungnya saat kampanye terbuka.

CMYK


RABU 23 OKTOBER 2013

ADVERTORIAL

17

RADAR TEGAL

Rojikin Siap Sejahterakan Tegal TEH Poci Gula Batu, Ayo Pilih Nomor Satu... Tahu Pletok Tahu Aci, Paling Cocok Nomor Siji... Itulah jargon yang diteriakan massa, pendukung, dan simpatisan ROJIKIN ber BUDI setiap kali bertatap muka. Selain dirasa pas, parikan khas Tegalan itu cukup signifikan untuk membangkitkan semangat memenangkan Pasangan Calon (Paslon) Bupati dan Wakil Bupati Tegal, H Rojikin AH SE SH dan H Budiharto SH MM yang dijagokan PDI Perjuangan. Semangat Tegalan itu pulalah yang ingin dibangun Rojikin dan Budiharto untuk memenangkan perhelatan, Minggu (27/10) mendatang. Bagi Rojikin, kesejahtraan masyarakat Kabupaten Tegal adalah di atas segala-galanya. Cita-cita itu sejalan dengan perjuangan marhaenisme yang lebih dari 21 tahun diperjuangkan Rojikin. Kendati begitu, Rojikin tidak lalu melupakan sisi lainnya utamanya bidang keagamaan. Misalnya, untuk menjamin pendidikan agama Islam dari dini, Rojikin dan Budiharto yang akrab disapa RIDHO akan memberikan insentif kepada guru paud, TPQ, dan madrasah diniyah. Kecuali itu juga menempatkan madrasah diniyah sebagai bagian penting dalam sistem pendidikan di Kabupaten Tegal dengan menghargai kelulusannya untuk melanjutkan ke jenjang pendidikan berikutnya. Selanjutnya, papar Rojikin, keduanya siap memfasilitasi para dai untuk melakukan syiar agama secara terpadu dan proporsional serta mengembangkan wisata religi dan sejarah di Kabupaten Tegal. Ini pula yang menyebabkan keduanya mendapatkan dukungan penuh dari Pengasuh Pondok Pesantren At-Tauhidiyah Cikura-Giren, KH Ahman Bin Armia. Selain dikenal sebagai santri Cikura-Giren, baik Rojikin dan Budiharto siap memnagun ukhuwah lebih erat lagi dengan para kiai serta kalangan umat beragam lainnya di Kabupaten Tegal. Di bidang pemberdayaan perempuan, Ridho siap memberikan kesempatan yang sama bagi kaum perempuan untuk berperan dan berpartisipasi aktif dalam pembangunan daerah. Juga memberikan ruang yang cukup untuk meningkatkan pengetahuan dan kapasitas pendidikan kaum hawa di Kabupaten Tegal yang jumlahnya lebih banyak dari laki-laki. Tak lupa bidang lingkungan hidup termasuk salah satu bidikan program yang akan ditata Rojikin dan Budiharto lima tahun ke depan. Di antaranya adalah melakukan upaya pencegahan perusakan lingkungan dengan membuat perda perlindungan lingkungan hidup. Upaya yang mendesak juga akan dilakukan yakni penghijauan lahan kritis, membuat hutan kota, ruang terbuka hijau, dan gerakan kali bersih. Bidang-bidang utama di atas menjadi bidikan tatanan ROJIKIN ber BUDI untuk menyeimbangkan tatanan peri kehidupan dalam berbangsa dan bernegara. Keduanya berharap, visi dan misi serta program unggulannya akan mendapat dukungan penuh dari warga dan masyarakat Kabupaten Tegal. Sehingga cita-cita untuk mewujudkan Tegal yang baldatun thoyibatun warobun ghafur segera terealisasi. Karena itulah, Rojikin dan Budiharto memohon doa restu kepada seluruh warga masyarakat Kabupaten Tegal, Minggu (27/10) mendatang, dengan mencoblos NO.1 dengan baju kotakkotak merah dan berpeci. Keduanya menegaskan, tak mungkin bisa berarti apa-apa tanpa dukungan penuh dari semua komponen masyarakat Kabupaten Tegal tercinta. Jangan Lupa COBLOS NOMOR 1, Minggu (27/ 10), di TPS-TPS yang sudah disediakan. Sekali lagi, Teh Poci Gula Batu, Ayo Pilih NOMOR SATU, Tahu Pletok Tahu Aci, Paling Cocok NOMOR SIJI. (zuhlifar arrisandy)

ZUHLIFAR ARRISANDY/RADAR TEGAL

BANTENG SANTRI - Calon Bupati H Rojikin AH SE SH dikenal mudah beradaptasi, sehingga gampang diterima berbagai kalangan dari sejumlah latar belakang.

ZUHLIFAR ARRISANDY/RADAR TEGAL

DUKUNGAN KIAI - Pengasuh Pondok Pesantren At-Tauhidiyah Cikura-Giren KH Ahman bin Armia saat mendoakan Rojikin dan Budiharto untuk memenangi pemilukada Kabupaten Tegal.

ZUHLIFAR ARRISANDY/RADAR TEGAL

JARINGAN LUAS - Kedekatan Rojikin (kiri) dengan Gubernur Jawa Tengah, Ganjar Pranowo (kanan), membuatnya mudah membina jaringan birokrasi pemerintahan.

ZUHLIFAR ARRISANDY/RADAR TEGAL

SOLIDITAS INTERNAL - Dukungan soliditas internal partai merupakan modal dasar Rojikin-Budiharto untuk memenangkan pilbub Kabupaten Tegal.

ZUHLIFAR ARRISANDY/RADAR TEGAL

ZUHLIFAR ARRISANDY/RADAR TEGAL

WONG CILIK - Kedekatannya terhadap perjuangan wong cilik, membuat Rojikin begitu dielu-elukan massa, pendukung, dan simpatisannya di setiap kali kampanye terbuka.

ULAMA UMARO - Pengalamannya 14 berkecimpung sebagai anggota legislatif bisa menyatukan ulama dan umaro untuk kejayaan Kabupaten Tegal.

ZUHLIFAR ARRISANDY/RADAR TEGAL

MULIAKAN PEREMPUAN - Pemberdayaan perempuan merupakan salah satu program unggulan untuk meningkatkan derajat perempuan di Kabupaten Tegal.

ZUHLIFAR ARRISANDY/RADAR TEGAL

ZUHLIFAR ARRISANDY/RADAR TEGAL

ZUHLIFAR ARRISANDY/RADAR TEGAL

SEMAKIN KUAT - Dukungan kiai dan santri membuat posisi ROJIKIN ber BUDI semakin kuat.

BERBAGAI KALANGAN - Kemampuannya berkomunikasi dengan publik, membuat Rojikin gampang diterima berbagai kalangan.

PEDULI BURUH - Rojikin juga menyiratkan akan meningkatkan kesejahteraan buruh dengan besaran UMK yang sesuai KHL.


ALL SPORTS

18

RABU 23 OKTOBER 2013

RADAR TEGAL

REAL MADRID VS JUVENTUS

AGENDA

BIKIN MERANA NYONYA TUA

Piala Dunia Rabu, 23 Oktober 2013 Honduras vs Brasil (TVOne pukul 22.30 WIB)

Liga Champions Kamis, 24 Oktober 2013 Real Madrid vs Juventus (SCTV pukul 01.45 WIB) Manchester United vs Real Sociedad (Nexmedia pukul 01.45 WIB)

BURSA Real Madrid vs Juventus Angin ke Tuan Rumah BERMAIN di Santiago Bernabeu, beberapa pemain kembali pulih dari cedera, dan Juve datang dengan modal kekalahan memberikan angin segar bagi Real dalam laga dini hari nanti. Wajar apabila rumah bursa memberikan dukungan kepada tuan rumah. (dns/bas) Bursa Laga

Home

Draw

Away

William Hill

1,6

3,6

6

Bwin

1, 5

4,5

5,5

Bet Victor

1,6

4,1

6,5

Sky Bet

1,5

4,2

6,5

Bursa Skor 2-1

9,5 (Bet Victor)

1-1

10,5 (Bet Victor)

2-0

10,5 (Bet Victor)

0-1

24 (Betfair)

Bursa Pencetak Gol Pertama Cristiano Ronaldo

3,5 (Ladbrokes)

Karim Benzema

6 (Bet365)

Isco

9 (Sky Bet)

Carlos Tevez

11,5 (Bwin)

Asian Handicap Real Madrid vs Juventus

0 :1

CSKA vs Man City

¾ :0

Bayern vs Viktoria Plzen

0 :2¾

Leverkusen vs Shakhtar Donetsk

0 :½

Man United vs Sociedad

0 :1¼

Galatasaray vs Copenhagen

0 :1½

Anderlecht vs PSG

1¼:0

Benfica vs Olympiacos

0 :¾

Simpati Gigi untuk Casillas SAMA-SAMA berposisi di bawah mistar gawang serta berstatus kapten tim di level klub maupun timnas. Gianluigi Buffon dan Iker Casillas sekaligus kiper yang mendominasi penghargaan IFFHS (organisasi independen yang mengurusi sejarah dan statistik sepak bola internasional) satu dekade terakhir. Tapi, belakangan, keduanya diklaim mengalami degradasi performa. Casillas misalnya. Kiper 32 tahun itu digusur Diego Lopez sebagai kiper nomor satu Real. Jika bukan karena kebijakan rotasi yang setengah dipaksakan oleh pelatih Real Carlo Ancelotti maupun entrenador Spanyol Vicente del Bosque, Sant-Iker (julukan Casillas)mungkinjadipenghuni setia bangku cadangan. Buffon masih beruntung. Predikatnya sebagai kiper utama Juve belum terusik meski dalam laga terakhir kontra Fiorentina (20/10), gawangnya dibobol empat kali dalam rentang 25 menit. Pelatih Italia Cesare Prandelli bahkan menggaransi namanya di urutan pertama dalam daftar skuad

yang akan dibawanya ke Piala Dunia 2014. Dalam laga dini hari nanti, Buffon pun berharap Casillas yang akan menjadi lawannya di gawang seberang. Sesuai kebijakan Ancelotti, Casillas memang diprioritaskan turun di Liga Champions. “Iker adalah salah satu kiper yang saya kagumi dan situasi yang dialaminya saat ini akan membuatnya lebih bermental tangguh,” kata Buffon seperti dilansir Marca. “Bagi saya, sangat aneh melihatnya berada di bangku cadangan karena saya pasti juga akan sulit menerimanya dalam situasi yang sama. Tapi, saya tetap memberikan respek kepada Diego Lopez yang juga seorang kiper bagus,” imbuh kiper yang juga punya julukan Superman tersebut. Laga di Santiago Bernabue pun membangkitkan memori Buffon lima tahun silam. “Kali terakhir saya bermain di sana, kami menang 2-0. Saya juga tidak mau kalah kali ini,” tandas kiper dengan caps terbanyak (137) di Italia itu. (dns/bas)

MADRID - Matchday ketiga fase grup Liga Champions kembali menghadirkan laga klasik antara klub raksasa Italia versus Spanyol. Setelah AC Milan vs BarcelonadiniharitadiWIB(23/10),RealMadrid akan menghadapi Juventus di Santiago Bernabeu dini hari nantiWIB (24/10). Seperti Milan lawan Barca, Real kontra Juvejugapertemuanklubdengankoleksi overall 11 trofi Liga Champions (Real 9, Juve 2). Kedua tim juga pernah bersua dalam final edisi 1998 di Amsterdam ArenA. Gol semata wayang Predrag Mijatovic kala itu membuat Los Merengues (sebutan Real) mengakhiri paceklik gelar Liga Champions selama 32 tahun. Juve lantas membalasnya dengan menghentikan langkah Realdalamsemifinaledisi2003 (agregat 4-3) maupun 16 besar edisi 2005 (agregat 2-1). Pertemuan terakhir di Bernabeu lima tahun silam juga dimenangi Nyonya Tua (julukan Juve) berkat dua gol Alessandro Del Piero. Yangjadimasalah,banyak yang meragukan Juve bisa melakukan yang sama dini hari nanti. Dibawah asuhan Carlo Ancelotti, yang notabene mantan pelatih Juve, Real melakukan start bagus di dua laga awal Liga Champions. Masing-masing membungkam Galatasaray 6-1 di Istanbul (17/9) lalu membekap Copenhagen 4-0 (2/10). Sebaliknya, Juve gagal menang dalam dua laga alias seri 1-1 di kandang Copenhagen dan 2-2 saat menjamu Galatasaray. Scudetto Serie A dua musim terakhir itu juga bertandang ke Bernabeu dengan modal kekalahan 2-4 dari Fiorentina (20/10). “Kami harus menang melawan Juve,” tegas Cristiano Ronaldo, bintang Real, seperti dilansir di situs resmi klub. “Bukan semata karena kami akan menghadapi laga penting (lawan Barca

dalam El Clasico, 2 6 / 1 0 , Red),

melainkan karena kemenangan akan membuat kami semakin cepat memastikan lolos ke fase knockout (16 besar),” imbuh pemain yang telah mengemas 5 gol dalam dua laga awal Liga Champions tersebut. Ronaldo juga menyatakan, timnya tak akan terlena dengan kekalahan Juve dari Fiorentina. “Saya meyakini Juve adalah tim kuat dan mereka akan berusaha menunjukkan kepada kami,” tutur pemain yang diklaim Luciano Moggi (mantan direktur sepak bola Juve yang tersandung skandal Calciopoli) nyaris digaet NyonyaTua saat usianya masih 18 tahun itu. Jika ArturoVidal yang cedera tertarik otot melawan Fiorentina bisa dimainkan, Juve memiliki kans untuk mengimbang Real. Selain Andrea Pirlo, Vidal merupakanpemainyangpalingdiwaspadai Ancelotti. “Cedera Arturo tidak terlalu serius dan kami optimistis kondisinya akan membaik,” kata allenatore Juve Antonio Conte kepada Tuttosport. (dns)

Perkiraan Pemain REAL MADRID (4-3-3) 1-Casillas (g/c); 17-Arbeloa, 3-Pepe, 4-Ramos, 12-Marcelo, 6-Khedira, 24-Ilrramendi, 19-Modric; 22-Di Maria, 9Benzema, 7-Ronaldo Pelatih: Carlo Ancelotti JUVENTUS (3-5-2 1-Buffon (g/c); 15-Barzagli, 19-Bonucci, 3-Chiellini; 33-Isla, 23-Vidal, 21-Pirlo, 8-Marchisio, 22-Asamoah; 10-Tevez, 14Llorente Pelatih: Antonio Conte

Cristiano Ronaldo

Siaran Langsung: SCTV, 01.45 WIB Stadion: Santiago Bernabeu, Madrid Wasit: Manuel Graefe

MAN. UTD VS REAL SOCIEDAD

Tepis Krisis Domestik, Incar Kemenangan

Robin van Persie

MANCHESTER - Manchester United sedang mengalami fase buruk. Rentetan hasil jelek di liga domestik membuat keraguan kepada manajer baru David Moyes merebak hebat. Setan Merah harus bisa mengalahkan Real Sociedad di Old Trafford pada match day ketiga Liga Champions dini hari nanti untuk membungkam banyaknya suara sumbang (Siaran Langung NexMedia pukul 01.45). Bersama Moyes, United hanya menang dua kali dalam enam pertandingan di semua

kompetisi. United juga mencatat start buruk di liga domestik dengan hanya berada di po-

sisi delapan klasemen Premier League. Melawan Sociedad, Moyes agaknya akan tetap me-

makaipola4-2-3-1.Wayne Rooney akan menyokong striker tunggal Robin van Persie. (nur)


JAWA TENGAH

RABU 23 OKTOBER 2013

19

RADAR TEGAL

Tuntut Upah Layak, Buruh Mogok Makan SEMARANG - Lima buruh Kota Semarang menggelar aksi mogok makan di depan eks videotron Jalan Pahlawan Semarang Selasa (22/10). Para buruh yang menutup mulutnya dengan lakban ini menuntut pemerintah agar menetapkan upah minimum kota (UMK) sesuai dengan kebutuhan hidup layak. Koordinator aksi Ahmad Zainudin mengatakan, aksi ini merupakan bentuk keprihatinan buruh terhadap pemerintah yang hingga saat ini belum menyikapi tuntutan buruh. ”Gubernur tidak melakukan tindakan liberal dengan memosisikan diri hanya sebagai wasit dalam persoalan kesejahteraan pekerja di Jateng,” katanya. Zainudin mengatakan aksi mogok makan ini akan dilakukan selama 3 hari. Kamis (24/10), ribuan buruh akan bergabung dengan peserta mogok makan. ”Aksi ini dilakukan sebelum menggelar aksi demonstrasi besar-besaran di kantor gubernuran,” ungkapnya. Terpisah, perusahaan jamu PT Nyonya Meneer akhirnya membayarkan gaji buruhnya yang sempat tertunda. Sebelumnya, buruh peru-

sahaan yang berada di Jalan Kaligawe Semarang ini mogok kerja menuntut pembayaran upah, mempekerjakan kembali buruh yang dirumahkan dan pemberian asuransi. Kepala Human Resource Development (HRD) PT Nyonya Meneer F Nova Calsica AD didampingi direksi Fiona mengatakan, pihak perusahaan telah mengadakan pertemuan dengan perwakilan buruh. Gaji yang tertunda saat ini sudah dibayarkan dan tak ada tunggakan lagi. Sementara untuk masalah asuransi, sedang dibahas direksi. ”Sampai saat ini masih dalam pembahasan di kalangan direksi sehingga pada November akan diselesaikan,” katanya. Koordinator buruh PT Nyonya Meneer Sukarman meminta agar perusahaan segera mengikutkan buruh dalam program Jamsostek dan memberikan hak-hak buruh yang meninggal dunia kepada ahli warisnya. ”Kami juga meminta kebebasan dalam berserikat dan dilibatkan dalam segala kebijakan tentang hubungan industrial,” katanya. (hid/ ton/ce1)

SOSOK Ekspresi lewat Make up SEPTIANA Girani mengaku suka make up sejak masih duduk di bangku SD. Saat itu, beauty consultant di perusahaan kosmetik Sariayu ini kerap melihat sang budhe yang berprofesi sebagai perias pengantin. Dari situlah, Septi —sapaan akrabnya— mulai sering mencoba berbagai macam peralatan make up. ”Sekarang saya merasa bisa mencurahkan ekspresi melalui make up ,” ujarnya kepada Radar Semarang kemarin. Karena kesukaannya pada tata rias itu, maka begitu lulus SMP, gadis kelahiran Pekalongan, 27 September 1991 ini pun melanjutkan ke Sekolah Menengah Kejuruan (SMK) jurusan kecantikan. ”Kebetulan dari sekolah ada produk Sariayu yang mengajarkan tentang spa, karena kebetulan tante saya personalia di sana, jadi saya tertarik untuk masuk,” ujarnya. Septi mengaku kerap menjadi tim make up saat Sariayu menjadi sponsor acara tertentu. Termasuk saat acara Carnaval SCTV di Semarang. Saat itu, Septi menjadi salah satu make up artis. Praktis, Septi sering bertemu artis ibu kota. ”Yang paling berkesan, saat saya make up Charlie ST 12 (sekarang Setia Band, Red), kebetulan saya memang penggemar beratnya,” ucapnya sambil tersenyum. Salah satu prestasi yang pernah diraihnya yakni terlibat dalam pemecahan rekor Muri untuk hijab dengan peserta terbanyak yang berlokasi di Rembang. ”Saat itu, saya menjadi salah satu pemandu yang ngajarin ibu-ibu untuk bisa memasang hijab, terutama untuk hijab kerja,” jelasnya yang saat acara tersebut diikuti sebanyak 2.700 peserta. (ars/aro/ce1)

BISNIS

IST

KREATIF – Banu Sukoco Ketua Komunitas Peternak Lele di Tulus Batang dan Panji Dwi Risantoro, marketing Bole-Bole memamerkan makanan kreasi mereka.

Abon Lele, Bisnis Menjanjikan SEMARANG – Kreativitas berkuliner, terbukti mampu menjadi peluang bisnis. Seperti yang sekarang dilakukan Banu Sukoco, Ketua Komunitas Peternak Lele di Tulus Batang, yang mampu mengolah abon dari bahan dasar lele. Produk Banu yang diberi nama Bole-Bole (Abon Lele), kini cukup diminati konsumen dan menjadi ladang bisnis yang menjanjikan. Lele, tak hanya digoreng atau dibakar. Di tangan Banu dan kawankawan, Lele bisa menjadi abon yang lezat. Kreativitas ini yang menjadikan Banu kini menjadi pengusaha Bole-Bole. Produknya, kini menjadi salah satu oleh-oleh khas Jawa Tengah yang bisa memperkaya pilihan pengunjung Jawa Tengah. Dikatakan Banu, Bole berbahan dasar ikan lele jenis dumbo sangkuriang. Meski baru diproduksi secara home industry sejak Februari 2013 lalu, abon yang diklaim mengandung protein yang bermanfaat untuk pertumbuhan sejak anak-anak ini sudah kebanjiran pesanan. Banu Sukoco mengatkan, rata-rata setiap minggunya, ia bisa memproduksi 2 hingga 5 kuintal abon tergantung pesanan. ”Pesanan bisa mencapai 5 kuintal seminggu di masa-masa Lebaran, untuk oleholeh,” ungkapnya. Selain dipasarkan melalui berbagai pameran dan toko, pelanggan juga bisa mendapatkan abon ini melalui online. Abon yang dikemas dengan takaran 60 gram, dalam plastik higienis ini, bisa diperoleh dengan hanya Rp 16.000. Selain itu Banu juga memproduksi Bole dengan beberapa tingkat rasa pedas. Mulai dari yang tidak terasa pedas sama sekali, hingga yang paling pedas ada pada level 5. ”Biasanya untuk anak-anak mereka akan gemar mengonsumsi yang level kepedasannya 0. Sedangkan para remaja lah yang mencari Bole dengan tingkat kepedasan 5,” terangnya. Untuk pemasaran sendiri, Panji Dwi Risantoro marketing bole-bole abon menjelaskan, hingga saat ini, pihaknya sudah memenuhi permintaan di wilayah Solo, Jakarta, Cikarang, Bali, Semarang, Kalimantan dan masih banyak lagi. (eny/smu/ce1)

ADITYO DWI/RADAR SEMARANG

TUTUP MULUT - Para buruh yang mogok makan di Jalan Pahlawan Semarang. Mereka menuntut pemerintah menetapkan UMK sesuai KHL.

Potongan Kaki Manusia Ditemukan di Selokan UNGARAN - Potongan kaki manusia yang diduga korban mutilasi, Selasa (22/10) sore kemarin, membuat gempar warga di Jalan Diponegoro, Ungaran, Kabupaten Semarang. Warga berkerumun untuk melihat dari dekat potongan kaki manusia yang ditemukan di selokan tepi jalan utama Ungaran-Bawen. Anggota Unit Olah Tempat Kejadian Perkara (TKP) Polres Semarang yang datang langsung melakukan pemeriksaan lokasi, dan membawa potongan kaki sebelah kanan tersebut ke RS Bhayangkara Semarang. Potongan kaki itu terlihat sudah membusuk dan dipenuhi belatung. Beberapa bagian dagingnya sudah tidak utuh lagi, dan terlihat tulangnya. Informasi yang dihimpun Radar Semarang menyebutkan, potongan kaki tersebut kali pertama ditemukan Giri Leksana (15), warga Lingkungan Rejosari RT 7 RW 2 Genuk, Ungaran Barat. Giri mengatakan, saat berang-

kat sekolah, Selasa pagi, dia melihat ada benda mencurigakan tergeletak di dekat selokan di tepi jalan yang dilewati, tepatnya di depan kantor Bank Mandiri Syariah Ungaran. Namun saat itu, ia tidak mengira itu potongan kaki manusia. Di sekolah, Giri masih menyimpan rasa penasaran dengan benda tersebut. Karena itu, sepulang sekolah, ia kembali mengecek dengan mendatangi lokasi penemuan benda tersebut. Dan, saat diamati dari dekat, ternyata benda tersebut potongan kaki manusia. Tentu saja, Giri kaget bukan kepalang. ”Sebenarnya saya melihat sejak pagi saat berangkat sekolah. Tapi, tidak menyangka kalau itu kaki manusia. Karena penasaran, saya balik lagi dan mengecek untuk memastikan apakah benar itu potongan kaki. Ternyata setelah saya perhatikan lebih detail, benar-benar potongan kaki yang sudah membusuk,” ujar pelajar SMP Islam Sudirman

PRISTYONO HARTANTO/RADAR SEMARANG

KAKI MISTERIUS - Polisi mengidentifikasi potongan kaki manusia yang ditemukan di selokan Jalan Diponegoro Ungaran, kemarin.

Ungaran ini kepada Radar Semarang. Temuan potongan kaki manusia itu pun langsung dilaporkan kepada warga di dekat lokasi. Dalam waktu singkat, kabar penemuan kaki itu cepat menyebar. Puluhan warga berdatangan ke

lokasi penemuan untuk melihat potongan kaki tersebut dari dekat. Penemuan itu juga dilaporkan ke Polres Semarang. Tak berselang lama, sejumlah petugas olah TKP tiba di lokasi, dan langsung melakukan pemeriksaan. Banyaknya masyarakat

yang berkerumun di sana, menyebabkan arus lalu lintas jalur utama Ungaran-Bawen itu tersendat. Pengamatan Radar Semarang, potongan kaki yang ditemukan itu mulai telapak kaki hingga pangkal paha. Bagian tubuh manusia itu tergeletak di luar selokan. Kebetulan selokan di tepi jalan tersebut ada yang berlubang, sehingga potongan kaki dan sampah menyembul keluar Kapolres Semarang AKBP Augustinus Berlianto Pangaribuan melalui Kasat Reskrim Polres Semarang AKP Pahala Martua Nababan mengatakan, pihaknya belum bisa memastikan apakah potongan kaki manusia tersebut korban mutilasi (pembunuhan dengan bagian tubuh dipotong-potong, Red) atau korban kecelakaan tabrak lari. Hingga kemarin, pihaknya masih melakukan penyelidikan dan pemeriksaan medis untuk mengidentifikasi potongan kaki tersebut. (tyo/aro/ce1)

Caleg Nasdem Gugat KPU Kota Eks Kantor SI Penuhi Syarat BCB SEMARANG - Buntut pencoretan nama salah satu Caleg Partai Nasional Demokrat (Nasdem) Kota Semarang di daftar caleg tetap (DCT) oleh KPU Kota, berbuntut panjang. Rojikin, caleg Nasdem yang namanya sempat tercoret akan tetap menempuh jalur hukum untuk menyelesaikan kasus tersebut. Menurut dia, tak hanya KPU, pihaknya juga menyayangkan pimpinan DPD Partai Nasdem Kota Semarang yang dinilainya arogan. Langkah hukum sudah disiapkan, tidak saja ke Panwaslu Kota Semarang, tapi juga ke lembaga lain, termasuk Dewan Kehormatan Penyelenggara Pemilu (DKPP) karena menyangkut kode etik. ”Selain ke KPU, saya juga minta agar DPW dan DPP Partai Nasdem untuk mengevaluasi jajaran DPD Partai Nasdem Kota Semarang, karena tidak menjalankan partai dengan baik,” katanya.

Dia menambahkan, Nasdem adalah partai harapan, namun sayangnya di Kota Semarang justru dirusak sendiri oleh sikap arogansi pimpinan. Sehingga partai jadi bermasalah, dan tak kondusif. ”Saya berharap kasus ini diinvestigasi oleh Panwas. Jika ternyata ada pelanggaran pidana, misalnya pemalsuan tanda tangan atau apa pun itu, pihak kepolisian kami minta untuk ikut menyelidiki,” tegasnya. Menanggapi tudingan arogansi pada kader, Ketua DPD Partai Nasdem Kota Semarang WS Basuki mengatakan, pencoretan Rojikin atas usulan seluruh pengurus partai. Langkah ini dilakukan karena yang bersangkutan dinilai tidak berkualitas, serta melakukan tindakan yang merugikan partai. ”Dia bukan pengurus, tapi banyak merugikan partai ya kita coret.” Namun pihaknya hanya sebatas mengusulkan pencoretan.

”Soal diluluskan atau tidak itu menjadi kewenangan KPU.” Ketua KPU Kota Semarang Hendry Wahyono menegaskan, persoalan seharusnya sudah selesai, karena yang bersangkutan (Rojikin) masih terdaftar sebagai caleg resmi dalam DPT (daftar pemilih tetap). ”Semua sudah dijelaskan dan seharusnya sudah clear. Karena yang bersangkutan tetap sebagai caleg resmi dari Partai Nasdem. Semua sudah clear ketika kita difasilitasi panwas (panitia pengawas) untuk menjelaskan dan menyelesaikan masalah ini,” katanya. Seperti diberitakan sebelumnya, KPU Kota Semarang akhirnya mengakui telah mencoret nama Rojikin berdasarkan surat yang dikirim oleh DPD Partai Nasdem Kota Semarang. Pencoretan itu dilakukan oleh salah satu anggota KPU Kota Semarang, Abdoel Kholik. (zal/aro/ ce1)

SEMARANG - Badan Pelestarian Cagar Budaya (BPCB) Jawa Tengah telah menyelesaikan kajian nilai sejarah bangunan Gedung Rakyat Indonesia atau bekas kantor Sarekat Islam (SI). Hasilnya, gedung di Jalan Gendong Selatan no 1144 Kelurahan Sarirejo Kecamatan Semarang Timur ini memenuhi syarat untuk ditetapkan sebagai bangunan cagar budaya (BCB). Kepala Seksi Perlindungan Pengembangan dan Pemanfaatan BPCB Jawa Tengah, Gutomo menjelaskan, empat syarat penetapan sebuah bangunan menjadi BCB, seluruhnya dipenuhi oleh eks kantor SI. Sesuai dengan Undang-Undang Nomor 11 Tahun 2010 tentang Cagar Budaya, syarat sebuah bangunan dikategorikan sebagai BCB meliputi umur ba-

ngunan, corak/gaya bangunan pada 50 tahun lalu, punya arti khusus, dan punya nilai budaya yang menggambarkan kepribadian bangsa. Eks kantor SI ini dibangun pada 1919, sehingga usianya lebih dari 50 tahun. Bangunan yang dibangun pada tahun 1919 ini usianya sudah lebih dari 50 tahun. Gedung tersebut dinyatakan punya nilai historositas tinggi dalam bidang pergerakan nasional untuk mencapai kemerdekaan. ” Dalam kajian kami, bahwa tokoh-tokoh yang menempati gedung ini memiliki kesadaran bahwa mereka berbeda dengan Belanda, di situ muncul kesadaran untuk menentukan nasib bangsanya sendiri,” ujar Gutomo. (ton/ce1)

PENGUMUMAN LELANG KEDUA EKSEKUSI HT

PT. Bank Tabungan Negara (Persero), Tbk. Kantor Cabang Syariah Cirebon

Berdasarkan Pasal 6 Undang-Undang Hak Tanggungan No. 4/1996, PT. Permodalan Nasional Madani (Persero) Cabang Cirebon akan melakukan Lelang Eksekusi Hak Tanggungan melalui Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Tegal atas jaminan debitur sebagai berikut : 1. CASTIMAH Sebidang tanah sesuai Sertipikat Hak Milik (SHM) No. 67, berikut bangunan dan atau segala sesuatu yang berdiri diatasnya, terletak di Desa Sukareja, Kec. Banjarharjo, Kab. Brebes, seluas+ 670 m2, atas nama SUPARJO. Harga Limit Rp 100.000.000,00; uang jaminan Rp. 20.000.000,00 2. RASBIN BIN DARSA Sebidang tanah sesuai Sertipikat Hak Milik (SHM) No. 228, berikut bangunan dan atau segala sesuatu yang berdiri diatasnya, terletak di Desa Luwunggede, Kec. Tanjung, Kab. Brebes, dengan luas tanah + 183 m2, atas nama NURHALIMAH Harga Limit Rp 100.000.000,00; uang jaminan Rp. 20.000.000,00

PENGUMUMAN LELANG KEDUA EKSEKUSI HAK TANGGUNGAN

PELAKSANAAN LELANG : Hari/tanggal : Rabu, 06 Nopember 2013, Pukul: 10.00 WIB s.d. selesai Tempat : Kantor Pelayanan Kekayaan Negara dan Lelang ( KPKNL ) Tegal Jln. KS Tubun No. 12 Kota Tegal 52131 Syarat-syarat Lelang : 1. Peserta Lelang diwajibkan mempunyai NPWP dan harus menyetor uang jaminan ke rekening KPKNL Tegal pada Bank BRI (Persero) Cabang Tegal, No. Rekening.:0101-01-000603-30-1 a.n. Rekening Penampungan Lelang KPKNL Tegal yang sudah efektif selambat-lambatnya 1 (satu) hari sebelum pelaksanaan lelang atau disetor tunai melalui Pejabat Lelang paling lambat sebelum lelang dimulai. 2. Peserta yang telah menyetor uang jaminan lelang harus hadir pada pelaksanaan lelang, jika diwakilkan harus dengan surat kuasa bermeterai cukup. 3. Pemenang lelang diwajibkan membayar pelunasan harga lelang dalam waktu 5 (lima) hari kerja setelah ditunjuk sebagai pemenang lelang. Apabila sampai 5 (lima) hari kerja tidak melunasi (wanprestasi), maka penetapan sebagai pemenangdibatalkandanuangjaminandisetorkankekasnegarasertadimasukandalamdaftarhitampesertalelang. 4. Pelaksanaan lelang dilakukan secara lisan dengan harga semakin meningkat. 5. Jika terjadi pembatalan / penundaan lelang sesuai ketentuan yang berlaku maka pihak-pihak yang berkepentingan tidak dapat melakukan gugatan terhadap KPKNL Tegal dan PT. Permodalan Nasional Madani (Persero). 6. Kondisi asset dijual apa adanya (as it is). Peserta Lelang dianggap telah mengetahui keberadaan dan kondisi obyek lelang yang dijual dengan kondisi apa adanya, untuk itu dipersilakan melihat kondisi obyek lelang sejak pengumuman ini terbit sampai dengan pelaksanaan lelang. Keterangan lebih lanjut hubungi PT. Permodalan Nasional Madani (Persero) Cabang Cirebon (CP Nanang HP 087847271600), atau KPKNL Tegal, Jln. KS Tubun No. 12 Kota Tegal Tlp 0283-324986. Cirebon, 23 Oktober 2013 Ttd. PT. Permodalan Nasional Madani (Persero) Cabang Cirebon

PT. Bank Tabungan Negara (Persero), Tbk Kantor Cabang Syariah Cirebon dengan Perantaraan Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Tegal, akan melaksanakan penjualan dimuka umum/lelang eksekusi berdasarkan pasal 6 Undang-undang Hak Tanggungan (UUHT) No. 4 Th. 1996, atas nama : - Debitur : EMAN SUPARMAN Sebidang tanah seluas ± 419 m2 berikut bangunan yang berdiri diatasnya sesuai SHM No. 00355 a.n. Eman Suparman, terletak di Jl. Raya Bojongsari-Ketanggungan Ds. Bojongsari, Kec. Losari, Kab. Brebes. Harga Limit sebesar Rp. 318.600.000,- Uang Jaminan sebesar Rp. 70.000.000,Pelaksanaan Lelang : Hari/Tanggal : Rabu, 06 Nopember 2013, Pukul 09.30 WIB s.d. selesai Tempat : Kantor KPKNL Tegal, Jln. KS. Tubun No. 12 Kota Tegal Syarat-syarat Lelang : 1. Peserta lelang diwajibkan mempunyai NPWP dan menyetor uang jaminan lelang melalui PT Bank BRI Cab. Tegal dengan no. rekening 0101-01-000603-30-1 a.n. KPKNL Tegal qq. Rekening Penampungan Lelang. 1. Uang jaminan lelang harus sudah masuk efektif selambat lambatnya 1 (satu) hari sebelum pelaksanaan lelang, bukan transfer melalui ATM, SMS Banking, Phone Banking, Internet Banking ataupun Tranfer otomatis lainnya. 2. Peserta lelang dapat melihat objek lelang sejak Pengumuman ini diterbitkan, agar mengetahui kondisinya dan dianggap menyetujui aspek legal dari obyek yang dilelang sesuai dengan kondisi apa adanya (as is). 3. Penawaran lelang dilakukan secara lisan dengan harga semakin meningkat. 4. Pemenang Lelang di wajibkan melunasi pokok/harga lelang dan bea lelang 2 % paling lambat 5 (lima) hari kerja setelah pelaksanaan lelang. 5. Apabila pemenang lelang tidak melunasi kewajibannya, maka dinyatakan wanprestasi dan uang jaminan akan disetor ke Kas negara sebagai Pendapatan Negara Bukan Pajak, status pemenangnya dibatalkan serta peserta lelang akan dimasukan ke dalam DAFTAR PEMBELI WANPRESTASI. 6. Pelaksanaan lelang dapat ditunda/dibatalkan sesuai ketentuan yang berlaku dan para peserta lelang tidak dapat melakukan tuntutan dalam bentuk apapun kepada KPKNL Tegal maupun PT. Bank Tabungan Negara (Persero), Tbk. Kantor Cabang Syariah Cirebon. 7. Keterangan lebih lanjut dapat menghubungi PT. Bank Tabungan Negara (Persero), Tbk. Kantor Cabang Syariah Cirebon, Telp. (0231) 235485-235486 (Sdr. Moran Harisdian) atau pada KPKNL Tegal Telp. (0283) 324986, Fax. 0283-321785 Cirebon, 08 Oktober 2013 PT. Bank Tabungan Negara (Persero), Tbk. Kantor Cabang Syariah Cirebon Ttd. Untung Surapati (Branch Manager)

Ttd. Iwan Kurniawan (DBM Supporting)


Ppre stasi s

23

RADAR TEGAL

RABU, 23 OKTOBER 2013

Tenaga Kesehatan Ambil Sumpah Profesi Politeknik Harapan Bersama Tegal

ROCHMAN GUNAWAN/RATEG

BERLANGSUNG KHIDMAT – Prosesi pengambilan sumpah tenaga kesehatan Politeknik Harapan Bersama, Selasa (22/10) berlangsung khidmat.

TEGAL - Politeknik Harapan Bersama Tegal, Selasa (22/10) menggelar pengambilan sumpah tenaga kesehatan Prodi D III Farmasi dan D III Kebidanan. Acara yang dilaksanakan di Aula Poltrans Tegal dihadiri sejumlah undangan seperti Dinas Kesehatan Provinsi Jawa Tengah, Dinas Kesehatan Kota dan Kabupaten Tegal. Perwakilan dari IBI, PAFI, IAI Kota dan Kabupaten Tegal dan undangan lainnya. Rangkaian acara dimulai sekitar pukul 08.00 WIB dan dari awal hingga akhir semua berjalan lancar serta khidmat. Direktur Politeknik Harapan Bersama Tegal Mc Chambali BEng MKom melalui Kaprodi D III Kebidanan Iroma Maulida SKM M Epid didampingi Kaprodi D III Farmasi Heru Nurcahyo SFarm Apt membenarkan hal itu. Menurutnya, peserta sumpah profesi kali ini terdiri dari 146 lulusan Prodi D III Kebidanan dan 95 lulusan Prodi D III Farmasi yang telah melak-

sanakan serangkaian kegiatan Ujian Akhir Program (UAP). Untuk Prodi D III Kebidanan UAP bekerjasama dengan Forum Komunikasi Kebidanan Jawa Tengah dalam Uji Knowledge dengan CBT dan Uji Skill dengan OSCE. Ada juga Uji Karya Tulis Ilmiah (KTI), Uji Kompetensi yang diselenggarakan Majelis Tenaga Kesehatan Provinsi (MTKP) Jawa Tengah. Untuk D III Farmasi terdiri dari Uji Karya Tulis Ilmiah (KTI), Uji Komprehensif (Ujian Akhir Program) yang diselenggarakan oleh BKS AKFAR-AAK-AKAFARMA di bawah naungan Dinas Kesehatan Provinsi Jawa Tengah. Ketua penyelenggara tahun ini dari D III Farmasi Politeknik Harapan Bersama Tegal. Peserta yang mengikuti sumpah tenaga kesehatan juga telah mengikuti wisuda Ahli Madya Politeknik Harapan Bersama Tegal pada 10 Oktober 2013 kemarin. Proses pengambilan sumpah tenaga kesehatan kali ini bisa berjalan dengan lancar tanpa kendala berarti. (gun)

Anak Tukang Becak Juara Nasional LKS BREBES - Meski hanya sebagai anak tukang becak, namun Slamet Riyadi mampu menorehkan prestasi tingkat nasional. Dengan nilai 88,33, siswa kelas XII jurusan Nautika SMK Negeri 1 Bulakamba Kabupaten Brebes ini berhasil menjadi Juara II Lomba Ketrampilan Siswa (LKS) SMK bidang Nautika Tingkat Nasional XXI 2013. Dia kalah tipis dengan pesaingnya Sofian Kholik dari SMK Negeri 36 Jakarta (89,03) dan Juara III Dedi Febriyanto asal SMK Negeri 2 Indramayu, Jabar (84,88). Sementara Juara Harapan 1 diraih Ivan Renaldi SMK Negeri Turen, Malang, Jatim (78) dan Harapan 2 Deva Nanda Adnan SMK Negeri 1

Sanden, Yogyakarta (77). Slamet mengaku bangga sebagai anak desa yang bisa mengharumkan nama Brebes ke kancah nasional. “Alhamdulillah, saya bisa menjadi juara,” ucapnya bangga ketika Humas mewawancarai di ruang Kepala SMK Negeri 1 Bulakamba, Sabtu (19/ 10). Anak bontot dari 5 bersaudara pasangan dari Riswan yang seorang tukang becak dan Jumena, yang sehari-hari menjadi buruh serabutan itu, mengaku sempat minder. Tetapi atas motivasi dari guru pembimbingnya Hindriyono SPi, dirinya mampu menghilangkan rasa rendah dirinya ketika berlangsung lomba di

TMII Jakarta pada 22 sampai 28 September lalu. “Sempat minder sih, wong baru pertama kali ikut lomba di Jakarta,” tuturnya dengan polos dan sopan. Di Jakarta, Slamet bertarung dengan 24 peserta utusan dari 24 provinsi se-Indonesia. Dia harus menguasai betul berbagai materi lomba yang meliputi tes teori, merencanakan pelayaran di peta, mengoperasikan alat navigasi (Radar, GPS), mengemudikan kapal, desain dan konstruksi pukat ikan, uji presentasi dan uji wawancaara. Atas prestasi yang ditorehnya, remaja asal Desa Grinting, Bulakamba yang lahir 10 Agustus 1995 mendapat piala, medali dan piagam serta uang

pembinaan sebesar Rp 8 juta dari Menteri Pendidikan Nasional Prof Muh Nuh, DEA. Di kelasnya, Slamet menempati rangking ke-6. Meski demikian, dia selalu aktif dan menjadi Danton (ketua kelas) yang mampu memanage teman-teman taruna peletonnya. Penggemar musik dangdut yang hobi renang ini bercita-cita ingin kerja di pelayaran Jepang. “Setelah lulus, saya pengin kerja pelayaran di Jepang untuk membantu orang tua,” ucapnya. Kepala SMK Negeri 1 Bulakamba yang juga bernama Slamet Riyadi MPd itu turut bangga atas prestasi peserta didiknya. SMK yang terletak di

DOK.ISTIMEWA

TOREH PRESTASI – Slamet Riyadi (tengah) mampu menorehkan prestasi tingkat nasional. Nampak dia berpose bersama guru dan tropinya.

Jalan Raya Kluwut ini, sejak berdiri 1999 baru kali pertama meraih prestasi tingkat nasional. Apresiasi atas prestasi itu,

juga ditunjukan Bupati dan Kepala Dinas Pendidikan Brebes. Di sekolahnya, lanjut Riyadi,

dia memberikan dorongan dan keleluasan para siswa yang berjumlah 996 itu untuk mengeksplorasi prestasinya. Segala prestasi yang diraih para siswanya diberi reward yang pantas termasuk dalam bentuk beasiswa. Riyadi menjelaskan, dengan bimbingan 71 guru dan 21 karyawan, SMK Negeri 1 Bulakamba bertekad menjadi sekolah yang terbaik di Kabupaten Brebes maupun Jateng. Di sekolahnya, telah dibuka 6 jurusan yakni teknik sepeda motor 2 kelas, teknik kendaraan ringan (9), audio video (6), instalasi tenaga listrik (5), nautika kapal penangkap ikan (3) dan agribisnis tanaman pangan dan holtikultura (3). (*)

SD THHK Bangun Karakter Siswa

DOK.RATEG

PANTI ASUHAN – SD THHK berkunjung ke Panti Asuhan Al-Islah, Dampyak, Kramat Kabupaten Tegal.

Ajarkan dengan Pengalaman Kontras TEGAL – Sekolah Dasar Tunas Hidup Harapan Kita (SD THHK) menggelar outdoor activity berupa kunjungan ke Panti Asuhan Al-Islah, Dampyak, Kramat Kabupaten Tegal. Kegiatan ini diikuti orang tua siswa kelas IV, V dan VI serta para guru dan pengurus komite sekolah.

Caesilian Suyatimah, kepala SD THHK mengatakan, kunjungan ini dirancang sebagai salah satu upaya sekolah untuk meningkatkan kepedulian para siswa. Selain itu, kegiatan tersebut bertujuan meningkatkan kerja sama dan keakraban antar orang tua siswa dan para guru. Saat mempersiapkan kegiatan ini, para siswa diajak untuk mengumpulkan barangbarang yang dapat disumbangkan berupa makanan,

pakaian dan perlengkapan tidur. Para siswa juga berkenalan langsung dengan anakanak panti asuhan, berbagi bersama, menyanyi serta bermain bersama. Di sinilah mereka diperkenalkan sebuah sisi berbeda dibandingkan kehidupan mereka di rumah. Karena itu, melalui kegiatan ini diharapkan para siswa tidak sekedar mengenal dan mengetahui kehidupan anak-anak panti asuhan saja tetapi bisa belajar dan mengenal arti kehidupan yang sesungguhnya. “Banyak nilai-nilai positif yang bisa diambil dari kegiatan luar sekolah seperti ini yang bisa memberikan wawasan kepada para siswa,” katanya. Gunawan, anggota komite sekolah menuturkan, kunjungan tersebut membuat anakanak bisa belajar kemandirian dan semangat juang dari anakanak panti asuhan. Karena itu, komite sekolah akan terus mendukung program dari SD THHK. “Anak-anak bisa melihat bagaimana kehidupan di panti asuhan dan mereka akan mendapatkan sebuah pengalaman dan pelajaran berharga dalam kunjungan tersebut,” terangnya. Ivander, siswa kelas V SD THHK mengaku senang bisa ambil bagian dalam kegiatan ini. Di sana, dia bisa belajar banyak tentang kehidupan teman-teman seusianya yang ada di panti asuhan dan bagaimana cara menghargai orang lain. “Kami senang bisa bermain dan bernyanyi dengan temanteman baru di sini,” ujarnya. Sutrisno, sekretaris Panti Asuhan Al Islah mengungkapkan rasa haru dan tidak lupa mengucapkan terima kasih atas kunjungan ini. (gun)

FOTO BERSAMA Siswa TK Kemala Bhayangkari 27 Brebes foto bersama Kapolres Brebes AKBP Ferdy Sambo SIK MH saat melakukan kunjungan ke Mapolres Brebes

HARVIYANTO/RADAR BREBES

Siswa TK Kemala Bhayangkari 27 Kunjungi Mapolres BREBES - Untuk bisa mengenal lebih dekat dan memahami tugas polisi, ratusan siswa dari Taman Kanak-kanak (TK) Kemala Bhayangkari 27 Brebes kemarin melakukan kunjungan ke Mapolres Brebes. Didampingi guru pembina, para siswa TK itu belajar untuk mengenal secara langsung tugas keseharian polisi. Suasana di Mapolres Brebes pun berubah semarak oleh anak-anak yang datang dengan mengenakan seragam layaknya polisi. Selain itu, anak-anak itu juga mendatangi sejumlah ruangan yang ada di Mapolres termasuk ruang kerja Kapolres Brebes AKBP Ferdy Sambo SIK MH. Para siswa kemudian mendapat sambutan langsung dari Kapolres. Bahkan dalam kesempatan itu, mereka sempat bernyanyi bersama Kapolres. Di sela pertemuan dengan Kapolres, beberapa anak nampak tak malu untuk melontarkan pertanyaan terkait dengan pekerjaan polisi. Usai berkunjung ke ruang Kapolres, anak-

anak kemudian diajak untuk berkunjung ke ruang Kasatreskrim setelah itu beranjak untuk melihat ruang tahanan. Mereka diajak melihat ruang tahanan untuk mengetahui fungsinya, dan dimaksudkan agar mereka tidak melakukan pelanggaran. Setelah berkunjung ke Mapolres, rombongan kemudian beranjak menuju Mapolantas Polres Brebes di Jalan Veteran. Para siswa kemudian mengunjungi langsung ruang pemantauan arus lalu lintas, ruang uji SIM dan ruang pengolahan data pembuatan SIM. Di tempat itu, mereka juga belajar mengenal rambu-rambu lalu lintas, dan diberi kesempatan menaiki mobil dan motor untuk patroli. Kapolres Brebes AKBP Ferdy Sambo SIK MH menyambut baik kegiatan yang diselenggarakan TK Kemala Bhayangkari 27 Brebes itu. Apalagi, kegiatan itu dimaksudkan untuk mengenalkan anak didik terhadap tugas polisi sehari-hari.

Di samping itu, lanjut dia, kegiatan itu juga sebagai wadah memberikan pembelajaran

kepada anak. Sehingga anak tidak takut saat bersua dengan anggota polisi. (har)


CMYK

24

KAMIS, 23 OKTOBER 2013

RADAR TEGAL

Ungkapan Kepala SMP Negeri 1 Adiwerna Tentang Perkembangan Zaman Pada kesempatan lay out ketiga ini redaksi menampilkan dialog interaktif siswa dengan Bapak Kepala SMP Negeri 1 Adiwerna (Sakirman S.Pd.M.Pd.) PAGI yang cerah saat itu, kami berkunjung ke ruang Kepala SMP Negeri 1 Adiwerna, Assalamualaikum…ucapan salam kami itu langsung di jawab oleh beliau, Waallaikumsalam… “Maaf Bapak, kami dari tim jurnalistik MADU STUNA maksud kedatangan kami akan berdialog tentang perkembangan zaman di era globalisasi” baik saya siap untuk melanjutkan dialog ini. Menurut Bapak apa arti singkat perkembangan zaman? Perkembangan zaman adalah perubahan perilaku, budaya dan cara hidup manusia secara menyeluruh pungkasnya. Apakah dampak positif dan negatifnya? Bapak Sakirman S.Pd.M.Pd memaparkan dampak positif dan negatif dari perkembangan zaman, yaitu manusia bisa bekerja dengan mudah, simple dan cepat karena di dukung dengan penggunaan teknologi yang memadai. Perkembangan zaman juga ada sisi negatifnya, yakni manusia semakin malas dalam melakukan aktifitasnya karena semua mudah dilakukan, mudah diperoleh, juga banyak yang memanfaatkan teknologi untuk tujuan penipuan, memanipulasi, pergaulan bebas dan masih banyak lagi dampak negatif lainnya. Mengapa para remaja Indonesia salah menanggapi perkembangan zaman saat ini? Remaja di zaman sekarang ini banyak yang keliru menanggapi perkembangan zaman, karena belum memiliki dasar, moral, agama, dan budaya yang begitu kuat. Banyak remaja sekarang sudah terjerumus ke hal hal yang tidak tepat untuk remaja, antara lain pornografi, narkotika, geng motor, pola hidup konsumtif (Boros)

DEWAN REDAKSI MADU STUNA Penanggung Jawab : Sakirman S.Pd. M.Pd. Pembimbing : Untung Setyo H S.Pd : Yuyun Sopiatun S.Pd Tim Editor : Iman Zam Zani Anggota : Mohammad Sopyan Ivan Rifani Rizky Tyas Prakusya Fajar Sodik Pamungkas Alya Dhiya Maryana Hasna Lutfiah Maulana Fizry Alifta Faris Dwi Novianto Daru Sartika Dewi Muhammad Rizki Hidayat

MARS SMP N 1 Adiwerna B = Do Marcia

Cipt. Mujiarti, S.Pd

dan menonton tayangan televisi, dania maya yang tidak mendidik. Perbincangan kami semakin seru karena Bapak Sakirman S.Pd.M.Pd menanggapi pertanyaan dari kami dengan luwes dan penuh antusias. Mengapa sikap Nasionalisme remaja sekarang berkurang dengan adanya perkembangan zaman saat ini? Sikap Nasionalisme remaja saat ini semakin berkurang karena mereka tidak mengalami penderitaan Bangsa ini pada saat penjajahan, mereka belum paham apa itu Nasionalisme.Mereka asyik dan ego dengan diri sendiri terlena oleh kehebatan teknologi dan fasilitas modern yang setiap hari bertambah. Nasionalisme mereka akan tumbuh bila ada masalah antara Negara kita dengan Negara lain sebagai contoh pertandingan olah raga dan event lain yang membawa nama Bangsa. Oh iya Bapak, seberapa penting peran orang tua dalam perubahan karakter anak untuk perkembangan zaman yang semakin maju saat ini? Dalam hal pen-

didikan, peran orang tua sangat penting, bersifat strategis dalam menentukan keberhasilan anak. Hal ini dikarenakan orang tua lebih dekat dengan anak, orang tua menjadi tauladan yang baik, dan tentunya dapat mengontrol perkembangan anak setiap saat. Kami pun melanjutkan pertanyaan. Karena kesibukan orang tua terkadang lalai akan perkembangan anaknya, membiarkan anak menikmati dampak negative dari perkembangan zaman antara lain Internet yang kurang sehat, apa tanggapan Bapak mengenai hal ini? Orang tua dalam memberikan fasilitas untuk anak tentunya harus diperhatikan terlebih dahulu, fasilitas diberikan jika memang sangat penting dan juga dimanfaatkan sebaik mungkin oleh anak. Karena fasilitas sangat berpengaruh dalam perkembangan dan kualitas pendidikan anak Ujarnya. Pesan apa yang akan Bapak sampaikan untuk Siswa SMP Negeri 1 Adiwerna dalam menyikapi arus perkembangan ini?

Bapak Sakirman S.Pd.M.Pd sebagai figure Kepala SMP Negeri 1 Adiwerna, berpesan supaya anak- anak mempunyai prinsip memegang teguh ajaran agama, taat dan patuh pada aturan agama, adat budaya dan negara. Jangan merusak diri sendiri, jangan mudah tergoda arus negatif. Selamatkan jiwa raga kalian agar tidak tercemar oleh racun pergaulan dan arus negatif perkembangan zaman. Kepada Orang tua/ Wali Siswa agar lebih menjaga putra – putrinya dan mengasuh sebaik-baiknya jangan sampai teledor, lupa dan lengah terhadap perkembangan anak. Anak adalah amanah orang tua, curahkan segala kemampuan untuk anak, karena anak adalah segala-galanya. Menurut Bapak apa bentuk perubahan yang bisa dilakukan oleh anak Indonesia? Sebagai anak bangsa tentunya kita mampu untuk melakukan perubahan di segala bidang, baik di bidang teknologi, ekonomi, dan lain sebagainya dengan catatan tidak

malas dan ada niat untuk berusaha keras. Bagaimana cara Bapak untuk memajukan STUNA supaya lebih unggul? Dengan cara membangun karakter anak bangsa secara optimal dan membekali ilmu ketrampilan, teknologi dan lain sebagainya adalah cara untuk menumbuhkan remaja unggul khususnya di lingkungan Sekolah. Hal ini dapat diwujudkan dengan mengajak semua stikholder Sekolah untuk semangat dalam bekerja dan ikhlas dalam berbuat. Semua sember daya manusia (SDM) harus ditingkatkan kemampuannya, mengadakan sarana prasarana dan fasilitas yang dibutuhkan dalam kemajuan Sekolah (Fasilitas Sekolah memadai). Demi kemajuan tentunya kita bekerjasama dengan berbagai pihak terkait untuk membantu sekolah serta selalu mempersiapkan diri untuk mengikuti lomba di berbagai tingkatan. Apa kesan Bapak selama ini untuk Siswa-siswi STUNA? Sebagai Kepala SMP Negeri 1 Adiwerna mengakui bahwa Siswa STUNA memang luar biasa, saya bangga terhadap Siswa STUNA mereka memiliki karakter sangat baik, sopan santun terhadap Bapak/Ibu Guru dan teman sebayanya, patuh pada tata tertib dan kondusif. Siswa – siswi SMP Negeri 1 Adiwerna pintar, kreatif, aktif ini terbukti dengan kejuaraan yang di raih dalam berbagai kegiatan perlombaan pungkasnya. Semua ini di dukung oleh Bapak/Ibu Guru dan masyarakat SMP Negeri 1 Adiwerna yang memberikan tauladan dan penuh kasih sayang kepada anak – anak. (sopian)

Pilihan STUNA

PROFIL PELUKIS Nama : Umi Rizqiyani TTL : Tegal, 3 Mei 1999 Alamat : Jln. Projo Sumarto II Langgen Talang Tegal

KAMIS, (2/10) warga SMP Negeri 1 Adiwerna menyumbangkan pilihannya pada pe-

milihan Ketua OSIS periode 2013/2014. Siswa turut berpartisipasi dalam menyumbang-

Idul Adha STUNA Bagi 300 Kantong Daging

IDUL Adha 1434H SMP N 1 Adiwerna dengan menyembelih 1 ekor sapi. Kegiatan ini di pimpin oleh Bapak Sakirman S.Pd.M.Pd selaku Kepala SMP N 1 Adiwerna. Kegiatan ini disaksikan Siswa agar dapat memaknai apa itu makna penyembelihan hewan kurban. Antusias Siswa sangat terlihat saat proses pemotongan hewan kurban yang kemudian akan dibagikan kepada warga setempat dan siswa kurang mampu. Selain itu perwakilan Siswa juga langsung turun tangan dalam kegiatan ini untuk membantu dalam hal pemotongan daging.

Bapak Sakirman S.Pd.M.Pd. mengatakan bahwa perayaan ini sangat bermanfaat bagi siswa terutama bagi siswa beragama muslim. Selain itu siswa dapat merasakan keikut sertaannya dalam panitia kurban yang diikuti oleh anak-anak OSIS SMP N 1 Adiwerna. Menurutnya, perayaan Idhul Adha SMP N 1 Adiwerna kedepannya agar bisa lebih baik lagi, dengan menambah jumlah hewan kurban. Pemotongan hewan kurban berlangsung cepat. Hanya butuh waktu 4 jam siswa dapat menyelesaikan pemotongan dan membagikan 300 kantong daging kurban. Sumber dana pembelian hewan kurban ini diperoleh dari sumbangan para siswa SMP N 1 Adiwerna yang diberikan secara ikhlas dan dana sosial. Perayaan Idhul Adha ini juga bertujuan melatih siswa ikhlas dalam menolong sesama. (Ivan Rifani 9B)

kan hak suaranya. Tiga kandidat Ketua OSIS SMP Negeri 1 Adiwerna secara berurutan Winda Arisusanti,Winda Alfiyani,Ikhda Fitria. Selanjutnya akan dipilih untuk menjadi ketua osis melalui bilik suara yang telah disediakan. Pemilihan ini dilakukan secara langsung oleh warga SMP Negeri 1 Adiwerna. Para siswa bergilir menuju ke bilik suara untuk menyalurkan suaranya. Sebelum itu, siswa diberi kartu suara yang bergambar foto ketiga kandidat yang akan dipilih. Proses pemilihan dengan cara mencontreng gambar/nama kandidat yang akan dipilih. Suara siswa lansung dima-

sukkan ke kotak suara yang nantinya dihitung selepas pemilihan. Para guru pun tak mau ketinggalan. Pemilihan berlangsung tertib dan lancar. Perhitungan cepat lansung dilakukan. Hasilnya, Ikhda Fitria mengungguli 2 kandidat lainnya dengan perolehan total 641 suara, meninggalkan Winda Alfiyani (2) 131 suara dan Winda Arisusanti (3) 114 suara. Tujuan daripada pemilihan ini agar menumbuhkan rasa demokrasi pada jiwa siswa-siswi SMP Negeri 1 Adiwerna, juga belajar untuk mengutarakan pendapatnya sesuai dasar Pancasila. (Moh. Sopyan 9a & Ivan Rifani 9b)

PROFIL SINGKAT Ketua Osis SMP Negeri 1 Adiwerna Nama TTL Alamat

: Ikhda Fitria : Tegal, 4 Agustus 2000 : Jl. Mute No 28 RT 11/04, Ds. Gembong Kulon – Talang

Orientasi Program Generasi Berencana

REMAJA sering dikenal dengan istilah masa transisi perubahan pertumbuhan dan perkembangan masa anak-anak menuju masa dewasa. Pada masa remaja banyak mengalami perubahan , godaan dan ujian,gejolak serta emosi belum stabil. Saat ini sering terjadi kenakalan remaja seperti narkoba dan seks bebas. Hal ini karena kurang pengawasan dari orang tua. Remaja umumnya sangat membutuhkan pengawasan dari orang tua, karena

pada remaja ini masih terpengaruh terhadap lingkungan sekitar. Maka pengawasan orang tua dan guru di sekolah sangat berperan penting dalam pembimbingan pada masa remaja saat ini. Dengan ini guru pembimbing di sekolah mengadakan “PERENCANAAN KELUARGA BAGI REMAJA”. Diharapkan dengan adanya kegiatan ini maka siswa dapat menghindari masalahmasalah yang terjadi pada remaja masa kini. KONDISI REMAJA SAAT INI: Jumlah remaja 10-24 th : 64 juta (28,6%) (PPI,20002025,Bapenas, UNFPA 2005). 62,7 % Remaja SMP dan SMA tidak Perawan (Survei KPA,2008) 30% dari 2 Juta Aborsi dilakukan oleh remaja (UNFPA & Bapenas, 2009). 78 % remajadari 3,2 juta jiwa orang adalah pengguna NAPZA (BNN, 2004) 54,3 % dari 17 Ribu pengidap AIDS adalah remaja (Depkes, Maret 2009). (Drs. Saad Tanaim) Hasil kegiatan Orientasi GENRE Bagi murid SMP dan Guru BK Se-BAKORWIL III Tanggal 11 s/d 12 Oktober 2013 Hotel Dafam Pekalongan


RADAR TEGAL 23 okt 2013