Page 1

Volum 66, 2015 - Índex

Destacats de ciència

2 Editorial. Dolors Vaqué El racó de la SCB. Josep Clotet

Flaixos de ciència 62 Una mirada val més que mil paraules. Mónica Marro i Pablo Loza-Álvarez 64 Els peixos són formidables nedadors (i nedar és bo per a ells). Josep V. Planas

3 Pròleg. Àurea Navarro-Sabaté 4 La nova generació de tecnologies de seqüenciació obre una nova era en la genòmica. Mònica Bayés 9 Proteòmica de sistemes complexos. Eva Borràs i Eduard Sabidó 15 Bioinformàtica: una eina essencial per als biòlegs del segle xxi. Marc A. Marti-Renom 19 Microscòpia òptica avançada per a les ciències de la vida: de les seccions òptiques a la nanodissecció òptica. Lídia Bardia, Maria Marsal i Julien Colombelli 25 La microscòpia electrònica de transmissió en biologia cel·lular: valoració de les tècniques i informació de les imatges. Núria Cortadellas i Mercè Durfort 31 La citometria com a eina per aprofundir en la complexitat dels organismes vius i les malalties. Jordi Petriz 37 Experimentació en animals: la revolució dels transgènics. Miquel Garcia i Anna Pujol 43 Espectroscòpia de ressonància magnètica nuclear (RMN). Margarida Gairí, Miguel Feliz i Miquel Pons 48 Tècniques d’imatge in vivo aplicades a la recerca biomèdica. Immaculada Rafecas Jorba 53 Tècniques de diagnòstic molecular aplicades a l’estudi del càncer. Sergio Alonso, Andreu Alibés i Manuel Perucho

treballs

Premi d’Estudiants de la SCB 2014 66 Vulnerabilitat per psicosi mesurada en població sana catalana. Elionora Peña Lozano

de la Societat Catalana de Biologia

RBC

Entrevistes 70 Entrevista a Francisco Guarner. Bru Papell 72 Entrevista a Daniel Simberloff. Bru Papell Premi Nobel 75 El sistema de navegació del cervell Carrera 76 Tècnics a l’Antàrtida. Juan Luis Ruiz Valderrama Àgora 78 Centre de Recerca en Sanitat Animal El personatge 80 Dues vides, un objectiu. Àlvar Martínez Vidal

C RBC

Ciència en societat 82 Divulgació: del model en sèrie a l’experiència en paraŀlel. Francesc Uribe  

Lectures 84 Premi Bromera. Soledat Rubio 84 Premi d’Assaig Josep Vallverdú. Oriol Izquierdo

i vols…

...conèixer els darrers aven ió de seminaris ...participar en l’organitzac ...rebre la revista . llibres, cursos i jornades.. ...gaudir de descomptes en ...per

1912 2012

PLACA NARCÍS

MONTURIOL

2003

CREU DE SANT JORDI

2012

què no t’hi associes? http://scb.iec.cat

Volum 66

ogia Si t’interessa la biolço s

B

A

Premi Gemma Rosell i Romero 2014 68 Les deteriorades bigues de l’envelliment cutani. Víctor Marcos Garcés

treballs de la Societat Catalana de Biologia

Destacats de recerca

Volum 66 2015 · revista anual

ISSN 0212-3037 (edició impresa) ISSN 2013-9802 (edició digital)

C


Treballs de la Societat Catalana de Biologia, revista anual de la SCB Societat Catalana de Biologia, filial de l’Institut d’Estudis Catalans

Carrer del Carme, 47. 08001 Barcelona scb@iec.cat

1) Densitat de coŀlagen en la dermis papiŀlar (p. 69). 2) Melsa infectada de malària, Plasmodium yoelii (p. 26). 3) Salmons americans (Oncorhynchus sp.) (p. 64). 4) Bioinformàtica entre la física i l’estadística (p. 16). 5) Microscòpia de fluorescència d’un embrió de ratolí (p. 22). 6) Equip tècnic instaŀlant el repetidor de ràdio a l’Antàrtida (p. 76). 7) Factors de risc implicats en l’etiologia de les psicosis (p. 66). 8) Josefa i Louis Flexner passejant per Barcelona (1958), cortesia dels University of Pennsylvania Archives (p. 81). Fotografies d’interior: quan no s’indica l’autor en el peu o en l’article, les fotografies són de domini públic o extretes de Wikimedia Commons o de Shutterstock. Tots els articles són propietat dels editors i dels autors respectius. Queda prohibida la reproducció total o parcial per qualsevol mitjà gràfic o electrònic del contingut de treballs de la societat catalana de biologia sense permís exprés. Els editors no es responsabilitzen de l’opinió ni dels continguts dels articles signats. © Societat Catalana de Biologia, Institut d’Estudis Catalans Dipòsit Legal B 12164-1963 ISSN 0212-3037 (ed. impresa) 2013-9802 (ed. digital) Web de la versió digital: http://revistes.iec.cat/index.php.TSCB

COMITÈ DE PUBLICACIONS Dolors Vaqué, presidenta, ICM-CSIC Ricard Roca, vocal, SCB Rafel Abós-Herràndiz, vocal, ICS Josep M. Espelta, vocal, UAB

Imprès per Gràfiques Llob3

EQUIP EDITORIAL Cristina Junyent, cap editorial Ricard Roca, redacció editorial Gerard Sardà, disseny gràfic i maquetació Servei Editorial, IEC, correcció d’originals

La Societat Catalana de Biologia (SCB) és una de les filials més antigues de l’Institut d’Estudis Catalans. Està regida per un Consell Directiu i organitzada en seccions especialitzades, que són les que organitzen les activitats principals que duu a terme la Societat. CONSELL DIRECTIU DE LA SCB

SECCIONS

President: Josep Clotet Vicepresident primer: Jordi Barquinero Vicepresidenta segona: Montserrat Corominas Secretària general: Rosa Pérez Vicesecretari: Carles Ciudad Tresorer: Marc Martí-Renom Vocal d’Acció Territorial: Oriol Cabré Vocal de Comunicació: Marina Rigau Vocal d’Ensenyament: Carles Giménez Vocal de Promocions: Eva Colàs Vocal de Seccions: Albert Jordan Vocal d’Estudiants: Oriol Iborra Delegat de l’IEC: Ricard Guerrero Vocals de Publicacions i Lexicografia: Dolors Vaqué i Ricard Roca

Aqüicultura: Nerea Roher Biofísica: Pere Garriga Biologia Computacional: Roderic Guigó Biologia del Desenvolupament: Francesc Cebrià Biologia Evolutiva: Josefa González Biologia i Indústria: Ramon Roca Biologia Molecular: Albert Jordan Biologia Molecular del Càncer: Oriol Casanovas Biologia i Societat: Maria Fontanals Biologia de la Reproducció: Enric Ribes Ecologia Aquàtica: Ramon Massana Ecologia Terrestre: Josep Maria Espelta Estudiants: Oriol Iborra Ensenyament: Carles Giménez Fisiologia Vegetal: Anna Caño Genòmica i Proteòmica: Mario Cáceres Microbiologia: Jordi Mas-Castellà Neurobiologia Experimental: Carles Saura Senyalització Ceŀlular i Metabolisme: Marc Claret Virologia: Rosa Pintó i Juana Diez SCB a Alacant: Ivan Quesada SCB a Lleida: Mª Ángeles de la Torre SCB a València: Lluís Pascual SCB a Vic: Julita Oliveras


Índex

66

2

Editorial. Dolors Vaqué El racó de la SCB. Josep Clotet

Destacats de recerca N ous reptes, nous enfocaments tècnics. A lbirant la biologia del segle xxi

3 4 9 15 19 25

Pròleg. Àurea Navarro-Sabaté La nova generació de tecnologies de seqüenciació obre una nova era en la genòmica Mònica Bayés

Proteòmica de sistemes complexos Eva Borràs i Eduard Sabidó

Bioinformàtica: una eina essencial per als biòlegs del segle xxi Marc A. Marti-Renom

Microscòpia òptica avançada per a les ciències de la vida: de les seccions òptiques a la nanodissecció òptica

37 43 48 53

Flaixos de ciència

62

Una mirada val més que mil paraules

64

Els peixos són formidables nedadors (i nedar és bo per a ells)

Mónica Marro i Pablo Loza-Álvarez

Josep V. Planas

Premi d’E studiants de la SCB 2014

66

Vulnerabilitat per psicosi mesurada en població sana catalana Elionora Peña Lozano

Premi G emma R osell i R omero 2014

68

Les deteriorades bigues de l’envelliment cutani Víctor Marcos Garcés

Entrevistes

70

Entrevista a Francisco Guarner

Lídia Bardia, Maria Marsal i Julien Colombelli

La microscòpia electrònica de transmissió en biologia ceŀlular: valoració de les tècniques i informació de les imatges

72

Entrevista a Daniel Simberloff

Núria Cortadellas i Mercè Durfort

31

Destacats de ciència

La citometria com a eina per aprofundir en la complexitat dels organismes vius i les malalties Jordi Petriz

Experimentació en animals: la revolució dels transgènics Miquel Garcia i Anna Pujol

Espectroscòpia de ressonància magnètica nuclear (RMN) Margarida Gairí, Miguel Feliz i Miquel Pons

Tècniques d’imatge in vivo aplicades a la recerca biomèdica Immaculada Rafecas Jorba

Tècniques de diagnòstic molecular aplicades a l’estudi del càncer Sergio Alonso, Andreu Alibés i Manuel Perucho

Bru Papell

Bru Papell

Premi N obel

75

El sistema de navegació del cervell

C arrera

76

Tècnics a l’Antàrtida Juan Luis Ruiz Valderrama

Àgora

78

Centre de Recerca en Sanitat Animal

El personatge

80

Dues vides, un objectiu Àlvar Martínez Vidal

Ciència en societat

82

Divulgació: del model en sèrie a l’experiència en paraŀlel Francesc Uribe

L ectures

84

Premi Bromera. Soledat Rubio Premi d’Assaig Josep Vallverdú. Oriol Izquierdo


Editorial

El racó de la SCB

Benvolguts lectors,

Donar diners a la ciència?

Ja fa un número que vaig estrenar-me en aquesta secció explicant-vos el perquè fèiem un canvi de format, i quins eren els continguts que trobaríeu en el volum 65 de la revista treballs de la scb. Val a dir que tots els que vam participar en l’edició teníem una mica de nervis, ja que no sabíem quina seria la resposta dels socis i públic en general. Francament, hem tingut una acollida reconfortant, encara que no tothom hi estigués d’acord, com és lògic. Gràcies a tots aquells, coŀlegues, socis, lectors, que ens vau donar suport abans del canvi i que ara ens heu manifestat el vostre grat, ja fos personalment com a través de les xarxes socials. Moltes gràcies, potser encara més, a aquells que vau acceptar a contracor el canvi i ara ens heu felicitat pel nou format. I tampoc no em vull oblidar d’aquells socis que m’han fet arribar les seves crítiques i disconformitat puntualitzant que el format anterior era més adient per a aquest tipus de publicació. Les crítiques sempre van bé per millorar, i les tindrem en compte; i, per tant, esperonats pels seus comentaris, tenim el repte de poder-los convèncer en els successius volums perquè se la facin seva i l’acabin estimant com el treballs de les etapes anteriors. En el dia de la presentació oficial de la nova etapa de la revista treballs de la scb, el 8 d’abril de 2015, el president de l’IEC, Joandomènec Ros, i el president de la SCB, Josep Clotet, van incidir en el fet que en la història de la revista s’han produït canvis substancials que han marcat les tres etapes anteriors, les quals van contribuir de manera positiva a la seva evolució, ja que els temps hi obligaven. Aquesta, doncs, que esdevé la quarta etapa, neix amb la intenció de no perdre l’essència i exceŀlència dels continguts de l’etapa anterior, a més d’ampliar l’oferta amb altres articles més divulgatius, tots plegats embolcallats amb un format més actual i, per què no dir-ho, més atractiu, que potser, tot plegat, és el reclam per a un públic més diversificat. En el volum 66, a la primera part trobareu en els «Destacats de recerca» deu articles metodològics, aplegats sota el títol: «Nous reptes, nous enfocaments tècnics. Albirant la biologia del segle xxi», coordinats per Àurea Navarro Sabaté. Aquests articles descriuen una sèrie de tècniques que han significat un abans i un després en l’evolució de la ciència al segle xxi. Quant a la segona part —«Destacats de ciència»—, formada per articles de divulgació, hi trobareu diferents apartats amb una oferta molt variada d’articles d’alta divulgació, articles guardonats en el Premi de la SCB per a Estudiants i el Premi Gemma Rosell i Romero, i que estimulen el reconeixement de la recerca feta per joves científics; a més d’altres apartats que ens revelen des de l’existència de personatges cabdals per a la ciència, com ara la científica Josefina Barba, fins a fets que mereixen el reconeixement d’un premi Nobel. També hi trobareu la descripció d’un centre de recerca, en aquest número el CRESA, i algunes reflexions entorn de la recerca i la divulgació que es pot fer als museus de ciència. Només resta dir-vos que amb l’edició d’aquest número s’acomiada una part de l’actual equip editorial —la cap editorial, Cristina Junyent, i en Gerard Sardà, encarregat del disseny gràfic i de la maquetació— als quals estic molt agraïda per la seva professionalitat i amistat, i de ben segur trobaré a faltar. Us deixo, doncs, que gaudiu llegint la revista.

El 10 de juny d’enguany la SCB va celebrar la darrera edició del Premi Sala-Trepat. El doctor Josep Maria Sala-Trepat va ser un prolífic investigador en el camp de l’expressió gènica que va morir a l’edat de 44 anys, i va deixar part del seu llegat dedicat a la promoció dels investigadors joves. D’aquesta manera, i gràcies al suport de la seva família, han estat dinou els investigadors premiats al llarg d’aquests anys, tots de molt renom en els seus camps respectius. Sens dubte, en Josep Maria SalaTrepat ha estat un exemple de mecenatge personal. A Catalunya tenim exemples extraordinaris de mecenatge científic, com són el cas de la Marató de TV3, les curses solidàries, o fins i tot campanyes de recollida de diners per a certes malalties; de fet, aquesta sensibilitat ciutadana podria ser considerada un altre dels fets diferencials del nostre país. Malgrat tot, manca encara aquell clima social present en alguns països on als ciutadans no els cal una excusa externa, sinó que de manera proactiva busquen la donació a entitats de recerca. Potser per això a casa nostra el micromecenatge científic és una idea més desitjada que no pas realitzada i l’exemple de Josep Maria Sala-Trepat n’és més aviat una excepció. Els experts apunten diverses causes per explicar la poca cultura de mecenatge científic. Per a alguns, ens manca la idea, tan present en països de tradició protestant, de retorn social: allò que hom ha de donar per agrair el que s’ha aconseguit al llarg de la vida. D’altres assenyalen la manca d’una llei de mecenatge que incentivi aquest fet (per cert, l’actual govern de l’Estat ha tornat a postposar aquest assumpte per a una altra legislatura). Finalment, són força els qui sospiten que hi ha una mala percepció de la ciència, quan va associada a paraules com ara clonatge, transgènics o experimentació animal. En aquest espai no puc entrar en una anàlisi detallada, però voldria fer algunes pinzellades de la darrera causa, potser perquè com a científics som parcialment responsables de subvertir aquesta percepció negativa que de vegades es té de la ciència. Els científics hauríem de saber transmetre que la nostra és una professió amb un vessant social claríssim, que sense ciència no hi ha progrés social i que, deixeu-m’ho dir així, la ciència és una de les poques armes de construcció massiva que tenim al món d’avui. Per aconseguir que els ciutadans facin pròpies aquestes idees calen moltes línies d’actuació. En proposo algunes com a reflexió: a) Que els científics deixem de veure la divulgació científica com el parent pobre de la recerca, allò a què es dediquen els qui no han triomfat en la ciència. b) Demanar a tots els nivells governamentals més inversió en actes de sensibilització per a la recerca. c) Demanar als mitjans de comunicació més presència del fet científic. La Societat Catalana de Biologia entoma algunes d’aquestes línies d’actuació com a pròpies. De fet, els socis heu de saber que pertanyent a la SCB esteu facilitant aquesta tasca de promoció de les ciències biològiques als ciutadans, als polítics i als mitjans de comunicació, pas necessari per al seu reconeixement social i, a la llarga, imprescindible per incrementar el mecenatge al nostre país. La nostra visió és despertar, de mica en mica, voluntats de gent com en Josep Maria Sala-Trepat, i saber transmetre, sense cap recança de ser gremialistes, que lliurar diners a la ciència és una de les donacions més nobles que es poden fer avui dia per al progrés de la nostra societat. Cal tenir una SCB forta, també per poder influir en aquest àmbit.

Dolors Vaqué, vocal de Publicacions de la SCB

Josep Clotet, president de la SCB


Nous reptes, nous enfocaments tècnics. Albirant la biologia del segle xxi

Pròleg Àurea Navarro-Sabaté, editora Arran de les reflexions entorn del centenari de la SCB, des del cor del Consell Directiu, vam fixar com a objectiu per al segle xxi convertir la SCB en el referent social de les ciències de la vida. Això implica, d’una banda, aglutinar els professionals experts i, de l’altra, saber-ne difondre adequadament l’opinió autoritzada arribant a la societat en general. Aquest doble afany ha estat present en tot moment a l’hora de dissenyar i editar el present monogràfic. Sota el títol: «Nous reptes, nous enfocaments tècnics. Albirant la biologia del segle xxi», hem volgut reunir i donar veu a científics experts en diferents tècniques que seran les eines essencials de la recerca «bio» de les properes dècades per apropar-les de manera entenedora i amb esperit divulgatiu a tota la societat. En aquesta recopilació trobareu una descripció, rigorosa i acurada, de l’estat actual i del futur proper de metodologies com la genòmica, la proteòmica, la bioinformàtica, la microscòpia, la citòmica, els models animals, l’espectroscòpia, la imatge in vivo i, finalment, d’un model d’estudi de càncer com a exemple de confluència de totes. No obstant això, l’abordatge d’un monogràfic estrictament limitat a un nombre màxim de capítols i caràcters obliga a prioritzar-ne els continguts. I així, per exemple, tot i ser eines fonamentals per al desenvolupament de la biomedicina, no hi trobareu cap capítol dedicat a la nanobiotecnologia i la nanomedicina, atès que aquestes ja havien tingut cabuda en el recent volum 64 de l’any 2013: «Les malalties del segle xxi». Alhora, hem volgut cuidar, de manera especial, que la participació provingués de diverses institucions científiques i centres de recerca del nostre territori de la mà dels seus tècnics experts. Malgrat les limitacions, hem pogut donar cabuda a una mostra de l’àmplia i diversa metodologia que s’està utilitzant en els centres del nostre país. Com veureu a continuació, quan us endinseu en la lectura, des dels diversos camps cientificotècnics exposats hi ha una coinci-

dència a presentar els avenços dels darrers anys com una autèntica revolució tecnològica que ens ha posat a l’abast solucions a problemes molt i molt complexos de la biologia. Aquest enfocament es va repetint un capítol rere l’altre. Abordar experiments d’una complexitat creixent també ha suposat un augment espectacular i molt significatiu en la quantitat de dades que es generen. I tot plegat, de manera cada vegada més ràpida i barata. És a dir, aconseguint gran quantitat de resultats amb menys temps de durada dels experiments i amb un cost econòmic per mostra cada vegada menor. I a més, conjuntament, augmentant tant la sensibilitat com la resolució, que ja no sempre van en sentit oposat. Les tècniques es tornen més potents i més eficients, i els resultats són progressivament més precisos, més fiables i, gràcies a l’automatització del procés d’anàlisi de dades es tornen més robustos. Si ens aturem un moment enfront d’aquesta visió d’acceleració tècnica plantejada en el microcosmos científic i l’extrapolem al macrocosmos de la societat, se’ns plantegen molts paraŀlelismes. Com a rerefons una societat culturalment canviant, en un moment d’agitació social, que es veu obligada a reinventar-se i a interaccionar des de la perspectiva d’un món global. Davant del teló, múltiples metodologies científiques, cadascuna abordant un aspecte propi i diferent per acabar convergint plegades en l’avenç global de la medicina personalitzada del futur. I més endavant què? Doncs, de ben segur, seguirem la tendència. Els investigadors ens plantejarem nous reptes i nous dissenys experimentals per respondre a noves demandes que portaran a nous enfocaments tècnics també en el futur, com ho han fet fins al present. Per acabar, des de les línies d’aquest pròleg volem agrair l’esforç de tots els autors pel treball aportat i per complir curosament amb la tasca encomanada. El seu voluntarisme ha estat el motor que ha fet possible l’edició del monogràfic que aquí presentem.


La nova generació de tecnologies de seqüenciació obre una nova era en la genòmica Mònica Bayés Centre Nacional d’Anàlisi Genòmica (CNAG-CRG)

DOI: 10.2436/20.1501.02.151 ISSN (ed. impresa): 0212-3037

Correspondència: Mònica Bayés. Centre Nacional d’Anàlisi Genòmica. Carrer de Baldiri Reixac, 4. 08028 Barcelona. Adreça electrònica: mbayes@pcb.ub.cat.

ISSN (ed. digital): 2013-9802 http://revistes.iec.cat/index.php/TSCB Rebut: 20/10/2014 Acceptat: 04/12/2014

Resum Les tecnologies i aplicacions de la genòmica han experimentat ràpids avanços en els darrers anys. La nova generació de tecnologies de seqüenciació (next generation sequencing, NGS) permeten recopilar informació a escala genòmica d’una mostra per identificar la seqüència dels fragments de DNA, la variació dels nivells d’expressió dels gens o les modificacions de les bases, en un temps relativament curt i a un cost relativament baix. Generen una quantitat immensa de dades que s’interpreten en el marc d’una disciplina, la bioinformàtica, i mitjançant l’ús de potents recursos informàtics. Les tecnologies NGS possibiliten avanços en camps molt diversos com ara la millora genètica dels conreus i del bestiar, la recerca relacionada amb la base molecular de les malalties humanes, el diagnòstic molecular, el desenvolupament de nous agents terapèutics i el descobriment de nous organismes infecciosos.

Paraules clau: genòmica, seqüenciació massiva, genoma, exoma, medicina personalitzada.

Next-generation sequencing technologies open a new era in genomics Summary DNA sequencing technologies and applications have undergone a remarkable evolution during the last few years. Next-generation sequencing (NGS) technologies enable the collection of genome-wide information from a sample and the identification of the DNA nucleotide sequence, the levels of gene expression and/or the nucleotide modification profiles, very rapidly and at relatively low costs. They produce an overwhelming amount of data that is interpreted within a bioinformatics framework that requires significant computational infrastructure. NGS advances open up new opportunities in genomics-assisted breeding of crops and livestock, in research about the molecular base of human diseases and clinical molecular diagnostics, and in the development of new therapies and the discovery of new infectious agents.

Keywords: genomics, massive sequencing, genome, exome, personalized medicine.

Introducció a la genòmica La genòmica és la disciplina que té per objectiu caracteritzar el genoma sencer dels organismes, utilitzant tècniques de biologia molecular a gran escala i l’anàlisi bioinformàtica de les dades (http://www.genome. gov/18016863). El genoma és el conjunt del material genètic de les cèŀlules d’un organisme que s’emmagatzema en forma de DNA (àcid desoxiribonucleic) i que conté tota la informació per al desenvolupament i funcionament correctes de l’organisme. La molècula de DNA està formada per dues cadenes d’unes unitats químiques que anomenem nucleòtids o bases, enrotllades al voltant d’un eix comú formant una doble hèlix. Hi ha quatre tipus de bases, que identifiquem amb les lletres A, T, G i C (adenina, timina, guanina i citosina). Les dues cadenes queden unides per ponts d’hidrogen formats entre la base d’una cadena i la de l’altra cadena amb la qual queda enfrontada. Els aparellaments sempre són entre A-T i G-C. Anomenem gens els segments de DNA que confereixen instruccions específiques a la cèŀlula, sovint mitjançant la síntesi de proteïnes a partir de molècules intermèdies anomenades RNA missatgers. Les proteïnes són les que formen el òrgans i teixits del cos, i controlen les reaccions químiques i la comunicació entre les cèŀlules. Una mutació en el DNA d’una cèŀlula pot produir una proteïna aberrant que pot alterar els processos normals de l’organisme i donar lloc a una malaltia com ara el càncer. El genoma humà té unes tres mil milions de bases i entorn de vint mil gens, cada un dels quals dóna lloc a tres proteïnes diferents de

4

mitjana. La primera seqüència del genoma humà, és a dir, l’ordre de la gran majoria de les bases en la cadena del DNA, es va completar l’any 2003 en el marc d’una coŀlaboració internacional, el Projecte Genoma Humà (http://www.genome.gov/10001772). És tracta d’un dels assoliments més importants de la biologia; el projecte es va dur a terme en tretze anys i es calcula que va tenir un cost d’uns tres mil milions de dòlars (vegeu la figura 1). Totes les dades del projecte estan dipositades en bases de dades púbiques i de lliure accés per tal de facilitar la recerca i promoure l’obtenció de beneficis i recursos per a la societat. Els resultats del projecte van posar de manifest que dues persones qualssevol comparteixen el 99,9 % del seu genoma. Les posicions en què dos individus difereixen en una única base s’anomenen SNP (single nucleotide polymorphisms) (Brookes, 1999). En el genoma també podem trobar reordenaments genòmics o variants estructurals que afecten centenars o milers de bases, com ara inversions, delecions o duplicacions.

Les tècniques d’enginyeria genètica El Projecte Genoma Humà va ser possible gràcies a les tecnologies d’enginyeria genètica desenvolupades a partir dels anys setanta (vegeu la figura 1). Aquestes tecnologies utilitzen enzims de restricció, polimerases i ligases per tallar, amplificar i unir fragments de DNA i generar molècules de DNA recombinant, formades per fragments que originalment no estaven junts. D’aquesta manera es van aïllar els primers gens i es van amplificar a l’interior de bacteris o virus en un procés que anomenem clonatge. Es marca un fragment de DNA homòleg

Treballs de la Societat Catalana de Biologia, 66: 4-8


La nova generació de tecnologies de seqüenciació obre una nova era en la genòmica

2014 Primer seqüenciador que permet seqüenciar un genoma sencer (Genome Analyzer, Illumina)

2006

2005

Obtenció de la seqüència completa del genoma humà

Seqüenciació del primer genoma bacterià (Haemophilus influenzae)

1990

1985 Frederick Sanger desenvolupa el mètode de seqüenciació que porta el seu nom

Primer seqüenciador de NGS (GS20, 454 Life Sciences)

2003

1995

Inici del Projecte Genoma Humà

S’estima que s’ha seqüenciat el genoma de més de 200.000 persones

Kary Mullis inventa la reacció en cadena de la polimerasa (PCR)

1977

1953

Francis Crick i James Watson desxifren l'estructura en doble hèlix de la molècula de DNA

Figura 1. Principals esdeveniments de la història de la genòmica.

al gen d’interès amb una molècula radioactiva o fluorescent, i s’utilitza com a sonda per identificar el clon que conté el gen, mitjançant un procés d’hibridació entre la sonda i el DNA del clon. Des de l’any 1977 s’utilitza el mètode de Sanger per determinar l’ordre de les bases de fragments de DNA fins a una quilobase (1.000 pb) en un procés que anomenem seqüenciació (Sanger et al., 1977). Es basa en l’ús d’un enzim, la DNA-polimerasa, per generar noves cadenes a partir de la cadena que es vol seqüenciar. En aquesta síntesi es generen fragments que acaben en les quatre possibles bases del DNA marcades cadascuna amb una molècula fluorescent diferent. Aquests fragments se separen després segons la mida en una matriu porosa i es detecten mitjançant el senyal fluorescent que emeten. Amb aquest mètode es va obtenir la primera seqüència del genoma humà i també de molts altres genomes. Actualment hi ha instruments amb noranta-sis capiŀlars que permeten generar al voltant de dues megabases (2.000.000 pb) de seqüència en vint-i-quatre hores. La tècnica de la reacció en cadena de la polimerasa (PCR) va ser inventada l’any 1985 per Kary B. Mullis (Saiki et al., 1985). Permet obtenir moltes còpies de fragments específics de DNA a partir d’una quantitat original mínima. Aquesta tècnica utilitza DNA-polimerases per replicar fragments de DNA utilitzant cicles que alternen temperatures altes i baixes per separar i ajuntar les cadenes de DNA després de cada fase de replicació. La PCR va revolucionar molts aspectes de la biologia molecular i el diagnòstic clínic. S’utilitza també en investigacions de criminologia per identificar persones a partir de mostres de cabell. Aquestes tècniques han proporcionat eines genètiques d’ús habitu-

al en els laboratoris de recerca, hospitals i empreses de biotecnologia. El seu impacte ha estat tan important que primer Sanger l’any 1980 i després Mullis l’any 1993 van ser guardonats amb el Premi Nobel de Química.

Els microxips de DNA Un microxip de DNA és una coŀlecció de milers de fragments petits de DNA coneguts i ancorats sobre una superfície sòlida, sovint una placa de vidre de la mida d’un portaobjectes per a observacions al microscopi (per a una revisió, vegeu Bumgarner, 2013). Hi ha diversos mètodes que permeten obtenir aquests fragments a gran escala i immobilitzar-los de manera ordenada en uns pocs centímetres o miŀlímetres quadrats. En els experiments de microxips s’hibriden una o més mostres complexes de DNA o RNA marcades amb molècules fluorescents, que anomenem sondes, amb els fragments de DNA immobilitzats, anomenats dianes (vegeu la figura 2). Quan les sondes troben les seves seqüències complementàries entre les dianes immobilitzades es formen dúplexs més o menys estables que es poden detectar amb un escàner d’alta resolució que registra la llum emesa en cada punt del microxip. La intensitat del senyal fluorescent que es detecta en un punt és proporcional al nombre de dúplexs que s’han format amb aquells fragments diana i és, per tant, un indicador de l’abundància relativa de cada seqüència de la mostra. Tot i la mida reduïda dels microxips, en cada experiment es genera una gran quantitat de dades que es processen amb programes informàtics especialitzats que permeten extreure les dades primàries d’intensitat de les imatges escanejades, normalitzar aquestes intensitats, eliminar el soroll de fons i finalment manipular les dades per treure’n les conclusions biològiques escaients. Els microxips van sorgir als anys noranta com a mètode per determinar a gran escala l’expressió relativa dels gens en un teixit o en diverses situacions experimentals, com ara la determinació dels efectes d’un fàrmac sobre el conjunt de RNA de les cèŀlules (el transcriptoma) (Schena et al., 1995). També es poden utilitzar per analitzar genomes. Hi ha plataformes de microxips comercials per analitzar milions de SNP coneguts al llarg del genoma (per a una revisió, vegeu Ragoussis, 2009). S’anomenen xips de genotipatge i contenen centenars de milers de petits fragments de DNA entre vint i seixanta nucleòtids que permeten determinar si el DNA de la mostra conté un nucleòtid determinat en una posició concreta. En un únic experiment es poden determinar fins a cinc milions de posicions del genoma humà. Finalment, també es poden utilitzar els microxips per identificar aquells elements reguladors del DNA als quals s’uneix una determinada proteïna o un factor de transcripció, o per detectar l’estructura de les diverses formes dels RNA missatgers. Gràcies als microxips es poden interrogar milers o fins i tot milions de seqüències en un únic experiment, sense cap hipòtesi prèvia, de manera ràpida i relativament barata. A diferència de la seqüenciació, però, en aquests experiments només podem detectar aquelles seqüències que coneixem i que estan presents en el microxip.

La nova generació de tecnologies de seqüenciació L’any 2004 hi va haver un canvi de paradigma en el camp de la seqüenciació del DNA i de la genòmica, amb l’aparició d’una nova generació de tecnologies de seqüenciació (NGS) o seqüenciació massiva (per a revisions, vegeu Buermans i Dunnen, 2014, i Dijk et al., 2014). Les tecnologies de NGS combinen l’ús de tècniques d’enginyeria genètica, la nanotecnologia i la generació de milions de dades basades en la imatge.

Treballs de la Societat Catalana de Biologia, 66: 4-8

5


Mònica Bayés

Fabricació del microxip: immobilització de petits fragments de DNA diana sobre una superfície sòlida

1

2

Sonda fluorescent

DNA

Preparació de les sondes: marcatge amb fluorescència del DNA o RNA de la mostra que es vol estudiar

Hibridació: es formen dúplexs estables entre les sondes i les seves seqüències complementàries del microxip

4

Detecció: un escàner d’alta resolució detecta la intensitat del senyal fluorescent en cada punt del microxip

5

Nivells expressió

3

Gen A Gen B Gen C

Gen A Gen B Gen C

Anàlisi: la intensitat del senyal fluorescent indica l’abundància relativa de cada seqüència de cada mostra

Figura 2. Esquema d’un experiment de microxips per detectar l’expressió de tots els gens del genoma.

A diferència de la seqüenciació pel mètode de Sanger, que es basa en l’anàlisi individual de fragments de DNA, els seqüenciadors de NGS són capaços d’analitzar milions de fragments de DNA en paraŀlel i, en conseqüència, de seqüenciar un genoma humà sencer en pocs dies. Generen una quantitat de dades genòmiques impensable fa deu anys, de qualsevol organisme, en coneguem o no el genoma prèviament, i de manera robusta. En els últims anys han aparegut diverses plataformes en el mercat però el seu flux de treball és conceptualment similar (vegeu la figura 3). El primer pas consisteix a fragmentar el DNA de manera aleatòria i afegir en els extrems dels milions de fragments resultants unes seqüències comunes. Després s’aïllen les molècules individuals d’aquesta biblioteca i s’obtenen milions de còpies de cadascuna mitjançant la tècnica de la PCR. Un cop amplificades les molècules originals, se seqüencien utilitzant equips que combinen sistemes de microfluids i la detecció d’imatges d’elevada resolució a temps real. La majoria de les plataformes actuals utilitza la seqüenciació per síntesi, és a dir, la fabricació d’una cadena a partir d’una cadena motlle gràcies a una DNA-polimerasa. Les lectures són una mica més curtes (generalment entre 75 i 400 pb) que les que s’obtenen pel mètode de Sanger (800-1.000 pb), però permeten seqüenciar els dos extrems de cada fragment i això facilita l’alineament amb el genoma de referència i la detecció de reordenaments genòmics. Diverses cases comercials han desenvolupat equips de NGS, com ara el HiSeq4000 d’Illumina, el Genome Sequencer FLX de Roche o el Proton de Life Technologies. Difereixen en els mètodes per preparar, aïllar i amplificar les biblioteques de DNA, en l’estratègia per detectar el senyal resultant de la seqüència, que pot ser òptic, químic o elèctric, i en la quantitat de gigabases (Gb, 1 Gb = 1.000.000.000 pb) que es poden generar en cada carrera o experiment. Avui dia el seqüenciadors més populars són els HiSeq4000 d’Illumina, que permeten generar 1.500 Gb de seqüència (l’equivalent a seqüenciar dotze genomes humans amb una cobertura alta) en una sola carrera que dura aproximadament quatre dies. Alguns d’aquests són instruments més petits, com el MiSeq (Illumina) o l’Ion Torrent (Life Technologies), pensats per a investigadors individuals o per a l’àmbit clínic. En l’extrem oposat trobem els nous equips X Ten d’Illumina, que permeten seqüenciar 18.000 geno-

6

mes humans a l’any per menys de mil dòlars cadascun. Recordem que es van necessitar més de deu anys i una inversió de tres mil milions de dòlars per obtenir la primera seqüència completa del genoma humà. De manera paraŀlela als avanços de les tecnologies de NGS, les eines bioinformàtiques per a l’anàlisi de les dades resultants han experimentat una ràpida evolució. Es tracta d’algoritmes i programari que ens permeten en primer lloc avaluar la qualitat dels resultats de la seqüenciació i alinear les lectures amb una seqüència ja coneguda del genoma, de manera que cadascuna dels milions de lectures de 75-400 pb que es generen en un experiment quedi aparellada amb les posicions equivalents del genoma de referència (vegeu la figura 4). El segon pas és identificar quines d’aquestes posicions o nucleòtids difereixen del genoma de referència. Finalment, cal anotar totes aquestes variacions, és a dir, identificar en quin gen es troben, si han estat descrites amb anterioritat i predir-ne les conseqüències. Tots aquests passos són crucials per a la interpretació correcta de les dades (per a una revisió, vegeu Dolled-Filhart et al., 2013). En aquells casos en què no es disposa d’un genoma de referència amb el qual es poden comparar els resultats, s’han desenvolupat algoritmes que reconstrueixen la seqüència de tot el genoma a partir de les lectures, acoblant unes amb altres, en un procés que s’anomena acoblament de novo. Es pot trobar una llista actualitzada d’aplicacions bio­ informàtiques per a l’anàlisi de dades genòmiques en diversos fòrums, com per exemple SEQanswers (http://www.seqanswers.com).

Figura 3. Esquema d’un experiment de seqüenciació d’un genoma amb les noves tecnologies de seqüenciació, utilitzant la plataforma desenvolupada per la casa comercial Illumina (http://www.illumina.com).

1

Genoma que es vol seqüenciar

2

Fragmentació del DNA genòmic

3

Lligació de seqüències adaptadores als extrems dels fragments de DNA

4

Ancoratge dels fragments de DNA en un suport sòlid

5

Amplificació dels fragments de DNA

G

6

Polimerasa Encebador

T

C

A A

ATTGCG ATTGCGACATCAGCGAGGG

G

Seqüenciació dels fragments de DNA utilitzant nucleòtids marcats amb fluorescència

7

Captació de la fluorescència emesa pels nucleòtids incorporats amb una càmera d’alta resolució

8

Transformació de les imatges fluorescents en seqüències de nucleòtids

Treballs de la Societat Catalana de Biologia, 66: 4-8


La nova generació de tecnologies de seqüenciació obre una nova era en la genòmica

Les tecnologies de seqüenciació del futur Actualment diverses companyies desenvolupen el que s’anomena la tercera generació de tecnologies de seqüenciació (Buermans i Dunnen, 2014). Aquestes tecnologies presenten sistemes de detecció extremadament sensibles que permeten la seqüenciació de molècules individuals de DNA, sense necessitat d’amplificació mitjançant PCR. Alguns d’aquests equips, com els de Complete Genomics i Pacific Bioscience, ja estan disponibles. Una altra casa comercial, Oxford Nanopores, està seguint una estratègia radicalment diferent, basada en la detecció dels canvis en el potencial de membrana a mesura que els nucleòtids passen a través d’uns petits porus. Es tracta d’un camp en constant evolució, però sembla clar que la tecnologia del futur podrà seqüenciar molècules individuals tant de DNA com de RNA, generar lectures de diverses megabases de longitud, de manera ràpida i amb una elevada precisió, i a un cost molt assequible.

Aplicacions clíniques de la nova generació de tecnologies de seqüenciació En molts hospitals i centres de recerca s’utilitzen les tecnologies de seqüenciació massiva per desxifrar la complexitat dels genomes normals i dels genomes associats a malaltia. L’objectiu del Consorci Internacional del Genoma del Càncer (ICGC, http://www.icgc.org) és obtenir una descripció completa dels canvis del genoma i del transcriptoma en cinquanta tipus de tumors diferents (The International Cancer Genome Consortium, 2010). Per identificar tots els canvis genòmics que contribueixen al procés tumoral es comparen les seqüències completes de DNA de mostres tumorals i de teixits normals del mateix individu. D’aquesta manera s’han obtingut els perfils moleculars del genoma tumoral d’individus amb leucèmia aguda mieloide, càncer de pulmó, glioblastoma, melanoma maligne i càncer de mama, entre d’altres. Aquests estudis han revelat que els tumors hemàtics (leucèmies i limfomes), els sarcomes i els càncers pediàtrics presenten taxes de mutació més baixes. El nombre més gran de mutacions el trobem en aquells tumors sotmesos a exposicions a agents mutagènics exògens, com en el càncer de pulmó i el melanoma (per a una revisió, vegeu Chmielecki i Meyerson, 2014). En aquests casos és molt difícil distingir les mutacions que realment tenen una influència en la patologia del càncer (mutacions de tipus driver) d’aquelles que apareixen a l’atzar (mutacions de tipus passenger). S’han trobat mutacions driver en gens de proliferació ceŀlular, com ara gens de transducció de senyal i de regulació del cicle ceŀlular, i també en gens del metabolisme, la transcripció i el processament de l’RNA, entre d’altres vies. En alguns casos aquestes mutacions permeten establir el pronòstic del tumor o ens donen pistes sobre el tipus de teràpia més adequada per a aquell individu, cosa que fa possible la medicina «personalitzada». El projecte PanCancer fa un pas més enllà i coordina l’anàlisi conjunta de les dades de diversos tipus de tumors per identificar patrons genòmics comuns en el càncer (Hoadley et al., 2014). La majoria de les malalties hereditàries o familiars estan causades per mutacions molt poc freqüents situades en les regions dels gens que codifiquen proteïnes, els exons, i que representen una petita part (un 2 %) del genoma humà. S’anomena exoma el conjunt d’aquestes regions. S’han desenvolupat mètodes basats en la hibridació de fragments de DNA per capturar regions genòmiques específiques, com ara l’exoma, usant un conjunt de sondes de DNA que són complementàries a les regions d’interès. Aquests mètodes de captura de l’exoma, juntament amb les tecnologies de NGS, són extremadament valuosos per identi-

ficar les mutacions que causen malalties hereditàries. En aquests estudis se seqüencia l’exoma d’uns pocs individus afectats per la malaltia, s’identifiquen totes les variacions o mutacions fent comparacions amb una seqüència de referència, i se seleccionen aquelles que no s’han descrit en individus sans i que provoquen alteracions en la proteïna (vegeu la figura 4) (per a una revisió, vegeu Rabbani et al., 2012). D’aquesta manera s’ha pogut identificar el gen responsable de la síndrome de Miller (Ng et al., 2010) i d’unes cent cinquanta malalties hereditàries de les més de sis mil descrites. Finalment, les tècniques de NGS també s’utilitzen per a la identificació ràpida de patògens en malalties cròniques o agudes (per a una revisió, vegeu Padmanabhan et al., 2013). Permeten detectar quantitats molt baixes del patogen sense necessitat de cultivar-lo i detectar la presència, per exemple, de gens que confereixen resistència a antibiòtics. Per iŀlustrar els avanços en aquest camp, en les bases de dades públiques trobem actualment la seqüència de més de deu mil mostres del virus de la grip. Les tècniques d’enginyeria genètica i els microxips s’utilitzen des de fa temps per a la identificació d’individus amb risc elevat de desenvolupar càncer de mama, per a l’aplicació de teràpies personalitzades en càncer en funció del perfil de mutacions del tumor o per al consell genètic en algunes malalties hereditàries, entre d’altres. La seqüenciació mèdica tindrà un paper molt important en la pràctica clínica del segle xxi, també amb finalitats diagnòstiques, preventives o terapèutiques. Algunes empreses i institucions, com ara Illumina (http://clinical. illumina.com/clinical.ilmn) i el Baylor College of Medicine (https:// www.bcm.edu/research/medical-genetics-labs), ofereixen serveis de seqüenciació de panels de gens, exomes o genomes amb finalitats mèdiques, en alguns casos directament als consumidors. És urgent establir un marc que reguli temes importants com ara la qualitat dels experiFigura 4. Ús de les noves tecnologies de seqüenciació per a la identificació de mutacions responsables de malalties hereditàries.

1

afectat

afectat

sa

Família en la qual segrega una malaltia hereditària

sa

afectat

sa

Extracció del DNA de tots els membres de la família

2 Exó 1

Exó 2

Exó 3

Gen A

3

Captura de l’exoma de tots els membres de la família

Proteïna A

Seqüenciació massiva dels exomes de tots els membres de la família

4

Genoma de referència GGTCTATCCCCGACTATCAGTTCAGGCATATCTCCCT

5

TCTATCCCCGACTATCGGT CTATCCCCGACTATCG ATCCCCGACTATCAGT TCCCCGACTATCGGTTCAG CGACTATCAGTTCAGGCAT

Treballs de la Societat Catalana de Biologia, 66: 4-8

Comparació de les seqüències dels individus sans i els afectats i identificació de la mutació responsable de la malaltia

7


Mònica Bayés

ments, la confidencialitat de les dades, el consentiment informat dels pacients i l’ús de la informació obtinguda no directament relacionada amb l’objecte de l’anàlisi (Abul-Husn et al., 2014).

Altres aplicacions de la nova generació de tecnologies de seqüenciació Les tecnologies de NGS possibiliten l’estudi dels organismes a una resolució sense precedents. Utilitzant aquestes plataformes podem cercar variacions en la seqüència del DNA però també determinar el nombre de còpies d’una seqüència, l’estructura, l’estat de metilació dels nucleòtids i els perfils d’expressió gènica. Processos tan diferents com la replicació, la transcripció, la traducció, la metilació i l’estructura del DNA es poden estudiar utilitzant la seqüenciació. Actualment, en la base de dades del National Center for Biotechnology Information (NCBI, http://www.ncbi.nlm.nih.gov/assembly) hi ha informació sobre la seqüència genòmica de més de dues mil espècies diferents. Hi ha iniciatives internacionals per seqüenciar mil genomes de fongs (http://1000.fungalgenomes.org), mil genomes d’insectes (http:// www.arthropodgenomes.org/wiki/i5K) i deu mil genomes de vertebrats

(https://genome10k.soe.ucsc.edu), entre d’altres. En un futur no gaire llunyà es disposarà del genoma de com a mínim una espècie de cada grup taxonòmic (Ellegren, 2013). Finalment, pel que fa a la indústria ramadera i de l’agricultura, la genòmica permet accelerar els processos de millora genètica tant en plantes com en animals. Es disposa ja del genoma de la majoria d’espècies vegetals d’interès agrícola i s’han utilitzat marcadors genètics per millorar la qualitat dels grans d’arròs, per aconseguir que els tomàquets madurin de manera uniforme o per controlar els processos de floració en patates (Bolger et al., 2014). En el camp de la ramaderia les tècniques genòmiques són una eina fonamental per aconseguir bestiar més productiu i aliments més saludables (Ludu i Plastaw, 2013).

Agraïments Vull expressar el meu agraïment a la doctora Berta Fuster i a l’Anna Borrell per la coŀlaboració en la confecció de les figures d’aquest article. El Centre Nacional d’Anàlisi Genòmica està finançat pel Ministeri d’Economia i Competitivitat i per la Generalitat de Catalunya.

Bibliografia Abul-Husn, N. S. [et al.] (2014). «Implementation and utilization of genetic testing in personalized medicine». Pharmgenomics. Pers. Med., 7: 227-240. Bolger, M. E. [et al.] (2014). «Plant genome sequencing - applications for crop improvement». Curr. Opin. Biotechnol., 26: 31-37. Brookes, A. J. (1999). «The essence of SNPs». Gene, 234: 177-186. Buermans, H. P.; Dunnen, J. T. den (2014). «Next generation sequencing technology: Advances and applications». Biochim. Biophys. Acta., 1842: 1932-1941. Bumgarner, R. (2013). «Overview of DNA microarrays: types, applications, and their future». Curr. Protoc. Mol. Biol., cap. 22, un. 22.1. Chmielecki, J.; Meyerson, M. (2014). «DNA sequencing of cancer: what have we learned?». Annu. Rev. Med., 65: 63-79. Dijk, E. L. van [et al.] (2014). «Ten years of next-generation sequencing technology». Trends Genet., 30: 418-426. Dolled-Filhart, M. P. [et al.] (2013). «Computational and bioinformatics frameworks for next-generation whole exome and genome sequencing». Scientific World Journal, 2013: 730210. Ellegren, H. (2014). «Genome sequencing and population genomics in non-model organisms». Trends Ecol. Evol., 29: 51-63. Hoadley, K. A. [et al.] (2014). «Multiplatform analysis of 12 cancer types reveals molecular classification within and across tissues of origin». Cell, 158: 929-944.

8

Ludu, J. S.; Plastow, G. S. (2013). «Livestock and the promise of genomics». Genome, 56: 556-566. Ng, S. B. [et al.] (2010). «Exome sequencing identifies the cause of a mendelian disorder». Nat. Genet., 42: 30-35. Padmanabhan, R. [et al.] (2013). «Genomics and metagenomics in medical microbiology». J. Microbiol. Methods, 95: 415-424. Rabbani, B. [et al.] (2012). «Next-generation sequencing: impact of exome sequencing in characterizing Mendelian disorders». J. Hum. Genet., 57: 621-632. Ragoussis, J. (2009). «Genotyping technologies for genetic research». Annu. Rev. Genomics Hum. Genet., 10: 117-133. Saiki, R. K. [et al.] (1985). «Enzymatic amplification of beta-globin genomic sequences and restriction site analysis for diagnosis of sickle cell anemia». Science, 230: 13501354. Sanger, F. [et al.] (1977). «DNA sequencing with chain-terminating inhibitors». Proc. Natl. Acad. Sci. USA, 74: 5463-5467. Schena, M. [et al.] (1995). «Quantitative monitoring of gene expression patterns with a complementary DNA microarray». Science, 270: 467-470. The International Cancer Genome Consortium (2010). «International network of cancer genome projects». Nature, 464: 993-998.

Treballs de la Societat Catalana de Biologia, 66: 4-8


Proteòmica de sistemes complexos Eva Borràs1,2 i Eduard Sabidó1,2 1 2

Unitat de Proteòmica, Departament de Ciències Experimentals i de la Salut, Universitat Pompeu Fabra Unitat de Proteòmica, Centre de Regulació Genòmica

Correspondència: Eduard Sabidó. Unitat de Proteòmica CRG/UPF. Carrer del doctor Aiguader, 88. 08003 Barcelona. Adreça electrònica: eduard.sabido@crg.cat.

DOI: 10.2436/20.1501.02.152 ISSN (ed. impresa): 0212-3037 ISSN (ed. digital): 2013-9802 http://revistes.iec.cat/index.php/TSCB Rebut: 13/11/2014 Acceptat: 23/02/2015

Resum

Proteomics of complex systems

La proteòmica basada en espectrometria de masses és una tècnica analítica d’identificació i quantificació de proteïnes que, gràcies als avenços de les últimes dècades, es troba actualment en disposició de resoldre problemes complexos de la biologia molecular i de sistemes. Avui dia s’estan posant les bases per a la consolidació d’aquestes aplicacions i per desenvolupar-les de manera que la proteòmica tingui un impacte real en la medicina personalitzada del futur. Els nous desenvolupaments han fet augmentar significativament la sinergia entre la proteòmica i la biologia molecular, especialment en l’anàlisi de les xarxes de proteïnes i en dinàmiques temporals i espacials. Aquests estudis han permès aprofundir en l’elucidació de mecanismes d’acció i les seves disfuncions, la creació de models de resposta a tractaments, la identificació de biomarcadors per a la classificació i estratificació de pacients, i la concreció de l’impacte de la variabilitat genètica sobre els fenotips observats.

Paraules clau: proteòmica, espectrometria de masses, biologia, medicina personalitzada.

Summary Mass spectrometry-based proteomics is an analytical technique for the identification and quantification of proteins which, thanks to advances in recent years, is now able to address complex problems in molecular biology and systems biology. Currently, efforts are being conducted to consolidate these applicating and to further develop in order for proteomics to have a real impact on the future of personalized medicine. New developments have significantly increased the synergy between proteomics and molecular biology, especially in the analysis of protein networks and their temporal and spatial dynamics. These studies have allowed the elucidation of certain mechanisms of action and their dysfunctions, the creation of models of response to treatment, the identification of biomarkers for patient stratification and classification, and the assessment of the impact of genetic variation on the observed phenotypes.

Keywords: proteomics, mass spectrometry, biology, personalized med-

icine.

Identificació dels components biològics Durant les últimes dècades la biologia molecular s’ha centrat en la identificació, enumeració i quantificació de les molècules que componen els organismes vius, incloent-hi el DNA, l’RNA, els metabòlits i les proteïnes. Aquest plantejament ha resultat extremadament efectiu i ha permès avançar significativament en el coneixement dels principals mecanismes de comunicació, resposta i regulació gènica de la cèŀlula. En aquest context, la proteòmica basada en espectrometria de masses ha tingut un paper rellevant en la identificació sistemàtica de les proteïnes ceŀlulars i de les seves modificacions i interaccions. Al llarg dels últims anys s’han fet diversos estudis exhaustius de proteòmica per identificar els components proteics de les cèŀlules i establir la topologia de les vies de senyalització i de les xarxes d’interacció proteïna-proteïna, tant en estats de salut com de malaltia. Aquests esforços han conduït a la publicació recent del primer esborrany del proteoma humà, en el qual s’han identificat més de divuit mil proteïnes diferents i se n’han caracteritzat els patrons d’abundància en la majoria de teixits i òrgans de l’organisme (Kim et al., 2014; Wilhelm et al., 2014). L’estratègia basada en espectrometria de masses més utilitzada per a la identificació dels components proteics que conformen els sistemes biològics ha estat la proteòmica de cribratge. En aquesta estratègia analítica les mescles de proteïnes es digereixen a pèptids mitjançant una proteasa específica. A continuació, els pèptids se separen mitjançant cromatografia en fase líquida, es converteixen a ions en fase gasosa, i s’analitzen mitjançant un espectròmetre de masses (Steen et al., 2004). En l’espectròmetre de masses, els pèptids es detecten en forma

d’ions en una primera exploració, i els ions més abundants se seleccionen automàticament per fragmentar-los i detectar posteriorment els fragments peptídics. Per poder identificar els pèptids presents en una mostra els espectres de fragmentació obtinguts es comparen amb espectres de fragmentació teòrica generats a partir d’una base de dades, i la identificació de les proteïnes s’aconsegueix assignant les seqüències peptídiques a les seves proteïnes corresponents (vegeu la figura 1). Aquesta tècnica té la capacitat d’identificar milers de proteïnes en qualsevol tipus ceŀlular o organisme, i per tant, proporciona una àmplia visió sobre la complexitat i la composició de la mostra estudiada, així com una estimació de l’abundància relativa de les proteïnes identificades i de les seves modificacions. La proteòmica de cribratge no requereix cap coneixement previ sobre la composició de la mostra i ha estat durant molt temps el mètode preferit en els estudis biològics que requereixen una elevada cobertura del proteoma. Una de les aplicacions més rellevants de la proteòmica basada en espectrometria de masses ha estat l’estudi de les modificacions posttraduccionals de proteïnes, com ara la fosforilació, i el seu impacte en les xarxes de senyalització ceŀlular, en l’activitat i la localització de les proteïnes, i en la determinació de les interaccions amb altres macromolècules (Christophorou et al., 2014). Tradicionalment, l’estat de fosforilació de les proteïnes s’ha determinat mitjançant mètodes bioquímics basats en anticossos (per exemple, transferència Western), però aquestes tècniques es veuen limitades a uns pocs analits per als quals hi ha anticossos disponibles. En canvi, l’espectrometria de masses ofereix la capacitat d’identificar un gran nombre de proteïnes i els llocs específics de fosforilació, i proporciona així una informació

Treballs de la Societat Catalana de Biologia, 66: 9-14

9


Eva Borràs i Eduard Sabidó

a digestió enzimàtica

extracció de proteïnes teixit

pèptids

proteïnes

b analitzador de masses detector

intensitat

MS1

mode de cribratge analitzador de masses detector

mode de filtre

MS2

intensitat

analitzador de masses

mode de cribratge m/z

c puntuació

espectres teòrics comparació

MS2

intensitat

intensitat

MS2

Assignació funcional dels components biològics

m/z

MS2

intensitat

assignació

...

m/z

MS2

intensitat

intensitat

MS2 AEETLPFTR FDR ≤ 1%

m/z

Figura 1. Esquema general de la identificació de components proteics mitjançant proteòmica de cribratge. a) Inicialment s’extreuen les proteïnes de les mostres biològiques, i s’obté una mescla de pèptids mitjançant la digestió de les proteïnes amb una proteasa específica, típicament tripsina. b) La mescla peptídica se separa per cromatografia en fase líquida, i els pèptids entren a l’espectròmetre de masses, en el qual es detecten en forma d’ions en una primera exploració (MS1) i, a continuació, els ions més abundants se seleccionen automàticament per fragmentar-los i detectar-los posteriorment (MS2). c) Finalment, els espectres de fragmentació obtinguts es puntuen segons la seva similitud amb espectres de fragmentació teòrics generats a partir d’una base de dades, i cada espectre s’assigna a una seqüència peptídica amb una determinada probabilitat. Els errors d’assignació es controlen a escala d’experiment mitjançant el control de falsos positius (FDR).

més precisa, i alhora, una visió global de l’estat de fosforilació de la cèŀlula. La identificació de fosfopèptids per espectrometria de masses ha estat tradicionalment difícil a causa de la seva naturalesa subestequiomètrica i transitòria, així com de les seves propietats cromatogràfiques i del seu patró de fragmentació. Per fer front a aquestes particularitats, s’han desenvolupat diferents tècniques per detectar pèptids fosforilats amb elevada sensibilitat, com ara a) mètodes d’enriquiment de fosfopèptids utilitzant òxids de metall; b) estratègies de fraccionament extens de la mostra utilitzant cromatografia líquida, i c) l’establiment de nous mètodes d’adquisició d’espectrometria de masses desenvolupats específicament per als pèptids fosforilats. Aquests esforços, juntament

10

amb el ràpid avenç de la tecnologia en el camp de l’espectrometria de masses, han permès la identificació i quantificació de milers de fosfopèptids en sistemes complexos. Per exemple, un estudi recent ha permès la identificació de més de vint mil llocs de fosforilació en cèŀlules canceroses humanes utilitzant diferents estratègies ortogonals de fraccionament cromatogràfic (cromatografia d’intercanvi catiònic, cromatografia basada en interaccions hidrofòbiques i cromatografia de fase inversa) en combinació amb tècniques d’enriquiment de fosfopèptids (Zhou et al., 2013). De manera similar, hi ha estudis recents en la caracterització d’interaccions proteïna-proteïna per a la caracterització de complexos proteics i xarxes d’interacció. Dos dels exemples més iŀlustratius han estat la utilització de l’espectrometria de masses combinada amb tècniques d’entrecreuament químic per a la caracterització estructural del ribosoma mitocondrial de mamífers (Greber et al., 2014a, b), i la identificació dels components i interactors implicats en la via de senyalització Hippo que controla el creixement d’òrgans en metazous mitjançant la regulació de la proliferació ceŀlular i l’apoptosi (Hauri et al., 2013; Kwon et al., 2013).

Aquests estudis han evidenciat el potencial de l’espectrometria de masses de cribratge per identificar milers de pèptids i proteïnes, i caracteritzar-ne les modificacions posttraduccionals i les interaccions moleculars. Tanmateix, quan es tracta d’assignar un significat funcional a les proteïnes i a les seves modificacions, o establir mecanismes d’acció que expliquin respostes ceŀlulars heterogènies a un determinat tractament, la identificació dels components del sistema no és suficient, i cal estudiar els sistemes biològics de manera dinàmica i quantitativa (vegeu la figura 2). Amb l’objectiu de caracteritzar funcionalment les xarxes moleculars, diversos estudis d’espectrometria de masses han abordat la dinàmica tant en vies de senyalització com en les interaccions proteïna-proteïna sota diferents tipus de pertorbacions. Aquests experiments van més enllà de la identificació dels components biològics en condicions basals i combinen la identificació d’alt rendiment amb tècniques de quantificació per comparar canvis en les modificacions posttraduccionals i en les interaccions entre proteïnes durant els diferents estats. A tall d’exemple, s’han utilitzat diverses tècniques de proteòmica quantitativa, com el marcatge isotòpic a escala ceŀlular o la quantificació lliure de marcatge, per discernir els efectes de la insulina sobre l’estat de fosforilació ceŀlular (Monetti et al., 2011), per estudiar la progressió del càncer de pell en ratolins (Zanivan et al., 2013), per estudiar la dinàmica del fosfoproteoma en resposta al dany ceŀlular (Bensimon et al., 2010), o per establir les diferències en els mecanismes de resposta induïda pel contacte entre cèŀlules (Jørgensen et al., 2009) o per factors de creixement (Kiel et al., 2014, 2013). Així mateix, també s’ha estudiat la dinàmica del proteoma i les seves fosforilacions al llarg del cicle ceŀlular en cèŀlules de mamífer (Olsen et al., 2010), i recentment, s’han utilitzat diverses soques mutants de llevat per elucidar el mecanisme d’eliminació de proteïnes mal plegades de la membrana interna nuclear (Foresti et al., 2014). Altres estudis han abordat la dinàmica de diferents modificacions posttraduccionals més enllà de la fosforilació, com ara l’acetilació i la ubiquitinació. De fet, el progrés en la identificació i quantificació mitjançant espectrometria de masses de les modificacions en lisines ha permès avançar en la comprensió del complex vincle entre l’acetilació

Treballs de la Societat Catalana de Biologia, 66: 9-14


Proteòmica de sistemes complexos

de lisina i el metabolisme ceŀlular, i ha refermat el paper actiu del metabolisme en els mecanismes de regulació de processos ceŀlulars (Choudhary et al., 2014; Henriksen et al., 2012; Weinert et al., 2014). Finalment, cal destacar que en l’àmbit de les xarxes d’interacció proteïna-proteïna també s’ha explorat la dinàmica de les interaccions després d’un determinat estímul o pertorbació. En aquest sentit, diversos estudis han caracteritzat la composició de determinats complexos, com per exemple el complex de la ligasa Cullin-Ring (Bennett et al., 2010), la xarxa d’interacció de Grb2 (Bisson et al., 2011), o els components del sistema 14-3-3 (Collins et al., 2013), en resposta al tractament ceŀlular amb inhibidors o efectors de diverses vies de senyalització.

amb estímul

sense estímul

proteïna

proteïna

fosforilació

fosforilació

acció

(fosfo-)proteòmica quantitativa

acció

Proteòmica dirigida i xarxes moleculars L’anàlisi de les molècules biològiques en un context en xarxa —ja sigui en forma de xarxa d’interactors o de vies de senyalització— contrasta amb la visió clàssica de considerar les molècules de manera aïllada, i aborda l’estudi dels sistemes biològics des d’una perspectiva integradora amb l’objectiu de capturar les propietats emergents del sistema. L’estudi de la biologia com a xarxa de molècules que interaccionen físicament i funcionalment entre si es coneix generalment com a biologia de sistemes. Aquest nou paradigma en el qual els processos biològics complexos s’estudien com a xarxes moleculars dinàmiques permet fer front a la complexitat inherent als sistemes biològics, i juntament amb els estudis de biomarcadors i de l’efecte dels polimorfismes genètics en el fenotip ceŀlular, té gran rellevància clínica en l’avenç de la medicina personalitzada. Més enllà de la comparació entre un estat pertorbat i una condició basal, els estudis basats en la consideració del sistema com un tot permeten augmentar significativament la quantitat d’informació recuperada dels conjunts de dades disponibles. D’aquesta manera, permeten la identificació de diferències en la resposta ceŀlular i milloren la predicció de la resposta de determinats tumors als fàrmacs, i l’eficàcia de teràpies de combinacions de medicaments, entre d’altres. Per desxifrar la complexitat biològica, aquests tipus d’estudis solen utilitzar dissenys experimentals del tipus estímul-senyal-resposta que requereixen múltiples pertorbacions i diferents punts temporals. Així, aquests estudis introdueixen limitacions i reptes específics d’anàlisi, entre els quals cal destacar la necessitat a) d’identificar i quantificar un nombre elevat d’analits en totes les condicions analitzades, i b) d’analitzar un elevat nombre de mostres atès l’alt nombre de condicions experimentals. Per tant, aquests estudis requereixen mètodes sensibles, específics, i d’alt rendiment d’anàlisi que permetin quantificar les proteïnes, els pèptids, i en especial els pèptids fosforilats (o altrament modificats) en un gran nombre de mostres complexes diferents. És evident que la proteòmica de cribratge ha contribuït significativament al desenvolupament del paradigma de la biologia de sistemes. Tanmateix, la proteòmica de cribratge presenta algunes limitacions quan es compara un elevat nombre de mostres, principalment per l’existència d’una certa estocasticitat de mostreig durant la selecció dels ions peptídics per a la fragmentació que tendeix a generar conjunts de dades incomplets i inconsistents (Rifai et al., 2006). Aquesta limitació s’ha resolt utilitzant principalment l’anomenada proteòmica dirigida, en la qual un nombre reduït d’analits es quantifica en múltiples mostres. Aquesta nova estratègia difereix dels mètodes de cribratge pel seu rendiment analític en termes de reproductibilitat, rang dinàmic i límit de detecció, i ha esdevingut el mètode preferit per a la quantificació reproduïble de pèptids i proteïnes en un gran conjunt de mostres o con-

temps Figura 2. Exemple d’estudi d’un sistema biològic complex de manera dinàmica i quantitativa. Concretament, s’exemplifica la identificació i quantificació dels llocs de fosforilació d’una via de senyalització a diferents temps després de l’aplicació d’un estímul concret. En l’exemple, gris: fosforilació que no canvia respecte a les condicions basals; verd: augment de la fosforilació; vermell: disminució de la fosforilació. Aquests estudis permeten l’assignació funcional de les modificacions posttraduccionals de les proteïnes.

dicions experimentals, tal com requereixen els estudis de biologia de sistemes i de validació de biomarcadors. Les principals estratègies de la proteòmica dirigida es corresponen amb els mètodes de supervisió de fragments (selected reaction monitoring o SRM), i els mètodes d’adquisició independent de dades (data independent acquisition o DIA) com ara els anomenats MSX (Egertson et al., 2013) i SWATH (Gillet et al., 2012). En aquests mètodes l’objectiu és identificar i quantificar en les mostres d’interès un conjunt de proteïnes seleccionades segons una hipòtesi. Per això, cal especificar els pèptids adients ja sigui abans (SRM) o després de l’adquisició de dades —DIA. El mètode de supervisió de fragments (o SRM, vegeu la figura 3) és una tècnica d’espectrometria de masses dirigida en la qual s’analitzen simultàniament un conjunt de pèptids prèviament seleccionats per quantificar-los. Aquesta tècnica es fa generalment en instruments de tipus triple quadrupol en els quals se seleccionen ions peptídics específics en el primer analitzador de masses —primer quadrupol—, que es fragmenten dins la ceŀla de coŀlisió —segon quadrupol— i, a continuació, se selecciona un fragment peptídic predeterminat en el tercer quadrupol i el seu senyal és registrat pel detector al llarg del temps. Cada parell d’ió peptídic i fragment s’anomena transició, i per identificar i quantificar de manera concloent un pèptid en una mostra complexa es mesuren múltiples transicions de manera coordinada. Típicament de tres a cinc fragments per pèptid i d’un a cinc pèptids per proteïna constitueixen un assaig per a la quantificació definitiva d’una proteïna en una mostra. El mètode de supervisió de fragments és un mètode atractiu per quantificar de manera consistent un conjunt de proteïnes en diverses condicions experimentals. És per això que s’empra en estudis de proteòmica clínica com a mètode de validació de biomarcadors i en estudis de biologia de sistemes, ja que permet analitzar uns pocs analits en un gran volum de mostres biològiques. Tanmateix, aquest mètode requereix el coneixe-

Treballs de la Societat Catalana de Biologia, 66: 9-14

11


Eva Borràs i Eduard Sabidó

un fragment específic del pèptid d’interès

pèptid d’interès

analitzador de masses

analitzador de masses

mode de filtre

mode de filtre

intensitat

a

intensitat

temps

intensitat

temps

intensitat

temps

intensitat

temps

mode de filtre

proteïna 9

proteïna 8

Proteïna 6

transició 2

proteïna 7

transició 1 proteïna 4

proteïna 3

proteïna 2

proteïna 1

intensitat

assaig de proteòmica dirigida

proteïna 5

b

temps

mode de filtre

Medicina personalitzada i proteòmica de la malaltia

temps

Figura 3. a) Esquema d’un espectròmetre de masses de tipus triple quadrupol operat en mode de supervisió de fragments, en el qual se supervisen dos fragments de cadascun dels dos pèptids seleccionats —vermell i blau— de manera seqüencial. Els ions peptídics se seleccionen en el primer analitzador de masses, mentre que els fragments se seleccionen en l’últim analitzador de masses. b) Esquema d’un assaig de proteòmica dirigida per a la quantificació de nou pèptids corresponents a nou proteïnes preseleccionades en el sèrum d’un pacient.

ment previ de les característiques cromatogràfiques i de fragmentació de cada pèptid que es vol mesurar, incloent-hi valors com la massa de l’ió peptídic i dels seus fragments, la intensitat de senyal relativa de cada fragment en l’espectre i el temps de retenció de cada pèptid (Lange et al., 2008). Per aquest motiu, s’han fet esforços per determinar, en diferents tipus d’espectròmetres de masses, els patrons de fragmentació dels pèptids que representen totes les proteïnes conegudes d’un proteoma. Aquests espectres de referència s’utilitzen per crear assajos dirigits que després es compilen en bases de dades públiques com SRMAtlas (Kusebauch et al., 2014). Actualment, s’han generat i posat a disposició de la comunitat científica espectres de referència per a tot el proteoma de llevat (Picotti et al., 2013) i de cèŀlules humanes (Rosenberger et al., 2014). Els assajos de proteòmica dirigida per SRM estan recolzats per un ampli ventall d’eines computacionals que permeten automatitzar la selecció de pèptids, el desenvolupament de l’anàlisi i optimització, i l’avaluació de les dades (Chang et al., 2012, 2014; Reiter et al., 2011; Röst et al., 2012). El mètode SRM requereix el desenvolupament d’assajos específics

12

per a cada proteïna d’interès i té una limitació en el nombre de proteïnes que poden ser analitzades en una única injecció. Malgrat que aquestes limitacions no solen restringir els estudis de validació de biomarcadors, sí que poden reduir l’abast d’estudis d’elucidació de mecanismes ceŀlulars o de l’impacte dels polimorfismes genètics en el proteoma. Per superar aquestes limitacions, han aparegut noves estratègies de proteòmica dirigida d’alt rendiment que permeten adquirir, potencialment, dades per a totes les proteïnes de la mostra, i posteriorment contrastar hipòtesis concretes mitjançant l’extracció d’informació per a les proteïnes d’interès. Aquests mètodes s’anomenen mètodes d’adquisició independent de dades (DIA) i operen a través de l’enregistrament cíclic de finestres d’aïllament peptídic que cobreixen tot el rang de masses. Per tant, en aquesta aproximació no és necessari tenir cap coneixement previ dels pèptids a mesurar sinó que el mètode registra, en una sola injecció, tots els fragments que deriven de qualsevol pèptid present a la mostra, i crea, doncs, un mapa complet d’ions de fragments. L’anàlisi de dades consisteix a extreure la informació quantitativa de tots els fragments d’un conjunt de pèptids d’interès gràcies a la informació relativa a la intensitat de cada fragment, la concurrència cromatogràfica, i altra informació disponible en la biblioteca espectral de referència. El gran atractiu d’aquestes estratègies d’adquisició independent de dades és que un mateix conjunt de dades pot ser interrogat iŀlimitadament per contrastar diferents hipòtesis. Així doncs, és possible reanalitzar les mateixes dades de manera iterativa per interrogar, per exemple, noves vies de senyalització o modificacions posttraduccionals a posteriori a partir d’un conjunt de dades adquirides un sol cop i per sempre.

Les noves estratègies de proteòmica dirigida com ara els mètodes de supervisió de fragments, i d’adquisició independent de dades, han introduït de ple la proteòmica basada en espectrometria de masses en el camp del diagnòstic clínic i la recerca aplicada, a causa de la capacitat de poder identificar i quantificar un conjunt de proteïnes seleccionades en un elevat nombre de mostres d’interès. En moltes ocasions la comprensió de la malaltia humana es limita a les principals característiques clíniques i als mecanismes moleculars comuns, mentre que es desconeixen els mecanismes moleculars específics que causen l’heterogeneïtat en el desenvolupament individual d’una certa malaltia o en la resposta al tractament. L’exemple paradigmàtic d’aquesta variabilitat en el desenvolupament i la resposta entre individus és el càncer. En aquest cas, els marcadors genètics es poden utilitzar per determinar la predisposició al desenvolupament de tumors, però en la majoria dels casos no es disposa encara d’estratègies concretes i personalitzades que millorin el pronòstic del pacient. Aquestes estratègies de medicina personalitzada es desenvolupen mitjançant l’aplicació de la investigació bàsica en el tractament clínic per tal d’elucidar els mecanismes moleculars subjacents a respostes heterogènies, identificar nous biomarcadors per al diagnòstic, prognosi i estratificació de pacients, i avaluar l’impacte de la variabilitat genètica individual en la funcionalitat del proteoma (vegeu la figura 4). Diversos estudis han utilitzat la proteòmica dirigida per determinar canvis específics en el proteoma de models animals en malalties d’etiologia complexa com és el cas de la síndrome metabòlica (Sabidó et al., 2013; Wu et al., 2014). De manera similar, la proteòmica dirigida també s’ha utilitzat exhaustivament per a la identificació i validació de proteïnes que ajudin en el diagnòstic o pronòstic de malalties així com de proteïnes que permetin la classificació i estratificació de

Treballs de la Societat Catalana de Biologia, 66: 9-14


Proteòmica de sistemes complexos

Figura 4. Exemples de tres de les principals aplicacions de la proteòmica en el camp de la medicina personalitzada i la malaltia. a) Les tècniques actuals de proteòmica permeten elucidar els mecanismes moleculars —retroactivació i retroinhibició— que expliquin respostes heterogènies d’un mateix tipus de cèŀlules —no-proliferació enfront de proliferació. b) Creació i validació d’assajos de biomarcadors que facilitin l’estratificació dels pacients i millorin l’elecció dels tractaments. c) Avaluació de l’impacte de la variabilitat genètica individual en la funcionalitat del proteoma. Certes mutacions o variants gèniques (per exemple, mutació verda/rosa) poden conduir a una alteració en les interaccions proteïna-proteïna, a una alteració de l’abundància de certes proteïnes, o a l’alteració de les variants transcrites i finalment traduïdes a proteïna.

a cèl·lules de càncer no proliferatives

cèl·lules de càncer proliferatives retroinhibició

retroactivació

mecanisme d’acció d’una via de senyalització

mecanisme d’acció d’una via de senyalització

pacients malalts de càncer de còlon

c

Proteïna 3

Proteïna 2

Proteïna 1

b

assaig quantitatiu de biomarcadors alteració de l’interactoma

Recentment, el consorci CPTAC (Clinical Proteomic Tumor Analysis Consortium) ha dut a terme un estudi en el qual s’han analitzat per proteòmica de cribratge cèŀlules procedents de desenes de tumors colorectals humans i s’ha determinat l’impacte de les alteracions genètiques en la funció proteica (Zhang et al., 2014). La integració de les dades proteòmiques i genòmiques —o proteogenòmica— ofereix una visió més completa de les característiques biològiques de la mostra, ja que, tal com destaca aquest estudi, l’abundància de RNA missatger no prediu de manera fiable l’abundància de proteïnes, a causa de l’existència de punts de regulació localitzats entre l’RNA sintetitzat i la traducció a proteïna. Així mateix, aquest estudi va identificar dianes potencials per al diagnòstic i la intervenció terapèutica, i va identificar cinc subtipus de càncer de còlon no obvis a partir de les dades genètiques. Aquest tipus d’estudis permeten entendre millor els mecanismes moleculars subjacents a les malalties i els marcadors proteics que es desenvolupin podran ser utilitzats en un futur per al diagnòstic i la classificació de pacients segons la seva capacitat de resposta a determinats tractaments. Finalment, l’estudi dels polimorfismes i el seu impacte en el fenotip s’ha ampliat amb alguns treballs mitjançant l’anàlisi de trets quantitatius a escala de proteïna (protein quantitative trait loci o pQTL) (Picotti et al., 2013; Wu et al., 2013, 2014; Engelken et al., 2015), actualment factibles gràcies a la capacitat de la proteòmica dirigida d’analitzar múltiples analits de manera sistemàtica en un nombre elevat de mostres.

Coroŀlari tractament A

alteració de l’abundància

tractament B

alteració de les variants transcrites

variant 1 ATGAAGCTGCCGACGATGCG TACTTCGACGGCTGCTACGC

variant 2 ATGAAGCGGCCGACGATGCG TACTTCGCCGGCTGCTACGC

pacients afectats per una determinada malaltia (Drabovich et al., 2013; Niederkofler et al., 2013; Borras et al., 2016). En aquest aspecte cal destacar els esforços en la identificació de marcadors proteics associats al nivell d’agressivitat del càncer de pròstata per minimitzar l’excés de tractament en pacients amb tumors no agressius. Dos estudis recents han utilitzat un enfocament de proteòmica dirigida (SRM i SWATH) amb l’objectiu de detectar signatures proteiques que permetin predir la progressió futura d’un càncer de pròstata en pacients i així millorar l’elecció de tractament en cadascun dels pacients analitzats (Cima et al., 2011; Liu et al., 2014).

La proteòmica basada en espectrometria de masses és una tècnica analítica d’identificació i quantificació de proteïnes que, gràcies als avenços de les últimes dècades, es troba actualment en disposició de resoldre problemes complexos de la biologia molecular i de sistemes. Així mateix, avui dia s’estan posant les bases per a la consolidació d’aquestes aplicacions i perquè la proteòmica tingui un impacte real en la medicina personalitzada del futur. Els nous desenvolupaments han fet augmentar significativament la sinergia entre la proteòmica i la biologia molecular, especialment en l’anàlisi de les xarxes pertorbades i en dinàmiques temporals i espacials. Aquests estudis han permès aprofundir en l’elucidació de mecanismes d’acció i les seves disfuncions, la creació de models de resposta a tractaments, la identificació de biomarcadors per a la classificació i estratificació de pacients, i la concreció de l’impacte de la variabilitat genètica sobre els fenotips observats. Aquests avenços són un pas ferm en la utilització de la proteòmica en la resolució de problemes biològics complexos. Tanmateix, l’aprofundiment en tècniques d’anàlisi que permetin la quantificació sistemàtica, no només de l’abundància de proteïnes, sinó també de les seves modificacions i variants naturals, serà essencial per augmentar la capacitat d’anàlisi del proteoma i, en definitiva, per fer de la proteòmica una tècnica fonamental per a l’avenç en la medicina personalitzada i en la biologia molecular.

Bibliografia Bennett, E. J. [et al.] (2010). «Dynamics of cullin-RING ubiquitin ligase network revealed by systematic quantitative proteomics». Cell, 143: 951-965. Bensimon, A. [et al.] (2010). «ATM-dependent and -independent dynamics of the nuclear phosphoproteome after DNA damage». Sci. Signal, 3: rs3. Bisson, N. [et al.] (2011). «Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor». Nat. Biotechnol., 29: 653658. Borràs, E. [et al.] (2016). «Protein based clarifier to predict conversion from clinically isolated syndrome to multiple sclerosis». Mol. Cell Proteomics, 15 (1): 318-328. Chang, C.-Y. [et al.] (2012). «Protein significance analysis in selected reaction monitoring (SRM) measurements». Mol. Cell Proteomics, 11: M111.014662.

— (2014). «Targeted protein quantification using sparse reference labeling». Nat. Methods, 11: 301-304. Choudhary, C. [et al.] (2014). «The growing landscape of lysine acetylation links metabolism and cell signalling». Nat. Rev. Mol. Cell Biol., 15: 536-550. Christophorou, M. A. [et al.] (2014). «Citrullination regulates pluripotency and histone H1 binding to chromatin». Nature, 507: 104-108. Cima, I. [et al.] (2011). «Cancer genetics-guided discovery of serum biomarker signatures for diagnosis and prognosis of prostate cancer». Proc. Natl. Acad. Sci. USA, 108: 3342-3347. Collins, B. C. [et al.] (2013). «Quantifying protein interaction dynamics by SWATH mass spectrometry: application to the 14-3-3 system». Nat. Methods, 10: 1246-1253.

Treballs de la Societat Catalana de Biologia, 66: 9-14

13


Eva Borràs i Eduard Sabidó

Drabovich, A. P. [et al.] (2013). «Differential diagnosis of azoospermia with proteomic biomarkers ECM1 and TEX101 quantified in seminal plasma». Sci. Transl. Med., 5: 212ra160. Egertson, J. D. [et al.] (2013). «Multiplexed MS/MS for improved data-independent acquisition». Nat. Methods, 10: 744-746. Engelken, J. [et al.] (2015). «Signatures of evolutionary adaptation in quantitative trait loci influencing trace elements homeostasis in liver». Mol. Biol. Evol. doi: 10.1093/ molbev/msv267. Foresti, O. [et al.] (2014). «Quality control of inner nuclear membrane proteins by the Asi complex». Science, 346: 751-755. Gillet, L. C. [et al.] (2012). «Targeted data extraction of the MS/MS spectra generated by data-independent acquisition: a new concept for consistent and accurate proteome analysis». Mol. Cell Proteomics, 11: O111.016717. Greber, B. J. [et al.] (2014a). «The complete structure of the large subunit of the mammalian mitochondrial ribosome». Nature, doi:10.1038/nature13895. — (2014b). «Architecture of the large subunit of the mammalian mitochondrial ribosome». Nature, 505: 515-519. Hauri, S. [et al.] (2013). «Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1». Mol. Syst. Biol., 9: 713. Henriksen, P. [et al.] (2012). «Proteome-wide analysis of lysine acetylation suggests its broad regulatory scope in Saccharomyces cerevisiae». Mol. Cell Proteomics, 11: 15101522. Jørgensen, C. [et al.] (2009). «Cell-specific information processing in segregating populations of Eph receptor ephrin-expressing cells». Science, 326: 1502-1509. Kiel, C. [et al.] (2013). «Integration of protein abundance and structure data reveals competition in the ErbB signaling network». Sci. Signal, 6: ra109. — (2014). «Quantification of ErbB network proteins in three cell types using complementary approaches identifies cell-general and cell-type-specific signaling proteins». J. Proteome Res., 13: 300-313. Kim, M.-S. [et al.] (2014). «A draft map of the human proteome». Nature, 509: 575-581. Kusebauch, U. [et al.] (2014). «Using PeptideAtlas, SRMAtlas, and PASSEL: comprehensive resources for discovery and targeted proteomics». Curr. Protoc. Bioinformatics, 46: 13.25.1-13.25.28. Kwon, Y. [et al.] (2013). «The Hippo signaling pathway interactome». Science, 342: 737740. Lange, V. [et al.] (2008). «Selected reaction monitoring for quantitative proteomics: a tutorial». Mol. Syst. Biol., 4: 222. Liu, Y. [et al.] (2014). «Glycoproteomic analysis of prostate cancer tissues by SWATH mass

14

spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness». Mol. Cell Proteomics, 13: 1753-1768. Monetti, M. [et al.] (2011). «Large-scale phosphosite quantification in tissues by a spikein SILAC method». Nat. Methods, 8: 655-658. Niederkofler, E. [et al.] (2013). «Targeted selected reaction monitoring mass spectrometric immunoassay for insulin-like growth factor 1». PLoS One, 8: e81125. Olsen, J. V. [et al.] (2010). «Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis». Sci. Signal., 3: ra3. Picotti, P. [et al.] (2013). «A complete mass-spectrometric map of the yeast proteome applied to quantitative trait analysis». Nature, 494: 266-270. Reiter, L. [et al.] (2011). «mProphet: automated data processing and statistical validation for large-scale SRM experiments». Nat. Methods, 8: 430-435. Rifai, N. [et al.] (2006). «Protein biomarker discovery and validation: the long and uncertain path to clinical utility». Nat. Biotechnol., 24: 971-983. Rosenberger, G. [et al.] (2014). «A repository of assays to quantify 10,000 human proteins by SWATH-MS». Scientific Data, doi:10.1038/sdata.2014.31. Röst, H. [et al.] (2012). «A computational tool to detect and avoid redundancy in selected reaction monitoring». Mol. Cell Proteomics, 11: 540-549. Sabidó, E. [et al.] (2013). «Targeted proteomics reveals strain-specific changes in the mouse insulin and central metabolic pathways after a sustained high-fat diet». Mol. Syst. Biol., 9: 681. Steen, H. [et al.] (2004). «The ABC’s (and XYZ’s) of peptide sequencing». Nat. Rev. Mol. Cell Biol., 5: 699-711. Weinert, B. T. [et al.] (2014). «Acetylation dynamics and stoichiometry in Saccharomyces cerevisiae». Mol. Syst. Biol., 10: 716. Wilhelm, M. [et al.] (2014). «Mass-spectrometry-based draft of the human proteome». Nature, 509: 582-587. Wu, L. [et al.] (2013). «Variation and genetic control of protein abundance in humans». Nature, 499: 79-82. Wu, Y. [et al.] (2014). «Multilayered genetic and omics dissection of mitochondrial activity in a mouse reference population». Cell, 158: 1415-1430. Zanivan, S. [et al.] (2013). «In vivo SILAC-based proteomics reveals phosphoproteome changes during mouse skin carcinogenesis». Cell Rep., 3: 552-566. Zhang, B. [et al.] (2014). «Proteogenomic characterization of human colon and rectal cancer». Nature, 513: 382-387. Zhou, H. [et al.] (2013). «Toward a comprehensive characterization of a human cancer cell phosphoproteome». J. Proteome Res., 12: 260-271.

Treballs de la Societat Catalana de Biologia, 66: 9-14


Bioinformàtica: una eina essencial per als biòlegs del segle x x i Marc A. Marti-Renom Structural Genomics Group, CNAG-CRG, The Barcelona Institute of Science and Technology, Institució Catalana de Recerca i Estudis Avançats

DOI: 10.2436/20.1501.02.153 ISSN (ed. impresa): 0212-3037

Correspondència: Marc A. Marti-Renom. Centre Nacional d’Anàlisi Genòmica. Carrer de Baldiri i Reixac, 4. 08028 Barcelona. Adreça electrònica: mmarti@pcb.ub.cat.

ISSN (ed. digital): 2013-9802 http://revistes.iec.cat/index.php/TSCB Rebut: 07/11/2014 Acceptat: 07/04/2015

Resum La bioinformàtica i la biologia computacional són dues cares d’una mateixa disciplina, que fa ús de tècniques i algoritmes informàtics per estudiar processos biològics. Ambdós termes tenen, però, matisos diferents. Històricament, el terme de biologia computacional s’ha emprat més en ambients de simulació computacional en què la física i les matemàtiques tenen un paper molt rellevant, mentre que el terme de bioinformàtica s’ha usat més en l’estudi de grans quantitats de dades en què l’estadística és essencial. Assignem el terme que assignem, l’augment de les dades òmiques juntament amb una comprensió més acurada dels processos estudiats, ha fet que la bioinformàtica resulti imprescindible en el currículum del biòleg. Com a conseqüència, en aquest segle que tot just estrenem, no tots els biòlegs hauran de ser bioinformàtics, però sí que hauran de saber fer servir la bioinformàtica.

Paraules clau: bioinformàtica, biologia computacional, simulació, modelització.

Bioinformatics: an essential tool for biologists of the 21st century Summary Bioinformatics and computational biology are parallel terms that refer to the application of computational science to the study of biological processes. However, these two terms have certain historical connotations. Computational biology has referred more specifically to a scientific approach to simulating biology in which physics and mathematics play an important role. Bioinformatics is often used to designate a discipline in which computational software allows the vast amounts of data now produced by biologists to be processed. Regardless of which term is used, the increase of biological data and the more accurate insights into the theory behind biological processes make bioinformatics essential for any biologists of the 21st century. Consequently, today not all biologists need to be bioinformaticians but they certainly all need to be proficient in bioinformatics.

Keywords: bioinformatics, computational biology, simulation, modeling.

Un abans i un després de la bioinformàtica en l’era òmica Al principi dels anys setanta del segle xx, Paulien Hogeweg i Ben Hesper van començar a usar el terme bioinformàtica per referir-se a «l’estudi de processos informàtics en sistemes biòtics». Aquesta definició original es referia més a un camp concret de la biologia que estudia com els sistemes biològics produeixen, usen i emmagatzemen informació (Hogeweg, 2011). Aquesta definició original contrasta amb la que podem trobar avui dia en l’Enciclopèdia Catalana: «Disciplina científica que aplica els principis de la informàtica a l’estudi de fenòmens biològics», o en l’Oxford English Dictionary: «The science of collecting and analysing complex biological data such as genetic codes». Aquestes aparents diferències en la definició del terme bio­ informàtica ens donen una idea de com en els darrers quaranta anys la producció de grans quantitats de dades biològiques ha fet canviar aquest camp de la biologia. Durant les dècades dels setanta i vuitanta, no es podia disposar de les quantitats de dades que l’era òmica portaria en el nou segle. Eren, doncs, anys en què els bioinformàtics (o biòlegs computacionals) feien ús de les eines informàtiques per estudiar molècules concretes d’organismes específics. Un dels camps de més producció en aquells moments va ser l’estudi del plegament de macromolècules, i en particular de proteïnes. Aquests estudis es feien principalment amb mè-

todes físics en què les interaccions entre els àtoms d’una molècula es tractaven a partir dels principis fonamentals de Newton (Brooks, 1995; Elber, 1996). Aquestes simulacions, però, eren (i són) molt costoses en hores de computació i, per tant, aplicables sols a un nombre limitat de macromolècules a la vegada. Aquestes limitacions de càlcul es van abordar a partir de l’ús de l’estadística per estudiar el plegament de proteïnes. Nous mètodes comparatius aprofitaven el creixement en dades al Protein Data Bank (PDB, Berman et al., 2000) per tal d’extreure estadístiques de conservació de l’estructura i la seqüència de proteïnes (Sali i Overington, 1994). Al mateix temps, els mètodes comparatius de seqüència començaven a ser suficientment ràpids per ser aplicats a gran escala, en què no sols es comparaven dues seqüències d’àcid desoxiribonucleic (DNA) o proteïnes, sinó que ja es podien fer cerques d’homòlogues contra bancs de seqüències (Altschul et al., 1990). Aquesta dicotomia, ja aparent en els anys noranta, entre la biologia computacional d’estructura basada principalment en la física i la bioinformàtica de seqüència basada en estadística, ens acompanyarà fins a l’aparició de mètodes híbrids en què la integració de dades i d’aproximacions per a l’estudi de sistemes complexos és primordial (vegeu la figura 1). De totes maneres, en aquelles dècades, la visió òmica de la biologia era pràcticament inexistent fins que a mitjans anys noranta comencen a aparèixer els estudis genòmics en molts dels organismes

Treballs de la Societat Catalana de Biologia, 66: 15-18

15


Marc A. Marti-Renom

(biologia estructural computacional), o alinear milions de seqüències per cercar mutacions associades a malalties (genòmica informàtica), entre d’altres. En totes aquestes aplicacions, la bioinformàtica afrontarà tres grans reptes o objectius, que descric en la secció següent.

Profunditat (física)

Diversitat (estadística)

>4RHA:A GHVAPAPAPAPEVQTKHFTLKSDVLFNFNK STLKPEGQQALDQLYSQLSNLDPKDGSVVV LGFTDRIGSDAYNQGLSEKRAQSVVDYLIS KGIPSDKISARGMGESNPVTGNTCDNVKPR AALIDCLAPDRRVEIEVKGVKDVVGS

Objectius de la bioinformàtica A grans trets, la bioinformàtica té tres objectius (Luscombe et al., 2001): a) organitzar i emmagatzemar dades biològiques, b) desenvolupar eines informàtiques per estudiar i analitzar les dades emmagatzemades, i c) extreure informació biològicament rellevant de les dades.

Organització de les dades biològiques

Figura 1. Bioinformàtica entre la física i l’estadística. La bioinformàtica ha fet ús de la física i de l’estadística per abordar problemes complexos. La física ha estat principalment emprada per estudiar l’estructura de macromolècules i complexos d’aquesta. L’estadística ens ha ajudat a entendre la diversitat de les seqüències i estructures de macromolècules, que és essencial per alinear-les i inferir relacions d’homologia evolutiva. L’ús de mètodes físics per a l’estudi de l’estructura s’ha associat clàssicament al terme biologia computacional. L’ús de l’estadística per a l’estudi de la diversitat de seqüència s’ha associat clàssicament al terme bioinformàtica. Mètodes híbrids recents que integren dades diverses per estudiar complexos de macromolècules fan ús combinat de l’estadística i de la física. Figura adaptada de Luscombe et al., 2001.

model usats en el laboratori. De fet, els primers articles de l’era òmica apareixen al final dels anys noranta (vegeu la taula 1). Una excepció d’aquesta regla és l’estudi del contingut genètic d’un organisme (o la genòmica), terme que apareix en articles ja en els anys quaranta, però que no és fins a la introducció del Projecte del Genoma Humà (1984) que pren una força rellevant. De fet, a partir de l’ús del terme genòmica altres camps de la biologia adopten el sufix -òmic per referir-se a l’estudi complet de les característiques dins un sistema biològic (vegeu la taula 1 per a una llista d’òmiques i el seu impacte). En el segle xxi, la bioinformàtica ja es pot considerar adulta (Ouzounis, 2012) i està present en la majoria dels laboratoris moderns en biologia, ja sigui perquè tenen bioinformàtics immersos en el laboratori o per la construcció de ponts de coŀlaboració amb grups de recerca en bioinformàtica. De fet, sembla que el moment de «moda» de la bioinformàtica ha passat i que ens trobem davant d’una disciplina de la biologia en un estat d’estabilització. Comparativament, el terme bioinformatics és cercat a Google d’una manera molt similar a termes com molecular biology o cell biology (vegeu la figura 2). Aquest fet indicaria que, igual com amb termes associats amb òmiques (vegeu la figura 2), a partir dels anys 2009-2010 s’estabilitza «l’interès» de la població, la qual percep notícies associades a la bioinformàtica amb més normalitat. Sigui com sigui, i gràcies a la bioinformàtica, avui dia podem fer recerca explorant sistemàticament la bibliografia (text mining), dissenyar nous fàrmacs (informàtica química), estudiar el plegament de proteïnes

16

Gràcies al concepte de relació comparativa i a la conservació evolutiva de les macromolècules, els bioinformàtics hem emmagatzemat i organitzat les dades biològiques basant-nos en la seva similitud. Per exemple, està demostrat que evolutivament la funció de dues proteïnes està més conservada que la seva estructura i, a la vegada, la seva estructura està més conservada que la seva seqüència (Chothia i Lesk, 1986; Rost, 1999). Tant és així, que es calcula que els milions de seqüències proteiques conegudes adopten poc més d’un miler d’estructures diferents (Yeats et al., 2006). Gràcies a aquesta conservació evolutiva, juntament amb l’aparició de programari que ens permet comparar seqüències, es comença a classificar i organitzar el coneixement de macromolècules biològiques. De fet, dos programes com el BLAST (Altschul et al., 1990) o el CLUSTAL (Higgins i Sharp, 1988), desenvolupats per comparar les seqüències biològiques d’una manera ràpida i acurada, es troben dins dels cent articles més referenciats en la història de la ciència (Noorden et al., 2014). Tot i que es coneix molt menys l’estructura de les macromolècules que la seva seqüència, un dels primers bancs de dades biològiques correspon al PDB que, des del principi dels setanta, emmagatzema i organitza totes les dades d’estructures de proteïnes i d’àcids nucleics (Berman et al., 2002). Similar a l’estructura de proteïnes, la gran quantitat de seqüències conegudes (per exemple, el banc de dades Universal Protein Resource (UniProt Consortium, 2010) conté actualment més de noranta milions de seqüències) ens ha permès classificar al voltant de quinze mil famílies de proteïnes a Pfam (Finn et al., 2014). El PDB, UniProt o Pfam són exemples clars d’un camp de la bioinformàtica que té una rellevància cabdal per organitzar la gran quantitat de dades biològiques. El darrer exemplar de Nucleic Acids Research (NAR) sobre bancs de dades recull més de 1.550 bancs de dades que es poden consultar a http://tinyurl.com/m5v9fw8 (Fernandez-Suarez et al., 2014).

Desenvolupar eines per a l’estudi i l’anàlisi de dades biològiques Qualsevol macromolècula en biologia es pot analitzar per la seva seqüència, estructura o funció. És precisament en aquests tres aspectes que els bioinformàtics hem desenvolupat eines per a l’estudi de les dades biològiques. Aquestes eines es basen en la física, l’estadística i els principis evolutius per comparar, classificar, simular i modelitzar macromolècules biològiques. Així mateix, aquests mètodes computacionals s’especialitzen en el tipus de macromolècula que estudien. Per exemple, els bancs de seqüències genòmiques, especialment les referents a l’àcid ribonucleic (RNA), s’han analitzat per tal de poder discernir entre regions codificants de proteïnes d’aquelles que no en codifiquen. Recentment, una gran quantitat de treballs apunten que l’RNA no es limita sols a la transferència d’informació entre el gen i la proteïna. Això ha fet que hi hagi un recent augment de programari que

Treballs de la Societat Catalana de Biologia, 66: 15-18


Bioinformàtica: una eina essencial per als biòlegs del segle xxi

adreça moltes qüestions sobre l’RNA i les seves múltiples funcions en la cèŀlula. Finalment, les proteïnes han estat clàssicament estudiades per la seva estructura, funció i interacció amb altres macromolècules o petites molècules (compostos químics). Tot plegat, ha fet que hi hagi actualment una llarga llista de mètodes computacionals que, de nou, la revista Nucleic Acids Research cataloga en el seu volum anual de Web Servers (Benson, 2014). Actualment, hi ha centenars de servidors a Internet que serveixen per estudiar les múltiples facetes de les macromolècules biològiques. Aquest servidors es poden consultar al directori d’enllaços bioinformàtics del Canadà: http://bioinformatics.ca/ links_directory. De totes maneres, el lector ha de ser avisat que l’avanç dels mètodes computacionals, juntament amb el finançament irregular de les iniciatives per desenvolupar aquests mètodes, fa que aproximadament el 10 % dels servidors tinguin una existència efímera a la Xarxa (Schultheiss et al., 2011).

Extracció d’informació biològicament rellevant Finalment, un cop hem emmagatzemat i estudiat les dades de macromolècules, s’ha de dur a terme una anàlisi exhaustiva per extreure’n informació de rellevància biològica. Aquest darrer punt és el menys específic dels tres grans objectius de la bioinformàtica. La pregunta de «què és biològicament rellevant?» té mil respostes, depenent de l’interlocutor que busca respondre a preguntes específiques. Aquestes poden anar des d’assignar la funció a una nova estructura resolta, ja sigui per mètodes experimentals o computacionals, fins a identificar quina combinació de factors de transcripció és la responsable de la transdiferenciació ceŀlular. És doncs, aquest tercer aspecte de la bioinformàtica, en què es requereix un coneixement de la biologia més profund i en què l’aspecte més pràctic (o menys tècnic) pren rellevància.

El bioinformàtic del segle xxi El camp de la bioinformàtica ha estat sempre un camp interdisciplinari en què es mesclen investigadors amb carreres tan dispars com la informàtica, les matemàtiques, la química, la física o la biologia, entre d’altres. En el nostre país, actualment les universitats UPF, UAB, UOC

Tendències a cerques de Google

Figura 2. Google trends (http://google.com/trends) per a termes associats a la bioinformàtica. La gràfica superior mostra la comparativa de mitjana de cerques amb termes com bioinformatics, molecular biology i cell biology des de 2005. La gràfica inferior mostra la comparativa de termes associats a mètodes òmics..

Bioinformatics Molecular biology Cell biology

2005

2007

2009

2011

2013

Tendències a cerques de Google

Genomics Proteomics Metabolomics Structural biology Lipidomics

2005

2007

2009

2011

2013

Taula 1. Òmiques. Taula adaptada i actualitzada de la pàgina web del Gerstein Group (http://tinyurl.com/owh52bv). Dades a la taula extretes de PubMed i de Google durant el novembre de 2014. Terme

Any 1a Pubmed publicació

Descripció

Google

Genome

Contingut genètic d’un organisme

65.500.000

925.543

1943

Proteome

Contingut proteic d’un organisme

7.320.000

32.918

1998

Transcriptome Contingut de mRNA en un organisme

3.300.000

22.616

1997

Phenome

Identificació qualitativa de la forma i funció derivats dels gens

647.000

295

1995

Interactome

Llista d’interaccions de totes les macromolècules en una cèŀlula

487.000

1.767

1991

Metabolome

Contingut de compostos químics i petites molècules en un organisme

426.000

4.546

1998

Secretome

Contingut de productes gènics secretats de la cèŀlula

241.000

1.208

2000

Orfeome

Contingut de tots els ORF en un genoma

213.000

104

2002

Glycome

Contingut de molècules de carbohidrats en una cèŀlula

85.700

353

2000

Physiome

Descripció de les condicions fisiològiques en un organisme

76.600

133

1998

Regulome

Descripció de la xarxa de regulació gènica en una cèŀlula

25.600

44

2002

Fluxome

Descripció del contingut proteic i els seus fluxos

20.200

49

1999

Morphome

Descripció quantitativa de l’anatomia, bioquímica i composició química d’un organisme

18.600

4

2000

Translatome

Contingut de mRNA en un organisme ponderat pels seus nivells

13.200

62

2001

Cellome

Contingut i interaccions de totes les molècules en una cèŀlula

8.660

46

2002

Pseudome

La població de pseudogens en un genoma

7.750

0

Operome

La caracterització de proteïnes sense funció coneguda

7.750

1

2002

Functome

La població de productes gènics classificats per la seva funció

5.610

2

2001

Transportome

La població de productes gènics que són transportats

5.170

18

2004

Localizome

Localització de tots els productes gènics en una cèŀlula

3.090

10

2002

Foldome

Descripció dels productes gènics classificats per la seva estructura

2.810

1

2009

Unknome

Tots els gens de funció desconeguda

2.060

0

Ribonome

Llista de regions del genoma que codifiquen amb RNA complexos ribonucleoproteics

1.520

10

2002

i UVic ofereixen màsters o postgraus en bioinformàtica. Aquests màsters o postgraus aviat s’acompanyaran de graus en bioinformàtica gràcies a iniciatives com el Bioinformatics Barcelona (BIB, http:// bioinformaticsbarcelona.eu). De totes maneres, i com deia en el resum al principi d’aquest article, no tots els biòlegs hauran de ser bioinformàtics però sí que hauran de conèixer la bioinformàtica. Els tres objectius principals de la bioinformàtica (és a dir, emmagatzemar i organitzar les dades, analitzar les dades, i extreure conclusions biològiques rellevants) requereixen perfils de biòlegs/informàtics diferenciats. Des del punt de vista més tècnic, es requeriran bioinformàtics amb coneixements computacionals alts per tal de construir bancs de dades eficients que ens permetin accedir a les dades ràpidament o fins i tot en temps real. D’altres bioinformàtics necessitaran coneixements

Any

Treballs de la Societat Catalana de Biologia, 66: 15-18

17


Marc A. Marti-Renom

en programació per desenvolupar eines eficients per comparar, classificar i analitzar les dades. Aquest segon gran grup de bioinformàtics, però, haurà de tenir uns coneixements de biologia més fonamentats per tal d’interpretar les dades experimentals correctament. Finalment, no haurien d’oblidar que les dades que analitzem provenen d’experiments sobre macromolècules biològiques de les quals hem de conèixer com funcionen i com es relacionen. És principalment en aquest tercer objectiu en què un biòleg o un bioinformàtic, per fer un estudi complet, haurà de conèixer bé l’ús d’eines bioinformàtiques per extreure el màxim profit de les dades.

Agraïments Aquest article ha estat inspirat per lectures de revisions històriques del camp de la bioinformàtica, incloent, entre altres, la sèrie de Bioinformatics Roots de la revista PLOS Computational Biology (http://www. ploscollections.org/rootsofbioinformatics) i un parell d’articles exceŀlents del grups de Mark Gerstein (Luscombe et al., 2001) i Christos A. Ouzounis (Ouzounis, 2012).

Bibliografia Altschul, S. F. [et al.] (1990). «Basic local alignment search tool». J. Mol. Biol., 215 (3): 403-410. Benson, G. (2014). «Editorial. Nucleic Acids Research annual Web Server Issue in 2014». Nucleic Acids Res., 42 (Web Server issue): W1. Berman, H. M. [et al.] (2000). «The Protein Data Bank». Nucleic Acids Res., 28 (1): 235242. Brooks, C. L. 3rd. (1995). «Methodological advances in molecular dynamics simulations of biological systems». Curr. Opin. Struct. Biol., 5 (2): 211-215. Chothia, C.; Lesk, A. M. (1986). «The relation between the divergence of sequence and structure in proteins». Embo J., 5 (4): 823-826. Elber, R. (1996). «Novel methods for molecular dynamics simulations». Curr. Opin. Struct. Biol., 6 (2): 232-235. Fernandez-Suarez, X. M. [et al.] (2014). «The 2014 Nucleic Acids Research Database issue and an updated NAR online Molecular Biology Database Collection». Nucleic Acids Res., 42 (Database issue): D1-6.

18

Finn, R. D. [et al.] (2014). «Pfam: the protein families database». Nucleic Acids Res., 42 (Database issue): D222-230. Higgins, D. G.; Sharp, P. M. (1988). «CLUSTAL: a package for performing multiple sequence alignment on a microcomputer». Gene, 73: 237-244. Hogeweg, P. (2011). «The roots of bioinformatics in theoretical biology». PLoS Comput Biol., 7 (3): e1002021. Luscombe, N. M. [et al.] (2001). «What is bioinformatics? A proposed definition and overview of the field». Methods Inf. Med., 40 (4): 346-358. Noorden, R. [et al.] (2014). «The top 100 papers». Nature, 514 (7524): 550-553. Ouzounis, C. A. (2012). «Rise and demise of bioinformatics? Promise and progress». PLoS Comput Biol., 8 (4): e1002487. Rost, B. (1999). «Twilight zone of protein sequence alignments». Protein Eng., 12 (2): 85-94.

Treballs de la Societat Catalana de Biologia, 66: 15-18


Microscòpia òptica avançada per a les ciències de la vida: de les seccions òptiques a la nanodissecció òptica Lídia Bardia, Maria Marsal i Julien Colombelli Institut de Recerca Biomèdica de Barcelona

DOI: 10.2436/20.1501.02.154

Correspondència: Julien Colombelli. Institut de Recerca Biomèdica de Barcelona. Carrer de Baldiri Reixac, 10. 08028 Barcelona. Adreça electrònica: julien.colombelli@irbbarcelona.org.

ISSN (ed. impresa): 0212-3037 ISSN (ed. digital): 2013-9802 http://revistes.iec.cat/index.php/TSCB Rebut: 16/10/2014 Acceptat: 10/04/2015

Resum La microscòpia òptica ha patit una gran revolució en les darreres tres dècades amb l’arribada dels làsers i les proteïnes fluorescents. Sent capaços de marcar individualment molècules i proteïnes en cèŀlules i organismes vius, ara els científics poden observar múltiples components ceŀlulars i proteïnes simultàniament, al llarg dels diferents compartiments i teixits, i també veure la interacció d’aquests entre si. Com que la microscòpia de fluorescència moderna està esdevenint una veritable microscòpia molecular amb tècniques específiques per a l’estudi de dinàmica de proteïnes com el FRAP o el FRET, la capacitat dels microscopis òptics de generar imatges altament resolutives, tant en la dimensió espacial com en la temporal, ha millorat dràsticament. En aquest capítol revisem els principis bàsics de la fluorescència, la preparació de mostres biològiques i els conceptes òptics darrere els quals es troba la capacitat de la microscòpia confocal de generar imatges tridimensionals a partir de seccions òptiques. També abordem tècniques basades en la manipulació amb làsers com la nanocirurgia per làser i en discutim aplicacions modernes dins de la biologia ceŀlular i del desenvolupament, en especial l’ablació ceŀlular i la cirurgia intraceŀlular, les quals han esdevingut avui dia eines importants per interactuar amb teixits pluriceŀlulars, ja que ens permeten avaluar forces i estats biomecànics de les cèŀlules durant processos importants del desenvolupament dels organismes. Finalment, expliquem els principis d’un dels últims avenços en l’adquisició d’imatges de fluorescència, la microscòpia en full de llum, que permet als científics esquivar les principals limitacions de les microscòpies convencional i confocal, ja que ofereix les capacitats d’adquirir imatges en profunditat en llargs períodes de temps.

Paraules clau: microscòpia òptica, microscopi confocal, làser, fluorescència, full de llum.

Advanced optical microscopy for life sciences: from optical sections to optical nanodissection Summary Optical microscopy has undergone several revolutions in the past three decades with the advent of lasers and fluorescent proteins. By being able to label single molecules and proteins in living cells and organisms, scientists can now observe multiple cellular components and proteins simultaneously, moving across compartments and tissues and interacting with each other. As modern fluorescence microscopy is turning into truly molecular microscopy with specific techniques for the study of protein dynamics like FRAP or FRET, the capability of optical microscopes to generate highly resolved images, both in spatial and temporal dimensions, is also dramatically improving. In this chapter, we review the basic principles of fluorescence, the preparation of biological samples and the optical concepts behind the capability of confocal microscopy to generate threedimensional images on the basis of optical sections. We also approach laser-based manipulation techniques such as laser nanosurgery and discuss modern applications in cell and development biology, in particular how cell ablation and intracellular surgery have now become important tools for interacting with multicellular tissues since they allow the probing of forces and biomechanical states of cells during important development processes of organisms. Lastly, we set forth the principles of one of the latest advances in fluorescence imaging, light sheet microscopy, which allows experimentalists to circumvent several major limitations of conventional and confocal microscopy by offering the capability of imaging deeply and for very long periods of time.

Keywords: optical microscopy, confocal microscope, laser, fluorescence, light sheet.

Dels inicis a la microscòpia de fluorescència Per als antics, el món físic era allò que podien veure. Però va succeir que l’home va interessar-se per conèixer un univers més gran, en tota la seva dimensió, amb l’ajuda dels primers telescopis, i també un món més petit, el que existia per sota dels límits del que es podia percebre amb l’ull humà. A principis del segle xvi es van dissenyar els primers microscopis simples, lents úniques per engrandir objectes petits, tot i que el terme microscopi es va emprar per primer cop per referir-se al microscopi compost de Galileu, que ell mateix anomenava occhiolino (‘ull petit’). Però un bon microscopi no és aquell que només magnifica, sinó que és aquell en què la imatge generada és ben definida; així doncs, la bona qualitat del funcionament d’un microscopi està determinada per la capacitat de visualitzar i distingir objectes minúsculs

en la mostra. Al segle xix, diferents científics, Abbe, Rayleigh i Airy entre d’altres, van treballar per poder definir un criteri que predigués acuradament el nivell de detall que un microscopi és capaç de resoldre. Avui sabem que moltes de les qüestions biològiques més rellevants s’han pogut respondre gràcies als microscopis òptics, i que moltes de les encara no respostes són potencialment abordables. El coneixement de les propietats de la llum, la millora tècnica de les lents i les fonts de llum, l’explotació de les capacitats dels microscopis per millorar la resolució fins a superar els límits imposats per la naturalesa de la llum, fan que la microscòpia òptica sigui una eina essencial per a molts dels estudis biològics. Avui dia les tècniques modernes de microscòpia òptica ofereixen la resolució temporal i espacial necessàries

Treballs de la Societat Catalana de Biologia, 66: 19-24

19


Lídia Bardia, Maria Marsal i Julien Colombelli

Figura 1. Principis de la microscòpia de camp ampli i confocal. Comparem les configuracions òptiques així com les imatges resultants de les microscòpies d’epifluorescència i confocal en a i h, utilitzant com a mostra model un mateix disc imaginal d’ala de Drosophila, formada per diverses capes multiceŀlulars i amb tres marcatges: DAPI per marcar els nuclis, faloïdina-FITC per marcar l’actina de les cèŀlules i una proteïna fluorescent vermella expressada en les cèŀlules dorsals. En b, l’esquema simple d’un microscopi d’epifluorescència mostra que l’excitació i l’emissió estan separades mitjançant un divisor de feix de llum i que s’utilitzen filtres d’amplitud de banda fixa per capturar la llum emesa. Un microscopi confocal, en canvi, té moltes implementacions diferents, però una manera genèrica de representar-lo es mostra en h. Un làser escaneja a través de l’objectiu per excitar la mostra punt per punt, i l’emissió es recull al llarg del camí òptic on es produirà el filtratge espectral, així com el filtratge espacial clau en la tècnica amb l’ús d’un pinhole per produir l’efecte de seccionament òptic. En n representem l’efecte de l’escaneig al llarg de la mostra i es mostra el camí del làser i com la imatge és formada tot recollint intensitats òptiques, píxel per píxel, mentre que en m mostrem el principi del seccionament òptic, és a dir, l’efecte produït pel pinhole que permet descartar els raigs de fora del pla d’enfocament. En i es mostren els espectres d’emissió i absorció dels tres fluorocroms usats. L’efecte confocal és sobretot visible quan es compara j, k, l i m (epifluorescència) amb c, d, e i f (confocal), en què es poden veure clarament imatges molt més nítides així com el rebuig axial de la llum provinent del fons de la mostra. Les imatges en a i g són projeccions màximes de la mostra sencera, mentre que c-f i j-m són plans únics. Les imatges en color s’han generat combinant les intensitats de cada canal i assignant a cadascun un color fals diferent, i no representen les propietats espectrals dels flurocroms. Barra d’escala en a i g: 0,2 mm.

per permetre estudiar la localització precisa, i dinàmica, de molècules i proteïnes en cèŀlules, teixits, òrgans i, fins i tot en organismes vius.

20

Tot i que les estructures dins d’una cèŀlula difereixen les unes de les altres, sovint no som capaços de veure-les. Si, a més, no les podem tenyir, com podríem distingir-les? Sens dubte, per a la biologia ceŀlular i la biomedicina, l’avenç per exceŀlència va ser l’aparició de la microscòpia de fluorescència. L’aplicació d’un ampli ventall de fluorocroms ha fet possible la identificació de cèŀlules i components subceŀlulars amb una alta especificitat. Els fluorocroms han d’estar acoblats a proteïnes i d’aquesta manera se’n pot veure la localització. Mitjançant la utilització de marcatges fluorescents múltiples, diferents sondes poden identificar diverses molècules diana simultàniament (vegeu la figura 1). Hi ha fluorocroms naturals, però també se n’estan desenvolupant molts de sintètics, amb els perfils d’excitació i emissió coneguts, que cobreixen àmpliament tot l’espectre de llum (vegeu la figura 1i). Però sobretot, la possibilitat d’expressar in vivo proteïnes fluorescents com la GFP (green fluorescent protein) i els seus derivats, ha permès comprendre com treballen les cèŀlules vives (Prasher, 1995). Aquestes proteïnes fluorescents es poden expressar selectivament en els diferents orgànuls ceŀlulars. La microscòpia de fluorescència va ser una revolució en si mateixa i va impulsar el desenvolupament d’altres tècniques, com la microscòpia confocal i la multifotònica, que ens permeten la visualització en tres dimensions. La microscòpia de fluorescència explota la capacitat d’una àmplia família de molècules d’emetre fotons de llum quan són excitades. El punt clau en aquest mecanisme és el desplaçament entre l’espectre d’emissió i la llum incident d’excitació. El fotó emès té menys energia i, per tant, una longitud d’ona més gran, i així doncs, excitar amb llum blava resultarà en l’emissió de fotons de longitud d’ona més gran, en el rang dels verds. Hi ha una varietat enorme de molècules i proteïnes fluorescents, tantes que virtualment tots els colors de l’espectre visible poden ser emesos. Com que les llums d’excitació i emissió són espectralment diferents, és fàcil separar-les amb filtres òptics, com mostrem en la figura 1b. En la microscòpia de fluorescència convencional (vegeu les figures 1a-f ), s’utilitza un filtre d’excitació per restringir l’espectre de llum incident (com per exemple una làmpada de mercuri o de LED). Aquest filtre d’excitació es posa entre la font de llum i un divisor de feix de llum, que sovint és un mirall dicroic que reflecteix les longituds d’ona curtes de l’excitació cap a la mostra a observar i transmet la longitud d’ona més llarga de l’emissió cap al detector. Una de les diferències principals entre un microscopi convencional de fluorescència i un microscopi confocal és la manera d’iŀluminar la mostra. En el primer, tota la mostra s’iŀlumina amb una font de llum d’ampli espectre, com la llum blanca, mentre que en el segon, la iŀluminació s’aconsegueix escanejant amb un o més feixos de llum enfocats, provinents de làsers, sobre la mostra, línia per línia (vegeu les figures 1h, n). Els làsers (light amplification by stimulated emission of radiation o amplificació de llum per emissió estimulada de radiació) són components essencials en els microscopis confocals, perquè poden dur un feix de llum suficient i de qualitat a un sol punt. En un medi actiu (com gas, cristall, líquid), la llum s’emet per una descàrrega elèctrica o òptica (estimulació). A continuació, aquests fotons es multiplicaran, i circularan endavant i endarrere en una cavitat ressonant, on s’emetran més fotons. Els làsers amplifiquen la llum i produeixen feixos coherents, que poden ser molt intensos, altament direccionals i molt purs en freqüència. N’hi ha de diferents tipus en funció del medi que genera l’acció làser: gas, estat sòlid, líquid o semiconductors. Els làsers de gas poden emetre diferents línies d’excitació simultà-

Treballs de la Societat Catalana de Biologia, 66: 19-24


Microscòpia òptica avançada per a les ciències de la vida: de les seccions òptiques a la nanodissecció òptica

niament, mentre que els d’estat sòlid típicament emeten una longitud d’ona específica. Recentment, s’han introduït làsers blancs personalitzables en la microscòpia confocal i permeten seleccionar qualsevol longitud d’ona de l’espectre visible per a l’excitació de les molècules fluorescents. Gràcies a l’ampli ventall de longituds d’ona disponibles, pràcticament qualsevol fluorocrom pot ser excitat si la longitud d’ona del làser coincideix amb el pic d’absorció de la molècula. Com acabem de veure, doncs, la microscòpia òptica engloba l’ús i desenvolupament de moltes tècniques així com de diferents equips que permetran la realització d’aplicacions diverses.

La microscòpia làser confocal És una de les tècniques de microscòpia òptica més utilitzades en els últims temps en moltes de les branques de la ciència pels seus grans avantatges respecte a la microscòpia òptica convencional. Fou patentada el 1961, però no va ser fins als anys vuitanta que van aparèixer els primers models comercials; actualment són una eina molt usada en la recerca de molts investigadors. Un microscopi òptic confocal és un equip capaç d’obtenir imatges tridimensionals d’un objecte fluorescent però amb més nitidesa, contrast i resolució que l’obtinguda amb la microscòpia de fluorescència convencional. Entenem resolució com la mínima separació entre dos punts en la qual dos objectes es poden resoldre o diferenciar, tant en profunditat, eix vertical o eix Z, com en l’eix horitzontal o eixos XY de la mostra, i permetrà resoldre millor (separar) partícules petites, fins als 200 nm de mida. Es generaran imatges seriades de seccions òptiques, no físiques, de la mostra tot basant-se en un principi molt similar al del microscopi òptic convencional de fluorescència però usant uns diafragmes anomenats pinhole (‘forat de la mida d’una agulla’) localitzats al camí òptic de detecció. El pinhole és, doncs, la clau de l’èxit. Gràcies a aquest filtratge espacial, tota la informació que hi passa a través serà la informació provinent del pla focal (pla de la imatge de la figura 1m), i aquesta és la que es capturarà, i en quedarà exclosa la que prové d’altres plans fora de focus, de manera que s’eliminaran així els feixos de llum provinents de plans inferiors i superiors al d’enfocament (Boyde, 1988). Amb l’ús del làser s’obté més excitació dels fluorocroms de la mostra en profunditat a través d’un escaneig línia per línia o el moviment del feix de llum al llarg de la mostra (vegeu la figura 1n), que anirà donant lloc a l’aparició de les diferents imatges seriades (vegeu la figura 1h). Els fluorocroms emetran fotons que travessaran el camí òptic de detecció (vegeu la figura 1h) a través del pinhole i seran capturats per uns detectors. Ara els fotons es transformaran en electrons, tot amplificant el senyal però també el soroll que s’origina. Finalment aquest senyal es transformarà en imatge digital, es convertirà la intensitat òptica en valors de grisos a la imatge i s’ompliran tots els píxels seqüencialment, en les tres dimensions. En la figura 1h se n’explica el funcionament. Com hem vist, el principal mode de captura del microscopi òptic confocal és l’adquisició en profunditat d’imatges individuals seriades de mostres tridimensionals, i aquestes poden estar fixades o vives. Les mostres són marcades amb un o diversos colorants al llarg de l’espectre, tot depenent de la diversitat del que es vol visualitzar. Les adquisicions poden ser en un únic punt del temps, i llavors es coneixen com a adquisició en XY, si són només d’una secció òptica, o bé XYZ si són d’adquisicions de seccions òptiques en sèrie. Poden ser també en forma de peŀlícula, i llavors s’adquireixen molts punts en el temps, i s’observen

Figura 2. Estudi de les forces en cèŀlules i teixits amb la nanodissecció per làser. Cèŀlula de mamífer d’una línia immortalitzada d’Hypsiprymnodon moschatus, un ratolí marsupial que expressa GFP associada a l’actina, en a-e. Un làser polsant escaneja al llarg de diverses fibres d’actina (fibres d’estrès), i indueix un dany local sense afectar la viabilitat ceŀlular. Després del tall, les fibres comencen a retreure’s, i se’n veu la contractilitat intrínseca. Després de 20 s (d) les fibres comencen un procés de reparació que durà a la restauració de la contractilitat per repolimerització de l’actina. Les cèŀlules poden percebre pèrdues i guanys de les forces intraceŀlulars i organitzar els mecanismes per reparar-les i equilibrar-les. Aquest efecte és part d’un fenomen ampli conegut com a mecanosensibilitat. En f ensenyem un esquema del tancament dorsal en l’embrió de Drosophila en què les forces implicades en tancar el teixit durant el desenvolupament estan representades amb fletxes. El teixit del centre se sotmet a cirurgia per làser de g fins a i: ablació de dues cèŀlules veïnes dirigint una línia molt petita de làser (aproximadament de 2 µm de llargada) a la seva membrana comuna d’unió. Poc després del tall, en escala de segons, la ferida s’obre, a causa del teixit circumdant, que es contrau intrínsecament. La retracció de les vores ceŀlulars és una prova de les forces de contracció presents en els teixits. Barra d’escala: 10 µm.

així processos dinàmics en mostres vives; en aquest cas són adquisicions XYT, i poden ser també en 4 dimensions, XYZT.

Aplicacions de la microscòpia làser confocal Les aplicacions principals dins el camp de la biologia en són moltes i molt diverses. Així, per exemple, es poden dur a terme des d’estudis de l’expressió de proteïnes en diferents línies de cèŀlules fins a l’estudi del desenvolupament in vivo de moltes espècies animals i vegetals (Pawley, 1989). Fem un esment especial a l’ús in vivo de cèŀlules mare embrionàries fluorescents, les quals han permès en els darrers temps gràcies al microscopi ser capturades en mode peŀlícula o XYZT, i s’han vist els processos de diferenciació que pateixen al llarg del temps. Per tant, assolir la visualització en tres dimensions ha estat possible gràcies a la microscòpia confocal i ha permès als biòlegs del desenvolupament, per exemple, estudiar in vivo com i cap a on les cèŀlules migren per acabar formant part dels diferents teixits i òrgans. En aquest sentit, els estudis en la biologia del càncer també s’han vist impulsats gràcies al fet que aquesta tècnica permet visualitzar in vivo la compartimentació de cèŀ-

Treballs de la Societat Catalana de Biologia, 66: 19-24

21


Lídia Bardia, Maria Marsal i Julien Colombelli

lules canceroses, marcades amb fluorescència, en relació amb els teixits veïns durant els progressos d’expansió tumorals (Cortina et al., 2007). Com a exemple d’aplicacions més rellevants i més usades trobem el que es coneix com a estudi de la coŀlocalització. Aquest permet saber si dues o més molècules en una mateixa mostra són molt properes o es troben en posicions espacials idèntiques (al mateix lloc), la qual cosa permet pensar que aquestes proteïnes podrien estar interaccionant, de manera directa o indirecta (Mauvezin et al., 2012). Una altra aplicació freqüentment usada és la d’immunofluorescències i detecció de sondes fluorescents, a través de l’ús de fluorocroms o marcadors específics per a una proteïna d’interès, o per a un determinat orgànul ceŀlular. Això permet l’estudi de nombrosos fenòmens, com en són l’apoptosi (mort ceŀlular), la proliferació i la localització ceŀlular i subceŀlulars, així com la difusió i l’expressió de proteïnes, entre d’altres. En el cas de mostres fixades, les immunotincions amb l’ús d’anticossos primaris que s’uneixen a la proteïna de la qual es vol conèixer la localització són molt freqüents. Anticossos secundaris conjugats a Figura 3. Adquisició d’imatges de mostres grans amb la microscòpia de fluorescència en full de llum. Adquisició d’imatges d’un embrió de ratolí en a, fixat i aclarit òpticament amb BABB, i muntat en una càpsula d’agarosa. La imatge es forma capturant l’autofluorescència movent la mostra a través del full de llum com es mostra en b. El full de llum es forma enfocant un làser coŀlimat amb una lent cilíndrica, que enfoca només en una dimensió. El sistema de detecció és molt senzill perquè només es necessiten filtres d’emissió i una càmera, com en els microscopis d’epifluorescència convencionals. Aquesta configuració permet fer zoom per visualitzar els òrgans com el cor o els pulmons en c, o cèŀlules i túbuls als pulmons en e. El postprocessament de la imatge permet visualitzar l’embrió sencer, com mostrem en d-f (una projecció màxima amb transparència) o en g (representació de la superfície combinada a la vegada amb les dades originals en el pla de tall). Finalment, el poder de la tècnica es mostra en h, en què els òrgans van ser segmentats completament (groc: pulmons; verd: fetge; lila: cor) i es representen en segments per ensenyar les dades originals en els plans de tall. Barra d’escala: 1 mm.

fluorocroms s’uniran a aquests anticossos primaris, i permetran així la visualització de la seva presència i la localització ceŀlular i subceŀlular. El que es coneix com a fotoactivació, o la seva variant fotoconversió, han estat aplicacions per a models in vivo, molt revolucionàries en els últims temps (Bancaud et al., 2010). Exploten els canvis conformacionals induïts en l’estructura química de les molècules fluorescents quan aquestes són excitades a longituds d’ona concretes pels làsers. S’usa en mostra viva i permet saber la vida mitjana d’una proteïna o si hi ha transport d’aquesta a escala intraceŀlular. En la fotoactivació s’indueix l’alliberament de la fluorescència quan un làser concret excita la molècula. En la fotoconversió, en canvi, el que es produeix és un canvi en l’emissió de la molècula, i es passa d’una longitud d’ona a una altra, de manera que canvia de color en l’emissió (Ando et al., 2002). Seguint amb aplicacions noves trobem el FRAP i el FRET. El FRAP (fluorescence recovery after photobleaching, o recuperació de la fluores­ cència després del fotocremat) és una altra aplicació que permet l’observació del moviment intraceŀlular perquè s’indueix l’extinció de la fluorescència en una zona concreta de la mostra, in vivo i a través de la captura en mode peŀlícula, es veu si existeix recuperació de la fluorescència en la zona concreta prèviament cremada. El FRAP permet veure dinamisme, difusió o desplaçament de les molècules que encara retenen la fluorescència i que reemplacen les extingides; per exemple, permet l’estudi del transport proteic entre diferents orgànuls ceŀlulars, o entre el nucli i el citoplasma veient si hi ha compartimentació (Saulière-Nzeh Ndong et al., 2010). El FRET (Förster resonance energy transfer o transferència d’energia per ressonància Förster) permet la detecció d’interaccions entre dues molècules biològiques (proteïnes, lípids, àcids nucleics). Caldrà que aquestes siguin properes i es trobin a uns 1-10 nm de distància. Quan la primera, coneguda com a molècula donadora, està sola, emetrà fluorescència en ser excitada apropiadament. Ara bé, quan hi ha la segona molècula, coneguda com a acceptora, suficientment a prop, la primera li transferirà energia, sense emetre fluorescència. És a dir, el que s’espera quan hi ha FRET és una disminució de la fluorescència del donador i un increment de la de l’acceptor (Sekar et al., 2003).

La micro/nanocirurgia per làser Hem vist com els làsers s’utilitzen de manera no invasiva per excitar fluorescència, generar imatges tridimensionals i estudiar la dinàmica de proteïnes. Però els làsers també tenen altres utilitats en els estudis de biologia: una de les tècniques més recents, que combina l’acció de làsers i la microscòpia, és la micro/nanocirurgia per làser. La manipulació i ablació per làser, altament precisa i dirigida a materials biològics, permet, per exemple, dur a terme experiments fins fa poc impossibles en la biologia ceŀlular i del desenvolupament. Poc després de la invenció el 1960 del làser polsant de robí, els científics van començar a investigar el potencial de la radiació làser polsada per a aplicacions mèdiques. Ja s’anticipava llavors que els làsers servirien per a la manipulació i destrucció de teixits biològics amb una precisió i selectivitat que no coneixia precedents. Avui dia, es poden ablacionar cèŀlules individuals i fins i tot es pot fer nanocirurgia intraceŀlular, per exemple de determinats compartiments ceŀlulars, in vivo sense perjudicar la viabilitat de la cèŀlula o teixit. Així doncs, recentment, polsos ultracurts (picosegons) de làsers ultraviolats i infraroig s’han utilitzat per tallar microtúbuls (Colombelli et al., 2005) i fibres d’actina (Colombelli et al., 2009) en el rang de micròmetres. Una de les aplicacions d’aquesta tècnica és l’estudi de les forces a les quals els teixits biològics

22

Treballs de la Societat Catalana de Biologia, 66: 19-24


Microscòpia òptica avançada per a les ciències de la vida: de les seccions òptiques a la nanodissecció òptica

estan subjectes durant el desenvolupament o en la reparació de dany (Colombelli i Solon, 2013). Ara ja es coneixen millor els mecanismes fonamentals que governen les interaccions làser-teixit biològic. Es coneix que el mecanisme d’ablació implica la formació d’un plasma, confinat en un punt de l’espai. El volum d’energia que es diposita es pot controlar enfocant el làser, perquè la formació de plasma només té lloc en localitzacions en què el llindar d’irradiància determinat és superat (Vogel i Venugopalan, 2003). Caldrà, doncs, controlar la duració del pols, i fer talls precisos per obtenir polsos de làser curts, típicament per sota d’un nanosegon. Més enllà del rang de nanosegons, el plasma absorbeix massa energia i continua creixent, fins a induir un dany incontrolat a la mostra. Controlant la freqüència i la densitat (distància entre polsos), així com l’energia de cada pols, es pot assolir una precisió de dissecció de 450 nm (Colombelli et al., 2004). Amb l’equipament adequat, es pot irradiar in vivo amb llum polsada una estructura determinada i visualitzar-la simultàniament. El sistema de dissecció es pot implementar en un microscopi invertit, per exemple, ja sigui de fluorescència convencional o confocal, i amb els objectius adequats es pot fer cirurgia subceŀlular, i fins i tot de mostres gruixudes com embrions sencers, com detallem més avall. Per exemple, si tenim una proteïna del citosquelet marcada fluorescentment, se’n pot estudiar la distribució abans i després de l’ablació per làser. Així, s’han fet estudis de correlació de la localització d’una proteïna i la distribució de forces (a escala ceŀlular) al llarg dels filaments d’actina (Colombelli et al., 2009), i s’ha demostrat que algunes proteïnes són mecanosensibles, reclutades on les cèŀlules exerceixen forces mecàniques, possiblement per activar vies moleculars i dur a terme una funció biològica en resposta a aquestes forces. Molts d’aquests estudis es fan en organismes model com Drosophila melanogaster (mosca del vinagre) o Danio rerio (peix zebra), in vivo, per entendre la contribució dels diferents teixits de l’embrió, quant a les forces que apliquen, durant els diferents processos morfogenètics. Per exemple el tancament dorsal durant la metamorfosi de D. melanogaster, on un teixit extraembrionari, l’amnioserosa, exerceix forces necessàries per a la formació del tòrax de la mosca adulta, estirant els teixits veïns per apropar-los i tancant el forat amb un efecte de cremallera. Aquestes forces s’han avaluat amb l’ablació per làser de les unions cèŀlula a cèŀlula de l’amnioserosa (Solon et al., 2009). En un altre tipus d’estudis, els investigadors actualment s’han centrat a descobrir els mecanismes de la migració ceŀlular en òrgans específics. En la formació de la tràquea en els embrions de D. melanogaster, ablacionar cèŀlules individuals al capdavant o al final d’un òrgan en formació permet demostrar si les cèŀlules migren individualment, o si requereixen la contribució de les cèŀlules veïnes per dur a terme un procés de migració coŀlectiva. Últimament, aquests estudis tenen implicacions molt importants per a la biologia del càncer, ja que ofereixen mecanismes alternatius, basats en senyals mecànics, per a la comprensió de comportaments ceŀlulars bàsics, com la migració de les cèŀlules, la qual cosa qüestiona una explicació purament genètica per a moltes malalties. Fins i tot, per a estudis in vivo de processos com la regeneració axonal, que són difícils i quasi impossibles en la majoria de vertebrats, s’ha emprat aquesta tecnologia. Aquest procés, essencial per al manteniment del sistema nerviós adult, tant després de lesions nervioses com en malalties neurodegeneratives, es pot estudiar amb aquesta tècnica

de microcirurgia per làser, tallant les cèŀlules nervioses que innerven un dels òrgans sensorials de D. rerio (Graciarena et al., 2014).

Microscòpia de fluorescència en full de llum (LSFM o SPIM) És una tècnica nova que podem trobar dins de la microscòpia òptica, revolucionària en la velocitat d’adquisició, en la disminució de la fototoxicitat per a la mostra i en més profunditat d’escaneig tridimensional. Coneguda com a LSFM (light-sheet fluorescence microscopy o microscòpia de fluorescència en full de llum, també anomenada SPIM, selective plane illumination microscopy, Huisken et al., 2004). Es va introduir fa uns deu anys per a la captura de la fluorescència de mostres in vivo. La clau és en la iŀluminació, que aquí és perpendicular a la direcció d’observació, com es mostra en la figura 3. El feix del làser enfoca en una sola direcció mitjançant l’ús de lents cilíndriques. Un full de llum molt fi, provinent d’aquest làser, és generat a la regió focal i iŀlumina la mostra des del seu costat, mentre que la fluorescència és recollida per la part frontal en una secció molt estreta de la mostra, que també es pot iŀluminar seqüencialment des dels dos costats. La mostra, a la vegada, serà moguda a través d’aquest full de llum i es generarà un seguit d’imatges seriades, com en el cas del microscopi confocal, per poder-les finalment combinar i obtenir imatges en tres dimensions. Les imatges poden ser generades en fraccions de segon gràcies a l’ús de càmeres d’adquisicions molt ràpides, cosa que permet així l’estudi de processos dinàmics del desenvolupament, com el batec del cor de D. rerio (Mickoleit et al., 2014) o estudis morfogenètics en el desenvolupament de D. melanogaster (Krzic et al., 2012). La velocitat d’adquisició que permet aquesta tècnica la fa òptima per a l’ús d’organismes vius en l’estudi del seu desenvolupament. Els principals avantatges són la baixa fototoxicitat que es genera en la mostra, ja que el làser s’aplica molt poc temps a cada secció i no s’enfoca en un únic punt, sinó que és difós en full cap a la mostra (vegeu la figura 1n), l’increment en la velocitat durant l’adquisició, ja que no hi ha necessitat de pinhole o de cap filtratge geomètric, cosa que augmenta dràsticament l’eficiència en la detecció, i el poc fotocremat dels fluorocroms, amb la qual cosa es requereix molta menys potència de làser que en microscòpia òptica confocal. Per a l’adquisició i penetració correcta del làser és necessari que les mostres siguin com més transparents millor, com en el cas de D. rerio o de l’embrió de D. melanogaster. Però per a certes mostres fixades hi ha la possibilitat d’aplicar un protocol d’aclariment previ, usant components químics que transparenten la mostra, per tal que quan el làser hi arribi pugui penetrar millor i no sigui dispersat cap als costats. Es generaran imatges més resolutives i amb més profunditat de captura, la qual cosa permet la visualització d’òrgans i organismes sencers. Hi ha diferents productes clarificants de les mostres fixades. El més usat és el BABB, barreja de benzil alcohol amb benzil benzoat (Dodt et al., 2007) però aquesta barreja, abans de la deshidratació de la mostra, produeix la pèrdua o disminució de l’expressió del fluorocrom en les proteïnes fluorescents com la GFP i, per tant, han aparegut nous mètodes. El CLARITY (Chung et al., 2013) és un compost molt prometedor usat actualment per transparentar les mostres amb una millor preservació de la fluorescència. El tipus de mostres que s’utilitzen amb l’SPIM solen ser molt gruixudes i no poden ser visualitzades d’extrem a extrem. Per això, un altre dels avantatges de la tècnica és la possibilitat d’adquirir imatges de la mateixa mostra però des de diferents angles (multiview acquisition), ja

Treballs de la Societat Catalana de Biologia, 66: 19-24

23


Lídia Bardia, Maria Marsal i Julien Colombelli

que el tipus de muntatge permet la rotació de la mostra (fet que no és possible en microscopis més convencionals), normalment encastada en un material com l’agarosa o similar. Caldrà un postprocessament de les dades per poder sumar la informació obtinguda des de diferents angles, tot incrementant així la resolució del microscopi. Volem fer un esment especial a l’ultramicroscopi, un equip pensat per a la visualització d’estructures grans, a un nivell macroscòpic. A l’Institut de Recerca Biomèdica de Barcelona se n’ha desenvolupat un amb el nom de MacrosSPIM. Com a exemples de mostres utilitzades, trobem els diferents òrgans de ratolí o certs tumors injectats, que generen masses ceŀlulars enormes, fins al rang de centímetres. Fins ara, l’anàlisi de teixits, i en particular l’anàlisi de tumors en els teixits, sempre ha estat duta a terme en la mostra tenyida mateixa prèviament, fent-ne seccions seriades amb equips de microdissecció com el criòstat o el micròtom, entre d’altres. Aquest tipus de treball fet a través de seccions histològiques és d’interpretació difícil en tres dimensions si es pretén entendre la morfologia dels òrgans, i és molt difícil ferne la reconstrucció. Amb l’ajuda del MacroSPIM ens podem endinsar en la captura de fins a centímetres de gruix en mostres transparentades prèviament. És molt important en estudis de biomedicina, ja que, per exemple, es pot estudiar la vascularització de tumors sencers i començar a estudiar l’organització global del creixement tumoral en 3D dins de cada òrgan. I també, de manera molt important, la tècnica permet estudiar els defectes anatòmics i de desenvolupament que determinades mutacions tenen en els embrions. Un escenari típic en recerca bàsica en oncologia és mutar proteïnes implicades en la proliferació del càncer tot introduint aquesta proteïna o molècula modificada a un organisme, generalment el ratolí. Però moltes proteïnes són tan importants que les seves mutacions resulten letals i impedeixen que els científics puguin obtenir una progènie viable per treballar-hi. En aquest cas, el MacroSPIM és molt útil perquè permet l’estudi sistemàtic de l’embrió, de qualsevol estadi i mida, per inferir el paper de les mutacions específiques en el seu desenvolupament, per exemple provocant hipertròfia d’òrgans en determinades condicions, defectes anatòmics, etc. És, per tant, una revolució en la interpretació de la tridimensionalitat de les estructures, i, com mostrem en la figu-

ra 3, les imatges ofereixen una representació similar a la ben coneguda tècnica TAC (MRI, magnetic resonance imaging), però òptica, amb la gran diferència que el macroSPIM proporciona resolució ceŀlular en òrgans sencers. Finalment, un altre avantatge d’aquest sistema és que els investigadors mateixos el poden construir a un preu força assequible, sempre que tinguin uns coneixements previs imprescindibles d’òptica. Hi ha una plataforma d’accés obert en la qual es troba explicat pas per pas com es pot construir un SPIM o com es pot ampliar o adaptar-ne un d’existent. Aquesta plataforma es diu openSPIM (openSPIM.org) i també s’hi explica quines peces cal adquirir o dissenyar per construir correctament el sistema.

Què ens depara el futur? Des dels inicis de la creació del primer microscopi òptic compost per Galileu fins al desenvolupament dels equips de microscòpia òptica més avançats que acabem d’explicar han passat uns quatre-cents anys, però realment ha estat en els darrers vint o trenta anys quan l’evolució en el desenvolupament d’aquests equips s’ha donat d’una manera més dràstica. Què ens depara el futur? Podrem arribar a combinar la superresolució, de pocs nanòmetres, amb la visualització de mostres de centímetres de gruix, per exemple? Tindrem càmeres encara més sensibles i ràpides? Podrem seguir i visualitzar les cèŀlules, una per una, al llarg del desenvolupament d’un organisme viu, com alguns ja s’han aventurat a intentar? Sens dubte, apareixeran noves modificacions dels equips ja existents que ens permetran veure estructures des d’una perspectiva nova o nous sistemes fins ara inimaginables que apareixeran i formaran part de la història de la microscòpia òptica. Implementacions ara com ara impensables per als microscopistes experts en el camp donaran segur una aproximació a les respostes de les moltes qüestions biològiques plantejades i encara no resoltes.

Agraïments Agraïm a Najate Benhra (IRB Barcelona) per la preparació de la mostra dels discs imaginals, a Helena González (IRB Barcelona) pels embrions de ratolí, i a Jérôme Solon (CRG) pels embrions de Drosophila.

Bibliografia Ando, R. [et al.] (2002). «An optical marker based on the UV-induced green-to-red photoconversion of a fluorescent protein». Proc. Natl. Acad. Sci. USA, 99 (20): 1265112656. Bancaud, A. [et al.] (2010). «Fluorescence perturbation techniques to study mobility and molecular dynamics of proteins in live cells: FRAP, photoactivation, photoconversion, and FLIP». Cold Spring Harb. Protoc., 12. Boyde, A. (1988). «Confocal optical microscopy. Microscopy and analysis». January, 7-13. Chung, K. [et al.] (2013). «Structural and molecular interrogation of intact biological systems». Nature, 497 (7449): 332-337. Colombelli, J. [et al.] (2004). «Ultraviolet diffraction limited nanosurgery of live biological tissues». Rev. Sci. Instrum., 75: 472. — (2005). «In vivo selective cytoskeleton dynamics quantification in interphase cells induced by pulsed ultraviolet laser nanosurgery». Traffic, 6 (12): 1093-1102. — (2009). «Mechanosensing in actin stress fibers revealed by a close correlation between force and protein localization». J. Cell Sci., 122 (10): 1665-1679. Colombelli, J.; Solon, J. (2013). «Force communication in multicellular tissues addressed by laser nanosurgery». Cell Tissue Res., 352 (1): 133-147. Cortina, C. [et al.] (2007). «EphB-ephrin-B interactions suppress colorectal cancer progression by compartmentalizing tumor cells». Nat Genet., 39 (11): 1376-1383. Dodt, H. U. [et al.] (2007). «Ultramicroscopy: three-dimensional visualization of neuronal networks in the whole mouse brain». Nat. Methods., 4 (4): 331-336.

24

Graciarena M. [et al.] (2014). «Dynamics of axonal regeneration in adult and aging zebrafish reveal the promoting effect of a first lesion». Proc. Natl. Acad. Sci. USA, 111 (4): 1610-1615. Huisken, J. [et al.] (2004). «Optical sectioning deep inside live embryos by selective plane illumination microscopy». Science, 305 (5686): 1007-1009. Krzic, U. [et al.] (2012). «Multiview light-sheet microscope for rapid in toto imaging». Nat. Methods, 9 (7): 730-733. Mauvezin, C. [et al.] (2012). «DOR undergoes nucleo-cytoplasmic shuttling, which involves passage through the nucleolus». FEBS Lett., 586 (19): 3179-3186. Mickoleit, M. [et al.] (2014). «High-resolution reconstruction of the beating zebrafish heart». Nat. Methods, 11 (9): 919-922. Pawley, J. B. (1989). Handbook of biological confocal microscopy. Springer. Prasher, D. C. (1995). «Using GFP to see the light». Trends Genet., 11 (8): 320-323. Saulière-Nzeh Ndong, A. [et al.] (2010). «Agonist-selective dynamic compartmentalization of human Mu opioid receptor as revealed by resolutive FRAP analysis». J. Biol. Chem., 285 (26): 20422 Sekar, R. B. [et al.] (2003). «Fluorescence resonance energy transfer (FRET) microscopy imaging of live cell protein localizations». J. Cell Biol., 160 (5): 629-633. Solon, J. [et al.] (2009). «Pulsed forces timed by a ratchet-like mechanism drive directed tissue movement during dorsal closure». Cell, 137 (7): 1331-1342. Vogel, A.; Venugopalan, V. (2003). «Mechanisms of pulsed laser ablation of biological tissues». Chem. Rev., 103 (2): 577-644.

Treballs de la Societat Catalana de Biologia, 66: 19-24


La microscòpia electrònica de transmissió en biologia ceŀlular: valoració de les tècniques i informació de les imatges Núria Cortadellas1 i Mercè Durfort2 Unitat de Microscòpia Electrònica, Centres Científics i Tecnològics de la Universitat de Barcelona, Facultat de Medicina, Universitat de Barcelona 2 Departament de Biologia Ceŀlular, Facultat de Biologia, Universitat de Barcelona 1

DOI: 10.2436/20.1501.02.155 ISSN (ed. impresa): 0212-3037 ISSN (ed. digital): 2013-9802

Correspondència: Mercè Durfort. Departament de Biologia Ceŀlular, Universitat de Barcelona. Avinguda de la Diagonal, 645. 08028 Barcelona. Adreça electrònica: mdurfort@ub.edu.

http://revistes.iec.cat/index.php/TSCB Rebut: 25/02/2015 Acceptat: 05/04/2015

Resum La microscòpia electrònica de transmissió dins l’àmbit de la biologia ceŀlular és una tècnica consolidada i una eina molt útil en la recerca biomèdica. Dins de les microscòpies és la que té un límit de resolució més alt i, per tant, la fa una tècnica molt eficient per interpretar l’arquitectura ceŀlular i poder relacionar aquesta estructura amb la seva funció. La innovació i la millora d’equipaments, juntament amb el desenvolupament de noves tecnologies, permeten assolir un millor coneixement del teixit biològic, una millor visualització de les estructures i la identificació i localització de molècules. Es defineixen processos i conceptes, valorant els avantatges i desavantatges de cada tècnica, la imatge i la informació final que podem obtenir utilitzant cadascuna.

Paraules clau: microscòpia electrònica de transmissió, fixació química, criofixació, noves tecnologies, informació de la imatge.

Transmission electron microscopy in cell biology: assessment of techniques and image information Summary Transmission electron microscopy is a proven technique in the field of cell biology and a very useful tool in biomedical research. Of all the types of microscopy used to date, transmission electron microscopy is the one with the best resolution limit and therefore it is a very efficient technique for deciphering cell architecture and relating it to function. Innovation and improvements in equipment together with the introduction of new technology have allowed us to improve our knowledge of biological tissues, to visualize structures better, and to identify and locate molecules. In this paper, processes and concepts are defined, and the advantages and disadvantages of each technique are assessed, describing the image and information that can be obtained with each one.

Keywords: transmission electron microscopy, chemical fixation, cryofixation, new technologies, image information.

Introducció La preparació de la mostra biològica (teixits i cèŀlules en cultiu) per a microscòpia electrònica de transmissió comporta diferents etapes. Hi ha un ampli ventall de possibilitats de tècniques i processos i la utilització d’un procés o un altre dependrà de la mostra (del tipus de teixits, cèŀlules, biofilms...), de la mida de l’espècimen en estudi, de com puguem obtenir la mostra (laboratori, quiròfan, vaixell...), de l’equipament que tinguem i finalment, i molt important, quin tipus d’informació volem obtenir de la mostra que estem estudiant (ultraestructural, localització molecular, immunolocalització, electrotomografia...). Per tant, basant-nos en la informació que es vol obtenir de la mostra, hem de definir quina és la millor via o vies que podem utilitzar. La primera etapa per a la preparació d’una mostra biològica és la fixació. La fixació és una de les etapes més importants i més crítiques de tot el procés que es portarà a terme amb la mostra. L’objectiu de la fixació és aturar l’activitat ceŀlular sense alterar-ne les característiques ceŀlulars ni els components que la conformen ni la distribució i preservar l’organització tridimensional interna, la mida i la forma de la mostra. El procés de fixació es pot portar a terme per vies diferents: fi­ xació química, criofixació i combinació de les dues anteriors. La fixa-

ció química consisteix en l’ús d’un conjunt de components químics (glutaraldehid, paraformaldehid, acroleïna, tetraòxid d’osmi, acetat d’uranil...), que utilitzats individualment o en una barreja de dos o més, a diferents proporcions i dissolts en una solució tampó que actua com a vehicle, faran de fixador, i es combinaran amb els components de la cèŀlula, i n’aturaran l’activitat. La fixació química pot comportar artefactes estructurals i també causar la redistribució d’ions i petites proteïnes solubles (Hayat, 2000). La millor manera, però, per immobilitzar i preservar l’arquitectura ceŀlular és probablement la criofixació. La criofixació consisteix en la congelació de la mostra a velocitats molt elevades. Hi ha diferents sistemes i equips per fer aquest procés: per immersió en un agent liquat, per impacte sobre un bloc metàŀlic prèviament refredat, per alta pressió... Un ús o un altre dependran del tipus de mostra i també de les possibilitats d’equipament del laboratori. L’únic sistema, però, que permet una profunditat de criofixació òptima del voltant de 200 µm és el sistema anomenat per alta pressió (HPF). Aquest consisteix a aturar l’activitat ceŀlular congelant la mostra a velocitats de més de 10.000 °C/s i a 2.100 bars de pressió. A aquesta velocitat de congelació i a aquesta pressió, les molècules d’aigua no tenen la mateixa mobilitat i no es formen cristalls (fenomen de nucleació), i aconseguim el que s’anomena aigua en estat vitri. En molts casos, depenent del ti-

Treballs de la Societat Catalana de Biologia, 66: 25-30

25


Núria Cortadellas i Mercè Durfort

qualitat de la fixació, atès que fa preservar principalment la part lipídica de la mostra. Seguidament la mostra s’ha de deshidratar amb un solvent orgànic (alcohol, acetona, òxid de propilè...) per tal d’eliminar el contingut aquós de la mostra i poder-la incloure en una resina (generalment no miscibles en aigua) de tipus epoxy (Epon 812, Spurr, Araldita...). Posteriorment cal fer el seccionament de la mostra, el que s’anomena ultramicrotomia, i finalment es porta a terme el contrast amb metalls pesants i l’observació al microscopi de transmissió (vegeu la figura 1 —Mascorro et al., 2007; Bozzola, 2014).

Esquema 1. Fixació química. Principals vies de processament d’una mostra biològica partint d’una fixació química. Els números 2, 3, 4 i 5 corresponen a les diferents tècniques (Ta: temperatura ambient).

pus de mostra, es necessita l’ús de crioprotectors abans del procés de criofixació. La criofixació és el sistema més modern de fixació per preservar la ultraestructura, però hem de tenir present la inestabilitat i la sensibilitat d’anòxia dels teixits previs a la criofixació, i això fa que en alguns casos, i en determinats tipus de mostra, la combinació d’una fixació química amb criofixació per HPF pugui ser un procés de compromís molt valuós (Möbius, 2009; Cortadellas et al., 2012).

Metodologia Després de l’etapa de la fixació, la mostra seguirà diferents vies de processament fins a poder ser observada al microscopi electrònic. Les principals vies després d’utilitzar una fixació química estan indicades en l’esquema 1.

Tècnica 1. Fixació química, mètode convencional (esquema 1) Si la mostra ha estat fixada químicament seguirà un procés de postfixació, generalment amb tetraòxid d’osmi, i aquesta etapa millora la

Figura 1. Fixació química, deshidratació, inclusió. a) Capiŀlar de ronyó i barrera de filtració. Barra: 2 µm. (Cortesia de Fausto Pardo i Ramon Gomis, Institut d’Investigacions Biomèdiques August Pi i Sunyer, IDIBAPS). b) Melsa infectada de malària, Plasmodium yoelii (→). Barra: 5 µm. (Cortesia d’Hernando del Portillo, Lorena Martin i Mireia Ferrer, Centre de Recerca en Salut Internacional de Barcelona, CRESIB). c) Detall del bacteri Clostridium bifermentans. Barra: 200 nm. (Cortesia de Ricard Guerrero i Laura Villanueva, Universitat de Barcelona en coŀlaboració amb la Unitat de Microscòpia Electrònica, Campus Casanova, Universitat de Barcelona).

26

Valoració de la tècnica. Avantatges. La major part de mostres biològiques poden ser fixades i processades per aquest mètode. La fixació química no necessita cap tipus d’equipament especial i es pot fer en qualsevol entorn (laboratori, quiròfan...). El bloc amb la mostra es manté durant molts anys. Desavantatges. Pot comportar artefactes estructurals (Durfort, 1993). Es poden produir modificacions en el volum ceŀlular per canvis osmòtics. Pot causar la redistribució d’ions i petites proteïnes solubles. Imatge i informació. La imatge que obtenim és una imatge contrastada, amb membranes ben definides i fàcil de focalitzar al TEM. Podem treballar amb una bona àrea de l’espècimen i la fixació és homogènia. Aquesta via de processament ens permet fer estudis previs a l’òptic, estudis ultraestructurals, detecció i localització de residus de sucres amb l’ús de lectines i or coŀloïdal, tècniques citoquímiques, digestions enzimàtiques, electrotomografia i tècniques de localització molecular amb nanogold (nanopartícules d’or) o quantum-dots (mètode de preinclusió) (vegeu l’esquema 1). Permet fer tècniques correlatives de microscòpia òptica amb microscòpia electrònica.

Tècnica 2. Fixació química, mètode PLT de crioinclusió (esquema 1) A partir d’una fixació química podem també fer el que s’anomena procés PLT (progressive lowering temperature). Aquest tipus de procés és específic per a tècniques d’immunolocalització i d’hibridació in situ. S’utilitza generalment una fixació aldehídica suau. La deshidratació es fa baixant progressivament la temperatura des de 4 °C fins a –35 °C. Aquest mètode, treballant a temperatures per sota de 0 °C, redueix l’extracció dels components de la mostra i minimitza la desnaturalització de les proteïnes. Seguidament la mostra s’inclou a –35 °C en resines acríliques (Lowicryls, LRWhite, LRGold...). Aquestes resines acríliques es caracteritzen per una baixa viscositat, són miscibles en aigua, són majoritàriament hidrofíliques quan polimeritzen i tenen bona estabilitat al feix electrònic, i a més polimeritzen amb llum ultraviolada, cosa que fa que es preservi l’antigenicitat del teixit (vegeu la figura 2) (Hobot, 1989; Carleman et al., 1982).

Valoració de la tècnica. Avantatges. Mètode ràpid i fàcil per a la

Treballs de la Societat Catalana de Biologia, 66: 25-30


La microscòpia electrònica de transmissió en biologia ceŀlular: valoració de les tècniques i informació de les imatges

membranosos intraceŀlulars. El mètode permet obtenir resultats en dos dies.

Figura 2. Fixació química, PLT, crioinclusió. Immunolocalització. a) Doble localització de xaperones DnaK (►) (15 nm or) i GroEl (→) (5 nm or) en Escherichia coli amb cossos d’inclusió i utilitzant anticossos de la mateixa espècie (barra: 200 nm). b) Detall ampliat de la imatge a (barra: 50 nm). c) Detall esquemàtic de la tècnica. (Cortesia de Marta Carrió i Antoni Villaverde, Universitat Autònoma de Barcelona amb la coŀlaboració de la Unitat de Microscòpia Electrònica, Campus Casanova.)

Desavantatges. La crioprotecció en sacarosa pot comportar problemes de reducció del volum ceŀlular i algunes proteïnes solubles es poden perdre, ja que la fixació que normalment es fa és suau. El contrast és baix i dificulta l’observació en el microscopi. Hi ha dificultat en el crioseccionament de determinades mostres. La mostra s’ha de mantenir congelada en nitrogen líquid. Imatge i informació. La mostra té un contrast suau, però les membranes i els compartiments ceŀlulars s’observen molt bé. És una tècnica específica i molt útil per a tècniques de localització molecular.

Tècnica 4. Fixació química, criofixació, mètode híbrid, inclusió (esquema 1) localització de proteïnes o per a la localització d’una seqüència gènica mitjançant hibridació in situ. Es poden fer marcatges o colocalitzacions utilitzant or coŀloïdal de diferents mides. Aquest mètode permet la colocalització amb anticossos provinents de la mateixa espècie incubant per les dues cares del tall ultrafí. La utilització de resines acríliques permet un 5 % del contingut aquós de la mostra. El bloc amb la mostra es conserva durant anys.

Desavantatges. Si la quantitat de proteïna per localitzar o la seqüència gènica és baixa, serà difícil obtenir senyal per aquest mètode i serà millor utilitzar el mètode de Tokuyasu, que és més sensible. Cal un equip comercial per fer la tècnica o bé un sistema home-made. Imatge i informació. La imatge permet identificar bé les estructures. Les membranes són molt poc electrodenses i en general la mostra té un contrast suau, cosa que fa que el marcatge amb or destaqui fàcilment sobre l’estructura que estem marcant. És una tècnica bona per a tècniques d’immunolocalització i d’hibridació in situ. Per a tècniques correlatives, cal visualitzar la mostra per microscòpia òptica i la mateixa zona que hem valorat observar-la després per microscòpia electrònica.

Tècnica 3. Fixació química, tècnica de Tokuyasu (esquema 1) La tècnica de Tokuyasu esta basada en el crioseccionament de la mostra i dirigida a utilitzar posteriorment les tècniques d’immunolocalització. En aquest cas la fixació química que es portarà a terme serà a baixes concentracions d’aldehids per tal de preservar l’antigenicitat de la mostra. La mostra s’ha d’englobar en gelatina i posteriorment infiltrar amb sacarosa; posteriorment s’ha de muntar sobre un portamostres específic (pin) i s’ha de congelar immediatament en nitrogen líquid. Finalment s’ha de crioseccionar en un crioultramicròtom a temperatures entre –80 °C i –140 °C. Sobre les seccions ultrafines (80-100 nm) s’ha de fer la immunolocalització i finalment aquests talls s’han de contrastar i incloure en metilceŀlulosa (una fina capa que engloba el tall i que permet la inclusió i l’assecament sense que es produeixi retracció de la mostra) (Tokuyasu, 1973; Liou et al., 1996).

Valoració de la tècnica. Avantatges. Les proteïnes es mantenen en l’estat aquós (sense deshidratació de la mostra ni inclusió en re­sina). Alta eficiència en la immunolocalització, molt útil per a antígens presents en baixes quantitats. Molt bona definició dels sistemes

Hi ha proves que assenyalen que la fixació química per si mateixa produeix menys alteracions o artefactes significatius que els que produeixen les etapes posteriors a la fixació, com són la postfixació i el procés de deshidratació. El mètode híbrid consisteix a fixar la mostra químicament i posteriorment crioprotegir-la (generalment en sacarosa) i criofixar-la (per exemple, per HPF) o congelar-la en nitrogen líquid (si la mostra és de mida gran, més d’1 mm 2). A continuació la mostra segueix el procés de criosubstitució, que consisteix en l’eliminació de l’aigua de la mostra a temperatures al voltant de –90 °C mitjançant l’ús de solvents orgànics, i en aquest cas utilitzarem com a solvent orgànic el metanol, ja que aquest és miscible amb la sacarosa. Aquest medi de criosubstitució contindrà, a més del solvent orgànic, diferents tipus de fixadors químics que es determinen en funció de la mostra i tipus d’estudi que vulguem fer, i que ens permetran una millor preservació ultrastructural i contrast (vegeu la figura 3) (Möbius, 2009; Sosinsky et al., 2008).

Valoració de la tècnica. Avantatges. Es pot evitar l’anòxia en alguns teixits si es fixen primer químicament (per exemple: sistema nerviós, amb temps de dissecció llarg abans de criofixar la mostra). Substituïm el procés de deshidratació pel de la criosubstitució, ja que aquest és menys agressiu, ja que es fa a molt baixes temperatures (–90 °C). Possibilitat de treballar amb una mostra gran i tenir una fixació homogènia. Desavantatges. Partim d’una fixació química que pot comportar canvis estructurals de la mostra. Necessitem un equipament comercial o un sistema home-made. Imatge i informació. Mostra una bona preservació de la ultraestructura amb una imatge semblant a la d’una criofixació. Serveix per fer estudis ultraestructurals, detecció de residus de sucre (tècniques amb lectines i or coŀloïdal), tècniques citoquímiques, digestions enzimàtiques, tècniques correlatives (òptiques i electròniques i electrotomografia per TEM).

Tècnica 5. Fixació química, mètode híbrid, crioinclusió (esquema 1) Aquest procés s’utilitza per fer tècniques d’immunolocalització. La fixació química ha de ser suau per tal de mantenir l’antigenicitat de la mostra, i tot seguit hem de crioprotegir la mostra en sacarosa; posteriorment hem de fer la criosubstitució (FS) a –90 °C. Al medi de crio-

Treballs de la Societat Catalana de Biologia, 66: 25-30

27


Núria Cortadellas i Mercè Durfort

substitució podrem afegir també diferents tipus de fixadors químics. Un cop feta la criosubstitució es comença a pujar la temperatura per fer la inclusió de la mostra en resines acríliques. La pujada de temperatura dependrà del tipus de resina en què vulguem incloure finalment la mostra; així, arribarem a –35 °C per a Lowicryl K4M o a –50 °C per a Lowicryl K11M. Finalment cal polimeritzar amb llum ultraviolada. (Möbius, 2009; Sosinsky et al., 2008).

Valoració de la tècnica. Avantatges. El procés de criosubstitució permet preservar millor les estructures ceŀlulars. El mètode permet incloure en diferents tipus de resines acríliques i a diferents temperatures. Desavantatges. Requereix un equipament comercial o un sistema home-made. Hi ha dificultat en el seccionament depenent del tipus de resina acrílica utilitzada. Imatge i informació. El contrast és suau, el marcatge amb or destaca fàcilment sobre l’estructura que estem marcant. És una tècnica bona per a tècniques d’immunolocalització i d’hibridació in situ. Es pot fer tant per a microscòpia òptica (semifins, marcatge amb or coŀloïdal i intensificació en plata) o per a microscòpia electrònica (ultrafins, marcatge amb or coŀloïdal).

Tècnica 6. Criofixació, FS, inclusió (esquema 2) La mostra provinent d’una criofixació, per alta pressió (high pressure freezing, HPF), pot seguir diferents vies de processament, i una seria fer el procés de criosubstitució (FS) amb l’ús de diferents solvents orgànics (acetona, alcohol, metanol...) per tal de substituir el contingut aquós de la mostra per un solvent orgànic que ens permeti incloure posteriorment la mostra. En el medi de criosubstitució podrem afegir-hi diferents tipus de fixadors químics (glutaraldehid, tetraòxid d’osmi, acetat d’uranil...) i a diferents proporcions (en funció de la mostra i el tipus d’estudi) per tal de preservar millor les estructures i intensificar-ne el contrast. Durant el procés d’escalfament els fixadors químics comencen a actuar: l’acetat d’uranil actua en el moment en què les càrregues negatives dels àcids nucleics i grups fosfat són accessibles, el tetraòxid d’osmi a –70 °C i el glutaraldehid entre –40 °C i –30 °C. Tenint en compte que el procés de criosubstitució es fa generalment entorn de –90 °C, després s’anirà incrementant gradualment la temperatura de la mostra fins arribar a temperatura ambient i posteriorment cal fer la inclusió Figura 3. Fixació química, criofixació, mètode híbrid. a) Visió general del fetge. Hepatòcits (H), canalicles biliars (→), cèŀlules de Kupffer (KC) en un sinusoide. Barra: 1 µm. b) Detall del citoplasma. Mitocondri (M), reticle endoplasmàtic (ER) i ribosomes (→). Barra: 0,2 µm. (Unitat de Microscòpia Electrònica, Campus Casanova.)

en resina epoxy, i després el seccionament de la mostra i l’observació (vegeu la figura 4) (Giddings, 2003; Hurbain et al., 2011; Mielanczyk et al., 2014)

Valoració de la tècnica. Avantatges. És la millor manera de preservar l’arquitectura ceŀlular. El temps de processament de mostres crio­immobilitzades no és superior a la de mètodes químics. La qualitat de la fixació depèn de la mida de l’espècimen i de la composició, com és el cas que la mostra contingui agents anticongelants de manera natural o que tingui poc contingut aquós. Desavantatges. Tot i que hi ha protocols de rutina, sovint cal modificar les condicions de treball experimentalment, per a cada mostra, per tal d’evitar la formació de cristalls (canvi del crioprotector, del portamostres mateix...). La mida de la mostra ha de ser entorn de 2 mm de diàmetre i 200 µm de gruix. Imatge i informació. Molt bona preservació ultrastructural, les imatges donen sensació de turgència, es mantenen els microtúbuls, li manca, però, la definició de membrana a la qual estem acostumats amb la fixació química. Aquesta via de processament ens permet fer estudis abans de l’òptic, estudis ultraestructurals, detecció i localització de residus de sucres amb l’ús de lectines i or coŀloïdal, tècniques citoquímiques, digestions enzimàtiques, electrotomografia, anàlisi elemental per EFTEM (energy filtered electron microscopy) o per SIMS (secondary ion mass spectrometry).

Tecnica 7. Criofixació, FS, crioinclusió (esquema 2) A partir d’una criofixació també podem fer tècniques d’immunolocalització i hibridació in situ. El procés seria com l’anterior, tot i que generalment s’utilitza acetona com a solvent orgànic i sempre cal tenir cura dels tipus de fixadors químics que utilitzem i les proporcions (opcionalment podem no utilitzar cap fixador químic), ja que cal mantenir l’antigenicitat de la mostra. Després de la criosubstitució, i igual com amb el mètode 5, podrem incloure en diferents tipus de resines acríliques a diferents temperatures i polimeritzar finalment amb llum ultraviolada (McDonald, 2009; Hurbain et al., 2011; Mielanczyk et al., 2014).

Valoració de la tècnica. Avantatges. La criosubstitució, juntament amb la criofixació, aconsegueix una molt bona preservació de les estructures ceŀlulars i a la vegada manté l’antigenicitat de la mostra. El mètode ens permet incloure en diferents tipus de resines acríliques i a diferents temperatures i el bloc es manté durant anys. Desavantatges. Els mateixos que en el procés anterior de criofixació-FS-crioinclusió. La visualització de la mostra durant el procés, la realització dels blocs i l’orientació de la mostra, té certa dificultat. Imatge i informació. Bona preservació per a la localització molecular (immunolocalització, hibridació in situ...). Aquesta via de processament ens permet fer estudis previs amb el microscopi òptic de la immunolocalització amb or coŀloïdal i intensificació amb plata, i també d’immunolocalització amb or coŀloïdal en sobreseccions ultrafines.

Tècnica 8. Criofixació, FS, rehidratació, tècnica de Tokuyasu La mostra criofixada per HPF i criosubstituïda es pot tornar a hidratar,

28

Treballs de la Societat Catalana de Biologia, 66: 25-30


La microscòpia electrònica de transmissió en biologia ceŀlular: valoració de les tècniques i informació de les imatges

temperatura i sota buit, i la mostra un cop assecada pot ser inclosa en qualsevol tipus de resina i seccionada (Edelmann, 2002). Tècnica Cemovis. Consisteix a congelar la mostra per alta pressió, crioseccionar-la i crioobservar-la directament al microscopi electrònic; aquesta tècnica ens permet veure el teixit en el seu estat hidratat, sense haver tret l’aigua de la mostra i, per tant, en el seu estat més natural (Dubochet et al., 1987; Al-Amoudi et al., 2004).

Esquema 2. Fixació per criofixació. Principals vies de processament d’una mostra biològica partint d’una criofixació. Els números 6, 7, 8, 9, 10 i 11 corresponen a les diferents tècniques. (Ta: temperatura ambient).

i seguir a continuació la tècnica de Tokuyasu per crioseccionar-la. Després de la criosubstitució es fa una rehidratació de la mostra, procés que es porta a terme entre 0 i 4 °C, i durant aquest procés les mostres són fixades amb glutaraldehid, ja que la fixació química durant la criosubstitució és insuficient. Posteriorment les mostres segueixen la tècnica de Tokuyasu, són crioprotegides amb sacarosa, muntades en un pin, congelades en nitrogen líquid i crioseccionades entre –120 °C i –140 °C. Tot seguit es fa la immunolocalització i la inclusió en metilceŀlulosa per a microscòpia electrònica o en Moviol per a microscòpia òptica (Ripper et al., 2008).

Valoració de la tècnica. Avantatges. És una tècnica que combina la preservació ultraestructural de la criofixació amb un sistema d’immunolocalització molt eficient. És interessant per a mostres de fixació química difícil, com llevats, bacteris, plantes, insectes... Desavantatges. La mida petita de la mostra, ja que partim d’una crio­fi xació. Possibles artefactes durant la rehidratació. Requereix un equipament de criofixació. Imatge i informació. Contrast suau, però les membranes i els compartiments ceŀlulars s’observen molt bé. És una tècnica específica i útil per a tècniques de localització molecular de mostres que puguin tenir dificultats per ser fixades químicament. A partir de la mostra criofixada, però, podem dur a terme altres tècniques, com: Criofractura (freeze-fracturing). Consisteix a congelar la mostra i fracturar-la de manera que obtinguem dues cares de fractura, i de les cares es fa una rèplica amb carboni-platí a diferents angles i s’observa al microscopi. Crioassecament (freeze-drying). Aquesta tècnica consisteix a criofixar la mostra i extreure l’aigua de la mostra per sublimació a baixa

Aplicacions. Totes aquestes tècniques es poden aplicar a diferents tipus de teixits animals (per exemple: fetge, melsa, cervell...), cèŀlules en cultiu (en monocapa, sobre substrats, en medi líquid...) i en teixits vegetals (per exemple: fulles, llavors, poŀlen...). Com a exemples podem esmentar els estudis ultrastructurals de la incorporació de nanopartícules en teixits vius, les immunolocalitzacions (com la proteïna del factor de creixement fibroblàstic 8B (FGF-8b) (fibroblast growth factor) en els estudis de la malària, en les biòpsies clíniques (renals, epiteli nasal...), per a l’estudi de les anomalies espermàtiques, així com en els estudis de fongs patògens en plantes, entre altres.

Conclusions La microscòpia electrònica de transmissió és essencial per entendre el funcionament de cèŀlules i teixits, ens permet visualitzar les estructures a un alt nivell resolutiu i relacionar la funció del seus components, i a més ens permet detectar i localitzar molècules in situ. És, però, molt important determinar, conèixer i evitar artefactes que poden donar lloc a interpretacions errònies de la ultraestructura ceŀlular. És molt important, doncs, considerar les diferents microscòpies i tècniques, poder treballar-hi, valorar els resultats i comparar-los, per tal d’arribar a una bona conclusió final.

Figura 4. Tècnica 6. Criofixació, FS, inclusió. a) Estructura embrionària (miracidi) de Mediogonimus jourdanei (tremàtode), centríol (→), cilis (►), nucli (N) i citoplasma (C) (barra: 0.5µm) (cortesia de Jordi Miquel, Universitat de Barcelona). b) Tricocist (→) de dinoflageŀlat (cortesia d’Esther Garces, Institut de Ciències del Mar, CSIC). c) Cèŀlules Caco-2 c directament criofixades sense crioprotecció, coated-pit (punta de fletxa) i autofagosomes (→) (cortesia de Carles Enrich, Universitat de Barcelona, en coŀlaboració amb la Unitat de Microscòpia Electrònica, Campus Casanova, Universitat de Barcelona).

Treballs de la Societat Catalana de Biologia, 66: 25-30

29


Núria Cortadellas i Mercè Durfort

Bibliografia Al-Amoudi, A. [et al.] (2004). «Cryo-electron microscopy of vitreous sections of native biological cells and tissues». J. Struct. Biol., 148: 131. Bozzola, J. J. (2014). «Conventional specimen preparation. Techniques for trasnmission electron microscopy. Methods in Molecular Biology, 1117: 1-19. Carlemalm, E. (1982). «Resin development for electron microscopy and an analysis of embedding at low temperature». J. Microsc., 126: 123. Cortadellas, N. [et al.] (2012). Transmission electron microscopy in cell biology: sample preparation techniques and image information. Handbook of instrumental techniques for materials, chemical and biosciences research. Part III. Biosciences tecnologies. Barcelona: Centres Científics i Tecnològics, Universitat de Barcelona. Dubochet, J. [et al.] (1987). «Cryo-electron microscopy of vitrified specimens». A: R. A. Steinbrecht; K. Zierold (ed.). Cryotechniques in biological electron microscopy. Berlín: Springer, p. 114. Durfort, M. (1993). «Reflexions sobre l’observació i la interpretació de les imatges microscòpiques en biologia ceŀlular (els artefactes metodològics)». Memorias de la Real Academica de Ciencias y Artes de Barcelona (RACAB). Discurs d’ingrés, 915. Edelmann, L. (2002). «Freeze-dried and resin-embedded biological material is well suited for ultrastructure research». J. Microsc., 207: 5. Giddings, T. H. (2003). «Freeze-substitution protocols for improved visualization of membranes in high-pressure frozen samples». J. Microscopy, 212: 53-61. Hayat, M. A. (2000). Principles and techniques of electron microscopy, biological applications. 4a ed. Cambridge: Cambridge University Press. Hobot, J. A. (1989). «Lowicryls and low temperature embedding for colloidal gold methods». A: M. A. Hayat (ed.). Colloidal gold: principles, methods and Applications. San Diego: Academic Press, 75.

30

Hurbain, I. [et al.] (2011). «The future is cold: cryo-preparation methods for transmission electron microscopy of cells». Biol. Cell, 103: 405-420. Liou, W. [et al.] (1996). «Improving structural integrity of cryosections for immunogold labelling». Histochem. Cell Biol., 106: 41. Mascorro, J. A. [et al.] (2007). «Processing biological tissues for ultrastructural study». A: J. Kuo (ed.). Electron microscopy. Methods and protocols. Methods in molecular biology. Human Press. McDonald, K. L. (2009). «A review of high-pressure freezing preparation techniques for correlative light and electron miccroscopy of the same cells and tissues». J. Microscopy, 235: 273-281. Mielanczyk, L. [et al.] (2014). «Closer to the native state. Critical evaluation of cryotechniques for transmission electron microscopy: preparation of biological samples». Folia Histochemica et Cytobiologica, 52 (1): 1-17. Möbius, W. (2009). «Cryopreparation of biological specimens for immunoelectron microscopy». Annals of anatomy, 191: 231-247. Ripper, D. [et al.] (2008). «Cryo-section immunolabelling of difficult to preserve specimens: advantges of cryofixation, freeze-substitution and rehydration». Biol. Cell, 100: 109. Sosinsky, G. E. [et al.] (2008). «The combination of chemical fixation procedures with high pressure freezing and freeze substitution preserves highly labile tissue ultrastructure for electron tomography applications». J. Structural Biology, 161: 359-371. Tokuyasu, K. T. (1973). «A technique for ultracryotomy of cell suspensions and tissues». J. Cell Biol., 57: 551.

Treballs de la Societat Catalana de Biologia, 66: 25-30


La citometria com a eina per aprofundir en la complexitat dels organismes vius i les malalties Jordi Petriz Institut de Recerca contra la Leucèmia Josep Carreras

DOI: 10.2436/20.1501.02.156

Correspondència: Jordi Petriz. Institut de Recerca Contra la Leucèmia Josep Carreras. Carretera de Can Ruti, Camí de les Escoles s/n. Edifici IMPPC. 08916 Badalona. Adreça electrònica: jpetriz@carrerasresearch.org.

ISSN (ed. impresa): 0212-3037 ISSN (ed. digital): 2013-9802 http://revistes.iec.cat/index.php/TSCB Rebut: 25/02/2015 Acceptat: 05/04/2015

Resum Com el seu nom indica, la citometria de flux (FCM) és una tècnica que porta a terme mesures (metria) sobre les cèŀlules (cito) en un sistema de flux. El sistema fluídic facilita el flux de cèŀlules en un raig per ser analitzades d’una en una en diverses aplicacions multicolor relacionades amb la biologia o amb els estudis funcionals, així com un ampli ventall d’aplicacions en la recerca. Aquesta tecnologia combina elegantment la capacitat única per aïllar ràpidament poblacions pures de cèŀlules o partícules amb un conjunt específic de característiques biològiques. En combinació amb els assaigs més moderns de biologia molecular, es poden dur a terme experiments amb molt poques cèŀlules o fins i tot amb una cèŀlula individual per tal d’investigar la complexitat dels organismes pel que fa a la seva unitat de funció bàsica, la cèŀlula.

Paraules clau: citometria de flux, separació ceŀlular, làser, fluorescèn-

cia, FACS.

Cytometry as a tool to deepen the complexity of living organisms and diseases Summary As its name indicates, flow cytometry (FCM) is a technique that performs measurements (metry) on cells (cyto) in a flow system. A fluidic system facilitates the flow of cells one-by-one for single-cell analysis to be used in several multicolor applications for biology and for functional studies as well as a broad range of research applications. This technology elegantly combines the unique ability to rapidly isolate pure populations of cells or particles with a specific set of biological characteristics. In combination with modern molecular biology assays, experiments using very few cells or even single cells can be conducted to systematically uncover an organism’s biocomplexity at its basic functional unit level, the cell.

Keywords: flow cytometry, cell sorting, laser, fluorescence, FACS.

Citometria de flux i FACS Avui dia molts laboratoris arreu del món fan servir la citometria de flux, i aquest article pretén fer un breu recorregut per aquesta tecnologia. Grans lectures molt recomanables són Flow cytometry: first principles d’Alice Givan i Practical flow cytometry de Howard M. Shapiro, i Flow cytometry and sorting de Myron R. Melamed, Tore Lindmo i Mortimer L. Mendelsohn, per a qui vulgui informació més detallada. També, cal recordar l’exceŀlent compendi Current protocols in cytometry (John Wiley & Sons). Acadèmicament, la citometria de flux és una tecnologia destinada a la quantificació de components o característiques estructurals de les cèŀlules, fonamentalment mitjançant mètodes òptics. Tot i que les mesures són fetes sobre cèŀlules individuals, permet processar milers de cèŀlules en pocs segons. La citometria de flux ha evolucionat ràpidament com a conseqüència del desenvolupament dels anticossos, en permetre conjugar fluorocroms i identificar diferents proteïnes estructurals en una suspensió ceŀlular. La disponibilitat de làsers de diferents longituds d’ona com a font d’excitació, en associació amb sistemes fotodetectors i fotomultiplicadors, permet identificar múltiples paràmetres a escala de cèŀlula individual, com per exemple en mostres de sang perifèrica, meduŀla òssia o biòpsies tumorals, amb aplicacions habituals en el cas del diagnòstic i seguiment de malalties hemàtiques i immunitàries. La majoria d’institucions relacionades amb la investigació biològica disposen de citofluoròmetres. També són abundants en centres mèdics, i s’utilitzen tant per al diagnòstic com per a la investigació. El principal ús diagnòstic s’ha centrat en l’estudi del cicle ceŀlular i de la ploïdia en càncer, en l’estudi de lim-

fomes i leucèmies analitzant l’expressió de marcadors de superfície importants per al diagnòstic, així com el seu valor pronòstic associat. Encara que actualment hi ha alternatives menys costoses a la citometria de flux, continua essent el mètode emprat en el recompte dels nivells de cèŀlules CD4 i CD8 en la sang de pacients amb la síndrome d’immunodeficiència adquirida. Addicionalment, l’ús de la citometria de flux també és clau, actualment, en altres camps allunyats de la pràctica clínica, com són la citometria subceŀlular per permetre l’estudi d’estructures i esdeveniments relacionats amb la reparació del DNA o el monitoratge del plàncton mitjançant citometria acústica. L’acrònim FACS (fluorescence activated cell sorting) és una marca registrada per un dels principals fabricants de citòmetres i sovint es fa servir com a sinònim de citometria de flux. També es reconeix incorrectament que Len Herzenberg va desenvolupar el primer separador ceŀlular activat per fluorescència. De fet, va ser desenvolupat per Mack Fulwyler, Marv Van Dilla, John Steinkamp i James Coulter. Fulwyler i els seus coŀlaboradors van adaptar el principi de deflecció de les impressores de raig de tinta desenvolupat per Richard Sweet per separar cèŀlules (Sweet, 1965). Més o menys al mateix temps, Lew Kamentsky va desenvolupar un separador ceŀlular basat en un sistema d’interrupció fluídica. Tant els separadors de Fulwyler i de Kamentsky van ser desenvolupats per aïllar cèŀlules i validar la finalitat analítica de tots dos instruments. Len Herzenberg va tenir la visió d’entendre com seria d’important la separació ceŀlular per desentranyar la complexitat del sistema immunitari (Hulett et al., 1973). Les seves contribucions científiques després d’haver treballat amb el separador de Kamentsky van concloure amb la comercialització d’un

Treballs de la Societat Catalana de Biologia, 66: 31-36

31


Jordi Petriz

instrument equipat amb un làser d’alta potència. Així, podria aprofitar els anticossos monoclonals conjugats a fluorocroms i aïllar diferents poblacions ceŀlulars del sistema immunitari. Aquest concepte, però, va ser proposat per primera vegada per Mac Fulwyler i coŀlaboradors, i també per Richard Sweet.

Fonaments de la citometria de flux En el moment de fer les mesures en el citòmetre de flux, les cèŀlules poden estar vives o fixades, obligadament en suspensió ceŀlular i preferiblement en forma de cèŀlula individual. Un flux amb enfocament hidrodinàmic o també acústic les obliga a passar alineades davant d’un feix làser de manera continuada, a manera d’un raig prim de la suspensió ceŀlular. Cada cèŀlula, alhora que dispersa la llum, emet llum fluorescent com a conseqüència de l’excitació làser a la qual és sotmesa. Els paràmetres que típicament es mesuren de manera simultània per a cada cèŀlula són: a) Dispersió frontal de la llum (forward scatter), proporcional a la grandària ceŀlular. b) Dispersió ortogonal de la llum (side scatter), proporcional a la quantitat d’estructures granulars o complexitat de la cèŀlula. c) Intensitats de fluorescència a diferents longituds d’ona. La dispersió de la llum per si sola resulta de força utilitat. Normalment s’utilitza en l’exclusió de les cèŀlules mortes, agregats i restes ceŀlulars, així com per reduir el soroll de fons en la mesura de la fluorescència. És suficient per discriminar limfòcits de monòcits i granulòcits en mostres leucocitàries hemolisades. La dispersió de la llum també es pot utilitzar en la quantificació de l’agregació de les cèŀlules vives. Convencionalment, les intensitats de fluorescència es mesuren a diferents longituds d’ona i de manera simultània per a cadascuna de les cèŀlules. Per tal de mesurar els components d’interès de cadascuna de Figura 1. Comptador fotoelectrònic de partícules coŀloïdals. També conegut com el comptador de Gucker, va ser desenvolupat amb el suport de l’exèrcit dels Estats Units com un citòmetre de flux per a la detecció de bacteris en els aerosols. Els resultats de la invenció van ser publicats durant la Segona Guerra Mundial i van romandre com a classificats, ja que la seva finalitat consistia a detectar bacteris i espores d’ús en la guerra biològica. L’aire filtrat es conduïa a una zona de confinament i generava un corrent cap a la part central de la càmera de flux, sotmesa a iŀluminació de camp fosc. L’aparell tenia una capacitat de detectar partícules de 0,6 µm de diàmetre amb una probabilitat del 60 %. Els exèrcits moderns continuen finançant projectes basats en la utilització de la citometria de flux per identificar soques de patògens amb mètodes d’identificació molt més sofisticats.

32

les cèŀlules, és possible utilitzar diferents sondes fluorescents. Els anticossos conjugats a fluorocroms són utilitzats molt sovint en la quantificació de la densitat antigènica de determinats marcadors i per distingir subpoblacions de tipus ceŀlulars diferenciats, fins i tot aquelles cèŀlules amb expressió de transgens. Mitjançant la conjugació a fluorocroms, es poden fer mesures de la unió de virus i hormones als seus receptors corresponents. També es poden analitzar components intraceŀlulars mitjançant sondes fluorescents específiques, com ara el contingut ceŀlular de DNA (permet estudis de cicle ceŀlular i ploïdia), el DNA sintetitzat de novo, seqüències nucleotídiques específiques, RNA missatger, filaments d’actina i, en definitiva, qualsevol estructura per a la qual existeixi un anticòs o una sonda fluorescent disponible. La citometria de flux es pot utilitzar a més en el monitoratge de canvis en el calci intraceŀlular, del potencial de membrana, el pH, o en el contingut d’àcids grassos. Els citòmetres de flux consisteixen en sistemes fluídics, òptica làser, detectors electrònics d’amplificació logarítmica del senyal, ara reemplaçats pel processament digital del senyal en els citòmetres més moderns, i ordinadors. Els sistemes òptics permeten l’enfocament làser en un feix amb un diàmetre reduït per impactar sobre el menor nombre de partícules possibles simultàniament. El sistema fluídic permet un enfocament hidrodinàmic o acústic del flux ceŀlular, fins a aconseguir l’alineament de les partícules o cèŀlules, i en els separadors ceŀlulars o cell sorters, es produeix un trencament del flux en gotes de mida uniforme per aconseguir la separació d’esdeveniments individuals (cèŀlules, cromosomes, fragments de DNA, etc.). En aquests separadors, el sistema electrònic s’encarrega de la quantificació dels centelleigs de fluorescència i de la llum dispersada i, sota el control de l’ordinador, s’aconsegueix la càrrega elèctrica de les gotes que contenen les cèŀlules d’interès per poder sotmetre-les a deflecció i recollir-les en tubs específics per a tal fi, o sobre els pouets de plaques de cultiu de teixits. L’ordinador permet emmagatzemar dades de milers de cèŀlules per a cada mostra i representar els resultats gràficament.

Una «no tan breu» història de la citometria Els orígens de la citometria es poden remuntar a l’any 1680, quan Antonie Philips van Leeuwenhoeck (Leeuwenhoeck, 1720) va ser el pioner a fer recomptes d’eritròcits de pollastre dins d’un capiŀlar graduat. En aquella època els únics colorants disponibles eren d’origen natural, com el safrà, i el va fer servir per tenyir cèŀlules musculars. Als voltants del 1880, Paul Ehrlich va fer servir per primera vegada sondes àcides i bàsiques que van servir per identificar leucòcits acidofílics, eosinofílics, basofílics i neutrofílics, i per estudiar les dinàmiques del fluids ceŀlulars va fer servir la fluoresceïna. La majoria d’aquestes sondes s’obtenien de la indústria tèxtil, i cal recordar que aquesta classificació dels leucòcits encara segueix vigent avui dia. Als voltants del 1900, Pappenheim i Unna van combinar el verd metil i la pironina per tal de tenyir els nuclis ceŀlulars de color verd i el citoplasma de color vermell. Ja l’any 1904, August Köhler, a Alemanya, va obtenir les primeres microfotografies de cèŀlules epidèrmiques mitjançant excitació ultraviolada i microscòpia òptica, i va obrir les portes a la utilització de sistemes alternatius per visualitzar estructures intraceŀlulars. No obstant això, Paul Ehrlich, uns cinquanta anys abans, ja havia utilitzat la fluoresceïna com a primer exemple d’utilització de molècules fluorescents aplicades a l’estudi de la dinàmica dels fluids oculars. El 1925, Robert Feulgen va demostrar que el DNA es trobava al nucli de les cèŀlules, tant en plantes com en animals, gràcies a la utilització d’una reacció que precisament porta el seu nom, i permet la tinció del DNA i visu-

Treballs de la Societat Catalana de Biologia, 66: 31-36


La citometria com a eina per aprofundir en la complexitat dels organismes vius i les malalties

alitzar-lo. Pocs anys després, Andrew Moldavan (Moldavan, 1934) va publicar a Science un treball en el qual descrivia la primera temptativa per adaptar els mètodes fotoelèctrics al recompte ceŀlular i de partícules microscòpiques en suspensions aquoses al llarg d’un tub capiŀlar de vidre. El 1941 Tobjorn Casperson va demostrar gràcies a la utilització d’agents capaços de revelar els àcids nucleics que aquests, més enllà de ser productes residuals, participaven activament en els processos de síntesi proteica. El mateix any, Albert H. Coons i els seus coŀlaboradors van ser els primers a conjugar un anticòs a una molècula fluorescent i els van fer servir per tal d’identificar antígens en talls de teixits, mentre que Papanicolau establia la classificació del càncer d’úter mitjançant els seus estudis pioners de citologia exfoliativa. Tres anys més tard, Oswald T. Avery va descobrir l’anomenat principi transformant, i va demostrar que el DNA era el responsable d’emmagatzemar la informació genètica. Ja el 1951, i utilitzant la tinció Feulgen, de nou Casperson va demostrar que tant el DNA com l’RNA s’incrementava en cèŀlules que creixien activament. Va ser cinc anys després quan Wallace H. Coulter va desenvolupar el comptador Coulter, el primer sistema d’alta velocitat per al recompte de cèŀlules sanguínies, a més de permetre diferenciarles per la seva grandària. I un any més tard, James C. Parker i William R. Horst van presentar la primera patent d’un aparell de recompte automàtic de cèŀlules sanguínies basat en dos colors. Mentrestant, el 1953, P. J. Crosland-Taylor va publicar a Nature el desenvolupament d’un sistema per al recompte de partícules suspeses en un fluid a través d’un capiŀlar (Crosland-Taylor, 1953), que va suposar el principi del desenvolupament del fluid acompanyant (sheath flow). Aquell mateix any, Watson i Crick descobrien la doble hèlix. Uns anys abans, Gucker (1947) havia desenvolupat un primer citòmetre per a la detecció de bacteris en aerosols, l’anomenat comptador fotoelectrònic per a partícules coŀloïdals. Aquests estudis es van fer durant la Segona Guerra Mundial i van romandre com a classificats, ja que el seu ús estava relacionat amb la identificació de bacteris i d’espores suspeses en l’aire emprades per la guerra biològica. Aquest instrument feia servir una làmpada dels fars d’un cotxe Ford, juntament amb un detector fotomultiplicador associat a una càmera de camp fosc (vegeu la figura 1). En el període comprès entre 1956 i 1975 es produeix un gran salt tecnològic, tant en la utilització de fluorocroms com en el desenvolupament dels primers sistemes basats en el flux de la mostra. Preston l’any 1951 i Marvin Lee Minsky (1953) presentaven el primer citoanalitzador i les bases del primer microscopi confocal, respectivament. A partir de 1964, Louis Kamentsky descriu a Science el desenvolupament d’un nou aparell, l’anomenat espectrofotòmetre, per a l’anàlisi ceŀlular ultraràpida (Kamentsky et al., 1965) i per a la separació ceŀlular. Aquest mateix any, Mack Fulwyler i Marvin van Dilla al laboratori de Los Álamos desenvolupen el primer separador ceŀlular basat en el mateix principi de Coulter per a la diferenciació de les cèŀlules (Fulwyler, 1965). Mentre es produïa aquest gran salt tecnològic, en paraŀlel es va produir un gran salt en l’anàlisi ceŀlular. L’any 1956, Von Bertalanffy i Bickis van fer servir el taronja d’acridina per identificar l’RNA, mentre que aquell mateix any Wallace Coulter comercialitzava el comptador Coulter. Només un any més tard, Marcos Boris Rotman, amb una trajectòria científica multidisciplinària absolutament atípica, va demostrar per primera vegada la possibilitat de mesurar molècules úniques de β-galactosidasa mitjançant sistemes microfluídics i substrats fluorogènics. Cal destacar un nom, el de Marylou Ingram, que ràpidament es va adonar de la precisió del recompte hemàtic desenvolupat per Coulter, i va ser una de les pioneres dels estudis més primerencs en la recerca de

Figura 2. Separador de partícules de Fulwyler. Reproducció d’una part de la patent original del 1968 que ensenya un diagrama esquemàtic de la invenció (Fig. 1), la disposició del sistema de l’embocadura i del sistema de deflecció (Fig. 2), així com una secció de l’embocadura adaptada per produir el raig i transmetre de manera eficient l’energia vibratòria que permeti una formació de gotes uniforme.

les cèŀlules sanguínies. L’any 1963 va descriure la presència de limfòcits binucleats després de la irradiació, una fita fonamental per entendre els efectes biològics de la radiació ionitzant. Precisament, Preston (1964) va dissenyar un citoanalitzador per estudiar les cèŀlules que detectava Ingram amb una freqüència 1/10.000, i va digitalitzar imatges de limfòcits prèviament tenyits amb combinacions d’eosina i blau de metilè. Mortimer Mendelsohn, Brian Mayall i Judith Prewett aquell mateix any també van fer contribucions molt importants per a les imatges digitalitzades, i específicament centrades en l’automatització de l’anàlisi dels cromosomes. En els tres anys següents, Hallerman i coŀlaboradors, Kosenow (1964), Marcos Boris Rotman (1966) i Marvin Van Dilla i Harry Krisman (1967) van fer possible la discriminació de leucòcits dels eritròcits amb tinció de taronja d’acridina, l’estudi de les propietats de les membranes de cèŀlules viables de mamífer mitjançant la hidròlisi enzimàtica dels èsters fluorogènics, i de la tinció fluorescent del DNA amb el microfluoròmetre de flux de Los Álamos, respectivament. També en aquells dies, la invenció de la impressora electrostàtica de raig de tinta feta per Dick Sweet va possibilitar que en aquell mateix any

Treballs de la Societat Catalana de Biologia, 66: 31-36

33


Jordi Petriz

Mack Fulwyler (1965) inventés el separador ceŀlular electrostàtic, una de les invencions més significatives en el camp de l’anàlisi ceŀlular (vegeu les figures 2 i 3). Fulwyler va ser molt brillant, especialment per la capacitat de connectar dues idees inicialment desconnectades i llunyanes: el recompte de cèŀlules vermelles inventat per Coulter i l’osciŀlògraf de raig de tinta de Sweet, per separar finalment cèŀlules. Lord Rayleigh l’any 1879 havia demostrat que els fluids que emergien d’orificis de diferents maneres eren inestables i que tendien a formar gotetes, i que sense aplicar una força externa al flux, el patró de les gotetes era impossible de predir (Strutt, 1879). I aquesta troballa és la que va inspirar Sweet per tal d’inventar la seva impressora (Sweet, 1965). El primer equip de citometria de flux basat en l’ús de fluorescència (ICP-11) va ser desenvolupat el 1968 per Wolfang Göhde de la Universitat de Münster (Alemanya) i comercialitzat entre 1968 i 1969 pel fabricant alemany Partec mitjançant Phywe AG (Göttingen). Fins llavors, els mètodes basats en l’absorció de la llum eren molt més habituals entre els científics que els basats en sondes fluorescents. La denominació original per a la tecnologia desenvolupada en aquests moments va ser la de citofotometria de pols (de l’alemany Impulszytophotometrie). Deu anys després i amb motiu de la reunió de la Fundació d’Enginyeria Americana a Pensacola (Florida), es va adoptar la denominació actual de citometria de flux, i ràpidament va ser acceptada. A partir de llavors es van desenvolupar nous instruments de citometria, incloent-hi el cytograph (1970) de Kamentsky, el citofluorògraf de Bio/Physics Systems Inc. (1970) (després Ortho Diagnostics), el PAS 8000 de Partec (1973), el primer FACS de Becton Dickinson (1973), el separador TPS-1 de Coulter Electronics (1975), l’IPC-22 de Partec/Phywe (1975) i l’EPICS de Coulter (1977). L’avanç més significatiu, en l’àmbit biomèdic, es va deure sens

Figura 3. Una mirada de ben a prop a l’evolució dels separadors ceŀlulars. Al llarg de molts anys, tant els citòmetres de flux com els separadors ceŀlulars electrostàtics han mantingut un disseny molt semblant al descrit en la patent original del separador de partícules de Fulwyler. En aquestes dues imatges es pot comprovar la similitud de l’espai del separador on la suspensió ceŀlular, a manera d’un raig prim, és exposada a iŀluminació làser de manera continuada, abans de la separació física de les cèŀlules d’interès.

34

dubte a la producció d’hibridomes de Köhler i Milstein i a l’obtenció d’anticossos monoclonals altament específics per als seus antígens diana i apropiats per ser conjugats amb fluoresceïna, ficobiliproteïnes i altres fluorocroms. Un altre pas important va ser el descobriment de la proteïna fluorescent verda (GFP), obtinguda a partir de la medusa Ae­quorea victoria. Un cop clonat el gen que la codifica, s’utilitza actualment en nombrosos estudis com a gen marcador, en ser detectable fàcilment mitjançant tècniques de fluorescència. I mentre anava creixent el catàleg dels CD, noves proteïnes i sondes fluorescents, nous fluorocroms i els seus tàndems, la tecnologia seguia evolucionant. Robinson i coŀlaboradors l’any 1991 van presentar els principis d’automatització amb la incorporació dels lectors de codis de barres als citòmetres comercials. Entre els anys 1991 i 1995, van den Engh va desenvolupar la separació ceŀlular d’alta velocitat, que ara incorporen la majoria de separadors ceŀlulars, i Roederer en el període comprès entre el 1997 i el 2004 (Baumgartha et al., 2000) presentava els seus resultats amb estudis de fenotip policromàtics fins amb disset colors (Perfetto et al., 2004). Actualment, molts citòmetres comercials permeten detectar fins a catorze colors simultàniament, i estan equipats amb tres o quatre làsers.

La citòmica en el segle xxi Actualment es poden trobar dades publicades obtingudes mitjançant citometria de flux en qualsevol tipus de revista científica, ja sigui en el camp de la biologia ceŀlular, medicina, microbiologia, protistologia, ecologia, limnologia, oceanografia, entre moltes altres disciplines. Prova d’això és la gran quantitat d’articles publicats en revistes científiques que presenten resultats obtinguts amb aquesta tecnologia (més de 159.000 en la base de dades PubMed en el moment d’escriure aquest article). La necessitat d’analitzar diversos paràmetres simultàniament ens ha portat a la citometria policromàtica. El gran potencial d’aquesta tecnologia es veu limitat pel solapament dels diferents espectres d’emissió dels fluorocroms, i requereix complexos sistemes d’algoritmes per a l’anàlisi, així com l’ús de nombrosos controls per minimitzar a més l’autofluorescència i la correcció de la contaminació de color. No obstant això, l’anàlisi de tal magnitud de dades amb la possible identificació de nous fenotips ceŀlulars suposa un obstacle per a l’aplicació generalitzada d’aquesta tecnologia. Petraush et al. (2006) van aconseguir identificar trenta-dues subpoblacions de limfòcits T per a dues condicions diferents de cultiu, en limfòcits de ganglis limfàtics criopreservats de pacients amb melanoma vacunats amb un pèptid modificat. Les cèŀlules es van adquirir en un citòmetre amb panells de vuit colors i les dades es van analitzar mitjançant algoritmes d’anàlisi jeràrquica i seqüencial de clústers per a l’obtenció del percentatge relatiu de cada subfenotip. Segons els autors, la tecnologia descrita i utilitzada en el seu treball és ràpida i efectiva per a l’estudi de patrons complexos d’expressió de subfenotips i entre diferents mostres, i conclouen que pot promoure l’ús de la citometria policromàtica per a aplicacions tant clíniques com de recerca. Entre els anys 1997 i 2001 ja s’havia aconseguit passar de cinc colors a onze (Rosa et al., 2001), encara que aquesta tecnologia estava disponible a molts pocs laboratoris arreu del món. L’any 2007, també fent servir vuit colors, es va posar de manifest la classificació del gran nombre de subpoblacions obtingudes amb anàlisi dels clústers i amb l’anàlisi del component principal per tal de simplificar les dades multicolor i la visualització (Lugli et al., 2007). Aquests aspectes tenen repercussions molt importants en el diagnòstic clínic, ja que molts assaigs necessiten la utilització del citòme-

Treballs de la Societat Catalana de Biologia, 66: 31-36


Destacats de Ciència

La citometria com a eina per aprofundir en la complexitat dels organismes vius i les malalties

tre de flux. Un programari d’aplicabilitat clínica ha de tenir diferents requisits en funció de l’aplicació específica, i el propòsit general ha de comprendre la visualització, la segmentació, el recompte, la interpretació i la generació dels informes corresponents. La visualització es basa en la transformació de les dades, mitjançant la compensació electrònica, la utilització del tipus d’escala (lineal, logarítmica i biexponencial), i l’anàlisi del component principal, per tal d’assolir una representació comprensible. La segmentació pretén identificar les poblacions, ja sigui per sobre o per sota d’una determinada intensitat de fluorescència, encerclada per una regió poligonal, per modelització de l’estat de probabilitat, o mitjançant algoritmes de clusterització. De manera molt important, ja sigui amb procediments manuals, supervisats o automatitzats, han de permetre la comparació amb dades de referència. A mesura que avança la tecnologia relacionada amb la citometria ha anat creixent la capacitat multicolor. Amb vista a aplicacions específiques, per exemple en l’àmbit del diagnòstic mèdic, és important destacar que molts assaigs no estan sotmesos a cap regulació que en permeti la comparació amb dades externes, ja sigui segons rangs de referència, per criteris clínics de classificació, i per la significació clínica que aquests resultats tinguin en cada activitat professional concreta. Per tant, és fonamental la identificació de possibles fonts d’error, començant per l’etiquetatge incorrecte, i passant per la manca de validació de l’assaig, o per la presència d’artefactes. En la pràctica clínica les conseqüències de l’error es poden traduir en un diagnòstic incorrecte, ja sigui no reconeixent la presència de malaltia, sobreinterpretant-la, o classificant-la inadequadament. Un recompte inexacte de cèŀlules malignes pot implicar una teràpia inadequada en el tractament de la malaltia residual mínima. Cal tenir present, doncs, que els resultats clínics són resultats d’un assaig i que tot assaig requereix una validació especialment rigorosa en l’àmbit clínic, i que si el programari falla, un assaig mai no podrà ser validat. L’objectivitat en l’anàlisi dels assaigs obtinguts mitjançant citometria és d’especial importància. L’any 2008, la Societat Internacional de Citologia Analítica (ISAC) i altres societats interessades van introduir una nova recomanació per al registre i la transmissió d’informació sobre els detalls experimentals de citometria de flux —incloent-hi mostres, instrumentació i anàlisi de dades— coneguts com la informació mínima sobre un experiment de citometria de flux (MIFlowCyt). MIFlowCyt s’ha desenvolupat de manera coordinada amb requisits ja inclosos en els experiments d’alt rendiment i, en conjunt, aquestes recomanacions constitueixen el projecte d’informació mínima per a la recerca biològica i biomèdica (MIBBI, minimum information for biological and biomedical investigations) (Taylor et al., 2008). D’altra banda, hi ha serveis que faciliten l’avaluació externa de la qualitat integral i proporcionen directrius als laboratoris clínics per a l’atenció òptima dels pacients. Mitjançant l’educació i la promoció de millors pràctiques, diferents organitzacions supranacionals estan treballant per millorar la comparabilitat i la fiabilitat dels resultats experimentals obtinguts mitjançant citometria de flux (i altres), amb independència d’on es duen a terme. Tot i que la citometria de flux es porta a terme sobretot en un context d’investigació, el marc esmentat abans també està contribuint a disminuir la variabilitat en els estudis clínics. La citometria de flux policromàtica avançada (amb la participació de setze o més colors simultàniament) ha afegit més complexitat als estudis immunofenotípics (Roederer, 2002). Els controls FMO (fluorescence minus one) són, ara com ara, la millor opció per identificar amb precisió les cèŀlules diana en aquest entorn. Però, són tots els laboratoris

econòmicament i tècnicament capaços d’incloure controls FMO per a la normalització d’aquests estudis? I com podem convèncer els gerents dels diferents hospitals sobre la necessitat d’utilitzar aquests controls òptims en entorns clínics malgrat que tenen més cost? Des del 1995, els grups de treball de la Societat Ibèrica de Citometria (SIC) han donat suport al control de qualitat de molts laboratoris d’Espanya i de Portugal, amb l’objectiu de reduir tant la variació intralaboratori i interlaboratoris dels resultats obtinguts amb la citometria de flux. Un laboratori de referència coordina una sèrie d’estudis d’intercalibració, i els resultats es discuteixen activament en les reunions territorials. L’experiència del grup de treball de la SIC en el recompte de cèŀlules CD34+ ha llançat més llum sobre els estudis de comparació entre laboratoris. Mitjançant un estudi multicèntric in silico per centrar-se en la subjectivitat de l’anàlisi per citometria un laboratori de referència va enviar arxius de dades representatives de diferents recomptes de les cèŀlules CD34+. Les mostres s’havien tenyit i adquirit en el laboratori de referència d’acord amb un protocol consensuat per al recompte absolut de cèŀlules CD34+. Sorprenentment, els resultats d’aquest estudi van mostrar coeficients de variació entre laboratoris molt elevats. Per tots aquests motius, la formació professional específica ajudarà a disminuir la variabilitat relacionada amb la subjectivitat que observem. Els nous esforços per incloure estudis in silico en projectes com el d’immunologia humana podrien contribuir substancialment a l’estandardització del fenotipatge. A més, estratègies supranacionals consensuades ajudarien a generar patrons de referència i bases de dades citòmiques, un fet que permetria la integració amb bases de dades genòmiques i proteòmiques existents.

Un futur immediat La necessitat creixent de mètodes multiparamètrics per al coneixement de complexos sistemes ceŀlulars, i concretament de la resposta de cèŀlules tumorals a diferents tractaments oncològics, ha impulsat el desenvolupament de la citometria de masses, i ha combinat l’espectrometria de masses amb fonaments de la citometria de flux per superar les limitacions esmentades de la fluorescència. Mitjançant la citometria de masses es poden analitzar simultàniament fins a trenta-cinc, i potencialment cent, marcadors diferents en una cèŀlula. La novetat està en l’ús de metalls, els lantanoides, com a marcadors dels anticossos monoclonals i substituint la conjugació amb fluorocroms. Els avantatges de l’ús d’aquests metalls com a marcadors són diversos: són molt minoritaris en les mostres biològiques, i redueixen el senyal de fons. A més, es poden utilitzar isòtops estables i elevar el nombre possible de combinacions, amb la qual cosa s’ofereix una resolució màxima per al nombre possible de canals de massa (Bandura et al., 2009). La citometria fotoacústica intravital és ja una realitat avui dia i possiblement serà implementada en els pròxims anys per tal de detectar cèŀlules tumorals circulants, així com cèŀlules mare tumorals. Alhora, el desenvolupament de nous fluorocroms basats en polímers sintètics orgànics permetran uns marges més amplis en el rang de colors per utilitzar amb uns espectres de solapament inferiors al 5 %. Els sistemes microfluídics suposaran també un gran ventall de possibilitats per aïllar les cèŀlules d’interès alhora que s’aniran desenvolupant sistemes d’alta velocitat de captura d’imatge en flux, de detectors multiespectrals, assaigs lliures de marcatge, i especialment, sistemes que permetin arribar a una sensibilitat de detecció de molècula única fent possibles sistemes de recompte i de concentració a escala molecular.

Treballs de la Societat Catalana de Biologia, 66: 31-36

35


Jordi Petriz

Una de les fronteres està relacionada amb la instrumentació de recerca, que permetrà la programació de l’operador en funció del disseny experimental, mentre que els sistemes clínics tendiran a ser completament automatitzats. Després de més de trenta anys, la citòmica ha entrat en una nova era per permetre descobertes revolucionàries en la biologia, s’incrementarà la qualitat del monitoratge de processos biotecnològics i es milloraran els diagnòstics clínics i les teràpies ceŀlulars, no solament allargant la supervivència dels pacients, sinó també millorant-ne la qualitat de vida.

Reflexions (i «refraccions») finals Més enllà de la descripció característica de la citometria de flux que es pot trobar arreu de molts documents i revisions, cal deixar molt clara la distància que hi ha entre la potencialitat d’aquesta tecnologia i com aplicar-la correctament. Malgrat que avui dia hi ha més de 15.000 cito­ fluoròmetres repartits per tot el món, només una fracció molt petita dels operadors tenen algun tipus d’acreditació del coneixement en la matèria. La International Society for Advancement of Cytometry (ISAC) és pionera en aquest sentit, i posa a disposició de la comunitat científica una acreditació internacional que ofereix les proves dels coneixements, de l’experiència, i que cal renovar cada tres anys. Des de l’any 2011, la ICCE (International Cytometry Certification Examination) ha certificat 191 citometristes arreu del món. Tenint en compte

que el mercat global de la citometria de flux assolirà els 5.700 milions de dòlars l’any 2018, això podria suposar un greu desequilibri entre la balança del coneixement, la tecnològica, i per tant, en la qualitat de la prestació de serveis i la validació dels resultats. En paraŀlel, la Societat Ibèrica de Citometria (SIC) està conduint uns esforços que permetin establir les categories d’operador de citòmetres de flux i d’operador de separadors ceŀlulars, i no solament en l’àmbit clínic i del diagnòstic, ja que aproximadament un 30 % de l’activitat relacionada amb la citometria de flux arreu del nostre entorn és «no clínica». En síntesi, aquests coneixements no han de ser només tecnològics, ja que han d’estar acompanyats d’una sòlida formació preferiblement en biologia ceŀlular i molecular, immunologia i física i química. En cas contrari, es pot arribar a situacions massa freqüents en què investigador i operador es retreuen un a l’altre els resultats negatius aconseguits, sense adoptar les mesures correctores necessàries. Dit d’una altra manera, la citometria necessita treure’s definitivament l’estigma de la seva «aparent simplicitat». El desconeixement envers la citometria fa que molt freqüentment es consideri que una persona amb una formació preliminar bàsica serà capaç de resoldre experiments de gran complexitat. Finalment, d’igual manera que una anàlisi complexa d’expressió gènica no es durà a terme sense el suport d’un bioinformàtic, els experiments, cada cop més complexos, de citometria, és necessari abordar-los amb l’assessoria i supervisió d’un citometrista.

Bibliografia Bandura, D. R. [et al.] (2009). «Mass cytometry: technique for real time single cell multitarget immunoassay based on inductively coupled plasma time-of-flight mass spectrometry». Anal Chem., 81 (16): 6813-6822. Baumgartha, N. [et al.] (2000). «A practical approach to multicolor flow cytometry for immunophenotyping». J. Immunol. Methods., 243: 77-97. Crosland-Taylor, P. J. (1953). «A device for counting small particles suspended in a fluid through a tube». Nature, 171: 37-38. Fulwyler, M. J. (1965). «Electronic separation of biological cells by volume». Science, 150 (3698): 910-911. Givan, A. L. (2001). Flow cytometry: first principles. Wiley-Liss. Hulett, H. R. [et al.] (1973). «Development and application of a rapid cell sorter». Clin. Chem., 19 (8): 813-816. Kamentsky, L. [et al.] (1965). «Spectrophotometer: new instrument for ultrarapide cell analysis». Science, 150: 630-631. Lee, J. A. [et al.] (2008). «MIFlowCyt: the minimum information about a flow cytometry experiment». Cytometry A., 73 (10): 926-930. Leeuwenhoeck, A. P. van (1720). «Observations of the muscular fibers of fish» Phil. Trans., 31: 190-199. Lugli, E. [et al.] (2007). «Subject classification obtained by cluster analysis and principal component analysis applied to flow cytometric data». Cytometry A., 71 (5): 334-344. Melamed, M. R. [et al.] (1990). Flow cytometry and sorting. Wiley-Liss.

36

Moldavan, A. (1934). «Photo-electric technique for the counting of microscopical cells». Science, 24: 188-189. Perfetto, S. P. [et al.] (2004). «Seventeen-colour flow cytometry: unravelling the immune system». Nat. Rev. Immunol., 4 (8): 648-655. Petrausch, U. [et al.] (2006). «Polychromatic flow cytometry: a rapid method for the reduction and analysis of complex multiparameter data». Cytometry A., 69 (12): 1162-1173. Robinson, J. P. [et al.] (2012). Current protocols in cytometry. John Wiley & Sons. Roederer, M. (2002). «Compensation in flow cytometry». Curr. Protoc. Cytom., cap. 1, unitat 1.14. Rosa, S. C. de [et al.] (2001). «11-color, 13-parameter flow cytometry: identification of human naive T cells by phenotype, function, and T-cell receptor diversity». Nat. Med., 7 (2): 245-248. Shapiro, H. M. (2003). Practical flow cytometry. Wiley-Liss. Strutt, J. W. (1879). «On the capillary phenomena of jets». Proc. R. Soc. London, 29: 71-97. Sweet, R. G. (1965). «High frequency recording with electrostatical deflected ink jets». Rev. Sci. Instr., 36 (2): 131-136. Taylor, C. F [et al.] (2008). «Promoting coherent minimum reporting guidelines for biological and biomedical investigations: the MIBBI project». Nat. Biotech., 26: 889896.

Treballs de la Societat Catalana de Biologia, 66: 31-36


Experimentació en animals: la revolució dels transgènics Miquel Garcia i Anna Pujol Centre de Biologia Molecular i Teràpia Gènica (CBATEG), Universitat Autònoma de Barcelona (UAB) Correspondència: Anna Pujol Altarriba. Unitat d’Animals Transgènics (UAT), Centre de Biologia Molecular i Teràpia Gènica (CBATEG), edifici H, Universitat Autònoma de Barcelona (UAB). Adreça electrònica: anna.pujol@ uab.cat.

DOI: 10.2436/20.1501.02.157 ISSN (ed. impresa): 0212-3037 ISSN (ed. digital): 2013-9802 http://revistes.iec.cat/index.php/TSCB Rebut: 20/02/2015 Acceptat: 08/04/2015

Resum

Animal research: the transgenics revolution

La transgènesi en animals ha estat una eina excepcional per als avenços en biotecnologia i biomedicina. La generació d’animals transgènics que sobreexpressen gens, o genoanuŀlats / genomodificats (knockout, KO / knockin, KI) que presenten modificacions específiques en determinats gens endògens, sovint per silenciar-los, ha estat clau per a l’anàlisi de la funció gènica i la seva relació amb processos patològics. Aquests animals han esdevingut models de malalties humanes necessaris per desenvolupar noves teràpies i estudis de xenotrasplantament, i han permès millores en l’àmbit de la producció animal. En recerca, però, l’espècie d’elecció ha estat el ratolí, per raons pràctiques i sobretot tecnològiques. Tanmateix, les limitacions tecnològiques per fer transgènesi dirigida en altres espècies es comencen a superar gràcies a la utilització de nucleases específiques de seqüència modificades. Aquesta tècnica està suposant una nova revolució en el camp de la transgènesi animal.

Summary

Paraules clau: animal transgènic, genoanuŀlat, biotecnologia, edició del genoma, model animal.

Animal transgenesis has been an essential tool for biotechnology and biomedicine research in recent decades. The generation of transgenic animals that overexpress a certain gene or knockouts/knockins (KO/KI) that carry a modification in a specific endogenous locus have been of key importance in the analysis of gene function and its relationship to pathological processes. These animal models have been used for the development of new therapies and for xenotransplantation studies, as well as to pursue improvements in animal production. Due to practical and mostly methodological reasons, mice have been the species of choice for research purposes. Nowadays, however, the technological limitations of gene targeting in other species are beginning to be overcome through the use of engineered sequence-specific nucleases. This technical advance is leading to a new revolution in the field of animal transgenesis.

Keywords: transgenic animal, knockout, biotechnology, genome editing, animal model.

Animals transgènics En les últimes dècades, la biotecnologia i la biomedicina han mostrat un avenç imparable associat a l’aparició de noves tecnologies. Entre aquestes, l’obtenció d’animals transgènics ha contribuït de manera decisiva a la gran majoria de descobriments científics i mèdics. Ha esdevingut clau en l’anàlisi de la funció gènica, en l’obtenció de models animals de malalties humanes i en el desenvolupament de noves teràpies, tant farmacològiques com gèniques, i en estudis de xenotrasplantament. D’altra banda, els transgènics també s’han utilitzat per aconseguir millores en producció animal. Va ser al principi dels anys vuitanta que la unió dels coneixements del DNA recombinant i de la reproducció va permetre el desenvolupament de la transgènesi en animals. Els primers van ser els anomenats transgènics convencionals, obtinguts per la integració de transgens en un punt a l’atzar del genoma i que permeten l’expressió o sobreexpressió d’un gen determinat. Una dècada després, els treballs d’Evans (1981) en el cultiu i la manipulació de les cèŀlules mare embrionàries murines, i els de Smithies (1985) i Capecchi (1987), en el procés de recombinació homòloga en cèŀlules eucariotes, van obrir la possibilitat de la modificació dirigida del genoma del ratolí (Evans i Kaufman, 1981; Smithies et al., 1985; Thomas i Capecchi, 1987). El desenvolupament d’aquestes tècniques va permetre obtenir ratolins amb un gen específic inactivat (knockout, KO) o amb modificacions

en un locus determinat (knockin, KI). Poc després, la combinació d’aquestes tecnologies amb recombinases específiques de seqüència va permetre desenvolupar animals amb modificacions genètiques dirigides restringides a un tipus ceŀlular o induïbles, fet que va obrir el ventall i l’especificitat de les possibles modificacions del genoma a l’abast dels investigadors. La transgènesi ha estat aplicada amb èxit en múltiples espècies animals, tant vertebrats com invertebrats (Gama Sosa et al., 2010). Tot i així, l’espècie d’elecció per generar transgènics destinats a la recerca és el ratolí. Els genomes humà i de ratolí presenten una homologia elevada i comparteixen la majoria dels gens i els processos fisiològics. Aquestes similituds fan del ratolí un bon model per a l’estudi de la funció gènica i les conseqüències patològiques del seu funcionament anòmal. A més, el ratolí presenta grans avantatges en l’aspecte experimental: un temps de gestació curt (entre 18,5 i 21 dies), l’existència de diferents soques i uns costos de manteniment relativament baixos. Però la principal raó per la qual el ratolí és l’espècie utilitzada majoritàriament en recerca és la possibilitat de treballar amb cèŀlules mare embrionàries murines per fer mutacions dirigides. En altres espècies la manca de disponibilitat d’aquestes línies ceŀlulars, o la baixa eficiència obtinguda en el procés, fa que es requereixin tecnologies més complexes, basades en la transferència de nuclis. En els últims anys, però, la utilització de nucleases específiques de

Treballs de la Societat Catalana de Biologia, 66: 37-42

37


Miquel Garcia i Anna Pujol

Figura 1. Generació de ratolins transgènics convencionals. El transgèn es microinjecta al pronucli masculí d’embrions d’una cèŀlula. Els embrions resultants es transfereixen a femelles receptores. Es determina el genotip de la descendència obtinguda per tal d’identificar els ratolins que han incorporat el transgèn (Tg) o els animals control que no l’han incorporat (Cn).

seqüència modificades per generar mutacions dirigides està significant un nou avenç en el camp de la transgènesi. Aquests sistemes permeten modificar locus concrets del genoma d’animals amb gran eficiència, rapidesa i facilitat, i ho fan possible per a espècies fins ara inaccessibles. Així, doncs, els continus avenços en el desenvolupament de noves tècniques de transgènesi, que faciliten i fan possible mutacions dirigides en diferents espècies animals, augura un ampli futur en aquest camp, limitat només per l’ètica i la imaginació. En aquest article pretenem exposar com es generen els diferents tipus d’animals transgènics i les seves aplicacions, basant-nos principalment en els models de ratolí perquè, fins al moment, és l’espècie animal d’experimentació per exceŀlència.

Ratolins transgènics convencionals El 1980, Gordon et al. van ser els primers a descriure la introducció de DNA forà en el genoma d’un ratolí per microinjecció en el pronucli masculí d’embrions d’una cèŀlula. Poc temps després, es va aconseguir el primer ratolí transgènic que presentava fenotip. S’hi havia introduït un transgèn que codificava l’hormona de creixement de rata sota el control del promotor de la metaŀlotioneïna I, i els ratolins transgènics presentaven un increment corporal important en comparació amb els seus germans no transgènics (Palmiter et al., 1982). Des de llavors, tot i que hi ha diverses possibilitats per introduir el transgèn en el genoma de l’animal (retrovirus, transferència vehiculada per espermatozoides, transposons...), aquesta és la tècnica més utilitzada en ratolí. Els objectius de la generació d’un animal transgènic convencional són l’expressió o la sobreexpressió de gens endògens o gens d’altres espècies amb un patró d’expressió seleccionat. Per aconseguir-ho cal dissenyar adequadament el transgèn que s’introduirà en el genoma de l’animal. Aquest ha d’estar format per una seqüència promotora, que determinarà on, com i quan s’expressarà el transgèn, i una seqüència codificant, que determinarà el producte gènic que se n’obtindrà i que serà el responsable de produir un fenotip. Per exemple, si l’objectiu és aconseguir expressar la proteïna de fluorescència verda (green fluorescent protein, GFP) en el múscul esquelètic, el transgèn consistirà en el promotor d’un gen que s’expressi específicament en cèŀlules musculars,

38

com pot ser l’MLC (miosin light chain), unit a la regió codificant, o el cDNA del gen GFP. A part de l’especificitat de teixit, també es pot determinar el moment de l’expressió del transgèn durant la vida de l’animal. Per això, s’utilitzen sistemes induïbles que s’activen amb l’administració d’un efector, com pot ser la tetraciclina, per via oral o injectat. Normalment, entre el promotor i el cDNA d’interès s’hi inclouen seqüències intròniques heteròlogues, com les del gen de la β-globina del conill, que incrementen l’expressió del transgèn. Amb la mateixa finalitat, a l’extrem 3´ s’hi situen seqüències de finalització de la transcripció eucariotes, que inclouen senyals de poliadenilació. Per protegir el transgèn de la possible interacció en la seva expressió dels dominis de cromatina adjacents al punt d’integració, el transgèn pot incorporar elements aïlladors o insulators (Wang et al., 1997; Potts et al., 2000). Quan la mida del transgèn és molt gran, es poden utilitzar cromosomes artificials com els dels bacteris (BAC) o els del bacteriòfag P1 (PAC), que poden incloure fins a 350 kb d’insert, i els de llevat (YAC), que poden incloure més d’1 Mb (Giraldo i Montoliu, 2001). L’avantatge és que tenen la capacitat d’incloure elements reguladors de l’expressió allunyats però necessaris perquè el transgèn s’expressi seguint el patró i la regulació del gen endogen del qual s’ha triat el promotor, i que a més poden actuar com a aïlladors per evitar efectes insercionals. Els embrions d’una cèŀlula s’obtenen de l’oviducte d’una femella a la qual s’ha induït la superovulació i que s’ha encreuat amb un mascle de la mateixa soca. La microinjecció consisteix en la introducció en el pronucli masculí de picolitres d’una solució que conté el transgèn en forma lineal i sense seqüències plasmídiques. Els embrions que sobreviuen es transfereixen a l’oviducte d’una femella receptora en estat de pseudogestació, perquè els gesti fins a generar un animal (vegeu la figura 1). Durant aquest procés, una o diverses còpies del transgèn s’integren en tàndem, normalment en un sol punt a l’atzar del genoma i abans de la primera divisió mitòtica. Per això, l’animal que es genera presenta el transgèn integrat en totes les cèŀlules, tant somàtiques com germinals, i serà capaç de transmetre la modificació genètica al 50  % de la descendència, seguint la proporció mendeliana d’un caràcter hemizigòtic o heterozigòtic. Si la inserció del transgèn es fa després de la primera divisió mitòtica, es generen animals mosaic, que es caracteritzen per presentar una transmissió menor del transgèn a la descendència. El genotip dels animals obtinguts després de la microinjecció es determina per PCR o transferència Southern per identificar els transgènics fundadors, que són aquells que han integrat el transgèn. L’eficiència del procés depèn de diversos factors, entre els quals l’experiència del tècnic, les característiques del transgèn i la soca de ratolí o espècie animal. Cada fundador obtingut s’encreua amb un ratolí no transgènic per generar línies independents. Per cada transgèn, es recomana determinar el fenotip com a mínim en dues línies en paraŀlel, per tal d’assegurar que el fenotip observat està produït per l’expressió del transgèn i no per possibles efectes insercionals. En el cas d’espècies en què la microinjecció del DNA no és tècnicament possible perquè no es poden visualitzar els pronuclis, es po-

Treballs de la Societat Catalana de Biologia, 66: 37-42


Destacats de Ciència

Experimentació en animals: la revolució dels transgènics

den utilitzar vectors vírics com a vehicle per introduir el transgèn al genoma. S’utilitzen vectors retrovírics del tipus lentivirus (derivats del virus de la sida) als quals s’han substituït les seqüències necessàries per al cicle víric pel transgèn, mantenint-ne la capacitat infectiva. Aquest mètode és molt eficient però presenta una sèrie de limitacions: la mida del transgèn no ha de superar les 10 kb perquè es pugui encapsidar dins la partícula vírica, es produeixen punts d’inserció en el genoma múltiples i independents i, finalment, es requereix treballar amb nivells de bioseguretat més estrictes. L’ús de lentivirus va permetre obtenir el primer primat no humà transgènic. Aquest animal expressava la proteïna de fluorescència verda en totes les cèŀlules de l’organisme (Chan et al., 2001).

Ratolins genoanuŀlats (knockout) i genomodificats (knockin) constitutius La generació de ratolins KO i KI es basa en les tècniques de recombinació homòloga en cèŀlules mare embrionàries (CME). Aquestes s’obtenen de la massa de cèŀlules interna del blastocist. La seva principal característica és la pluripotencialitat, és a dir, el fet que són capaces de generar qualsevol tipus ceŀlular. En el cas de les CME murines, aquesta característica es manté fins i tot després de ser modificades genèticament in vitro. Així, un cop reintroduïdes en un embrió poden contribuir a generar els diferents llinatges ceŀlulars de l’organisme, fins i tot la línia germinal (vegeu la figura 2). Amb aquesta tecnologia s’han obtingut models animals mutants que repliquen fenotips de malalties humanes, com ara diversos tipus de càncer, malalties cardiovasculars, malalties metabòliques, trastorns neurodegeneratius i defectes congènits (Rosenthal i Brown, 2007). Aquests animals també ofereixen un context biològic en el qual es poden desenvolupar i provar aplicacions terapèutiques. Figura 2. Generació de ratolins KO constitutius. El vector de recombinació s’introdueix per electroporació en cèŀlules mare embrionàries (CME) i se selecciona en cultiu per tal d’obtenir i identificar els clons en què s’ha produït la recombinació homòloga. Aquests s’injecten en blastocists que posteriorment es transfereixen a femelles receptores. Els animals quimera resultants s’encreuen amb animals control (+/+) per tal d’obtenir ratolins heterozigots per a la mutació (+/–). Finalment, els ratolins KO homozigots (–/–) s’obtenen de l’encreuament de dos heterozigots.

La recombinació homòloga és un procés d’intercanvi de material genètic entre dues molècules de DNA similars. Per induir recombinació homòloga en una regió concreta del genoma de les CME, s’hi introdueix un vector de recombinació per electroporació. Quan l’objectiu és generar un ratolí KO, el vector es construeix de manera que la recombinació produeixi la deleció de seqüències crítiques del locus d’interès, la qual cosa impedeix que es produeixi una proteïna funcional. En el cas dels ratolins KI, l’objectiu és introduir seqüències en una regió genòmica concreta; per exemple, per generar mutacions puntuals o inserir gens marcadors. El vector de recombinació conté dos fragments o braços homòlegs a les seqüències genòmiques que envolten la regió que es vol modificar. En general, la llargada dels braços és proporcional a la probabilitat de recombinació homòloga (Joyner i Sedivy, 2000). La majoria d’integracions del vector en el genoma són a l’atzar i no per recombinació homòloga. Per tal d’eliminar les integracions a l’atzar, els vectors presenten gens de resistència o sensibilitat a drogues que permetran seleccionar aquells clons en què s’ha produït la modificació específica en la regió d’interès. Els més utilitzats són el gen de resistència a la neomicina (neo), que se situa entre els dos braços d’homologia i que permet la selecció positiva dels clons recombinants, i el gen de la timidina-cinasa (TK), que confereix sensibilitat a la presència de ganciclovir i que se situa en un extrem del vector i permet la selecció negativa de les integracions a l’atzar. El genotip dels clons que han superat la doble selecció es determina per transferència Southern o PCR. Aquells que tenen la modificació genètica correcta s’integren en embrions perquè contribueixin al desenvolupament de l’animal. Les dues tècniques més utilitzades són la injecció de les CME recombinants en blastocists i l’agregació o injecció a embrions en l’estadi de vuit cèŀlules. Després de la manipulació, els embrions es transfereixen a l’úter d’una femella receptora perquè els gesti. Dels embrions en naixeran ratolins quimera, formats per la contribució de l’embrió i de les CME modificades genèticament. Una variant de la tècnica és la utilització d’embrions tetraploides, que permet generar animals totalment derivats de les CME amb la modificació genètica. No totes les soques de ratolí són bones per produir línies estables de CME ni per ser utilitzades com a donadores d’embrions. Actualment es disposa de diferents línies de CME. Les més utilitzades són les de fons genètic 129 (agutí) (Brook i Gardner, 1997) i les C57BL/6N (negres o agutís) (Pettitt et al., 2009). Les cèŀlules amb caràcter agutí s’injecten en blastocists C57BL/6 negres per donar lloc a quimeres que presentaran dos colors. Així, el color de pelatge de la quimera es pot relacionar amb el grau de contribució de les CME en la generació de l’animal. En els ratolins amb un grau de quimerisme elevat és més probable que les CME recombinants hagin colonitzat la línia germinal i que la quimera pugui transmetre la mutació a la descendència. Els animals obtinguts hauran rebut la modificació genètica en heterozigosi (+/–) i, per tant, caldrà encreuar-los per obtenir finalment ratolins homozigots (–/–) KO o KI.

Treballs de la Societat Catalana de Biologia, 66: 37-42

39


Miquel Garcia i Anna Pujol

Figura 3. Generació de ratolins KO específics de teixit i induïbles. a) Sistema de recombinases Cre-LoxP. Un transgènic que expressa la recombinasa Cre sota el control d’un promotor específic de tipus ceŀlular o un sistema induïble, s’encreua amb un ratolí floxat, que presenta una regió crítica del gen d’interès flanquejada per seqüències LoxP. La recombinació es donarà només en els tipus ceŀlulars en què s’expressi la recombinasa Cre. b) Sistema induïble de la tetraciclina. Està format per dos elements, un transactivador (tTA, rtTA) i un operador (tetO) que expressarà Cre. La unió de tetraciclina al transactivador produeix la inhibició del sistema (tTA, Tet-Off ) o bé l’activació (rtTA, Tet-On). c) Sistema induïble del tamoxifèn. Està basat en una recombinasa Cre unida al domini d’unió del receptor d’estrògens (CreER). En absència de tamoxifèn, Cre és retinguda al citoplasma per les heat shock proteins (HSP) i per tant resta inactiva. La presència de tamoxifèn desplaça les HSP i permet que la recombinasa migri cap al nucli i produeixi la recombinació.

Aquests animals presenten la modificació genètica dirigida de manera constitutiva. En altres espècies animals ha estat molt difícil o impossible establir línies de CME. En aquests casos, la generació d’animals KO o KI requereix un procés de transferència de nuclis, més complex i molt menys eficient. Aquest procés es basa en la transferència del nucli d’una cèŀlula somàtica en la qual hem introduït una modificació genètica, en un oòcit enucleat. Posteriorment l’oòcit s’activa per tal que iniciï el desenvolupament embrionari fins a generar l’animal mutant que contindrà la informació genètica amb la modificació desitjada. El primer mamífer clonat per transferència de nuclis va ser l’ovella Dolly (Campbell et al., 1996). Els animals KO i KI constitutius tenen la mutació en totes les cèŀlules de l’organisme i durant tota la vida, incloent-hi el període embrionari. Per aquest motiu, sovint presenten fenotips complexos, per la contribució de diferents tipus ceŀlulars. A més, els efectes de la modificació genètica durant el període embrionari també afegeixen complexitat al fenotip i poden arribar fins i tot a provocar mort embrionària. Per superar aquestes limitacions es va desenvolupar la tecnologia de generació de KO condicionals, que permet generar modificacions específiques de teixit o induïbles, segons si es determina el tipus ceŀlular o el moment de la vida de l’animal en què es produeix la modificació.

Ratolins genoanuŀlats i genomodificats específics de teixit i induïbles La generació d’animals KO i KI condicionals es basa en la utilització de sistemes de recombinases específiques de seqüència juntament amb les tècniques de recombinació homòloga en CME. El sistema de

40

recombinases més habitual és el Cre-LoxP, tot i que n’hi ha d’altres, com l’Flp-FRT, que funcionen de manera similar (Nagy, 2000; Zhu i Sadowski, 1998). Està format per un enzim amb activitat recombinasa (Cre) que reconeix específicament dues unitats d’una determinada seqüència de nucleòtids (LoxP) i les recombina (vegeu la figura 3). Cada LoxP consisteix en 34 pb formats per dos extrems invertits de 18  pb i un cor central de 8 pb asimètric que hi confereix direccionalitat. El resultat de la recombinació entre dos LoxP depèn de l’orientació relativa de les dues seqüències. Si es troben en la mateixa orientació, la recombinació produeix la deleció del fragment de DNA flanquejat pels dos LoxP, de manera que queda un únic LoxP en la seqüència de DNA original. Si l’orientació és inversa, es produeix la inversió de les seqüència de DNA flanquejada pels dos LoxP (Hamilton i Abremski, 1984). L’obtenció de KO i KI condicionals requereix encreuar dos tipus de ratolins (vegeu la figura 3): d’una banda, un ratolí generat per recombinació homòloga en CME anomenat floxat, perquè s’hi han introduït dues seqüències LoxP, normalment en la mateixa orientació (per tal de no afectar l’expressió del gen, els LoxP se solen situar en regions intròniques i flanquejant un o diversos exons crítics), i, de l’altra banda, un ratolí transgènic convencional que expressa Cre sota el control d’un promotor específic de teixit o un sistema induïble; en els descendents, el patró d’expressió d’aquest promotor determinarà el tipus ceŀlular i el moment en què es produirà la recombinació i, per tant, la modificació genètica. Els sistemes induïbles es basen en el control temporal de la transcripció o activitat de Cre. Això permet produir la modificació que ens interessa en un moment determinat de la vida de l’animal. Els més utilitzats són el sistema de la tetraciclina i el del tamoxifèn (vegeu la figura  3). El sistema de la tetraciclina controla la transcripció de l’enzim Cre mitjançant l’administració a l’animal de l’antibiòtic doxiciclina, normalment a través de la beguda. Consisteix en l’expressió d’un transactivador (tTA en el sistema Tet-Off, o rtTA en el sistema Tet-On) que s’unirà al seu operador i promourà l’expressió de Cre depenent de la presència (Tet-On) o de l’absència (Tet-Off) de la doxiciclina, que actua com a efector. Per tant, l’administració de doxiciclina a l’animal permet controlar la transcripció de la recombinasa Cre i induir la modificació genètica (Gossen et al., 1995). El sistema del tamoxifèn consisteix en una proteïna Cre quimèrica, fusionada amb el domini d’unió d’un receptor nuclear d’estrògens (CreER, CreERT2) que ha perdut la capacitat d’unir-se a hormones endògenes, però que pot unir-se a agonistes d’estrògens com el tamoxifèn o a l’esteroide sintètic RU486. La CreER queda retinguda al citoplasma per la unió a les proteïnes hsp90 (heat-shock proteins) i, per tant, resta inactiva. L’administració de tamoxifèn o RU486 desplaça les hsp90 i permet el moviment de la CreER al nucli ceŀlular, on produirà la recombinació dels dos LoxP (Metzger et al., 1995; Feil et al., 1997). La combinació dels sistemes específics de teixit i els induïbles permet un gran ventall de possibilitats d’introduir mutacions restringides a un tipus ceŀlular i en un moment determinat.

Treballs de la Societat Catalana de Biologia, 66: 37-42


Experimentació en animals: la revolució dels transgènics

Actualment, la comunitat científica disposa de recursos importants per a l’obtenció i la distribució de ratolins KO. Destaca l’International Mouse Phenotyping Consortium (IMPC, http://www.mousephenotype. org), que té com a objectiu generar ratolins KO de tots els gens murins i, paraŀlelament, actua com a repositori de ratolins i de CME modificats, que distribueix als investigadors interessats. Aquest consorci també duu a terme l’anàlisi fenotípica dels animals generats i en publica les dades obtingudes. Hi ha altres recursos per obtenir informació i ratolins, tant floxats com transgènics que expressen Cre; per exemple, The Jackson Laboratory (http://jax.org) o bases de dades de ratolins transgènics que expressen Cre (http://nagy.mshri.on.a/cre_new).

Noves tecnologies: nucleases específiques de seqüència modificades Tot i que la modificació dirigida d’un locus genòmic per recombinació homòloga en CME és la tècnica més utilitzada per generar ratolins mutants, l’eficiència global del procés és baixa, econòmicament costosa i restringida bàsicament a aquesta espècie. En els últims anys, el desenvolupament de sistemes d’edició del genoma mitjançant nucleases específiques de seqüència modificades (NESM) està representant la possibilitat de modificar el genoma de manera dirigida (Swarthout et al., 2011; Joung i Sander, 2013; Cong i Zhang, 2015). L’edició del genoma mitjançant NESM es basa en els processos ceŀlulars de reparació del DNA. Les NESM es dissenyen per tallar la cadena de DNA específicament en un punt del genoma. La reparació d’aquest tall es pot donar per dues vies. La primera, mitjançant un procés d’unió no homòloga d’extrems (non-homologous end join, NHEJ), que repara el tall a la doble cadena de DNA per inserció a l’atzar de nucleòtids. Aquesta via sol provocar insercions i delecions que tenen per resultat la disrupció del gen d’interès. La segona via és a través d’un procés de recombinació homòloga (homologous recombination, HR) o de reparació dirigida per homologia (homologous direct repair, HDR) entre el gen d’interès i una seqüència donant de DNA, un vector de recombinació o un oligonucleòtid de seqüència homòloga, que s’ha introduït a la cèŀlula juntament amb la NESM. Aquests sistemes permeten reparar el tall i introduir seqüències de DNA en la regió específica del genoma. Les primeres NESM utilitzades per editar el genoma van ser les ZFN, nucleases de dit de zinc (zinc finger nucleases) (Urnov et al., 2010). Són molècules híbrides que combinen de tres a sis dominis d’unió a DNA amb el domini endonucleasa de l’enzim FokI. Cada domini reconeix un determinat triplet de nucleòtids, de manera que la ZFN presenta especificitat per una seqüència entre nou i divuit nucleòtids. El tall de la doble cadena es produeix quan FokI dimeritza, i per això es requereixen dues ZFN independents, que s’uneixin a cada cadena de DNA en l’orientació i la distància adequades. Les principals limitacions d’aquesta tecnologia són degudes a la dificultat de dissenyar el domini d’unió per aconseguir especificitat. Mitjançant ZFN s’ha descrit un increment de l’eficiència de recombinació homòloga en CME i s’han generat ratolins KI per mi-

croinjecció pronuclear (Meyer et al., 2010). També s’han generat modificacions dirigides amb ZFN en rates KO (Geurts et al., 2009), així com en moltes altres espècies (Wijshake et al., 2014). El 2009 es van descriure les TALEN, formades també pel domini nucleasa FokI i una regió de reconeixement del DNA. A diferència de les ZFN, aquesta regió conté unitats repetides entre 33-35 aminoàcids, altament conservats, excepte els de la posició 12 i 13, anomenats repeat-variable di-residues (RVD), que confereixen especificitat de seqüència d’unió a un nucleòtid. Aquesta característica permet a les TALEN una resolució més gran del lloc de tall en el genoma. De la mateixa manera que les ZFN, les TALEN permeten editar el genoma amb elevada eficiència, però amb menys talls inespecífics. Aquestes nucleases s’han utilitzat en transgènesi per modificar el genoma d’altres espècies, com la rata, el peix zebra, la vaca o el porc (Wijshake et al., 2014). Recentment s’han utilitzat TALEN per introduir modificacions genètiques en fibroblasts i generar porcs mutants per transferència nuclear, útils per a estudis de xenotrasplantament (Xin et al., 2013). El 2012 va aparèixer un nou sistema, el CRISPR/Cas9 (clustered, regulatory interspaced, short, palindromic repeats / nuclease CRISPR associated), una tecnologia d’edició del genoma revolucionària. Les CRISPR/Cas són essencials en la immunitat adaptativa de determinats bacteris i arqueus contra material genètic extern, com ara virus o altres patògens (Wiedenheft et al., 2012). Es tracta d’una ribonucleoproteïna constituïda per l’enzim endonucleasa Cas9, que talla la doble cadena de DNA, i una guia de RNA (gRNA) responsable del reconeixement de la seqüència diana. Aquest RNA esta compost per 20 pb que reconeixen la seqüència diana, més la seqüència 5´-NGG-3´ coneguda com a PAM. Aquests tres nucleòtids són reconeguts per la Cas9 i són imprescindi-

Figura 4. Edició del genoma mitjançant nucleases específiques de seqüència modificades (NESM). a) Estructura de les ZFN, TALEN i CRISPR/Cas9. b) Les NESM actuen generant un tall en un lloc específic de la cadena de DNA. La reparació d’aquest tall es pot produir per diferents mecanismes. Si es fa mitjançant la unió no homòloga d’extrems (NHEJ) dóna lloc a petites insercions o delecions que poden portar a la generació de KO. En presència d’un vector de recombinació o d’un oligonucleòtid de seqüència homòloga, pot tenir lloc una recombinació homòloga (HR) o reparació dirigida per homologia (HDR) que permet generar KO/KI.

Treballs de la Societat Catalana de Biologia, 66: 37-42

41


Miquel Garcia i Anna Pujol

bles per al funcionament del sistema. Un cop reconeguda la seqüència diana, la nucleasa tallarà el DNA tres nucleòtids cadena amunt de la seqüència PAM. A diferència de les ZFN i les TALEN, aquest sistema només requereix la síntesi de gRNA. Per aquesta facilitat de disseny i obtenció, i la gran eficiència, el CRISPR/Cas s’està convertint en el sistema d’elecció per a l’edició del genoma (Yang et al., 2014). La principal limitació de les NESM és que també produeixen talls en altres llocs a part de la seqüència diana. Això comporta la introducció de mutacions no desitjades, difícils de predir i de comprovar. Per això, els estudis actuals s’estan centrant a millorar aquests sistemes per reduir-ne els efectes adversos. Per exemple, en el cas de les CRISPR/ Cas9 s’ha descrit un mutant (D10A) que converteix la nucleasa en una DNA nickase, capaç de tallar una sola cadena del DNA (Ran et al., 2013). D’altra banda, també s’ha produït un CRISPR gRNA, que utilitza la nucleasa FokI en comptes de la Cas9 i, per tant, requereix actuar en forma de dímer, com les ZFN i les TALEN (Tsai et al., 2014). La necessitat de reconèixer dues seqüències o de dimeritzar per poder tallar les dues cadenes de DNA permet reduir els efectes inespecífics sense disminuir l’eficiència del sistema.

Tot i això, l’elevada eficiència de les NESM possibilita la generació d’animals KO/KI per microinjecció directa dels seus components en embrions d’una cèŀlula, sense la necessitat d’utilitzar CME. Això redueix molt el temps necessari per obtenir animals mutants i obre la possibilitat d’editar el genoma a espècies fins ara inabastables (Wijshake et al., 2014). Així, s’ha aconseguit el KO de dos gens per microinjecció del sistema CRISPR/Cas9 en embrions d’una cèŀlula de mico (Niu et al., 2014). A part de silenciar gens, en un sol pas també s’ha aconseguit inserir epítops i marcadors (tags), gens marcadors, i generar aŀlels condicionals o floxats (Yang et al., 2014). A més, s’ha descrit la possibilitat de modificar diversos gens o els dos aŀlels d’un mateix gen simultàniament, per evitar així la necessitat d’encreuar animals i estalviar temps (Cong et al., 2013). Aquests avantatges han fet que les NESM, i especialment les CRISPR/Cas, siguin uns sistemes exceŀlents d’edició del genoma i estiguin suposant una nova revolució en el camp de la transgènesi animal (Seruggia i Montoliu, 2014).

Bibliografia Brook, F. A.; Gardner, R. L. (1997). «The origin and efficient derivation of embryonic stem cells in the mouse». Proc. Natl. Acad. Sci. USA, 94: 5709-5712. Campbell, K. H. [et al.] (1996). «Sheep cloned by nuclear transfer from a cultured cell line». Nature, 380: 64-66. Chan, A. W. [et al.] (2001). «Transgenic monkeys produced by retroviral gene transfer into mature oocytes». Science, 291: 309-312. Cong, L. [et al.] (2013). «Multiplex genome engineering using CRISPR/Cas Systems». Science, 339: 819-823. Cong, L.; Zhang, F. (2015). «Genome engineering using CRISPR-Cas9 system». Methods Mol. Biol., 1239: 197-217. Evans, M. J.; Kaufman, M. H. (1981). «Establishment in culture of pluripotential cells from mouse embryos». Nature, 292: 154-156. Feil, R. [et al.] (1997). «Regulation of Cre recombinase activity by mutated estrogen receptor ligand-binding domains». Biochem. Biophys. Res. Commun., 237: 752-757. Gama Sosa, M. A. [et al.] (2010). «Animal transgenesis: an overview». Brain Struct. & Funct., 214: 91-109. Geurts, A. M. [et al.] (2009). «Knockout rats via embryo microinjection of zinc-finger nucleases». Science, 325 (5939): 433. Giraldo, P.; Montoliu, L. (2001). «Size matters: use of YACs, BACs and PACs in transgenic animals». Transgenic Res., 10: 83-103. Gordon, J. W. [et al.] (1980). «Genetic transformation of mouse embryos by microinjection of purified DNA». Proc. Natl. Acad. Sci. USA, 77: 7380-7384. Gossen, M. [et al.] (1995). «Transcriptional activation by tetracyclines in mammalian cells». Science, 268: 1766-1769. Hamilton, D. L.; Abremski, K. (1984). «Site-specific recombination by the bacteriophage P1 lox-Cre system. Cre-mediated synapsis of two lox sites». J. Mol. Biol., 178: 481-486. Joung, J. K.; Sander, J. D. (2013). «TALENs: a widely applicable technology for targeted genome editing». Nat. Rev. Mol. Cell Biol., 14: 49-55. Joyner, A. L.; Sedivy, J. M. (2000). Gene targeting: a practical approach. Oxford; Nova York: Oxford University Press. Metzger, D. [et al.] (1995). «Conditional site-specific recombination in mammalian cells using a ligand-dependent chimeric Cre recombinase». Proc. Natl. Acad. Sci. USA, 92: 6991-6995. Meyer, M. [et al.] (2010). «Gene targeting by homologous recombination in mouse zygotes mediated by zinc-finger nucleases». Proc. Natl. Acad. Sci. USA, 107: 1502215026. Nagy, A. (2000). «Cre recombinase: the universal reagent for genome tailoring». Genesis, 26: 99-109.

42

Niu, Y. [et al.] (2014). «Generation of gene-modified cynomolgus monkey via Cas9/ RNA-mediated gene targeting in one-cell embryos». Cell, 156: 836-843. Palmiter, R. D. [et al.] (1982). «Dramatic growth of mice that develop from eggs microinjected with metallothionein-growth hormone fusion genes». Nature, 300: 611-615. Pettitt, S. J. [et al.] (2009). «Agouti C57BL/6N embryonic stem cells for mouse genetic resources». Nat. Methods, 6: 493-495. Potts, W. [et al.] (2000). «Chicken beta-globin 5’HS4 insulators function to reduce variability in transgenic founder mice». Biochem. Biophys. Res. Commun., 273: 10151018. Ran, F. A. [et al.] (2013). «Double nicking by RNA-guided CRISPR Cas9 for enhanced genome editing specificity». Cell, 154: 1380-1389. Rosenthal, N.; Brown, S. (2007). «The mouse ascending: perspectives for human-disease models». Nat. Cell Biol., 9: 993-999. Seruggia, D.; Montoliu, L. (2014). «The new CRISPR-Cas system: RNA-guided genome engineering to efficiently produce any desired genetic alteration in animals». Transgenic Res, 5: 707-716. Smithies, O. [et al.] (1985). «Insertion of DNA sequences into the human chromosomal beta-globin locus by homologous recombination». Nature, 317: 230-234. Swarthout, J. T. [et al.] (2011). «Zinc finger nucleases: A new era for transgenic animals». Ann. Neurosci., 18: 25-28. Thomas, K. R.; Capecchi, M. R. (1987). «Site-directed mutagenesis by gene targeting in mouse embryo-derived stem cells». Cell, 51: 503-512. Tsai, S. Q. [et al.] (2014). «Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editin». Nat. Biotechnol., 32: 569-576. Urnov, F. D. [et al.] (2010). «Genome editing with engineered zinc finger nucleases». Nat. Rev. Genet., 11: 636-646. Wang, Y. [et al.] (1997). «Ligand-inducible and liver-specific target gene expression in transgenic mice». Nat. Biotechnol., 15: 239-243. Wiedenheft, B. [et al.] (2012). «RNA-guided genetic silencing systems in bacteria and archaea». Nature, 482: 331-338. Wijshake, T. [et al.] (2014). «Endonucleases: new tools to edit the mouse genome». Biochim. et Biophys. Acta, 10: 1942-1950. Xin, J. [et al.] (2013). «Highly Efficient Generation of GGTA1 Biallelic Knockout Inbred Mini-Pigs with TALENs». PloS One, 8, e84250. Yang, H. [et al.] (2014). «Generating genetically modified mice using CRISPR/Cas-mediated genome engineering». Nat. Protoc., 9: 1956-1968. Zhu, X. D.; Sadowski, P. D. (1998). «Selection of novel, specific single-stranded DNA sequences by Flp, a duplex-specific DNA binding protein». Nucleic Acids Res., 26: 1329-1336.

Treballs de la Societat Catalana de Biologia, 66: 37-42


Espectroscòpia de ressonància magnètica nuclear (RMN) Margarida Gairí,1 Miguel Feliz1 i Miquel Pons2 1 2

Centres Científics i Tecnològics, Universitat de Barcelona Laboratori de RMN de Biomolècules, Departament de Química Orgànica, Universitat de Barcelona

Correspondència: Miquel Pons. RMN de Biomolècules, Edifici Modular, Parc Científic de Barcelona. Carrer de Baldiri Reixac, 10-12. 08028 Barcelona. Adreça electrònica: mpons@ub.edu.

DOI: 10.2436/20.1501.02.158 ISSN (ed. impresa): 0212-3037 ISSN (ed. digital): 2013-9802 http://revistes.iec.cat/index.php/TSCB Rebut: 16/10/2014 Acceptat: 08/11/2014

Resum

Nuclear magnetic resonance (NMR) spectroscopy

La capacitat de la RMN per obtenir informació molecular a escala atòmica l’ha convertida en una poderosa tècnica en biomedicina i biotecnologia. Entre les seves aplicacions pot destacar-se, per exemple, la caracterització de productes naturals i sintètics i la identificació i quantificació de components individuals de barreges complexes, eines clau en les indústries farmacèutica o alimentària. A més és una tècnica molt valuosa en diagnosi mèdica. Ens permet obtenir imatges de parts del cos humà (RMN d’imatge) per detectar tumors o lesions. Possibilita la identificació de metabòlits com a possibles biomarcadors de malalties específiques. Addicionalment s’utilitza en la determinació de l’estructura tridimensional, la dinàmica i el funcionament de les principals dianes terapèutiques: les proteïnes, i també en l’estudi de les interaccions entre aquestes dianes i els fàrmacs, punt clau en el desenvolupament i millora d’un medicament.

Summary

Paraules clau: qualitat alimentària, metabolòmica, estructura i dinàmica de proteïnes, disseny de fàrmacs.

NMR has become a powerful technique in biomedicine and biotechnology because of its ability to provide molecular information at atomic level. Among its many applications, we highlight its use for natural products characterization and the identification and quantification of individual components of complex mixtures in the pharmaceutical or food industries. NMR is a potent tool in medical diagnosis as well. Body images obtained through nuclear magnetic resonance imaging (NMRI) inform of the presence of tumours or injuries, and metabolites can be identified as specific disease-related biomarkers. In addition, NMR provides advantages in determining the structure, dynamics and function of drug targets such as proteins, and it can characterize drug-target interactions, which are critical to the drug discovery process.

Keywords: food quality control, metabolomics, protein structure and dynamics, drug discovery.

Introducció El nom de ressonància magnètica o simplement ressonància ha esdevingut familiar com una prova mèdica utilitzada sovint per diagnosticar l’abast de les lesions dels esportistes o per detectar tumors. Aquests termes escurcen i fan menys temible per als malalts el nom original de ressonància magnètica nuclear o RMN. El terme nuclear no té res a veure amb la radioactivitat sinó que es refereix al fet que la RMN obté informació sobre els nuclis dels àtoms. Nosaltres, tots els animals i plantes i tots els objectes que ens envolten, estem formats per àtoms i cada àtom té el seu nucli. Els àtoms es poden agrupar en molècules: l’aigua està formada per tres àtoms (dos d’hidrogen i un d’oxigen); la sacarosa té de fórmula C12H22O11, en què els subíndexs reflecteixen el nombre de cadascun dels tipus d’àtoms; la insulina, la proteïna que falta en alguns tipus de diabetis, està formada per 257 carbonis, 385 hidrògens, 65 nitrògens, 42 oxígens i 6 sofres. Aportant informació dels nuclis —i per tant dels àtoms— d’una molècula, la RMN ens permet saber la forma de les molècules, com es mouen, amb qui interaccionen i, per tant, entendre com funcionen i de quina manera es poden corregir, mitjançant els fàrmacs, disfuncions que causen malalties. Una variant de la RMN ens permet, a més, conèixer la localització de les molècules més abundants (aigua) dins del cos i això ens dóna imatges que els metges poden interpretar per detectar tumors, lesions, etc. Aquesta variant de la RMN s’anomena ressonància magnètica d’imatge i és la ressonància que molts de nosaltres hem experimentat com a pacients.

Una mica d’història. El concepte de espín, una nova propietat de

les partícules elementals (a més de la seva massa o càrrega), s’havia predit i trobat en el cas dels electrons i Stern el 1933 va demostrar que el protó, que forma el nucli de l’àtom d’hidrogen, també tenia espín. Això li va valdre el Premi Nobel de física de l’any 1943. L’any següent Rabi rebia el Premi Nobel pel descobriment del mètode de ressonància per detectar-lo. La predicció era que les partícules amb espín havien de respondre a la presència de camps magnètics intensos i adquirir la propietat d’absorbir (i després tornar a emetre) ones de ràdio que complissin una determinada condició anomenada ressonància. El 1946 els grups de Bloch, a Stanford, i de Purcell, a Harvard, demostraven que es podia mesurar la ressonància magnètica nuclear de mostres massives (parafina, aigua, etanol). Tots dos van compartir el Premi Nobel de Física del 1952. Molt aviat es va demostrar que les implicacions d’aquests descobriments, primer en el camp de la química i després en els de la biologia i la medicina, eren immenses. Els premis Nobel de Química de 1991 (Ernst) i 2002 (Wüthrich) i el de Medicina o Fisiologia del 2003 (Lauterbur i Mansfield) en donen testimoni. El discurs de concessió del Premi Nobel de 1946 descriu de manera poètica i profètica la rellevància i l’impacte de la RMN: «Dr. Bloch i Dr. Purcell! Heu obert el camí cap a noves perspectives en el micromón de la física nuclear. Cada àtom és com un subtil i refinat instrument tocant la seva tènue melodia magnètica que l’oïda humana no pot copsar. Amb els vostres mètodes, aquesta música s’ha fet perceptible i la melodia característica de cada àtom es pot utilitzar per identificar-lo. Més enllà de la seva gran bellesa inteŀlectual, aquest descobriment posa a les mans dels científics un mètode analític de la més gran utilitat.»

Treballs de la Societat Catalana de Biologia, 66: 43-47

43


Margarida Gairí, Miguel Feliz i Miquel Pons

Figura 1. Espectres de 1H d’heparina amb CSOS i d’heparina comercial.

Les capacitats de la RMN: les molècules àtom a àtom. La freqüència de ressonància de cada nucli («el to de la melodia») depèn no tan sols del tipus de nucli sinó també del seu entorn. Així, els vint-i-dos hidrògens de la molècula de sacarosa poden ser distingits entre si. La complexa melodia d’aquest cor de vint-i-dues veus es pot separar per extreure’n cada una de les contribucions per mitjà d’un procés anomenat transformada de Fourier. El resultat és un espectre de RMN, que conté les freqüències associades a cadascun dels nuclis observats. L’anàlisi dels espectres de RMN ens indica, per a cada nucli d’hidrogen, a quins àtoms està unit, quins altres hidrògens té a prop, com d’exposat està al dissolvent (aigua) que envolta la molècula de sacarosa, com giren les parts de la molècula unides per enllaços senzills i quines orientacions relatives assumeixen. Si no sabéssim de quina molècula es tracta, aquesta informació ens permetria identificar-la. Si ja ho sabem, ens permet conèixer l’estructura i la dinàmica, que determinen i expliquen les seves propietats.

Aplicacions Caracterització de molècules i barreges complexes. La RMN ha esdevingut una de les tècniques més potents per determinar l’estructura de productes naturals i sintètics. La seva sensibilitat a petites modificacions estructurals i també la capacitat de quantificar la presència de components individuals de barreges sense separar-los físicament ha fet de la RMN una eina molt important per a la caracterització de productes complexos. En alguns casos, és el procediment analític obligat per les farmacopees i la FDA, com en l’anàlisi de l’heparina sòdica. El 2008 es va detectar un increment de les reaccions aŀlèrgiques dels pacients tractats amb heparina, a causa d’una adulteració amb sulfat de condroïtina persulfatat (CSOS). Tot i que l’heparina té un elevat pes molecular i una gran heterogeneïtat, en els espectres de protó (vegeu la figura 1) és possible distingir la presència del senyal de baixa intensitat corresponent al N-acetil del CSOS a 2,17 ppm diferenciat dels acetils dels components principals (2,10-2,04 ppm). Alimentació. Cada vegada és més necessari verificar la identitat i qualitat del producte, disposar d’informació per assegurar-ne la traçabilitat i prevenir possibles fraus. La RMN reuneix els requisits necessaris per fer anàlisis d’aliments a gran escala: mínima manipulació de la mostra,

44

alta reproductibilitat, resultats qualitatius i quantitatius fàcils d’obtenir i baix cost per mostra. Un exemple és l’aplicació a l’anàlisi de vins. Els seus espectres de RMN de protó (1H) mostren una gran complexitat, però utilitzant experiments en els quals es detecten simultàniament parelles de nuclis relacionats entre si (per exemple, perquè estan enllaçats entre si), es poden identificar fins a uns quaranta compostos orgànics (aminoàcids, hidroxiàcids, àcids orgànics, sucres, polifenols, etc.). Aquests experiments s’anomenen bidimensionals o 2D, en referència al nombre de nuclis que correlacionen, i poden ser homonuclears (per exemple, 1H-1H) o heteronuclears (per exemple, 1H-13C). El 13C és un isòtop del carboni que té una abundància natural d’un 1 % —l’isòtop més abundant del carboni (12C) no és observable en RMN. Des del punt de vista pràctic, les mostres requereixen una mínima manipulació: l’addició d’una petita quantitat (10-15 %) d’aigua deuterada i d’un compost de referència. En el moment d’adquirir els espectres cal minimitzar el senyal de les molècules més abundants (aigua i etanol) per poder detectar millor els compostos minoritaris. Aquesta capacitat de no-observació selectiva d’alguns senyals és el resultat de l’aplicació del que s’anomenen seqüències de polsos i iŀlustra la versatilitat de la RMN, que permet dissenyar experiments optimitzats per a problemes específics. La figura 2 mostra els espectres de protó de diferents vins negres, en els quals ja s’observa una diferent empremta dactilar, conseqüència de la diferent evolució i procedència de cadascun. La disponibilitat de bases de dades de RMN facilitarà en el futur el tractament de les dades mitjançant l’anàlisi estadística multifactorial, per obtenir informació sobre l’anyada, composició de most, regió geogràfica, perfil del productor, influència del territori, i en últim extrem la detecció d’anomalies. Una altra alternativa és obtenir un perfil de components (anàlisi dirigida), amb identificació i quantificació del major nombre possible dels compostos orgànics presents. D’aquesta manera es poden seguir els processos de fermentació o bé determinar la presència d’additius (Spraul, 2013).

Medicina i salut. La RMN és una tècnica no invasiva. El fet d’observar la molècula no en canvia el comportament i el procés d’adquisició d’un espectre de RMN té un risc mínim per a la salut. Aquesta innocuïtat ha permès el desenvolupament de la ressonància com a eina de diagnosi mèdica. En aquest àmbit d’aplicació, a més de les imatges anatòmiques, també es poden distingir els diferents metabòlits i fins i tot seguir-ne les transformacions en temps real. Aquesta branca de la biomedicina es coneix com a metabolòmica. La identificació i quantificació dels metabòlits proporciona una valuosa informació sobre l’estat funcional dels sistemes biològics. Potencialment aquesta informació pot ser utilitzada per detectar malalties, fins i tot en un estat incipient, ja que les alteracions comporten modificacions en el sistema biològic implicat. La RMN es pot aplicar amb una mínima manipulació a mostres procedents de qualsevol tipus de fluid biològic (orina, sang, saliva, etc.). Per a la identificació dels components individuals es recorre a experiments multidimensionals i a la comparació amb bases de dades. En altres casos es comparen directament els espectres amb els de mostres de referència utilitzant mètodes estadístics sofisticats que aconsegueixen associar certes característiques espectrals amb trets mèdicament rellevants que poden ajudar els metges a diagnosticar malalties. Actualment la metabolòmica s’utilitza extensament en estudis preclínics, d’identificació de toxicitat i per a la detecció de nous biomarcadors. Així, la RMN ha estat utilitzada per identificar biomarcadors potencials en la malaltia d’Alzheimer en ratolins, per de-

Treballs de la Societat Catalana de Biologia, 66: 43-47


Espectroscòpia de ressonància magnètica nuclear (RMN)

tectar una reducció del N-acetil-L-aspartat abans que es manifestessin els símptomes clínics. La metabolòmica basada en RMN presenta també un elevat potencial de desenvolupament en l’anomenada medicina personalitzada, mitjançant la determinació dels perfils metabòlics i de la seva modificació en funció de l’evolució del pacient i del tractament amb fàrmacs (Palmnas et al., 2013). La RMN no solament es limita a l’estudi de mostres de fluids sinó que pot ser aplicada a l’estudi de teixits, mitjançant l’aplicació de l’HRMAS (high resolution magic angle spining). Aquesta tècnica es basa a fer girar les mostres a velocitats relativament altes al voltant d’un eix inclinat 54,74° (l’anomenat angle màgic) respecte a la direcció del camp magnètic. Un exemple de l’aplicació són els estudis recents destinats a trobar noves eines per predir la supervivència en càncer colorectal a través de la identificació i quantificació de trenta metabòlits (PacholczykSienicka et al., 2014).

Estudi de proteïnes. En l’estudi d’aquestes macromolècules resulta útil enriquir la mostra amb 13C i 15N, isòtops estables però amb una baixa abundància natural (aproximadament 1 % per al 13C i 0,4 % per al 15N). Per enriquir les proteïnes s’utilitzen tècniques de biologia molecular per aconseguir produir-les en bacteris, els quals es fan créixer en medis de cultiu on les seves fonts de carboni i nitrogen estan formades únicament pels isòtops pesants. Hi ha dos tipus d’espectres que ens aporten informació qualitativa sobre com són les proteïnes: l’espectre de 1H i els mapes de correlació 1H-15N (vegeu la figura 3), que mostren un senyal per a cada parella de HN. A la cadena principal d’una proteïna, cada aminoàcid té un grup HN, exceptuant les prolines. Per tant, cada pic d’un mapa de correlació 1 H-15N correspon a un residu diferent. Aquests espectres ens permeten saber si una proteïna està plegada o no, si està agregada o té tendència a agregar, ens informen sobre la seva estabilitat temporal i fins i tot poden revelar la presència de processos dinàmics. Per exemple, en una proteïna ben plegada els entorns de cadascun dels residus és molt diferent i els senyals corresponents estaran dispersos per l’espectre (vegeu les figures 3a, b). En canvi, les proteïnes desplegades mostren una dispersió molt menor, conseqüència dels entorns químics més similars en què es troben els protons (vegeu les figures 3c, d). Actualment, es requereixen concentracions de proteïna de l’ordre de 0,5 mM i volums de mostra al voltant de 0,6 ml per poder abordar un estudi estructural d’una proteïna de mida moderada per RMN (20 kDa). Com més grans són les proteïnes més difícil resulta estudiar-les per RMN. En augmentar el nombre d’àtoms els espectres són més complexos. La mida de la molècula també afecta la manera com gira sobre ella mateixa. Les molècules més grans es mouen i giren més lentament que les més petites i la RMN és sensible a aquest moviment global. Una de les conseqüències pràctiques és que els senyals de RMN de les molècules grans són més amplis i això té conseqüències en la resolució (capacitat de distingir dos senyals com a diferents quan estan un a prop de l’altre en l’espectre) i la sensibilitat (els senyals amplis són també menys intensos i costa més distingir-los del soroll de fons). L’ús d’imants cada cop més potents (fins a 23,5 T, que correspon a una freqüència de protó de 1.000 MHz), sistemes de detecció més sensibles, i seqüències de polsos que permeten obtenir senyals més estrets, han fet possible que actualment es puguin resoldre estructures de proteïnes fins a 40-50 kDa de manera relativament rutinària.

Figura 2. Espectres de 1H de tres mostres de vi negre.

Determinació de l’estructura de proteïnes. L’estudi per RMN d’una proteïna comença sempre per l’assignació de l’espectre. Això vol dir esbrinar a quin aminoàcid de la proteïna correspon cada senyal del mapa de correlació 1H-15N. El procés és més complex com més gran és la proteïna. La utilització d’altres nuclis com el 13C, a part de 1H i 15N, és essencial en les estratègies modernes d’assignació que es basen en l’ús d’espectres de correlació que impliquen els nuclis de 1H, 15N i 13C. Habitualment s’utilitzen espectres de tres dimensions (en què es correlacionen grups de tres nuclis). Aquests experiments connecten àtoms situats dins del mateix residu o en residus veïns (vegeu la figura 4a). Els carbonis carbonílic (C=O) i alfa (Cα) són els punts de connexió entre els grups amida d’aminoàcids consecutius, mentre que els carbonis beta (Cβ) ajuden a distingir les cadenes laterals dels diferents aminoàcids. Es tracta d’identificar fragments de residus consecutius i comparar-los amb la seqüència d’aminoàcids de la proteïna (que ja coneixem), fins a completar l’assignació de tots els senyals. El procés recorda la resolució d’un trencaclosques. Un cop assignades les freqüències dels diferents nuclis podem determinar l’estructura tridimensional de la proteïna, és a dir, conèixer la disposició relativa d’àtoms o regions de la proteïna allunyades en la seqüència d’aminoàcids però properes en l’espai, a causa del plegament mateix de la proteïna. Per a això utilitzem experiments de RMN que identifiquen aquells parells de protons (a través dels seus senyals assignats) que estiguin separats com a màxim una distància de 5 Å. Aquesta informació representa un conjunt de restriccions que ha de complir un model que representi correctament el plegament de la proteïna. L’estructura de la proteïna s’obté a través d’un programa de dinàmica molecular, en què s’han incorporat aquestes restriccions estructurals. La determinació estructural de proteïnes per RMN està descrita amb detall en un treball previ de treballs de la societat catalana de biologia (Contreras et al., 1998). Recentment s’ha estès la utilització de marcatges selectius per observar només alguns àtoms de la macromolècula. Això simplifica els espectres i la informació que se’n deriva de manera molt significativa. Les «sondes» més usades són els grups metil marcats amb 13C (13CH3) de les cadenes laterals dels aminoàcids leucina, isoleucina, valina i metionina. Aquests metils presenten unes propietats espectroscòpiques òptimes, solen estar ubicats en els nuclis hidrofòbics de les proteïnes o en les

Treballs de la Societat Catalana de Biologia, 66: 43-47

45


Margarida Gairí, Miguel Feliz i Miquel Pons

als extrems N-terminals dels set monòmers α de l’anell. Els espectres de correlació 1H-13C de mostres etiquetades selectivament amb 13C en els metils de metionina van demostrar la presència d’almenys dos pics per a cadascuna de les metionines d’aquesta regió. Mitjançant experiments de bescanvi es va determinar que aquests pics corresponien a dues formes, una de tancada, en la qual l’accés del substrats a l’interior del proteasoma està limitat (D), i una d’oberta, que permet aquest accés (F), vegeu la figura 4b. La interconversió entre aquests dos estats, en l’escala de temps dels segons, és el mecanisme que controla l’entrada del substrat en el proteasoma per a la degradació posterior, mentre que les poblacions relatives d’aquests dos estats sembla que determinen la velocitat de proteòlisi. La comprensió de la dinàmica d’accés al proteasoma obre la possibilitat de regular-ne la funció, per exemple amb el disseny de fàrmacs que puguin alterar la dinàmica del bescanvi entre els dos estats conformacionals majoritaris.

Figura 3. Espectres de 1H (a) i de correlació 1H-15N (b) d’una proteïna plegada (domini SH3 de la proteïna c-Src). Espectres de 1H (c) i de correlació 1 H-15N (d) d’una proteïna intrínsecament desordenada o desplegada (domini únic de la proteïna c-Src).

interfases dels complexos biomoleculars i actuen com a «espies» molt eficaços per esbrinar l’estructura i dinàmica de la proteïna.

Dinàmica de proteïnes: molècules en funcionament. La RMN és gairebé l’única tècnica que permet, de manera general, estudiar la mobilitat interna de les molècules en dissolució en una àmplia escala de temps, és a dir, seguir canvis de l’entorn dels nuclis que duren des dels nanosegons fins a les hores. En el cas de molècules biològiques, els estudis es poden fer en les condicions naturals (dissolució aquosa) i permeten estudiar l’escala de temps en la qual tenen lloc els processos vitals en què participen com la catàlisi de les reaccions bioquímiques per enzims. Fins i tot per a grans complexos moleculars, la RMN permet quantificar les fluctuacions conformacionals que acompanyen l’activitat biològica de les proteïnes i que poden ocórrer en uns pocs picosegons, micro­ segons o miŀlisegons, o bé en hores o fins i tot en dies (Mittermaier i Kay, 2009). Un nucli en una proteïna que experimenta un bescanvi entre dues conformacions diferents pot presentar un, dos o cap senyal en un espectre de RMN, en funció de la velocitat de bescanvi i de com de diferents siguin les freqüències de ressonància (per tant, l’entorn químic) d’aquest nucli en els dos estats conformacionals. A velocitats baixes de bescanvi s’observarien dos senyals, un per a cada estat. A velocitats altes s’observa un únic senyal situat a mig camí. A velocitats intermèdies els senyals s’eixamplen (fins i tot poden desaparèixer). Un exemple rellevant de l’aportació de la RMN a l’estudi del funcionament d’un complex macromolecular és el proteasoma (Sprangers et al., 2007; Religa et al., 2010). Aquesta gran màquina molecular té un paper central en l’homeòstasi ceŀlular. La partícula central del proteasoma, de 670 kDa, presenta una estructura cilíndrica —determinada per raigs X— i consta de quatre anells. Cada anell està format per set monòmers idèntics de 21 kDa de dos tipus diferents (α o β). Els anells s’apilen formant un cilindre en aquest ordre: α7β7β7α7 (vegeu la figura 4b). L’accés dels substrats al proteasoma té lloc a través dels anells α, mentre que la cambra catalítica es troba ubicada entre els dos anells β. Per RMN s’ha observat que la regió del complex que dóna accés als substrats és molt flexible. Està constituïda per un petit nombre de residus, situats

46

Proteïnes desordenades i càncer. Fins fa pocs anys només les proteïnes plegades eren objecte d’estudi en biologia estructural. Darrerament també ho són les anomenades proteïnes intrínsecament desordenades. S’ha descobert que tenen un paper clau en la regulació de processos essencials en organismes superiors. Per exemple, el 80 % de les proteïnes implicades en càncers humans tenen grans regions desordenades. La RMN és l’única tècnica amb resolució atòmica que permet l’estudi de les proteïnes desordenades. Un exemple interessant d’aplicació en aquest camp és l’estudi d’un domini de la proteïna c-Src, una cinasa involucrada en moltes rutes de senyalització ceŀlular. S’ha detectat que l’anomenat «domini únic» d’aquesta cinasa, intrínsecament desordenat, presenta unions secundàries amb els lípids de la membrana ceŀlular i és capaç de modular la unió d’altres dominis plegats de la proteïna amb la membrana, fet que representa el descobriment d’un nou mecanisme de regulació de l’activitat d’aquest enzim (Pérez et al., 2013). La capacitat oncogènica de la c-Src està lligada a defectes en la seva regulació, de manera que qualsevol avenç en la comprensió d’aquests mecanismes reguladors obre la porta a noves estratègies de lluita contra el càncer. Descobriment de fàrmacs. La formació de complexos estables entre molècules petites (fàrmacs) i proteïnes és freqüentment responsable de la seva funció com a medicaments. Els nuclis que formen part de la molècula lliure i del complex sovint ressonen a freqüències diferents i, per tant, es poden distingir per RMN. Així, a partir d’una coŀlecció de compostos («quimioteca») és possible identificar aquells que interaccionen amb la proteïna d’interès. Per a la cerca de nous fàrmacs hi ha dues grans estratègies: la cerca de molècules complexes que directament s’uneixin a la seva diana amb alta afinitat o el disseny d’aquestes molècules a partir del coneixement de la capacitat d’unió a la diana, encara que sigui amb baixa afinitat, de petits fragments. La primera estratègia requereix grans quimioteques i s’anomena, en anglès, high-throughput screening (HTS). És una alternativa poc eficient i costosa, ja que requereix l’exploració d’un nombre molt elevat de molècules. Els compostos prototip obtinguts sovint no tenen interaccions òptimes, ja que hi haurà parts de la molècula que no estan involucrades en la interacció amb el receptor. L’altra alternativa, més utilitzada actualment, s’anomena fragment based drug discovery (FBDD), i es basa en la recerca de quimioteques més reduïdes amb compostos de baix pes molecular (9-20 àtoms diferents de protó) que interaccionin dèbilment amb la diana terapèutica seleccionada. Posteriorment, sobre aquestes molècules es fan modifica-

Treballs de la Societat Catalana de Biologia, 66: 43-47


Espectroscòpia de ressonància magnètica nuclear (RMN)

Figura 4. a) Esquema de la determinació estructural de proteïnes per RMN. 1) Identificació dels espins («assignació») mitjançant experiments de correlació de tres espins (1H, 15N i 13C). Cada grup amida (1H-15N) presenta correlacions amb els carbonis del seu propi aminoàcid (color blau) i també amb els carbonis de l’aminoàcid veí (color lila). 2) Derivació de restriccions estructurals: sobretot distàncies (fletxes negres) entre protons assignats (punts negres). 3) Càlcul de l’estructura 3D amb programes de dinàmica molecular que incorporen les restriccions estructurals derivades per RMN. b) Estudi per RMN d’un complex macromolecular de 670 kDa: el proteasoma. S’usen com a sonda els grups metil (13CH3) de les tres metionines ubicades a l’extrem N-terminal de cada monòmer β (punts verds). Els mapes de correlació 1H-13C presenten almenys dos senyals per a cada metionina. Experiments de bescanvi han posat de manifest l’existència d’un bescanvi conformacional entre dos estats (D: cap a dins del proteasoma /F: cap a fora del proteasoma). La interconversió D/F, que té lloc en segons, és la responsable de la regulació de l’entrada dels substrats al proteasoma.

cions, o bé es combinen diversos fragments fins a obtenir una estructura química amb més afinitat, que es pugui utilitzar com a punt de partida en el desenvolupament de fàrmacs. Per detectar les interaccions es pot observar la proteïna o el lligand potencial. Quan s’observa la proteïna cal haver assignat prèviament el seu espectre de RMN. En aquests estudis es comparen els espectres en presència i en absència de lligand per veure si hi ha canvis i identificar els residus afectats. Amb aquest mètode es poden localitzar lligands amb un ampli rang d’afinitats amb constants de dissociació (Kd) de mM a nM. Una altra possibilitat és observar els canvis que es produeixen sobre el lligand que s’uneix a la proteïna (mobilitat, amplada dels senyals). En aquest cas la proteïna no cal que estigui marcada ni disposar prèviament d’un coneixement detallat de l’estructura; tampoc no hi ha una limitació quant a la mida. Típicament, s’observa l’espectre d’una barreja de molècules petites en presència i en absència de proteïna per tal d’identificar aquelles que s’hi uneixen. Aquests experiments inclouen un filtratge dels espectres, de manera que únicament apareixen senyals de les molècules que interaccionen. S’han desenvolupat experiments de RMN que permeten amplificar els efectes, especialment quan les interaccions són febles (Mayer i Meyer, 1999; Dalvit et al., 2000).

Els reptes Molècules més grans, mostres més petites. Les limitacions més grans de la RMN són la seva baixa sensibilitat a l’hora de mesurar els espectres i la mida màxima de les molècules que poden ser estudiades. Totes dues fronteres es van eixamplant contínuament amb els avenços de la tècnica. La baixa sensibilitat es compensa mesurant repetidament i sumant els espectres. La capacitat de distingir un senyal real del soroll de

fons augmenta amb l’arrel quadrada del nombre d’espectres acumulats. Així, si s’aconsegueix augmentar la sensibilitat un factor de 100, l’estalvi de temps és de 10.000. És a dir, un experiment que podria necessitar un any d’acumulació contínua, es podria fer en 50 min. Tècniques com l’anomenada polarització nuclear dinàmica ja permeten aquests guanys. L’altra barrera, la de la mida de les molècules, està associada principalment a la seva baixa velocitat de reorientació en dissolució, que és el medi en el qual s’adquireixen la majoria dels espectres. Actualment, la RMN de sòlids ha emergit poderosament tant en el camp de la biologia molecular com en el de la ciència dels materials. En les mostres sòlides no hi ha reorientació i s’utilitzen altres tècniques per poder observar els espectres i, per tant, la mida de les molècules, en si mateixa, no representa un límit (encara que la complexitat dels espectres continua essent una limitació). En eliminar el requisit de que les molècules estiguin dissoltes s’ha obert tot un nou món d’aplicacions: les proteïnes que formen les plaques amiloides associades a l’Alzheimer, les proteïnes de membrana que constitueixen la majoria dels punts d’actuació dels fàrmacs actuals. En el camp dels nous (i vells) materials, els grups capdavanters utilitzen la RMN per optimitzar les piles que alimentaran els cotxes elèctrics, els superconductors que permetran utilitzar l’energia cada vegada més cara de manera molt més eficient o els catalitzadors que s’utilitzen en la indústria per fer reaccions químiques més eficients i més netes. En els poc més de cinquanta anys d’història de la RMN els desenvolupaments tècnics han respost a les demandes de les aplicacions existents però han obert nous camps d’aplicació abans considerats inabastables. No sembla que aquesta tendència s’aturi. La imaginació dels investigadors encara marca les fronteres de la RMN.

Bibliografia Contreras, M. A. [et al.] (1998). «Estructura i dinàmica en pèptids i proteïnes: la visió de la ressonància magnètica nuclear». Treb. Soc. Cat. Biol., 48: 25-45. Dalvit, C. [et al.] (2000). «Identification of compounds with binding affinity to proteins via magnetization transfer from bulk water». J. Biomol. NMR, 18: 65-68. Mayer, M; Meyer, B. (1999). «Characterization of ligand binding by saturation transfer difference NMR spectroscopy». Angew. Chem. Int. Ed., 38: 1784-1788. Mittermaier, A. K. [et al.] (2009). «Observing biological dynamics at atomic resolution using NMR». Trend. Biochem. Sciences, 34 (12): 601-611 Pacholczyk-Sienicka, B. [et al.] (2014). «Prediction of survival for patients with advanced colorectal cancer using 1H high-resolution magic angle spinning NMR spectroscopy». J. Mag. Reson. Imaging (21 agost). Palmnas, M. S. A.; Vogel, H. J. (2013). «The future of NMR metabolomics in cancer

therapy: towards personalizing treatment and developing targeted drugs». Metabolites, 3: 373-396. Pérez, Y. [et al.] (2013). «Lipid binding by the Unique and SH3 domains of c-Src suggests a new regulatory mechanism”. Sci. Rep., 3: 1295. DOI: 10.1038/srep01295. Religa, T. L. [et al.] (2010). «Dynamic regulation of Archaeal proteasome gate opening as studied by TROSY NMR». Science, 328: 98-102. Sprangers, R. [et al.] (2007). «Quantitative dynamics and binding studies of the 20S proteasome by NMR». Nature, 445: 618-622. Spraul, M. (2013). «Improved NMR wine screening heralds new era of wine quality control» [en línia] <http://www.theresonance.com/2013/categories/food-quality-safety/ nmr-wine-qc>. Wüthrich, K. (1986). NMR of proteins and nucleic acids. Nova York: John Wiley & Sons.

Treballs de la Societat Catalana de Biologia, 66: 43-47

47


Tècniques d’imatge in vivo aplicades a la recerca biomèdica Immaculada Rafecas Jorba Unitat Tècnica de Protecció Radiològica, Universitat de Barcelona (UTPR-UB), CCiTUB Correspondència: Immaculada Rafecas Jorba. Unitat Tècnica de Protecció Radiològica, Universitat de Barcelona (UTPR-UB), CCiTUB. Carrer d’Adolf Florensa, 8. 08028 Barcelona. Adreça electrònica: imma.rafecas@ub.edu.

DOI: 10.2436/20.1501.02.159 ISSN (ed. impresa): 0212-3037 ISSN (ed. digital): 2013-9802 http://revistes.iec.cat/index.php/TSCB Rebut: 03/11/2014 Acceptat: 20/02/2015

Resum La possibilitat de visualitzar l’estructura i els processos que tenen lloc a l’interior dels organismes en condicions fisiològiques in vivo ha revolucionat la recerca biomèdica amb aproximacions que fins fa uns anys només es podien dur a terme in vitro. Actualment hi ha un ampli ventall de tècniques d’imatge molecular a l’abast de la recerca biomèdica que permeten el seguiment de paràmetres fisiològics, metabòlics i patològics en models d’experimentació animal. Aquestes tècniques són molt variades i inclouen la imatge mitjançant fluorescència (FLI), per ressonància magnètica (MRI) o per emissió de positrons (PET), entre d’altres. El seu caràcter no invasiu facilita la traducció directa dels estudis de laboratori a les aplicacions en humans i permet avançar en el coneixement en camps tan diversos i complexos com l’oncologia, les neurociències, la cardiologia o el desenvolupament de nous fàrmacs.

Paraules clau: imatge molecular, imatge preclínica, recerca biomèdica, imatge multimodal.

In vivo imaging techniques for biomedical research Summary The possibility of visualising the structures and processes that take place inside organisms under in vivo physiological conditions has revolutionised biomedical research studies with approaches that until recently were only possible in vitro. At present a wide range of molecular imaging techniques are available for biomedical research allowing the monitoring of physiological, metabolic and pathologic parameters in animal research models. These techniques are varied and include imaging by means of fluorescence (FLI), by magnetic resonance (MRI) or positron emission (PET), among others. Its non-invasive nature facilitates the direct translation from lab studies to applications in humans, and allows advances to be made in knowledge in areas as diverse and complex as oncology, neuroscience, cardiology or new drug development.

Keywords: molecular imaging, preclinical imaging, biomedical research, multimodality imaging.

Introducció L’estudi dels processos metabòlics o patològics que es donen en els éssers vius pot ser abordat des de diferents nivells, però la seva complexitat en els organismes superiors (humans), així com la interrelació entre diferents vies metabòliques i la seva regulació multifactorial, fan que sovint els estudis es duguin a terme en sistemes simplificats, en condicions controlades al laboratori, el que anomenem estudis in vitro. Aquest estudis in vitro poden ser duts a terme sobre cèŀlules en cultiu o més recentment sobre bioxips (Huh et al., 2011), però en molts casos es basen en l’extracció d’una mostra biològica de l’organisme (sang, teixits o cèŀlules) i, en qualsevol cas, en la quantificació posterior de metabòlits mitjançant diferents tècniques analítiques, la visualització per diferents tècniques de microscòpia o la combinació d’ambdues. En canvi, les tècniques d’imatge in vivo permeten la quantificació o visualització dels processos in situ a temps real, directament sobre els animals vius, de manera no invasiva, i amb l’animal el més intacte possible; aquestes característiques ens permeten una aproximació molt més representativa de les condicions fisiològiques reals en les quals es produeixen els fenòmens i processos bioquímics objecte d’estudi. Els subjectes emprats en recerca biomèdica són habitualment models animals, entre els quals destaquen els animals de laboratori de mida més petita: rata i ratolí. Estan disponibles en una gran varietat de soques específiques per a diferents estudis, àmpliament caracterit-

48

zades i estandarditzades, moltes productes de l’enginyeria genètica (Vandamne, 2014). Per tant, les tècniques d’imatge que tractarem a continuació s’apliquen fonamentalment en aquests models animals. Tot el que acabem de comentar implica la necessitat de visualitzar d’una manera o altra l’interior dels organismes vius, i per aquest motiu parlem de tècniques d’imatge. En aquest context, l’obtenció d’una imatge implica la detecció des de l’exterior de l’organisme, de manera directa o indirecta, de fotons de diferents longituds d’ona de l’espectre electromagnètic, aprofitant diferents fenòmens físics que es comentaran. Un avenç significatiu de les tècniques d’imatge està representat per la possibilitat d’obtenir imatges tridimensionals (imatges en 3D o tomografia), que s’acosten més a la realitat dels fenòmens i estructures que les tradicionals imatges bidimensionals (radiografia). En recerca biomèdica, igual que en el diagnòstic clínic, és important disposar d’informació sobre les característiques o canvis que produeixen variacions en la morfologia d’òrgans o teixits (hipertròfia, masses tumorals), i per tant són molt útils aquelles tècniques que proporcionen imatges purament anatòmiques. Si bé però, atès que en els processos patològics habitualment es produeixen alteracions bioquímiques i metabòliques prèvies a la manifestació morfològica, les tècniques d’imatge in vivo que ens aporten informació funcional constitueixen eines amb un potencial més gran en recerca i diagnòstic; tècniques que en conjunt coneixem com a imatge molecular.

Treballs de la Societat Catalana de Biologia, 66: 48-52


Tècniques d’imatge in vivo aplicades a la recerca biomèdica

En aquest article, doncs, farem un breu repàs per tot un ventall de tècniques d’imatge en recerca biomèdica que s’apliquen a models animals in vivo, normalment de cos sencer, i que no són invasives, de manera que permeten la realització d’estudis longitudinals en un mateix subjecte; característiques que faciliten la translació de la recerca a aplicacions en humans (imatge preclínica), allò que alguns en diuen bench to bed (Koba et al., 2011).

TC: tomografia computada La TC prové del desenvolupament de la radiografia i, igual que aquesta, ens permet l’obtenció d’imatges anatòmiques de l’interior de l’organisme mitjançant l’atenuació diferencial d’un feix de raigs X en incidir en les diferents estructures del cos (ossos-teixits tous, greix-teixit magre, aire). En TC es fa un escàner o tomografia tridimensional, que mesura el grau d’atenuació dels diferents teixits en les denominades unitats de Hounsfileld (HU) per vòxel (unitat d’imatge volumètrica). A diferència també de la radiografia, en TC el feix de raigs X és estret i en forma de ventall, i va escanejant l’organisme mentre aquest es desplaça longitudinalment per l’eix de l’equip (gantry), de manera que el tub de raig X i els detectors estan en posició diametralment oposada i giren solidàriament al voltant del gantry. Els detectors actuals són conjunts lineals de detectors que consten de cristalls centellejadors i fotodíodes, que transformen els raigs X incidents en senyal elèctric que, mitjançant el programari de tractament d’imatge, serà visualitzat i permetrà la reconstrucció d’imatges en 3D. Aquesta tècnica s’aplica tant en diagnòstic en humans com en recerca en animals, en què es coneix com a microTC o mTC, en referència explícita a la mida més petita de l’equipament específicament dissenyat per emprar en models d’animals petits. Aquest escalat constitueix un repte tecnològic important, ja que els equips per a humans no tenen prou sensibilitat o resolució per poder ser emprats en aquests models animals. La TC té aplicacions en estudis cardíacs, en oncologia per a la detecció de petites masses tumorals i, en general, en qualsevol estudi en què se cerqui una mínima diferència morfològica. És, per tant, una tècnica eminentment anatòmica amb una molt alta resolució, però amb pràcticament nuŀles aplicacions en imatge molecular per si sola, si bé quan es combina amb altres tècniques —en les anomenades tècniques d’imatge multimodal— aporta el marc anatòmic que manca a les tècniques d’imatge funcional (Fine et al., 2014). Per augmentar-ne la baixa capacitat de diferenciació entre teixits tous, s’administren agents de contrast iodats. Els darrers avenços tecnològics en aquesta tècnica inclouen el TC multitall, els helicoïdals, de feix cònic (cone beam, CBCT) o el DECT (dual energy CT), que milloren encara més la qualitat de la imatge (resolució) i en potencien la capacitat de diferenciar els teixits tous (contrast).

MRI: imatge per ressonància magnètica Basat en l’aplicació d’un camp magnètic intens (5-15 tesles), es considera un equipament complex i de cost relativament elevat. El camp magnètic i els polsos de radiofreqüència a una determinada freqüència de ressonància alteren l’espín dels nuclis dels àtoms (bàsicament de l’hidrogen de l’aigua dels teixits), de manera que les petites diferències energètiques degudes a les variacions d’espín són emeses com

Figura 1. Visió general de les tècniques d’imatge in vivo, agrupades en funció de l’origen del senyal a detectar: a) extern i b) intern a l’animal. (Malgrat que els fluorocroms són administrats com a traçador —senyal intern—, requereixen ser activats externament amb llum làser, vegeu la figura 3 i el text.)

a senyal de radiofreqüència captada per una antena de l’equip, que seran transformades en posicions espacials precises. Com a principal característica cal destacar que es tracta d’una tècnica fonamentalment anatòmica, ideal per visualitzar teixits tous com ara el cervell (Herrmann et al., 2012), però la seva relativa manca de sensibilitat fa que els temps d’adquisició d’imatge siguin llargs. Per altra banda, la manca de contrast a vegades es compensa amb l’ús d’agents de contrast, si bé aquests, en quantitats elevades, podrien ser tòxics o alterar l’homeòstasi de l’animal. Un exemple són les partícules paramagnètiques, que poden contenir galodini (Gd) o òxid de ferro (SPIO: superparamagnetic iron oxide). El desenvolupament d’aquesta tècnica ha portat a modalitats com la imatge funcional per RM (fMRI), que permet visualitzar les àrees que incrementen l’activitat cerebral en resposta a un estímul específic, i detecta els canvis produïts en la relació hemoglobina oxigenada/desoxigenada, mecanisme conegut també per BOLD (blood oxygen level-dependent mechanism). Una altra modalitat en expansió és l’espectroscòpia per RM (MRS), que permetria l’obtenció de l’espectre d’un sol vòxel d’imatge per tal d’identificar-ne la composició bioquímica.

US: ultrasons L’aplicació dels ultrasons per a l’obtenció d’imatges anatòmiques de l’interior de l’organisme ens és del tot familiar, sobretot gràcies a les ecografies gestacionals. Requereix una sonda externa que cal mantenir en contacte amb la superfície del cos mitjançant un gel. Aquesta sonda o transductor emet ones de so no detectables per l’oïda humana (entorn de 20 MHz) i que es transmeten a través dels teixits tous en funció de la seva impedància acústica, que és proporcional a la densitat dels teixits, de manera que les diferències d’impedància acústica entre teixits propers provoquen la reflexió de les ones de so (ressò), que és recollit i analitzat pel transductor mateix. Aquesta tècnica està evolucionant amb l’ús, com a agent de contrast, de bombolles de gas recobertes que no escapen del sistema vascular, i per tant tenen aplicacions en estudis intravasculars (Unnikrishnan et al., 2012). Aquestes microbombolles es poden recobrir amb molècules

Treballs de la Societat Catalana de Biologia, 66: 48-52

49


Immaculada Rafecas Jorba

gents com la SERS (surface enhanced Raman scattering), que queden fora de l’abast d’aquest document.

BLI: bioluminescència La bioluminescència (vegeu la figura 3a) es basa a incorporar el gen que codifica un enzim que activa l’emissió de llum d’una proteïna fluorescent (per exemple, el gen de la luciferasa, com la de les cuques de llum) sota el mateix control transcripcional que el gen/proteïna d’interès, i actua de gen reporter. De manera que l’expressió del gen d’interès serà proporcional a l’expressió del gen de la luciferasa, que visualitzem in vivo captant la intensitat de llum produïda i la seva distribució en l’organisme. Per tal d’incorporar un d’aquests gens cal obtenir cèŀlules o ratolins transgènics, i posteriorment administrar-los el substrat (luciferina). Aquesta tècnica presenta una alta sensibilitat en la detecció de tumors en no haver-hi senyal de fons en els teixits que no expressen el gen. També s’ha aplicat aquesta tècnica en l’estudi de malalties infeccioses, i en teràpia ceŀlular per al seguiment de la distribució i capacitat d’implantació de les cèŀlules subministrades (Paley et al., 2014).

FLI: fluorescència Figura 2. Diferents tipus de sondes o traçadors aplicats en tècniques d’imatge in vivo.

d’adhesió per a estudis d’inflamació i per a seguiment de biomarcadors de l’endoteli vascular; o amb anticossos monoclonals per a estudis d’angiogènesi (neovascularització de masses tumorals), o l’estudi de zones danyades per episodis d’isquèmia-reperfussió i trombus. Una variant és la imatge fotoacústica, en la qual s’ha substituït la font emissora d’ones de so per un làser polsat, que en interaccionar amb els teixits biològics genera una expansió termoelàstica transitòria i aquesta els ultrasons, que seran detectats.

Tècniques òptiques Sota aquesta denominació s’inclouen diferents tècniques que tenen en comú l’obtenció d’imatges a partir de la captació d’un senyal lluminós, és a dir, fotons de llum de diferents longituds d’ona fins al VIS/UV, però no ionitzants, sobretot en la banda de l’infraroig proper (NIR). Això permet que el sistema de detecció sigui relativament simple: una càmera CCD (charge-coupled device), el mateix sistema que incorporen la majoria de càmeres fotogràfiques digitals domèstiques, fet que confereix a aquestes tècniques l’atractiu que l’equipament necessari té un cost relativament baix. La principal limitació de les tècniques òptiques està determinada per la baixa capacitat de penetració en la matèria d’aquests fotons, a causa de la dispersió i absorció de la llum en els teixits, que limita la profunditat d’observació dels fenòmens a uns pocs centímetres. Per tant, solen ser útils per estudiar lesions superficials o aplicables a animals molt petits, generalment animals transgènics tipus nude (rata/ratolí atímics desproveïts de pèl). Dins les tècniques òptiques podem distingir diferents modalitats, com per exemple les basades en la bioluminescència, la fluorescència i el Cerenkov; però si no es requereix una informació de tot l’organisme, sinó una imatge funcional més localitzada i a escala subceŀlular, hi podem incloure la IVM (intravital microscopy) i altres tècniques emer-

50

En les tècniques amb marcadors fluorescents, en canvi (vegeu la figura 3b), introduïm o bé molècules marcades amb molècules fluorescents (fluorocroms com el pèptid Cy5.5), proteïnes fluorescents o bé quantum dots (nanopartícules de materials semiconductors amb propietats fluorescents), que un cop es distribueixen en l’organisme s’activen mitjançant un làser extern, i emeten fotons fluorescents que seran detectats externament. Actualment els fluorocroms es combinen amb altres molècules, com per exemple anticossos o els seus derivats nanobodies (Chakravarty et al., 2014) per conferir-los especificitat. També poden formar part de les anomenades smart probes, en què el fluoròfor es troba unit a un agent blocador mitjançant un pèptid, de manera que en les cèŀlules que no expressen la proteasa específica d’aquest pèptid d’unió no hi ha emissió de fluorescència, mentre que en presència de la proteasa s’indueix l’emissió fluorescent. Algunes d’aquestes sondes activables estan disponibles comercialment, com per exemple sondes específiques per quantificar l’activitat de l’enzim caspasa-1, directament relacionada amb l’apoptosi de cèŀlules tumorals; llavors aquestes sondes poden presentar múltiples fluoròfors units a un esquelet d’aminoàcid mitjançant un pèptid que pot ser tallat per l’enzim caspasa-1 (Hellebust et al., 2012).

CLI: Cerenkov La radiació Vavilov-Cerenkov és un tipus de radiació (llum) que emeten les partícules subatòmiques carregades en travessar un medi amb una velocitat més gran que la velocitat de la llum en aquell medi. Aquest fenomen es produeix, per exemple, amb les partícules carregades emeses per radionúclids com el 32P, el 124I i altres radionúclids emissors de positrons, dels quals parlarem més endavant (vegeu l’apartat sobre el PET). Per tant, de fet, aquesta tècnica d’imatge es basa en la captació externa de la llum provocada per marcadors radioactius introduïts a l’organisme, però no de la detecció directa de les seves emissions radioactives. Malgrat que la radiació Cerenkov va ser descrita per aquest físic el 1934, l’aplicació en tècniques d’imatge molecular és recent, i es tracta, doncs, d’una tècnica emergent, en fase de desenvolupament (James et al., 2012). El principal avantatge d’aquesta tècnica estaria en la simplici-

Treballs de la Societat Catalana de Biologia, 48-52


Tècniques d’imatge in vivo aplicades a la recerca biomèdica

tat i menor cost econòmic dels seus sistemes de detecció (CCD), aprofitant radiotraçadors existents.

SPECT: single photon emission computed tomography La tècnica SPECT, juntament amb la PET, són tècniques que permeten obtenir imatges funcionals basant-se en la detecció de les radiacions ionitzants emeses per molècules marcades amb isòtops radioactius (radiotraçadors o radiofàrmacs). El principal avantatge respecte de les tècniques òptiques es troba en el fet que les radiacions ionitzants són més penetrants en la matèria i per tant no tenen les limitacions quant a la profunditat dels òrgans o teixits a interrogar, i és habitual usar-les en estudis de cos complet. Així doncs, aquestes tècniques permeten estudis ràpids, in vivo, a temps real i de cos sencer, de manera no destructiva (permet estudis longitudinals en un mateix animal) i no invasiva (en condicions fisiològiques); i a més de manera quantitativa, en què mesura la concentració i el desplaçament del radiotraçador. La denominació d’ambdues tècniques porta el mot tomografia, que és sinònim d’imatges en 3D, i són homònimes de les que s’utilitzen en la pràctica clínica en humans en medicina nuclear. En tractar-se, doncs, de tècniques clàssiques en el diagnòstic per a la imatge en humans, se’n veu facilitada la traducció dels estudis en models animals a l’home, és a dir, fan de pont i permeten fer el salt dels models animals a l’aplicació clínica o preclínica en humans (Koba et al., 2013). En concret l’SPECT es basa en l’ús de radioisòtops emissors de fotons γ que tenen un període de semidesintegració curt (T½), de l’ordre d’hores, és a dir, que l’activitat radioactiva desapareix per decaïment radioactiu de manera relativament ràpida, cosa que limita els nivells de dosi de radiació rebuda pel subjecte estudiat. El radionúclid més usat en SPECT és el 99mTc, que té com a principals característiques un T½ de 6 h i l’emissió de fotons d’una energia de 140 keV. Addicionalment el 99mTc té la particularitat que es pot obtenir en els anomenats generadors de 99Mo/99mTc. En síntesi, aquests generadors consisteixen en un contenidor autoblindat (de sobretaula) a l’interior del qual s’hi ha disposat una columna d’alúmina amb 99Mo adsorbit (anomenat radionúclid pare, obtingut en reactors nuclears), que va decaient en 99mTc (radionúclid fill). Aquest darrer pot ser eluït de la columna amb Figura 3. Bases de les principals tècniques òptiques: a) bioluminescència i b) fluorescència. Malgrat que tenen en comú la captació final de llum mitjançant sistemes de detecció equivalents (CCD), l’origen d’aquest senyal és diferent: a) activació enzimàtica de la luciferina (administrada) pel gen reportador luciferasa i b) activació mitjançant un làser extern dels fluorocroms administrats.

solució salina estèril en forma de pertecnetat per usar-lo en el marcatge dels radiofàrmacs; de manera que es poden fer elucions successives (per exemple, una cada dia) i garantir el subministrament continuat al laboratori de marcatge durant un cert període sense una dependència diària del subministrament directe des del centre de producció. Es disposa comercialment de força radiofàrmacs d’ús habitual en SPECT, per a aplicacions tan variades com: gammagrafia òssia, estudis d’Alzheimer, tiroide o isquèmia en miocardi. Per a estudis d’infecció/inflamació complexos es fa ús d’una tècnica consistent en l’obtenció dels leucòcits del subjecte, que es marquen amb 99mTc i es tornen a administrar a l’individu per localitzar-ne el focus d’infecció.

PET: positron emission tomography Podem dir que la PET (tomografia per emissió de positrons) és actualment la tècnica d’imatge molecular per exceŀlència. Els radionúclids emprats en PET es caracteritzen per tenir un T½ molt curt, la majoria de l’ordre de minuts. Així actualment el radionúclid més habitual és el 18 F, amb un T½ de 110 min; però també el 11C (20 min), 13N (10 min), 15O (2 min ), i més recentment 68Ga (271 dies) i 89Zr (78 h). Aquesta característica (la rapidesa del seu decaïment) té dues implicacions pràctiques importants. D’una banda la desaparició ràpida de la seva activitat radioactiva un cop administrat minimitza la dosi de radiació impartida al subjecte, però de l’altra dificulta la disponibilitat contínua del radiofàrmac amb una activitat suficientment elevada per ser administrada. De fet, aquests radionúclids normalment es produeixen en ciclotrons, equips acceleradors de partícules (protons) que transformen àtoms estables en radioactius. El pas següent (comú als radionúclids per SPECT) és la síntesi del radiotraçador, és a dir, incorporar químicament l’àtom radioactiu a la molècula d’interès. Tot això comporta que els temps d’obtenció/distribució/utilització del radiofàrmac hagin de ser curts i acuradament calculats. Aquesta tècnica es caracteritza per una bona resolució (de l’ordre de mm), però el seu punt fort és la seva alta sensibilitat. D’altra banda, els equips més actuals fins i tot poden disposar del programari de tractament d’imatge conegut com a sistema DICOM, que és l’estàndard habitual per a imatges mèdiques. El radiofàrmac més utilitzat és la 18F-FDG (desoxiglucosa de fluor), anàleg no metabolitzable de la glucosa que és transportat dins les cèŀlules i fosforilat per l’hexocinasa, però hi queda atrapat, ja que la forma fosforilada no es transporta. Aquesta característica fa que s’acumuli en teixits amb una alta demanda metabòlica, com són la majoria de tumors malignes, fet que permet diferenciar-los dels benignes. Per contra, algunes malalties neurodegeneratives com l’Alzheimer es caracteritzen per àrees concretes del cervell amb baixa activitat glucolítica, fet que permet diagnosticar-ne la malaltia i l’evolució. En cardiologia també s’aplica en estudis de reperfusió/viabilitat postinfart, així com en l’estudi de la vulnerabilitat de les plaques d’ateroma a trencar-se i provocar trombus, ja que la 18F-FDG és incorporada pels macròfags que formen part de les plaques. L’acumulació diferencial de 18F-FDG també permet l’estudi de les àrees del cervell recuperables de la penombra isquèmica postíctica. Altres radiofàrmacs PET marcats amb 18F són el 18F-NaF per al seguiment de metàstasis òssies; el 18F-FLT (fluorotimidina) per al seguiment de la proliferació ceŀlular tumoral, o complexos com el 18F-MISO, que queda atrapat dins les cèŀlules tumorals que presenten hipòxia (fenomen observat en els tumors més resistents i agressius). I d’altres més específics, com 18F-DOPA (dopamina) per a estudis de neurotrans-

Treballs de la Societat Catalana de Biologia, 66: 48-52

51


Immaculada Rafecas Jorba

missors en la malaltia de Parkinson; per exemple, 18F-FHBG, un substrat de la tirosina-cinasa del HSV1 i, per tant, emprat en tècniques de reportador de gen (Yaghoubi et al., 2012); 18F-estradiol, com a marcador de receptors estrogènics (ER) en càncers de mama; o el pèptid 18F-galacto-RGD (Arg-Gly-Asp), que té una alta especificitat per la integrina αvβ3, un receptor implicat en diferents processos patològics que inclouen l’angiogènesi (neovascularització) i la metàstasi tumoral. Malgrat la prevalença del 18F com a principal radionúclid en PET, hi ha altres radionúclids emissors de positrons emprats en PET com el 11C, que marca, per exemple, l’aminoàcid metionina o el fosfolípid colina per a estudis de tumors cerebrals (gliomes). En altres casos, però, com en l’estudi de tumors neuroendocrins, resulta útil la quantificació de la sobreexpressió dels receptors de la somatostina, en què s’utilitzen anàlegs marcats amb radionúclids mitjançant lligands com el denominat DOTA (agent quelant), en què el radionúclid pot ser el 111In, 90Y o més habitualment el 68Ga. Aquest darrer presenta l’avantatge que pot ser subministrat en generadors de 68Ge/68Ga.

Estat actual i perspectives Aquesta miríade de tècniques d’imatge in vivo s’ha de veure amb una certa perspectiva, en el sentit que cadascuna presenta les seves característiques i limitacions, sobretot des del punt de vista de la seva sensibilitat i de la seva resolució, que sempre van en sentits oposats. De manera que la tendència general és que les tècniques amb més resolució espacial són bàsicament tècniques que ens proporcionen imatges anatòmiques (CT i MRI), mentre que les tècniques que ens aporten imatges realment funcionals, imatges moleculars, són tècniques amb més sensibilitat (PET o SPECT) però amb una pobra referència anatòmica. La solució a aquest dilema ha vingut de la mà de l’anomenada mutimodalitat, és a dir, de la fusió d’ambdós tipus de tècniques en equips híbrids. Per exemple, PET/CT, PET/MRI o CT/imatge òptica. Ara ja hi ha equips trimodals (PET/SPECT/CT). Un pas més endavant, que confereix flexibilitat a les tècniques d’imatge in vivo, és la multiplexació (multiplexing), és a dir, la capacitat de visualitzar simultàniament múltiples dianes relacionades amb un

determinat procés metabòlic, fisiològic o patològic. En aquest sentit actualment les tècniques PET no ho permeten, ja que tots els isòtops emissors de positrons emeten els mateixos raigs γ de 511 keV; mentre que les tècniques SPECT sí que admeten certa multiplexació, atès que diferents radionúclids emeten raigs γ de diferent energia i això, en teoria, permet distingir-los encara que es detectin simultàniament. Però les tècniques més proclius a la multiplexació són sens dubte les tècniques òptiques, que permeten l’ús simultani de diferents fluorocroms, proteïnes fluorescents o diverses nanopartícules, que emetin a longituds d’ona diferenciables. Ateses les dificultats, el temps i els recursos que cal invertir per tal d’obtenir i validar nous agents d’imatge específics, una altra tendència va en el sentit d’aconseguir suports d’agents d’imatge el més generalitzables possible, i que siguin fàcilment modificables a posteriori. És el cas del premarcatge, basat a administrar primer un anticòs específic (per exemple, d’un antigen tumoral que premarcarà el tumor) modificat amb un grup funcional (per exemple, TCO, transciclooctè) i posteriorment administrar un lligand marcat que reaccioni amb aquest grup funcional (per exemple, una tretrazina unida a un grup quelant i un metall radioactiu com 68Cu), de manera que ambdós (anticòs i lligand marcat) s’uniran in vivo mitjançant una reacció bioortogonal, basada en l’anomenada química click (Zeglis et al., 2013). Aquesta estratègia permetria disposar d’una banda d’agents d’imatge marcats que serien genèrics per a PET, per exemple, mentre que d’altra banda l’anticòs podria anar variant específicament segons l’antigen d’interès (biomarcadors específics de diferents tumors o d’altres dianes). En conclusió, hem vist que les tècniques d’imatge in vivo aplicades a la recerca biomèdica en animals petits ofereixen oportunitats úniques per a l’estudi del metabolisme en models animals de malalties que afecten l’home. Moltes d’aquestes tècniques permeten la traducció en aplicacions, no solament al diagnòstic clínic dels pacients, sinó al descobriment de noves dianes terapèutiques, fan viable les tècniques amb doble finalitat de diagnòstic i teràpia (teranòstic), i obren camí cap a la medicina personalitzada del futur.

Bibliografia Chakravarty, R. [et al.] (2014). «Nanobody: the “magic bullet” for molecular imaging?». Theranostics, 4: 386-398. Fine, E. [et al.] (2014). «Small-animal research imaging devices». Semin. Nucl. Med., 44: 57-65. Hellebust, A.; Richards-Kortum, R. (2012). «Advances in molecular imaging: targeted optical contrast agents for cancer diagnostics». Nanomedicine (Lond.), 7: 429445. Herrmann, K. H. [et al.] (2012). «Possibilities and limitations for high resolution small animal MRI on a clinical whole-body 3T scanner». Magn. Reson. Mater. Phy., 25: 233-244. Huh, D. [et al.] (2011). «From 3D cell culture to organs-on-chips». Trends in Cell Biology, 21: 745-754. James, M. L.; Gambhir, S. S. (2012). «A molecular imaging primer: Modalities, imaging agents, and applications». Physiol. Rev., 92: 897-965. Koba, W. [et al.] (2011). «Imaging devices for use in small animals». Semin. Nucl. Med., 41: 151-165.

52

— (2013). «MicroPET/SPECT/CT imaging of small animal models of disease». Am. J. Pathol., 182: 319-324. Paley. M. A.; Prescher, J. A. (2014). «Bioluminescence: a versatile technique for imaging cellular and molecular features». Med. Chem. Commun., 5: 255-267. Unnikrishnan, S.; Klibanov, A. L. (2012). «Microbubbles as ultrasound contrast agents for molecular imaging: Preparation and application». Am. J. Roentgenology, 199: 292-299. Vandamme, T. F. (2014). «Use of rodents as models of human diseases». J. Pharm. Bioall. Sci., 6: 2-9. Yaghoubi, S. S. [et al.] (2012). «Positron emission tomography reporter genes and reporter probes: gene and cell therapy applications». Theranostics, 2: 374-391. Zeglis, B. M. [et al.] (2013) «A pretargeted PET imaging strategy based on bioorthogonal diels-alder click chemistry». J. Nucl. Med., 54: 1389-1396.

Treballs de la Societat Catalana de Biologia, 48-52


Tècniques de diagnòstic molecular aplicades a l’estudi del càncer Sergio Alonso,1 Andreu Alibés1 i Manuel Perucho1,2 1 2

Institut de Medicina Predictiva i Personalitzada del Càncer Institució Catalana de Recerca i Estudis Avançats (ICREA)

DOI: 10.2436/20.1501.02.160 ISSN (ed. impresa): 0212-3037

Correspondència: Manuel Perucho. Institut de Medicina Predictiva i Personalitzada del Càncer (IMPPC). Carretera de Can Ruti, camí de les Escoles, s/n. 08916 Badalona. Adreça electrònica: mperucho@imppc.org.

ISSN (ed. digital): 2013-9802 http://revistes.iec.cat/index.php/TSCB Rebut: 03/11/2014 Acceptat: 20/02/2015

Resum

Molecular diagnostic techniques in cancer

La transformació neoplàsica succeeix per l’acumulació consecutiva d’alteracions genètiques i epigenètiques que confereixen a les cèŀlules on ocorren avantatges selectius sobre les seves germanes, cosa que condueix al tumor per selecció clonal i evolució. Aquest treball pretén facilitar una visió general de diverses tècniques de diagnòstic d’alteracions genètiques i epigenètiques comunament utilitzades en l’estudi molecular dels càncers humans en l’àmbit de la investigació bàsica, algunes de les quals s’estan aplicant actualment o estan properes a implementar-se en l’entorn clínic. Entre les tècniques de detecció d’alteracions genètiques descriurem aquelles que identifiquen alteracions cromosòmiques i mutacions puntuals. I entre els mètodes de detecció d’alteracions epigenètiques descriurem aquells dedicats als canvis somàtics de metilació en el DNA.

Summary

Paraules clau: càncer, diagnòstic molecular, mutació, tècnica, seqüenciació.

Neoplastic transformation is caused by the consecutive accumulation of genetic and epigenetic alterations providing selective growth advan­ tages to cancer cells, ultimately leading to tumor development by clonal selection and evolution. This study aims to provide an overview of several epigenetic and genetic alteration diagnostic techniques commonly used in basic research in the molecular study of human cancers, some of which are currently implemented or are close to implementation in the clinical setting. Among the techniques for detecting genetic alterations we describe those that identify chromosomic alterations and point mutations. Among the methods of detecting epigenetic alterations we describe those that deal with somatic changes in DNA methylation.

Keywords: cancer, molecular diagnostics, mutation, techniques, se-

quencing.

Introducció. Alteracions somàtiques en càncer

Alteracions cromosòmiques

El càncer comprèn un conjunt molt divers de malalties caracteritzades pel creixement anormal i incontrolat de les cèŀlules d’un determinat teixit, que arriba en última instància a envair i colonitzar altres teixits i òrgans. La transformació d’una cèŀlula normal en una cèŀlula cancerosa (carcinogènesi) és un procés seqüencial d’acumulació d’alteracions genètiques i epigenètiques que confereix a les cèŀlules canceroses la capacitat de divisió ceŀlular sense restriccions mitjançant l’activació contínua dels senyals de divisió, la pèrdua de resposta als senyals d’arrest del cicle ceŀlular i l’evasió dels mecanismes de control que, en circumstàncies normals, condueixen a la mort ceŀlular programada (apoptosi). Algunes mutacions afavoreixen que les cèŀlules canceroses siguin capaces d’induir la formació de nous vasos sanguinis que aporten nutrients al tumor (angiogènesi) i d’envair els teixits circumdants i colonitzar altres òrgans (Hanahan et al., 2000, 2011). Les alteracions en el DNA poden produir-se per l’acció d’agents externs (carcinògens) o interns, per la inestabilitat intrínseca del genoma, o durant la replicació ceŀlular que, malgrat els complexos mecanismes de reparació del DNA, és inherentment mutagènica. Fins i tot procedint d’un mateix teixit, els càncers presenten una enorme variabilitat molecular que en reflecteix la complexa etiologia i és determinant en el pronòstic i la resposta al tractament. En les últimes dècades, s’han fet importants esforços per catalogar els tumors ja no solament pel teixit d’origen i les seves característiques clinicopatològiques, que han estat els criteris clàssics durant molts anys, sinó aplicant els més recents descobriments i tecnologies per fer una classificació molecular.

Les primeres observacions de l’existència d’un nombre anòmal de cromosomes (aneuploïdia) en cèŀlules tumorals es remunten a principis del segle passat. Arran d’aquestes observacions, l’aneuploïdia es va postular com una de les principals causes de la transformació ceŀlular fins al descobriment en els anys setanta i vuitanta dels primers oncogens i supressors tumorals (revisat per Holland et al., 2009). Avui dia, però, no hi ha un consens definitiu sobre si l’aneuploïdia és un factor que contribueix d’una manera fonamental a la carcinogènesi o és merament un efecte secundari conseqüència de la pèrdua de control durant la mitosi (Li et al., 2000; Pellman, 2007). Posteriorment, mitjançant tècniques citogenètiques amb més resolució es va descobrir que, a més d’aneuploïdia, el genoma de les cèŀlules tumorals pateix reorganitzacions cromosòmiques més complexes, incloent-hi duplicacions, delecions, inversions i translocacions. Totes aquestes alteracions són de gran importància perquè poden alterar els nivells normals d’expressió gènica (Beroukhim et al., 2010). Com a exemples paradigmàtics es troben l’oncogèn MYC, localitzat en el cromosoma 8q i freqüentment amplificat en els càncers de pulmó, colorectals, gàstrics, de mama i d’úter, el supressor tumoral APC, localitzat en una regió del cromosoma 5q freqüentment delecionada en tumors colorectals (Bodmer et al., 1989), o les freqüents translocacions que ocorren en la majoria de les leucèmies, i que tenen utilitat prognòstica i de resposta al tractament (Mitelman et al., 1990; Braekeleer et al., 2014). Per això, la detecció d’alteracions que afecten el nombre i l’estructura dels cromosomes és fonamental en els estudis de diagnòstic i classificació molecular del càncer.

Treballs de la Societat Catalana de Biologia, 66: 53-61

53


Sergio Alonso, Andreu Alibés i Manuel Perucho

fingerprints obtinguts dels tumors i les mostres normals permetien la detecció de guanys i pèrdues en el nombre de còpies (Peinado et al., 1992). Aquestes tècniques van ser molt utilitzades en l’estudi d’alteracions en el nombre de còpies en diversos tipus de càncer (revisat per Samuelsson et al., 2010). L’AP-PCR va ser, a més, crucial en el descobriment del fenotip mutador de microsatèŀlits en posar de manifest l’altíssima freqüència de microdelecions en seqüències repetides en un subgrup de càncers colorectals (Ionov et al., 1993).

Figura 1. Esquerra: anàlisi del nombre de còpies en el cromosoma 8 en un cas de càncer colorectal de la nostra coŀlecció mitjançant aCGH. Cada creu representa una sonda. L’escala indica el nombre de còpies en el tumor respecte a la mostra normal, en escala logarítmica en base 2. Així, el 0 indica no-alteració, l’1 la duplicació del nombre de còpies (4n), i el –1 la pèrdua d’un aŀlel. En vermell, les sondes amb valors més petits que 0, i en blau aquelles amb valors superiors a 0. Cal notar que la pèrdua del 8p no arriba, de mitjana, a un valor de –1, cosa que indica la presència de cèŀlules sense l’alteració (molt probablement cèŀlules no tumorals). En aquest cas, la interpretació és la pèrdua del braç cromosòmic 8p i guany de 8q en la mostra tumoral. Dreta: resultats representatius de l’anàlisi d’alteracions en el nombre de còpies utilitzant xips SNP (figura obtinguda de http://cancer. sanger.ac.uk/). Al panell superior es mostren el nombre de còpies (sondes en gris, i el valor mitjà en línia blau fosc) i la freqüència mitjana dels aŀlels menors (en blau clar), que s’obté de l’anàlisi de la freqüència aŀlèlica (panell inferior). Així, l’absència d’heterozigosi en cap dels locus al llarg d’una regió (línies vermelles en el panell inferior) indica la pèrdua d’un aŀlel, que en alguns casos pot anar acompanyada de la duplicació de l’altre aŀlel i generar un copy neutral LOH (fletxes taronges) indetectable mitjançant aCGH.

Durant molts anys, les detecció d’anomalies cromosòmiques es va fer mitjançant tècniques citogenètiques clàssiques, com per exemple tincions cromosòmiques i observació mitjançant microscòpia. Més endavant, la hibridació in situ amb fluorescència (FISH) va millorar la resolució per detectar anomalies complexes (Langer-Safer et al., 1982) i va establir les bases per al desenvolupament de la hibridació genòmica comparativa (CGH), en la qual dues mostres es marquen amb diferents fluoròfors i s’hibriden sobre preparacions de cèŀlules en metafase, cosa que permet identificar variacions en el nombre de còpies entre les dues mostres (Kallioniemi et al., 1992). La tècnica CGH es va adaptar posteriorment a plataformes de microxips (aCGH), cosa que evita les laborioses preparacions metafàsiques i facilita l’automatització del procés (Lucito et al., 2003). Les plataformes aCGH, i més recentment els xips de SNP, són les tecnologies més habituals per a l’anàlisi d’alteracions en el nombre de còpies cromosòmiques. D’altra banda, poc després de la invenció de la tècnica de reacció en cadena de la polimerasa (PCR) (Mullis et al., 1986), es van publicar dos mètodes, AP-PCR i RAPDS (Welsh et al., 1990; Williams et al., 1990), que mitjançant l’amplificació de seqüències aleatòries generaven «empremtes» genètiques o fingerprints característiques de cada individu, població o espècie, per la qual cosa van ser molt populars en estudis filogenètics. A més, la comparació de la intensitat de les bandes dels

54

aCGH. Els xips de CGH es basen en el mateix principi que la tècnica CGH: la comparació de la intensitat relativa entre dos genomes marcats independentment amb diferents fluoròfors (Kallioniemi, et al., 1992). La diferència és que en comptes de fer la hibridació sobre preparacions de cèŀlules en metafase es fa sobre un xip que conté sondes clonades en vectors o oligonucleòtids sintètics. Després de la hibridació, els xips s’escanegen amb càmeres de molt alta resolució i la proporció relativa de la intensitat de senyal d’emissió de cada fluròfor en cada sonda del xip permet determinar diferències entre les dues mostres en el nombre de còpies en aquest locus (vegeu la figura 1). Les plataformes d’aCGH han assolit resolucions del voltant d’un milió de sondes, cosa que representa una mitjana d’una sonda per cada 2 kb del genoma. Els aCGH que s’utilitzen avui dia als laboratoris clínics permeten la detecció d’alteracions d’unes poques desenes de quilobases (Miller et al., 2010). També es poden utilitzar custom-arrays, que interroguen només una fracció del genoma però a molta més resolució, i permeten detectar alteracions més petites, com les que afecten un sol exó (Boone et al., 2010). La robustesa, relativa senzillesa, l’automatització del procés i preu contingut d’aquesta tecnologia, així com la profusió d’eines d’anàlisi tant comercials com de lliure accés (Lin et al., 2009), ha afavorit que l’aCGH sigui avui dia una de les eines habituals en l’àmbit clínic per al diagnòstic, classificació i pronòstic en diferents tipus de càncer (Shinawi et al., 2008). Xips SNP. Encara que inicialment dissenyats per a la identificació de polimorfismes (single nucleotide polymorphisms, SNP), els xips SNP permeten a més detectar alteracions en el nombre de còpies. En generar informació sobre el nombre de còpies de cada aŀlel en heterozigosi, els xips SNP permeten detectar un fenomen indetectable per als aCGH: la pèrdua d’heterozigositat (loss of heterozygosity, LOH) que no afecta el nombre total de còpies cromosòmiques (copy neutral LOH, vegeu la figura 1) (Leeuw et al., 2011). Aquest fenomen, freqüent en càncers sanguinis, es produeix quan la pèrdua d’una regió genòmica en un aŀlel es compensa per la duplicació de l’aŀlel complementari (Langdon et al., 2006), i exposa el fenotip de les variants germinals i mutacions somàtiques amplificades encara que aquestes siguin recessives. Les alteracions copy neutral LOH també poden ser detectades mitjançant tècniques més senzilles, com PCR múltiplex de seqüències microsatèŀlit, seguides d’una anàlisi informàtica específica (Garcia-Linares et al., 2012). Malgrat l’avantatge que suposa la seva capacitat per detectar copy neutral LOH, els xips SNP no són tan efectius com els aCGH per detectar alte-

Treballs de la Societat Catalana de Biologia, 66: 53-61


Tècniques de diagnòstic molecular aplicades a l’estudi del càncer

racions que afecten regions petites del genoma. No obstant això, aquesta limitació es veu compensada pel fet que aquests xips donen informació sobre el nombre de còpies i simultàniament el genotip del pacient, cosa que permet explorar possibles factors de risc (Boyd et al., 2009). Una opció nova i eficaç per combinar les dues aproximacions són els xips mixtos aCGH-SNP, alguns dels quals estan comercialitzats però encara pendents de l’aprovació en diagnosi clínica (Wiszniewska et al., 2014).

Mutacions puntuals A més d’alteracions cromosòmiques, el genoma de les cèŀlules canceroses presenta un alt nombre de mutacions puntuals, cadascuna de les quals afecta un o uns pocs nucleòtids. La freqüència mutacional varia dramàticament entre diferents tipus de càncer (Lawrence et al., 2013). Els càncers primordialment infantils, com els tumors rabdoides renals i els sarcomes d’Ewing, tenen una freqüència mutacional molt baixa, generalment inferior a una mutació somàtica per megabase, mentre que els càncers adults en teixits exposats als efectes deleteris dels carcinògens, per exemple els melanomes o els càncers de pulmó, en molts casos superen les cent mutacions per megabase. Totes les cèŀlules de l’organisme acumulen mutacions amb una taxa que depèn de la seva freqüència replicativa, de l’eficàcia dels mecanismes de reparació del DNA en aquest tipus ceŀlular, i de l’exposició a agents carcinògens. En els càncers de l’edat adulta, la majoria de les mutacions reflecteixen l’acumulació de dany genètic patit per les cèŀlules mare prèviament a l’expansió clonal i no contribueixen necessàriament a la carcinogènesi. La raó per la qual les mutacions anteriors a la carcinogènesi es detecten fàcilment en un tumor i no en el teixit circumdant és la clonalitat de les cèŀlules tumorals (originàries d’una única cèŀlula) (Nowell, 1976). En el teixit normal, però, les mutacions es troben diluïdes a causa de l’heterogeneïtat intratissular, ja que moltes cèŀlules mare (amb diferents espectres mutacionals) contribueixen a la població ceŀlular de cada teixit. Els gens mutats poden veure alterada la seva funció, regulació o els seus nivells d’expressió. Tradicionalment, els gens associats al càncer s’han catalogat en oncogens —aquells en què l’activació o sobreexpressió afavoreix la carcinogènesi— i en gens supressors tumorals, que inhibeixen la tumorigènesi. Mentre que l’activació d’un oncogèn freqüentment requereix només un esdeveniment mutacional (activació monoaŀlèlica), els supressors tumorals, com a norma general, requereixen una inactivació biaŀlèlica perquè la seva funció sigui completament anuŀlada (Knudson, 1971). El perfil mutacional dels tumors permet, en certs càncers, determinar el pronòstic i resposta al tractament (Ince et al., 2002; Arteaga, 2006; Hendifar et al., 2014), i en conseqüència s’utilitzen cada vegada més habitualment com a biomarcadors en la classificació diagnòstica dels tumors. Molts dels mètodes actuals per a la detecció de mutacions puntuals es basen en l’amplificació mitjançant PCR de la seqüència estudiada. Revisions anteriors van resumir aquests mètodes de detecció pre- i immediatament post-PCR (Winter et al., 1985; Almoguera et al., 1989; Perucho, 1994). Fa uns anys, quan la seqüenciació era encara costosa, era freqüent analitzar mutacions mitjançant la digestió del producte de PCR amb enzims de restricció (restriction fragment length polymorphism, o RFLP). Si la mutació o mutacions afecten algun lloc de

restricció, es generen fragments de diferent longitud que es poden resoldre mitjançant electroforesi. No obstant això, amb la proliferació i l’abaratiment dels aparells i reactius per a la seqüenciació de DNA, els termocicladors equipats amb detecció de fluorescència en temps real (real time PCR) i, més recentment, les plataformes per a seqüenciació massiva en paraŀlel, la majoria dels investigadors i laboratoris clínics opten per algun d’aquests mètodes per detectar mutacions en les mostres tumorals.

Seqüenciació Sanger. El mètode desenvolupat per F. Sanger, S. Nicklen i A. R. Coulson per seqüenciar DNA mitjançant la incorporació de didesoxinucleòtids terminadors de cadena (Sanger et al., 1977) va suposar una revolució en la biologia molecular. Aquest mètode ha estat el més utilitzat durant més de vint anys, i encara avui s’utilitza de manera rutinària per a la validació de mutacions identificades amb altres mètodes. La modificació d’aquest mètode substituint el marcatge radiactiu per molècules fluorescents (Smith et al., 1986) va permetre combinar l’electroforesi i la detecció en un sol aparell dotat d’un lector de fluorescència (vegeu la figura 2). Els primers seqüenciadors automatitzats comercials (AB370 d’Applied Biosystems, 1987) utilitzaven el mètode Sanger en gels verticals, cosa que limitava la quantitat de mostres que podien analitzar per dia. Els gels verticals van ser posteriorment substituïts per electroforesi en capiŀlars (Kasper et al., 1988), que podien instaŀlar-se en grups de fins a noranta-sis capiŀlars, cosa que facilitava i accelerava tremendament el procés de seqüenciació (Huang et al., Figura 2. Detecció de la mutació oncogènica G>A en el codó 13 del gen KRAS en un càncer colorectal mitjançant seqüenciació Sanger (esquerra), high-resolution melting (centre) i mitjançant next generation sequencing (dreta). En l’aŀlel normal, el codó 13 (GGT) codifica un residu de glicina (G), mentre que en l’aŀlel mutant (GAC) codifica un aspartat. En el mètode Sanger, la mutació és detectada com la superposició de dos pics (G/A). En el HRM, a causa de la formació de molècules heterodúplex, la corba de desnaturalització dels mutants heterozigots (panell superior, línies verdes, G/A) és fàcilment diferenciable de la de l’aŀlel normal (línia blava, G/G) i d’una molècula control amb la mutació (línia vermella, A/A), especialment després de normalitzar la fluorescència i la temperatura i calcular la diferència amb la corba control (panell inferior). En la seqüenciació NGS, la regió és analitzada per més de seixanta seqüències en el normal (panell superior) i en el tumor (panell inferior). En vermell clar, les seqüències en direcció forward i en blau aquelles en direcció reversal. En el tumor s’identifica la mutació per l’aparició de seqüències amb una timina en comptes d’una citosina, que corresponen a la substitució G>A en la cadena codificant que, en aquest gràfic, es troba a la cadena inferior.

Treballs de la Societat Catalana de Biologia, 66: 53-61

55


Sergio Alonso, Andreu Alibés i Manuel Perucho

1992). Aquesta generació de seqüenciadors es van emprar en els primers projectes de seqüenciació del genoma humà (Lander et al., 2001; Venter et al., 2001). Encara que avui dia disposem de tècniques amb una capacitat de seqüenciació moltíssim més elevada, els seqüenciadors capiŀlars segueixen sent el mètode més utilitzat per identificar mutacions en l’àmbit acadèmic en projectes d’una escala reduïda, i també per validar les dades obtingudes amb altres plataformes. En l’entorn clínic també són àmpliament utilitzats per la seva robustesa, preu, facilitat d’ús i per la senzillesa de l’anàlisi dels resultats obtinguts.

Determinació de mutacions mitjançant high-resolution melting (HRM). Una alternativa a la seqüenciació és la determinació de la temperatura de desnaturalització dels productes de PCR, mitjançant el que s’anomena high-resolution melting (HRM) (Wittwer et al., 1997; Wittwer, 2009). La temperatura de desnaturalització (Tm) d’una molècula de DNA depèn principalment de la seva longitud i del seu contingut G+C. Per tant, les mutacions que modifiquen aquests paràmetres poden afectar la Tm. Per estudiar la presència de mutacions mitjançant HRM s’empra una molècula intercalant fluorescent, la intensitat d’emissió de la qual varia en funció de si està intercalada o no. Així, quan el DNA es desnaturalitza, la molècula intercalant s’allibera i s’observa una pèrdua de la intensitat de fluorescència. Inicialment, la resolució d’aquesta tècnica no permetia detectar canvis tan subtils com la substitució d’un sol nucleòtid, però millores posteriors en els fluoròfors intercalants emprats van augmentar molt el poder de discriminació (Wittwer et al., 2003). El procediment habitual de HRM es fa en un termociclador amb un lector de fluorescència (real-time PCR). Primer es procedeix a l’am-

Figura 3. Esquerra: metilació d’un locus genòmic mitjançant seqüenciació per bisulfit. Cada línia horitzontal representa la seqüència d’un clon individual. Els cercles blancs indiquen els llocs CpG desmetilats, i els negres els CpG metilats. A la part superior, una mostra completament desmetilada (teixit normal clònic). Al mig, una mostra tumoral amb metilació biaŀlèlica, i a la part inferior una mostra amb metilació biaŀlèlica (o metilació monoaŀlèlica acompanyada de pèrdua de l’aŀlel no metilat). Dreta: resultats representatius de la classificació sense supervisió obtinguda mitjançant l’anàlisi de la metilació de quaranta mostres tumorals (en vermell) i trenta-vuit mostres no tumorals (en verd) de pacients amb càncer colorectal, utilitzant xips Illumina HumanMethylation450. Cada fila representa una sonda que interroga un lloc CpG únic en el genoma. Només es mostren les mil sondes més variables i que interroguen llocs CpG autosòmics. En gradació creixent de blau a groc s’indica el nivell de metilació (de no metilat a completament metilat).

56

plificació mitjançant PCR de la seqüència a estudiar, immediatament seguida d’una desnaturalització amb monitoratge continu de la fluorescència emesa, de la qual es deriven les corbes de desnaturalització. En presència de dos tipus de molècules, com és el cas de les mutacions en heterozigosi en la qual hi ha un aŀlel mutant i un altre de natural (wild type), la PCR genera tres productes diferents: el producte mutant, el natural i productes híbrids denominats heterodúplex (una cadena de la molècula és mutant i l’altra natural). Aquesta heterogeneïtat produeix una corba de desnaturalització complexa en la qual no es pot determinar amb precisió una Tm única. En aquests casos és habitual comparar les diferències en les corbes de desnaturalització després de normalitzar tant la fluorescència com el rang de temperatures, en comptes de comparar directament les Tm (vegeu la figura 2). Per la seva senzillesa, rapidesa i cost limitat, la tècnica HRM és molt útil en l’entorn clínic per a la detecció de mutacions conegudes (Erali et al., 2008).

Seqüenciació massiva en paraŀlel. La seqüenciació massiva en paraŀlel, també anomenada next-generation sequencing (NGS), comprèn diverses tecnologies que s’han desenvolupat més o menys al mateix temps i que permeten la seqüenciació simultània de centenars de milers, fins i tot milions, de fragments curts de DNA. Hi ha quatre tecnologies principals que s’han disputat el mercat durant els últims anys: Solexa (Illumina), 454 (Roche), Ion Torrent i SOLiD (Applied Biosystems). Hi ha abundant literatura que compara els avantatges i limitacions de cadascuna d’aquestes plataformes, de manera que en aquest treball només citarem unes revisions que considerem molt informatives per proveir una descripció més detallada del seu funcionament (Mardis, 2008; Ansorge, 2009; Fox et al., 2009). Independentment de la tecnologia emprada, l’anàlisi de l’enorme volum de les dades generades exigeix una alta capacitat computacional. Paradoxalment, s’ha passat d’una època en què el pas limitant de la investigació era la generació de dades a una en què aquest es troba en l’anàlisi (Koboldt et al., 2010). Generalment, l’anàlisi s’inicia amb un pas de filtratge en el qual s’eliminen les seqüències de baixa qualitat i els artefactes generats pels processos d’amplificació i seqüenciació. Posteriorment, aquestes seqüències es mapen sobre una seqüència referència, que pot ser el genoma complet o una fracció d’aquest. Després del mapatge, les variacions trobades es classifiquen en germinals —aquelles presents en la mostra normal i en la tumoral— i mutacions somàtiques, exclusives de la mostra tumoral. Molt recentment, científics de Barcelona han desenvolupat una nova aproximació computacional que no requereix mapar les seqüències sobre una referència, cosa que representa un enorme avanç en facilitar la detecció de mutacions que, per la seva complexitat, són difícils o impossibles de mapar mitjançant les tècniques habituals (Moncunill et al., 2014). Una de les aplicacions més esteses de la NGS és la detecció de mutacions i variants germinals mitjançant la seqüenciació d’exomes, és a dir, les regions genòmiques corresponents a les seqüències codificants dels gens. Els fragments genòmics corresponents als exomes es capturen mitjançant hibridació

Treballs de la Societat Catalana de Biologia, 66: 53-61


Tècniques de diagnòstic molecular aplicades a l’estudi del càncer

amb seqüències sintètiques complementàries a tots els exons del genoma humà. La captura es fa habitualment mitjançant hibridació sobre xips (Choi et al., 2009) o en solució utilitzant sondes marcades amb biotina que es poden aïllar mitjançant estreptavidina (Mamanova et al., 2010). Aquesta captura redueix la regió a seqüenciar (coverage) a unes 30-60 Mb per mostra, en comptes de les 3.200 Mb del genoma complet. Aquesta reducció permet augmentar molt la profunditat de lectura (depth), és a dir, el nombre de lectures per cada base, facilita el processament i seqüenciació simultània de diverses mostres i abarateix així els costos tant de la seqüenciació com de l’anàlisi posterior. La seqüenciació d’exomes irremeiablement ignora aquelles mutacions en regions no codificants, però moltes, si no la majoria, de les mutacions causals s’esperen trobar a les regions codificants. A més, és generalment més senzill inferir l’efecte de les mutacions en seqüències codificants que en seqüències no codificants. Pel seu equilibri entre cost i potència, la seqüenciació d’exomes és molt habitual avui dia en l’àmbit acadèmic per definir el perfil mutacional dels càncers i, a poc a poc, s’està obrint pas en l’àmbit clínic. L’espectacular descens dels costos de seqüenciació (vegeu la figura 4) ha promogut que molts equips d’investigació es decideixin per la seqüenciació de genomes complets, una cosa que fins fa només uns anys era absolutament prohibitiva. L’avantatge fonamental de la seqüenciació del genoma complet és evident: s’obté una visió completa de les alteracions somàtiques, tant les cromosòmiques com les puntuals, al llarg de tot el genoma. A causa de l’abaratiment d’aquesta tecnologia i la possible entrada al mercat de tecnologies fins i tot més poderoses és molt probable que la seqüenciació de genomes complets s’imposarà en un futur proper com la tècnica d’elecció no només per a l’anàlisi mutacional en càncers, sinó fins i tot com a alternativa als xips per a la determinació del genotip dels pacients de manera rutinària. Avui dia, però, l’anàlisi bioinformàtica suposa un important cost en temps i recursos i possiblement es necessitaran noves aproximacions computacionals per millorar i estandarditzar l’anàlisi abans de l’aplicació rutinària en l’àmbit clínic.

Alteracions epigenètiques Les cèŀlules canceroses exhibeixen perfils epigenètics anormals que afecten els patrons d’expressió gènica i, en alguns casos, l’estabilitat mateixa del genoma (Jones et al., 2002). Entre les modificacions epigenètiques que s’han estudiat amb més profunditat destaquen les alteracions en els patrons de metilcitosina en el DNA, associats a canvis en l’estat de compactació i accessibilitat de la cromatina. En la majoria dels genomes dels vertebrats les citosines poden metilar-se per acció d’enzims nuclears denominats DNA-metiltransferases (DNMT), formant 5-metilcitosina. En vertebrats, la metilació de citosines està restringida gairebé exclusivament als llocs CpG (un nucleòtid de citosina seguit de guanina), que estan infrarepresentats en el genoma dels vertebrats a causa de la inestabilitat intrínseca de la metilcitosina que muta a timina fixant una mutació C→T (Russell et al., 1976; Bird, 1980). Hi ha regions en el DNA anomenades illes CpG (CGI), d’uns 200-1.000 pb i amb més proporció de CpG (Gardiner-Garden et al., 1987), generalment associades a seqüències repetitives amb alt contingut en G+C, així com

Figura 4. Disminució del cost de la seqüenciació d’un genoma humà en els darrers quinze anys (figura obtinguda del National Human Genome Research Institute, www.genome.gov). Després de la finalització del projecte de seqüenciació del genoma humà (2001), el cost de seqüenciació seguia aproximadament la llei de Moore, inicialment postulada per predir el descens exponencial del cost de computació, i que s’ha emprat per determinar la reducció en el cost d’altres tecnologies. La implementació dels seqüenciadors de nova generació (NGS) el 2007 va suposar una enorme reducció en el cost. Es preveu que, amb la probable irrupció de noves tecnologies, en els propers anys el cost de seqüenciar un genoma complet sigui significativament de menys de mil dòlars.

en la regió promotora d’aproximadament el 60-70 % dels gens humans (Illingworth et al., 2009). En general, la metilació de les CGI en promotors gènics s’associa al seu silenciament transcripcional. A principis dels anys vuitanta es va descobrir que el genoma de les cèŀlules canceroses estava hipometilat (Diala et al., 1982; Feinberg et al., 1983). La hipometilació genòmica reflecteix majoritàriament la desmetilació de seqüències repetitives, que representen més del 50 % del genoma humà, i en menys mesura la desmetilació de les regions no promotores dels gens (gene bodies). Encara que s’ha descrit que la hipometilació d’alguns oncogens està associada a la seva sobreexpressió (Feinberg et al., 1983; Vachtenheim et al., 1994), avui dia es creu que l’efecte més important de la hipometilació del DNA en càncer és la reactivació de l’expressió de retrotransposons (Bestor et al., 1996) i l’augment d’inestabilitat genòmica (Ehrlich, 2002). Posteriorment, es va descobrir que alguns tumors presentaven, a més, hipermetilació localitzada en les regions promotores de certs gens implicats en la tumorigènesi i el desenvolupament tumoral (Greger et al., 1989, 1994; Herman et al., 1994, 1995; Gonzalez-Zulueta et al., 1995). Aquests descobriments van iniciar una veritable revolució en el camp de la genètica del càncer, en demostrar que molts gens supressors tumorals resultaven inactivats no solament per mutacions genètiques, sinó per alteracions en la metilació del DNA (revisat per Esteller, 2002). Un exemple paradigmàtic d’aquest fenomen és, sens dubte, la hipermetilació del gen MLH1, que és el principal causant dels càncers colorectals esporàdics amb el fenotip mutador (Kane et al., 1997). L’epigenètica ha obert un nou front en la batalla contra el

Treballs de la Societat Catalana de Biologia, 66: 53-61

57


Sergio Alonso, Andreu Alibés i Manuel Perucho

càncer, basat en el disseny i aplicació de medicaments dirigits a revertir la metilació dels supressors tumorals o, en alguns casos, a explotar les conseqüències dels canvis epigenètics (Yoo et al., 2006). Els canvis en la metilació del DNA són possiblement les alteracions epigenètiques en càncer més estudiades i millor conegudes. Durant els últims trenta anys s’han desenvolupat i perfeccionat diversos mètodes per identificar aquest tipus d’alteracions. Molts dels mètodes inicials es van basar en l’ús d’endonucleases de restricció sensibles a la metilació. No obstant això, els mètodes actuals més habituals es basen en la transformació química del DNA mitjançant tractament amb bisulfit, que modifica les citosines no metilades i deixa intactes les citosines metilades (Frommer et al., 1992; Clark et al., 1994).

Detecció d’alteracions mitjançant enzims de restricció sensibles a la metilació. Una de les primeres aproximacions experimentals per detectar canvis en els patrons de metilació del DNA va ser l’ús d’endonucleases de restricció sensibles a la metilació. La gran majoria de les endonucleases de restricció utilitzades en biologia molecular provenen dels sistemes bacterians de metilació-restricció de tipus II, que combinen una parella d’enzims, una metilasa i una endonucleasa que reconeixen la mateixa seqüència del DNA. La metilasa actua sobre el DNA propi després de la síntesi, i protegeix de l’acció de l’endonucleasa. El DNA forà, però, no té el mateix patró de metilació i, per tant, queda exposat a digestió de l’endonucleasa (Wilson, 1991). Així, l’estudi de la mida dels fragments del DNA tractat amb enzims de restricció que contenien un o més llocs CpG en la seva seqüència de reconeixement permet identificar llocs CpG metilats en un locus determinat. Posteriorment es van desenvolupar diverses tècniques que permetien analitzar canvis en la metilació d’un major nombre de locus simultàniament mitjançant electroforesi unidimensional generant fingerprints, com la methylation-sensitive arbitrarily primed PCR (MS-AP-PCR), restriction fingerprinting (MSRF), amplification of inter methylated sites (AIMS) i methylation sensitive amplification length polymorphism (MS-AFLP), o mitjançant electroforesi bidimensional, com la restriction landmark genomic scanning for methylation (RLGS-M) (revisat per Samuelsson et al., 2010). En general, aquestes tècniques han estat desplaçades pels mètodes basats en la transformació del DNA amb bisulfit, molt especialment els xips de metilació d’Illumina. No obstant això, la tècnica MS-AFLP ha estat adaptada a plataformes de xips, utilitzant com a sondes els fragments de MS-AFLP clonats (Yamamoto et al., 2004) o oligonucleòtids sintètics (Koizumi et al., 2012). El nostre grup ha utilitzat aquests xips de metilació per identificar alteracions epigenètiques en la mucosa colònica de pacients amb colitis ulcerosa (Koizumi et al., 2012) i més recentment per investigar la metilació d’una regió interna del gen AXIN2 com a biomarcador associat a la ruta de transformació dels adenomes serrats en carcinomes (Muto et al., 2014). Captura de DNA metilat. Una altra de les tècniques habituals és l’enriquiment de DNA metilat mitjançant anticossos que reconeixen directament la metilcitosina (MeDIP) o dominis d’unió a citosina metilada (MBD) (Rauch et al., 2006; Jacinto et al., 2008). Conceptualment, les dues tècniques són molt similars. Es basen en la captura de la fracció del DNA que es troba metilat i l’anàlisi posterior mitjançant hibridació en tiling-microarrays o mitjançant NGS (Down et al., 2008) per detectar regions amb metilació diferencial (DMR) entre dues o més mostres. Avui dia hi ha múltiples productes comercials basats en aquestes tecnologies. No obstant això, cal tenir en compte que els anticossos i

58

les proteïnes amb dominis MBD presenten una afinitat diferent per la 5-metilcitosina, cosa que resulta en diferents biaixos en funció de la tècnica emprada (Nair et al., 2011).

Transformació del DNA amb bisulfit. La transformació del DNA mitjançant tractament amb bisulfit ha facilitat enormement l’estudi de la metilació del DNA. Aquest tractament provoca la desaminació de les citosines, i les converteix en uracils. La 5-metilcitosina, però, és molt més resistent a la transformació i roman majoritàriament inalterada. Després del tractament, el DNA és amplificat mitjançant PCR. La Taq-polimerasa confon els residus d’uracil amb residus de timina, per la qual cosa introdueix una adenina com a base complementària. D’aquesta manera, les citosines originalment desmetilades, però no les metilades, són substituïdes per timines en el cicle d’amplificació següent (Frommer et al., 1992; Clark et al., 1994). Encara que és possible, en general es desaconsella seqüenciar directament el producte d’amplificació, i és preferible clonar i seqüenciar clons individuals i obtenir així l’estat de metilació de molècules individuals (vegeu la figura 3). S’han desenvolupat molts mètodes basats en el tractament del DNA amb bisulfit (revisat per Jordà et al., 2010). Una opció molt utilitzada pel seu moderat cost és la digestió del producte d’amplificació amb enzims de restricció, la seqüència de reconeixement dels quals inclou dinucleòtids CpG, que són transformats a TpG a les molècules originalment desmetilades i generen, per tant, fragments de diferent longitud (combined bisulfite and restriction analysis, COBRA) (Xiong et al., 1997). Una altra alternativa econòmica que no requereix seqüenciar és la PCR sensible a metilació (methylation-sensitive PCR, o MSP), potser un dels mètodes més emprats per investigar l’estat de metilació de locus individuals (Herman et al., 1996). Per estudiar una seqüència mitjançant MSP es dissenyen dues parelles d’encebadors (primers): una específica per al producte de transformació de la seqüència desmetilada (considerant totes les citosines transformades a uracil), i l’altra parella reconeix el producte de transformació de la seqüència metilada (totes les citosines transformades a uracil, excepte aquelles en llocs CpG). Tot i que la MSP és molt sensible, és també propensa a generar falsos positius. Una versió quantitativa de la MSP és el mètode MethyLight, que empra sondes fluorescents per quantificar la proporció de molècules metilades (o desmetilades) en una mostra (Eads et al., 2000). Altres opcions menys habituals són la determinació de l’estat de metilació mitjana del producte amplificat mitjançant MS-SSCA (methylation-sensitive single stranded conformation analysis) (Bianco et al., 1999) o HRM (Worm et al., 2001), la determinació de l’estat de metilació d’uns pocs llocs CpG interns mitjançant PCR d’inhibició headloop (Rand et al., 2005), i la quantificació de l’estat de metilació d’un únic lloc CpG mitjançant Ms-SNuPE (Gonzalgo et al., 1997), o de tots els llocs CpG del producte d’amplificació mitjançant piroseqüenciació (Tost et al., 2003). Totes aquestes tècniques van ser dissenyades per estudiar la metilació d’un sol locus i, excepte per a estudis molt específics o per confirmar les observacions fetes mitjançant altres mètodes, s’han vist relegades per tecnologies més recents que permeten analitzar diversos locus simultàniament. Microxips basats en el tractament amb bisulfit. Encara que hi ha diverses plataformes comercials per estudiar la metilació del DNA, possiblement la més utilitzada avui dia són els xips desenvolupats per Illumina. La primera generació d’aquests xips disposava d’unes 1.500 sondes basades en la tecnologia GoldenGate (Bibikova et

Treballs de la Societat Catalana de Biologia, 66: 53-61


Tècniques de diagnòstic molecular aplicades a l’estudi del càncer

al., 2006). Com a exemple pràctic del poder d’aquesta plataforma per classificar càncers, el 2011 es va utilitzar per generar mapes epigenòmics en més de 1.600 mostres tumorals (Sandoval et al., 2011). Posteriorment es va desenvolupar una segona generació de xips basats en la tecnologia Infinium. El primer d’aquests xips, denominat HumanMethylation27, interrogava uns 27.000 llocs CpG localitzats principalment en promotors gènics (Bibikova et al., 2009). Aquests xips contenien sondes anomenades de tipus I, en el qual cada CpG és interrogat per dues sondes independents, una complementària a la seqüència desmetilada i una altra a la seqüència metilada. L’assaig analitza l’extensió de la base que es troba a continuació del lloc CpG interrogat. Així, la intensitat relativa entre els dos tipus de sondes per a cada lloc CpG permet estimar la proporció de molècules metilades en aquesta posició. Poc després es va comercialitzar el HumanMethylation450, amb molta més resolució, en interrogar uns 480.000 llocs CpG (aproximadament l’1,7 % de tots els llocs CpG del genoma), localitzats tant en regions promotores com en regions intra i intergèniques (vegeu la figura 3) (Bibikova et al., 2011; Sandoval et al., 2011). Aquesta generació de xips inclou sondes anomenades de tipus II, en què es dissenya una sola sonda per a cada lloc CpG i s’analitza la incorporació d’una citosina o una timina en el lloc estudiat. Pel seu preu limitat i alta resolució, els xips HumanMethylation450 són molt emprats per moltíssims grups de recerca, i han estat la plataforma triada per al projecte de l’International Cancer Genome Consortium (ICGC, https://icgc.org/) per analitzar la metilació dels tumors.

Seqüenciació de genomes transformats amb bisulfit. Actualment, la tècnica de més resolució per determinar la metilació del DNA és la seqüenciació completa del genoma després de la transformació amb bisulfit (whole genome bisulfite sequencing, o WGBS) (Lister et al., 2009; revisat per Stirzaker et al., 2014). Aquesta tècnica permet la identificació de l’estat de metilació de la gran majoria dels llocs CpG genòmics, excloent aquells en seqüències repetitives que sempre suposen un problema per mapar-los. No obstant això, aquesta aproximació comporta considerables obstacles tècnics. Comparat amb la seqüenciació de genomes sense transformar, per a la WGBS es requereix més quantitat de material inicial a l’hora de generar les biblioteques, ja que una gran part del DNA és degradat durant el tractament amb bisulfit. Després de la seqüenciació, totes les citosines fora de llocs CpG hauran estat substituïdes, cosa que redueix la informació útil (de quatre bases a tres) per mapar les seqüències obtingudes. D’altra banda, els llocs CpG poden estar metilats o no, cosa que genera una variabilitat per a la qual no estan dissenyats la majoria dels programes de mapatge de seqüències. L’estratègia més estesa és substituir in silico les citosines per timines (o les guanines per adenines en funció de l’orientació) en totes les seqüències obtingudes i, a continuació, mapar-les sobre dues versions del genoma humà, cadascuna generada a partir d’una de les cadenes substituint les citosines per timines (i llavors les cadenes perden la seva complementarietat). Després del mapatge, es reposa la informació referent a l’estat de metilació dels llocs CpG per a cadascuna de les seqüències. A causa de l’elevat cost i la complexitat de l’anàlisi, sobretot si es compara amb

les plataformes de xips actuals, la WGBS no s’ha estès encara en l’àmbit acadèmic excepte per a estudis en què s’analitzen un nombre petit de mostres. S’han desenvolupat alternatives per reduir la complexitat i el cost, com seqüenciar només una part del genoma (reduced representation bisulfite sequencing, RRBS) (Meissner et al., 2005) o millorar l’eficiència de la construcció de les biblioteques mitjançant la fragmentació del DNA amb la transposasa Tn5 (tagmentation-based WGBS, o T-WGBS) (Wang et al., 2013).

Recapitulació i direccions futures Avui dia disposem de plataformes molt potents per a la classificació i caracterització dels càncers en funció de les seves alteracions genòmiques i epigenòmiques. Algunes d’aquestes plataformes estan encara restringides a l’àmbit acadèmic però a poc a poc van introduint-se en la pràctica clínica per a la diagnosi molecular. La PCR, la seqüenciació Sanger i els xips són probablement les tecnologies més comunes avui dia per la seva fiabilitat, relativa senzillesa i cost limitat. No obstant això, la seqüenciació massiva en paraŀlel ha suposat una tremenda revolució en el camp, i ha facilitat l’anàlisi de pràcticament tots els tipus d’alteracions esmentades en aquest treball. Els seus inconvenients actuals són l’elevat cost dels equips i els reactius emprats per a la seqüenciació, de manera que l’ús d’aquestes tecnologies en l’àmbit acadèmic està restringit a unitats especialitzades de seqüenciació, públiques o privades. En qualsevol cas, els costos han disminuït de manera espectacular en els darrers anys (vegeu la figura 4), i es preveu que amb el desenvolupament definitiu de l’anomenada seqüenciació de tercera generació, amb nous mètodes capaços de generar desenes de milers de seqüències de més de 20 kb cadascuna i partir de molècules individuals, els preus baixaran per sota dels mil dòlars per genoma (cent mil vegades menys del que va costar el primer genoma humà el 2001). D’altra banda, en tractar-se de tecnologies molt joves que generen una enorme quantitat de dades, els mètodes d’anàlisi computacional són complexos i estan en continu desenvolupament, cosa que en dificulta la implementació immediata en l’àmbit clínic, en què la fiabilitat i l’estandardització dels protocols de diagnòstic són absolutament crítics. Malgrat aquestes dificultats, la implementació clínica de les tecnologies d’anàlisi molecular, tant les actuals com les que estan en fase de desenvolupament, és fonamental per a la futura aplicació d’una medicina de precisió per al càncer, en la qual se seleccionarà la teràpia més apropiada per a cada pacient en funció del seu genotip i de la informació genètica/epigenètica del càncer que l’afecta (Esplin et al., 2014). No és improbable, a més, que el desenvolupament de noves tecnologies —avui completament impredictibles— facilitarà encara més l’aplicació de la informació genètica i epigenètica en el diagnòstic dels pacients, tal com ja ha passat tantes i tantes vegades en el passat amb la seqüenciació del DNA, la PCR, els microxips, la NGS, i un llarguíssim etcètera. Parafrasejant Sydney Brenner: «Progress in science depends on new techniques, new discoveries and new ideas, probably in that order» (Brenner, 2002). Treball finançat per Spanish Ministry of Health Grants FIS PI09/2444 i FIS PI12/00511.

Treballs de la Societat Catalana de Biologia, 66: 53-61

59


Sergio Alonso, Andreu Alibés i Manuel Perucho

Bibliografia Almoguera, C. [et al.] (1989). «Application of the Polymerase Chain Reaction for the detection of single-base substitutions by the RNAse A mismatch cleavage method». A: H. A. Erlich [et al.] (ed.). Current Communications in Molecular Biology, Polymerase Chain Reaction. Cold Spring Harbor Laboratory, p. 37-41. Ansorge, W. J. (2009). «Next-generation DNA sequencing techniques». N. Biotechnol., 25 (4): 195-203. Arteaga, C. L. (2006). «EGF receptor mutations in lung cancer: from humans to mice and maybe back to humans». Cancer Cell, 9 (6): 421-423. Beroukhim, R. [et al.] (2010). «The landscape of somatic copy-number alteration across human cancers». Nature, 463 (7283): 899-905. Bestor, T. H. [et al.] (1996). «Creation of genomic methylation patterns». Nat. Genet., 12 (4): 363-367. Bianco, T. [et al.] (1999). «Methylation-sensitive, single-strand conformation analysis (MS-SSCA): A rapid method to screen for and analyze methylation». Hum. Mutat., 14 (4): 289-293. Bibikova, M. [et al.] (2006). «High-throughput DNA methylation profiling using universal bead arrays». Genome Res., 16 (3): 383-393. — (2009). «Genome-wide DNA methylation profiling using Infinium(R) assay». Epi­ genomics, 1 (1): 177-200. — (2011). «High density DNA methylation array with single CpG site resolution». Genomics, 98 (4): 288-295. Bird, A. P. (1980). «DNA methylation and the frequency of CpG in animal DNA». Nucleic Acids Res., 8 (7): 1499-1504. Bodmer, W. F. [et al.] (1989). «Genetic analysis of colorectal cancer». Princess Takamatsu Symp., 20: 49-59. Boone, P. M. [et al.] (2010). «Detection of clinically relevant exonic copy-number changes by array CGH». Hum. Mutat., 31 (12): 1326-1342. Boyd, L. K. [et al.] (2009). «Use of SNPs in cancer predisposition analysis, diagnosis and prognosis: tools and prospects». Expert Opin. Med. Diagn., 3 (3): 313-326. Braekeleer, E. de [et al.] (2014). «Genetic diagnosis in malignant hemopathies: from cytogenetics to next-generation sequencing». Expert Rev. Mol. Diagn., 14 (2): 127129. Brenner, S. (2002). «Life sentences: Detective Rummage investigates». Genome Biology, 3 (9): comment1013.1-comment1013.2. Choi, M. [et al.] (2009). «Genetic diagnosis by whole exome capture and massively parallel DNA sequencing». Proc. Natl. Acad. Sci. USA, 106 (45): 19096-19101. Clark, S. J. [et al.] (1994). «High sensitivity mapping of methylated cytosines». Nucleic Acids Res., 22 (15): 2990-2997. Diala, E. S. [et al.] (1982). «Hypomethylation of HeLa cell DNA and the absence of 5-methylcytosine in SV40 and adenovirus (type 2) DNA: analysis by HPLC». Biochem. Biophys. Res. Commun., 107 (1): 19-26. Down, T. A. [et al.] (2008). «A Bayesian deconvolution strategy for immunoprecipitation-based DNA methylome analysis». Nat. Biotechnol., 26 (7): 779-785. Eads, C. A. [et al.] (2000). «MethyLight: a high-throughput assay to measure DNA methylation». Nucleic Acids Res., 28 (8): E32. Ehrlich, M. (2002). «DNA methylation in cancer: too much, but also too little». Oncogene, 21 (35): 5400-5413. Erali, M. [et al.] (2008). «High resolution melting applications for clinical laboratory medicine». Exp. Mol. Pathol., 85 (1): 50-58. Esteller, M. (2002). «CpG island hypermethylation and tumor suppressor genes: a booming present, a brighter future». Oncogene, 21 (35): 5427-5440. Feinberg, A. P. [et al.] (1983a). «Hypomethylation distinguishes genes of some human cancers from their normal counterparts». Nature, 301 (5895): 89-92. — (1983b). «Hypomethylation of ras oncogenes in primary human cancers». Biochem. Biophys. Res. Commun., 111 (1): 47-54. Fox, S. [et al.] (2009). «Applications of ultra-high-throughput sequencing». Methods Mol. Biol., 553: 79-108. Frommer, M. [et al.] (1992). «A genomic sequencing protocol that yields a positive display of 5-methylcytosine residues in individual DNA strands». Proc. Natl. Acad. Sci. USA, 89 (5): 1827-1831. Garcia-Linares, C. [et al.] (2012). «Applying microsatellite multiplex PCR analysis (MMPA) for determining allele copy-number status and percentage of normal cells within tumors». PLoS One, 7 (8): e42682. Gardiner-Garden, M. [et al.] (1987). «CpG islands in vertebrate genomes». J. Mol. Biol., 196 (2): 261-282. Gonzalez-Zulueta, M. [et al.] (1995). «Methylation of the 5´ CpG island of the p16/ CDKN2 tumor suppressor gene in normal and transformed human tissues correlates with gene silencing». Cancer Res., 55 (20): 4531-4535. Gonzalgo, M. L. [et al.] (1997). «Rapid quantitation of methylation differences at specific sites using methylation-sensitive single nucleotide primer extension (MsSNuPE)». Nucleic Acids Res., 25 (12): 2529-2531. Greger, V. [et al.] (1989). «Epigenetic changes may contribute to the formation and spontaneous regression of retinoblastoma». Hum. Genet., 83 (2): 155-158. — (1994). «Frequency and parental origin of hypermethylated RB1 alleles in retinoblastoma». Hum. Genet., 94 (5): 491-496. Hanahan, D. [et al.] (2000). «The hallmarks of cancer». Cell, 100 (1): 57-70. — (2011). «Hallmarks of cancer: the next generation». Cell, 144 (5): 646-674. Hendifar, A. [et al.] (2014). «Biomarker-driven EGFR therapy improves outcomes in patients with metastatic colorectal cancer». Expert Rev. Anticancer Ther., 14 (9): 1051-1061. Herman, J. G. [et al.] (1994). «Silencing of the VHL tumor-suppressor gene by DNA methylation in renal carcinoma». Proc. Natl. Acad. Sci. USA, 91 (21): 9700-9704.

60

— (1995). «Inactivation of the CDKN2/p16/MTS1 gene is frequently associated with aberrant DNA methylation in all common human cancers». Cancer Res., 55 (20): 4525-4530. — (1996). «Methylation-specific PCR: a novel PCR assay for methylation status of CpG islands». Proc. Natl. Acad. Sci. USA, 93 (18): 9821-9826. Holland, A. J. [et al.] (2009). «Boveri revisited: chromosomal instability, aneuploidy and tumorigenesis». Nat. Rev. Mol. Cell Biol., 10 (7): 478-487. Huang, X. C. [et al.] (1992). «DNA sequencing using capillary array electrophoresis». Anal Chem., 64 (18): 2149-2154. Illingworth, R. S. [et al.] (2009). «CpG islands–’a rough guide’». FEBS Lett, 583 (11): 1713-1720. Ince, T. A. [et al.] (2002). «Functional genomics and the breast cancer problem». Cancer Cell, 1 (1): 15-17. Ionov, Y. [et al.] (1993). «Ubiquitous somatic mutations in simple repeated sequences reveal a new mechanism for colonic carcinogenesis». Nature, 363 (6429): 558-561. Jacinto, F. V. [et al.] (2008). «Methyl-DNA immunoprecipitation (MeDIP): hunting down the DNA methylome». Biotechniques, 44 (1): 35, 37, 39 pàssim. Jones, P. A. [et al.] (2002). «The fundamental role of epigenetic events in cancer». Nat. Rev. Genet., 3 (6): 415-428. Jorda, M. [et al.] (2010). «Methods for DNA methylation analysis and applications in colon cancer». Mutat. Res., 693 (1-2): 84-93. Kallioniemi, A. [et al.] (1992). «Comparative genomic hybridization for molecular cytogenetic analysis of solid tumors». Science, 258 (5083): 818-821. Kane, M. F. [et al.] (1997). «Methylation of the hMLH1 promoter correlates with lack of expression of hMLH1 in sporadic colon tumors and mismatch repair-defective human tumor cell lines». Cancer Res., 57 (5): 808-811. Kasper, T. J. [et al.] (1988). «Separation and detection of DNA by capillary electrophoresis». J. Chromatogr., 458: 303-312. Knudson, A. G., Jr. (1971). «Mutation and cancer: statistical study of retinoblastoma». Proc. Natl. Acad. Sci. USA, 68 (4): 820-823. Koboldt, D. C. [et al.] (2010). «Challenges of sequencing human genomes». Brief Bioinform., 11 (5): 484-498. Koizumi, K. [et al.] (2012). «Array-based identification of common DNA methylation alterations in ulcerative colitis». Int. J. Oncol., 40 (4): 983-994. Lander, E. S. [et al.] (2001). «Initial sequencing and analysis of the human genome». Nature, 409 (6822): 860-921. Langdon, J. A. [et al.] (2006). «Combined genome-wide allelotyping and copy number analysis identify frequent genetic losses without copy number reduction in medulloblastoma». Genes Chromosomes Cancer, 45 (1): 47-60. Langer-Safer, P. R. [et al.] (1982). «Immunological method for mapping genes on Drosophila polytene chromosomes». Proc. Natl. Acad. Sci. USA, 79 (14): 4381-4385. Lawrence, M. S. [et al.] (2013). «Mutational heterogeneity in cancer and the search for new cancer-associated genes». Nature, 499 (7457): 214-218. Leeuw, N. de [et al.] (2011). «SNP array analysis in constitutional and cancer genome diagnostics-copy number variants, genotyping and quality control». Cytogenet. Genome Res., 135 (3-4): 212-221. Li, R. [et al.] (2000). «Aneuploidy vs. gene mutation hypothesis of cancer: recent study claims mutation but is found to support aneuploidy». Proc. Natl. Acad. Sci. USA, 97 (7): 3236-3241. Lin, S. [et al.] (2009). «Using free and open-source bioconductor packages to analyze array comparative genomics hybridization (aCGH) Data». Curr. Genomics, 10 (1): 60-63. Lister, R. [et al.] (2009). «Human DNA methylomes at base resolution show widespread epigenomic differences». Nature, 462 (7271): 315-322. Lucito, R. [et al.] (2003). «Representational oligonucleotide microarray analysis: a high-resolution method to detect genome copy number variation». Genome Res., 13 (10): 2291-2305. Mamanova, L. [et al.] (2010). «Target-enrichment strategies for next-generation sequencing». Nat. Methods, 7 (2): 111-118. Mardis, E. R. (2008). «Next-generation DNA sequencing methods». Annu. Rev. Genomics Hum. Genet., 9: 387-402. Meissner, A. [et al.] (2005). «Reduced representation bisulfite sequencing for comparative high-resolution DNA methylation analysis». Nucleic Acids Res., 33 (18): 58685877. Miller, D. T. [et al.] (2010). «Consensus statement: chromosomal microarray is a first-tier clinical diagnostic test for individuals with developmental disabilities or congenital anomalies». Am. J. Hum. Genet., 86 (5): 749-764. Mitelman, F. [et al.] (1990). «Chromosome abnormalities in cancer». Cancer Detect. Prev., 14 (5): 527-537. Moncunill, V. [et al.] (2014). «Comprehensive characterization of complex structural variations in cancer by directly comparing genome sequence reads». Nat. Biotechnol., 32 (11): 1106-1112. Mullis, K. [et al.] (1986). «Specific enzymatic amplification of DNA in vitro: the polymerase chain reaction». Cold Spring Harb. Symp. Quant. Biol., 51 Pt 1: 263-73. Muto, Y. [et al.] (2014). «DNA methylation alterations of AXIN2 in serrated adenomas and colon carcinomas with microsatellite instability». BMC Cancer, 14: 466. Nair, S. S. [et al.] (2011). «Comparison of methyl-DNA immunoprecipitation (MeDIP) and methyl-CpG binding domain (MBD) protein capture for genome-wide DNA methylation analysis reveal CpG sequence coverage bias». Epigenetics, 6 (1): 34-44. Nowell, P. C. (1976). «The clonal evolution of tumor cell populations». Science, 194 (4260): 23-28. Peinado, M. A. [et al.] (1992). «Isolation and characterization of allelic losses and gains

Treballs de la Societat Catalana de Biologia, 66: 53-61


Tècniques de diagnòstic molecular aplicades a l’estudi del càncer

in colorectal tumors by arbitrarily primed polymerase chain reaction». Proc. Natl. Acad. Sci. USA, 89 (21): 10065-10069. Pellman, D. (2007). «Cell biology: aneuploidy and cancer». Nature, 446 (7131): 38-39. Perucho, M. (1994). «PCR and cancer diagnostics: detection and characterization of single point mutations in oncogenes and antioncogenes». A: K. B. Mullis [et al.] (ed.). The polymerase chain reaction. Birkhauser: Springer-Verlag, p. 369-394. Rand, K. N. [et al.] (2005). «Headloop suppression PCR and its application to selective amplification of methylated DNA sequences». Nucleic Acids Res., 33 (14): e127. Rauch, T. [et al.] (2006). «MIRA-assisted microarray analysis, a new technology for the determination of DNA methylation patterns, identifies frequent methylation of homeodomain-containing genes in lung cancer cells». Cancer Res., 66 (16): 79397947. Russell, G. J. [et al.] (1976). «Doublet frequency analysis of fractionated vertebrate nuclear DNA». J. Mol. Biol., 108 (1): 1-23. Samuelsson, J. K. [et al.] (2010). «DNA fingerprinting techniques for the analysis of genetic and epigenetic alterations in colorectal cancer». Mutat. Res., 693 (1-2): 61-76. Sandoval, J. [et al.] (2011). «Validation of a DNA methylation microarray for 450,000 CpG sites in the human genome». Epigenetics, 6 (6): 692-702. Sanger, F. [et al.] (1977). «DNA sequencing with chain-terminating inhibitors». Proc. Natl. Acad. Sci. USA, 74 (12): 5463-5467. Shinawi, M. [et al.] (2008). «The array CGH and its clinical applications». Drug Discov. Today, 13 (17-18): 760-770. Smith, L. M. [et al.] (1986). «Fluorescence detection in automated DNA sequence analysis». Nature, 321 (6071): 674-679. Stirzaker, C. [et al.] (2014). «Mining cancer methylomes: prospects and challenges». Trends Genet., 30 (2): 75-84. Tost, J. [et al.] (2003). «Analysis and quantification of multiple methylation variable positions in CpG islands by Pyrosequencing». Biotechniques, 35 (1): 152-156. Vachtenheim, J. [et al.] (1994). «Hypomethylation of CCGG sites in the 3´ region of H-ras protooncogene is frequent and is associated with H-ras allele loss in non-small cell lung cancer». Cancer Res., 54 (5): 1145-1148.

Venter, J. C. [et al.] (2001). «The sequence of the human genome». Science, 291 (5507): 1304-1351. Wang, Q. [et al.] (2013). «Tagmentation-based whole-genome bisulfite sequencing». Nat. Protoc., 8 (10): 2022-2032. Welsh, J. [et al.] (1990). «Fingerprinting genomes using PCR with arbitrary primers». Nucleic Acids Res., 18 (24): 7213-7218. Williams, J. G. [et al.] (1990). «DNA polymorphisms amplified by arbitrary primers are useful as genetic markers». Nucleic Acids Res., 18 (22): 6531-6535. Wilson, G. G. (1991). «Organization of restriction-modification systems». Nucleic Acids Res., 19 (10): 2539-2566. Winter, E. [et al.] (1985). «A method to detect and characterize point mutations in transcribed genes: amplification and overexpression of the mutant c-Ki-ras allele in human tumor cells». Proc. Natl. Acad. Sci. USA, 82 (22): 7575-7579. Wiszniewska, J. [et al.] (2014). «Combined array CGH plus SNP genome analyses in a single assay for optimized clinical testing». Eur. J. Hum. Genet., 22 (1): 79-87. Wittwer, C. T. (2009). «High-resolution DNA melting analysis: advancements and limitations». Hum. Mutat., 30 (6): 857-859. Wittwer, C. T. [et al.] (1997). «Continuous fluorescence monitoring of rapid cycle DNA amplification». Biotechniques, 22 (1): 130-131, 134-138. — (2003). «High-resolution genotyping by amplicon melting analysis using LCGreen». Clin. Chem., 49 (6 Pt 1): 853-860. Worm, J. [et al.] (2001). «In-tube DNA methylation profiling by fluorescence melting curve analysis». Clin. Chem., 47 (7): 1183-1189. Xiong, Z. [et al.] (1997). «COBRA: a sensitive and quantitative DNA methylation assay». Nucleic Acids Res., 25 (12): 2532-2534. Yamamoto, F. [et al.] (2004). «A DNA microarray-based methylation-sensitive (MS)AFLP hybridization method for genetic and epigenetic analyses». Mol. Genet. Genomics, 271 (6): 678-686. Yoo, C. B. [et al.] (2006). «Epigenetic therapy of cancer: past, present and future». Nat. Rev. Drug. Discov., 5 (1): 37-50.

Treballs de la Societat Catalana de Biologia, 66: 53-61

61


Flaix de ciència

Una mirada val més que mil paraules Detectar malalties neurodegeneratives a partir de la retina

Mónica Marro i Pablo Loza-Álvarez. Super-resolution Light Microscopy & Nanoscopy (SLN) Lab ICFO, Institut de Ciències Fotòniques

La detecció precoç de malalties neurodegeneratives és clau, perquè un bon tractament a temps pot alleugerir els símptomes i allargar l’esperança de vida del pacient. El problema d’aquestes malalties és que, quan apareixen els símptomes, més del 70 % del sistema nerviós ja es troba afectat. Per això, és molt important detectar la malaltia fins i tot abans que el pacient presenti els símptomes. En aquest sentit, és necessari establir una eina no invasiva que es pugui fer servir de manera rutinària per detectar pacients susceptibles d’estar desenvolupant malalties neurodegeneratives. Les tècniques actuals que serveixen per detectar aquestes malalties (ressonància magnètica nuclear, punció lumbar o les proves de potencials evocats, en anglès evoked potential tests, que mesuren l’activitat elèctrica) són o bé invasives o bé costoses en temps i diners. Per aquest motiu, aquestes proves es reserven per a pacients que ja presenten símptomes i a vegades ja és massa tard.

La retina és una part del sistema nerviós central en què les cèŀlules ganglionars projecten els seus axons a través del nervi òptic. Aquestes cèŀlules són danyades en nombroses malalties com el glaucoma o l’esclerosi múltiple. Per tant, l’anàlisi dels canvis moleculars de la retina incrementaria el nostre coneixement sobre pèrdua neuronal i neuroinflamació i ens ajudaria a desenvolupar estratègies noves neuroprotectores per al cervell.

La retina delatora Per a la fotònica, la retina és una part molt accessible del sistema nerviós central, ja que es podria enviar un feix de llum a l’ull i així poder estudiar les neurones i la seva evolució de manera no invasiva. Una de les tècniques òptiques més prometedores per a aquest estudi és l’espectroscòpia Raman (ER). Es basa a enviar un feix monocromàtic de llum a una

62

Imatge 1. Fotografia del laboratori de SLN.

mostra. La interacció dels fotons del feix amb les vibracions moleculars de la mostra fa que la llum dispersada contingui fotons de longitud d’ona diferent a la inicial (coneguts com a espectre Raman). Com que cada molècula té unes vibracions moleculars definides i específiques, analitzant l’espectre Raman de la mostra tindrem informació del seu contingut molecular. La ER és no invasiva, ja que no excita les molècules, no requereix una preparació prèvia de la mostra i els resultats són immediats. Com a conseqüència, utilitzar l’ER per a l’estudi i la detecció de malalties neurodegeneratives a través de la retina és molt prometedor. L’ICFO, en coŀlaboració amb l’Institut d’Investigació Biomèdica August Pi Sunyer Treballs de la Societat Catalana de Biologia

(IDIBAPS) fa tres anys va començar a estudiar la possibilitat de detectar i monitorar processos inflamatoris de la retina, i ha obtingut resultats molt esperançadors. Específicament, es van preparar cultius de retina de ratolí i es van separar en dos grups. Un, que era el control, i l’altre, al qual s’induïa una inflamació. Es va obtenir l’espectre Raman de les retines de tots dos grups (control i inflamat) durant vint-i-quatre hores i després es van analitzar els espectres per veure si hi havia algun canvi bioquímic causat per la inflamació. Com que les mostres biològiques contenen un nombre elevat de molècules diferents, i l’espectre Raman és molt ric per a cadascuna d’aquestes molècules, l’anàlisi de l’espectre Raman esdevé complex. Per això es van desenvolupar i aplicar tècniques estadístiques avançades de multivariable per poder extreure’n els resultats. En concret, es va utilitzar la tècnica de resolució multivariant de corbes (multivariate curve resolution, MCR) per monitorar el contingut molecular de les retines durant les vint-i-quatre hores. Aquesta tècnica estadística descompon l’espectre Raman de la mostra en l’espectre de components moleculars presents en la mostra i la seva concentració. El resultat que es va trobar va ser que després de deu o dotze hores (en què s’espera un màxim d’inflamació del teixit) el grup de retines inflamades presentava una alta concentració de mediadors immunitaris (lipooxigenasa, òxid nítric-sintasa i factor de necrosi tumoral). Al llarg del procés inflamatori també es van observar canvis en molècules involucrades en la producció energètica (citocrom C, fenilalanina i NADH/NAD+) i una reducció de la fosfatidilcolina. A més, utilitzant l’algoritme partial least squares-discriminant analysis (PLSDA, que busca parts en l’espectre diferents que discriminen dos grups d’espectres) s’han pogut discriminar espectres de retines sanes i inflamades amb un 99 % de sensibilitat i especificitat, cosa que representa un molt bon resultat per a l’aplicació clínica.


Una mirada val més que mil paraules

Una mirada val més quexxxxxxxxxxxxxxxx mil paraules

estadístiques i SERS per expandir l’aplicabilitat de l’ER en bioquímica: des de molècules individuals fins a cèŀlules i teixits. Imatge 2. Feix de llum interactuant amb la retina. La llum és dispersada i conté fotons Raman.

Aquest estudi presenta una tècnica molt prometedora per a la detecció, estudi i moritoratge de malalties neurodegeneratives de manera ràpida i no invasiva. Aquesta tècnica es basa en una tecnologia fotònica i en el desenvolupament d’algoritmes estadístics per interpretar els resultats. Així, amb l’espectroscòpia Raman s’han identificat uns biomarcadors de neuro­ inflamació, informació que no s’hauria pogut obtenir d’una altra manera. L’anàlisi dels canvis moleculars a escala de la retina de manera no invasiva incrementarà el nostre coneixement sobre pèrdua neuronal i neuroinflamació i ens ajudarà a desenvolupar estratègies noves neuroprotectores per al cervell. A més permetrà establir una tècnica rutinària de detecció precoç per a malalties neurodegeneratives.

Raman en l’ICFO Des que es va descobrir l’espectroscòpia Raman el 1928 aquesta tècnica va produir una revolució en l’àrea de la química analítica. Gràcies als darrers avenços tècnics, les expectatives d’aplicar-la en biomedicina han augmentat. La possibilitat de detectar i monitorar de manera no invasiva i amb alta especificitat l’evolució del contingut bioquímic en mostres biomèdiques es va convertir en un repte a assolir. No obstant això, les propietats inherents a la dispersió Raman han fet que el seu ús per a aplicacions biomèdiques no hagi estat completament explotat des del seu descobriment. En la darrera dècada, l’espectroscòpia Raman sensibilitzada en superfície (surface enhanced Raman spectroscopy, SERS) i l’anàlisi multivariant s’han erigit com a possibles solucions per superar la baixa eficiència i la complexitat dels senyals Raman de material biològic. El treball fet en l’ICFO representa un pas endavant envers la combinació i l’ús d’anàlisis

En l’ICFO s’han dut a terme projectes d’investigació relacionats amb l’anàlisi biomecànica de molècules individuals (DNA) i eritròcits combinant pinces òptiques amb l’ER i SERS. Es van desenvolupar mètodes estadístics com la correlació 2D i l’anàlisi de components principals (PCA) per mostrar les propietats estructurals tan importants de cèŀlules i teixits. D’altra banda, també s’han fet investigacions relacionades amb el monitoratge de tractaments com la teràpia fotodinàmica (PDT) en cèŀlules glials combinant l’espectroscòpia amb tècniques estadístiques. A més, s’han investigat sistemes més complexos per seguir l’evolució molecular de cèŀlules i teixits durant un procés bioquímic. Així, es va utilitzar l’anàlisi de components principals (PCA) per estudiar el metabolisme lipídic en diferents línies ceŀlulars de càncer de mama relacionant-lo amb el seu grau de malignitat. Malgrat això, l’anàlisi de components principals (PCA) no proporciona components significatius que podrien ser assignats directament a espectres moleculars Raman. Conseqüentment, es va proposar el mètode estadístic de resolució multivariant de corbes (MCR) per extraure components moleculars amb significat físic i químic que varien durant un procés bioquímic i van aplicar-lo a estudiar la transició epiteli-mesènquima (EMT) en cèŀlules cancerígenes. Això va permetre identificar metabòlits implicats en el procés EMT, relacionats amb l’inici de la metastasi. Tal com descrivim en l’inici de l’article, es va monitorar la composició de la retina ex vivo quan s’induïa una neuroinflamació, i això representa la primera aplicació de l’MCR per descompondre i monitorar el contingut d’un teixit biològic amb ER, i identifica biomarcadors per a la detecció precoç de proTreballs de la Societat Catalana de Biologia

cessos neuroinflamatoris. Això representa el primer pas envers l’establiment d’una tècnica no invasiva i de diagnosi primerenca d’esclerosi múltiple o altres malalties neurodegeneratives. Aquesta investigació feta en l’ICFO ha revelat un potent mètode que afegeix una nova dimensió al camp de la química analítica. S’ha pogut extreure informació amb alta especificitat i sensibilitat de manera no invasiva, ràpida i sense preparació especial de la mostra. Les mostres es poden monitorar in vivo, i quantificar-ne els components moleculars difícils o impossibles d’extreure amb la tecnologia actual.

Sobre SLN El grup a què pertanyen els autors que signen l’article duu a terme les seves activitats dins de la Unitat de Microscòpia de Llum de Superresolució i de Nanoscòpia (super-resolution light microscopy & nanoscopy, SLN). La triple missió del grup és dur a terme activitats de recerca i desenvolupament amb les tècniques més avançades de microscòpia de llum, proveir de sistemes d’imatge més avançats dels que estan disponibles comercialment avui dia, capacitar investigadors en l’avantguarda de les tècniques de microscòpia i, finalment, facilitar l’ac­cés a les aplicacions biomèdi­ques més exigents. Així, doncs, en termes de recerca en l’SLN ens encarreguem de desenvolupar noves tècniques de microscòpia i de l’aplicació en reptes biològics. Així, en coŀlaboració en projectes nacionals i internacionals, hem desenvolupat una nova generació de làsers compactes per a microscòpia, i incorporem nous components i equipaments a la fotònica. La possibilitat d’involucrar diverses disciplines de l’àrea de la biomedicina, com ara l’oncologia, la neurobiologia i l’oftalmologia, permet tenir esperances de diagnòstic precoç. •

63


Flaix de ciència

Els peixos són formidables nedadors (i nedar és bo per a ells) Josep V. Planas. Departament de Fisiologia i Immunologia, Facultat de Biologia, Universitat de Barcelona i Institut de Biomedicina de la Universitat de Barcelona (IBUB)

Quan preguntem a un nen què és el que fa un peix, la resposta és: neda! La natació és un comportament locomotor innat en els peixos i que els permet desplaçar-se dins del medi aquàtic. Està associada amb el desenvolupament de l’animal, amb el seu creixement i amb la capacitat per reproduir-se amb èxit en el seu estat natural. Per tant, la natació és essencial per a la supervivència dels peixos. La natació és un comportament natural i innat en els peixos i és un aspecte integral del cicle vital de moltes espècies en l’ambient aquàtic. Els peixos tenen una enorme varietat d’estratègies locomotores que estan lligades al seu comportament alimentari i de fugida davant de depredadors, a les seves preferències ambientals (llum, temperatura, salinitat, profunditat, etc.), als seus comportaments socials i reproductors, etc. Els exemples més espectaculars de les estratègies locomotores es troben en aquelles espècies que fan llargues migracions alimentàries i reproductives, com ara les tonyines, els salmònids i els anguíŀlids. És força coneguda l’extraordinària capacitat natatòria d’espècies com la tonyina blava (Thunnus thynnus), els salmons del Pacífic (Oncorhynchus sp.) i l’anguila europea (Anguilla anguilla).

catàdroma, ja que migren al mar per reproduir-se. Els salmons del Pacífic, per contra, neixen en petits tributaris dels grans rius de la costa oest d’Amèrica del Nord i migren riu avall, segons les espècies milers de quilòmetres, fins a arribar a l’oceà, on fan llargues migracions. Quan han completat el creixement fins a esdevenir adults, retornen riu amunt al lloc exacte del seu naixement. Aquest fenomen es coneix com a migració anàdroma, ja que migren de l’oceà als rius per reproduir-se. Tant per a les anguiles com per als salmons, com també per a mol-

Les migracions reproductives Els salmons i les anguiles fan possiblement les migracions reproductives més espectaculars. Les anguiles neixen en un lloc encara no identificat a la mar dels Sargassos, a l’Atlàntic occidental, i neden aproximadament sis mil quilòmetres fins a la costa europea, on colonitzen els rius d’aigua dolça d’Europa central. Creixen fins a convertir-se en adults i tornen al mar per tornar a nedar sis mil quilòmetres més cap a les àrees reproductives on van néixer. Aquest itinerari es coneix com a migració Imatge 1. Salmons americans (Oncorhynchus).

64

Treballs de la Societat Catalana de Biologia

Imatge 2. Tonyina atlantica (Thunnus

thynnus).

tes altres espècies, la capacitat natatòria és fonamental per completar la totalitat, o almenys part, del seu cicle vital. Des d’un punt de vista de l’individu, la natació és un comportament estretament relacionat amb altres processos fisiològics que els peixos experimenten durant el seu cicle vital, com pot ser el desenvolupament embrionari, el creixement, l’estat metabòlic, el


Els peixos són formidables nedadors xxxxxxxxxxxxxxxx

desenvolupament i la maduració gonadal, etc. Per tant, es pot considerar que la natació és en part essencial per a la supervivència i és també un factor important que determina l’eficiència biològica (fitness) en els peixos.

La fisiologia de la natació L’estudi de la fisiologia de la natació en peixos ha permès descobrir que, com en els humans, l’exercici és bo per als peixos i que la natació provoca adaptacions fisiològiques que contribueixen a una millora de la capacitat natatòria. Per exemple, la natació en peixos té importants efectes cardiovasculars que condueixen a una millor funció cardíaca i distribució de la sang. La natació, en ser una funció de la capacitat contràctil del múscul esquelètic, també té efectes adaptatius sobre aquest teixit, i augmenta la massa muscular per hipertròfia de les fibres musculars i la vascularització del múscul per incrementar l’arribada d’oxigen i nutrients necessaris per mantenir l’estat contràctil. Per tant, un dels efectes positius de la natació en moltes espècies de peixos estudiades és l’estimulació del creixement, no solament per l’augment de la massa muscular, sinó també perquè estimula la ingesta i el metabolisme de l’animal. És important remarcar que l’estimulació del creixement per natació s’observa únicament quan els peixos neden a la seva velocitat òptima, que és la velocitat que requereix el mínim cost energètic possible, i, normalment, en condicions aeròbiques. S’ha demostrat que la natació continuada a velocitats per sobre de la velocitat òptima i prop de la velocitat critica, que és la màxima velocitat de natació que els peixos poden mantenir, provoca un balanç energètic negatiu i possiblement alteracions estructurals en el múscul esquelètic.

Altres efectes de la natació A més d’estimular el creixement, la natació també s’ha demostrat que té altres efectes positius. En primer lloc potencia la resposta immunitària enfront de patògens vírics.

També redueix l’estrès per confinament o captura. I, en tercer lloc, regula el desenvolupament gonadal i la reproducció. Aquest últim aspecte reflecteix la interrelació que hi ha entre natació i reproducció, principalment en espècies migratòries. Tant en anguiles com en salmònids femelles, la natació provoca una aturada del desenvolupament ovàric possiblement per evitar el cost energètic i les conseqüències hidrodinàmiques del creixement gonadal que anirien en detriment d’una activa natació migratòria.

Imatge 3. Granja de truites (Salmo trutta).

estructures adients per induir la natació en captivitat en aqüicultura permetrà obtenir una millora en la producció sota condicions més fisiològiques i, possiblement, millors per a l’estat de salut i benestar dels peixos: peixos sans i saludables per a un consum més racional. •

Actualment, l’estudi dels efectes positius de la natació en peixos és un tema d’enorme interès en relació amb el cultiu i la producció de peixos en aqüicultura. Malauradament, moltes espècies en aqüicultura no poden tenir un comportament natatori normal en les condicions d’estabulació emprades, per culpa del tipus de tancs en els quals els peixos estan confinats, de corrents d’aigua insuficients, o de densitats massa altes. Per tant, els peixos cultivats en aqüicultura no poden experimentar els beneficis fisiològics que comporta la natació i que sí que aprofiten els seus conspecífics salvatges. Molt probablement, el desenvolupament d’infraTreballs de la Societat Catalana de Biologia

65


Premi d’Estudiants de la SCB

Vulnerabilitat per psicosi mesurada en població sana catalana Elionora Peña Lozano. Unitat d’Antropologia, Departament de Biologia Animal, Facultat de Biologia, Universitat de Barcelona

Les funcions cerebrals humanes que tenen a veure amb la manera de sentir o percebre la realitat que ens envolta i, sobretot, de com ens percebem a nosaltres mateixos, estan estretament lligades al procés evolutiu de la nostra espècie i als gens sobre els quals han actuat els mecanismes de selecció natural. La conseqüència d’aquest procés ha estat una espècie primat eminentment social i amb un llenguatge verbal altament desenvolupat, capaç d’establir una complexa relació simbòlica amb la realitat que ens envolta i fonamentalment amb altres éssers humans (Fañanás, 2003). D’aquesta experiència de realitat complexa deriva, en gran mesura, la vulnerabilitat de l’ésser humà per a la malaltia mental. La psicosi és un estat mental alterat en el qual el subjecte perd el judici de la realitat i desenvolupa deliris, aŀlucinacions i desorganització del pensament. Es tracta, doncs, d’un fenomen subjectiu i d’experiència de la ment que recau sobre una etiologia complexa. Els estudis de bessons i famílies descarten la possibilitat d’un model d’herència monogènic, és a dir, l’existència d’un únic gen amb efecte major com a causant de la malaltia, i assenyalen la possible implicació de múltiples gens amb un efecte menor. A més, els estudis epidemiològics suggereixen la implicació de factors ambientals tant pre-

natals (l’ambient uterí) com perinatals (els hàbits en la vida adulta, l’estrès, els esquemes cognitius de cada individu, les experiències viscudes en la infància, etc.). Per aquesta raó, cada vegada és més acceptat el fet que en l’etiologia del trastorn no tan sols hi ha involucrades causes genètiques i ambientals, sinó també la interacció entre aquestes (gens i ambient). Aquesta interacció explicaria per què hi ha en la població individus genèticament vulnerables que quan s’exposen a determinats factors ambientals desenvolupen la malaltia, mentre que d’altres, exposats al mateix ambient, no emmalalteixen.

El fenotip de les psicosis tradicionalment s’ha vist com una entitat dicotòmica en què els individus es classifiquen en sans o malalts. En canvi, des d’un punt de vista epidemiològic, hi ha evidències que mostren que les psicosis es presenten en la natura com una distribució dels seus símptomes, i es manifesten com un fenotip continu. D’acord amb aquest model es considera l’existència en la població d’un ampli ventall de fenotips, que comprèn des de la relativa normalitat, passant per una desviació subclínica, estats d’alt risc, fins al brot manifest de psicosi (la malaltia pròpiament dita). L’estudi d’individus de la població general posa de manifest que alguns comparteixen, amb més o menys grau, característiques cognitives, emocionals i comportamentals amb pacients. Aquests trets reben el nom de esquizotípia, de manera que puntuacions més altes d’aquest tret s’han associat a més risc per patir el desordre. Addicionalment, s’ha vist que aquests trets esquizotípics o símptomes psicòtics atenuats estarien genèticament relacionats amb l’esquizofrènia, és a dir, que probablement alguns dels gens implicats en l’etiologia de l’esquizofrènia també estarien implicats en aquests trets esquizotípics que trobem en les poblacions humanes. En aquest sentit, un estudi previ portat a terme en una mostra de població japonesa suggeria que una variació genètica del gen p250GAP podria augmentar la vulnerabilitat no tan sols a patir esquizofrènia, sinó també a presentar trets de personalitat esquizotípica. L’objectiu del nostre estudi va ser replicar aquest estudi original analitzant quatre marcadors genètics del gen candidat en una nova mostra de 547 individus Imatge 1. Entre tots els factors de risc implicats en l’etiologia de les psicosis, el factor genètic (compartir gens amb una persona afectada) sembla que és el més important. Addicionalment, els estudis epidemiològics han posat de manifest l’existència de múltiples factors ambientals de risc que en interacció amb la vulnerabilitat genètica dels individus poden donar lloc al trastorn.

66

Treballs de la Societat Catalana de Biologia


Vulnerabilitat per psicosi mesurada en poblacióxxxxxxxxxxxxxxxx sana catalana

Llegenda. • Puntuacions baixes-mitjanes: individus amb poca vulnerabilitat. • Puntuacions elevades: individus de risc. • Puntuacions més altes: pacients.

com l’esquizotípia, amb la finalitat de facilitar la detecció de gens de risc de manera més eficaç. Així doncs, treballs com el que hem portat a terme posen de manifest que la importància d’identificar i estudiar els individus amb esquizotípia es troba en el fet que això facilitaria la determinació de factors etiològics i evitaria les complicacions i la confusió generades pels efectes de l’esquizofrènia, com ara l’hospitalització, medicació, estigma social, etc., i alhora, assistiria en el desenvolupament d’intervencions primerenques i tractaments profilàctics. • sans de la població catalana. Les nostres anàlisis posen de manifest que variants del gen analitzat mostrarien signes d’associació amb una de les dimensions de l’esquizotípia, i els individus portadors d’aquesta variant genètica serien aquells que presentarien puntuacions més grans d’esquizotípia, i per tant serien individus amb més risc de patir el trastorn. Així, els nostres resultats donen suport a la hipòtesi del continu que suggereix que alguns dels factors de risc per a esquizofrènia són comuns per a aquests fenotips intermedis més homogenis (esquizotípia).

A més, d’acord amb els nostres resultats, el gen p250GAP és un gen candidat potencial per a esquizofrènia, i per tant és de gran interès fer nous estudis per analitzar-ne la variabilitat en mostres d’origen europeu. La inversió tant personal com econòmica portada a terme en els últims anys en la cerca de gens candidats per a l’esquizofrènia ha estat molt important, però tot i així els resultats no han estat gaire fructífers, en part per la gran complexitat etiològica de la malaltia. Una de les propostes per cercar gens candidats ha estat l’estudi de fenotips intermedis de la malaltia que minven la complexitat,

Bibliografia Fañanás, L. (2003). «Hacia un entendimiento genético-ambiental de la salud mental». A: Avances neurocientíficos y realidad clínica. Madrid: Ediciones Fundación Cerebro y Mente, p. 25-44.

johns, L. C.; Os, J. van (2001). «The

continuity of psychotic experiences in the general population». Clinical Psychology Review, 21 (8): 1125-1141.

Elionora Peña Lozano (Barcelona, 1990) és graduada en ciències biomèdiques per la Universitat de Barcelona (UB) (2013) i va cursar el màster «Iniciación a la investigación en salud mental» de la Universitat de Cantàbria (2014). Des del 2012 coŀlabora en la Unitat d’Antropologia (Facultat de Biologia, UB) amb la doctora Araceli Rosa.

Treballs de la Societat Catalana de Biologia

67


Premi Gemma Rosell i Romero

Les deteriorades bigues de l’envelliment cutani Com intervé el coŀlagen en l’envelliment de la nostra pell Víctor Marcos Garcés. Departament de Patologia, Facultat de Medicina i Odontologia, Universitat de València

Ningú no vol tindre arrugues. En la societat actual, amb una població cada vegada més envellida i individus que volen apropar-se el màxim possible a l’ideal de bellesa (independentment de l’edat), l’envelliment de la pell adquireix una importància enorme. Però quins mecanismes moleculars, ceŀlulars i histopatològics subjeuen a aquest procés? Conèixer-los és fonamental per plantejar possibles tractaments. I una molècula molt coneguda, el coŀlagen, sembla un dels principals culpables del deteriorament de l’arquitectura cutània que ocorre, inexorablement, amb el pas dels anys.

broblasts: amb el pas dels anys, aquests esforçats obrers es van fent vells i cada vegada els costa més construir les fibres. Aquest és el model de la senescència ceŀlular, segons el qual les cèŀlules, al final de la seva vida replicativa, adquireixen un patró anòmal de secreció de substàncies. El rellotge ceŀlular va avançant inexorablement. Tempus fugit, amics fibroblasts. Tempus fugit.

Què és l’envelliment de la pell?

I si els fibroblasts estan estressats, encara pitjor. A escala ceŀlular, el principal tipus d’estrés és l’oxidatiu, provocat principalment per les espècies reactives de l’oxigen (ROS), que es generen com a subproducte del metabolis-

«El fet que el cos siga real no significa que no puga ser també simbòlic». Així expressava l’antropòleg Marshall Sahlins el fet que el cos té una important funció sociocultural. La pell que ens envolta actua com a targeta de presentació, i els signes associats a l’envelliment s’interpreten com a dolents. Ningú no vol envellir, i això condueix a una cerca contínua de l’aparença jove i sana de la pell, a qualsevol edat. L’envelliment de la pell s’ha convertit en un problema que necessita una solució, i més hui dia, a causa de l’envelliment progressiu de la població. Però, què s’entén per envelliment cutani? Es podria definir com el procés de deteriorament morfològic (estructural) i fisiològic (funcional) que ocorre en aquest teixit amb el pas dels anys. Tothom envelleix, i això inclou tots els òrgans i teixits de l’organisme. En la major part d’aquests teixits, el temps és el director de l’orquestra de l’envelliment: com en el Titanic, els músics (cèŀlules) continuen tocant, mentre que el vaixell (matriu extraceŀlular), cada vegada més deteriorat, va perdent progressivament la seva funcionalitat. Aquest és l’envelliment intrínsec o cronològic. Però la pell ens recobre externament i està exposada constantment a factors agressors del medi extern, que determinen també un envelliment extrínsec. La radiació UV (fotoenvelliment) i el tabac en són els principals factors, responsables d’un envelliment prematur, accelerat i amb característiques diferenciades de l’envelliment intrínsec. Envellir és «normal» i fisiològic, però això no vol dir que no s’associe a determinades

68

malalties. Queratosis seborreiques i actíniques, càncers com el carcinoma basoceŀlular o el de cèŀlules escamoses, pruïja, úlceres per pressió, sequedat i fragilitat cutània, són només alguns exemples de problemes cutanis característics de la pell envellida. L’envelliment no és només un problema estètic.

El coneixement dels culpables Com en una bona peŀlícula de detectius, els investigadors intenten descobrir qui són els culpables del crim de l’envelliment cutani. Analitzen l’escena del crim, la pell, amb tècniques histopatològiques; prenen mostres i mesuren diferents paràmetres moleculars com si d’una prova de DNA es tractara; i fins i tot aïllen els sospitosos i fan que es reproduïsquen en plaques de Petri (cultius ceŀlulars). Cada vegada és més clar que faltarien dits a les mans per assenyalar aquests culpables: l’envelliment de la pell és un procés complex en el qual intervenen nombrosos actors. Es podria pensar en la pell com en un edifici en contínua remodelació i reconstrucció. Les bigues que conformen l’edifici serien les molècules de la matriu extraceŀlular. La major part de les bigues són gruixudes, sòlides i estan preparades per suportar forces de tensió i pressió: són les fibres de coŀlagen de tipus i. També hi ha altres bigues, com les fibres elàstiques, més menudes, flexibles i especialitzades a adaptar-se al medi. I si hi ha bigues, hi ha d’haver algú que les construïsca. Els obrers de l’edifici de la pell són els fibroblasts, unes cèŀlules que viuen a la dermis cutània i que es dediquen dia i nit a sintetitzar fibres de la matriu extraceŀlular. Els principals sospitosos podrien ser els fiTreballs de la Societat Catalana de Biologia

Figura 1. Canvis histopatològics en la dermis cutània al llarg de la vida. La densitat de les fibres de coŀlagen (blau) es redueix en l’etapa adulta (maduració) i encara més en edats més avançades. Noteu també que el grossor de les fibres és màxim en l’etapa adulta en la dermis reticular, amb el coŀlagen disposat en les tres direccions de l’espai, mentre que en una pell envellida les fibres han perdut grossor i es disposen en paraŀlel. Els fibroblasts (rosa) es redueixen en nombre amb el pas dels anys. Adaptat amb permís de «Age-related dermal collagen changes during development, maturation and ageing—a morphometric and comparative study», de Marcos-Garcés V. [et al.], 2014, Journal of Anatomy, 225 (1): 98-108. Copyright 2014 John Wiley & Sons.


Les deteriorades bigues de l’envelliment cutani xxxxxxxxxxxxxxxx

© Imatges Víctor Marcos

me ceŀlular normal. Amb l’envelliment, els nivells d’antioxidants disminueixen, i aquest estrés fa que sintetitzen menys fibres de la matriu extraceŀlular. Per acabar d’agreujar el problema, també alliberen més metaŀloproteases de la matriu (MMP), que són els martells pneumàtics amb els quals trenquen les bigues per després tornar a construir-les... Però en una pell envellida no poden reparar totes les fibres que es destrueixen, i això comporta una pèrdua constant de coŀlagen. Però el temps també passa per als edificis: les bigues poden envellir. Doncs sí, l’envelliment de les fibres de la matriu extraceŀlular és un altre culpable. Una molècula de coŀlagen té una vida mitjana de quinze anys en la dermis cutània, la qual cosa la predisposa a acumular danys, com per exemple productes de la glicosilació avançada (AGE), que, com el corc o la humitat, fan que les fibres de la pell es coŀlapsen per si mateixes si els fibroblasts no les recanvien o reparen.

Obrers, bigues; bigues i obrers Menys fibroblasts i més envellits, menys fibres de coŀlagen i d’altres components de la matriu extraceŀlular... L’edifici de la pell es deteriora durant el procés d’envelliment, i això es pot demostrar si s’observa l’escena del crim: s’ha demostrat aquesta pèrdua de fibres de coŀlagen, que a més es tornen més fines, i això condueix a un gruix més petit

Figura 2. Mesura de la densitat de coŀlagen en la dermis papiŀlar mitjançant anàlisi d’imatge (morfometria). Mostra histològica amb tinció de tricròmic de Masson, a 40× augments.

de la dermis, el principal component de la pell. Fins ara, els protagonistes han estat els obrers, però en els últims anys les bigues estan prenent més protagonisme: al paper aparentment estàtic i merament estructural del coŀlagen s’estan afegint funcions importants i dinàmiques; entre aquestes, estimular mecànicament els fibroblasts per tal que aquests sintetitzen més coŀlagen. Les bigues estimulen els obrers per tal que aquests creen més bigues! Un coŀlagen gruixut i abundant implica molta estimulació mecànica, i els fibroblasts es posen a treballar a tota màquina. Però si el coŀlagen és fi i escàs, l’estímul és més petit. Els fibroblasts creen la matriu extraceŀlular i aquesta, al seu torn, en regula la síntesi parlant amb els fibroblasts. La relació entre obrers i bigues és bidireccional. I queda encara un últim factor. No només

Bibliografia Dayan, N. (2008). Skin aging handbook: an integrated approach to biochemistry and product development. Norwich: William Andrew. Farage, M. A. [et al.] (2011). Textbook of aging skin. Berlín: Springer. Kohl, E. [et al.] (2011). «Skin ageing». J. Eur. Acad. Dermatol. Venereol., 25 (8): 873-884. Marcos-Garcés, V. [et al.] (2014). «Age-related dermal collagen changes during development, maturation and ageing—a morphometric and comparative study». J. Anat., 225 (1): 98-108.

Moragas, A. [et al.] (1998). «Image analysis of dermal collagen changes during skin aging». Anal Quant. Cytol. Histol., 20 (6): 493-499. Varani, J. [et al.] (2006). «Decreased collagen production in chronologically aged skin». Am. J. Pathol., 168 (6): 1861-1868. Zouboulis, C. C.; Makrantonaki, E. (2011). «Clinical aspects and molecular diagnostics of skin aging». Clin. Dermatol., 29 (1): 3-14.

importa la quantitat o el grossor de les bigues, sinó també la disposició, com estan coŀlocades. La perfecció arquitectònica en la dermis cutània s’assoleix quan les fibres de coŀlagen es disposen en les tres direccions de l’espai, de manera aparentment desordenada, perquè així l’estimulació mecànica dels fibroblasts és més gran. Quan la pell envelleix, les fibres es disposen en paraŀlel, estimulen menys els obrers, i aquests no treballen tan bé. No estan contents vivint en un edifici defectuós. L’envelliment cutani és un procés complex i amb protagonistes relacionats entre ells. Els fibroblasts envelleixen i l’estrès oxidatiu els lesiona, mentre que les fibres de coŀlagen acumulen danys, es perden i es disposen de manera anòmala en el teixit. Quin d’aquests factors és l’iniciador, quina és la contribució relativa de cadascú en l’envelliment? I, per descomptat, què es pot fer pel que fa a això? Què en podem fer? Encara s’està lluny de trobar la font de l’eterna joventut de la pell. Durant les darreres dècades, s’han dut a terme molts estudis amb substàncies diverses per intentar evitar o paŀliar els efectes de l’envelliment cutani, però l’evidència científica és escassa. Cal continuar investigant. Obrers, bigues... bigues i obrers. •

Víctor Marcos (Castelló de la Plana, 1991) és estudiant de 6è curs de medicina en la Facultat de Medicina i Odontologia de la Universitat de València. Començà la carrera investigadora l’any 2011, i es va incorporar com a alumne intern al Departament de Patologia de la mateixa universitat. Des d’aleshores, ha assistit a deu congressos científics, ha presentat vuit treballs de recerca (tres dels quals han estat premiats) i ha publicat un article en una revista internacional. També ha estat president del Comitè Organitzador i responsable del Comitè Científic del II Congrés d’Investigació Biomèdica (CIB 2014) i membre del Comitè Organitzador i del Comitè Científic de les Jornades d’Investigació 2012/2013.

Treballs de la Societat Catalana de Biologia

69


Entrevista a

Francisco Guarner Bru Papell Gastroenteròleg i investigador del projecte MetaHIT

«L’enterotip és relativament estable: es pot modificar temporalment, però no de manera permanent» Fa cinc anys els mitjans es van fer ressò dels primers resultats d’un projecte d’envergadura similar al Projecte Genoma Humà, però destinat a estudiar els microorganismes que viuen amb nosaltres. La branca europea del Projecte Microbioma Humà es va centrar en els nostres veïns intestinals i va dur a terme una tasca ingent de seqüenciació i identificació de multitud de microorganismes, la majoria bacteris. D’aquí va sorgir la hipòtesi dels enterotips, segons la qual els humans tindríem tres grans tipus de flora intestinal en funció de si el gènere dominant és Bacteroides, Prevotella o Ruminococcus. La proposta va tenir força repercussió i no va estar exempta de crítiques; per això conversem amb Francisco Guarner, gastroenteròleg de l’Hospital Vall d’Hebron de Barcelona i un dels investigadors rere el consorci europeu MetaHIT. La gran diferència entre el projecte nord-americà —Human Microbiome Project— i l’europeu —Metagenomics of the Human Intestinal Tract (MetaHIT)— és que a l’altra banda de l’Atlàntic es van centrar en la seqüenciació d’un únic gen: l’rDNA 16S, que codifica un component dels ribosomes dels procariotes. En canvi, nosaltres vam seqüenciar tot el genoma microbià, de manera que la quantitat de dades que hem aconseguit és ingent, cosa que ens ha permès guanyar en resolució. Per això podeu postular l’existència dels enterotips? Efectivament. Vam disposar de més solidesa a l’hora d’entendre l’ecosistema que els bacteris formen als nostres budells. Vam tenir arguments per evidenciar que els microorganismes que hi ha no hi són per casualitat, sinó que hi ha una organització: comparteixen nutrients, activitats i informació en el seu propi benefici. La nostra dieta hi pot influir, però hi ha una estructura general global molt determinada per les poblacions de bacteris. I aquest coneixement sorgeix del projecte europeu, no del nord-americà. Però aquesta classificació també ha rebut crítiques, no tothom ho veu amb els vostres ulls. És cert, i bona part d’aquestes crítiques han vingut d’investigadors nord-americans. Afirmen, i amb raó, que els infants no encaixen en la nostra classificació. Però això ja ho vam indicar en el primer article que vam publicar sobre els enterotips. La flora dels infants és

70

Imatge. Francisco Guarner és gastroenteròleg a l’Hospital Vall d’Hebron, membre del Comitè Científic de l’Institut de Recerca Vall d’Hebron i investigador del consorci europeu MetaHIT.

molt inestable, de vegades predomina un gènere i més endavant en predomina un altre; per això no vam fer servir les seves mostres a l’hora de descriure la nostra proposta de classificació, senzillament no encaixen. Als crítics tampoc no sembla encaixar-los que us referiu a gèneres en comptes d’espècies. Si analitzéssim un bosc alpí suís i un d’austríac pel que fa a espècies potser veuríem que són diferents; però probablement no ho serien tant si els analitzéssim sota la lupa del gènere. És possible que en cada bosc hi hagi espècies diferents de pins, però potser en ambdós casos el gènere dominant sigui Pinus. I si comparem el gènere dominant del bosc alpí amb el del bosc amazònic segur que es distingeixen perfectament. Aquest mateix raonament és vàlid per als enterotips, centrar-se molt en el detall pot fer perdre aquesta visió global. Ara bé, hi ha una tercera línia crítica, i és que no sembla que els enterotips tinguin una rellevància clínica. Però això està començant a canviar. A què es refereix? Sabíem que alguns enterotips s’associaven a un tipus de dieta més proteica —Bacteroides— o més vegetariana —Prevotella—, però no havíem detectat malalties concretes associades a un enterotip o un

Treballs de la Societat Catalana de Biologia


Entrevista a Francisco Guarner xxxxxxxxxxxxxxxx

altre. No obstant això, recentment estem observant que més del 70 % dels pacients amb una flora intestinal poc diversa tenen l’enterotip Bacteroides, i que aquest mateix enterotip és més freqüent en diabètics de tipus 2. Per tant, podria ser que sí que tinguessin certa rellevància clínica. En cas de confirmar-se, però, el tractament no podria implicar un canvi d’enterotip, atès que és quelcom relativament estable; es pot modificar temporalment, però no de manera permanent. Però pel que fa a espècies sí que clarament hi ha alteracions associades a malalties, no és així? Sí. Hem pogut observar que hi ha un tipus de disbiosi, una irregularitat microbiana, que es troba present en la malaltia inflamatòria intestinal (MII) i en l’obesitat mòrbida. Hem vist que es redueix un grup de bacteris productors de butirat, que serveix de font d’energia a les cèllules del còlon, i es va substituint per bacteris proteolítics que viuen més enganxats a la paret intestinal i tenen més tendència a provocar inflamacions. Al final, la inflamació depèn de la genètica de cada individu: en alguns casos acaba en malaltia de Crohn, en altres en colitis ulcerosa i en altres en diabetis de tipus 2. I aquesta disbiosi n’és la causa o la conseqüència? Encara no ho sabem del cert, però s’estan fent estudis en aquesta línia. Un dels equips de MetaHIT va dur a terme un transplantament de femta —per sonda nasogàstrica— en afectats de diabetis de tipus 2. En alguns casos, el quadre clínic va revertir, però també es va veure que l’efecte positiu del transplantament no durava gaire, al cap de sis mesos desapareixia. No podia ser així de fàcil. No obstant això, en estudis amb afectats per MII —en què els brots s’alternen amb períodes relativament asimptomàtics— hem observat que algunes espècies de la flora poden ser factors predictius a l’hora d’indicar quan hi haurà un nou brot. Pacients que han perdut espècies crítiques, com ara Faecalibacterium prausnitzii i Akkermansia

«Alguns bacteris de la flora poden ser factors predictius per indicar quan hi haurà un nou brot de malaltia inflamatòria intestinal» muciniphila, tenen més risc de patir un brot al cap d’un any. I això és important, perquè tenim tractaments per aconseguir que un brot de MII acabi remetent, però no sabem quan se’n tornarà a produir un altre. I no es pot aturar la desaparició d’aquestes espècies crítiques? Bé, per això estem estudiant l’ús de prebiòtics i de probiòtics. Els prebiòtics són substàncies que nosaltres no digerim, però que afecten el creixement dels bacteris del còlon. Com que sabem que hi ha factors microbians implicats en una mala evolució de la MII, el nostre objectiu és testejar diversos prebiòtics per mirar de restaurar aquests factors i veure si això es tradueix en una ampliació del temps entre brots o un millor pronòstic. Val a dir que aquesta recerca l’estem fent amb el suport de l’Associació de Malalts de Crohn i Colitis Ulcerosa de Catalunya (ACCU), que organitza contínuament activitats per recollir fons, cosa que agraïm moltíssim. Queda dit. Compteu també amb la coŀlaboració de la indústria alimentària? Sí, hem fet diversos estudis en coŀlaboració, tant pel que fa a prebiòtics com probiòtics. Amb Danone, per exemple, vam fer algun estudi pilot i vam observar que els probiòtics típics de l’alimentació van bé en aquests malalts, però no tenen un efecte curatiu. Es refereix a bifidobacteris i lactobacils? Els hem estudiat tots dos. Amb Bifidobacterium vam aconseguir millorar la qualitat de la flora només en aquells malalts que es trobaven en una situació millor; en pacients en fase aguda hi havia poca resposta. I això que ho vam fer servir juntament amb el tractament habitual, però no va ser suficient. De tota manera, els probiòtics comuns són ben tolerats per malalts de MII, però realment són bacteris que transiten pel nostre sistema digestiu sense romandre-hi, no són propis del nostre ecosistema intestinal. •

«Fem estudis amb prebiòtics per mirar de restaurar la flora i veure si això es tradueix en una ampliació del temps entre brots o un millor pronòstic» Treballs de la Societat Catalana de Biologia

71


Entrevista a

Daniel Simberloff Bru Maria Papelldel Mar Cendra Gascón i Eduard Torrents Serra Grup d’Infeccions bacterianes: teràpies antimicrobianes de l’Institut de Bioenginyeria de Catalunya (IBEC) Ecòleg, catedràtic a la Universitat de Tennessee (EUA) i Premi Ramon Margalef d’Ecologia 2012

«Tots els ecosistemes són vulnerables a l’invasor adient» Rebre un premi de la importància del Margalef és un bon reconeixement a la feina feta, però acostuma a comportar un dies esgotadors d’entrevistes i declaracions per a multitud de mitjans de comunicació. He de reconèixer que Daniel Simberloff ho porta molt bé, no sóc el primer a entrevistar-lo i tampoc no seré l’últim. No perd el somriure en cap moment. Sembla que està encantat de parlar de la seva feina, i també entusiasmat amb el premi. En acabar la conversa, em mostra el seu exemplar de Perspectives in ecology theory, de Ramon Margalef, i em confessa que és un orgull rebre el premi en memòria d’un científic tan inspirador i admirat. No puc evitar pensar que potser Simberloff, amb més de quaranta anys dedicats a l’ecologia, també hagi esdevingut una inspiració per a les noves generacions, si més no en l’àmbit de la biologia de les invasions. En general, els mitjans es fan ressò de les invasions més espectaculars i vistoses: una espècie de pitó que ha envaït Florida i devora caimans o una vespa gegant que aniquila multitud d’eixams d’abelles de la mel a França. Tenen la seva importància, és clar, però normalment aquests casos no són els que provoquen els problemes ecològics més greus. Ah, no? El tipus d’invasió amb efectes més devastadors és el que comporta canvis complets de l’ecosistema. Transformar un bosc en una praderia o viceversa, com han fet algunes plantes invasores, és catastròfic, perquè implica un canvi en tot l’entorn i afecta totes les espècies que hi viuen. Posi-me’n un exemple. Bé, un bon exemple aquí a la mediterrània és el de Caulerpa taxifolia. És una alga molt resistent i força tòxica que ha envaït moltes praderies marines de posidònia, i ha afectat de retruc els peixos i invertebrats que hi vivien. En l’àmbit terrestre, també teniu el cas de Carpobrotus edulis. És una petita planta suculenta que forma grans tapissos on només es troba aquesta espècie, desplaça les plantes natives i, per tant, modifica tot l’entorn. I també ens estan envaint els ailants, no? Sí, i potser durant molt temps no els hem prestat l’atenció que mereixien. Ailanthus altissima és una espècie d’arbre molt usada en ornamentació que creix ràpidament. Però, a més, modifiquen la composició de nutrients del sòl i alliberen substàncies químiques que són

72

tòxiques per a altres plantes, de manera que tenen la capacitat de canviar paisatges sencers. Als EUA han tingut efectes devastadors. I què fa que aquestes espècies siguin tan invasores? El cert és que la cerca de trets que fan que una espècie sigui invasora ha estat una mena de Sant Grial de la biologia de les invasions. Però al meu parer, no crec que es tracti d’un pla de recerca gaire fructífer. Per què no? Doncs perquè cada invasió és bastant idiosincràtica. Cada espècie interacciona amb moltes altres, de manera que hi ha molts factors individuals que afecten el procés d’invasió. A més, també hi ha interaccions entre l’espècie i l’ambient, cosa que afegeix encara més factors a l’equació. Em resulta difícil pensar a aconseguir una llista de trets infalibles a l’hora de determinar si una espècie serà invasora o no. Entenc, però... Fixa’t, et posaré un exemple. Hi ha espècies que són altament invasives en uns indrets, però gens en uns altres. El pardal xarrec (Passer montanus) és un ocell molt comú a Europa que va ser introduït als EUA fa un centenar llarg d’anys. No obstant això, des d’aleshores, roman quasi exclusivament als voltants de Sant Louis, entre Missouri i Illinois. No ha tingut gaire èxit estenent-se a d’altres indrets.

Treballs de la Societat Catalana de Biologia


Entrevista a Daniel Simberloff xxxxxxxxxxxxxxxx

On vol anar a parar? Doncs resulta que aquesta mateixa espècie introduïda a Austràlia ha tingut un èxit enorme. S’ha estès per molts indrets, fins al punt que és un dels ocells més comuns als parcs australians, i això afecta negativament la niuada d’altres ocells autòctons. Llavors tenim la mateixa espècie, els mateixos trets, però no invasiva en un lloc i molt invasiva en un altre.

© Rubén Moreno, Generalitat de Catalunya.

Ja veig, però suposo que hi ha trets que hi predisposen, no? Òbviament, hi ha una sèrie de característiques, com, per exemple, l’habilitat per autofertilitzar-se en les plantes, que fan que una espècie tingui més números a l’hora de protagonitzar una invasió. Però per a cadascun d’aquests trets pots trobar una espècie que el presenta però que no és invasiva. Doncs analitzem l’entorn. Què fa que un indret sigui més vulnerable a ser envaït? Ah! Aquesta és l’altra cara de la moneda del Sant Grial de la biologia de les invasions; però puc apuntar algunes idees pel que fa a això. La primera és que tots els ecosistemes són vulnerables a algun invasor, al més adient. Per molt invulnerable que sembli un ambient, sempre trobaràs algun invasor que se salta les defenses. Sembla lògic. Es diu habitualment que els ecosistemes menys vulnerables són els boscos tropicals i els boreals. La meva sensació és que probablement l’asseveració és falsa en tots dos casos. En el cas dels boscos tropicals ja tenim alguns exemples d’invasions importants, i pel que fa als boreals el cert és que no hi ha hagut casos massius, però sí petites incursions. Com ara? Hi ha hagut invasions menors de pi roig (Pinus sylvestris) al Canadà, tot i que no s’ha estès gaire. I també es va plantar una espècie de pi americà, Pinus contorta, a l’àrea més septentrional de Suècia, però no sembla que hagi envaït boscos nadius encara. El cert és que no hi ha gaire espècies adaptades a l’entorn boreal, però n’hi ha; de manera que probablement es tracta d’una qüestió que hi arribi l’espècie adequada. Es pot predir una invasió? La millor predicció ha estat sempre analitzar si es tracta d’una espècie que s’ha documentat com a invasora amb anterioritat o bé si està relacionada amb una espècie invasora. S’han fet molts estudis, sobretot amb finalitats reguladores. Per exemple, el govern australià utilitza un sistema d’avaluació del risc per a plantes. Si vols entrar plantes al país has d’omplir un formulari que conté una cinquantena de preguntes, moltes de les quals relatives a trets concrets, com ara la reproducció, quantes llavors produeix, sobre quin tipus de sòls creix, etc. Són molt curosos, els australians. El resultat del test els permet decidir si permetre l’entrada d’una determinada planta és arriscat o no, però es tracta d’una regla molt general. S’han permès plantes que després han esdevingut problemàtiques i a d’altres els han impedit l’entrada malgrat que possiblement no haurien tingut conseqüències greus.

Suposo que tracten de curar-se en salut, perquè una invasió pot causar pèrdues econòmiques importants, no és així? De fet, un estudi molt detallat de David Pimentel i el seu equip a la Universitat Cornell va concloure que el cost econòmic global de totes les invasions biològiques als EUA era de 120.000 milions de dòlars anuals. Déu n’hi do! I de la llista d’invasions, les que tenen un impacte més gran són les que causen plagues en l’agricultura, com ara l’àfid Diuraphis noxia, que afecta principalment els cultius de cereals, i el barrinador del blat de moro europeu (Ostrinia nubilalis). Igualment greus són les plagues per a la ramaderia. I també n’hi ha que no són plagues però que tenen conseqüències nefastes igualment, com ara el musclo zebra (Dreissena polymorpha), almenys a l’Amèrica del Nord i el Regne Unit. Malauradament aquí també en tenim. Doncs als EUA suposa una despesa enorme! Perquè infesta ports, plantes de tractament d’aigua i canonades, de manera que cal gastar anualment centenars de milers de dòlars per netejar totes aquestes instaŀlacions. Un altre exemple que afecta l’agricultura i la ramaderia alhora és el del bromus teulader (Bromus tectorum). Quin problema causa? Milions d’hectàrees de pastures han estat envaïdes per aquesta herba ruderal euroasiàtica, que pràcticament no té utilitat per alimentar el bestiar i que, a més, ha reemplaçat espècies natives. I és que sembla que contribueix a fomentar els incendis, li serveixen per perpetuarse. Sobreviu al foc mentre la resta de plantes sucumbeixen i aleshores té més terreny lliure per colonitzar. Entrem en política: creu que els governs són conscients del problema? Crec que sí que ho són, però la pregunta és què han fet per plantar cara a les invasions. Alguns països com Nova Zelanda i Austràlia han estat molt agressius intentant controlar el problema. Altres, com els EUA i Canadà, han adoptat algunes mesures, però no tan efectives. Al Tercer Món crec que també en són conscients, però senzillament tenen molts altres problemes greus. I a Europa? Europa és un cas molt particular. Moltes nacions, moltes fronteres, però sense un govern comú. En realitat, la Comissió Europea (CE) té directives molt estrictes per al control de les invasions biològiques, però el problema és que correspon a cada país traduir-les en llei i aplicar-les. Alguns ho fan, d’altres fins a cert punt i d’altres gens. Vist així, és un problema. I també hi ha l’inconvenient dels països que no són membres de la UE. T’explicaré una anècdota. He fet molta recerca sobre la mangosta petita de l’Índia (Herpestes auropunctatus). És de mida menor que les mangostes natives que teniu a Espanya, però està considerada per la Unió Internacional per a la Conservació de la Natura (IUCN) com un dels pitjors invasors del món. I és, sens dubte, un dels mamífers invasors més perillosos.

Treballs de la Societat Catalana de Biologia

73


I com ha arribat a Europa? Tal com ja s’havia fet en altres illes, com ara Hawaii, Okinawa i les Fiji, aquesta mangosta va ser introduïda en la dècada de 1920 en una illa de l’Adriàtic, bàsicament en un intent de controlar la població de rates. No cal dir que l’experiment no va resultar i que, actualment, aquests voraços mamífers ja es troben en terra ferma a Croàcia, amb petites poblacions també a Bòsnia i Hercegovina i Montenegro. I són terribles! Ataquen rèptils, amfibis i ocells, incloent-hi pollastres i galls d’indi, de manera que són una autèntica plaga. I el perill és que s’estenguin.

Suposo que quan hi ha una invasió cal actuar-hi, però no seria millor mirar de prevenir-la? És clar! És com en medicina: més val prevenir que curar. Però hi ha dificultats: calen polítiques que estableixin inspeccions, cal portar a terme aquestes inspeccions i, si cal, prohibir l’entrada de determinats productes al país. I això requereix recursos, no exageradament alts, però cal destinar-hi diners. A més, en aquests casos també podem topar amb l’Organització Mundial del Comerç (OMC). Amb els interessos comercials hem topat! Quan un país prohibeix l’entrada d’un producte comercial al seu territori sovint és requerit per l’OMC perquè demostri quantitativament que hi ha un risc, perquè al contrari podria considerar-se proteccionisme econòmic. El problema és que avaluar quantitativament el risc d’una invasió és molt difícil, hi ha massa factors a tenir en compte, bàsicament tota la probabilística associada a un ésser viu i la seva interacció amb l’entorn.

És descoratjador.

Sembla impossible.

És el clar reflex del problema que considero que té Europa i les seves fronteres. És probable que la mangosta petita de l’Índia arribi en breu a Albània i Grècia. I també pot estendre’s cap al nord, perquè pot suportar climes bastant freds. De manera que tot sembla indicar que Europa serà envaïda per un dels pitjors invasors del món.

A més, cal tenir en compte que apostar per la prevenció seria apostar pel futur a llarg termini, i qualsevol decisió racional hauria de basar-se en aquesta premissa, però tots dos sabem que en política les decisions no sempre es prenen de manera racional. •

© Rubén Moreno, Generalitat de Catalunya.

Exactament. Per això, l’ideal seria una resposta a escala europea, perquè és tot el territori del continent el que corre perill. Però quan vaig posar-me en contacte amb la Direcció General de Medi Ambient de la CE em van dir que coneixien el problema i l’entenien, però que no podien fer-hi res perquè els països afectats no són dins la UE, de manera que no poden destinar-hi pressupost.

74

Treballs de la Societat Catalana de Biologia


Premi Nobel de Fisiologia o Medicina 2014

Figures adaptades de Mattias Karlén © Comitè del Nobel de Fisiologia o Medicina.

El sistema de navegació del cervell

xxxxxxxxxxxxxxxx

Cada dia, milions de persones prenem la ruta que ens ha de dur a la feina. La coneixem tan bé que potser podríem fer-la a ulls clucs i tot. Sense ser-ne gaire conscients, el nostre cervell fa una ingent tasca diària d’integrar la informació sensorial amb la coordinació del moviment i els records que tenim de la ruta per saber on som a cada moment i fer que el desplaçament sigui precís i directe cap a la nostra destinació sense més incidències. Fins aquí, res fora de l’habitual.

una cèŀlula concreta de l’hipocamp que s’activa. Però si l’animal es desplaça, aquesta neurona deixa d’emetre senyal i se n’activa una altra de diferent. És a dir, en funció de la posició que la rata ocupa en l’espai, s’activen unes cèŀlules de l’hipocamp o unes altres. Aquest patró d’activació no s’havia vist mai, i va portar al descobriment d’aquestes neurones, que són les encarregades d’elaborar un mapa cognitiu del nostre entorn i, a més, de mantenir-lo en memòria per a properes ocasions.

afectades en estadis inicials de la malaltia d’Alzheimer. L’alteració d’aquest sistema de navegació explicaria per què molt sovint els afectats són incapaços de trobar el camí de tornada a casa. Tal com apunten Kiehn i Forssberg, no es pot descartar que investigacions posteriors permetin conèixer millor aquestes alteracions i, per què no, trobar una via per poder revertir-les en un futur no gaire llunyà. •

El mecanisme cerebral que permet dur a terme una activitat aparentment tan rutinària no es va començar a dilucidar fins al 1971, quan John O’Keefe i Jonathan Dostrovsky van publicar un article en què assenyalaven l’hipocamp com l’espai on s’integra aquest sistema de navegació. I precisament per aquest treball i la seva feina posterior, O’Keefe, actualment professor de neurociència en el University College London (UCL), va ser reconegut amb el Nobel de Medicina 2014. Va compartir el guardó amb el matrimoni format per May-Britt i Edvard Moser, tots dos professors de neurociència en la Universitat Noruega de Ciència i Tecnologia.

Si O’Keefe es va sorprendre pel patró d’activació de les cèŀlules de lloc, May-Britt i Edvard Moser devien quedar estupefactes amb el de les cèŀlules en graella (grid cells), que van descriure més de tres dècades després. En mesurar l’activació d’una sola d’aquestes neurones van observar que el potencial d’acció es produïa no quan l’animal es trobava en un únic punt de l’espai d’estudi, sinó en diversos; i amb una regularitat sorprenent: el patró prenia forma de graella hexagonal. Ubicades a l’escorça entorínica, una zona del cervell propera i molt connectada a l’hipocamp, les cèŀlules en graella permetrien així mesurar distàncies, i afegirien una valuosa informació mètrica al mapa cognitiu generat per les cèŀlules de lloc. Per això, els investigadors noruecs van concloure que aquestes neurones formaven part del sistema de navegació suggerit per O’Keefe.

Figura 1. Esquema de l’espai en què es mou l’animal de laboratori i exemple d’activació d’una única cèŀlula de lloc, en aquest cas, quan la rata es trobava en qualsevol dels punts taronja.

L’Assemblea del Nobel va fallar el premi pel «descobriment de les cèŀlules que constitueixen un sistema de posicionament al cervell». Com explica O’Keefe en una entrevista per a la Fundació Nobel, per poder moure’ns per l’entorn necessitem saber on som, on són la resta de coses i la relació de distàncies entre aquests elements diferents. «Amb els anys hem descobert que hi ha cèŀlules especialitzades al cervell que representen espais, distàncies i direccions», tot constituint el que s’ha batejat com el nostre «GPS intern». Un dels pilars d’aquest mecanisme el constitueixen les cèŀlules de lloc (place cells). Per mitjà d’implants al crani per registrar activitat cerebral en rates que es movien lliurement per un espai delimitat, O’Keefe i Dostrovsky van descobrir un patró molt particular d’activació de neurones a l’hipocamp. Els investigadors van observar que quan l’animal ocupa una zona específica de l’àrea d’estudi, hi ha

Si bé les investigacions guardonades es van fer amb rates, investigacions posteriors han identificat estructures i cèŀlules similars en mamífers, incloent-hi els humans. Segons el dossier científic del premi, elaborat pels neurocientífics del Karolinska Ole Kiehn i Hans Forssberg, aquest sistema podria estar, de fet, força conservat al llarg de l’evolució dels vertebrats.

Figura 2. Exemple d’activació d’una cèŀlula en graella. En aquest cas, la cèŀlula mateixa s’activa quan l’animal es troba en qualsevol dels punts blaus, tot configurant un patró espacial hexagonal.

En definitiva, el Nobel va destacar la recerca bàsica que ha permès comprendre com el cervell ens permet saber on som, com podem desplaçar-nos per l’ambient que ens envolta i recordar aquesta informació per a properes ocasions. En relació a aquest darrer aspecte, se sap que l’hipocamp és unes de les àrees Treballs de la Societat Catalana de Biologia

75


Carrera

Tècnics a l’Antàrtida

.

Els bastidors de la investigació Juan Luis Ruiz Valderrama. Unitat de Tecnologia Marina (UTM-CSIC)

Quan algú que acabo de conèixer descobreix que he treballat a l’Antàrtida no és estrany que el comentari següent sigui: «ets biòleg?». La divulgació relacionada amb expedicions polars normalment se centra en paisatges espectaculars, la vida dels animals superiors i les peripècies dels científics; entre bastidors queda la feina de l’equip tècnic i logístic. Tot i que el meu interlocutor pot quedar temporalment contrariat en descobrir que no sóc científic ni mariner, i que els estudis en els quals coŀlaboro no inclouen les balenes, pingüins i foques que apareixen en la majoria de documentals, sempre procuro aprofitar l’evident atractiu que suposen les expedicions per divulgar i reivindicar el paper dels tècnics en la investigació polar. En el meu perfil professional consta que sóc llicenciat en enginyeria electrònica, i que treballo des de l’any 2001 en el Departament de Tecnologies de la Informació i les Comunicacions de la Unitat de Tecnologia Marina (UTM) del Consell Superior d’Investigacions Científiques (CSIC). Aquesta presentació curricular tan altisonant i llarga és sintetitzada per alguns amics com «l’antàrtic». La UTM va ser creada el 1994 per proporcionar el suport tecnològic i logístic a la investigació marina i polar espanyola després de l’avarada del BIO Hespérides, el vaixell insígnia de l’oceanografia espanyola, on es poden desenvolupar expedicions d’una gran varietat de disciplines científiques amb un abast geogràficament global, incloent-hi tots dos pols. L’any 1999 la UTM assumeix també la responsabilitat de mantenir operativa la base antàrtica Joan Carles I, en funcionament des del 1988 gràcies a l’obstinació i passió de dos honorables científics i veritables pioners antàrtics: els catalans Antoni Ballester i Josefina Castellví. Tres dies de navegació i més de mil quilòmetres separen Ushuaia, la darrera ciutat del Con Sud, de la base antàrtica ubicada a l’illa

76

Livingston. L’equip tècnic desembarca cada any a principis de novembre i s’avança a la campanya que es desenvoluparà durant els quatre mesos de l’estiu austral. La composició professional òptima per atendre els diferents serveis ha d’incloure guies de muntanya, patró d’embarcacions, cuiner, metge, personal de mecànica i manteniment, tècnic de medi ambient i laboratoris, enginyers per a l’electrònica, comunicacions i informàtica, un meteoròleg (de l’Institut Nacional de Meteorologia) a més d’un cap de base per coordinar totes les operacions. Tot i que la responsabilitat de cada servei recau en el tècnic especialista, el més important és que tot el personal treballa de manera conjunta i solidària en qualsevol tasca. La primera és posar en marxa el protocol d’obertura, que consisteix a restablir les condicions bàsiques per habitar l’illa amb seguretat: es facilita l’accés a les instaŀlacions, en moltes ocasions bloquejades per la neu, es posen en marxa els generadors elèctrics i les comunicacions, es restableix l’abastiment d’aigua i la fossa sèptica, es netegen i reparen els desperfectes que les dures condicions de l’hivern antàrtic hagin pogut ocasionar i, és clar, també es desembarquen les provisions, combustible i tot el material necessari fins la propera visita del vaixell logístic, que pot trigar unes quantes setmanes. Després de la generació elèctrica, el primer servei que s’ha de posar en marxa són les comunicacions tant internes com externes per ràdio i satèŀlit, ja que són imprescindibles per coordinar les operacions i garantir la seguretat en cas d’accident. Tot el personal ha d’estar sempre localitzable per ràdio dins i fora de les instaŀlacions. Les converses per coordinar treballs i informar de la posició durant les expedicions per mar o muntanya són contínues i es fan pel canal intern. També es manté el contacte amb altres bases i vaixells propers gràcies a l’ampliació de l’abast que proporciona un repetidor instaŀlat al cim d’un turó proper. Si bé encara es mantenen les clàssiques coTreballs de la Societat Catalana de Biologia

municacions per ràdio a llarga distància per HF (alta freqüència), les millores i l’abaratiment de les tecnologies de comunicació per satèŀlit han comportat un avenç importantíssim per superar el tradicional aïllament al qual ens vèiem sotmesos fins fa no gaires anys. Actualment es disposa de connexió telefònica i a Internet; fins i tot és possible enviar i rebre missatges amb el WhatsApp amb els telèfons inteŀligents connectats a la xarxa sense fil disponible a totes les instaŀlacions de la base i el seu entorn. Molts pensem que això ha trencat l’estil de vida romàntic i els hàbits de convivència de l’exploració antàrtica allunyats de la connexió virtual continuada a què estem sotmesos en les nostres modernes societats de la informació. No obstant això, és innegable que no només facilita la logística i els treballs científics amb l’enviament de dades, sinó que millora l’estat anímic del personal, que pot mantenir una comunicació fluida amb els seus familiars i amics; sobretot per a aquells, normalment tècnics, que romanen durant quatre llargs mesos, amb festes de Nadal incloses, que dura la campanya completa. Un cop l’estació està llesta per viure amb relativa comoditat, comencen les feines quotidianes, tant de manteniment de les condiImatge 1. Equip tècnic instaŀlant el repetidor de ràdio.


Tècnics a l’Antàrtida xxxxxxxxxxxxxxxx

cions d’habitabilitat com de suport als projectes científics. Una de les tradicions que es conserven des dels orígens de la BAE Joan Carles I és distribuir per torns i en parelles tasques domèstiques com atendre el servei a taula, ajudar el cuiner i fer la neteja general de les zones comunes. Tothom és cordialment convidat a participar-hi, incloent-hi investigadors principals, becaris, cap de base i autoritats. És un exercici molt saludable d’humilitat i ens recorda la nostra interdependència com a petit grup humà lluny de l’entorn protector al qual estem habituats i en el qual tothom és igual de necessari i important. Per tal de fer els treballs de camp a les glaceres i zones marítimes, la UTM posa a disposició dels científics motos de neu i llanxes neumàtiques per desplaçar-se als punts de mostreig. Els guies de muntanya i el patró d’embarcacions garanteixen la seguretat d’aquestes expedicions. La instrumentació per prendre mostres o mesurar pot ser pròpia de l’equip científic i els tècnics aporten l’experiència i el coneixement de l’entorn per fer-ne la instaŀlació i integració amb altres sistemes comuns de la base, com poden ser els serveis de comunicació per a la transmissió de dades o la connexió a les energies renovables, eòlica i fotovoltaica, per mantenir l’adquisició de manera autònoma incloent-hi els mesos d’hivern amb la base tancada. D’aquesta manera es poden mantenir de manera ininterrompuda sèries llargues de meteorologia, geomagnetisme, sísmica, etc. A més, els científics també poden emprar els recursos que per les característiques o l’ús generalitzat són gestionats per la UTM, com per exemple el GPS diferencial: un servei imprescindible per a les mesures topogràfiques d’alta precisió, ja que elimina l’error intrínsec del GPS convencional, i passa de precisió mètrica a miŀlimètrica. El sistema complet envia les dades de correcció en temps real de l’estació base al dispositiu de mesura dintre d’un ampli radi de cobertura mitjançant equips repetidors distribuïts pels cims de diverses muntanyes i turons. Una de les aplicacions

científiques de llarg recorregut és mesurar l’evolució de les glaceres properes, i calcular-ne el creixement o decreixement, cosa que aporta informació molt valuosa per als estudis de canvi climàtic. Les mesures contínues i precises fetes per l’estació de referència ubicada sobre un punt geodèsic són enviades també a bases de dades internacionals que s’utilitzen per ajustar models dinàmics de tectònica de plaques. Aquestes i altres mesures, com les meteo­ rològiques o geomagnètiques, són d’especial rellevància per als models globals, ja que les dades d’ajustament en les zones extremes del planeta són escasses. Alguns projectes d’investigació també reben cada any noves dades i mostres sense necessitat d’enviar investigadors. Bon exemple són els perfils CTD (conductivitat, temperatura i fondària) i mostres d’aigua que el biòleg responsable del laboratori i el patró d’embarcacions adquireixen periòdicament en diferents punts costers prèviament seleccionats pels científics. L’enginyer en electrònica, junt amb els guies de muntanya, també s’encarrega de la distribució de sensors de temperatura especials per mesurar l’evolució del permafrost (terra congelada). Un cop adquirides, les dades digitals són enviades via satèŀlit i les mostres són convenientment processades i emmagatzemades per portar-les als centres d’investigació que les han soŀlicitades. Es diu que treballar i viure a l’Antàrtida és una experiència personal única, que queda gravada per sempre en la memòria i el cor dels privilegiats que ho hem pogut gaudir. Que l’aventura es pot viure intensament en primera persona. Que els paisatges antàrtics són d’una immensitat i bellesa que talla la respiració i que conviure tan estretament amb l’espectacular fauna local és quasi místic. Tot és cert! Malgrat tot, no és per això Treballs de la Societat Catalana de Biologia

Imatge 2. Responsable d’electrònica i científic camí de la glacera per fer les mesures amb el GPS diferencial.

que centenars de tècnics viatgem cada any tan lluny de casa. La nostra missió és ser partícips d’un gran projecte de coneixement per entendre com funciona el nostre món. El genial i metòdic explorador polar Amundsen va dir que l’aventura és només una mala planificació. Malgrat que ser tècnic a l’Antàrtida requereix esperit aventurer, no som aventurers; som professionals al servei de la ciència i procurem fer la nostra feina amb seriositat, seguretat i eficàcia, conscients de la responsabilitat que comporta el suport econòmic fort que la societat en el seu conjunt aporta a aquesta fita mitjançant els seus impostos. No oblidem el compromís de retre comptes. • Per saber-ne més Castellví, J. (1996). Yo he vivido en la Antártida: Los primeros españoles en el continente blanco. Barcelona: Galaxia Gutenberg. Editorial (29/01/2015). «Technicians are often under appreciated, but without them there could be no research». Nature, 517: 528 <http://www.nature.com/news/technicalsupport-1.16797>. http://www.utm.csic.es (Base Antàrtica Espanyola Joan Carles I)

77


Àgora

Centre de Recerca en Sanitat Animal Aquest 2015 el Centre de Recerca en Sanitat Animal (CReSA) celebra el 15è aniversari de funcionament, i ho fa amb l’afegit que fa un any el Consell de Política Científica, Tecnològica i d’Innovació del Ministeri d’Economia i Competitivitat incloïa les seves instaŀlacions de bioseguretat dins del nou Mapa d’Infraestructures Cientificotècniques Singulars (ICTS). D’altra banda, el 2015 el centre ha deixat de ser una fundació pública i ha passat a integrar-se dins de l’Institut de Recerca i Tecnologia Agroalimentàries (IRTA). «Serem el programa en sanitat animal de l’IRTA, cosa que implica un canvi d’estatus jurídic», explica Joaquim Segalés, director del CReSA des del 2012. «Però només ens afectarà en l’àmbit administratiu, perquè des del punt de vista de la recerca continu-

l’esmentat institut públic de recerca, tot i que la UAB hi continuarà aportant investigadors adscrits.

arem amb les mateixes línies que fins ara», afegeix.

Segalés compara el CReSA amb un parc de bombers. El centre ha d’estar preparat i alerta amb vista a possibles alertes sanitàries i zoosanitàries que es puguin produir, ja sigui l’encefalopatia espongiforme bovina, la pesta porcina o la grip aviària, per esmentar-ne alguns casos de fort ressò mediàtic. Però amb l’arribada de la crisi, es començà a veure el centre —i tants d’altres— com quelcom car de mantenir, tant per les instaŀlacions com pel personal qualificat. Per això, posa l’accent en el fet que és la «matèria gris» del personal el que dóna sentit als resultats de laboratori i la que ofereix indicacions de com cal actuar en cas d’una alerta. «L’Administració crec que ja ho ha entès, però potser no s’estan fent tots els esforços que serien desitjables en aquest sentit», manifesta.

I és que, segons explica, les retallades de les administracions en resposta a la crisi financera global han compromès la sostenibilitat del centre, i la millor solució que s’ha trobat des del Patronat —que inclou l’IRTA mateix, la Universitat Autònoma de Barcelona (UAB) i tres departaments de la Generalitat, entre d’altres— ha estat la integració amb

A l’espera de veure com anirà aquesta nova etapa, el cert és que el CReSA és un centre jove que va néixer administrativament a finals del 1999, però no va iniciar activitats fins al gener del 2000 i no va estrenar l’edifici on actualment s’ubica fins al 2005. Els seus objectius se centren en l’R+D+i en sanitat animal i en la transferència de coneixement

Imatge 1. Un grup de garrins en una de les quadres de biocontenció de nivell 3 del CReSA.

78

Treballs de la Societat Catalana de Biologia

i tecnologia tant al sector públic com al privat. La joia de la corona són les instaŀlacions de biocontenció amb bioseguretat de nivell 3 (laboratoris i animalari), que és precisament el que ha estat reconegut com a ICTS pel Ministeri. És l’única instaŀlació d’aquestes característiques a Catalunya i una de les dues a Espanya, juntament amb el laboratori de bioseguretat del Centre d’Investigació en Sanitat Animal, que depèn de l’Institut Nacional d’Investigació Agrària i Alimentària. De fet, totes dues instaŀlacions integren la Xarxa de Laboratoris d’Alta Seguretat Biològica dins el mapa d’ICTS. Aquest laboratori i animalari de bioseguretat de nivell 3 permet treballar amb patògens d’interès sanitari i zoosanitari com ara els virus de la grip aviària d’alta patogenicitat, el de la febre del Nil occidental, el del Chikungunya o el de la febre de la vall del Rift, entre d’altres. El nivell 3, explica Segalés, garanteix la capacitat de contenir agents biològics

Imatge 2. Personal del CReSA treballant amb el virus de la febre de la vall del Rift en les instaŀlacions de bioseguretat de nivell 3.


Centre de Recerca en Sanitat Animal xxxxxxxxxxxxxxxx

Imatge 3. Les instaŀlacions del CReSA permeten treballar amb patògens de risc epidèmic, com ara el virus de la grip de tipus A.

© Imatges cedides pel CReSA.

i permet treballar amb patògens capaços de provocar epidèmies greus en animals i persones per a les quals hi ha algun sistema de prevenció i tractament. L’oferta tecnològica del CReSA també inclou laboratoris de bioseguretat de nivell 2, aptes per treballar amb patògens per als quals hi ha un tractament eficaç i que normalment no són capaços de provocar grans epidèmies ni en animals ni en persones. L’adquisició de la categoria ICTS implica obrir la instaŀlació a tothom que en requereixi l’ús, quelcom que el CReSA ja fa des que es van estrenar les instaŀlacions de biocontenció el 2006. L’únic requisit és superar l’avaluació d’idoneïtat d’un comitè científic i acceptar el pressupost associat. «Nosaltres som usuaris sistemàtics de les nostres instaŀlacions, però també rebem grups de fora, com ara del Regne Unit i d’Holanda», afirma Segalés. Al seu parer, els preus del centre són competitius en relació amb la mitjana d’instaŀlacions similars a Europa occidental, tot i que se li fa difícil especificar un preu mitjà. «És molt variable en funció del tipus de recerca que fas: per a un estudi amb ratolins tindrà un cost relativament baix, tot i que més elevat que en un laboratori convencional pel fet de treballar amb biocontenció, mentre que amb animals més grans, com ara porcs o vedells, surt bastant més car.» A banda de l’oferta tecnològica, l’altre puntal del CReSA són els programes de recerca que porta a terme. En aquest sentit, un dels punts forts són les malalties d’origen víric, amb dues grans àrees d’investigació: una per a infeccions endèmiques, que normalment no són zoonosis, i una altra per a infeccions exòtiques, en què hi pot haver en alguns casos risc de transmissió a humans. Les malalties exòtiques acostumen a ser de declaració obligatòria de l’Organització Mundial en Sanitat Animal, i per això la necessitat de disposar d’una unitat de biocontenció de nivell 3, aclareix Segalés. Completen el quadre

una àrea dedicada a la recerca en malalties d’origen bacterià i parasitari i una altra de transversal dedicada a l’epidemiologia i l’anàlisi del risc. El centre treballa estretament amb l’Administració a través d’encàrrecs de serveis anuals, principalment dels departaments d’Agricultura i de Salut; tot i que també es fan coŀlaboracions amb empreses. En

aquest sentit, hi ha molta relació entre els productors locals i la línia de recerca sobre malalties endèmiques, atès que són aquestes les que causen més problemes econòmics al sector. Alhora, i per posar-ne un altre exemple, també s’estableixen sinergies amb la indústria farmacèutica, que sovint utilitza les instaŀlacions del CReSA per dur a terme proves d’efectivitat d’antibiòtics o vacunes. •

El CReSA en xifres L’edifici del CReSA té uns 6.000 m2. Les instaŀlacions de bioseguretat de nivell 2 ocupen 717 m2 i les de nivell 3 ocupen 4.500 m2 distribuïts en tres àrees, incloent-hi les estances d’animalari. El personal està integrat per poc més d’un centenar de persones, dels quals el 36 % són investigadors, el 24 % personal tècnic, el 16 % estudiants de postgrau i el 24 % personal d’administració i serveis. El 51 % del finançament prové de contractes i acords amb el sector privat, mentre que el 46 % procedeix de fonts públiques, incloent-hi els projectes competitius. La resta prové de fonts extraordinàries i subvencions. El 2013 els investigadors del centre van publicar 61 articles en revistes incloses al Science Citation Index i van fer 91 comunicacions en congressos. El centre participa en 10 projectes i xarxes europees i en 9 projectes de recerca nacionals.

Treballs de la Societat Catalana de Biologia

79


El personatge

Dues vides, un objectiu Àlvar Martínez Vidal. Institut López Piñero, Universitat de València. Empar Pons Barrachina, Periodista.

Amagada sota el nom de J. B. Flexner (Barcelona, 1904 - Filadèlfia, 2000), es troba una científica catalana amb una trajectòria professional i investigadora del tot excepcional. Igual que el seu cognom de soltera, el rastre de la doctora en farmàcia Josefa Barba Gosé es va perdre al Pertús, al Pirineu, tot just després de travessar la frontera clandestinament l’estiu de 1937, en plena Guerra Civil, i casar-se tot seguit amb el neurofisiòleg nord-americà Louis B. Flexner (19021996). Josefa Barba, que havia estat una jove promesa de l’anomenada escola biològica catalana, iniciava així als Estats Units, sota un altre nom, una fecunda vida personal i científica. Oxford, 1940. En una llarga carta adreçada a l’oncòleg Francesc Duran i Reynals (18991958), que treballava aleshores a la Universitat de Yale, el reconegut traumatòleg català Josep Trueta escrivia des del seu exili a Anglaterra: «Sóc un bon amic del doctor Bach de Sabadell que amb freqüència em parla de vostè i també de la Pepeta Barba, actual esposa del doctor Louis B. Flexner, al Johns Hopkins H[ospital] de Baltimore.» Barcelona, 2006. Amb el títol L’exili manllevat, es publica a Barcelona l’autobiografia de Núria Pi-Sunyer, filla de l’enginyer i polític Carles Pi Sunyer (1888-1971) i vídua del diabetòleg Rossend Carrasco i Formiguera (1892-1990). Entre els incomptables metges i biòlegs exiliats que desfilen per les seues pàgines —catalans i no catalans— tan sols fa una aŀlusió a la protagonista de la nostra història: «Per fi una dona, la Pepita Barba, va fer un bon treball a Washington». Era la primera vegada que algú, en un exercici de memòria personal, recordava la figura de Josefa Barba i la ubicava en el marc de l’exili mèdic i biològic.

perat significat: una noia que apareix en segona fila de la foto i que responia al nom de Josefa Barba, amb el temps havia esdevingut Josefa B. Flexner, una reconeguda experta en neurofisiologia de la memòria, adscrita a la Universitat de Pennsilvània i amb treballs sobre l’aprenentatge i la retenció a llarg i curt termini publicats, entre d’altres, a la revista Science. La lectura de l’obituari de Josefa B. Flexner i de la biografia del seu marit, Louis B. Flexner, nebot d’Abraham, publicada per la National Academy of Sciences dels EUA, semblava confirmar la veracitat i la pertinença d’aquesta hipòtesi de treball. València, 2014. Una conversa entre nosaltres dos —un historiador de la ciència amb interès per l’exili mèdic català i una redactora d’informatius de ràdio i televisió amb un interès creixent per la ciència— ens animà a prosseguir la indagació biogràfica sobre Pepita Barba. Calia, però, assegurar-se i no precipitar-se. I l’única manera possible de no fer

Creuant aquestes dues dades, semblava plausible la hipòtesi següent: potser Pepita i Pepeta foren la mateixa persona i que, casada amb un científic nord-americà, haguera adoptat el cognom del seu marit. El cognom Flexner evoca d’immediat la figura d’Abraham Flexner (1866-1959), l’autor del famós informe sobre la reforma dels estudis mèdics que porta el seu nom, i el de tota una iŀlustre nissaga de metges i científics nord-americans d’origen jueu. En aquesta línia, la fotografia de grup de l’Institut de Fisiologia de Barcelona, datada c. 1928, cobrava un nou i ines-

80

Treballs de la Societat Catalana de Biologia

volar coloms era seguir la pista que hi ha en l’última línia del seu obituari: «She is survived by a nephew, Don Eduardo Barba of Barcelona, Spain». Es tractava d’intentar localitzar aquest nebot seu, que podria ser ja molt gran. Les primeres cerques per Internet van ser infructuoses, ja que el desconeixement del seu segon cognom impedia destriar, és a dir, identificar i localitzar, el veritable nebot de la neurofisiòloga catalana. Calia buscar des d’un altre angle i potser la resposta estava en la Pepita Barba mateixa. Trobats els seus primers articles en revistes científiques —Treballs de la Societat de Biologia de Barcelona, per exemple—, vam saber que el seu segon cognom era Gosé i que Josefa era el nom amb què signava els seus treballs. Teníem així el nom complet i això ens va permetre emprendre novament la recerca. El diari La Vanguardia, amb la digitalització de totes les seues edicions, es va revelar com l’eina més útil. Amb les esqueles del diari vam poder reconstruir una bona part del seu l’arbre genealògic: trobàrem els noms dels pares, dels avis, d’una part dels besavis i també del seu únic germà, Eduard Barba Gosé, enginyer industrial que va ocupar un alt càrrec Figura 1. Components del Laboratori de Fisiologia de la Facultat de Medicina de Barcelona, cap a l’any 1925. Cortesia del Museu d’Història de la Medicina de Catalunya.


Dues vides, un objectiu xxxxxxxxxxxxxxxx

informació obtinguda amb l’objectiu d’elaborar una narrativa no escrita que plantejara un diàleg poc transitat encara entre la memòria i la història, entre el familiar i l’investigador. El resultat, un vídeo de deu minuts titulat Les dues vides científiques de Josefa Barba, és una primera aproximació a un personatge molt singular i polièdric, que havia quedat ocult a Catalunya i a la penombra als Estats Units. Una invisibilitat que encara no se sap si fou deliberada o inevitable.

Figura 2. Josefa i Louis Flexner passejant per Barcelona (1958). Cortesia dels University of Pennsylvania Archives.

durant el govern de la República i que es va haver d’exiliar al final de la Guerra Civil. Novament, l’esquela del seu germà ens posà sobre la pista del seu nebot, que finalment vam localitzar en un poble del Maresme. És molt més jove del que havíem pensat. Les dificultats de reagrupament que van tenir els seus pares durant l’exili en foren la causa. Ell mateix és fill de l’exili i el guardià de la memòria familiar. La seua inestimable coŀlaboració va permetre confirmar la informació que havíem recopilat sobre Josefa Barba Gosé, alhora que va aportar la documentació bàsica sobre la seua identitat i formació. Aprofitant l’oportunitat que comportava la XIII Trobada de la Societat Catalana d’Història de la Ciència i de la Tècnica (Sant Feliu de Guíxols, setembre del 2014), que permetia presentar les comunicacions en format audiovisual, vam organitzar i estructurar la

De la primera etapa de la seua vida, la informació obtinguda ens proporciona la imatge d’una jove de família burgesa, llicenciada en la Facultat de Farmàcia de Barcelona l’any 1926 amb un expedient més que brillant: vuit matrícules d’honor, quatre exceŀlents i un sol notable. Un expedient que cobra més valor encara si es té en compte que Josefa Barba va cursar la carrera de dret de manera simultània i per lliure. L’any 1929 va ampliar els seus estudis a Londres, a la Pharmaceutical Society of Great Britain, i l’any següent va presentar la tesi doctoral a Madrid. Tot seguit, amb una beca de la Fundació Maria Patxot i Rabell, marxà als Estats Units, a la Universitat Johns Hopkins de Baltimore. Queda constància també que Josefa Barba fou una dona del seu temps, independent i amb determinació, com ho demostra el fet que acabada la seua estada a Baltimore l’any 1931, va tornar a Barcelona pel Pacífic, i va fer la volta al món tota sola. D’aquesta etapa inicial daten les seues primeres investigacions publicades a Barcelona, Madrid, Londres i Baltimore. A l’estiu de 1937, i enmig de les convulsions de la Guerra Civil, Josefa Barba va travessar els Pirineus pel pas fronterer del Pertús. Allí l’esperava amb una ambulància Louis B. Flex­ner, a qui havia conegut durant la seua estada a la Johns Hopkins. L’endemà mateix es van casar a l’ajuntament d’aquesta localitat francesa i d’aquesta manera es va iniciar la segona etapa de la seua vida professional. Fou la més prolífica i fructífera i va estar estretament vinculada a la del seu marit, que amb el temps va esdevenir un dels investigadors més destacats dins l’àmbit de les neurociències. Treballs de la Societat Catalana de Biologia

Entre d’altres, fou el fundador i director fins a l’any 1967 de l’Institute for Neurological Sciencies de la Universitat de Pennsilvània. Això no obstant, dues coses criden l’atenció. La primera, que tots dos van mantenir la seva tasca investigadora de manera inalterable fins a la mort de Louis B. Flexner, l’any 1996. I la segona, que de cap manera no es pot pensar que el treball de Josefa Barba fos el d’ajudant del seu marit al laboratori, sinó que van treballar conjuntament com una veritable parella científica. Prova d’això són la cinquantena d’articles publicats per tots dos al llarg de més de mig segle de treball cooperatiu, i que ella és la primera signant d’aproximadament la meitat. Josefa Barba Flexner va sobreviure el seu marit quatre anys més, però no va voler tornar a Barcelona. El 25 de juny del 2000 va morir a Filadèlfia a l’edat de 96 anys. Només als Estats Units es va fer un discret ressò del seu traspàs i és ara, a la Universitat de Pennsilvània, des d’on cal resseguir les petjades de la seua trajectòria vital i científica. Nota: aquesta indagació biogràfica forma part del projecte Hacia la consolidación de las especialidades médicas en Barcelona (1911-1936): unidad y división en el saber y la práctica de la medicina (MINECO, HAR2012-34586). Volem agrair a Josep Maria Camarasa la seua ajuda, tant pel que fa a la notícia de les coŀlaboracions de Josefa Barba en Treballs de la Societat de Biologia de Barcelona, com pel que fa a la localització de la correspondència entre ella i Josep Trueta. • Per saber-ne més Roca, A.; Glick, T. F. (1986). Francesc Duran i Reynals (1899-1958). Barcelona: Ajuntament de Barcelona. Pi-Sunyer, N. (2006). L’exili manllevat. Barcelona: Proa. The two scientific lives of Josefa Barba [en línia] <http://vimeo.com/107123597>. [Consulta: 4 gener 2015]

81


Ciència en societat

Divulgació: del model en sèrie a l’experiència en paraŀlel Francesc Uribe. Museu de Ciències Naturals de Barcelona

Aquest és un escrit fruit de la passió i convicció amb què vull respondre a la invitació de coŀlaborar amb la secció de divulgació de la revista treballs de la societat catalana de biologia. Ara bé, escric en exercici del dret a especular sobre el que m’han proposat: parlar de l’experiència de traslladar conceptes científics al llenguatge d’una exposició d’un museu de ciències naturals.

Per als qui prenem la mesura preventiva de recórrer al cartesianisme bucòlic per organitzar l’activitat professional, concloem sovint que la divulgació és una fase simplificadora i posterior a la creació de coneixement. Si és així, fins i tot és possible divulgar coneixement creat per altres persones. Només ocasionalment es donen les circumstàncies per divulgar i crear recursos científics alhora. Una d’aquestes rares ocasions la vaig poder gaudir amb motiu de participar en la gestació d’un nou espai museogràfic al Museu Blau. Ens remuntem a l’any 2011, quan s’hi va presentar l’exposició de referència «Planeta vida», encara oberta al públic. En el sistema modular d’aquesta exposició s’incorporaven diversos espais monotemàtics. A la capçalera d’un d’aquests nous àmbits resa un títol tan ortodox com «Classificació i nomenclatura», dos exordis de la recerca biològica sovint bandejats per ser vuitcentistes. Davant l’audiència dels lectors de

82

classificacions i nomenclatures preexistents en molts àmbits de la vida personal, sense perjudici d’intentar-ne alguna modificació quan la necessitat hi obliga. La premissa de la universalitat del fenomen classificador i nominatiu era una de les receptes que es volien imprimir a l’espai d’exposició. El comerç és una experiència ben servida d’exemples d’intercanvi d’informació basada en l’ordre lògic de comportar-nos com a compradors o venedors de béns que tenen nom i que s’organitzen en esquemes lògics d’ordenació, en última instància de classificació. En la miniexposició «Classificació i nomenclatura» vam destacar la indústria botonera, en què la fabricació, l’emmagatzemament, la distribució al detall i la venda final exemplifiquen un flux d’informació dependent a tothora de la codificació o noms de cada tipus de botó i de l’organització en catàlegs de les seves característiques formals o funcionals per gestionar els intercanvis econòmics associats. I aquest només és un exemple entre moltíssims.

treballs no caldrà reivindicar la importància intrínseca d’aquestes disciplines, ni el suport que atorguen a la simple comunicació de resultats científics. Malgrat la desventura anímica que acompanya el simple esment de la classificació i la nomenclatura biològiques no parem de fer ús quotidià d’algun esquema classificador i d’anomenar organismes segons criteris científics.

Què tenen de particular la nomenclatura i la classificació biològiques? Segurament en podem començar a justificar la singularitat amb l’argument que estan immerses en una metodologia científica, la qual cosa obliga a sistematitzar, objectivar, documentar i, finalment, a difondre els resultats obtinguts. El repte museogràfic consistia a combinar la naturalitat humana davant el fet de classificar amb les especificitats de la tasca investigadora. El camí triat va ser acompanyar la descripció dels mecanismes propis de les disciplines científiques amb la iŀlustració de la utilitat dins i fora de l’activitat científica.

Posar nom a objectes d’una classificació o classificar objectes amb nom són les dues cares d’un procés que està assimilat en propietats profundes dels éssers humans en general i que no són exclusives de les persones de ciència. Classifiquem i anomenem en molts àmbits de l’activitat, des del lleure infantil a les responsabilitats més pregones de la societat. I també fem un ús continuat de les

La univocitat inherent al nom científic i la classificació en què aquest s’associa als sistemes naturals és un valor molt preuat per donar seguretat en àmbits com el consum de productes naturals, la legislació ambiental, l’explotació de recursos naturals, etc. La fixació d’un nom sobre els atributs distintius explícitament descrits d’un organisme biològic és garantia de rigor en les comunicacions

Imatge 1. Illa de classificació. © J. M. Llobet/MCNB

Treballs de la Societat Catalana de Biologia


Divulgació: del model en sèrie a l’experiència en paraŀlel xxxxxxxxxxxxxxxx

humanes quan l’intercanvi d’informació ha de superar barreres idiomàtiques, de limitacions lèxiques en els vocabularis, o de simple aleatorietat ortogràfica. Els noms comuns d’animals i plantes conserven tot el seu potencial de comunicació en el context cultural de cada llengua i els noms científics són cridats a existir per a l’univers de situacions en què cal precisió, intercultural fins i tot. De nou, la doble via de noms vulgars i científics en contextos diferents. Els noms de la llengua en ús es controlen en diccionaris; per contra, els noms científics es mostren en estructures jeràrquiques, taxonòmiques, que faciliten l’aplicació de noms coŀlectius que contenen noms específics. En les llengües aquesta compartimentació és molt asimètrica i no es correspon necessàriament a l’evolució del coneixement científic. Com podem explicar aquestes virtuts de la classificació científica de noms d’organismes? Universalitat, flexibilitat, estructuració ontogenètica... En els museus caiem sovint en la temptació de mostrar objectes; aquest és el nostre pecat original. Per què no podem mostrar la clasImatge 2. Vestíbul del Museu Blau. © Duccio Malagamba/MCNB

sificació com un objecte? En aquest cas, per les dimensions i per la dinàmica de desplaçament que representa la classificació, l’objecte en qüestió seria un element flexible i adaptatiu. D’un temps ençà la biologia ha anat desvetllant l’interès i la necessitat de visualitzar grans conjunts de dades, a l’ensems que proliferen àmbits de coneixement on s’acumulen terabytes d’informació. Visualitzar la informació respon a una modalitat de cognició més espontània i de batuda ràpida. Traduït en l’esfera de la classificació biològica des del Museu ho hem assimilat a dues vies per localitzar informació. L’una és la tradicional, consistent a declarar unes condicions —el nom d’un o més tàxons, potser un àmbit geogràfic segons una toponímia particular i el nom d’algun recoŀlector, suposem— per iniciar una cerca en la base de dades de les coŀleccions. Se’n diu també aplicar un filtre per aconseguir desplaçar tot allò que no interessa i reduir el marc de treball de manera molt específica. Tanmateix, hi ha una altra manera d’accedir a la informació, justament la contrària i complementària. Es mostra tota la informació en les màximes dimensions possible i qui consulta navega entre els feixos de dades per acabar descobrint allò que buscava o allò que no esperava. Enfront d’una cerca total-

ment dirigida, hi ha l’alternativa de cercar especulativament. Aquí intervenen les eines de visualització, en auge espectacular en els darrers anys. El procés de crear l’àmbit museogràfic «Classificació i nomenclatura» va ser l’esquer per desenvolupar les eines de visualització de dades que s’havien creat al Museu en ocasió d’un altre experiment museogràfic anterior. L’any 2010 s’inaugurà una exposició, «Exploradors: aventura i biodiversitat». Per destacar el paper del Museu com a receptor de resultats d’exploracions naturalistes es van crear dues eines de consulta a Internet de les coŀleccions: una jugava amb molta elegància a simular els vells fitxers taxonòmics, mentre que l’altra lliscava per la cartografia del planeta. Actualment, l’activitat museogràfica ens ha conduït a plantejar la fusió dels dos elements de cerca en una sola interfície, de manera que la immersió en les dades de coŀleccions s’opera comandant una selecció taxonòmica i cartogràfica simultània a partir d’impulsos molt senzills de governar. Què ha passat a la fi? Doncs que a partir d’un procés de caràcter museogràfic el Museu s’ha dotat d’una eina tecnològica orientada a satisfer necessitats de consulta del patrimoni del centre que millora les característiques dels serveis habituals. Es pot afirmar que els projectes d’exposicions han servit també per equipar les vies de comunicació dels departaments científics. Amb agraïment a les persones del departament d’exposicions del Museu per fer possible aquest balanç final. •

Per saber-ne més http://www.bioexplora.cat/exploradors/ index.htm http://arbre.bioexplora.cat/ http://mapa.bioexplora.cat/ http://taxomap.bioexplora.cat/taxomap.php Treballs de la Societat Catalana de Biologia

83


Lectures

Tot és mentida Descobrint el cervell Antonio Rial Premi Europeu de Divulgació Científica Estudi General 2014 Coŀlecció «Sense Fronteres». Editorial Bromera (Alzira, 2015), 160 pàgines

Que la realitat no existeix —o que no existeix com creiem percebre-la— sembla un tòpic més o menys gastat, començant pel famós del mite de la caverna. Ara bé, això mateix —però de manera molt més precisa i radical i amb fets mesurables—, és la conclusió i alhora el punt de partida de la recerca científica més avançada en neurociències, en l’estudi de com percebem, com processa el nostre cervell i com actuem. Un món literalment fascinant, perquè ens endinsa en el que ha estat un altre tòpic fílmic: vivim en una realitat paraŀlela fabricada pel nostre cervell. El quid de la qüestió és que això no és el problema sinó la solució: habitem un món fals «per culpa» del nostre cervell, però és precisament «gràcies a» aquesta visió parcial i distorsionada que hem sobreviscut com a espècie. Expliquem la paradoxa del cervell més competitiu precisament perquè falsifica la realitat.

Cada segon el cervell rep 400.000 milions de bits, dels quals la memòria només en guarda un 10 %, que, al seu torn, ha de processar en només 13 miŀlèsimes de segon. Aquesta dosi indigerible, per monumental, d’informació que s’ha de desxifrar en un no res, fa que el cervell no puga tant «veure» com «intuir»: que identifique allò que ha percebut confrontant-ho amb conceptes semblants enregistrats en la nostra memòria. L’autoengany forma part de la nostra naturalesa. El cervell construeix primer la realitat. Després, ja reflexionem seleccionant els aspectes que contribueixen a reafirmar els nostres pensaments previs. La major part de la nostra activitat mental està automatitzada, tant la que portem de sèrie, escrita en el genoma, com la que adquirim en l’aprenentatge. La raó: aprendre requereix establir noves connexions, cosa que consumeix molta energia. Però aquest òrgan de menys d’1,5 kg de pes, que té 100.000 milions de neurones, cadascuna de les quals és capaç d’establir unes 10.000 connexions, es resisteix a canviar, que vol dir gastar més energia. I té tendència a mantenir només

les connexions imprescindibles que ens ajuden a sobreviure. La resta, va en automàtic. Cadascun de nosaltres venim millor o pitjor preparats de sèrie per dur a terme unes tasques i no unes altres. És durant els cinc primers anys de vida quan el cervell creix de pressa fins a arribar al 90 % del volum. Aquesta etapa és clau en el desenvolupament de les nostres capacitats, perquè és quan s’estableixen la major part de les connexions que restaran per sempre. Però —atenció, lector, que després de tanta «mentida» vénen les bones notícies!— hi ha persones que descobreixen un talent ocult després de jubilar-se i, a més, tal com afirma Rial, tots tenim algun talent. Ni que siga per descobrir-ho a temps i per assaborir el plaer de penetrar en aquest món intrigant, semiocult i paraŀlel del cervell, bé paga la pena endinsar-se en Descobrint el cervell d’Antonio Rial, conductor del programa «Secretos del cerebro» a RNE. Milions de connexions de les teues neurones t’ho agrairan. Soledat Rubio

La transformació digital La digitalització de l’Altre

Els reptes de la democràcia en l’era del ciberespai Carlos M. Ruiz Caballero XXXI Premi d’Assaig Josep Vallverdú 2014 Coŀlecció «Argent Viu». Pagès editors (Lleida, 2015),160 pàgines

Fa molts anys que parlem de noves tecnologies. Tants, que ja no en són gaire, de noves. Podem, doncs, començar-ne a constatar els efectes. Carlos Ruiz, periodista i professor d’ètica de la comunicació a la Universitat Ramon Llull, dedica aquest assaig a analitzar-ne alguns. La digitalització de l’Altre radiografia el terreny que l’espai digital ofereix als mitjans de comunicació, un terreny que propicia una relació entre el públic i els mitjans diferent que no era en l’espai analògic, diferent sobretot pel que comporta políticament. Hi ha un exemple eloqüent d’aquesta transformació: els recursos 2.0. Sembla una evolució natural que el que en el món dels diaris de paper era la finestra oberta a l’opinió dels lectors, les cartes al director, hagi evolucionat i s’hagi ampliat en els diaris digitals sota la forma de fòrum de comentaris

84

i debat al peu de cada notícia. Ara bé, la dinàmica pròpia de l’espai 2.0 fa molt difícil que cap capçalera es pugui fer en la pràctica responsable, no de l’opinió que s’hi expressa, sinó del to i el registre de les intervencions. Aleshores, què han de fer els mitjans? Filtrar i editar els missatges per evitar que desvirtuïn el valor de la capçalera que els aixopluga? Caldrien més recursos dels que no hi haurà mai disponibles. I fer-ho podria ser percebut com un gest de censura. Perquè el ciberespai potencia en el lector la iŀlusió que pot participar i participa efectivament en la construcció de la informació. Però, pel que s’ha vist fins ara, això no és sinó una iŀlusió que posa el periodisme en crisi entre la seva funció tradicional com a emissor gairebé del tot unidireccional i el nou paper actiu del ciutadà-consumidor, com més va més avesat a la interacció compulsiva. Carlos Ruiz analitza, a partir de treball de camp sobre la conversa 2.0 dels lectors en edicions digitals de la premsa, les fronteres de l’espai mediàtic digital i l’efecte en l’espai social, moral, polític.

Un efecte que es pot resumir gairebé amb un joc de paraules: els mitjans cada dia poden treballar menys per «l’interès públic» i han de sucumbir més a «la temptació de l’interès del públic» (això és, «el més vist, el més llegit»). El ciberespai, amb tot el seu potencial d’estímuls i possibilitats, sembla el domini de les paradoxes. Ens ofereix un immens espai de llibertat i, quan creiem que ens l’hem fet nostre, ens adonem que hi som del tot captius. Ens dóna accés, en aparença, en teoria, a la suma del coneixement; però acabem tenint-hi una relació superficial, banalitzadora, trista. Ruiz ho mostra, sense dramatisme. I deixa oberta l’esperança que no ens hi conformem, que el periodisme no s’hi conformi. Cal veure si hi serem a temps. O si, per contra, el ciberespai i les eines que ens permeten accedir-hi ens han transformat fins a atrofiar alguna de les antigues capacitats i hipertrofiar-ne d’altres o de noves. Perquè, estem segurs que som exactament com érem abans? Oriol Izquierdo


NORMES DE PRESENTACIÓ D’ARTICLES PER ALS AUTORS DE TREBALLS DE LA SOCIETAT CATALANA DE BIOLOGIA RULES FOR SUBMISSION OF ARTICLES BY AUTHORS TO TREBALLS DE LA SOCIETAT CATALANA DE BIOLOGIA Abast La revista Treballs de la Societat Catalana de Biologia (Treb. Soc. Cat. Biol.), editada per la Societat Catalana de Biologia (SCB), filial de l’Institut d’Estudis Catalans (IEC), publica articles de l’àmbit de les ciències de la vida en llengua catalana (i ocasionalment en altres llengües). Aquesta revista consta de dues seccions: — «Destacats de recerca». Conjunt d’articles de recerca o de revisió sobre un tema monogràfic que tracta d’alguna qüestió científica concreta. Un coordinador, expert en el tema, encarrega els articles a un equip d’autors i en supervisa la redacció. Si voleu fer de coordinador d’un tema del vostre interès per als «Destacats de recerca», poseu-vos en contacte amb la secretaria de la SCB (scb@iec.cat). — «Destacats de ciència». Conjunt d’articles de divulgació, actualitat i opinió científica sobre temes diversos. Si voleu proposar un article per als «Destacats de ciència», poseu-vos en contacte amb la secretaria de la SCB (scb@iec.cat). Els autors que també siguin socis de la SCB tenen preferència en el procés d’acceptació dels articles.

Scope The journal Treballs de la Societat Catalana de Biologia (Treb. Soc. Cat. Biol.), published by the Societat Catalana de Biologia (SCB), a subsidiary of the Institut d'Estudis Catalans (IEC), releases articles in the field of life sciences in the Catalan language (and occasionally in other languages). The journal comprises two sections: — “Destacats de recerca”: articles in the field of research or a monographic review of a topic in a specific scientific field. A coordinator expert in the field commissions the articles to a team of authors and supervises the drafting process. If you would like to take part as a coordinator for a topic of your interest for the “Destacats de recerca” section you can contact the SCB secretary at scb@iec.cat. — “Destacats de ciència”: articles about popular science, current affairs and scientific opinion on a range of topics. If you would like to propose an article for the “Destacats de ciència” section you can contact the SCB secretary at scb@iec.cat. Authors who are also SCB members have preference in the article admission process.

Procés editorial Els articles, un cop rebuts, se sotmeten a un procés de revisió externa de forma i contingut. En acabat, poden ser: a) acceptats sense canvis, b) rebutjats o c) acceptats amb esmenes proposades als autors. En aquest darrer cas, és un requisit indispensable per a publicar-los que l’autor accepti introduir les esmenes proposades. Els autors rebran unes galerades perquè les revisin. En aquest procés només poden introduir-hi esmenes de caràcter lingüístic i tècnic, però no de contingut. En casos especials, la SCB podrà demanar als autors revisions addicionals. Els autors rebran sense càrrec un exemplar de la revista un cop publicada.

Publishing process Upon receipt, articles undergo a peer review of form and content. Once this process is complete, the articles may: i) be accepted without changes; ii) be rejected; or, iii) be accepted, albeit with the author being advised to make amendments. In the latter case, authors must agree to make the changes proposed in order for the articles to be published. Authors will be given galley proofs in order to review them. At this stage of the process they will only be able to make technical or linguistic amendments and not changes related to content. In specific circumstances, the SCB may ask authors to carry out additional reviews. Authors will receive a copy of the journal free of charge once it has been published.

Criteris generals de presentació d’articles El material presentat ha de ser original i no ha d’haver estat publicat abans. Els articles han de tenir l’extensió demanada (vegeu els dos apartats següents, tenint en compte que cal incloure els espais en blanc en el comptatge de caràcters) i el nombre de taules i figures ha de ser el mínim imprescindible per a facilitar la comprensió del text. En cas que la llargària no s’adeqüi als criteris especificats o que el nombre de taules o figures es consideri excessiu, la SCB podrà proposar canvis pel que fa a aquests aspectes abans d’acceptar l’article. Els articles s’han d’enviar en un arxiu en format Microsoft Office o OpenDocument. Aquest arxiu ha de contenir només text (article, bibliografia, taules, peus, etc.). Les figures s’han d’enviar en arxius a part i, si contenen text (a part dels peus), ha d’estar en un format que permeti editar-lo. Si la taula o figura té copyright, cal indicar-ho. La bibliografia s’ha de compondre tal com s’exemplifica tot seguit, per bé que, posteriorment, els editors adequaran tipogràficament aquestes referències a l’estil de la publicació: Codina, C. [et al.] (1989). “Potencial biotecnològic del cultiu de cèŀlules vegetals per a l’obtenció de productes farmacèutics”. Treb. Soc. Cat. Biol., 40: 47-70. Mellado, R. P. (1987). “Vectores utilizados para la manipulación y expresión de genes”. A: Vicente, M.; Renart, J. (ed.). Ingeniería genética. Madrid: CSIC, 21-30. Wolffe, A. (1995). Chromatin structure and function. Londres: Academic Press. Les referències bibliogràfiques completes han d’aparèixer ordenades alfabèticament al final dels articles i, si contenen més de dos autors, cal escriure només el primer, seguit de la indicació et al. entre claudàtors. Les remissions a la bibliografia dins el text han de seguir el sistema de cognom i any, no pas un sistema numèric, i, si contenen més de dos autors, cal escriure només el primer, seguit de la indicació et al., en aquest cas sense claudàtors. Criteris específics per als articles de «Destacats de recerca» Els articles de la secció «Destacats de recerca» han de tenir una extensió de 20.00030.000 caràcters i han d’incloure els apartats següents: títol; noms i cognoms dels autors; filiació de tots els autors; autor per a la correspondència (cal indicar-ne les adreces postal i electrònica, i el telèfon); resum en català (màxim de 1.000 caràcters); paraules clau en català (màxim de cinc); títol, resum i paraules clau en anglès (que han de ser fidels, en extensió i contingut, als corresponents en català); text de l’article (amb un màxim de dos nivells d’apartats); bibliografia; taules, i peus de figura. Criteris específics per als articles de «Destacats de ciència» Els articles de la secció «Destacats de ciència» han d’incloure els apartats següents: títol (no acadèmic), subtítol (opcional, i aquest pot ser més acadèmic), noms i cognoms dels autors i filiació de tots els autors. A més, si n’hi ha, bibliografia, taules i peus de figura. Els articles d’aquesta secció poden ser: — Articles llargs (6.000-8.000 caràcters; inclouen una entradeta de 500-700 caràcters i una nota curricular de 500-600 caràcters). Tipologia: «Exposició» (desenvolupament d’una idea de ciència en sentit ampli) i «Jove investigador» (escrit pel guanyador del Premi per a Estudiants de la SCB). — Articles curts (4.000 caràcters). Tipologia: «Flaix» (desenvolupament d’una idea de ciència en sentit ampli); «Carrera» (descripció de la carrera d’un biòleg no investigador); «Fòrum» (descripció d’un centre o instaŀlació de recerca); «Ciència en societat» (descripció d’activitats de transmissió de coneixement); «Del laboratori a l’aula» (propostes de la Secció d’Ensenyament); «Racons» (propostes, preferentment, de les seccions transversals d’Estudiants i de Biologia i Indústria); «Lectura» (llibre de ciència editat en català), o «Un lloc per visitar» (proposta de turisme científic).

General criteria for submitting articles Material submitted must be original and cannot have been published elsewhere previously. Articles must be of the required length (see sections below – character counts must include spaces) and the number of tables and figures should be kept to a minimum in order to simplify understanding of the text. If the length is unsuitable for the specified criteria or if there are too many tables or figures, the SCB may propose changes concerning these areas before accepting the article. Articles must be submitted in Microsoft Office or OpenDocument format. The file should contain text only (the main article, references, tables, figure captions, etc.). Figures must be sent in separate files and if they incorporate text (aside from captions) the file format must allow for them to be edited. If a table or figure is copyrighted, this circumstance must be specified. References must be set out as shown below, although the editors may subsequently adapt them according to the definitive publishing style: Codina, C. [et al.] (1989). “Potencial biotecnològic del cultiu de cèŀlules vegetals per a l’obtenció de productes farmacèutics”. Treb. Soc. Cat. Biol., 40: 47-70. Mellado, R. P. (1987). “Vectores utilizados para la manipulación y expresión de genes”. In: Vicente, M.; Renart, J. (ed.). Ingeniería genética. Madrid: CSIC, 21-30. Wolffe, A. (1995). Chromatin structure and function. London: Academic Press. Full bibliographic references must be set out in alphabetical order at the end of articles and, if they contain more than two authors, only the first author should be specified followed by the indication et al. in square brackets. References to the bibliography within the text must follow the author-year system rather than being in numerical order of appearance and, if they contain more than two authors, only the first author should be specified followed by the indication et al. without square brackets. Specific criteria for articles in the “Destacats de recerca” section Articles in the “Destacats de recerca” section should be between 20,000 and 30,000 characters long and include the following information: title; authors’ names and surname; personal particulars of all authors; contact author (email, address and telephone number required); abstract in Catalan (1,000 characters maximum); keywords in Catalan (maximum of 5); title, abstract and keywords in English (which must be true to the Catalan versions in terms of length and content); main text of the article (with two sections of levels at the most); references; tables and figure captions. Specific criteria for articles in the “Destacats de ciència” section Articles in the “Destacats de ciència” section must include the following information: title (non-academic), subtitle (optional and may be more academic), authors’ names and surname and personal particulars of all authors. In addition, if applicable, references, tables and figure captions. Articles in this section can be either of the following: — Long articles (6,000-8,000 characters; including an introduction of about 500-700 characters and a biographical note of about 500-600 characters). The latter may be of the following types: “Exposició” (broad development in a field of science) and “Jove investigador” (written by the SCB student prize winner). — Short articles (4,000 characters). Types: “Flaix” (broad development in a field of science); “Carrera” (description of the career of a non-research biologist); “Fòrum” (description of a research centre); “Ciència en societat” (description of knowledge transfer activities); “Del laboratori a l’aula” (SCB education section proposals); “Racons” (proposals preferably made by the cross-disciplinary sections for students and biology and industry); “Lectura” (science book published in Catalan) or “Un lloc per visitar” (proposal about scientific tourism).

85


Volum 66, 2015 - Índex

Destacats de ciència

2 Editorial. Dolors Vaqué El racó de la SCB. Josep Clotet

Flaixos de ciència 62 Una mirada val més que mil paraules. Mónica Marro i Pablo Loza-Álvarez 64 Els peixos són formidables nedadors (i nedar és bo per a ells). Josep V. Planas

3 Pròleg. Àurea Navarro-Sabaté 4 La nova generació de tecnologies de seqüenciació obre una nova era en la genòmica. Mònica Bayés 9 Proteòmica de sistemes complexos. Eva Borràs i Eduard Sabidó 15 Bioinformàtica: una eina essencial per als biòlegs del segle xxi. Marc A. Marti-Renom 19 Microscòpia òptica avançada per a les ciències de la vida: de les seccions òptiques a la nanodissecció òptica. Lídia Bardia, Maria Marsal i Julien Colombelli 25 La microscòpia electrònica de transmissió en biologia cel·lular: valoració de les tècniques i informació de les imatges. Núria Cortadellas i Mercè Durfort 31 La citometria com a eina per aprofundir en la complexitat dels organismes vius i les malalties. Jordi Petriz 37 Experimentació en animals: la revolució dels transgènics. Miquel Garcia i Anna Pujol 43 Espectroscòpia de ressonància magnètica nuclear (RMN). Margarida Gairí, Miguel Feliz i Miquel Pons 48 Tècniques d’imatge in vivo aplicades a la recerca biomèdica. Immaculada Rafecas Jorba 53 Tècniques de diagnòstic molecular aplicades a l’estudi del càncer. Sergio Alonso, Andreu Alibés i Manuel Perucho

treballs

Premi d’Estudiants de la SCB 2014 66 Vulnerabilitat per psicosi mesurada en població sana catalana. Elionora Peña Lozano

de la Societat Catalana de Biologia

RBC

Entrevistes 70 Entrevista a Francisco Guarner. Bru Papell 72 Entrevista a Daniel Simberloff. Bru Papell Premi Nobel 75 El sistema de navegació del cervell Carrera 76 Tècnics a l’Antàrtida. Juan Luis Ruiz Valderrama Àgora 78 Centre de Recerca en Sanitat Animal El personatge 80 Dues vides, un objectiu. Àlvar Martínez Vidal

C RBC

Ciència en societat 82 Divulgació: del model en sèrie a l’experiència en paraŀlel. Francesc Uribe  

Lectures 84 Premi Bromera. Soledat Rubio 84 Premi d’Assaig Josep Vallverdú. Oriol Izquierdo

i vols…

...conèixer els darrers aven ió de seminaris ...participar en l’organitzac ...rebre la revista . llibres, cursos i jornades.. ...gaudir de descomptes en ...per

1912 2012

PLACA NARCÍS

MONTURIOL

2003

CREU DE SANT JORDI

2012

què no t’hi associes? http://scb.iec.cat

Volum 66

ogia Si t’interessa la biolço s

B

A

Premi Gemma Rosell i Romero 2014 68 Les deteriorades bigues de l’envelliment cutani. Víctor Marcos Garcés

treballs de la Societat Catalana de Biologia

Destacats de recerca

Volum 66 2015 · revista anual

ISSN 0212-3037 (edició impresa) ISSN 2013-9802 (edició digital)

C

Treballs de la Societat Catalana de Biologia  

Volum 66 - 2015

Read more
Read more
Similar to
Popular now
Just for you