Issuu on Google+

Friday, August 6, 2010

A Star News Group publication

Phone: 5221 5200 Trades and Classifieds: 1300 666 808

Help us name dingo pups

MPs warm to Gillard entering electorate

PAGE 5

PAGE 12

487442-RMB31-10

The Independent, Friday August 6, 2010

OPTUS page 1


487443-RMB31-10

OPTUS page 2

The Independent, Friday August 6, 2010.


Friday, August 6, 2010

A Star News Group publication

Phone: 5221 5200 Trades and Classifieds: 1300 666 808

YOUR GUIDE TO LOCAL PROPERTY MARKET INSIDE

ACTU ENTERS ARC DISPUTE PAGE 3

Service overcomes concerns to find Headspace for youth at Drysdale

Here to help: Headspace’s Tanya Fitzpatrick, Naomi Adams, Mirella Barton and Robert Taylor.

Picture: John Conway

51189

BY KIM WATERS A PROGRAM helping youths with mental health problems has overcome community opposition to open at Drysdale, according to management. Barwon Headspace’s Toni van Hamond said the service’s push into Peninsula Drive had sparked concerns about “disturbed and drugaffected” youths gathering in the area. But the Bellarine Peninsula had a “high need” for a Headspace centre, she said. “Young people who will access our services are already there right now in the community. “We’re trying to prevent long-term health issues and, as adults, we’ve got to get over the stigma surrounding mental health. These are our young people - your nieces, nephews, sons, daughters and grandchildren – so let’s not label them.” Ms van Hamond said the centre would open on Monday initially as a part-time service on weekday afternoons. “We’ll have minimum staff to start with but the aim is to get a general practitioner, youth workers, mental health workers, drug and alcohol workers, psychologists and nurses involved. “Last year we did an analysis of the postcodes accessing our city Headspace hub and Drysdale and Ocean Grove were in the top eight.” Drysdale and Clifton Springs Community Association spokesperson Patrick Hughes said residents had finally accepted the program after initial “concerns”. “There is always concern when something unusual and off-the-wall like this is proposed,” Mr Hughes said. “We don’t have a lot of facilities for young people here and all of the professionals in the area think that this is a good idea, so, as an association, we’re definitely behind it.”

Rotunda lease battle BY KIM WATERS TWO COMMUNITY services are battling each other for a five-year lease on Portarlington’s historic rotunda. A district hospital auxiliary op shop wants to move back into its home of 35 years after the completion of upgrade works but faces competition from a push for a tourist information centre and “eco shop” in the rotunda. The op shop has sought a five-

year lease extension from City of Greater Geelong after the renovations. But Portarlington’s Yvonne Parker said she had written to council proposing the eco shop. Ms Parker said volunteers would run the shop to provide residents and tourists with tips for being environmentally friendly. “It would be a bit of a travesty to keep the op shop there,” Ms Parker said.

“The rotunda is right in the centre of town and is a perfect spot for a combined eco shop and tourist information centre.” Ms Parker said council had yet to respond to her proposal. The facility would be a first for Victoria, she said. “The idea started in South Australia but there isn’t a shop in Victoria where you can get all kinds of environmental tips in the one place.

“Tourists and residents could get information from how to make their house more environmentally friendly to how to plant a droughttolerant garden.” Portarlington Community Association president John Turner backed the proposal. He called for “more discussion” before council extended the op shop lease. “From a community association point of view, before anyone

makes any decisions about whether the op shop goes back there the (eco shop) idea should be canvassed to the community to see what they want,” Mr Turner said. “The idea of an eco shop or tourism hub is a worthwhile discussion and there is a great opportunity here for a real use for the rotunda.” Bellarine Community Health chief executive John Fendyk said the rotunda site played a “significant” role in funding for the service.

The auxiliary’s lease expires at the end of August next year, Mr Fendyk said. “We have sought a commitment from the City that we can return when the renovations are completed but have not received an official answer. “As well, I wrote seeking an additional extension beyond the existing lease period and have not received any confirmation.”

OVERSTOCKED!

65

$ our 5 s

tar bus

Solid Pine Tallboy

Was $399 Now $189

departs

EVERY S UN IN 2010 DAY kid

426799-FB25-10

CHARLES ST

WE ARE HERE

TORQUAY RD

TH ST

LEARMOU

GLYN ST

SH

WY

JAMES ST

CE PR IN

• • • •

s up t only $ o 15 60 hire jackets/pants sales snowboards

KIDMAN AVE

Phone: 5244 0111 Mobile: 0424 660 207 Shop 2/48 Kidman Ave, Belmont

CHECK OUT OUR NEW WEBSITE! www.ozextreme.com.au

Solid Pine Bedsides

Was $179 Now $79

487744-JF31-10

High Back Fully Upholstered PU Chair - Chocolate & Brown

Federation Double Bed

Was $499 Now $199

Was $149 Now $69

Fully Upholstered Micro Suede Chairs

Modern Stools ALL ONE PRICE

Was $119 Now $59

Was $179 Now $79

CHECK OUT MORE GREAT BARGAINS IN THE TV GUIDE 327 Shannon Ave, Newtown (Next to St Josephs College) P: 5222 4583 M: 0431 702 252


423352-FB21-9

Liberal hand-out for libary, heritage works

'2<28+$9(7<3( ',$%(7(6"

Hands out: Geelong Mayor John Mitchell, Liberal candidate Sarah Henderson and deputy leader Julie Bishop at the funding announcement. Picture: John Conway 51331

BY KIM WATERS A LIBERAL government would give Geelong $15 million for a library and heritage centre upgrade, the oppositionâ&#x20AC;&#x2122;s deputy leader announced on Wednesday. Julie Bishop joined Liberal candidates Sarah Henderson and Don Gibson at the library to unveil the pre-election commitment. The former education minister said she was â&#x20AC;&#x153;very pleasedâ&#x20AC;? to announce the promise. â&#x20AC;&#x153;Todayâ&#x20AC;&#x2122;s announcement goes very much to the passion I have,â&#x20AC;? Ms Bishop said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s not only very dear to the hearts of Don Gibson and Sarah Henderson but also to everyone who lives in the vicinity and to me.â&#x20AC;? Ms Bishop said the new library and heritage centre would house â&#x20AC;&#x153;fundamentalâ&#x20AC;? memorabilia and historical records. â&#x20AC;&#x153;They will enrich our understanding of where we come from, where we are going and where we are,â&#x20AC;? she said. Geelong Mayor John Mitchell said council had campaigned â&#x20AC;&#x153;long and hardâ&#x20AC;? for the library and heritage centre upgrade. Council would provide $20 million for the project, he said. â&#x20AC;&#x153;This really is a great day for Geelong.â&#x20AC;?

mitch37102

<RXPD\EHVXLWDEOHIRUWKLVVWXG\LI\RXDUH Â&#x2021;$SHUVRQZLWK7\SHGLDEHWHV Â&#x2021;$JHGEHWZHHQLQFOXVLYH Â&#x2021;&XUUHQWO\WUHDWHGZLWKPHWIRUPLQ 25 Â&#x2021;0DQDJHGZLWKGLHWDQGH[FHUFLVHRQO\

Listening to the Community Bushfire Royal Commission Recommendations The Royal Commission into the 2009 Victorian bushfires handed down its final report on the 31st July.

 ,WLVHVVHQWLDOIRUSHRSOHZLWKGLDEHWHVWRPDLQWDLQJRRGEORRGJOXFRVHFRQWURO IRUDKHDOWK\OLIHVW\OH

To develop its final response, the Government will consult people who are directly affected.

A meeting will be held in Anglesea - Friday 6 August, 6.30 - 8.30pm All members of the community surrounding this area are invited to attend. Please refer to www.premier.vic.gov.au for further details.

s

â&#x20AC;˘

pair

Sale

1

#

s

Feedback can also be emailed to the Premier, John Brumby, at: john.brumby@parliament.vic.gov.au

487964-RMB31-10

As part of the consultation process over the coming weeks, communities will be asked for their views on these important decisions that will help make Victoria as fire-safe as possible.

BY ERIN PEARSON A SURGE in reports of family violence around Geelong has prompted police to launch a new unit in the city. Leading Senior Sergeant Brendan Whitefield said the dedicated Geelong Police Family Violence Unit was a first for the city. He said Geelong now had â&#x20AC;&#x153;enough incidents to warrantâ&#x20AC;? establishing the unit, which would focus on repeat offenders. The Independent has reported rising levels of family violence in Geelong during the past few years. A Salvation Army annual report noted that domestic violence had risen 60 per cent during 2008/2009 in the armyâ&#x20AC;&#x2122;s Kardinia region of Geelong.

Re

-R&KDPEHUVLQWKH'HSDUWPHQWRI&OLQLFDODQG %LRPHGLFDO6FLHQFHVDW%DUZRQ+HDOWKÂą7KH*HHORQJ +RVSLWDORQ  RU HPDLOMFKDP#EDUZRQKHDOWKRUJDX

487955-RMB31-10

7KHVWXG\LVFRQGXFWHGE\3URIHVVRU*HRII1LFKROVRQRI7KH8QLYHUVLW\RI 0HOERXUQHLQDVVRFLDWLRQZLWK%DUZRQ+HDOWK,I\RXZRXOGOLNHWRYROXQWHHU RUVLPSO\ÂżQGRXWPRUHLQIRUPDWLRQSOHDVHFRQWDFW

The remaining recommendations are complex and will affect communities in different ways.

Fast Art 115462_v5

,QGLYLGXDOVZLWK7\SHGLDEHWHVDUHLQYLWHGWRWDNHSDUWLQDVL[PRQWK FOLQLFDOWULDOGHVLJQHGWRDVVHVVWKHHIIHFWLYHQHVVRIDQHZRUDOWKHUDS\

Of the Commissionâ&#x20AC;&#x2122;s 67 recommendations, the Victorian Government has supported 59 in principle and has called for further consultation.

Family violence rise â&#x20AC;&#x2DC;behind unitâ&#x20AC;&#x2122;

Ser vice â&#x20AC;˘

*6473,;,*647<;,9:,9=0*,7(*2

9LTV]HSVMHSS=PY\ZLZ:W`^HYLHUK7VW\WZ:`Z[LT6W[PTPZH[PVU0UZ[HSSM\SS]LYZPVUVMHU[P]PY\ZVM`V\Y JOVPJL5VY[VU;YLUK4PJYV2HZWLYZR`JH0U[LYUL[:LJ\YP[`4J(MLL5VYTHS=HS\L  

5V^

ZH]L 

%&&&RPSXWHUVLV1R&RPSXWHU6DOHVDQG6HUYLFHVLQFH

23(1'$<6

3+

3DNLQJWRQ6WUHHW*HHORQJ:HVW  6XSHUVWRUHVLQRQHFRQYHQLHQWORFDWLRQ ZLWKDPSOHFDUSDUNLQJ

3+ 3+  

WE WILL BEAT ANYONEâ&#x20AC;&#x2122;S ADVERTISED PRICE! 2

The Independent, Friday August 6, 2010.

0010ajelowyi4/8/10

467759-RMB31-10

Save $$$ expires 31/8/2010


More police on attack over shift from Corio

in brief

BY ERIN PEARSON MORE Corio police have come forward to vent frustration over a forced move into Geelong. A long-serving officer, who wanted to remain anonymous, backed concerns among detectives reported in last weekâ&#x20AC;&#x2122;s Independent that the shift would hamper crime-fighting in the Corio area. â&#x20AC;&#x153;Corio station is one of the best stations Iâ&#x20AC;&#x2122;ve ever worked at,â&#x20AC;? the officer said. â&#x20AC;&#x153;It breaks my heart to see a bloody good station get ruined because Corio was getting the job done.â&#x20AC;? Command started transferring Corio

VOTERS have stared having their say in Corio electorate as part of an early voting program. Australian Electoral Commission said it had started receiving ballots from voters who would be unable to vote on election day, August 21.

detectives to the Geelong station on Monday. The Corio officer said he believed the â&#x20AC;&#x153;removalâ&#x20AC;? of retired police from station desks had put pressure on serving members to handle more work. â&#x20AC;&#x153;Operational police persons were used to greet people at station counters and take reports, which freed up fully operational members,â&#x20AC;? he said. â&#x20AC;&#x153;But the changes made by State Government have fazed these people out and now the Government expects uniform officers to do more work. â&#x20AC;&#x153;This has resulted in Geelong needing more CIU officers, which it has taken from Corio.â&#x20AC;?

The officer said command had slowly been taken officers from the Corio station over the last 10 years. â&#x20AC;&#x153;The traffic operations unit has already disappeared from Corio and now the CIU. We must stop taking local knowledge out of the area. â&#x20AC;&#x153;This move is an absolute crock.â&#x20AC;? Geelong police CIU Senior Sergeant Rod Lloyd said he had yet to hear any complaints about the â&#x20AC;&#x153;mergerâ&#x20AC;?. â&#x20AC;&#x153;I think thereâ&#x20AC;&#x2122;s been a positive reaction and thereâ&#x20AC;&#x2122;s certainly been no decrease in service,â&#x20AC;? he said. â&#x20AC;&#x153;Attending crimes has proceeded as normally and I donâ&#x20AC;&#x2122;t see thereâ&#x20AC;&#x2122;s has been any negatives but weâ&#x20AC;&#x2122;re still very

much in formative stage â&#x20AC;&#x201C; itâ&#x20AC;&#x2122;s just a matter of acclimatising. â&#x20AC;&#x153;People are often reluctant or resistant to change but once it occurs they soon realise itâ&#x20AC;&#x2122;s not as bad as they thought it would be. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s not going to change. Itâ&#x20AC;&#x2122;s a matter of moving forward and making the emphasis on preventing and detecting crime. â&#x20AC;&#x153;People can complain but thatâ&#x20AC;&#x2122;s the way it is.â&#x20AC;? Snr Sgt Lloyd said the move would allow a â&#x20AC;&#x153;greater concentration of detectivesâ&#x20AC;? at the Geelong station to share their knowledge of criminal suspects and crimes.)

Brain talk A FORMER professional tennis player who lost his career when he injured his brain in a skateboarding accident will speak in Geelong about how he dealt with his impairment. Grayden Moore will be the keynote speaker at community service provider Karingalâ&#x20AC;&#x2122;s expo on August 16 at Geelongâ&#x20AC;&#x2122;s State Government offices as part of Brain Injury Awareness Week around Victoria.

Early voting

Restaurant win A BELLARINE Peninsula venue has won an award for best restaurant at a winery in a 2010 Restaurant and Caterers Awards in Melbourne. Wallingtonâ&#x20AC;&#x2122;s Oakdene Vineyards won the award from a field including previous winner Pettavel Winery Restaurant, of Ceres.

Falls cash A LORNE music festival is calling for funding submissions to vie for a funding pool of $16,000. Falls Festival Organisers said information and application forms were available at Lorne businesses to nominate projects to be determined with a community vote in October.

Library launch GEELONG Regional Library service is on the way to Moriac. The service said it would run its â&#x20AC;&#x153;inaugural visitâ&#x20AC;? to the townâ&#x20AC;&#x2122;s community centre from 11am to 1pm on Monday as part of a new program delivering services to towns without libraries.

Z club A WOMENâ&#x20AC;&#x2122;S service club will launch a branch in Geelong for youths. Zonta said its Z Club would provide â&#x20AC;&#x153;career guidance and promote leadershipâ&#x20AC;?.

See page 22 for your own comprehensive Unpaid: Workers and unionists rally outside the premises of former employer Arc Engineering.

Picture: John Conway

51301

New ACTU boss wades into Geelong Arc dispute

New: ACTU boss Ged Kearney.

BY ANDREW MATHIESON A BOSS who started a third failed business left owing workers tens of thousands of dollars in entitlements, according to Australiaâ&#x20AC;&#x2122;s peak union organisation. The ACTU joined former Arc Engineering employees this week to take up the fight for their missing accrued annual leave, redundancy payments, final weekly wages and up to 20 months of superannuation each. New ACTU president Ged Kearney said unions were dismayed the workers had been held in such contempt. â&#x20AC;&#x153;This is just pretty terrible,â&#x20AC;? she said. â&#x20AC;&#x153;They all got laid off around Christmas last year, which makes it even more tragic.

â&#x20AC;&#x153;This is sort of situation we have to avoid and the unions have been fighting for a long time. â&#x20AC;&#x153;Workers should be top of the list for getting paid out when companies go under.â&#x20AC;? Ms Kearney said the ACTU attempted to make contact with former Arc boss Phil Townrow at his latest venture, Inteng, on the same site as the defunct business only to discover the doors closed again on Tuesday. Unions claimed Inteng was the third re-branding of the engineering firm following previous names Alloy and Arc. â&#x20AC;&#x153;To open up another business straight away is a real slap of the face if he had enough money to start up another business

in a different name,â&#x20AC;? M Kearney said. She believed the workers were entitled to their minimum entitlements under existing federal laws. Mrs Kearney said the Arc workers had been unaware the company was insolvent company until their last day. â&#x20AC;&#x153;They just said they had no cash, didnâ&#x20AC;&#x2122;t have any money to pay them out. They should have been paying the superannuation all long. They should have made provisions to pay out redundancy entitlements.â&#x20AC;? The Independent attempted to contact Mr Townrow at the premises of Inteng but a woman who answered the call said: â&#x20AC;&#x153;There is no one of that name here.â&#x20AC;?

Wedding & Celebration Lift-Out Guide &

SAVE

486589-JM31-10

TOYS(;+,%,7,21 &20,1*6221 'RQÂśWPLVVLW

6 AUGUST TO 3 OCTOBER, 2010 Developed by Questaconâ&#x20AC;&#x201D;The National Science and Technology Centre, Canberra.

6FKRROKROLGD\VFLHQFHDFWLYLWLHVKHOGGXULQJWKHÂżUVWZHHNRIWKH6HSWHPEHU VFKRROKROLGD\VERRNLQJVUHTXLUHG9LVLWZZZQZPYLFJRYDXIRUPRUHLQIRUPDWLRQ

CHRISTMAS CREATIONS for Mr Johnston ss rti anan iss ng loon g AArt Geel bybyGee

Donâ&#x20AC;&#x2122;t miss your chance to view the exquisite handmade Christmas decorations created by Geelongâ&#x20AC;&#x2122;s own artists and craftspeople for the Johnston Collection in Melbourne. Come individually or get your group together now and make a booking.

29 MAY TO 29 AUGUST 26 Moorabool Street, Geelong, 3220 Tel: 03 5272 4701 Email: nwminfo@geelongcity.vic.gov.au Web: www.nwm.vic.gov.au Open: Mon-Fri 9.30am-5.00pm, Sat & Sun 1.00-5.00pm General admission charges apply

national wool museum

The Independent, Friday August 6, 2010

487916-RMB30-10

Com on an incredible journey Come ourney from the outer limits of the fro M Milky Way galaxy, through our S Solar System and into the vvery centre of planet Earth. arth. A Along the way, play with in over interactive exhibits that cover a wide range of topics such ch as astro raphy, astronomy, geology, geography, envir ology. environmental science and biology.

'RQÂśWPLVV\RXUFKDQFHWRZLQDIUHH IDPLO\SDVVWR(DUWK4XHVWVHHWKH79 *XLGHLQVLGHIRUPRUHLQIR

3


Proposed Redistribution of Federal Electoral Boundaries in Victoria

The Federal Redistribution 2010 VICTORIA

(proposed boundaries do not apply for the 21 August federal election) How to lodge an objection to the proposed redistribution Interested persons or organisations may lodge written objections against the proposed redistribution. Objections must be lodged in writing with the office of the Australian Electoral Officer for Victoria before 6 pm on Friday 27 August 2010. Address details are listed above. The Electoral Act requires that the objections and comments be made publicly available. Copies of submissions will be made available in full for public inspection at the address above, in accordance with the Electoral Act. These submissions will also be published on the AEC website and included in the report produced by the augmented Electoral Commission for Victoria. Name, signature and address details of persons and organisations that lodge written submissions are published as part of these processes. Further information about the disclosure of personal details is provided in the Guidelines for Making Public Submissions to a Redistribution, available on the AEC’s website, or can be obtained from the Redistribution Secretariat whose contact details are listed above.

The redistribution will take effect when the final determination is made on 17  December  2010. That is, the new boundaries do not apply for the 21 August federal election. Members of the public and organisations are invited to inspect the report of the Redistribution Committee which contains reasons for the proposed redistribution and detailed maps showing the names and boundaries of each proposed electoral division, as well as the suggestions, and comments on those suggestions, lodged with the Redistribution Committee.

What is a redistribution? A redistribution is a redrawing of electoral boundaries to ensure that, as far as practicable, there are the same number of electors in each division within a state or territory. In making the proposed redistribution, the Redistribution Committee takes into account community of interests, communication and transport links, physical features, and the current boundaries.

The proposed divisions Projected enrolment growth across the state means that divisional boundaries must be reviewed to ensure that, as far as possible, there are equal numbers of electors in each division. The Redistribution Committee has proposed changes to the existing federal electoral boundaries in order to meet the numerical parameters that are prescribed in the Electoral Act. The Committee’s proposal includes the creation of a new Division of Burke in the north-west outer Melbourne metropolitan area and the abolition of the Division of Murray. In developing its proposal, the Redistribution Committee considered community of interests. It also took into account transport and communication links across and between communities, and made use of local government boundaries, main roads and geographical features.

Names of proposed divisions The Redistribution Committee has proposed that the new division be named Burke, in recognition of the explorer Robert O’Hara Burke.

Want more information? Why is a redistribution being conducted? A redistribution is required because seven years has elapsed since Victoria was last distributed into federal electoral divisions. In accordance with section 59 of the Commonwealth Electoral Act 1918 (the Electoral Act) the Electoral Commission therefore directed that a redistribution commence on 1 February 2010.

What has happened so far? A Redistribution Committee was appointed on 3  May  2010. Notices inviting suggestions and comments were placed in the Commonwealth Gazette on 10  March  2010, and in The Age and the Herald Sun newspapers on 13 March 2010. Twelve suggestions and nine comments on those suggestions were received and considered by the Redistribution Committee in the development of its proposal.

The Redistribution Committee’s report is available on the AEC website (www.aec.gov.au). Copies of the report, including maps, can be obtained by contacting the Redistribution Secretariat:

Persons or organisations considering making objections against the proposed redistribution are urged to take account of the requirements of the Electoral Act which can be accessed through the AEC’s website under the heading About AEC (Publications).

What happens next? The objections will be available for inspection at the office of the Australian Electoral Officer for Victoria and on the AEC’s website from 9 am on Monday 30 August 2010. Persons or organisations may then lodge written comments on these public objections. Written comments must be received at the office of the Australian Electoral Officer for Victoria before 6 pm on Friday 10 September 2010. All public submissions received within the legislative timeframe will be considered by the augmented Electoral Commission for Victoria. The augmented Electoral Commission for Victoria may hold public hearings and, if necessary, will make a revised proposal, in which case it will consider any further objections before making a final determination of divisional boundaries and names. Details of the determination will be published and tabled in Federal Parliament. The final determination is not subject to appeal.

When will the new boundaries come into effect?

Email: vicredistribution@aec.gov.au Phone: (03) 9285 7177 Fax: (03) 9285 7169 Australian Electoral Commission Level 8 Casselden Place 2 Lonsdale Street Melbourne Victoria 3000 Victoria 8060

GPO Box 9867 Melbourne

The report can also be inspected at Australian Electoral Commission (AEC) Divisional Offices in Victoria, the AEC’s State Office in each capital city, and the National Office in Canberra. For the address of the nearest AEC office, please phone 13 23 26.

The proposed boundaries are not applicable for the 21 August 2010 federal election. The redistribution takes effect when the final determination is made on 17  December  2010. New boundaries will not apply until the first federal election after that determination date. Ed Killesteyn Jenni McMullan Electoral

John E Tulloch

Des Pearson

Australian Electoral Surveyor-General Auditor-General

Commissioner Officer for Victoria Victoria

Victoria

REDISTRIBUTION COMMITTEE FOR VICTORIA

487953-RMB31-10

The Redistribution Committee for Victoria has made a proposed redistribution of federal electoral boundaries in Victoria.

adcorp29443

4

The Independent, Friday August 6, 2010.


It’s dingo puppy love

ACCOUNTING & TAXATION SERVICES ABN 53 730 260 132

• MAXIMISE your REFUND

Name the pups and win passes

• Lodged electronically • Over 20 years experience in taxation

FROM

• Also business and corporate accounting and taxation No appointment necessary

$77

173A Melbourne Rd, North Geelong PO Box 8030, Rippleside Vic. 3215 Ph: 03 5277 3380, Fax: 03 5277 3382 Email: accounting@darrenthomas.com.au

NO DEBT..! ... it’s what we all want..! Want to pay off your unsecured debts at NO INTEREST?

We Can Help!

HAVE PEACE OF MIND...

Through a Government legislative debt agreement, you can remove the “stress” of dealing with your creditors and debt collectors plus, remove the “stress” of repaying your debts individually. We consolidate all your unsecured debts into one easy repayment plan best suited to your income and budget.

For a free, no obligation consultation...

Contact CNN DEBTTM today Minimum debt $10,000

Furry friends: Tehree Gordon with two of her new “little terrors” at Barwon Heads’ Jirrahlinga wildlife sanctuary. To see more photos of the pups, go to StarPhotos.com.au, follow the prompts and enter code 50861. Picture: John Conway 50861

1300 266 332 (1300 CNN DEBT) www.cnndebt.com.au 487351-TB31-10

endangered. “Dingoes only recently came off the vermin list in Victoria and have now been put on the threatened species list. It’s a new recognition for purebred dingoes and this is important because we only have a very limited numbers in Australia.” Volunteer carer Samantha Hall said dingo pups were “completely different” to domestic dogs. “The big difference is the mum supplies the milk and the dad goes out hunting then regurgitates the meat for the pups to eat, so by three weeks of age they’re eating solid food,” she said.

TAX

• JULY AND AUGUST OPEN: 9.00am - 8.00pm Monday to Friday 8.00am - 12.00pm RETURNS Saturday

482747-FB27-10

THE INDEPENDENT’S readers can enter a competition to name one of Jirrahlinga’s new dingo puppies. Tehree Gordon will choose the best names for seven puppies and give the winners a free pass to the sanctuary as a prize. The Independent will reveal the names and winners in the September 10 edition of the paper. Each entry should contain one puppy name. Send entries with your name and phone number to: Independent Name the Dingo Puppy Competition, PO Box 407, Geelong, 3220; email editorial@geelongindependent.c om.au; or fax 5221 3823 The competition closes on August 31.

401121-JM10-10

BY ERIN PEARSON THE REGION’S first breeding program for dingoes will begin at Barwon Heads after the birth of nine pups at Jirrahlinga wildlife sanctuary, according to its owner. Tehree Gordon said the “little terrors” would lead the program after she recently took over a dingo farm at Castlemaine. Jirrahlinga would have one of only a few purebred dingo breeding programs in Australia, she said. Ms Gordon called the pups from three litters an “exciting” addition to the Jirrahlinga family. But the five-week-olds were proving a challenge for staff. “They’re little terrors,” Ms Gordon said. “Normally people go ‘Ooh, ahh’ when you bring the koalas out but now we’re getting that when we bring the dingo pups out. “They are very spoilt little dingoes.” Jirrahlinga has put three of the pups on public display Ms Gordon said the pups were an expensive addition, costing the not-for-profit sanctuary around $2000 a year each to raise. She was seeking sponsors to help cover the cost of the “little balls of fur”. Ms Gordon said dingoes often received a “bad rap” in the media for attacks on humans but she was determined to change the stigma. “Hybrid” crosses between wild dogs and dingoes were the real problem, she said. “Joe Blow doesn’t want his dog any more so he leaves it in the bush and they bred with purebred dingoes, producing a hybrid strain of dog. “It’s these dogs that are the problem, not purebred dingoes.” Ms Gordon said dingoes were only recently recognised as

DARREN THOMAS CPA

APPLIANCE SALE SAVE $$$ Entertainer Package

• 6.5 Load Capacity • Made in Germany BONUS 4 MONTH SUPPLY OF MIELE CARE LAUNDRY PRODUCTS WITH EVERY WASHER SOLD. (offer available 1/8/10-31/8/10)

NOW • Commercial Grade Top Load Washer • 8kg Load Capacity

$5,397

Was $5,997

+ SAVE $600

CK SALE SAVE $$$ FLOORSTO

19 Ormond Road, East Geelong Ph: 5221 1642 TRADING HOURS MONDAY - FRIDAY 9-5PM, SATURDAY 9-12PM

+

OR

Offer Ends 31/09/10 RYRIE STREET

EXTENSIVE SHOWROOM DISPLAYS

GE HO ELON SPIT G AL

SYD

NE

Bell

YP

arin

eH

wy

this

wa

y

DE

GARDEN STREET

from $1699

• Double Side Opening Ovens • 92 litre (upper) • 62 litre (lower) • Handmade in Australia • Multifunction Oven

GI

WASHER (W1611)

WE ARE HERE

OR

MO

ND

RD

Slash $100’s off your power bill... Invest in a Solar System today! • Earn income from the power grid • Take advantage of rebates (renewable energy certificates) • Environmentally friendly • Great tax advantages “You can’t go past the experience, knowledge and service of Cec Hopper and Sons Solar Installation team when it comes to making an informed decision on the installation of a Solar y y needs.” System that meets your FFor o r aalll l yyour o u r ddomestic o m e s t i c & ccommercial o m m e r c i a l ssystems ystems Recc 12 Rec 1 1222 22 22 2

• COMMERCIAL • INDUSTRIAL • MINING • DOMESTIC • PHONE & SECURITY INSTALLATION

NOW IN GEELONG

For a FREE no-obligationn quote please callll Greg Millard 0419 574 703 Email: admin@cechopper.com.au Web: www.cechopper.com.au 487933-JF30-10

The Independent, Friday August 6, 2010

5


clearance centre M I D - Y E A R - S A L E

ends sunday 8th august at 4pm Emerald Queen Size Bed Dark Brown

Was $799 Now $499

Ballarat Entertainment Unit Was $799 Now $585

Tokyo 4pce QS Bedroom Suite including Dresser Was $1499 Now $1233

SAVE $220 Venice 9pce Dining Setting Was $1499 Now $999

SAVE $500

Milano Lamp Table Was $399 Now $79

SAVE $214 Murray Entertainment Unit M Was $999 Now $799

SAVE $209

SAVE $200

Tina 3 Pce Dining ng Setting Was $499 Now $290

1 ONLY

SAVE $266

SAVE $750

Venezia 9pce Dining Setting Was $2599 Now $1849

3 Pce Lounge Suite Inc 2 Recliners in Suede Fabric Was $1899 Now $1350

Dallas 6 Seater Corner Lounge Suite including 2 Recliners Was $1999 Now $1549

SAVE $320

SAVE $549

1 ONLY Palma 3+2 Seater ater Sofa in Leather Was $1999 Now $1399

Forrest Entertainment Unit Was $599 Now $449

SAVE $150

SAVE $69ea Lotus Barr Stools Red or Black Was $119 Now $50

Torquay Entertainment Unit Was $499 Now $339

SAVE $160

1 ONLY

SAVE $450 Darwin 3+2 Seater Leather Sofas Was $2499 Now $1999

1 ONLY

Emma Tassie assie Oak Entertainment Unit Was $799 Now $580 Interest Free Terms Available. Conditions Apply

295 Thompson Road, North Geelong • 5277 1300 • www.homemakersaustralia.com.au TRADING HOURS: Monday - Friday 9.00am-5.30pm, Saturday 10.00am-5.00pm, Sunday 11.00am-4.00pm 6

The Independent, Friday August 6, 2010.

417261-TB31 417261-TB31-10

Ballan King Single Bed Was $449 Now $229

SAVE $300


Hoons, vandals, druggies terrorise suburb

PIONEER ORCHID FARM AUSTRALIA’S MOST SPECTACULAR ORCHID DISPLAY AND SALES SIZES AND PRICES TO SUIT ALL BUYERS BRILLIANT NEW VARIETIES THIS SEASON

ORCHID SEASON NOW OP EN 408926-JL25-9

OPEN 7 DAYS

735 Portarlington Road, LEOPOLD PH: 5250 2058 MOB: 0409 355 388 www.pioneerorchidfarm.com.au e: pioneer@pipeline.com.au

RIVER GLEN BEEF

Picture: John Conway.

‘Fed-up’ residents demanding action BY KIM WATERS A THOMSON community group has taken matters into its own hands following increasing accounts of hoon driving, vandalism and substance abuse in the area. Residents of the eastern Geelong suburb contacted Geelong MP Ian Trezise earlier this year fearing “antisocial problem behaviour” would turn the area into “another Norlane or Corio”. Mr Trezise called on State Government to support a Thomson Community Development Project last week in an attempt to “address” the suburb’s worsening problems

with anti-social behaviour. Thomson’s Janet Lonzarich said residents were “desperate” for help following widespread vandalism and substance abuse around the suburb. “It all started about two years ago when someone started throwing rocks through windows and setting hedges alight,” she said. “Since then the whole issue has just progressed and become worse and worse. “People here don’t go outside and they don’t know their neighbours because they don’t want to leave their homes. “We all know what happens in Norlane and Corio and we want to stop it here before it

$47 Special Packs THIS WEEK ONLY

growing crime and behaviour problems. He called on his State Government to provide “support” for the community development project. “The residents and I came to the conclusion that dealing with these issues on an ad hoc or issue-by-issue basis was pretty ineffective,” Mr Trezise said. “We want to build on the strengths of the area of Thomson and the various organisations within the neighbourhood, perhaps identifying weaknesses or what is missing in the area and for the community to come together to build a more-cohesive or better place in which to live.”

gets to that stage.” Ms Lonzarich said residents had raised suggestions for the development plan in a series of meetings with Mr Trezise. “People want things like a community garden, a play area for children, more trees planted and to use the buildings that are here,” she said. “The football club is empty most of the time and we really want to set up events for youth there. “The plan has received great support from the kinder, police, football club, senior citizens and the local schools.” Mr Trezise said he believed authorities had failed to “effectively” deal with Thomson’s

Finest Aussie Beef Grown Amongst The Otway Glens DELIVERY AVAILABLE CONTACT SIMONE

PH: 5222 3863 or Mobile: 0427 358 351

6-08-2010

PCD International Pty Ltd 78 Mercer St Geelong

$999

DVDRW

DVDRW

4G DDR3 22”LCD

4G DDR3

Intel Core i3 530 (2.9Ghz) MS Keyboard & Mouse Asus P5G41T-M-LX Ms Window 7 H PRE FREE Ms Office Home & Student 2010 Word, Excel, Power point Single UPG Canon Printer Print /Scan/ Copier TO Free Antivirus - Acer 22” LCD 1000G

$999

Phenom II X6Core 1090T (2.8Ghz) GAMING CASE 3X Blue FAN Acer 19” LCD With DVI Seagate 1TB Hard drive Window 7 Premium 64bit ATI Radeon 5570 1G HDMI

Smart Starter

Smart Core i3

$660

$855

Intel Duo Core E6500 2GB DDR3 - 1TB Hard drive Acer 22” Wide Screen LCD Liteon DVDRW Writer Logtech K/B & Mouse Windows 7 Home Premium

Home & Business Pack Intel Core2 Duo E7500 4G DDR3 PC-1066 Seagate 1TB HDD Samsung DVD Writer Acer 22” Wide Screen Ms Window 7 Pro, 1 YRS Security Ms Office 2010 (Word, Excel, Outlook, PowerPoint) 1Note MS Keyboard & Mouse

Micro SD

2GB 4GB 8GB 16G

Laptop Adapter Suitable For

$49

SMART E6300 i7 SmartCore Bluray

24” LCD

1TB

24”

4GB DDR3 - 1TB Hard drive LG DVDRW - Microsoft KB & Mouse Acer/BENQ 22” LCD P/C ATI RADEON 5450 HDMI Windows7 Premium 64bit/32bit

$8 $15 $28 $60

Intel Core i7 870 (2.9Ghz) Nvidia GT220 1G DDR3 Acer/BENQ 24” LCD

4G D3

Samsung BLU-RAY COMBO Microsoft K/B & Mouse, Windows 7 64 Home Premium

TM 5740

was

now $35

$1159

$1199 VIRUS

NETWORKING & COMPUTER REPAIR SpywareTERMINATOR

Analyse, design, install, commission and manage. Internet, Security solutions

Samsung 1.5TB Hard Drive

$98

*PC BOX ONLY* Gigabyte/Asus DDR3 M/B 2GB DDR3 - 500GB SATA Asus DVDRW - ATX Case

$299 $359 $399 $450 $555

Am3 II X2 245 Intel Duo core E6500 Intel Core2 Duo E7500 Intel Core i3 530 Intel Core i5 650

MULTIMEDIA SYSTEM

Intel Core i5 (3.2GHz) 4G DDR3 PC-1066 Seagate 1TB HDD Sony DVD Writer, WIFI READY Acer 24” LCD Wide Screen Ms Window 7 Media Centre Dual HD Digital TV Viewing (PIP) Ms Key Board & Mouse ATI RADEON HD5450 HDMI

$999 Acer $699

Special

Acer TM7720G...

4GB $12 8GB $19 16G $39

Dell Series

$1299

22” Intel22” Core i3 5302.9GHz)

Call 5222 5189

417233-RMB31-10

2.8Ghz

500G

Email:geelong@pcdi.com.au

www.pcdi.com.au

10 Years Still Going Strong With Good Price @ Quality Service 6 Core System Home/Office i3 System

487819-JF31-10

Seeking action: Ian Trezise and Janet Lonzarich survey the Thomson landscape.

Intel C2D T5870,Web, BT 4G RAM, 512M Graphic 320G,DVDRW, WIFI, Numeric K/B 17 WXGA, Vista Buz & XPP

HP HP Compag

Acer Special

$1099 Acer 2 YRS Warranty

$479 EMACHINE $599 Special

HP Intel Core T1600 1G RAM, Intel GMA4500 160G, DVDRW-WIFI, WEB 15.6” Win7 H Premium

MSI $799 CR620 Intel i5 430, 2 YRS Warranty 2G DDR3, DVDRW, WIFI 320G, BT, WEB, Intel HD Grap 15.6 LED Win 7 H Premium

Asus

2 Yrs Warranty

Intel i3 330, WEB 2G DDR3, 15.6” LED 320G,DVDRW, WIFI, BT Win7 PRO & XPP / 2YRS W

Intel Duo Core T4400 4G RAM, Intel GMA4500 320G, DVDRW-WIFI, WEB 15.6”LED Win7 H Premium

$35

Asus $1125 K52JC Intel i5 430, 2YRS Warranty 4G DDR3, DVDRW, WIFI 500G, BT, WEB, 1G Graphic 15.6 LED Win 7 Pro, 2 YRS.W

Intel SUL7300, WEBCAM 4G RAM, G210M/512M 500G, DVDRW, WIFI, BT 15.6’LED Win 7 Pro 64bit

MSI SlIM

5 Port Gigabit Switch

$399 Intel Atom N450 , 1G RAM , WIFI, WEB 250G, 10.1” LED 6Cell & 8 HRS Window 7 Starter

Asus UL50VT-XX025 Turbo

$1149

Acer 5740 Intel i5 450M Turbo, WEBC 4G RAM, ATI 1G Graphic 500G HD, DVDRW, WIFI 15.6”LED ,Bluetooth, HDMI Win 7 Home Premium

CANON MX350

Intel Centrino SU3500 4G RAM WIFI , WEB, BT 320G, 15.6 LED Win 7 H PRE ATI 512M Graphic 8 HRS Battery 2 YRS WARRANTY

Print/Scan/Copier/Fax

$115 $670

D.I.Y Your Dream PC As Following Steps As 1,2,3..... CPU $ 88 intel E6500 $135 Intel E7500 $199 Intel Q8400 $135 Intel i3 530 $249 Intel i5 760 $349 Intel i7 930 $345 Intel i7 870 $225 Intel i5 750 $210 Intel i5 650 $ 67 Am3 II X2 245 $112 Am3 II X4 630 Phenom II X4 965 $199 Phenom II X61055T $235 Phenom II X6109T $372

Mainboard Asus P5G41T-MLX Asus P5P41TLE Asus MAXIMUS-III GA P45T-UD3LR GA-EG41MFT-US2H GA-P55-USB3 GA-P55A-UD3R GA-P55A-UD4P GA-H55M-S2H GA-EX58-UD5 Asus P7P55-Lx Asus P7P55D-LE GA- MA74GMT-S2 GA-MA790XUD4P

$ 57 $ 89 $199 $129 $ 99 $155 $160 $205 $107 $295 $119 $130 $ 70 $135

HARDDISK

RAM 512M DDR TEAM 1024M DDR King 2GB D3 2GB DDR2 6400 TEAM 4G D31600 TEAM 2G DDR3

$30 $55 $62 $55 $138 $ 55

DVDRW SAM/LIteon SATA $25 LG ATA DVRW $29 LG SATA DVDRW $30 Pioneer 218L $35 Pioneer BluRay Writer $265 SAM Bluray combo $110

WD 320G ATA S/W 250G SATA S/W 320G SATA S/W 500G SATA SAM 1.5G sata SEA 1TB SATA WD 1TB SATA SEA 1.5TB SATA SEA 2 TB SATA

$ 85 $ 52 $ 47 $ 50 $104 $ 80 $ 80 $115 $165

-----External HD----

LCD

Video Card P/C 3650 512M Asus 8400GS 512M GA-GT210 512M GA- GT-220 1GB GA- GT-240 1GB GA- GTX 465 1G GA-SL9800GT 1GB Asus GTS250 1GB ---------ATI-------------

Asus 4350 512M GA 5670 1Gb

Omega 500G2.5$95 GA- 5450 1GB SAM 500G 2.5” $85 Asus 5450 512M S/W 1.5TB 3.5” $125 Asus 5770CUCORE WD 320G 2.5” $70 P/C 5570 1G

Acer 225HQBD Acer 24” X243HBMID BENQ 22” G222HDL BENQ 24” G2420HD SAM E2220X 21.5” SAM 2333HD 23” TV SAM P2370HD 23”TV SAM P2350 23” SAM 2233RZ 22” 3D $ 38 SAM Bx2440 24”

$175 $229 $185 $225 $185 $319 $339 $225 $275 $339

$120 $70 $50 $185 $105

$129 $129 $179 $235

$ 75 $ 35 $ 38 $ 75 $109 $345 $145 $160

Software MS Xp Home Home Premium 7 Win Pro 7 Win 7 Ultimate

Cash or Bank Cheq Only At Advertised Prices.Visa,Mastercard 2% Surcharge will apply. Prices & Specification are subject to change without notice. Pictures for Illustrative Purposes Only. All Systems Come With 3Yrs Labour & 1 Yr Parts R.T.B

The Independent, Friday August 6, 2010

7


487354-RMB31-10

PUBLIC NOTICES

CAREERS AT THE CITY SENIOR STRATEGIC PLANNER – ARMSTRONG CREEK PROJECT TEMPORARY FULL-TIME POSITION (Until approximately July 2012) $69,376 to $77,057 (negotiable commensurate with experience) plus superannuation • Diverse Strategic Planning work. • Be instrumental in the growth of the region. • Accelerate your career development. If you are an experienced Senior Strategic Planner who has good analytical skills and a strong work ethic, this is the job for you. This challenging role requires finely tuned investigative skills, with a sound knowledge of government policies and practices relating to current trends and issues in urban growth planning. The successful applicant will possess extensive experience in strategic planning in terms of community creation for the Armstrong Creek project. The role is in the Urban Growth Area Planning Unit which is focused on the Armstrong Creek project, and forms part of a broader State Government partnership team.

COMMUNITY RENEWAL PROJECT OFFICER TEMPORARY PART-TIME POSITION UNTIL SEPTEMBER 2012 (Approximately 38 hours per fortnight) $62,486 to $67,479 (pro rata) plus superannuation • Implement community development activities. • Engage and collaborate with residents and external agencies. • Focus on community cultural development. This diverse role will build on the current successes of our Community Renewal Team in Whittington, enhancing the capacity of local residents to achieve their aspirations through innovative projects and activities. The successful applicant will hold tertiary qualifications in Social Sciences, Community Development or a related field, combined with experience in planning and implementation of community development programs. This appointment will work closely with the other incumbent of the role and will have a focus on the Whittington Flamefest Festival. Applications close 5.00pm Friday 13 August 2010

Applications close 5.00pm Friday 20 August 2010.

RECREATION AND OPEN SPACE PROJECT DEVELOPMENT OFFICER

ANIMAL AND INFORMATION SERVICES OFFICER

PERMANENT FULL-TIME POSITION

PERMANENT FULL-TIME POSITION

$62,486 to $67,479 plus superannuation

$47,852 to $51,270 plus superannuation

This is your opportunity to:

• Do you have strong customer service skills? • Are you able to resolve conflict? • Are you interested in learning legislation?

• Join one of the regions leading Sport, Recreation and Open Space divisions. • Become part of a committed team of recreation professionals. • Challenge yourself in a diverse and exciting environment. An excellent opportunity exists for a self motivated individual to join our Sport, Recreation and Open Space team. This community and sport focused position involves developing the City’s extensive range of recreation facilities, services and opportunities. Your sound knowledge of the recreation industry will be essential while coordinating the development of recreation and open space projects from an initial idea to concept stage. Strong communication skills with the ability to work in teams and manage projects will be necessary to effectively liaise with Councillors and manage a variety of sporting clubs and community groups.

COMMUNITY ARTS AND FESTIVALS GRANTS PROGRAMS (2010-2011)

Our Local Laws unit is looking for a self-motivated person who enjoys working with people and animals. To succeed in this diverse role, you will need to be a team player with the ability to work independently and have an understanding of safe working practices. Your strong animal management background will be coupled with outstanding customer service, conflict resolution and problem solving abilities, ideally regarding local laws issues. Working outdoors and with members of the Geelong community, you will be rewarded with a well-structured environment, a wide variety of work, training and development opportunities. Applications close 5.00pm Friday 20 August 2010.

Qualifications in recreation or a related discipline (or significant experience in the field) and a current Victorian driver’s licence are essential. Applications close 5.00pm Friday 20 August 2010.

Image courtesy of Diversitat

The City is pleased to announce the opening of the Community Arts Grants Program and the Community Festivals Grants Program 2010/2011. These programs are offered to facilitate innovative community arts and festivals projects undertaken within the City of Greater Geelong. This year marks the introduction of a new suite of grants for projects initiated and managed by not-for-profit, incorporated organisations and one grant that will be available to individuals. Community Arts and Festivals Grants are available across the following areas: • Community Arts (Arts Project) • Community Arts (Biennial) • Community Festivals (One Off) • Community Festivals (Development) • Community Festivals (Triennial) The 2010-2011 Round will open 9 August 2010, and all applications must be received or post-dated no later than 5.00pm Monday 3 September 2010. Two new programs are open all year round, subject to availability of funds: • Community Arts (Quick Response) • Community Arts (Professional Development) (individuals may apply) Guidelines and Application Forms for all programs are available at Customer Service Centres, from the City’s website www.geelongaustralia.com.au, or by contacting the Arts and Culture Department at the City of Greater Geelong directly on 5272 4703. Applications can be submitted online, via mail to the City of Greater Geelong, Community Arts and Festivals Grants Programs, PO Box 104, Geelong Vic, 3220, or in person at any City of Greater Geelong Customer Service Centre. GRANTS INFORMATION SESSIONS Two Information Sessions will be held, please register by calling 5272 4703. Session One: 6.00 to 8.00pm, Tuesday 10th August 2010 Session Two: 10.00am to 12pm, Friday 13th August 2010 Bookings are essential. Both information sessions will be held at the National Wool Museum, Cnr Moorabool & Brougham Streets, Geelong (enter via Moorabool Street):

MENTAL HEALTH WEEK 2010 WELLBEING AWARDS

Join one of Geelong’s largest employers. We offer excellent employment conditions and opportunities to further your career. To apply or obtain a position description, log onto our website www.geelongaustralia.com.au or phone 5272 4273. Only people with the right to work in Australia may apply and a three month probationary period is applicable to most positions.

PUBLIC MEETINGS NOTICE OF COUNCIL MEETING

GRAFFITI NEAR YOU?

The next Ordinary Meeting of the Greater Geelong City Council will be held at the Council Conference and Reception Centre, City Hall, Little Malop Street, Geelong on Tuesday 10 August 2010, commencing at 7.00pm.

PHONE THE GRAFFITI HOTLINE 5272 4319

Details of issues to be considered will be published on the City’s website www.geelongaustralia.com.au on Friday 6 August 2010. The meeting is open to the public.

CENTRAL GEELONG MARKETING COMMITTEE MEETING CI060810L-1

PUBLIC NOTICES

The next meeting of the Central Geelong Marketing Committee will be held on Tuesday 17 August 2010, at 7.30am, at the Central Geelong Marketing Office, Busport, 17 Gheringhap Street, Geelong. This meeting is open to the public.

If graffiti appears on your property or a public place please let us know. Phone the Graffiti Hotline on 5272 4319 (message service after business hours) or fill out an online request at www.geelongaustralia.com.au We will help with the removal of graffiti as much as possible on private properties with advice and / or a free graffiti removal kit available at all Customer Service Centres.

SMALL GRANTS PROGRAM MENTAL HEALTH WEEK 2010 Sunday 10 - Saturday 16 October The aim is to promote social and emotional wellbeing. Organisations can apply for funds of up to $300 to run events during Mental Health Week. Grants will be awarded to organisations/partnerships that tie their event in with this year’s theme and can demonstrate benefits in terms of enhancing wellbeing. For nomination forms and selection criteria please contact: Chris Scanlan, Barwon Health on 0417 300 683 or chrissc@barwonhealth.org.au The closing date for nominations and the grants program is Friday 27 August 2010.

CENTRAL GEELONG

The City of Greater Geelong can provide you with some helpful information if you are a new resident to our municipality or thinking about moving here.

No matter what time of the year, there is always plenty to do in Central Geelong. Wander along the Waterfront and take in our magnificent north facing bay, get a glimpse of the Bollard Walk, or enjoy Central Geelong’s art galleries and museums.

Request a New Residents Kit online by providing some information about yourself so that we can tailor the kit for you. Go to www.geelongaustralia.com.au/residents to find out more.

GRANTS PROGRAMS 2010-2011 NOW OPEN The Independent, Friday August 6, 2010.

Categories include: Someone with a mental illness; A carer award; mental health employee; volunteer worker; community organisation; employer; primary and secondary school or education facility; sport or recreation organisation

ARE YOU NEW TO GEELONG?

COMMUNITY ARTS & FESTIVALS 8

Awards – Mental Health Week Civic Reception, Monday October 11 2010 at City Hall, 5.30pm-7.00pm.

There's loads of fun for all the family. Go on, discover Central Geelong!


HAVE YOUR SAY

PLANNING

NOTICE OF THE PREPARATION OF AN AMENDMENT TO A PLANNING SCHEME AND NOTICE OF AN APPLICATION FOR PLANNING PERMIT

NOTICE OF AN APPLICATION FOR PLANNING PERMIT

GIVEN UNDER S96C OF THE PLANNING AND ENVIRONMENT ACT 1987 GREATER GEELONG PLANNING SCHEME

THE APPLICATION IS FOR A PERMIT TO: Variation to restriction - modification of building envelope

AMENDMENT C224 & PLANNING PERMIT APPLICATION 208/2010

THE APPLICANT FOR THE PERMIT IS: Michael Higgins Building Design

AUTHORISATION NO. A01714

THE APPLICATION REFERENCE NUMBER IS: 731/2010

The land affected by the amendment is 204 Aberdeen Street and the narrow roadway between the rear of the existing shops and 204 Aberdeen Street, Geelong West.

You may look at the above applications and any documents that support the applications at the following locations:

The land affected by the application is the same land as described above. The amendment proposes to rezone land at 204 Aberdeen Street from Residential 1 to Mixed use Zone, remove the Design and Development Overlay 14 and include a Road Closure Overlay over the narrow roadway between the rear of the existing shops and 204 Aberdeen Street, Geelong West. The application is for a permit for works associated with the use of a car park. The person who requested the amendment is the Greater Geelong City Council. The applicant for the permit is the Greater Geelong City Council. You may inspect the amendment, any documents that support the amendment and the explanatory report about the amendment, free of charge, at the following locations: • Myers Street Customer Service - 131 Myers Street, Geelong Weekdays 8.00am – 5.00pm • ‘Have Your Say’ section of the City’s website www.geelongaustralia.com.au/council/yoursay • The Department of Planning and Community Development website www.dpcd.vic.gov.au/planning/publicinspection For further information call 5272 4478 or email: strategicplanning@geelongcity.vic.gov.au Submissions close Monday 13 September 2010. Send Submissions to: The Coordinator Strategic Implementation City of Greater Geelong PO Box 104 GEELONG VIC 3220 Or email: strategicplanning@geelongcity.vic.gov.au Any person who may be affected by the amendment may make a submission to the planning authority. Please be aware that all submissions will be made available to the applicant and copies of objections/submissions received may be made available to any person for the purpose of consideration as part of the planning process. Submissions can be viewed at the office of the planning authority, City of Greater Geelong, Ground Floor, 131 Myers Street, Geelong until the end of two months after the amendment comes into operation or lapses. Anonymous or illegible submissions will not be considered. PETER SMITH COORDINATOR STRATEGIC IMPLEMENTATION

THE LAND AFFECTED BY THE APPLICATION IS LOCATED AT: 118 Field Street South, Ocean Grove

• Myers Street Customer Service - 131 Myers Street, Geelong Weekdays 8.00am - 5.00pm • Ocean Grove Customer Service Centre – The Avenue, Ocean Grove Weekdays 9.00am - 5.00pm • The City’s website www.geelongaustralia.com.au/residents/planning/advertising.aspx The application can be viewed during office hours and is free of charge. Any person who may be affected by the granting of the permit may object or make other submissions to the Responsible Authority, City of Greater Geelong, PO Box 104, Geelong VIC 3220. If you wish to discuss the application further please contact the Statutory Planning department on 5272 4456. An objection must: • be sent to the Responsible Authority in writing. • include the reasons for the objection. • state how the objector would be affected.

AUGUST 2010 ACTIVITIES

Please be aware that copies of objections/submissions received ved may be made available to any person for the purpose of consideration on as part of the planning process in accordance with the Planning and Environment Act, 1987. Personal information will be used solely by Council ncil in accordance with the Planning and Environment Act, 1987.

CI060810R-1

Please rsvp to attend the transport industry briefing by email: jtaylor@geelongcity.vic.gov.au. VOLUNTEER POSITIONS STILL AVAILABLE

Visit www.melbourne2010.com.au and follow the links to Volunteers. Event information is also available at www.geelongaustralia.com.au/2010cycling.

WASTE AND RECYCLING Remember to keep plastic bags out of your recycling and green waste bins. Plastic bags can go into the red bin or return to a participating supermarket. For more tips on recycling, go to www.geelongaustralia.com.au/residents/waste

FAMILY DAY CARE Family Day Care is a home-based child care service designed for children aged between 6 weeks and 12 years operated by the City of Greater Geelong. For more information or to find out if there are any vacancies call us on 5272 4805.

FREE UCI BUMPER STICKERS Call into one of our Customer Service Centres to pick up a free bumper sticker promoting the 2010 UCI Road World Championships. With the world’s best cyclists coming to Geelong it will be like our own Olympics. Put the sticker on your car or house window and show your support for Geelong host city of the 2010 UCI Road World Championships.

‘TRAINS, SCOOTERS AND AUTOMOBILES’ – TRANSPORT FOR OLDER PEOPLE

Do you want to know what alternative means of transport exist in our community and how to plan for a time when you may no longer be able to drive? Join us for this free special joint presentation by RACV and the Transport Accident Commission at Geelong West Town Hall from 10.00am to 12.15pm on Thursday 12 August 2010. Places are limited, so please contact Customer Service on 5272 5272 to book your place.

FREE UCI POSTERS Pick up a free 2010 UCI Road World Championships poster now available at City of Greater Geelong Customer Service Centres. The poster features three of Australia’s star cyclists, Bridie O’Donnell, Jack Bobridge and Cadel Evans. Jack and Cadel both won world championships in 2009 and as host city this year we’ll be hoping to do even better in 2010. Put the poster on your home or shop window and get behind the Australian team.

487355-RMB31-10

Keep an eye out for other roving entertainment throughout Central Geelong in the coming months! For more information contact Shelley at the City’s Central Geelong and Waterfront unit on 5272 5272.

Event organisers and Council officers will be on hand to provide information on the traffic and transport plan including the recommended through routes during the road closure periods.

PUBLIC NOTICES

Or what you need to consider when assessing whether you are fit to drive?

• 26 August, 12noon -2.00pm Marcus Hayden will perform popular hits

If you’re involved in the transport industry come along to a special briefing on the changed traffic conditions due to the 2010 UCI Road World Championships, 10.00am to 11.30am Thursday 12 August at City Hall.

Places are filling fast but there are still opportunities for people living in the Geelong region to register their interest in becoming a volunteer for what promises to be the biggest event ever seen in our city.

• 10 August, 12noon – 2.00pm Spider Jazz performance will delight all visitors to Central Geelong

• 24 August, 12noon – 2.00pm Gaz Jaz will fill the site with sounds from the past

TRANSPORT INDUSTRY BRIEFING

If you object, the Responsible Authority will advise you of its decision.

Do you want to know what the rules are about driving as you age?

• 14 August, 8.30am – 12.30pm Central Geelong Farmers Market for all your fresh & gourmet food requirements

2010 UCI ROAD WORLD CHAMPIONSHIPS A WEEK LIKE NO OTHER

Opportunities exist for people to join the volunteer team at the 2010 UCI Road World Championships.

Activities and performances in Lt Malop Street Central for August are as follows. All performances are subject to suitable weather conditions.

• 13 August, 12noon – 1.30pm Victoria Police Code 1 band perform current and past hits

HAVE YOUR SAY

The Responsible Authority will not decide on the application before 21 August 2010.

PUBLIC NOTICES LITTLE MALOP STREET CENTRAL

UPCOMING EVENT

The Independent, Friday August 6, 2010

9


487356-RMB31-10

TEMPORARY CHANGED TRAFFIC CONDITIONS - 2010 GMHBA TOUR OF GEELONG - 11-15 AUGUST 2010 Between 11-15 August 2010, Geelong will host mens and womens time trials, criterium and road races as some of Australia’s best cyclists compete in the GMHBA Tour of Geelong. This event also incorporates the Victorian Open Road Cycling Championships. The areas hosting stages of this event are: North Shore Wednesday 11 August - Stage 1: Criterium 10.30am to 11.30am

Grovedale Thursday 12 August - Stage 3: Criterium 12noon to 1.30pm

Anakie Saturday 14 August - Stage 5: Road Race 9.00am to 4.00pm

Lara and You Yangs Wednesday 11 August - Stage 2: Road Race 2.00pm to 4.00pm

Portarlington Friday 13 August - Stage 4: Individual Time Trial 10.00am to 2.30pm

Eastern Park, Geelong Sunday 15 August - Stage 6: Criterium 1.00pm to 4.00pm

CHANGED TRAFFIC CONDITIONS - Please note the areas specific to your property. WEDNESDAY 11 AUGUST 2010 NORTH SHORE – STAGE 1: CRITERIUM SUBURB STREET / ROAD > Rose Avenue (between Plume Street and Tallis Street) > Plume Street (between Rose Avenue and Gerbera Avenue) > Gerbera Avenue (between Plume Street and Tallis Street) > Tallis Street (between Gerbera Avenue and Rose Avenue)

North Shore

DESCRIPTION

TIME

Road closed to vehicular traffic

9.30am to 11.45am

No vehicle parking is permitted on this event course. Please refer to the map opposite for the course route and suggested detour routes. WEDNESDAY 11 AUGUST 2010 LARA AND YOU YANGS – STAGE 2: ROAD RACE SUBURB STREET / ROAD DESCRIPTION Mill Road; Windermere Road; Flinders Avenue; Branch Road; Farrars Road; You Yangs Road; Edgars Road; Kirksbridge Road; Little River Ripley Road; Bacchus Marsh Road; Granite Road; Staughton Vale Road; Ballan Road; Carrs Road

Rolling road closure (Delays up to 15 minutes may be experienced)

1.00pm to 5.00pm

NORTH SHORE

THURSDAY 12 AUGUST 2010 GROVEDALE – STAGE 3: CRITERIUM SUBURB

STREET / ROAD

TIME

Grovedale

A small section of Bailey Street outside the Grovedale Primary school, Road closed to vehicular traffic between Marshalltown Road and Edna Way, will be closed for the event start / finish area

9.30am to 2.00pm

> Bailey Street between Grove Road and Muscovy Drive (with local traffic maintained via traffic controller at all times between Grove Road and Marshalltown Road, and Smith Street and Muscovy Drive)

11.30am to 2.00pm

Grove Rd

Grove Rd

d

Bailey St

Marshalltown Rd

Marshalltown Rd

> Barwarre Road between Reserve Road and Grove Road (with local traffic maintained via traffic controller between Reserve Road and Smith Street, and between Grove Road and Marshalltown Road)

Hewitt Dr

START/ FINISH

Grovedale Primary School

Bailey St

> Smith Street between Pickerall Avenue and Barwarre Road

Krisanway Dr

Edna Way

Alan St Kilmory Cl

FRIDAY 13 AUGUST 2010 PORTARLINGTON – STAGE 4: INDIVIDUAL TIME TRIAL

Smith St

> The Esplanade (between Pier Street and Harvey Road)

Road closed to vehicular traffic

9.30am to 2.45pm

St Leonards

> First Avenue, Manning Street and Second Avenue

Road closed to vehicular traffic

9.30am to 2.45pm

Moira Lane

9.00am to 3.00pm

Portarlington / St Leonards

Smith St

Balbair Dr

TIME

Road closed to vehicular traffic

Bailey St

DESCRIPTION

> The Esplanade (between Fisher Street and Pier Street)

Pickerall Ave

STREET / ROAD

Portarlington

Surf Coast Hwy

SUBURB

Dunkeld Ct

No vehicle parking is permitted on this event course. Please refer to the map opposite for the course route and suggested detour routes.

Drews Rd

Carstairs Cl

Hewitt Dr

Barwarre St

Essington St

>Marshalltown Road between Station Road and Dendel Street (with local traffic maintained via traffic controller between Barwarre Road and Station Road, and between Dendel Street and Bailey Street.

Race Course Local Trafic Only Road Closure Temporary Bus Route

GROVEDALE

Please refer to the map below for the course route and suggested detour routes. PORTARLINGTON / ST LEONARDS

on R

DESCRIPTION

Stati

Lara/Little River/ Anakie

TIME

Brett Dr

TURN AROUND

3

The Esplanade Adam St

Hood Rd

YR D RVE HA

e

Batman Rd

rey St

1

ade splan The E Clarke St

Ozo

ne

Espl

e

St

Oxley St

Mercer St

Simson St

Dosseter Rd

lan

ade

Coach Rd

UCI ROAD WORLD CHAMPIONSHIPS 29 SEPTEMBER TO 3 OCTOBER - WWW.GEELONGAUSTRALIA.COM.AU/2010CYCLING 10

The Independent, Friday August 6, 2010.

Harv

Brett Dr

Grassy Point Rd

Calhoun Rd

HOOD RD

Oxley St

CI060810L-2

Mitchell St

Esp

ey R d

d Ave Secon M an ni ng

St

QUEENSCLIFF RD

Arl ing ton St

s er in ar M

FISHER ST

Sunset Bvd

5

Bla

Drysdale - St Leonards Rd

nch

e St

de

Seaforth Dr

2 The

Ibbotson St

START/ FINISH

ade

PORTARLINGTON

a plan

1

The Esplan

Es The

OXLEY ST

4

anad

McDonald St

Fairfax St

Batman St

Fisher St

The

Grieve Ave

The Esplanade

Newcombe St

Gellibrand St

Drysdale St

GRASSY POINT RD

Jefe

START/ FINISH

ad lan

ST LEONARDS The Esplanade

2

sp

Jubilee Ave

IBBOTSON ST

INDENTED HEAD

Walpole Ave

eE

MCDONALD ST

Pigdon St

Ibbotson St

3

4

Th

5

St

e t Av Firs


TEMPORARY CHANGED TRAFFIC CONDITIONS - 2010 GMHBA TOUR OF GEELONG - 11-15 AUGUST 2010 SATURDAY 14 AUGUST 2010 ANAKIE – STAGE 5: ROAD RACE SUBURB

STREET / ROAD

Anakie

> Geelong-Ballan Road (between De Motts and Slate Quarry Road) Rolling road closure > Slate Quarry Road (between Geelong-Ballan Road and (Delays up to 15 minutes Ballan Meredith Road) may be experienced) > De Motts Road (between Steiglitz Road and Geelong-Ballan Road)

DESCRIPTION

TIME 7.00am to 5.00pm

Meredith

> Ballan-Meredith Road (between Grant Street and Midland Highway) Rolling road closure > Wallace Street (between Midland Highway and Staughton Street) (Delays up to 15 minutes > Meredith Steiglitz Road (between Wallace Street and Steiglitz Road) may be experienced)

9.00am to 4.00pm

CYCLING CRITERIUM

STREET / ROAD

DESCRIPTION

TIME

Geelong

> Hearne Parade (between Limeburners Boat Ramp and Upper Eastern Beach Road) > Upper Hearne Parade (between Hearne Parade and Eastern Park Circuit) > A small section of Eastern Park Circuit (between Upper Hearne Parade and Limeburners Road) > The new circuit link between Hearne Parade and Eastern Park Circuit

Road closed to vehicular traffic

9.00am to 4.00pm

SF

For the GMHBA Tour of Geelong, Victoria Police will manage the rolling road closures with qualified traffic controllers. A number of marshals will also be placed on the course to assist vehicle and pedestrian traffic. EMERGENCY ACCESS Emergency access will be maintained at all times. DETOUR SUGGESTION Where practical, motorists are urged to avoid using the roads being used for the GMHBA Tour of Geelong and seek alternate routes. Where possible stages of the event will include detour options and event marshals will be located at key intersections to assist you in reaching your destination. ABIDING BY LOCAL LAW REQUIREMENTS It is important that all residents and motorists abide by the changed traffic conditions. Infringement notices may be issued to those who breach the law by parking in no stopping areas, too close to intersections, causing obstructions to driveways, using disabled parking bays without a permit and causing potential damage to City assets by parking on reserves, nature strips or footpaths.

NE PARA DE AR HE

ST

N ER

SF CUIT CIR RK PA

EASTERN PARK BBQ AREA

PODB

URY C

TEMPORARY CHANGES TO BUS SERVICES Due to the road closures in place for this event, please note the following temporary changes to bus services. GROVEDALE Buses are not able to service Bailey Street between Reserve Road and Grove Road, or Marshalltown Road between Dendel Street and Station Road between 11.30am and 1.45pm on Thursday 12 August. Therefore, please note that the normal bus stops along these sections of roads will not be serviced during the road closure period. Instead, the following services will travel along the Surf Coast Highway, Marshalltown Road, Dendel Street, Grove Road, Station Road to Marshall Station, and then back to continue along the normal route: • • • • • • •

RADE E PA ARN HE

R PE UP

Please refer to the map opposite for the course route and suggested detour routes.

WHAT IS A ROLLING ROAD CLOSURE? A rolling road closure refers to the manner the event course is managed during racing. This means that the roads comprising the event course will remain open except for the short period while the cyclists pass through.

START/FINISH LINE

EA

SUBURB

There are some stages that use a rolling road closure.

LIMEBURNERS BOAT RAMP

ROAD CLOSED

SUNDAY 15 AUGUST 2010 EASTERN PARK, GEELONG – STAGE 6: CRITERIUM

Route 19 - 12.15 Departing Geelong Rail Route 19 - 12.30 Departing Deakin University Route 20 - 11.55 Departing Geelong Rail Route 20 - 12.57 Departing Geelong Rail Route 20 - 12.05 Departing Deakin University Route 20 - 13.00 Departing Deakin University Route 80 - 11.35 Departing Ocean Grove

RES

PORTARLINGTON Please note that all bus stops along The Esplanade between Pier Street (Portarlington) and Harvey Road (St Leonards), and the bus stop on Leviens Road between Murroduc Road and Seachange Way will not be serviced between 9.30am and 2.45pm on Friday 13 August. Instead, the following shuttle bus services will operate: • Shuttle bus departing Drysdale (at the main interchange on High Street) – 9.50am, 11.50am and 12.40pm (travels along Newcombe Street and turns right into Mercer Street, left into Hood Road, right into Henderson Street and left onto Batman Road). • Shuttle bus departing St Leonards (Murroduc Road outside St Leonards Hotel) – 9.55am, 11.45am, 1.10pm and 2.00pm (travels along Bluff Road, Mainsail Drive, Sandbar Street, Seachange Way, right into Leviens Road, left into Bluff Road and then left onto Murroduc Road – to continue to Geelong. Bus services will resume their normal operations once the road closures are removed at approximately 2.45pm.

Temporary bus stops will be located on Grove Road near Bailey Street and Capital Drive. Bus services will resume their normal operations once the roads closures are removed at approximately 1.45pm.

FURTHER INFORMATION: If you require further information regarding this event, please contact the Event Coordinator, Leanne Freeman via telephone 5224 2466. For further information regarding the event’s changed traffic conditions or access arrangements, please contact the appointed Traffic Management contractor, Deploy Traffic Management on 0409 351 264. To contact the City of Greater Geelong, please call 5272 5272. Additional details can be found online: www.caribou.net.au or www.geelongaustralia.com.au

CHANGED TRAFFIC CONDITIONS STREET CONSTRUCTION WORKS, OCEAN GROVE

CENTRAL GEELONG FARMERS MARKET TEMPORARY CHANGED TRAFFIC CONDITIONS SATURDAY 14 AUGUST 2010

Motorists and pedestrians are advised that road construction and associated works will be undertaken in Karri Close, Wedge Street (between The Avenue and Asbury St East) and Eggleston Street (between The Terrace and Dare Street), Ocean Grove.

To ensure this event is run safely, a road will be closed temporarily. Little Malop Street, between Union and Moorabool Streets will be closed from 7.00am to 2.00pm. Access for emergency vehicles and deliveries will be maintained at all times.

When: Construction will begin on Tuesday 17 August with anticipated completion in late October 2010, weather permitting.

PUBLIC NOTICES GEELONG SKILLED MIGRATION PROJECT

Impacts on traffic: As part of the works Wedge Street shall be permanently closed to through traffic at two locations (see diagrams).

The Skilled Migration Project is part of the Victorian State Government’s Skilled Migration Strategy - Global Skills for Provincial Victoria which aims to help employers attract and retain the skills they need when they are unable to source these skills locally.

1. Mid block between Asbury Street East and Draper Street; and 2. North side of intersection with Powell Street East.

For more information go to www.geelongaustralia.com.au/business/migration

All roads shall be temporarily closed to through traffic during working hours of 7.00am to 4.30pm however access will be maintained to local residents where possible.

EFFECTIVE CONTROL / RESPONSIBLE PET OWNERSHIP

For further information contact Michael Stott, Senior Engineer on 5272 4301. PERMANENT CLOSURE

WORKS AREA

It is essential when in an off leash area with your dog, it is under effective control. Effective Control is when your dog is always within your sight, can be controlled immediately by voice command and if in doubt place your dog back on lead out of respect and harmony for all!

487357-RMB31-10

CI060810R-2

During the works we recommend local traffic seek an alternative route.

The Independent, Friday August 6, 2010

11


Call for highway Fine message for drinkers in new poster campaign funding promise

Fine posters: Cats star Shannon Byrnes, Inspector Carl Peers, Mayor John Mitchell, Sergeant Shane Connolly and Geelong Safety Committeeâ&#x20AC;&#x2122;s John Frame launch the So You Know posters. Picture:

     

487739-JF31-10

            

attached,â&#x20AC;? he said. â&#x20AC;&#x153;As the tagline of the posters states: â&#x20AC;&#x2DC;Your action, your decisionâ&#x20AC;&#x2122;. â&#x20AC;&#x153;There are no excuses for behaving badly.â&#x20AC;? Other fines highlighted on the posters include $60 for under-age consumption or possession of alcohol $60; $100 for possessing an open container of alcohol in a public place $100; $239 for production of false identification; and $478 for failing to leave licensed premises when drunk, violent or â&#x20AC;&#x153;quarrelsomeâ&#x20AC;?. The City will pay for the initial print run of posters. Mayor Cr John Mitchell called the campaign a â&#x20AC;&#x153;simple yet effective way to make people think before they actâ&#x20AC;?.

Gillard set to rule northern Geelong BY KIM WATERS PRIME Minister Julia Gillard is welcome to move into Geelongâ&#x20AC;&#x2122;s northern suburbs as part of a redistribution of electoral boundaries, according to the cityâ&#x20AC;&#x2122;s federal Labor MPs. But a leading lobby group for the city has warned the expansion of her Lalor electorate into Corio could limit Geelongâ&#x20AC;&#x2122;s control over important assets such as Avalon Airport. An Australian Electoral Commission boundary review has proposed expanding Lalor from Melbourneâ&#x20AC;&#x2122;s west and

Werribee to include Avalon, Anakie, Lara and parts of Lovely Banks. The review also proposes expanding Corio to take Queenscliff and Ocean Grove from Corangamite, its eastern boundary would fall back to the Barwon River. The proposed boundaries would come into effect after this monthâ&#x20AC;&#x2122;s federal election. Corio MP Richard Marles was unfazed about losing part of his electorate. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a huge advantage that we have our Prime Minister as our closest neighbour because

she has an instinctive sense of the challenges faced by Geelong,â&#x20AC;? Mr Marles said. â&#x20AC;&#x153;Under these new boundaries we would see her move ever close to Geelong. Indeed, part of the City of Greater Geelong would be in her electorate.â&#x20AC;? Corangamite MP Darren Cheeseman was â&#x20AC;&#x153;pleasedâ&#x20AC;? with the review. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s good news for Geelong because it means...sheâ&#x20AC;&#x2122;ll have a direct personal interest in the area,â&#x20AC;? he said. Committee for Geelong executive director Peter Dorling

said the proposed boundaries had â&#x20AC;&#x153;good and badâ&#x20AC;? implications for Geelong. â&#x20AC;&#x153;Avalon and the northern industrial area are seen to be part of the Geelong region, so that would be a big loss if the boundaries changed,â&#x20AC;? Mr Dorling said. â&#x20AC;&#x153;We would have preferred those assets to be inside one electoral boundary and attached to City of Greater Geelong although if the Prime Minister was re-elected it could be good to have her watching over those assets.â&#x20AC;?

ly pp re su ctu nds ow ufa bli e n an C W d m r PV a n tdo o ou

Patios Verandahs Pergolas Carports Opening Roof Authorised

DESIGNER PERGOLAS & CARPORTS SERVICING THE GEELONG & BELLARINE PENINSULA

Distributor

AUTHORISED STRATCO DEALER Telephone 1300 665 590 or online at www.designerpergolas.com.au

426444-JJ13-10

BOTH major political parties should make funding the duplication of the Princes Highway between Geelong and Colac their number-one priority, according to a councils alliance body. G21, which represents the regionâ&#x20AC;&#x2122;s five councilâ&#x20AC;&#x2122;s on planning and development issues, said Princes Highway West was vital to the economy of south-western Victoria yet renowned as one of the stateâ&#x20AC;&#x2122;s worst highways for road fatalities. G21 chief Elaine Carbines welcomed a Federal Government commitment to duplication the highway to Winchelsea but wanted Labor to follow the Liberalsâ&#x20AC;&#x2122; lead in promising to extend the works to Colac. â&#x20AC;&#x153;The Princes Highway West needs federal Labor to commit funds (because) saving lives should take precedence over party politics,â&#x20AC;? Ms Carbines said. â&#x20AC;&#x153;Travel demandâ&#x20AC;? on the stretch of highway was set to increase 3.5 per cent annually, she said.

BY ERIN PEARSON A NEW campaign will use posters in Geelong licensed venues to warn drinkers they face fines for playing up. Victoria Police and City of Greater Geelong have joined forces to distribute the So You Know posters highlighting 11 on-the-sport fines for antisocial behaviour. The penalties range from $239 for offensive language to $711 for supplying alcohol to underage drinkers. Geelong Police Superintendent Peter Oâ&#x20AC;&#x2122;Neill wanted revellers to know they would be â&#x20AC;&#x153;held accountableâ&#x20AC;? for bad behaviour. â&#x20AC;&#x153;It will also hurt the hip pocket with hefty fines

â&#x20AC;˘ Motor Vehicle Finance â&#x20AC;˘ Tradesman & Commercial Finance â&#x20AC;˘ Heavy Equipment & Machinery Finance â&#x20AC;˘ Online Applications

â&#x20AC;&#x153;At Morris Finance our staff have over 150 years of experience in the commercial lending sector. Abby Davis has been a part of our team for the past three years and can assist you with all your finance and insurance inquiries. Best of all she will give you customer service.â&#x20AC;?

487447-KS31-10

Q: Looking for customer service? A: Abby Davis

â&#x20AC;˘ Motor Vehicle Finance â&#x20AC;˘ Tradesman & Commercial Finance â&#x20AC;˘ Heavy Equipment & Machinery Finance â&#x20AC;˘ Online Applications 12

The Independent, Friday August 6, 2010.


BY ERIN PEARSON A “PRE-EXISTING” medical condition” could have caused a cyclist to fall into the path of a car in a fatal accident at Torquay this week, according to police. The man, aged in his 50s, died on Horseshoe Bend Road soon after 6pm on Monday night. Torquay Police said investigators were trying to determine whether the man’s unspecified medial condition was why he fell onto the other side of the road before his collision with a

single vehicle travelling in the opposite direction. Sergeant Jason Van Doren told the Independent the Major Collision Investigation Unit had ruled out a hit-run. “We believe the man was riding south toward Torquay about one kilometre from home and for whatever reason he’s ended up lying in the north-bound lane,” he said. “Unfortunately, a 21-yearold girl heading back to Barwon Heads was unable to see him and they’ve collided.

“From our inquires, we’ve determined there was nothing she could have done. She has stopped immediately but unfortunately it was too late.” Police described the motorist as distressed after the accident. Sgt Van Doren said police were unlikely to lay charges over the accident. The victim was a husband and a father, he said. Paramedics tried to revive the cyclist but he died at the scene. The accident was the third road death of a cyclist on the

region’s roads in the past 10 months. Oberon High School teacher Ron Thompson, 61, died when his bike collided with a truck on Anglesea Road, Waurn Ponds, in October. Eight weeks later Rex Sizeland, 66, died after suffering serious head injuries in a collision with a car while cycling on a Breamlea Road with friends. Mr Sizeland was a father of four. Victoria’s road toll so far in 2010 is 194 compared to 174 at the same time last year.

RICHARD MARLES Labor for Corio

I’ll be at The Centreway Lara Saturday 7 August 10am to Noon

487814-MD31-10

‘Health issue’ link to death of cyclist

Advertisement

Showgrounds Market East Geelong Sunday 8 August 10am to Noon to talk to residents about Federal & local issues

Authorised by J. Eren, Level 1 Corio Village Shopping Centre, Corio Vic 3214

417235-RMB31-10

THE HOME OF FIRST CLASS CINEMA

Students shun ‘greed’ for famine fundraiser BY ANDREW MATHIESON WORLD Vision’s 40-hour Famine campaign is more than just missing a few meals while sucking on barley sugars to Geelong College students. They are sacrificing everyday luxuries like mobile phones and internet access in an attempt to raise money for victims of starvation around the world. College campaign organiser and school chaplain David Curnow said many senior students were thinking outside the square to know what it was like to go without. “It’s not just the food they take out of their life; it could be technology, it could be anything they give up for the 40 hours,” he said. “The idea is to give up something that has a hold of your life; things that drive them in a way that may be seen as greedy.” Now entering its 10th year participating in the 40-hour Famine, the college has led

SESSIONS UNTIL WED AUG 11

WAURN PONDS PRIN PRINCES HWY PH: 5249 2800 KATHERINE HEIGL

Famine: Jason O'Loughin, back left, and David Curnow, front right, with students helping organise the fundraiser. Picture: John Conway other Geelong schools in fundraising more around the nation fasting as Australians than $28,000. cast votes in the federal election on August The students will be among thousands 21.

STEP UP 3D (M) NO FREE TIX FRI MON - WED: 11.00 1.20 6.30 8.45 SAT SUN: 1.20 3.50 6.30 8.45 3D TOY STORY 3 (G) NO FREE TIX FRI MON WED: 3.50 SAT SUN: 10.45 2D STEP UP 3 (M) NO FREE TIX DAILY: 11.15 1.40 4.00 6.30

THE SPECIAL RELATIONSHIP (M) NO FREE TIX FRI MON - WED: 10.45 12.50 3.30 7.00 9.15 SAT SUN: 12.50 3.30 7.00 9.15 KILLERS (M) NO FREE TIX DAILY: 11.20 2.00 4.20 6.50 9.20 INCEPTION (M) DAILY: 10.30 1.30 4.30 7.30 8.50 THE TWILIGHT SAGA: ECLIPSE (M) DAILY: 10.25 1.00 9.10

ASHTON KUTCHER

KNIGHT & DAY (M) DAILY: 1.00 4.00 6.45 THE CONCERT (M) FRI MON - WED: 1.15 6.40 SAT SUN: 10.25 6.40 TOY STORY 3 (G) FRI: 6.40 MON - WED: 10.30 6.40 SAT SUN: 10.30 1.15 6.40 THE KARATE KID (PG) DAILY: 10.25 3.40 MOTHER AND CHILD (MA 15+) DAILY: 3.30 9.00 PREDATORS (MA 15+) DAILY: 9.20PM

ONLINE TICKETING AVAILABLE www.readingcinemas.com.au

Continuing quality Lutheran Education in Geelong Kindergarten, primary and secondary Understanding and celebrating God’s love in our lives Bus service available

486875-SH18-10

Geelong Lutheran College and St John’s Lutheran School Geelong Lutheran College Burvilles Rd, Mt Duneed Primary and Secondary www.glc.vic.edu.au St John’s Lutheran School and Kindergarten K-6 Aberdeen Street, Geelong www.stjohns.vic.edu.au

Two schools–One community

Keep it Local Competitive Prices

Your local Kleenheat Gas supplier will always offer a competitive price on 45kg LPG cylinders.

Safe and Professional Service 421393-RMB16-10

We provide convenient home delivery of 45kg cylinders and will safely connect them if required.

Convenient Ordering Ordering your gas has never been easier, you can order over the phone or online 24 hours a day!

Over 50 Years of Local Experience Kleenheat Gas is an Australian owned and operated company that has been supplying LPG to regional Australia for over 50 years. As your local supplier, we’re proud to be right here in our community, while being part of a national network. Kleenheat Gas is proud to be part of The Salvation Army Regional Care Services, providing support and help to those who need it throughout regional Australia.

Geelong North Newcomb St. Leonards Winchelsea

Gas & Industrial Supplies ........................... 5278 8999 Ivorson Poultry Farm & Hatchery .............. 5248 1552 Brennans Gas & Bin Hire ........................... 52571951 Winchelsea Trading Company ................... 5267 2092

75,*$6(*,

   

kleenheat.com.au The Independent, Friday August 6, 2010

13


Storages ‘low’ after dry July

‘Advertising in the Independent really works’ ‘We advertise in the Independent because it works. The other papers don’t seem to work anywhere near as well - I think it’s the coverage of the Independent hitting the right areas. Advertising in the Independent works for us.’ Warren Pisano Andrews and Parker

The Independent - phone 5221 5200 Trading as

K.L.D FLOORING

487901-TB28-10

www.kldhome.com.au

EXCLUSIVE WHOLESALE PRICES FOR BUILDERS AND DEVELOPERS

• LAMINATE FLOORBOARDS from $9.60m2 (patented click system) • SELECT SOLID TIMBER (selected colour) from $55m2 • BAMBOO from $48m2

• Pre finished Solid timber floorboards • Pre finished Engineered timber floorboards • Pre finished strand woven bamboo floorboards •Engineered bamboo floorboards • Laminate floorboards

• 5 LINEAL METRE KITCHEN start from $2900 48 Mercer St, Geelong • Ph 5242 8057 • Fax 5242 8514

LINDSAY SMAIL a similar fraction. The area’s average daily minimum for July was 5.5C, exactly on average. The maximum daily average was 13.6C compared to the mean maximum 14.0C. The highest maximum for the month was 17.6C on July 30, while the lowest was 10.1C on July 28. The month’s highest overnight minimum was 9.3C on July 11, with the lowest 1.4 C on July 9. Three frosts were recorded for the month. July also produced three days of strong wind gusts over 60km/h, while a slow-moving high pressure system over Victoria produced five or six days of fog in the final week. Geelong recorded one thunder day on July 31st but no storms. An unusual feature of the month was a mammatus sky, characterised by a cellular pattern of pouchlike clouds, on July 10.

A NEWTOWN artist is in the running for one of Australia’s biggest art prizes. Metro Art Award organisers said Michael Gromm was one of 27 finalists for the prize, recognising Australian artists aged under 35. Mr Gromm was rapt his painting, Tourist (from start to finish), was chosen for the finals from 250 entries. “It’s pretty cool to be selected

Cool: Michael Gromm’s shortlisted painting. for such a well-known award,” the 30-year-old said. “It’s great to get the recognition from a panel of judges like this for my work. It’s really

encouraging.” The Metro award’s $40,000 judges’ prize and $10,000 people’s choice winners will be announced this month. 487950-RMB31-10

FLOORING

Under the weather

Newtown artist finalist in ‘Metro’

NOW OPEN IN GEELONG DIY WARDROBE

THE REGION received only around half to two thirds of its normal July rain, according to Geelong Weather Services’ figures. Geelong Airport received only 23.6mm, just below half the average. However, some other suburbs, such as Leopold, exceeded 35mm. Disappointing falls of the same proportions were received in the Otways catchment area. At the end of the month the region’s water storages were only 32.5per cent of capacity, although this was higher than at the same time for the past two years. July was cooler than average by .2C in Geelong despite some predictions that southern Victoria would end up warmer than normal for the month. These type of generalised comments have seldom been correct for the Geelong region, as the figures from Geelong Airport’s weather station are actual raw data, not subject to any weighted area grids. The systems of grids used result in numbers about data, rather than the pure recorded data itself. As such, those types of generalisations are best avoided. Geelong Airport also did not warm during July. The 19-year mean temperature linear trend from 1992 to 2010 is statistically level and this is Geelong’s seventh-coolest July in that time. Minimums have been decreasing fractionally – down .3C in 19 years - and maximums increasing by

Get “The Look”

“The Half Carat Look” 9ct Diamond Ring *Was $699

“The One Carat Look”

NOW $399

1 Carat Diamond Solitaire in 18ct Gold *Was $6499

18ct Gold Diamond Ring *Was $1499

SAVE $2000

Ring TDW=1.00ct 9ct Diamond D *Was *W $2499 NOW $1499 $3.95 per day~

SAVE $1000

8231082

18ct Gold Diamond Anniversary Ring TDW=1.00ct *Was $1999

NOW $4499

NOW $999

NOW $1249

8014291

$2.70 per day~

$3.33 per day~

8041117

8041118

SAVE $500

SAVE $1000 88113475 8311223

“The Half Carat Look” 9ct Diamond Pendant *Was $499

NOW $299

8311057

“The One Carat Look” 8441144

9ct Diamond Studs *Were $999 NOW $599 $1.70 per day~

9ct Diamond Deals HALF PRICE 9ct Diamond Ea Earrings *Were $149

202 02 7719202

NOW $74 74

HALF PRICE

HALF PRICE

18ct Gold Diamond Studs TDW=1.00ct *Were $2999

NOW $1999

$5.20 per day~

1 Carat Diamond Solitaire in 18ct Gold *Was $6499

NOW $4999

8111821 821

18ct Gold Diamond Anniversary ar y Ring TDW=1.00ct *Was $2999 NOW $1799 $4.70 per day~

9ct Diamond Cocktail Rings HALF PRICE

7553432

9ct Diamond Pendant *Was $129

NOW $64

9ct Crystal Hoop Earrings *Were $119

NOW $65

NOW $599

SAVE $250

7018650

7008592

SAVE $400

NOW $99

4271056 4281073

9ct Crystal Circle Pendant *Was $89

SAVE $400

NOW $49

7100716 7001049

9ct Diamond Ring *Was $399 2151133

Sparkle in 9ct Gold

9ct Diamond Ring TDW=.50ct *Was $1199

9ct Diamond Ring *Was $199

9ct 19cm Belcher Diamond Padlock Bracelet *Was $999 NOW $599 $1.70 per day~

SAVE $1200

8011170

NOW $149

9ct Diamond Ring *Was $699

NOW $299

9ct 19cm CZ Belcher Padlock Bracelet 599 NOW $799 $2. *Was $1599 $2.20 per p day~

2151161

HALF PRICE

82 Malop Street, Geelong Also available at our Corio and Waurn Ponds Stores 14

The Independent, Friday August 6, 2010.


Ford ‘hope’ in green car plan

SALE! CLOSING 6TH, 7TH, 8TH AUGUST

DOWN SOON

Chin Wool with Art Silk Outline 330x240cm

Hand-Knotted Fine IndiPersian Design 365x250cm

Traditional Printed or Modern 120x67cm

5pcs $8999 $1099 SOLD! HING MUST BE EVERYT NOW NOW

$399 NOW

Candidate: The Greens’ Gavin Brown.

49

$

EA

EA

NOW

$

9

69

EA

NOW

NOW

$

$

NOW

NOW

of cost...

399

$

Last week: The Independent’s story on the electric car trial. The Greens’ funding announcement coincided with the arrival of the first fully-electric vehicle in Australia. Mitsubishi Motors released its i-MiEV in Japan last year before introducing the car onto Melbourne roads for its first test run this week. A Mitsubishi Motors spokesperson said the vehicle was one of the world’s “first truly viable zero drive-time emission city commuter cars in volume production”.

NOW

$

rather s We’d 999

79

$

$9

NOW

... T U O S S I M T ’ N DO rdless ell to you, rega $

NOW ea

$3999

NOW

1

$

$29

69

NOW

19

$

EA

Thousands le ab of rugs avail e us k a m , for sale an offer. Sizes from 50x80cm to 400x300m

LIQUIDATION HOUSE NOW

5

$

199

$

a metre

Focus 5 Building, Corner of Lt Malop & Gheringhap St, Geelong Ph: 0406 116 522 - 0425 871 571

487360-JF31-10

BY KIM WATERS INTRODUCING electric cars in Geelong could “secure” the future of the city’s Ford factory, according to a Greens candidate. Gavin Brown said the Greens had a focus on Ford as part of its policy for a $75 million funding injection into the development of green cars in Australia. “The Labor Government and opposition may differ on how to keep local companies like Ford in business, yet the truth is that only the Greens plan to invest in electric cars will enable a truly secure future for Ford,” Mr Brown said. “The Greens focus on assisting Ford is part of their overall plan to assist local companies to adjust to a changing economy.” The Independent reported last week that Geelong council officers were “currently investigating” potential for an electric car trial with international car firm Better Place Electric Vehicles. The trial would incude a network of recharging stations across the city. Mr Brown said Geelong manufacturing industries like Ford should take advantage of “the opportunities on the horizon”. “The world is moving to electric cars and Australia will eventually make this step,” he said. “The Government needs to be assisting companies like Ford to prepare to take part in this emerging market. “This will provide a massive opportunity for Geelong to be a major provider of clean cars for Australia.” Mr Brown promised to push for increased funding for electric vehicle development if he scored a shock win in the safe Labor seat of Corio against incumbent Richard Marles. “We’re proposing that if we get into power we’ll take the opportunity to provide more funding for companies like Ford to start producing electric cars,” he said. “The environment is changing and fuel will get more and more expensive. “This would enable us to keep travelling in a more sustainable way and would help our industry in Geelong get on the front-foot and be leaders in the new economy.”

3 DAY

A Sоg L Vƣ Sarah Henderson L I B E R A L F O R CO R A N G A M I T E

“The first 1.

9 things I’ll do if elected.”

Support initiatives to restore the integrity of Australia’s borders.

2. I’ve already secured a funding commitment to duplicate the Princes Highway from Geelong to Colac. I will also continue to work with local communities to identify road ‘black spots’and secure funding to improve road safety.

3. Work with environmental, community and Landcare groups on local initiatives, such as the Clean Energy Coast Forum.

4. Support local small business to help get the economy growing and create local jobs.

CONTACT SARAH HENDERSON Suite 3, 165 High St, Belmont 3216 (PO Box 20 Belmont 3216) P. 5243 2862 | F. 5244 5404 | E. sarah.henderson@vic.liberal.org.au

5. Work with school councils and school principals to improve our local schools. 6. Oppose plans by Labor and the Greens

– which will increase private health insurance premiums and put more pressure on hospitals.

7. Support a rejuvenated Landcare program to ensure those who work the land and care about sustainability are supported.

8. Fight to ensure urban growth does not outpace the infrastructure needed to support growing communities.

9. Improve public safety and secure more CCTV cameras in known trouble spots, with a direct feed to local police stations.

www.sarahhenderson.com.au

Authorised by I. Smith, Suite 3, 165 High St Belmont 3216. 487721-RMB31-10

The Independent, Friday August 6, 2010

15


buckets & bouquets BOUQUETS to the kind ambulance crew who took Peter to hospital on July 27 under difficult circumstances. They are special people. Jean, Bell Post Hill Cathie.

Bouquets to Forty Winks’ Cathie for the most outstanding customer service I have received while looking for a new bed. She went the extra mile for me. Well done, SM, North Geelong

BOUQUETS to Louise for bucketing a rude priest (Buckets and Bouquets, July 23). I had a similar experience when I parked my caravan in a church car park to stay overnight. The priest shouted at me: “If you are not out of here in one hour I’ll call the police”. Keith, Corio

BUCKETS to Keith (Buckets and Bouquets, July 30) for his suggestion I should avoid parking in Highton Safeway’s car park and on naturestrips instead, which is illegal. Not Happy, Highton

BUCKETS to a mother who left two young children in her car outside Coles Geelong West for over 20 minutes with the engine running while she shopped. When she noticed an emergency worker and others concerned about the safety of the children she told them to get a life. Disgusted, Geelong West

BUCKETS to Keith for bucketing drivers for leaving cars parked where other vehicles reverse into them. Anyone who isn’t parked across a driveway should have confidence parking in the street. The problem is drivers failing to pay attention. I recently stopped at a stop sign and was hit from behind. Pay Attention People, Norlane

BOUQUETS to the wonderful staff and carers at Point Londale’s Coorabin Hostel for caring for our mum, nan and greatgrandmother, Jean, who was 96 years young. Thanks for making her final hours so peaceful. Shania, Clifton Springs

BUCKETS to Keith. I have three words for you mate: get a life. I’m sick of seeing your buckets in the paper and I’m sure most of Geelong is sick of them, too. Elizabeth, Manifold Heights

BOUQUETS to the staff at Geelong Hospital, particularly in Birdsey Wing, for their care and professional attitude. They do an amazing job. Janice, Hamlyn Heights BUCKETS to thieves who stole my Tarago from Geelong West and set it on fire at Whittington. The vehicle had been in my family for 22 years. The selfish scum thieves left an eight-and-a-half-month pregnant woman with two kids and no car. Kelly, Geelong West BUCKETS to a boarding kennel where my daughter booked in her two dobermans for a month while she was overseas. Imagine her distress to be told two days before leaving that her dogs were double-booked and would be put down the back, not in the section she had intended. Samantha’s Mother, Anglesea BOUQUETS to the person who found my Suzanne Grae shopping and handed it in at Corio Shopping Centre on July 22. I was grateful for the person’s caring and honesty. Lucky, Hamlyn Heights

BOUQUETS to Sticky Little Fingers’ Lauren. My son is loving his cooking lessons in a fun, clean environment. Well done, Sticky Little Fingers. Happy Mother and Tyler, Drysdale BOUQUETS to the amazing staff and families of Point Lonsdale Primary School, district nurses, Dr Horne and the staff of Queenscliff Bait and Tackle for their support, caring and compassion over the past six years, especially the past seven months. We will never be able to thank them enough. Grateful Family, Point Lonsdale BUCKETS to a woman who chased my cat as it passed through her yard for a second while it followed my dog on our walk. She attempted to kick my cat as she chased it down the street. Her behaviour was unnecessary, especially since my cat was not hurting anybody. Disgusted, Geelong West

WRITE TO US Mail: email: FAX:

PO Box 407, Geelong, 3220 editorial@geelongindependent.com.au 5221 3823 487328-RMB31-10

Where Will

you Sleep Tonight?

We’re Building Geelong’s First Homeless Shelter And We Need Your

help To Raise Funds

Can you volunteer 12 hours per week or more, to doorknock our neighbourhoods and collect donations for this much needed facility?

Shelter for the Homeless Foundation is a locally based, registered public benevolent institution, created to address a critical community need and build Geelong’s first Homeless Shelter. Shelter for the Homeless Foundation was established by a group of community minded people, dedicated to building a shelter facility for people who find themselves in unfortunate circumstances, with nowhere to sleep at night.

se o p r u r p om u o t i Vis showro , built sington St s E 8 e l t a a d e Grov

“We need 300 volunteers, young and old, to get involved and help us raise funds for this project, by collecting donations door to door. Rosters are flexible so you can find time to help us, and a petrol allowance is available. Please join the team committed to helping those less fortunate.” To register please phone Andrew Podolak Phone: 03 5282 5432 Mob: 0412 107555 Email: sfthf@iinet.net.au

Helping People in Crisis

Our Mission Statement Every person is entitled to sleep in a warm and safe environment. Our objective is to build a Community Shelter to provide emergency relief, with beds for approx 50 people in crisis at a permanent facility. We will assist them to deal with challenging circumstances, providing a life-skills program, plus help them find employment and establish independent living. SHELTER FOR THE HOMELESS FOUNDATION ACN 144 979 779 *please note, donations over $2 are tax deductable

For more information go to http://www.shelterforthehomelessfoundation.org/

> New and Old Floors > Staining to Suit > Timber Decking > Solid Timber Flooring > Cork Supplied > Timber Sales > Recent Existing Floors & Professionally Laid > Home > Halls > Gyms > DIY Hire of all Sanding Machines & Equipment > Prompt & Reliable Service Skilled Tradesmen

Under Construction

Why Should Anyone Have To Live Like This

? 487327-KC31-10

Light a balloon to remember, celebrate and give hope to leukaemia, lymphoma and myeloma patients and their families.

Geelong, Wednesday 1 Sept Eastern Beach Reserve

Sign up www.lightthenight.org.au MAJOR NATIONAL PARTNER

MEDIA PARTNERS

487301-KC30-10

16

The Independent, Friday August 6, 2010.


On track to the blues Local Legends ANDREW MATHIESON THE ‘T’ in Hugo T Armstrong’s name could just as well stand for trains. But that would also then require a second middle initial of B for the Blues. In Hugo’s world, red rattlers and soulful tunes don’t exist without the other. The founder of Queenscliff’s Blues Train loves to drift off to a bygone era and envisage the Deep South of America when the rolling of musical rhythms combined with the natural chugging of steam engines. “Blues musicians would hitch a ride on a steam train to get around from town and town,” Hugo explains. “So there has always been a synergy between the music and trains – I mean, how many blues songs are there about trains? There are a lot. “The make-up of the music fits in well with the confines of the train, physically – you couldn’t do a jazz ensemble because it’s rattling around and moving. “But the rawness of rhythm and blues music fits.” That fuzzy image was turned into reality 18 years ago when a couple of trainspotter mates wanted to start shovelling coal again into some early 1900s steam locomotives abandoned in the old Fyansford quarry. Hugo’s own love affair with rail travel stretches back to when grandma would roll into Queenscliff station in a rattling train from Melbourne. It even dates back to memories from Point Lonsdale kindergarten where he and other kids would climb up on the safety fence and encourage the passing train driver to blow his whistle for their amusement. “A lot of people don’t realise that the Fyansford fleet (which carries the Blues Train) is a really significant train that has come to Queenscliff,” the 43 year old adds. “This is Geelong’s rail history; trains that are our living history, they’re still going and they’re not sit-

Off the rails: Hugo T Armstrong is the driving force behind Queenscliff’s Blues Train. Picture: John Conway 51226 ting in a museum.” Spicing up the ride with the blues was a masterstroke of the community radio station DJ, who last week finished 21 years on air. Each of the Blues Trains’ four carriages hosts a different musical genre performed by a different band or artist. The crowd swaps carriages every half hour to get a new taste of the blues – and of its meals. “I never envisaged when we first started we’d still be here doing it now,” Hugo reflects. “There’s nothing like this in the world, so people come from all over Australia to do it.” Hugo would be the first to admit his love of the blues has gone off the rails

– and into the home. His three-storey Point Lonsdale house is overwhelmed with memorabilia reflecting the atmosphere of a blues bar. Lava lamps, neon signs and stacks of vinyl records are among a myriad of things to dazzle the eye. “I’ve slowed down these days...I’m thinking it’s time for a garage sale,” Hugo laughs. What stands out the most among the clutter is an obscure TV Logie. It sits on top of his television, staring back every day when Hugo sits down. He owns the statuette but it’s not really his. A guy who worked at the factory where the Logies are crafted decided to add to Hugo’s rare array of collectables.

“There’s no guilt because it doesn’t belong to anyone,” he quips. “I have this Logie, it’s really heavy and it sits on top of the TV - where else would you put a TV Week Logie?” Then, for Hugo, there’s the kite world. A hidden part of his alter ego, it was more than just child’s play when he owned a kite shop in Point Lonsdale. There was also a time when Hugo was the national stunt kite champion, flying two-string sport kites to rhythmic music and in perfect formation, like Olympic synchronised swimmers. Hugo interrupts to corrects the analogy. “The speed our kites we were flying at, it was more like the Roulettes,” he smiles.

ROTARY CLUB OF GEELONG WEST

GEELONG BOOK FAIR 2010 11.00am – 5.00pm 9.00am – 5.00pm 10.00am – 2.00pm Geelong West Town Hall Admission – Gold coin donation

E L P M I S A ENT

487314-JL31-10

Friday 6 August Saturday 7 August Sunday 8 August

INVESTM

1,000s of Second-hand Books For Sale. Local authors in attendance over the weekend. Proceeds to Rotary approved projects Any enquiries phone 0427 211 273

Securities with Banksia

Limited ABN

45 004 736 45

6.75

D TERM 1 YEAR FIXE

terest

- Monthly In

% pa

tere Quarterly In

rest Monthly Inte

6.50%pa 6.50%pa

2 Year Term

9 Month Term 6 Month Term

PAYDAY LOANS Never be short of cash again!

Immediate Approval! Cheques Cashed Western Union Open Saturday 12pm - 4pm

No Credit Checks For a location near you call

1300 227487 *Conditions apply

(1300 CASHUP) 486282-RMB29-10

8

6.55%pa na

6.25%pa 5.50%pa

na na

3 Month Term .00) vestment $500 (Minimum in R TARGET SAVE

G TODAY! START SAVIN formation For further in D r ianne on contact Sue o

9 03 5221or7ca5ll9into

ol 199 Moorabo

Street, Geelong

st

6.25%

Mat pa Paid on

urity

a bank. es and is not ts in debentur of their principal en stm ve in s (BSL) offer some or all credit rities Limited rs risk losing a recognised Banksia Secu involve risk and investo edit rating by e about the risk of cr a ts ve en ha t stm en mad All inve es do no e current ment has be BSL debentur ould read th ndent assess investment. oducts you sh eds. A prospectus ns no indepe pr ea e m es is th Th . in agency vesting r your ne 1800 333 rs. Before in suitability fo tion centre on 2010 and loss to investo be satisfied about their r administra d ay ou an M g us 14 llin ct at ca pe , by pros rrent as m any branch . Rates are cu is available fro w.banksiagroup.com.au ww m fro e. or 4 tic 11 t no ange withou subject to ch

.auu m.a up up.c.coom garo ro ia g s k si n k a n a .b .b w w ww ww 422279-RMB27-10

487944-RMB31-10

The Independent, Friday August 6, 2010

17


letters Suburbs in road MANY thanks to the Independent for last week’s story headlined ‘Process failed link objectors’. Perhaps the Independent could also warn residents of Marshall, Breakwater, East Geelong, St Alban’s Park and Moolap that the proposed six-lane bypass road will not end at Grovedale. There are plans to continue it in and near their suburbs, although VicRoads states that “the route has yet to be decided”. Residents can contact their state MP, attend City of Greater Geelong council meetings and write to VicRoads’ regional director at PO Box 775, South Geelong, 3220. Lee Gladwell Grovedale

Neglect’s the crime LAST week’s Independent reported the quote: “Due to Corio being a general commission and low-socio economic area it has a highly concentrated number of people committing criminal offences”. If this is an indication of the mindset of local

police then I am almost lost for words. It is as well that the detective wished to remain anonymous. I’ll bet he doesn’t live in Corio. The problems facing Geelong’s northern suburbs have been well documented in the media. The issues are not unique to Corio or even Geelong. We have had Labor governments in Victoria for almost 20 of the past 30 years. If there was ever a chance to deal with the neglect of the Bolte and Hamer years then surely that time has come and gone. What is singularly unnecessary is the kind of profiling evident in the comments by the anonymous detective. Crime happens everywhere and for all sorts of reasons. A little more objectivity and a lot less bias is what is needed. And responsible reporting. Kevin V Russell Geelong

Save lone pine IN 1994 Geelong Legacy planted a lone pine at Geelong Golf Club in recognition of the sacrifice made by soldiers during the world wars (Independent, July 23).

Although the club has been closed for a number of years, the tree remains healthy and now stands five metres tall. This tree is sacred to Geelong Legacy, the families of the fallen and the broader community. Plans to redevelop the site into a series of retail outlets including a Woolworths hardware store may result in the destruction of the tree. Legacy, Geelong RSL and community members are all opposed to any desecration of the tree. Geelong RSL President Rodney Meeke has emphasised the need to save the lone pine as a memorial to our diggers. In bypassing City of Greater Geelong’s stringent planning procedures, the developers of the site have taken their proposal directly to Planning Minister Justin Madden. It is a tragedy the fate of this living memorial is now in the hands of the Planning Minister. Geelong Legacy is writing to the minister requesting the preservation of the tree. The president of Legacy Australia, John Pepperdine, has backed the campaign. I urge all Geelong residents to do the same. I support Legacy’s push to have this important and sacred site retained as a tribute to fallen soldiers

be preserved for future generations. David Koch MLC Member for Western Victoria Region

No power for cars PREMIER John Brumby has announced plans to close a nasty, polluting coal-generated power station in the Latrobe Valley. Readers who remember the power outages we experience in peak demand times, especially during summer, will wonder how we will manage after the closure, since the power redirected to the national grid from solar and wind generation is but token. If we have trouble coping now, what will happen as the population increases? It appears we are in for difficult times in respect of power services, so imagine my astonishment to read that Geelong might be a trial city for electric car plug-in power stations (Independent, July 30). I can’t see how we will have the power to support electric cars unless some environmentally clean power production method is forthcoming. Any ideas? Dot Lea Grovedale

Premium quality, modern style and flexible design options g enin d Op room Gran m Showst u ha Mitc 9th Aug orse Rd iteh 3132 h W 531 itcham 3433 M 873 Ph 9

Call Ziggy on 06 0417 434 3

Wardrobes

Splashbacks

Shower Screens

1300 664 150 - www.premiumoz.com.au

417260-TB31-10

ing Now servic g n Geelo

91 Pakington Street, Geelong West Ph. 5221 1275 Fax. 5221 1276 10 Foxley Court, Derrimut Vic 3030 (Cnr West Park Drive). Ph: 1300 664 150 - Ph: 9394 0700 Fax: 9394 0770 1339 Toorak Rd, Camberwell Vic. Ph: 9889 5566 Fax: 9889 6094 68 Beischer Street, Bendigo Vic 3550. Ph: 5442 7799 Fax 5442 6800

MIC0099A

Going bald? Call a specialist.

TYREPLUS is the specialist in tyres. We’re committed to providing high quality, convenient service that you can trust. No matter what your tyre need, we have a team of local, independent experts to get you back on the road in no time.

The best for you. Delivered. Call 1300 897 375 or visit tyreplus.com.au 487874-RMB30-10

18

The Independent, Friday August 6, 2010.


JUST where has Christina Dengler been (Letters, July 30)? In a trance, no doubt! It sure was great of the Liberals to create a surplus while in office – but at what cost to others? For example, cutting beds in hospitals, reducing police numbers, introducing Workchoices. There are too many examples to mention here. Yes, Labor has produced excessive debt but what Ms Dengler failed to mention was that spending erased the threat of Australia entering a recession, unlike many countries round the world. We emerged from this threat quite well, I feel. What’s the use of having money to spare if it isn’t used to improve our living standards? On this basis, I state that I vote Labor for sure. Tom Sim Grovedale

Liberals a bit rich I WAS intrigued by Christine Denglers’ political science and economics thesis. Personally, I don’t expect to be affected regardless of whether Labor or Liberal is in power, although I do care. In the past I lost thousands of dollars and had to endure issues made possible only by Liberal party policy. Under Labor, less-than-privileged people like myself were able to climb a rung on the social and, more importantly, self-esteem ladders and were given opportunities to complete tertiary studies. I obtained a degree and a secure job and enjoyed the fruits of hard work. By all means, if you are rich, a company director or a mining magnate vote Liberal. Liberal policies and philosophy are designed to cater to your whims. But if you want a fairer distribution of the wealth, health, opportunities and lifestyle Australia has to offer vote, Labor. Left or right, it’s your choice. If we vote the wrong way, some people are going to get richer and some of us will suffer even more. Geoffrey H Day Bell Post Hill

Mayor ‘misleading’ IN HER newspaper column, Mayor Libby Coker had a misleadingly selective view of history when claiming to be setting things straight about State Government’s decision on the C37 amendment to Surf Coast Shire’s planning scheme. She was selective in that she ignored events such

as the overwhelming public rejection of the 2008 Spring Creek study findings. History knows this was the event that led council to defer a decision on Torquay’s western boundary until important, basic matters were decided about how much growth and in what form. Council’s resolution did not “override decades of planning history”, as Cr Coker asserted, it responded to that history. Planning documents only saw potential in the Spring Creek Valley - potential that was not decided, let alone agreed with by a never-consulted community. In changing C37, Planning Minister Justin Madden ignored that hard-won, community-responsive council resolution and adopted a contrary position more aligned with developers’ needs. We want him to change that position and will support council in all endeavours to do so. Bellbrae Residents Association supports the 2040 process to ensure unrestrained growth does not bugger Torquay, Jan Juc and particularly Bellbrae. John Olsen Bellbrae Residents Association

Towering landmark WHAT a great promotional exercise it would be for City of Greater Geelong to have the iconic water tower at Newtown National Trust property The Heights located on the UCI World Championships circuit as a landmark to look for while watching riders on the steep climb from the Barwon River crossing. The media coverage around the world would surely highlight yet another attraction for national and international visitors. Let’s support and encourage this event for our city. Pricilla Wright Newtown

Spinning lights A STORY in the July 23 Independent, headlined ‘Traffic lights on way’ was misleading on behalf of State Government. At this stage the Government has offered no funding for these projects. This is just spin from State Government, who no on can believe. John Walsh Torquay

– MORE LETTERS PAGE 20

HAVE YOUR SAY Mail: email: FAX:

PO Box 407, Geelong, 3220 editorial@geelongindependent.com.au 5221 3823

487942-RMB31-10

LARKO’S

New & Used

LE A S a s ’ y a d y r Eve at Larkos

Present this coupon for 20% OFF Floorstock Pics for Pi for ill illustrative ustr str t ati ative ativ ti e purpos pu purposes rpose rpos es only es o

TRADING HOURS Monday - Friday 9.30am - 5.30pm, Saturday 9am - 4.30pm, Sunday 10am 0 -4 4pm

Ph: 5277 9949 www.larkos.com.au 1 SHARON CRT, NORTH GEELONG

417262-RMB31-10

482281-MD31-10

letters Debt of gratitude

The Independent, Friday August 6, 2010

19


C I L B PU CE I T O N

letters Carbon pay day

Furniture

AUCTION

SUNDAY August 15th 12 noon Leather Lounge Suites Fabric Lounges, Sofa Beds Leather Dining Settings Timber Dining Settings Mattress - Single, King Single, Double & Queen Single Bedroom Suites Queen Bedroom Suites Double Beds Chest of Drawers, Tallboys TV Units, Oudoor Settings Umbrellas, Wall Units Coffee Tables, Lamps Mirrors

Join club campaign I FIRST came to Barwon Rowing Club in 1984 while still a student at Bell Park High School. I travelled all over the country competing and making many friends who I have competed with and against. Even though most of us have finished competing we still keep in contact, so when travelling I always have somewhere to stay or someone to catch up with. I owe these friendships to Barwon Rowing Club and am pleased to say I am still actively involved with the club. I am proud of the way the diverse membership has rallied together after City of Greater Geelong served the club with building notices. The club is being rebuilt to a stage where we will be able to operate out of a skeleton shed. The club has received some support from State Government through MP Michael Crutchfield and also from the City but the club itself has raised the majority of the funds to partially complete this redevelopment. I urge the community to get behind Barwon Rowing Club so it can continue for another 140 years and to support the club in its quest to develop its facilities so they can continue providing services through disabled, learn-to-row, masters and school programs. Sean Drew Barwon Rowing Club president

Greens stand alone

All goods must be sold as business is relocating Al 20% deposit on day of auction Balance by Monday, 16th August, 2010 S Stock must be picked up by 18th August,2010

487740-KS31-10

The Independent, Friday August 6, 2010.

es Hw Princ

324 Melbourne Road, North Geelong DAYS Dunn St Enquiries Ph: 5272 1331 Next to Super Cheap Auto

y

Victor St Separation St

LORENZO DESIGNS OP7EN

20

JASON West and Alan Barron mentioned the costs of curbing carbon pollution (Letters, July 30). It is true there will be costs that, incidentally, Australians are prepared to pay. However, we have already been paying huge, hidden costs for decades due to our dependence on fossil fuels. We pay dearly for tax subsidies to produce coalfired power. We pay every time there is a moresevere drought, flood, fire or heatwave that has been made more intense by climate change. We are talking big dollars, not the paltry costs that in comparison it will take to turn the situation around. Only this week the US National Oceanic and Atmospheric Administration found that the last decade was the world’s warmest since modern temperature records began and that last year was the warmest year on average. The sceptical rump, who for their numbers get far too much media time, along with Tony Abbot, his backward-looking Liberals and the pathetic Labor time-waster of a people’s convention on climate change consensus are going to delay moving to a low-carbon economy yet another 10 years. Sorry, guys, but large sections of industry, other nations, the Greens and the majority of the community are racing ahead and leaving you all in the dust. Mr West and Mr Barron should get out of the way because they and their ilk are costing us billions of dollars in revenue that could be earned with a greener economy. Leigh Adamson Belmont

IT HAS been reported that the Australian Greens have negotiated a preference deal with Labor. As is the practice of all political parties, this was done to maximise the Greens’ election prospects. However, the Greens are in no way allied with the ALP. The Greens opposed Labor’s weak carbon pollution reduction scheme that paid big polluters, opposed Labor’s backdown on the mining tax and have worked with all parties to improve legislation and get better outcomes for Australia. Greens candidate for Corio Gavin Brown said: “The two major parties are both in basic agreement on weak greenhouse gas emission reduction targets, pandering to our worst tendencies by taking an inhumane stand on asylum seekers and refusing to take serious action on public transport and preventative health. “In contrast, the Greens stand on our own. Our policies are based on common sense values and are for the long-term benefit of all Australians. “It appears that the Labor and Liberal Party are an extension of each other and that’s why more and more people are voting Greens.” People see the Greens as a breath of fresh air. We have consistently worked to end the practice of backroom deals on preferences, firstly by moving to change senate voting so voters make their own choices and secondly by moving to ban how-to-vote cards entirely. Voters should remember they are free to choose their own preferences, regardless of what their party’s how-to-vote card suggests. Tory Sorensen Greens Geelong branch convenor

HAVE YOUR SAY Mail: PO Box 407, Geelong, 3220 email: editorial@geelongindependent.com.au FAX: 5221 3823 Letters must be a maximum 250 words and include the writer’s full name, address and contact phone number. Names are only withheld in exceptional circumstances.


Finally Friday Live Music

Dining

Cinema

Television

Events

Activities

Theatre

Absolutely ‘Peanuts’ BY ERIN PEARSON AMONG the most recognisable comic book characters in the world, Charlie Brown and his friends have entertained audiences on paper and television for close to 60 years. Now Geelong theatre company Parcell is transforming the iconic images of Snoopy, Sally, Lucy, Linus, Schroeder and Charlie Brown onto the stage in You’re a Good Man, Charlie Brown. Julian Hart said he was “blessed” to play the role of Charlie’s pet beagle, Snoopy, in the cast of 16 to 30-year-olds. He admitted the actors had their own little “quirks”. “We’re six adults playing a dog and seven-year-olds,” he laughed. “We’ve certainly had to challenge ourselves to play roles we’ve never had to play before. “When you play a dog you don’t have that human element, you have to bring in a whole new species.” Hart compared his onstage performance of Snoopy to other “human-like” dogs. “Snoopy as a character is quite human when you look at the comic strips,” he said. “He’s like Brian from Family Guy with some Garfield thrown in because he loves his food.” Hart said the death of his own “best mate” provided inspiration for the role. “To dress-up as a human, not in a dog costume, meant my physical per-

formance had to become a major part of the character,” he said. “My dog, Grayson, had to be put down last year and I took a lot of inspiration from him because my performance had to come from physicality, so when Snoopy’s sleepy I pull faces like Grayson used to do. “I used the memories of my little man to prompt my actions on stage.” Hart said the other performers were also “fully committed” to the show. “Jared Smith plays Linus and he was told to get attached to his blanket,” he said. “But now it’s seeping into real life and he’s been taking it everywhere.” Charlie Brown comic books made their debut on October 4, 1950. The characters were transformed into their first cartoon movie in 1985 before a Broadway musical soon after. Director Scott Bradley said the Geelong performance would stick closely to the comic books themes. “We’ve basically designed the show to be like a comic book from scene to scene; a typical day in the life of Charlie Brown,” he said. “April Fools Day, Valentines Day and Charlie’s baseball team trying to win a game are all in there. “The show is something Geelong audiences and performers don’t get to do or see and our goal is to bring these different performances to the people.” You’re a Good Man, Charlie Brown will be at Geelong Performing Arts Centre from this Friday to August 14.

Dreamy: Enola Fall.

Ready for a Fall BY ERIN PEARSON TASMANIAN band Enola Fall will bring its “intense and noisy” sound to Geelong this Friday night, according to singer Joe Nuttal. The Tasmanian band’s frontman said the band’s “indie-cabaret” style was beginning to catch on with audiences. “We’ve received quite a bit of attention lately and I think it’s because we’re very different to bands that put out folksy stuff or simply just the guy singing with a guitar,” Nuttal observed. “I tend to write very introspective, dream-like songs – I’m not a storyteller with an acoustic guitar. “We tend to take a lot from flamboyant performers such as Tom Waits and Arcade Fire.” Nuttal said Enola Fall’s members met by chance in Hobart music stores. “In instruments and in ideas, we bring our own influences to our music. You’ve got to have conflict or there’s nothing.” The band’s debut album, We Never Sleep, won Enola Fall a Triple J radio Next Crop recognition, followed by appearances at festivals and supporting bands including The Panics, Eskimo Joe and Something for Kate. Nuttal was looking forward to the Geelong gig. “It was really good last time we performed here in January (2009) because Geelong seems to be a little less trendy, so they listen a lot more rather than judge.” Enola Fall will play at Bended Elbow.

Comic capers: The cast of You’re a Good Man, Charlie Brown in character.

l e t o H y aayhotel.com.au Gatheegw atew CAL LIVE AT YOURCALO L.COM.AU WWW.LIVEATYOURLO

420785-JF31-10

www.t

Accommodation • Function Room • Kids Indoor Playroom contact us at

Gateway Hotel 218-230 Princes Hwy, Corio. Ph: 5275 1091

Geelong’s newest Entertainment Venue! The Independent, Friday August 6, 2010

21


nicole penning

Everything you need to organise & celebrate your Wedding Day is right here!

civil celebrant weddings & naming days

“may the love in your life create a life to love” 0417 924 148 nicolepenning@gmail.com www.nicolepenning.com.au

*25% OFF Selected Bridal Gowns - Floor Stock Only

BRIDAL HOUSE GEELONG That’s Amore -

The largest range of bridal & formal wear All in one beautiful building

Timeless, Classic, Elegant & Sophisticated Wedding Gowns Large Range of Dresses for Bridesmades, Mother of the Bride & Groom Stunning Special Occasion, Cocktail & Debutante Gowns Ferrari Mens Suits – For Hire & Sale

Bridal Wear

Mens Formal Wear

Kelbergs Classic Buicks

Special Occasion Wear

140 Little Malop Street, Geelong Ph: 5222 6272 info@bridalhousegeelong.com Opening Hrs: Mon - Sat

1946-48 chauffer driven Buicks

*10% OFF Visit our website for further details

www.kelbergsclassicbuicks.com.au

All of the businesses listed in this comprehensive Lift-Out Guide have been specifically selected for your convenience and are among the best in their industry. Together we aim to make your wedding day truly memorable. Book your event NOW & SAVE, whilst supporting local businesses. *All offers are valid until 30th September 2010. Mention or present this lift-out to receive special offers. See individual businesses for conditions. Not to be used in conjunction with any other offer.

Wedding Belles

Make your dream honeymoon a reality

Everything a Bride will need... The largest range of: Invitations & Bomboniere (DIY or we can do it for you) Children’s Formal Wear Wedding Accessories, Gifts & Keepsakes Personalised Candles All in one convenient location Wedding - Christening - Communion - Confirmation

Perfect for Weddings, Corporate Events & Special Occasions

We can design a marque that’s perfect for you.

Set up your bridal registry for free with us. Ask in store for details. 116 Moorabool St. Geelong Phone: 5215 3500

package booking of $2000 or more *conditions apply

The Finishing Touch

*Buy Now or Layby Everything You Need & get 10% OFF the total.

Showroom: 111-113 Little Malop St. Market Square Mall, Geelong Ph: 5229 8008 info@weddingbelles.com.au

CANDLES • TABLE CLOTHS NAPKINS • WEDDING CAR RIBBONS

Phone 5229 7275

www.weddingbelles.com.au NEWMINSTER FUNCTION DESIGN

*10% OFF

To a r r a n g e a n a p p o i n t m e n t p l e a s e c a l l

Lorraine (03) 9395 1768

*10% OFF

lorraine@newminster functiondesign.com 6 N e w m i n s t e r W a y, Po i n t C o o k 3 0 3 0

270 Shannon Ave. Geelong West

*Chair Covers $4.50 each - Free Delivery

acrylic nails ‡ gel nails ‡ manicures ‡ pedicures ‡ nail art

SAMPLE SATURDAY

The Last Saturday of Every Month Come in for F R E E Cake Samples & Cake Quotes

03 5272 2554 119 Separation St. North Geelong Open Mon - Sat 10.00am - 6.00pm

*30% OFF

*10% OFF

Wedding & Celebration Cakes Modern & Traditional Designs

Specialists in Wedding Dress Cleaning & Preservation. All Gowns intricately hand cleaned and lovingly preserved. www.weddingdresscleaning.com.au

M: 0409 177 980

T: 5277 2309

Display Home Open Saturday & Sunday 1-5pm Crn Church St & Vines Road Hamlyn Heights

*$25 OFF

*10% OFF

Inside Desire Hair Salon Shop 15 Bell Post Shopping Centre, Anakie Rd

Office: 104B Shannon Avenue, Geelong West www.vinmarhomes.com.au

Phone: 5229 7655

Email: info@vinmarhomes.com.au

486587-MD31-10

83 BARWON TERRACE, STH GEELONG P: 5221 2022 WWW.OCCASIONSPARTYHIRE.COM.AU

by

Another Belle Advertising Shared Marketing Initiative: email: belleadvertising@gmail.com

22

The Independent, Friday August 6, 2010.

The Independent, Friday August 6, 2010

47


Finally Friday DINING OUT

Home-style cooking at Dog Rocks Hotel

gust Friday 6th Au t h Family N30igpm

6.30pm-11. , $18 Members 0 Kids. $1 , rs be em $21 Non M rse Meal. Includes 3 Cou ize Duo ru Band: City C

ugust Saturday 7th A ual n Club 515’s An Ball hite Black & W -11.00pm

T

8.00pm en cludes Chick $12 Entry. In gne Supper & Champa

ntial

Bookings esse

515 Bellarine Hwy, Moolap Ph: 5250 2349 Mob: 0425 794 706 www.clubitalia.com clubitalia@bigpond.com EVERY SUNDAY: Meal, Live Band & Dancing from 6pm *This is a notice to all members & guests of club italia

Dog Rocks staff serve up great-priced traditional a la carte country fare. The hotel’s Pudding Club this month will offer a new chance to sample their talents. A second dining room or a prior an innovative cocktail. All they have to do is just ask for Corey the vate dining area for up to 60 guests is another recent addition. barman. Guests can make bookings or The hotel is an ideal venue for all guests. A large function room enquiries by phoning Dog Rocks on 5276 1201 has undergone a luxurious refur- Hotel bishment to offer a timeless venue or emailing mail@dogrockfor weddings or special occasions. shotel.com.

INGREDIENTS

method

OPEN 7 DAYS

1 Preheat oven to 180 degrees C. Lightly grease a pie or quiche dish and line with one sheet of pastry. 2 Spread onion and bacon over pastry, cover with peas, cheese and tomato slices. Crack whole eggs over, keeping yolk intact. Lay remaining sheet of pastry over the top, trim edges. 3 Cook in pre-heated oven for 40 - 45 mins or until golden.

23

5248 8777 54 Fellmongers Rd, Breakwater

90

31

74

By HP of Leopold

62

59

WIN A $20 North Geelong: 135 Separation St • Ph: 5277 2662 Geelong: 112 Mt Pleasant Rd, Belmont • Ph: 5244 0300

12

For your chance to win a yummy cake to the value of $20 from The Cheesecake Shop send your recipe to: The Geelong Independent (marked “Recipe”) P.O. Box 407 Geelong 3220 or email: advertising@geelongindependent.com.au (Subject: Recipe)

18

23

WITH LAURIE ATLAS

SAT - GIRL FRIDAY “LIVE” Neat dress required, Doors open from 9:00pm

RU OPEN • PHAROAHS BISTRO H T • FUNCTION ROOM VE NOW I R • TAB / SPORTS BAR D EE F • TEXAS HOLD EM POKER DELLTONES THUR 12TH AUG COF Sunday to Thursday from 7pm

Not valid with specials or any other offers.

VALID UNTIL: 13/8/10

CLUB CATS, SKILLED STADIUM Entry Via Kilgour Street 417231-KC31-10

9

90 5 55

FRI - KARAOKE

Conditions Please present this coupon to redeem offer Evenings only from 6.00pm - 8.30pm

PH: 5225 2355

ELECTRON Paper or electronic. have a choice,

cazbarr

74

81

2 E1W N331 NEW N8E8W IC BINGO

You now 12

4 47

71

38

Purchase one main meal from our menu and receive a second meal of equal or lesser value for half price.

Sell your car from

$34 Wheel &Deal *

*conditions apply

SEE MOTOR PAGES

HANNAH MONTANA TRIBUTE THUR 30TH SEPT Show Only $16 During school holidays

DENIS WALTER SUN 10TH OCT Show Only $16.50 Meal & Show $41.50

Show Only $38 – Meal & Show $65

BABBA FRI 1ST OCT Show Only $28 Meal & Show $53

2 Thompson Rd, North Geelong / Ph: 5278 2911 www.sphinxhotel.com.au / info@sphinxhotel.com.au

ELVIS LEAVES HIS MARK SAT 13TH NOV COL ELLIOT SAT 27TH NOV ANGIE HILTON AS KYLIE SAT 4TH DEC PINK TRIBUTE SHOW SAT 11TH DEC The Independent, Friday August 6, 2010

420783-JF31-10

ingredients

18

BACON & EGG PIE

READER’S RECIPE > 2 sheets puff pastry > 1 onion, diced > 4 rashers bacon, trimmed and diced > ½ cup peas, fresh or frozen > ¾ cup (100g) grated tasty or cheddar cheese > 1 tomato, sliced > 6 - 8 eggs

BUY ONE MEAL GET ONE FOR HALF PRICE

417232-KC31-10

This week’s winner

Cheesecake Shop voucher

420778-KC30-10

club ITALIA

Pub hosts new event he saying the kitchen is the heart of the home rings true for patrons of Dog Rocks Hotel when immersed in the venue’s atmosphere of homely nostalgia. The hotel’s kitchen has at its core sometimes-forgotten principles, such as preparing all food fresh on the premises using quality ingredients to create dishes that are all about flavour. Head chef Sam Clifton is excited about the hotel’s upcoming Pudding Club on August 22. “This event is unique,” Sam explains. “The day begins with the chef’s hand-made canapés followed by a light meal and then a huge buffet of puddings. “The inspiration for many of the home-made treats is old-fashioned favourites, all cut in small portions so guests have the opportunity to try everything.” Dog Rocks Hotel is also rightly proud of its friendly service and welcoming bar where the beer is always cold and crisp. The passion and approach of the bar staff is inspiring, whether guests are looking for a cold one with their mates after a hard day

advertising feature

23


Finally Friday TELEVISION GUIDE

Saturday August 28th

Meal Deal available 2 Course $10 Must be 18 years of age & over. Bookings Essential

Nine

Live

Acoustic

Every Friday

Ten

7.30pm till late

SBS

487312-MD31-10

price blitz on all floor stock! OVERstocked - must sell! 7 Pce Leather Dining. Choice of colours in chairs - Black, Choc & Cream

7 Pce Mustang Dining - Chocolate

WAS $1,199

NOW $499

WAS $799

NOW $699

Micro Suede Recliners Chocolate & Stone

WAS $499

NOW $279

Leather Corner Suite S/S Chocolate & Black

3 Piece Full Motion Suite Full Leather With Recliners On 3 Seater

WAS $2,999

WAS $3,299

NOW $1,499

NOW $1,999

Paler Solid Pine 2m Lowline

NOW $199

NOW $369

service, servic ser vice, vic e, qua qualit quality lityy & in lit integ integrity tegrit teg rityy rit

p parker afufurn rurnrnit kitur eure r ffurniture rnit itur ure

327 27 7 Sh Shannon Ave A Ave, Newtown N (Nextt tto St JJosephs (N h CCollege) ll g ) P:

24

5222 4583 M: 0431 702 252

The Independent, Friday August 6, 2010.

4:30 Shortland Street (PG) [s] 5:00 Something In The Air [s] 5:30 The New Inventors [s] 6:00 Childrenʼs Programs 11:00 How The Earth Was Made [s] 12:00 Midday Report [s] 12:30 Agatha Christieʼs Partners In Crime 1:30 Collectors [s] 2:00 Waterloo Road (M v) [s] 3:00 Childrenʼs Programs 6:00 Announcement: The Coalition [s] 6:05 Grand Designs Revisited: Yorkshire 7:00 ABC News [s] 7:30 The 7.30 Report [s] 8:00 Catalyst [s] 8:27 Announcement: Australian Labor Party 8:30 Dick Smithʼs Population Puzzle [s] 9:40 The Population Debate With Tony Jones [s] – Tony Jones will moderate a debate on Australiaʼs population question. 10:30 Lateline [s] 11:05 Lateline Business [s] 11:35 Latin Music USA [s] 12:30 Movie: “If I Had A Million” (PG) (ʼ32) Stars: George Raft & Gary Cooper 2:00 Movie: “Joy Of Living” (G) (ʼ38) Stars: Irene Dunne & Douglas Fairbanks Jr 3:30 Green Warrior [s] 5:30 Seven Early News 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 The Midday Movie: “The Brush Off” (M v,s,l) (ʼ03) Stars: David Wenham 2:00 All Saints (M) [s] 3:00 Find My Family (PG) [s] 3:30 All For Kids [s] 4:00 Itʼs Academic [s] 4:30 Seven News at 4:30 [s] 5:00 M*A*S*H 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home And Away (PG) [s] 7:30 How I Met Your Mother (PG) [s] 8:30 Special: The Rise And Fall Of Concorde (PG) – Witness the rise and fall of Concorde through the people who knew the aircraft best. 10:00 Ghost Whisperer: On Thin Ice (PG) – When comic book artist Damon Weaver begins drawing his own run-ins with ghosts before they happen, it is up to Melinda and Avery to discover the secrets behind his art. 11:00 True Beauty - Face Of Vegas: The Final Test (PG) 12:00 The Matty Johns Show (PG) [s] 1:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* [s] 9:00 Kerri-Anne *Live* (PG) [s] 11:00 National Morning News 12:00 The Ellen Degeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) [s] 3:00 Entertainment Tonight [s] 3:30 Hi-5 [s] 4:00 Pyramid [s] 4:30 Afternoon News [s] 5:00 Antiques Roadshow 5:30 Hot Seat [s] 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 Two And A Half Men (PG s) [s] 7:30 Getaway: Getawayʼs Guide To The Greek Islands - Part 1 (PG) [s] 8:30 The Mentalist: Red Scare (M) [s] – Patrick and the team are called in to investigate the death of a prominent architect found murdered in a crumbling old mansion. 9:30 The AFL Footy Show (M) [s] 11:15 The NRL Footy Show Late (M) 1:00 Entertainment Tonight [s] 1:30 Skippy The Bush Kangaroo 2:00 Guthy Renker Australia 3:00 Danoz 3:30 Good Morning America [s] 5:00 Early Morning News 6:00 TEN Early News [s] 7:00 Toasted TV [s] 8:00 Scope [s] 8:30 Puzzle Play [s] 9:00 TEN News [s] 10:00 The Circle (PG) [s] 12:00 Dr Phil: Extreme Teen Dangers (PG) [s] 1:00 The Oprah Winfrey Show: Julia Roberts & The Men Of “Eat, Pray, Love” (PG) [s] 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Infomercial (PG) 4:00 Hueyʼs Cooking Adventures [s] 4:30 The Bold And The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Simpsons [s] 6:30 Neighbours [s] 7:00 The 7pm Project (PG) [s] 7:30 Bondi Vet (PG) 8:00 Recruits (PG) [s] 8:30 Rush (M v,s) [s] 9:30 Burn Notice: Friends And Enemies (M v,a) 10:30 TEN Late News / Sports Tonight [s] 11:15 The Late Show (PG) 12:00 Swingtown (M s) 1:00 What It Takes: Drew Barrymore 1:30 Infomercials (PG) 5:05 Worldwatch 1:00 Food Loversʼ Guide to Australia 1:30 Return Of The Bible Plagues: Sandstorms 2:30 Dateline [s] 3:30 Letters and Numbers 4:00 The Journal [s] 4:30 PBS Newshour 5:30 Global Village: Makishi Masquerade 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:35 A Taste of Iran [s] – This is a rare opportunity to meet ordinary Iranians. 8:30 Supersizers Go... Edwardian (PG) [s] – Restaurant Critic Giles Coren and writer and performer Sue Perkins attempt to eat for a week in the style of the eraʼs moneyed classes. 9:30 World News Australia [s] 10:00 Mystery Movie: “Counter Investigation” (M a,l) (ʼ07) – When detective Richard Malinowskis daughter is raped and murdered, his colleagues are in a hurry to make an arrest. A suspect is quickly brought to trial and sentenced to life imprisonment. From his cell, however, he pleads his innocence. (In French) 11:30 Action Adventure Movie: “A Bittersweet Life” (MA15+v) (ʼ05) (In Korean) 1:40 Weatherwatch & Music

Ear to Inner

Win one of 10 FAMILY PASSES to the new EARTH QUEST exhibition at the National Wool Museum, 26 Moorabool St Geelong - on show from 6th Aug - 3rd Oct 2010. Come on an incredible journey from outer sspace to inner earth, without leaving Geelong!

Fast approval - payday loans 1 week to 12 months. *Conditions Apply.

HE SPOT!

UES ON T WE CASH TAX CHEQ 487743-JF31-10

andrews a ndre ew ws

4:30 Shortland Street (PG) [s] 5:00 Something In The Air [s] 5:30 The New Inventors [s] 6:00 Childrenʼs Programs 11:00 Big Ideas [s] 12:00 Midday Report [s] 12:30 National Press Club Address 1:30 Talking Heads [s] 2:00 Waterloo Road [s] 3:00 Childrenʼs Programs 6:00 Cheese Slices: Portugal [s] 6:30 Pohʼs Kitchen [s] 7:00 ABC News [s] 7:30 The 7.30 Report 8:00 The New Inventors [s] 8:30 Spicks & Specks (PG) 9:00 The Gruen Transfer (M l) [s] 9:30 United States Of Tara: Explosive Diorama (M l,a) [s] 10:00 At The Movies [s] 10:30 Lateline [s] 11:05 Lateline Business [s] 11:30 Jekyll (M v,l) [s] Stars: James Nesbitt 12:25 Chandon Pictures: Run Bitch Run (M) 12:50 Movie: “Mexican Spitfire Sees A Ghost” (G) (ʼ42) Stars: Lupe Velez & Leon Errol 2:00 Big Ideas [s] 3:00 National Press Club Address [s] 4:00 Catalyst [s] 5:30 Seven Early News 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 Midday Movie: “Stiff” (M l,v,d) (ʼ03) Stars: David Wenham. 2:00 All Saints (M) [s] 3:00 Find My Family (PG) [s] 3:30 All For Kids [s] 4:00 Itʼs Academic [s] 4:30 Seven News at 4:30 [s] 5:00 M*A*S*H 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home And Away (PG) [s] 7:30 Worldʼs Strictest Parents Australia: Texas (PG l,a) [s] 8:30 City Homicide: Last Seen (M v) [s] – Itʼs New Yearʼs Eve when a young woman vanishes after partying with her friends. 9:30 Lewis: Allegory Of Love (M) – In this new murder mystery, Lewis investigates the vicious murder of a young barmaid. 10:30 Air Crash Investigations: Fatal Flaw (PG) 11:40 Most Shocking: Citizens Under Attack (M) – The worldʼs most shocking footage. 12:35 Sons & Daughters [s] 1:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* [s] 9:00 Kerri-Anne *Live* (PG) [s] 11:00 National Morning News 12:00 The Ellen Degeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) [s] 3:00 Entertainment Tonight [s] 3:30 Magical Tales [s] 4:00 Pyramid [s] 4:30 Afternoon News [s] 5:00 Antiques Roadshow 5:30 Hot Seat [s] 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 Two And A Half Men (PG s) [s] 8:00 Hot Property (PG) [s] 8:30 The Farmer Wants A Wife (PG) 9:30 RPA (PG mp) – 23 year old Sharon has been totally blind since she was five, the result of a number of health problems that caused the loss of one kidney. 10:30 Embarrassing Bodies: Cambridge / Oral (M mp, n) 11:30 Til Death: Speed Bump (PG) [s] 12:00 Eclipse Music TV (PG) 12:30 20/20 [s] 1:30 Danoz 2:00 Guthy Renker Australia 2:30 Danoz 3:30 Good Morning America [s] 6:00 TEN Early News [s] 7:00 Toasted TV 8:00 Totally Wild [s] 8:30 Puzzle Play [s] 9:00 TEN News [s] 10:00 The Circle (PG) [s] 12:00 Dr Phil: Dp Family Returns: Erin Reveal (PG) [s] 1:00 The Oprah Winfrey Show: Women Who Claim They Were Child Brides In The USA (PG) 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Infomercial (PG) 4:00 Hueyʼs Cooking Adventures [s] 4:30 The Bold And The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Simpsons [s] 6:30 Neighbours [s] 7:00 The 7pm Project (PG) [s] 7:30 The All New Simpsons Hour: Stealing First Base / The Greatest Story Ever Dʼohed (PG) [s] 8:30 Lie To Me: Headlock (M) [s] 9:30 Law & Order: Criminal Intent: The Mobster Will See You Now (M) 10:30 TEN Late News / Sports Tonight [s] 11:00 Netball Test Series: 2nd Test -Australia v Jamaica 1:00 The Late Show (PG) 2:00 Infomercials (PG) 5:05 Worldwatch 1:00 Drama Movie: “The Circle” (PG) (ʼ00) (In Farsi) 2:35 Short: Horn Ok Please (PG) / 3 Towers 3:00 Nest: Vera [s] 3:30 Letters and Numbers [s] 4:00 The Journal [s] 4:30 PBS Newshour [s] 5:30 Global Village: Football Fever [s] 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:35 Inspector Rex: A City in Fear (PG) – Two people die from drinking a soft drink laced with cyanide. Will Rex be able to stop any further seemingly unconnected deaths? 8:30 Anna Pihl (M l,s,v) [s] – Anna Pihl is a rookie police officer assigned to one of Copenhagens busiest, most densely populated constabularies. 9:30 World News Australia [s] 10:00 Drama Movie: “Or” (MA15+s,a,n) (ʼ04) – A teenager, doing odd jobs, does her best to keep her prostitute mother off the streets. (From Israel, In Hebrew) 11:45 Comedy Movie: “Tickets” (MA15+l) (ʼ05) (In Italian) 1:40 Weatherwatch Overnight

WIN!

Cash Loans & Cheques Cashed

WAS $699

Tuesday 10 Wednesday 11 Thursday 12 4:30 Shortland Street (PG) [s] 5:00 Something In The Air [s] 5:30 The New Inventors [s] 6:00 Childrenʼs Programs 11:00 Big Ideas [s] 12:00 Midday Report [s] 12:30 Terrors Of Tasmania [s] 1:30 The Einstein Factor [s] 2:00 Waterloo Road (PG) [s] 3:00 Childrenʼs Programs 6:00 Three Men Go To Ireland [s] 7:00 ABC News [s] 7:30 The 7.30 Report [s] 8:00 Foreign Correspondent [s] 8:30 Nicholas Craneʼs Britannia (PG) [s] – In the last leg of his epic 5,000 mile journey Nicholas Crane traverses Ireland. 9:30 Announcement: Australian Labor Party 9:35 QI (PG) [s] 10:05 Jennifer Byrne Presents: Graphic Novels 10:35 Lateline [s] 11:10 Lateline Business [s] 11:40 Four Corners [s] 12:25 Media Watch [s] 12:40 Chaserʼs War On Everything (M l,s) 1:10 Movie: “Irene” (G) (ʼ40) Stars: Anna Neagle 2:50 Big Ideas [s] 4:00 Good Game (M v) [s] 5:30 Seven Early News 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 Midday Movie: “Nora Robertsʼ Angels Fall” (M v,s) (ʼ07) Stars: Heather Locklear 2:00 All Saints (M) [s] 3:00 Find My Family (PG) [s] 3:30 All For Kids [s] 4:00 Itʼs Academic [s] 4:30 Seven News at 4:30 5:00 M*A*S*H 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home And Away (PG) [s] 7:30 Minute To Win It (PG) [s] 8:30 Packed To The Rafters: Rites Of Passage (PG a) [s] – Nathan is forced to question his motives for wanting to donate a kidney. 9:30 Parenthood: Pilot (M) – This is the story of the Bravermans - Sarah, Adam, Crosby, and Julia - four grown siblings sharing the headaches and joys of being a parent. 10:30 Keeping Up With The Kardashians: Iʼm watching You (M) – Take a peek inside the life of sexy socialite Kim Kardashian and her larger than life family. 11:30 Alan Sugar: The Apprentice (M l) 1:00 Home Shopping 4:00 NBC Today 5:30 Today *Live* [s] 9:00 Kerri-Anne *Live* (PG) [s] 11:00 National Morning News 12:00 The Ellen Degeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) [s] 3:00 ET [s] 3:30 Magical Tales [s] 4:00 Pyramid [s] 4:30 Afternoon News [s] 5:00 Antiques Roadshow 5:30 Hot Seat [s] 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 Two And A Half Men (PG s) [s] 7:30 Top Gear (PG) [s] – The team test the Aston Martin Rapide, the Porsche Panamera Turbo & the Maserati Quattroporte. 9:00 20 To 1: Sexiest On The Planet (PG) – Hosted by Bert Newton, counting down the hottest men and women on earth. 10:00 Commercial Breakdown Adults Only (M s) 10:45 How To Have Sex After Marriage: Megan & Richard Marshal (MA15+a,s) 11:40 Til Death: Snip Duck (PG) 12:05 Balls Of Steel (M a,l) ) 12:45 Entertainment Tonight [s] 1:30 Danoz 2:00 Guthy Renker Australia 3:00 Danoz 3:30 Good Morning America [s] 6:00 TEN Early News [s] 7:00 Toasted TV 8:00 Totally Wild [s] 8:30 Puzzle Play [s] 9:00 TEN News [s] 10:00 The Circle (PG) 12:00 Dr Phil: Bullied To Death (M a) [s] 1:00 The Oprah Winfrey Show: On Location: Oprah & Simon Cowell: The Farewell Interview (PG) [s] 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Infomercial (PG) 4:00 Hueyʼs Cooking Adventures [s] 4:30 The Bold And The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Simpsons [s] 6:30 Neighbours [s] 7:00 The 7pm Project (PG) [s] 7:30 Modern Family: My Funky Valentine (PG s) 8:00 Rules Of Engagement: 3rd Wheel (PG s) 8:30 NCIS: Requiem (M) [s] 9:30 NCIS: Designated Target (M) [s] 10:30 TEN Late News / Sports Tonight [s] 11:15 The Late Show (PG) 12:00 Law & Order: By Perjury (M) [s] 1:00 What It Takes: Adam Sandler 1:30 Infomercials (PG) 4:00 Religious Programs (PG) 5:05 Worldwatch 1:00 Comedy Movie: “The Man On The Train” (M v,s,l) (ʼ02) (In French) 2:35 Shorts (M v) 3:00 Help (PG) [s] 3:30 Letters and Numbers [s] 4:00 The Journal [s] 4:30 PBS Newshour [s] 5:30 Global Village: In The Shade Of Ganesh [s] 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:30 Insight [s] – Presented by Jenny Brockie. 8:30 One Born Every Minute (PG) [s] – In this episode, Lisaʼs baby Jack has been born with his bowel outside his body. 9:30 World News Australia [s] 10:00 Hot Docs: Being Married (PG) [s] – In 2001, Michael Apted filmed the first installment, Married in America, which featured 9 couples on the eve of their marriages. Five years later, he revisited them and talked openly about their situation. 11:15 Drama Movie: “Yella” (M a,l) (ʼ07) – Follows a woman who leaves her hometown and her husband for a promising job and a new life. (In German) 12:50 Welcome 2 My Deaf World (M s) 1:55 Weatherwatch Overnight

e Outer Spac th

real people fast cash!

4 Drawer Coffee Table

WAS $399

Monday 9 4:30 Shortland Street (PG) [s] 5:00 Something In The Air [s] 5:30 The New Inventors [s] 6:00 Childrenʼs Programs 11:00 Landline [s] 12:00 Midday Report [s] 12:30 Casebook Of Sherlock Holmes (PG) 1:30 The Cook And The Chef [s] 2:00 Waterloo Road (PG) [s] 3:00 Childrenʼs Programs 6:00 Travel Oz [s] 6:30 Talking Heads: John & Ros Moriarty [s] 7:00 ABC News [s] 7:30 The 7.30 Report [s] 8:00 Australian Story [s] 8:30 Four Corners [s] 9:20 Media Watch [s] 9:35 Q&A *Live 10:35 Lateline [s] 11:10 Lateline Business [s] 11:35 The War: A Deadly Calling (PG) [s] 12:30 The Clinic (M l) – Susieʼs life changes with the unexpected arrival of her teenage daughter. 1:20 Movie: “Night Of The Living Dead” (M h,v) (ʼ68) Stars: Judith OʼDea 3:00 Bowls: World Cup 2010: Menʼs Final 4:00 The Cook And The Chef [s] 5:30 Seven Early News [s] 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 Midday Movie: “Something New” (PG s,l) (ʼ06) Stars: Simon Baker 2:00 All Saints (M a,v,d) [s] 3:00 Find My Family (PG) [s] 3:30 All For Kids [s] 4:00 Itʼs Academic [s] 4:30 Seven News at 4:30 [s] 5:00 M* A*S*H 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home And Away (PG) [s] 7:30 RSCPA Animal Rescue 8:00 Under The Hammer (PG) 8:30 Criminal Minds: The Fight / Bloodline (M v,a) – The BAU travels to San Francisco to investigate the murders of several homeless men. 9:30 Criminal Minds: Bloodline (M) [s] 10:30 How I Met Your Mother: Okay Awesome (PG) [s] 11:00 My Name Is Earl: Randyʼs Touchdown (PG) 11:30 Trauma: Frequent Fliers (M) 12:30 Trade Wars (PG) 1:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* [s] 9:00 Kerri-Anne *Live* (PG) [s] 11:00 National Morning News 12:00 The Ellen Degeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) [s] 3:00 Entertainment Tonight [s] 3:30 Magical Tales [s] 4:00 Pyramid [s] 4:30 Afternoon News [s] 5:00 Antiques Roadshow 5:30 Hot Seat [s] 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 Two And A Half Men (PG s) [s] 8:00 Hot In Cleveland: Birthdates (PG) [s] – The ladies set each other up on blind dates and itʼs love at first sight for Elka and Max. 8:30 Rescue Special Ops: Find My Baby (M) [s] 9:30 CSI: Miami: Spring Breakdown / A Grizzly Murder (M) [s] 11:30 McLeodʼs Daughters (PG) [s] 1:00 Spyforce: The Saviour - Part 1 (PG) 2:00 Guthy Renker Australia 3:00 Danoz 3:30 Good Morning America [s] 5:00 Early Morning News 6:00 TEN Early News [s] 7:00 Toasted TV 8:00 Totally Wild [s] 8:30 Puzzle Play [s] 9:00 TEN News [s] 10:00 The Circle (PG) [s] 12:00 Dr Phil: Love Triangle Tension (PG s,a) [s] 1:00 The Oprah Winfrey Show (PG) [s] 2:00 Ready Steady Cook (PG) [s] 3:00 Judge Judy (PG) [s] 3:30 Infomercial (PG) 4:00 Hueyʼs Cooking Adventures [s] 4:30 The Bold And The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Simpsons [s] 6:30 Neighbours [s] 7:00 The 7pm Project (PG) [s] 7:30 Undercover Boss: Churchill Downs (PG) 8:30 Good News Week (M s,l) [s] –Guests include: Kitty Flanagan, Josh Thomas, Taika Waititi, Megan Washington. 10:00 Cops: Family Ties #2 Special Edition 10:30 TEN Late News / Sports Tonight [s] 11:15 The Late Show (PG) 12:00 Burn Notice: Hard Bargain (M) 1:00 What It Takes: Jim Carrey 1:30 Infomercials (PG) 5:05 Worldwatch 1:00 Food Loversʼ Guide to Australia [s] 1:30 Dateline [s] 2:30 Insight [s] 3:30 Letters and Numbers [s] 4:00 The Journal [s] 4:30 FIFA Futbol Mundial 5:00 The Crew 5:30 Global Village: Las Mdulas 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:30 Mythbusters (PG) [s] – In response to fan criticism, Kari, Grant and Tory retest Knock Your Socks Off, while Jamie and Adam take on Compact again. 8:30 Man v Wild: Belize (PG) [s] – Bear Grylls is dropped out of a helicopter at the top of a 200metre waterfall in Belize. 9:30 World News Australia [s] 10:00 Skins: Skins: Cook (MA15+l,a) [s] – After beating someone up at a party in front of a room full of witnesses, Cook is told by his lawyer that he has no choice but to plead guilty. 10:55 Entourage: Manic Monday (M l,s) 11:30 The World Game – Expert analysis on all facets of the game. 12:30 Drama Movie: “The Bodyguard” (M l,v,s) (ʼ06) (In Spanish & French) 2:20 Weatherwatch Overnight

Call your nearest store or visit our website www.cashstop.com.au

5221 0900 146 Moorabool Street, Geelong

Family pass valued at $20 valid for two adults and up to four children. F

Simply SMS “EARTH” and your full name to 19 19 18* S C closes midnight July 2010 Competition closes midnight 27th 10th August 2010 *Winners will be notified via SMS. Premium SMS cost is 55 cents. SMS service provided by * SL Interactive. See terms & conditions at www.starnewsgroup.com.au S

487926-KS31-10

l Journey A musica the h g throu s oll Classic 0’s Rock’N R 8 & ’s 0 7 , ’s of the 60

Sunday 8 5:00 Rage (PG) 6:30 Childrenʼs Programs 9:00 Insiders [s] 10:00 Inside Business (PG) 10:30 Offsiders [s] 11:00 Asia Pacific Focus [s] 11:30 Songs Of Praise [s] 12:00 Landline [s] 1:00 Gardening Australia [s] 1:30 Message Stick [s] 2:00 Travel Oz [s] 2:30 How Kevin Bacon Cured Cancer [s] 3:25 Caravaggio – The Staatsballet, Berlin. 5:00 First Tuesday Book Club With Jennifer Byrne [s] 5:30 Art Nation [s] 6:00 At The Movies [s] 6:30 Mother & Son: Maggie Alone [s] 7:00 ABC News [s] 7:30 Life: Mammals [s] 8:20 ABC News Up-Date [s] 8:30 Return To Cranford (PG) [s] 10:00 Compass: The Nunsʼ Story [s] 10:30 Wonders Are Many: The Making Of Doctor Atomic (M l) [s] 11:55 Movie: “Bloodline” (MA15+v,s,n) (ʼ79) Stars: Audrey Hepburn & Omar Shariff 1:55 Movie: “Touch Of Evil” (M v) (ʼ58) Stars: Charlton Heston 6:00 Childrenʼs Programs 7:00 Weekend Sunrise [s] 10:00 AFL Game Day (PG) [s] 11:00 Special: Crossing The Ditch (PG) 12:00 Sunday Afternoon Movie: “Marty” (PG a) (ʼ55) Stars: Ernest Borgnine 2:00 Footy Flashbacks: 1980: Grand Final Collingwood v Richmond 3:00 2010 AFL Premiership Season: Melbourne v Richmond: Rnd 19 *Live 6:00 Seven News [s] 6:30 Dancing With The Stars [s] – The pressureʼs on as our remaining six couples perform two dances each. 8:30 Bones: The Knight On The Grid (M) [s] – The body of an archbishop is found by some construction workers. In a bizarre twist, the archbishopʼs kneecaps were found to be surgically removed. 9:30 Castle: Vampire Weekend (M) [s] 10:30 Scrubs: My Malpractical Decision (PG) [s] 11:00 Air Crash Investigations (PG) 12:00 Heroes: Villains / Itʼs Coming (M) 2:00 Home Shopping 3:00 NBC Meet The Press [s] 4:00 NBC Today [s] 6:00 Childrenʼs Programs 7:00 Weekend Today [s] 10:00 Wide World Of Sports *Live* 11:00 The Sunday Footy Show 1:00 TAC Cup: Future Stars (PG) 2:00 F Troop: The Great F Troop Robbery 2:30 Afternoon Movie: “Promise Her Anything” (PG s) (ʼ66) Stars: Warren Beatty 4:30 Rescue Special Ops Encore: Thicker Than Water (PG v,s) 5:30 Postcards 6:00 National News Sunday [s] 6:30 RBT (PG) 7:00 Send In The Dogs (PG) [s] 7:30 60 Minutes [s] 8:30 CSI: Crime Scene Investigation: Irradiator (M v) [s] 9:30 Cold Case: One Fall (M) [s] 10:30 Cold Case: Family 8108 (M) [s] 11:30 Afterlife: Things Forgotten All New (M) 12:30 Sunday Football: Sydney Roosters v St George Illawarra Dragons – from the SCG. 2:30 Guthy Renker Australia 3:30 Danoz 4:00 Good Morning America [s] 5:00 Early Morning News 6:00 Religious Programs 7:00 Animalia 7:30 Totally Wild [s] 8:00 Running: The Sun-Herald City 2 [s] 9:30 The Benchwarmers Oz Made 10:00 Hits List TV (PG s,a,l) 12:00 Out Of The Blue (PG) 1:00 On The Ball (PG l) 2:00 ANDRA Pro Series Drag Racing: Round 1 *Live* – Top Alcohol at Willowbank Raceway, Queensland. 3:00 Netball Test Series 1st Test: Australia v Jamaica –From Melbourneʼs State Netball & Hockey Centre. 5:00 TEN News At Five [s] 5:30 Sports Tonight [s] 6:00 The Simpsons (PG) [s] 6:30 Modern Family: Moon Landing (PG) [s] 7:00 Rules Of Engagement: The Four Pillars (PG s) 7:30 Talkinʼ ʼbout Your Generation (PG) [s] 8:30 The Good Wife: Running (M v,d) [s] 9:30 Sunday Night Movie: “The Devil Wears Prada” (PG l) (ʼ06) Stars: Meryl Streep. 11:40 Late Movie: “Late Movie: “Adaptation” (MA15+ v,s,l,d) Stars: Nicolas Cage. 1:30 Infomercials (PG) 5:00 Weatherwatch & Music 7:00 Worldwatch 10:30 Football Asia 11:00 Les Murrayʼs Football Feature 12:00 FIFA Futbol Mundial 12:30 Speedweek 1:30 2010 World Superbike Championships – From Donington Park, UK. [s] 2:00 Tales From A Suitcase: Lola Harding-Irmer 2:30 Science and Islam: The Empire of Reason 3:30 Once Bitten: Conflict and Complications 4:30 Loveʼs Harvest: Cheese (PG) – A long drought takes its toll on Carla and Anne-Marieʼs cherished goat herd. 5:00 Cycling Central 6:00 Thalassa: Treasure of the Red Algae [s] 6:30 World News Australia [s] 7:30 Who Do You Think You Are? Kim Cattrall (PG) [s] 8:30 Dateline [s] – Australian photojournalist Philip Blenkinsop journeys through Asiaʼs chaotic cities and deadly jungles. 10:30 Drama Movie: “The Colonel” (M v) (ʼ06) (In French) 12:30 Drama Movie: “Hostage” (M v,a,l) (ʼ04) (In Greek & Albanian) 2:15 Weatherwatch Overnight

422284-KS31-10

Door Entry

Seven

$5

ABC

oll R n ' k c o R Night with

Saturday 7 5:00 rage (PG) 10:00 rage: Guest Programmer: Cat Empire 11:00 Pohʼs Kitchen [s] 11:30 Message Stick [s] 12:00 Stateline [s] 12:30 Australian Story [s] 1:00 VFL Football 2010: Casey Scorpions Vs Gold Coast (Live) 4:00 Pilot Guides: Trekking In The Pacific (PG) – Zoe heads off to the South Pacific to explore the idyllic Cook Islands. 5:00 Bowls: World Cup 2010: Menʼs Final 6:00 Planet Food: Israel [s] 6:30 Gardening Australia [s] 7:00 ABC News [s] 7:30 New Tricks: Spare Parts (PG) [s] – Jack Halford confronts his nemesis in court. 8:25 ABC News Up-Date [s] 8:30 The Bill (PG) [s] – An abandoned car registered to wealthy businessman Ajay Kapuris is found with traces of blood leading from the scene. 9:15 ABC News Up-Date [s] 9:20 The Prisoner: Harmony (M) [s] – Six is welcomed as a long-lost brother by 16. 10:10 Ashes To Ashes (M v,s) [s] 11:05 rage (M) 6:00 Childrenʼs Programs 7:00 Weekend Sunrise [s] 9:00 Saturday Disney 11:00 Legend Of Enyo [s] 11:30 Trapped [s] 12:00 V8 Xtra [s] 12:30 King Of The Hill (PG) 1:00 Beauty And The Geek Australia (PG) 2:15 Afternoon Movie: “D2: The Mighty Ducks” (G) (ʼ94) Stars: Emilio Estevez 4:30 Whatʼs Up Down Under [s] 5:00 Delish 5:30 Coxyʼs Big Break 6:00 Seven News [s] 8:00 Friday Movie: “Grease” (PG l,a) – Teenagers, Danny and Sandy share a perfect summer holiday romance and part ways when her family returns home to Australia. Stars: Olivia Newton-john & John Travolta 8:50 Classic James Bond Movie: “The Living Daylights” (M) (ʼ87) Stars: Timothy Dalton 11:40 The Late Movie: “Shanghai Knights” (M v,s) (ʼ03) Stars: Jackie Chan & Owen Wilson 2:05 Bledisloe Cup Rugby: Australia v New Zealand – Join Gordon Bray and Wallaby legends Tim Horan and Dan Crowley. 4:05 Home Shopping [s] 5:00 Dateline NBC (PG) 6:00 Childrenʼs Programs 7:00 Weekend Today 9:00 Saturday Kerri-Anne [s] 10:00 Childrenʼs Programs 2:00 Afternoon Classic Movie: “Diamond Head” (PG v,s) (ʼ62) Stars: Charlton Heston 4:00 Discover Downunder 4:30 Talk To The Animals 5:00 Antiques Roadshow 5:30 Home Cooked! With Julie Goodwin 6:00 National News Saturday [s] 6:30 Australiaʼs Funniest Home Videos 7:30 Family Movie: “Racing Stripes” (G) (ʼ05) – Racing Stripes is the endearing tale of a young zebra who finds himself living on a farm in Kentucky along with a colourful assortment of farmyard animals. Stars: Whoopi Goldberg. 9:40 Saturday Movie: “Michael Clayton” (M l,s) (ʼ07) Stars: George Clooney and Tilda Swinton. 12:05 Late Movie: “Bonnie And Clyde” (M v) (ʼ67) Stars: Faye Dunaway. 2:10 Movie: “Mrs Harris” (M v,l,a,s) (ʼ05) Stars: Ben Kingsley & Annette Bening 4:00 Danoz 4:30 Religious Programs 6:00 Toasted TV 9:00 Scope: Things That Climb [s] 9:30 K9 [s] 10:00 Hit List TV (PG l,s,a) 12:00 Landed Music (PG l,s,a) 12:30 Hook Line & Sinker [s] 1:00 Ax Men: The Final Haul (PG l) 2:00 AFL Premiership Season 2010: Sydney v Hawthorn - Rnd 19 *Live* – A stretch of outstanding form shows the Hawks can threaten the top side, while Sydney need to lock in a finals spot. 5:00 Program To Be Advised 6:00 TEN News [s] 6:30 Before The Game (PG) [s] – Join Dave Hughes, Mick Molloy, Andrew Maher, Sam Lane, Ryan Fitzy Fitzgerald and Lehmo for all the footy action. 7:30 AFL Premiership Season 2010: Rnd 19 Geelong v Collingwood [s] – Join expert commentators for all the action from the MCG. 11:00 Late Movie: “Double Jeopardy” (M v,l,s) (ʼ83) [s] Stars: Ashley Judd. 1:00 Infomercials (PG) 4:00 Religious Programs 5:05 Worldwatch 1:00 Program To Be Advised 2:45 Animated Short: Spare Change (PG) 2:55 Masterpiece: Looking for Truffaut 3:25 Masterpiece: Art In The 21st Century 4:30 PBS Newshour [s] 5:30 Mythbusters: You Canʼt Teach An Old Dog New Tricks (PG) [s] – Jamie and Adam test out three dog myths: can you evade a bloodhound; sneak past a guard dog; or teach an old dog new tricks? 6:30 World News Australia [s] 7:30 Monster Moves: Tall Towers [s] – A team of building movers brave thunder and lightning at Heathrow Airport to transport a gigantic glass and steel air traffic control tower across one of the worldʼs busiest runways. 8:30 Iron Chef 9:20 RocKwiz: Anika Moa & Dave Dobbyn (PG) 10:10 Drama Movie: “La Vie En Rose” (PG) (ʼ07) – Explores the often troubled life of Edith Piaf. (In French) 12:40 So Frenchy, So Chic - Part 2 1:10 Shameless (MA15+v,l,a) 2:00 Speaking in Tongues (M a) 2:30 Weatherwatch & Music

www.nwm.vic.gov.au

Friday 6 4:30 Shortland Street (PG) 5:00 Something In The Air [s] 5:30 The New Inventors [s] 6:00 Childrenʼs Programs 11:00 Catalyst [s] 11:30 The New Inventors [s] 12:00 Midday Report [s] 12:30 Enough Rope - Andrew Denton (PG) 1:30 East Of Everything (M l) [s] 2:30 Spicks And Specks (PG) [s] 3:00 Childrenʼs Programs 6:00 Announcement: The Coalition 6:05 Meerkat Manor: Growing Pains [s] 6:30 Can We Help? [s] 7:00 ABC News [s] 7:30 Stateline [s] 8:00 Collectors [s] 8:30 Waking The Dead: Missing Persons (M v) [s] – The Cold Case squad think they are chasing a case of sexual violence, but instead unearth evidence of a terrorist cell. 10:10 beached az: The Hermit Crab 10:15 The IT Crowd: From Hell (PG) [s] 10:40 Lateline [s] 11:20 Gruen Transfer (M l) [s] 11:50 rage (M) 5:30 Seven Early News 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 The Midday Movie: “Chicago” (M a,v) (ʼ02) Stars: Richard Gere 2:30 The Golden Girls (PG) [s] 3:00 Find My Family (PG) [s] 3:30 All For Kids [s] 4:00 Itʼs Academic [s] 4:30 Seven News at 4:30 [s] 5:00 M*A*S*H 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home And Away (PG) [s] 7:30 Better Homes And Gardens [s] 8:30 2010 AFL Premiership Season: Rnd 19: Essendon v Carlton [s] – At the MCG? 11:45 Scrubs: My Last Chance (PG) [s] – Molly announces to everyone that sheʼs moving away for a new job opportunity. 12:15 Heroes: Eris Quod Sum (M) – Trapped and terrified, Nathan and Tracy fight for their lives against a monstrous Suresh. 1:15 Special: Secrets Of A Coral Cay 2:15 Room For Improvement 3:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* [s] 9:00 Kerri-Anne *Live* (PG) [s] 11:00 National Morning News 12:00 Ellen Degeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) [s] 3:00 Entertainment Tonight [s] 3:30 Hi5 [s] 4:00 Pyramid [s] 4:30 Afternoon News [s] 5:00 Antiques Roadshow 5:30 Hot Seat [s] 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 Two And A Half Men (PG s) [s] 7:30 Customs (PG l) [s] 8:00 Motorway Patrol: Car Fire 8:30 Friday Night Movie: “First Daughter” (PG s,l) (ʼ04) – The daughter of the President of the USA goes off to college and insists that the ever present Secret Service backs off in order for her to be a “normal student”. Stars: Katie Holmes & Michael Keaton 10:40 Flashpoint: Scorpio (M v) 11:40 How Clean Is Your House (PG) 12:10 Friday Night Football: Gold Coast Titans v Parramatta Eels – From Skilled Park. 2:05 Friday Night Football: North Queensland Cowboys v Brisbane Broncos 4:00 Guthy Renker Australia 4:30 Good Morning America [s] 6:00 TEN Early News [s] 7:00 Toasted TV 8:00 Totally Wild [s] 8:30 Puzzle Play [s] 9:00 TEN News [s] 10:00 The Circle (PG) 12:00 Dr Phil: Dp Family Returns: Warning Marty (PG) [s] 1:00 Oprah Winfrey Show: Oprah Fridays Live: Avatarʼs Billion Dollar Man, James Cameron, And Lady Gaga (PG) [s] 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Infomercial (PG) 4:00 Hueyʼs Cooking Adventures [s] 4:30 The Bold & The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Simpsons [s] 6:30 Neighbours [s] 7:00 The 7pm Project (PG) [s] 7:30 Jamie Oliverʼs Food Revolution (PG a) [s] 8:30 NCIS: Faking IT (M) 9:30 Numb3rs: Where Creditʼs Due (M) [s] 10:30 Outrageous Fortune (MA15+) 11:30 TEN Late News [s] 12:00 Sports Tonight [s] 12:30 The Late Show (PG) 1:30 Infomercials (PG) 5:05 Worldwatch 1:00 The Food Loverʼs Guide To Australia 1:30 Insight 2:30 Darwinʼs Dangerous Idea: Life and Death 3:30 Here Comes the Neighbourhood [s] 4:00 The Journal [s] 4:30 PBS Newshour 5:30 Global Village 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:30 Coast: The Outer Hebrides [s] – Tonight, Neil Oliver and the team visit the Outer Hebrides. This rugged remote coast is a wonderland of stacks, secret inlets and wind swept secluded beaches. 8:30 As It Happened: Doctors of Death (M v,a) [s] – After WWII, seven Nazi doctors were executed for experimenting on prisoners. 9:30 World News Australia [s] 10:00 Love At The Twilight Motel (MA15+a,n) – Alison Roseʼs documentary follows those who frequent the clandestine no-tell motels along the Miami strip. 11:00 Comedy Movie: “Trivial Matters” (M s,d,l,n) (ʼ07) (In Cantonese & Mandarin) 12:45 Drama Movie: “To Get To Heaven” (M s,a,l,n) (ʼ06) (In Russian) 1:25 Weatherwatch & Music

TELEVISION GUIDE

The Peninsula Early Bird Dining Bistro opens at 5.30pm

Every night is Early Openers First 15 kids’ meals* ordered before 6pm are FREE! FREE!... and includes a FREE glass of soft drink! *Kids’ meals are for children under 12 years old. Valid Monday to Friday only.

a g n i v a H

PARTY?

Book yourr 21st, pecial 30th, 40th, Sp Special O ccasion or Wed dding! Occasion Wedding!

GREAT VALUE PACK AGE FOR YOUR SPECIAL EVENT!

Private Function Room. No room hire fee!

E K O A R A K IGHT N Ev er y Sa tu rd ay ni gh t!

COME JOIN IN THE FUN!

Alll your All ourr favourite favo favourit avourit a vo ourite ou te te songs, son so ong ngs, n ngs gs, all gs ll the tth h cl cclassic classics, class classics la assi ass s iccs ssic ssi c , party art arty rtty ty hits h ts ts and d man many many, m nyy, FEATURING m y mor many mo more… QUEENSLAND’S TOP DJ STARTING 7.00PM 7.00PM - GARY DEAM IN THE PUBLIC BAR “PLAY IT TO ME” Bistro Open 7 Days a Week. 12-2 & 5:30 until late

195 Bellarine Highway, Newcomb Ph: 5248 2606 • www.thepeninsula.com.au The Independent, Friday August 6, 2010

417227-JF30-10

Finally Friday

45


Finally Friday TELEVISION GUIDE

Saturday August 28th

Meal Deal available 2 Course $10 Must be 18 years of age & over. Bookings Essential

Nine

Live

Acoustic

Every Friday

Ten

7.30pm till late

SBS

487312-MD31-10

price blitz on all floor stock! OVERstocked - must sell! 7 Pce Leather Dining. Choice of colours in chairs - Black, Choc & Cream

7 Pce Mustang Dining - Chocolate

WAS $1,199

NOW $499

WAS $799

NOW $699

Micro Suede Recliners Chocolate & Stone

WAS $499

NOW $279

Leather Corner Suite S/S Chocolate & Black

3 Piece Full Motion Suite Full Leather With Recliners On 3 Seater

WAS $2,999

WAS $3,299

NOW $1,499

NOW $1,999

Paler Solid Pine 2m Lowline

NOW $199

NOW $369

service, servic ser vice, vic e, qua qualit quality lityy & in lit integ integrity tegrit teg rityy rit

p parker afufurn rurnrnit kitur eure r ffurniture rnit itur ure

327 27 7 Sh Shannon Ave A Ave, Newtown N (Nextt tto St JJosephs (N h CCollege) ll g ) P:

24

5222 4583 M: 0431 702 252

The Independent, Friday August 6, 2010.

4:30 Shortland Street (PG) [s] 5:00 Something In The Air [s] 5:30 The New Inventors [s] 6:00 Childrenʼs Programs 11:00 How The Earth Was Made [s] 12:00 Midday Report [s] 12:30 Agatha Christieʼs Partners In Crime 1:30 Collectors [s] 2:00 Waterloo Road (M v) [s] 3:00 Childrenʼs Programs 6:00 Announcement: The Coalition [s] 6:05 Grand Designs Revisited: Yorkshire 7:00 ABC News [s] 7:30 The 7.30 Report [s] 8:00 Catalyst [s] 8:27 Announcement: Australian Labor Party 8:30 Dick Smithʼs Population Puzzle [s] 9:40 The Population Debate With Tony Jones [s] – Tony Jones will moderate a debate on Australiaʼs population question. 10:30 Lateline [s] 11:05 Lateline Business [s] 11:35 Latin Music USA [s] 12:30 Movie: “If I Had A Million” (PG) (ʼ32) Stars: George Raft & Gary Cooper 2:00 Movie: “Joy Of Living” (G) (ʼ38) Stars: Irene Dunne & Douglas Fairbanks Jr 3:30 Green Warrior [s] 5:30 Seven Early News 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 The Midday Movie: “The Brush Off” (M v,s,l) (ʼ03) Stars: David Wenham 2:00 All Saints (M) [s] 3:00 Find My Family (PG) [s] 3:30 All For Kids [s] 4:00 Itʼs Academic [s] 4:30 Seven News at 4:30 [s] 5:00 M*A*S*H 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home And Away (PG) [s] 7:30 How I Met Your Mother (PG) [s] 8:30 Special: The Rise And Fall Of Concorde (PG) – Witness the rise and fall of Concorde through the people who knew the aircraft best. 10:00 Ghost Whisperer: On Thin Ice (PG) – When comic book artist Damon Weaver begins drawing his own run-ins with ghosts before they happen, it is up to Melinda and Avery to discover the secrets behind his art. 11:00 True Beauty - Face Of Vegas: The Final Test (PG) 12:00 The Matty Johns Show (PG) [s] 1:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* [s] 9:00 Kerri-Anne *Live* (PG) [s] 11:00 National Morning News 12:00 The Ellen Degeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) [s] 3:00 Entertainment Tonight [s] 3:30 Hi-5 [s] 4:00 Pyramid [s] 4:30 Afternoon News [s] 5:00 Antiques Roadshow 5:30 Hot Seat [s] 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 Two And A Half Men (PG s) [s] 7:30 Getaway: Getawayʼs Guide To The Greek Islands - Part 1 (PG) [s] 8:30 The Mentalist: Red Scare (M) [s] – Patrick and the team are called in to investigate the death of a prominent architect found murdered in a crumbling old mansion. 9:30 The AFL Footy Show (M) [s] 11:15 The NRL Footy Show Late (M) 1:00 Entertainment Tonight [s] 1:30 Skippy The Bush Kangaroo 2:00 Guthy Renker Australia 3:00 Danoz 3:30 Good Morning America [s] 5:00 Early Morning News 6:00 TEN Early News [s] 7:00 Toasted TV [s] 8:00 Scope [s] 8:30 Puzzle Play [s] 9:00 TEN News [s] 10:00 The Circle (PG) [s] 12:00 Dr Phil: Extreme Teen Dangers (PG) [s] 1:00 The Oprah Winfrey Show: Julia Roberts & The Men Of “Eat, Pray, Love” (PG) [s] 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Infomercial (PG) 4:00 Hueyʼs Cooking Adventures [s] 4:30 The Bold And The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Simpsons [s] 6:30 Neighbours [s] 7:00 The 7pm Project (PG) [s] 7:30 Bondi Vet (PG) 8:00 Recruits (PG) [s] 8:30 Rush (M v,s) [s] 9:30 Burn Notice: Friends And Enemies (M v,a) 10:30 TEN Late News / Sports Tonight [s] 11:15 The Late Show (PG) 12:00 Swingtown (M s) 1:00 What It Takes: Drew Barrymore 1:30 Infomercials (PG) 5:05 Worldwatch 1:00 Food Loversʼ Guide to Australia 1:30 Return Of The Bible Plagues: Sandstorms 2:30 Dateline [s] 3:30 Letters and Numbers 4:00 The Journal [s] 4:30 PBS Newshour 5:30 Global Village: Makishi Masquerade 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:35 A Taste of Iran [s] – This is a rare opportunity to meet ordinary Iranians. 8:30 Supersizers Go... Edwardian (PG) [s] – Restaurant Critic Giles Coren and writer and performer Sue Perkins attempt to eat for a week in the style of the eraʼs moneyed classes. 9:30 World News Australia [s] 10:00 Mystery Movie: “Counter Investigation” (M a,l) (ʼ07) – When detective Richard Malinowskis daughter is raped and murdered, his colleagues are in a hurry to make an arrest. A suspect is quickly brought to trial and sentenced to life imprisonment. From his cell, however, he pleads his innocence. (In French) 11:30 Action Adventure Movie: “A Bittersweet Life” (MA15+v) (ʼ05) (In Korean) 1:40 Weatherwatch & Music

Ear to Inner

Win one of 10 FAMILY PASSES to the new EARTH QUEST exhibition at the National Wool Museum, 26 Moorabool St Geelong - on show from 6th Aug - 3rd Oct 2010. Come on an incredible journey from outer sspace to inner earth, without leaving Geelong!

Fast approval - payday loans 1 week to 12 months. *Conditions Apply.

HE SPOT!

UES ON T WE CASH TAX CHEQ 487743-JF31-10

andrews a ndre ew ws

4:30 Shortland Street (PG) [s] 5:00 Something In The Air [s] 5:30 The New Inventors [s] 6:00 Childrenʼs Programs 11:00 Big Ideas [s] 12:00 Midday Report [s] 12:30 National Press Club Address 1:30 Talking Heads [s] 2:00 Waterloo Road [s] 3:00 Childrenʼs Programs 6:00 Cheese Slices: Portugal [s] 6:30 Pohʼs Kitchen [s] 7:00 ABC News [s] 7:30 The 7.30 Report 8:00 The New Inventors [s] 8:30 Spicks & Specks (PG) 9:00 The Gruen Transfer (M l) [s] 9:30 United States Of Tara: Explosive Diorama (M l,a) [s] 10:00 At The Movies [s] 10:30 Lateline [s] 11:05 Lateline Business [s] 11:30 Jekyll (M v,l) [s] Stars: James Nesbitt 12:25 Chandon Pictures: Run Bitch Run (M) 12:50 Movie: “Mexican Spitfire Sees A Ghost” (G) (ʼ42) Stars: Lupe Velez & Leon Errol 2:00 Big Ideas [s] 3:00 National Press Club Address [s] 4:00 Catalyst [s] 5:30 Seven Early News 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 Midday Movie: “Stiff” (M l,v,d) (ʼ03) Stars: David Wenham. 2:00 All Saints (M) [s] 3:00 Find My Family (PG) [s] 3:30 All For Kids [s] 4:00 Itʼs Academic [s] 4:30 Seven News at 4:30 [s] 5:00 M*A*S*H 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home And Away (PG) [s] 7:30 Worldʼs Strictest Parents Australia: Texas (PG l,a) [s] 8:30 City Homicide: Last Seen (M v) [s] – Itʼs New Yearʼs Eve when a young woman vanishes after partying with her friends. 9:30 Lewis: Allegory Of Love (M) – In this new murder mystery, Lewis investigates the vicious murder of a young barmaid. 10:30 Air Crash Investigations: Fatal Flaw (PG) 11:40 Most Shocking: Citizens Under Attack (M) – The worldʼs most shocking footage. 12:35 Sons & Daughters [s] 1:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* [s] 9:00 Kerri-Anne *Live* (PG) [s] 11:00 National Morning News 12:00 The Ellen Degeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) [s] 3:00 Entertainment Tonight [s] 3:30 Magical Tales [s] 4:00 Pyramid [s] 4:30 Afternoon News [s] 5:00 Antiques Roadshow 5:30 Hot Seat [s] 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 Two And A Half Men (PG s) [s] 8:00 Hot Property (PG) [s] 8:30 The Farmer Wants A Wife (PG) 9:30 RPA (PG mp) – 23 year old Sharon has been totally blind since she was five, the result of a number of health problems that caused the loss of one kidney. 10:30 Embarrassing Bodies: Cambridge / Oral (M mp, n) 11:30 Til Death: Speed Bump (PG) [s] 12:00 Eclipse Music TV (PG) 12:30 20/20 [s] 1:30 Danoz 2:00 Guthy Renker Australia 2:30 Danoz 3:30 Good Morning America [s] 6:00 TEN Early News [s] 7:00 Toasted TV 8:00 Totally Wild [s] 8:30 Puzzle Play [s] 9:00 TEN News [s] 10:00 The Circle (PG) [s] 12:00 Dr Phil: Dp Family Returns: Erin Reveal (PG) [s] 1:00 The Oprah Winfrey Show: Women Who Claim They Were Child Brides In The USA (PG) 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Infomercial (PG) 4:00 Hueyʼs Cooking Adventures [s] 4:30 The Bold And The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Simpsons [s] 6:30 Neighbours [s] 7:00 The 7pm Project (PG) [s] 7:30 The All New Simpsons Hour: Stealing First Base / The Greatest Story Ever Dʼohed (PG) [s] 8:30 Lie To Me: Headlock (M) [s] 9:30 Law & Order: Criminal Intent: The Mobster Will See You Now (M) 10:30 TEN Late News / Sports Tonight [s] 11:00 Netball Test Series: 2nd Test -Australia v Jamaica 1:00 The Late Show (PG) 2:00 Infomercials (PG) 5:05 Worldwatch 1:00 Drama Movie: “The Circle” (PG) (ʼ00) (In Farsi) 2:35 Short: Horn Ok Please (PG) / 3 Towers 3:00 Nest: Vera [s] 3:30 Letters and Numbers [s] 4:00 The Journal [s] 4:30 PBS Newshour [s] 5:30 Global Village: Football Fever [s] 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:35 Inspector Rex: A City in Fear (PG) – Two people die from drinking a soft drink laced with cyanide. Will Rex be able to stop any further seemingly unconnected deaths? 8:30 Anna Pihl (M l,s,v) [s] – Anna Pihl is a rookie police officer assigned to one of Copenhagens busiest, most densely populated constabularies. 9:30 World News Australia [s] 10:00 Drama Movie: “Or” (MA15+s,a,n) (ʼ04) – A teenager, doing odd jobs, does her best to keep her prostitute mother off the streets. (From Israel, In Hebrew) 11:45 Comedy Movie: “Tickets” (MA15+l) (ʼ05) (In Italian) 1:40 Weatherwatch Overnight

WIN!

Cash Loans & Cheques Cashed

WAS $699

Tuesday 10 Wednesday 11 Thursday 12 4:30 Shortland Street (PG) [s] 5:00 Something In The Air [s] 5:30 The New Inventors [s] 6:00 Childrenʼs Programs 11:00 Big Ideas [s] 12:00 Midday Report [s] 12:30 Terrors Of Tasmania [s] 1:30 The Einstein Factor [s] 2:00 Waterloo Road (PG) [s] 3:00 Childrenʼs Programs 6:00 Three Men Go To Ireland [s] 7:00 ABC News [s] 7:30 The 7.30 Report [s] 8:00 Foreign Correspondent [s] 8:30 Nicholas Craneʼs Britannia (PG) [s] – In the last leg of his epic 5,000 mile journey Nicholas Crane traverses Ireland. 9:30 Announcement: Australian Labor Party 9:35 QI (PG) [s] 10:05 Jennifer Byrne Presents: Graphic Novels 10:35 Lateline [s] 11:10 Lateline Business [s] 11:40 Four Corners [s] 12:25 Media Watch [s] 12:40 Chaserʼs War On Everything (M l,s) 1:10 Movie: “Irene” (G) (ʼ40) Stars: Anna Neagle 2:50 Big Ideas [s] 4:00 Good Game (M v) [s] 5:30 Seven Early News 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 Midday Movie: “Nora Robertsʼ Angels Fall” (M v,s) (ʼ07) Stars: Heather Locklear 2:00 All Saints (M) [s] 3:00 Find My Family (PG) [s] 3:30 All For Kids [s] 4:00 Itʼs Academic [s] 4:30 Seven News at 4:30 5:00 M*A*S*H 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home And Away (PG) [s] 7:30 Minute To Win It (PG) [s] 8:30 Packed To The Rafters: Rites Of Passage (PG a) [s] – Nathan is forced to question his motives for wanting to donate a kidney. 9:30 Parenthood: Pilot (M) – This is the story of the Bravermans - Sarah, Adam, Crosby, and Julia - four grown siblings sharing the headaches and joys of being a parent. 10:30 Keeping Up With The Kardashians: Iʼm watching You (M) – Take a peek inside the life of sexy socialite Kim Kardashian and her larger than life family. 11:30 Alan Sugar: The Apprentice (M l) 1:00 Home Shopping 4:00 NBC Today 5:30 Today *Live* [s] 9:00 Kerri-Anne *Live* (PG) [s] 11:00 National Morning News 12:00 The Ellen Degeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) [s] 3:00 ET [s] 3:30 Magical Tales [s] 4:00 Pyramid [s] 4:30 Afternoon News [s] 5:00 Antiques Roadshow 5:30 Hot Seat [s] 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 Two And A Half Men (PG s) [s] 7:30 Top Gear (PG) [s] – The team test the Aston Martin Rapide, the Porsche Panamera Turbo & the Maserati Quattroporte. 9:00 20 To 1: Sexiest On The Planet (PG) – Hosted by Bert Newton, counting down the hottest men and women on earth. 10:00 Commercial Breakdown Adults Only (M s) 10:45 How To Have Sex After Marriage: Megan & Richard Marshal (MA15+a,s) 11:40 Til Death: Snip Duck (PG) 12:05 Balls Of Steel (M a,l) ) 12:45 Entertainment Tonight [s] 1:30 Danoz 2:00 Guthy Renker Australia 3:00 Danoz 3:30 Good Morning America [s] 6:00 TEN Early News [s] 7:00 Toasted TV 8:00 Totally Wild [s] 8:30 Puzzle Play [s] 9:00 TEN News [s] 10:00 The Circle (PG) 12:00 Dr Phil: Bullied To Death (M a) [s] 1:00 The Oprah Winfrey Show: On Location: Oprah & Simon Cowell: The Farewell Interview (PG) [s] 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Infomercial (PG) 4:00 Hueyʼs Cooking Adventures [s] 4:30 The Bold And The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Simpsons [s] 6:30 Neighbours [s] 7:00 The 7pm Project (PG) [s] 7:30 Modern Family: My Funky Valentine (PG s) 8:00 Rules Of Engagement: 3rd Wheel (PG s) 8:30 NCIS: Requiem (M) [s] 9:30 NCIS: Designated Target (M) [s] 10:30 TEN Late News / Sports Tonight [s] 11:15 The Late Show (PG) 12:00 Law & Order: By Perjury (M) [s] 1:00 What It Takes: Adam Sandler 1:30 Infomercials (PG) 4:00 Religious Programs (PG) 5:05 Worldwatch 1:00 Comedy Movie: “The Man On The Train” (M v,s,l) (ʼ02) (In French) 2:35 Shorts (M v) 3:00 Help (PG) [s] 3:30 Letters and Numbers [s] 4:00 The Journal [s] 4:30 PBS Newshour [s] 5:30 Global Village: In The Shade Of Ganesh [s] 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:30 Insight [s] – Presented by Jenny Brockie. 8:30 One Born Every Minute (PG) [s] – In this episode, Lisaʼs baby Jack has been born with his bowel outside his body. 9:30 World News Australia [s] 10:00 Hot Docs: Being Married (PG) [s] – In 2001, Michael Apted filmed the first installment, Married in America, which featured 9 couples on the eve of their marriages. Five years later, he revisited them and talked openly about their situation. 11:15 Drama Movie: “Yella” (M a,l) (ʼ07) – Follows a woman who leaves her hometown and her husband for a promising job and a new life. (In German) 12:50 Welcome 2 My Deaf World (M s) 1:55 Weatherwatch Overnight

e Outer Spac th

real people fast cash!

4 Drawer Coffee Table

WAS $399

Monday 9 4:30 Shortland Street (PG) [s] 5:00 Something In The Air [s] 5:30 The New Inventors [s] 6:00 Childrenʼs Programs 11:00 Landline [s] 12:00 Midday Report [s] 12:30 Casebook Of Sherlock Holmes (PG) 1:30 The Cook And The Chef [s] 2:00 Waterloo Road (PG) [s] 3:00 Childrenʼs Programs 6:00 Travel Oz [s] 6:30 Talking Heads: John & Ros Moriarty [s] 7:00 ABC News [s] 7:30 The 7.30 Report [s] 8:00 Australian Story [s] 8:30 Four Corners [s] 9:20 Media Watch [s] 9:35 Q&A *Live 10:35 Lateline [s] 11:10 Lateline Business [s] 11:35 The War: A Deadly Calling (PG) [s] 12:30 The Clinic (M l) – Susieʼs life changes with the unexpected arrival of her teenage daughter. 1:20 Movie: “Night Of The Living Dead” (M h,v) (ʼ68) Stars: Judith OʼDea 3:00 Bowls: World Cup 2010: Menʼs Final 4:00 The Cook And The Chef [s] 5:30 Seven Early News [s] 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 Midday Movie: “Something New” (PG s,l) (ʼ06) Stars: Simon Baker 2:00 All Saints (M a,v,d) [s] 3:00 Find My Family (PG) [s] 3:30 All For Kids [s] 4:00 Itʼs Academic [s] 4:30 Seven News at 4:30 [s] 5:00 M* A*S*H 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home And Away (PG) [s] 7:30 RSCPA Animal Rescue 8:00 Under The Hammer (PG) 8:30 Criminal Minds: The Fight / Bloodline (M v,a) – The BAU travels to San Francisco to investigate the murders of several homeless men. 9:30 Criminal Minds: Bloodline (M) [s] 10:30 How I Met Your Mother: Okay Awesome (PG) [s] 11:00 My Name Is Earl: Randyʼs Touchdown (PG) 11:30 Trauma: Frequent Fliers (M) 12:30 Trade Wars (PG) 1:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* [s] 9:00 Kerri-Anne *Live* (PG) [s] 11:00 National Morning News 12:00 The Ellen Degeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) [s] 3:00 Entertainment Tonight [s] 3:30 Magical Tales [s] 4:00 Pyramid [s] 4:30 Afternoon News [s] 5:00 Antiques Roadshow 5:30 Hot Seat [s] 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 Two And A Half Men (PG s) [s] 8:00 Hot In Cleveland: Birthdates (PG) [s] – The ladies set each other up on blind dates and itʼs love at first sight for Elka and Max. 8:30 Rescue Special Ops: Find My Baby (M) [s] 9:30 CSI: Miami: Spring Breakdown / A Grizzly Murder (M) [s] 11:30 McLeodʼs Daughters (PG) [s] 1:00 Spyforce: The Saviour - Part 1 (PG) 2:00 Guthy Renker Australia 3:00 Danoz 3:30 Good Morning America [s] 5:00 Early Morning News 6:00 TEN Early News [s] 7:00 Toasted TV 8:00 Totally Wild [s] 8:30 Puzzle Play [s] 9:00 TEN News [s] 10:00 The Circle (PG) [s] 12:00 Dr Phil: Love Triangle Tension (PG s,a) [s] 1:00 The Oprah Winfrey Show (PG) [s] 2:00 Ready Steady Cook (PG) [s] 3:00 Judge Judy (PG) [s] 3:30 Infomercial (PG) 4:00 Hueyʼs Cooking Adventures [s] 4:30 The Bold And The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Simpsons [s] 6:30 Neighbours [s] 7:00 The 7pm Project (PG) [s] 7:30 Undercover Boss: Churchill Downs (PG) 8:30 Good News Week (M s,l) [s] –Guests include: Kitty Flanagan, Josh Thomas, Taika Waititi, Megan Washington. 10:00 Cops: Family Ties #2 Special Edition 10:30 TEN Late News / Sports Tonight [s] 11:15 The Late Show (PG) 12:00 Burn Notice: Hard Bargain (M) 1:00 What It Takes: Jim Carrey 1:30 Infomercials (PG) 5:05 Worldwatch 1:00 Food Loversʼ Guide to Australia [s] 1:30 Dateline [s] 2:30 Insight [s] 3:30 Letters and Numbers [s] 4:00 The Journal [s] 4:30 FIFA Futbol Mundial 5:00 The Crew 5:30 Global Village: Las Mdulas 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:30 Mythbusters (PG) [s] – In response to fan criticism, Kari, Grant and Tory retest Knock Your Socks Off, while Jamie and Adam take on Compact again. 8:30 Man v Wild: Belize (PG) [s] – Bear Grylls is dropped out of a helicopter at the top of a 200metre waterfall in Belize. 9:30 World News Australia [s] 10:00 Skins: Skins: Cook (MA15+l,a) [s] – After beating someone up at a party in front of a room full of witnesses, Cook is told by his lawyer that he has no choice but to plead guilty. 10:55 Entourage: Manic Monday (M l,s) 11:30 The World Game – Expert analysis on all facets of the game. 12:30 Drama Movie: “The Bodyguard” (M l,v,s) (ʼ06) (In Spanish & French) 2:20 Weatherwatch Overnight

Call your nearest store or visit our website www.cashstop.com.au

5221 0900 146 Moorabool Street, Geelong

Family pass valued at $20 valid for two adults and up to four children. F

Simply SMS “EARTH” and your full name to 19 19 18* S C closes midnight July 2010 Competition closes midnight 27th 10th August 2010 *Winners will be notified via SMS. Premium SMS cost is 55 cents. SMS service provided by * SL Interactive. See terms & conditions at www.starnewsgroup.com.au S

487926-KS31-10

l Journey A musica the h g throu s oll Classic 0’s Rock’N R 8 & ’s 0 7 , ’s of the 60

Sunday 8 5:00 Rage (PG) 6:30 Childrenʼs Programs 9:00 Insiders [s] 10:00 Inside Business (PG) 10:30 Offsiders [s] 11:00 Asia Pacific Focus [s] 11:30 Songs Of Praise [s] 12:00 Landline [s] 1:00 Gardening Australia [s] 1:30 Message Stick [s] 2:00 Travel Oz [s] 2:30 How Kevin Bacon Cured Cancer [s] 3:25 Caravaggio – The Staatsballet, Berlin. 5:00 First Tuesday Book Club With Jennifer Byrne [s] 5:30 Art Nation [s] 6:00 At The Movies [s] 6:30 Mother & Son: Maggie Alone [s] 7:00 ABC News [s] 7:30 Life: Mammals [s] 8:20 ABC News Up-Date [s] 8:30 Return To Cranford (PG) [s] 10:00 Compass: The Nunsʼ Story [s] 10:30 Wonders Are Many: The Making Of Doctor Atomic (M l) [s] 11:55 Movie: “Bloodline” (MA15+v,s,n) (ʼ79) Stars: Audrey Hepburn & Omar Shariff 1:55 Movie: “Touch Of Evil” (M v) (ʼ58) Stars: Charlton Heston 6:00 Childrenʼs Programs 7:00 Weekend Sunrise [s] 10:00 AFL Game Day (PG) [s] 11:00 Special: Crossing The Ditch (PG) 12:00 Sunday Afternoon Movie: “Marty” (PG a) (ʼ55) Stars: Ernest Borgnine 2:00 Footy Flashbacks: 1980: Grand Final Collingwood v Richmond 3:00 2010 AFL Premiership Season: Melbourne v Richmond: Rnd 19 *Live 6:00 Seven News [s] 6:30 Dancing With The Stars [s] – The pressureʼs on as our remaining six couples perform two dances each. 8:30 Bones: The Knight On The Grid (M) [s] – The body of an archbishop is found by some construction workers. In a bizarre twist, the archbishopʼs kneecaps were found to be surgically removed. 9:30 Castle: Vampire Weekend (M) [s] 10:30 Scrubs: My Malpractical Decision (PG) [s] 11:00 Air Crash Investigations (PG) 12:00 Heroes: Villains / Itʼs Coming (M) 2:00 Home Shopping 3:00 NBC Meet The Press [s] 4:00 NBC Today [s] 6:00 Childrenʼs Programs 7:00 Weekend Today [s] 10:00 Wide World Of Sports *Live* 11:00 The Sunday Footy Show 1:00 TAC Cup: Future Stars (PG) 2:00 F Troop: The Great F Troop Robbery 2:30 Afternoon Movie: “Promise Her Anything” (PG s) (ʼ66) Stars: Warren Beatty 4:30 Rescue Special Ops Encore: Thicker Than Water (PG v,s) 5:30 Postcards 6:00 National News Sunday [s] 6:30 RBT (PG) 7:00 Send In The Dogs (PG) [s] 7:30 60 Minutes [s] 8:30 CSI: Crime Scene Investigation: Irradiator (M v) [s] 9:30 Cold Case: One Fall (M) [s] 10:30 Cold Case: Family 8108 (M) [s] 11:30 Afterlife: Things Forgotten All New (M) 12:30 Sunday Football: Sydney Roosters v St George Illawarra Dragons – from the SCG. 2:30 Guthy Renker Australia 3:30 Danoz 4:00 Good Morning America [s] 5:00 Early Morning News 6:00 Religious Programs 7:00 Animalia 7:30 Totally Wild [s] 8:00 Running: The Sun-Herald City 2 [s] 9:30 The Benchwarmers Oz Made 10:00 Hits List TV (PG s,a,l) 12:00 Out Of The Blue (PG) 1:00 On The Ball (PG l) 2:00 ANDRA Pro Series Drag Racing: Round 1 *Live* – Top Alcohol at Willowbank Raceway, Queensland. 3:00 Netball Test Series 1st Test: Australia v Jamaica –From Melbourneʼs State Netball & Hockey Centre. 5:00 TEN News At Five [s] 5:30 Sports Tonight [s] 6:00 The Simpsons (PG) [s] 6:30 Modern Family: Moon Landing (PG) [s] 7:00 Rules Of Engagement: The Four Pillars (PG s) 7:30 Talkinʼ ʼbout Your Generation (PG) [s] 8:30 The Good Wife: Running (M v,d) [s] 9:30 Sunday Night Movie: “The Devil Wears Prada” (PG l) (ʼ06) Stars: Meryl Streep. 11:40 Late Movie: “Late Movie: “Adaptation” (MA15+ v,s,l,d) Stars: Nicolas Cage. 1:30 Infomercials (PG) 5:00 Weatherwatch & Music 7:00 Worldwatch 10:30 Football Asia 11:00 Les Murrayʼs Football Feature 12:00 FIFA Futbol Mundial 12:30 Speedweek 1:30 2010 World Superbike Championships – From Donington Park, UK. [s] 2:00 Tales From A Suitcase: Lola Harding-Irmer 2:30 Science and Islam: The Empire of Reason 3:30 Once Bitten: Conflict and Complications 4:30 Loveʼs Harvest: Cheese (PG) – A long drought takes its toll on Carla and Anne-Marieʼs cherished goat herd. 5:00 Cycling Central 6:00 Thalassa: Treasure of the Red Algae [s] 6:30 World News Australia [s] 7:30 Who Do You Think You Are? Kim Cattrall (PG) [s] 8:30 Dateline [s] – Australian photojournalist Philip Blenkinsop journeys through Asiaʼs chaotic cities and deadly jungles. 10:30 Drama Movie: “The Colonel” (M v) (ʼ06) (In French) 12:30 Drama Movie: “Hostage” (M v,a,l) (ʼ04) (In Greek & Albanian) 2:15 Weatherwatch Overnight

422284-KS31-10

Door Entry

Seven

$5

ABC

oll R n ' k c o R Night with

Saturday 7 5:00 rage (PG) 10:00 rage: Guest Programmer: Cat Empire 11:00 Pohʼs Kitchen [s] 11:30 Message Stick [s] 12:00 Stateline [s] 12:30 Australian Story [s] 1:00 VFL Football 2010: Casey Scorpions Vs Gold Coast (Live) 4:00 Pilot Guides: Trekking In The Pacific (PG) – Zoe heads off to the South Pacific to explore the idyllic Cook Islands. 5:00 Bowls: World Cup 2010: Menʼs Final 6:00 Planet Food: Israel [s] 6:30 Gardening Australia [s] 7:00 ABC News [s] 7:30 New Tricks: Spare Parts (PG) [s] – Jack Halford confronts his nemesis in court. 8:25 ABC News Up-Date [s] 8:30 The Bill (PG) [s] – An abandoned car registered to wealthy businessman Ajay Kapuris is found with traces of blood leading from the scene. 9:15 ABC News Up-Date [s] 9:20 The Prisoner: Harmony (M) [s] – Six is welcomed as a long-lost brother by 16. 10:10 Ashes To Ashes (M v,s) [s] 11:05 rage (M) 6:00 Childrenʼs Programs 7:00 Weekend Sunrise [s] 9:00 Saturday Disney 11:00 Legend Of Enyo [s] 11:30 Trapped [s] 12:00 V8 Xtra [s] 12:30 King Of The Hill (PG) 1:00 Beauty And The Geek Australia (PG) 2:15 Afternoon Movie: “D2: The Mighty Ducks” (G) (ʼ94) Stars: Emilio Estevez 4:30 Whatʼs Up Down Under [s] 5:00 Delish 5:30 Coxyʼs Big Break 6:00 Seven News [s] 8:00 Friday Movie: “Grease” (PG l,a) – Teenagers, Danny and Sandy share a perfect summer holiday romance and part ways when her family returns home to Australia. Stars: Olivia Newton-john & John Travolta 8:50 Classic James Bond Movie: “The Living Daylights” (M) (ʼ87) Stars: Timothy Dalton 11:40 The Late Movie: “Shanghai Knights” (M v,s) (ʼ03) Stars: Jackie Chan & Owen Wilson 2:05 Bledisloe Cup Rugby: Australia v New Zealand – Join Gordon Bray and Wallaby legends Tim Horan and Dan Crowley. 4:05 Home Shopping [s] 5:00 Dateline NBC (PG) 6:00 Childrenʼs Programs 7:00 Weekend Today 9:00 Saturday Kerri-Anne [s] 10:00 Childrenʼs Programs 2:00 Afternoon Classic Movie: “Diamond Head” (PG v,s) (ʼ62) Stars: Charlton Heston 4:00 Discover Downunder 4:30 Talk To The Animals 5:00 Antiques Roadshow 5:30 Home Cooked! With Julie Goodwin 6:00 National News Saturday [s] 6:30 Australiaʼs Funniest Home Videos 7:30 Family Movie: “Racing Stripes” (G) (ʼ05) – Racing Stripes is the endearing tale of a young zebra who finds himself living on a farm in Kentucky along with a colourful assortment of farmyard animals. Stars: Whoopi Goldberg. 9:40 Saturday Movie: “Michael Clayton” (M l,s) (ʼ07) Stars: George Clooney and Tilda Swinton. 12:05 Late Movie: “Bonnie And Clyde” (M v) (ʼ67) Stars: Faye Dunaway. 2:10 Movie: “Mrs Harris” (M v,l,a,s) (ʼ05) Stars: Ben Kingsley & Annette Bening 4:00 Danoz 4:30 Religious Programs 6:00 Toasted TV 9:00 Scope: Things That Climb [s] 9:30 K9 [s] 10:00 Hit List TV (PG l,s,a) 12:00 Landed Music (PG l,s,a) 12:30 Hook Line & Sinker [s] 1:00 Ax Men: The Final Haul (PG l) 2:00 AFL Premiership Season 2010: Sydney v Hawthorn - Rnd 19 *Live* – A stretch of outstanding form shows the Hawks can threaten the top side, while Sydney need to lock in a finals spot. 5:00 Program To Be Advised 6:00 TEN News [s] 6:30 Before The Game (PG) [s] – Join Dave Hughes, Mick Molloy, Andrew Maher, Sam Lane, Ryan Fitzy Fitzgerald and Lehmo for all the footy action. 7:30 AFL Premiership Season 2010: Rnd 19 Geelong v Collingwood [s] – Join expert commentators for all the action from the MCG. 11:00 Late Movie: “Double Jeopardy” (M v,l,s) (ʼ83) [s] Stars: Ashley Judd. 1:00 Infomercials (PG) 4:00 Religious Programs 5:05 Worldwatch 1:00 Program To Be Advised 2:45 Animated Short: Spare Change (PG) 2:55 Masterpiece: Looking for Truffaut 3:25 Masterpiece: Art In The 21st Century 4:30 PBS Newshour [s] 5:30 Mythbusters: You Canʼt Teach An Old Dog New Tricks (PG) [s] – Jamie and Adam test out three dog myths: can you evade a bloodhound; sneak past a guard dog; or teach an old dog new tricks? 6:30 World News Australia [s] 7:30 Monster Moves: Tall Towers [s] – A team of building movers brave thunder and lightning at Heathrow Airport to transport a gigantic glass and steel air traffic control tower across one of the worldʼs busiest runways. 8:30 Iron Chef 9:20 RocKwiz: Anika Moa & Dave Dobbyn (PG) 10:10 Drama Movie: “La Vie En Rose” (PG) (ʼ07) – Explores the often troubled life of Edith Piaf. (In French) 12:40 So Frenchy, So Chic - Part 2 1:10 Shameless (MA15+v,l,a) 2:00 Speaking in Tongues (M a) 2:30 Weatherwatch & Music

www.nwm.vic.gov.au

Friday 6 4:30 Shortland Street (PG) 5:00 Something In The Air [s] 5:30 The New Inventors [s] 6:00 Childrenʼs Programs 11:00 Catalyst [s] 11:30 The New Inventors [s] 12:00 Midday Report [s] 12:30 Enough Rope - Andrew Denton (PG) 1:30 East Of Everything (M l) [s] 2:30 Spicks And Specks (PG) [s] 3:00 Childrenʼs Programs 6:00 Announcement: The Coalition 6:05 Meerkat Manor: Growing Pains [s] 6:30 Can We Help? [s] 7:00 ABC News [s] 7:30 Stateline [s] 8:00 Collectors [s] 8:30 Waking The Dead: Missing Persons (M v) [s] – The Cold Case squad think they are chasing a case of sexual violence, but instead unearth evidence of a terrorist cell. 10:10 beached az: The Hermit Crab 10:15 The IT Crowd: From Hell (PG) [s] 10:40 Lateline [s] 11:20 Gruen Transfer (M l) [s] 11:50 rage (M) 5:30 Seven Early News 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 The Midday Movie: “Chicago” (M a,v) (ʼ02) Stars: Richard Gere 2:30 The Golden Girls (PG) [s] 3:00 Find My Family (PG) [s] 3:30 All For Kids [s] 4:00 Itʼs Academic [s] 4:30 Seven News at 4:30 [s] 5:00 M*A*S*H 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home And Away (PG) [s] 7:30 Better Homes And Gardens [s] 8:30 2010 AFL Premiership Season: Rnd 19: Essendon v Carlton [s] – At the MCG? 11:45 Scrubs: My Last Chance (PG) [s] – Molly announces to everyone that sheʼs moving away for a new job opportunity. 12:15 Heroes: Eris Quod Sum (M) – Trapped and terrified, Nathan and Tracy fight for their lives against a monstrous Suresh. 1:15 Special: Secrets Of A Coral Cay 2:15 Room For Improvement 3:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* [s] 9:00 Kerri-Anne *Live* (PG) [s] 11:00 National Morning News 12:00 Ellen Degeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) [s] 3:00 Entertainment Tonight [s] 3:30 Hi5 [s] 4:00 Pyramid [s] 4:30 Afternoon News [s] 5:00 Antiques Roadshow 5:30 Hot Seat [s] 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 Two And A Half Men (PG s) [s] 7:30 Customs (PG l) [s] 8:00 Motorway Patrol: Car Fire 8:30 Friday Night Movie: “First Daughter” (PG s,l) (ʼ04) – The daughter of the President of the USA goes off to college and insists that the ever present Secret Service backs off in order for her to be a “normal student”. Stars: Katie Holmes & Michael Keaton 10:40 Flashpoint: Scorpio (M v) 11:40 How Clean Is Your House (PG) 12:10 Friday Night Football: Gold Coast Titans v Parramatta Eels – From Skilled Park. 2:05 Friday Night Football: North Queensland Cowboys v Brisbane Broncos 4:00 Guthy Renker Australia 4:30 Good Morning America [s] 6:00 TEN Early News [s] 7:00 Toasted TV 8:00 Totally Wild [s] 8:30 Puzzle Play [s] 9:00 TEN News [s] 10:00 The Circle (PG) 12:00 Dr Phil: Dp Family Returns: Warning Marty (PG) [s] 1:00 Oprah Winfrey Show: Oprah Fridays Live: Avatarʼs Billion Dollar Man, James Cameron, And Lady Gaga (PG) [s] 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Infomercial (PG) 4:00 Hueyʼs Cooking Adventures [s] 4:30 The Bold & The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Simpsons [s] 6:30 Neighbours [s] 7:00 The 7pm Project (PG) [s] 7:30 Jamie Oliverʼs Food Revolution (PG a) [s] 8:30 NCIS: Faking IT (M) 9:30 Numb3rs: Where Creditʼs Due (M) [s] 10:30 Outrageous Fortune (MA15+) 11:30 TEN Late News [s] 12:00 Sports Tonight [s] 12:30 The Late Show (PG) 1:30 Infomercials (PG) 5:05 Worldwatch 1:00 The Food Loverʼs Guide To Australia 1:30 Insight 2:30 Darwinʼs Dangerous Idea: Life and Death 3:30 Here Comes the Neighbourhood [s] 4:00 The Journal [s] 4:30 PBS Newshour 5:30 Global Village 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:30 Coast: The Outer Hebrides [s] – Tonight, Neil Oliver and the team visit the Outer Hebrides. This rugged remote coast is a wonderland of stacks, secret inlets and wind swept secluded beaches. 8:30 As It Happened: Doctors of Death (M v,a) [s] – After WWII, seven Nazi doctors were executed for experimenting on prisoners. 9:30 World News Australia [s] 10:00 Love At The Twilight Motel (MA15+a,n) – Alison Roseʼs documentary follows those who frequent the clandestine no-tell motels along the Miami strip. 11:00 Comedy Movie: “Trivial Matters” (M s,d,l,n) (ʼ07) (In Cantonese & Mandarin) 12:45 Drama Movie: “To Get To Heaven” (M s,a,l,n) (ʼ06) (In Russian) 1:25 Weatherwatch & Music

TELEVISION GUIDE

The Peninsula Early Bird Dining Bistro opens at 5.30pm

Every night is Early Openers First 15 kids’ meals* ordered before 6pm are FREE! FREE!... and includes a FREE glass of soft drink! *Kids’ meals are for children under 12 years old. Valid Monday to Friday only.

a g n i v a H

PARTY?

Book yourr 21st, pecial 30th, 40th, Sp Special O ccasion or Wed dding! Occasion Wedding!

GREAT VALUE PACK AGE FOR YOUR SPECIAL EVENT!

Private Function Room. No room hire fee!

E K O A R A K IGHT N Ev er y Sa tu rd ay ni gh t!

COME JOIN IN THE FUN!

Alll your All ourr favourite favo favourit avourit a vo ourite ou te te songs, son so ong ngs, n ngs gs, all gs ll the tth h cl cclassic classics, class classics la assi ass s iccs ssic ssi c , party art arty rtty ty hits h ts ts and d man many many, m nyy, FEATURING m y mor many mo more… QUEENSLAND’S TOP DJ STARTING 7.00PM 7.00PM - GARY DEAM IN THE PUBLIC BAR “PLAY IT TO ME” Bistro Open 7 Days a Week. 12-2 & 5:30 until late

195 Bellarine Highway, Newcomb Ph: 5248 2606 • www.thepeninsula.com.au The Independent, Friday August 6, 2010

417227-JF30-10

Finally Friday

45


Finally Friday DINING OUT

advertising feature

GEELONG RSL Grasshopper is Back!

Joker Poker and Happy Hour every Thursday Night from 5.30pm till 7.30pm

One of Geelong’s most popular bands from the 70s has reformed.

The Pudding Club Sunday 22nd August

$39

per person

Saturday September 11 Rubber

Soul

Lady Ga Ga & Rhiannon Tribute Show

M o on o l Pa tr

Saturday October 2

420774-JL30-10

Come along to see the boys and dance away to music of the Beatles, Beach Boys, Rolling Stones, The Doors, Creedance & many Aussie covers. WHERE: GEELONG RSL WHEN: FRIDAY 3RD SEPTEMBER TIME: 6.30pm DINNER & SHOW: $30 Members & $35 Non Members Bookings Essential! Phone 5241 1766

The Dog Rocks Grand Final Breakfast September 25th $25p/p - Promos and Live music before the game. Bookings Essential

420773-FB29-10

50 BARWON HEADS ROAD, BELMONT TEL: 5241 1766

bookings phone: 5276 1201 420771-KS29-10

An inviting contemporary interior welcomes guests to Abruzzi Café.

all you can eat smorgasbord lunch & dinner - 7 days

DINING FOR THE WHOLE FAMILY LUNCH 11.45am - 2.00pm DINNER 5.00 - 8.30pm $49.95 Family Discount Meal Monday to Friday Lunch & Dinner, 2 adults and 2 kids (3-14 years)

ith seating for groups of 10 to 50 guests for dining or finger-food functions, Abruzzi is a fully-licensed and responsible server of alcohol. Customers are welcome to call into the café to discuss functions with Terry and Daniel. Abruzzi Café is ideal for all sorts of gatherings such as end-of-

W

• 300 Seat Bistro • Fully Licensed Bar • Children’s room with Playstation Games • ★★ 2½ Star Rating Accommodation • Private Function Room

Phone: 5275 1091

218 - 230 Princes Highway Corio Geelong

year celebrations; family functions, product launch, business meetings, corporate parties, business luncheons or dinners, reunions and anniversaries. A smoke-free venue with ample parking at the rear as well as onstreet, Abruzzi Cafe is passionate about delighting customers with inspired food and service. Along with its professionalism

and reliability, Abruzzi has earned a reputation for inspired food, great presentation and exceptional service. Its appetising meals always look and taste great, with attentive service aimed at making guests feel special. Abruzzi Cafe is available for daytime and evening functions seven days a week.

feel it... hot tasty soups available all winter... fast & friendly service... great coffee just the way you like... Herne Hill 29 Minerva Road

5222 2155

Newtown Cnr Pako & Nicholas St

5224 1991

Belmont Spotlight Centre

5244 1426

423487-TB24-10

Abruzzi ideal for functions

NEWLY RENOVATED BISTRO NEW LOOK...SAME PRICES!

417349-JL30-10

t

Offer valid until 13/8/10 Opening Mon-Fri O i times ti M F i 10am-5pm. 10 5 Sat 10am-2pm. Thur/Fri/Sat Nights 6pm until late

221 Moorabool Street, Geelong Phone: 5222 8565

*Winners will be notified via SMS. Premium SMS costs 55¢. SMS service provided by SL Interactive. See terms and conditions at: www.starnewsgroup.com.au

Free Fingerfood For all Friday night functions booked. 2 rooms available

Come in and see us at

Abruzzi Café

(formally Relish Café)

select something from our exciting Italian menu Shop 13/321 Pakington Street, Newtown 3220

5229 4466 for bookings

The Independent, Friday August 6, 2010.

487685-JJ30-10

Open for Dinner every Thursday in August. Meals from 6:00pm till 8:00pm.

46

DELIVERED TO YOUR FREEZER EVERY WEEK, SUITABLE TO MAINTAIN BLOOD SUGAR LEVELS FOR DIETS MOST MEALS ARE GLUTEN FREE, NUMEROUS MEALS ARE LOW IN SALT, STRAIGHT FROM THE FREEZER TO THE MICROWAVE OR OVEN

to Abruzzi Cafe, simply email your full name to abruzzicafe@me.com. Competition closes midnight Wednesday 11th August 2010.

Abruzzi Café

Ph:

W

487664-JJ27-10

up to a value of $40 on Thurs, Fri, & Sat night.

For your chance to win a $100 Gift Voucher

21 Malop Street, Geelong Ph: 5229 1954

487657-JF26-10

fe

t Res 25% off total bill,

420808-JF31-10

Ca

an r u a

R A ON EE, L A RSDAY ERRIB A ON THU W , G L SIN SU CROS INE PENIN PERS R , HOP HE BEL L A IT E N TA R ONG & T EL ERING DELIV AY A ND GE D S EDNE


nicole penning

Everything you need to organise & celebrate your Wedding Day is right here!

civil celebrant weddings & naming days

“may the love in your life create a life to love” 0417 924 148 nicolepenning@gmail.com www.nicolepenning.com.au

*25% OFF Selected Bridal Gowns - Floor Stock Only

BRIDAL HOUSE GEELONG That’s Amore -

The largest range of bridal & formal wear All in one beautiful building

Timeless, Classic, Elegant & Sophisticated Wedding Gowns Large Range of Dresses for Bridesmades, Mother of the Bride & Groom Stunning Special Occasion, Cocktail & Debutante Gowns Ferrari Mens Suits – For Hire & Sale

Bridal Wear

Mens Formal Wear

Kelbergs Classic Buicks

Special Occasion Wear

140 Little Malop Street, Geelong Ph: 5222 6272 info@bridalhousegeelong.com Opening Hrs: Mon - Sat

1946-48 chauffer driven Buicks

*10% OFF Visit our website for further details

www.kelbergsclassicbuicks.com.au

All of the businesses listed in this comprehensive Lift-Out Guide have been specifically selected for your convenience and are among the best in their industry. Together we aim to make your wedding day truly memorable. Book your event NOW & SAVE, whilst supporting local businesses. *All offers are valid until 30th September 2010. Mention or present this lift-out to receive special offers. See individual businesses for conditions. Not to be used in conjunction with any other offer.

Wedding Belles

Make your dream honeymoon a reality

Everything a Bride will need... The largest range of: Invitations & Bomboniere (DIY or we can do it for you) Children’s Formal Wear Wedding Accessories, Gifts & Keepsakes Personalised Candles All in one convenient location Wedding - Christening - Communion - Confirmation

Perfect for Weddings, Corporate Events & Special Occasions

We can design a marque that’s perfect for you.

Set up your bridal registry for free with us. Ask in store for details. 116 Moorabool St. Geelong Phone: 5215 3500

package booking of $2000 or more *conditions apply

The Finishing Touch

*Buy Now or Layby Everything You Need & get 10% OFF the total.

Showroom: 111-113 Little Malop St. Market Square Mall, Geelong Ph: 5229 8008 info@weddingbelles.com.au

CANDLES • TABLE CLOTHS NAPKINS • WEDDING CAR RIBBONS

Phone 5229 7275

www.weddingbelles.com.au NEWMINSTER FUNCTION DESIGN

*10% OFF

To a r r a n g e a n a p p o i n t m e n t p l e a s e c a l l

Lorraine (03) 9395 1768

*10% OFF

lorraine@newminster functiondesign.com 6 N e w m i n s t e r W a y, Po i n t C o o k 3 0 3 0

270 Shannon Ave. Geelong West

*Chair Covers $4.50 each - Free Delivery

acrylic nails ‡ gel nails ‡ manicures ‡ pedicures ‡ nail art

SAMPLE SATURDAY

The Last Saturday of Every Month Come in for F R E E Cake Samples & Cake Quotes

03 5272 2554 119 Separation St. North Geelong Open Mon - Sat 10.00am - 6.00pm

*30% OFF

*10% OFF

Wedding & Celebration Cakes Modern & Traditional Designs

Specialists in Wedding Dress Cleaning & Preservation. All Gowns intricately hand cleaned and lovingly preserved. www.weddingdresscleaning.com.au

M: 0409 177 980

T: 5277 2309

Display Home Open Saturday & Sunday 1-5pm Crn Church St & Vines Road Hamlyn Heights

*$25 OFF

*10% OFF

Inside Desire Hair Salon Shop 15 Bell Post Shopping Centre, Anakie Rd

Office: 104B Shannon Avenue, Geelong West www.vinmarhomes.com.au

Phone: 5229 7655

Email: info@vinmarhomes.com.au

486587-MD31-10

83 BARWON TERRACE, STH GEELONG P: 5221 2022 WWW.OCCASIONSPARTYHIRE.COM.AU

by

Another Belle Advertising Shared Marketing Initiative: email: belleadvertising@gmail.com

22

The Independent, Friday August 6, 2010.

The Independent, Friday August 6, 2010

47


487956-RMB31-10

48

The Independent, Friday August 6, 2010.


Finally Friday community calendar

BOOKS – Geelong Rotary Club hosts Geelong Book Fair 11am-5pm at Geelong West Town Hall. Also Saturday 9am-5pm and Sunday 10am-2pm. Enquiries 0427 211 273.

Saturday DANCING – Ballroom dancing 8pm-11.30pm at The Ballroom, Bay View Pde, Hamlyn Heights. Cost $7. Also Monday 8-11pm. Enquiries 5229 3785. DANCING – Old-time dance featuring band New Ritz 8pm-midnight at Leopold Hall. Cost $8. Enquiries 5250 1333. STAMPS – Geelong Philatelic Society hosts guest speaker Paul Howden from 7pm at 9-15

Sunday GARDENING – Geelong Hydroponic Gardening meets 9.30am at Geelong Botanic Gardens meeting room. Enquiries 5250 3952.

Monday ROSTRUM – Public speaking and meeting procedure 6.45-8.15pm at St George Workers Club, 212 Pakington St, Geelong West. Enquiries 5275 8763 or 0408 294 868. BREASTFEEDING – Discussion on Just 10 Steps – The Baby Friendly Way as part of World Breastfeeding Week. Bookings on 5221 9864.

Tuesday PHILOSOPHY - Philosophy cafe 7-9pm at Black Bull Tapas Bar, 48 Moorabool St, Geelong. Enquiries 5264 7484. DANCING – Community dancing practice 7.309.30pm at Uniting Church hall, Newcombe St, Portarlington. Cost $3. Enquiries 5259 1776. CANCER – GRACE Breast Cancer Support Group meets 1-3pm at St John of God hospital. Guest speaker surgeon Conrad Brandt on breast construction. Enquiries 5226 8888. HEALTH – Adult mental health first aid 9am4.30pm at Uniting Church Hall, Saffron St, Newtown. Cost $200, $50 concession. Enquiries 5279 2542. TALK – Life conversation presents local artist Jill Shalless 5-7pm at Congregational Hall, Wesley Church, 100 Yarra St, Geelong. Enquiries 5229 0719.

Wednesday FILM – Queenscliff reconciliation mob presents Women of the Sun…25 years later 8pm at Uniting Church Hall, Queenscliff. Enquiries 5258 1722. FILM – Geelong Classic Cinema presents Good Will Hunting at Morrow Theatrette, 51 Malop St, Geelong. Enquiries 5243 6926. MEDITIATION - Meditation and philosophy of stillness and awareness morning and evening groups for beginners. Enquiries 5264 7484.

Thursday DANCE – West Coast Seekers Club dance 811.30pm at Geelong RSL, Belmont. Enquiries 5248 4903, 5241 8001. DANCE – Life Activities Club meets 2.304.30pm at Belmont Pavilion, Barrabool Rd, Belmont. Cost $4. Enquiries 5241 1220. PHILOSOPHY - Meditation and philosophy of stillness and awareness morning and evening groups for beginners. Enquiries 5264 7484. ORIENTEERING – Victoria Orienteering Association night street walk or run 6.40pm for 7pm start at Sparrow Park, Hope St, Geelong West. BYO torch. Enquiries 5277 0668. ENGLISH – Free English language program 10am-midday at Waterfront Christian Church, 35 Corio St. Enquiries 5229 5799. WOMEN – Aglow ministry for women meeting

10am at The Ballroom, Hamlyn Park, Carey St, Hamlyn Heights. Cost $7. Enquiries 5222 7311. ARTHRITIS – Barwon Arthritis Self-Help Group meets 10.30am-midday at Barwon Health, 104-108 Bellarine Hwy, Newcomb. Enquiries 5229 8826. BUSINESS – Tax basics seminar 5pm City Hall, corner Gheringhap and Lt Malop Sts, Geelong. Enquiries 132 215.

Friday FASHION – Geelong West Hospital Auxiliary a Blumes fashion parade 2pm at supper room, Geelong West Town Hall. Cost $5 includes afternoon tea. Enquiries 5277 0580. DANCE – Portarlington Community Dance Group walk-through practice 7.30pm, social dancing 8-11pm at Portarlington senior citizens hall, Newcombe St. Cost $4. Enquiries 5229 1776.

Contributions to Community Calendar must be received at least one week prior to intended publication date. Details should be typed or neatly hand-written and include a contact number for publication, address, time and date of the event. Fax: 5221 3823. Email: editorial@geelongindependent.com.au Mail: PO Box 407, Geelong, 3220.

Community Calendar proudly sponsored by GMHBA

1300 4 GMHBA (1300 4 46422)

GMHBA.com.au Health Insurance

440215-RMB34-9

Friday

Clarence St, Geelong West. Enquiries 5261 5461. BALL – Winchelsea Uniting Church presents Rainbow Ball at Globe Theatre, Winchelsea. Cost $12. Enquiries 5267 2243 or 5267 2630. WORKSHOP – Awareness/protection workshop 1-4pm with Keith McKinlay at Samata Yoga Centre. Enquiries 0402 098 793. JUMBLE – Jumble sale 10am-midday at St John’s Lutheran Church, 163 Yarra St. Enquiries 5248 4231. MARKET – Salvation Army Northside Community Centre community market 8am-1pm at 92 Cox Road, Corio. Enquiries 5275 7771.

487957-RMB31-10

VOLUNTEER - Cancer Connect one-on-one peer support program seeks volunteers to support cancer victims. Free training for volunteers with at least two years of post-treatment experience. Travel and out-of-pocket expenses reimbursed. Enquiries 13 11 20 or cancer.connect@cancervic.org.au. VOLUNTEER – Shelter for the Homeless Foundation seeks full-time coin collection volunteers. Fuel allowance paid. Enquiries 0412 107 555. CLASS – Geelong Society of Model and Experimental Engineers fitting and turning classes available. Enquiries sec_gsmee@fastmail.fm SOCIAL – Weekend and weeknight social activities for working-aged people. Activities include dining out, theatre, movie and trivia nights. Enquiries 0411 952 598. MS – Geelong People With Multiple Sclerosis self-help group runs exercise classes, art and craft activities, social events etcetera. Enquiries 5277 3918, 0411 499 191. VOLUNTEERS – Retail volunteers sought for Red Cross stores. For more information phone 1800 339 888 or email retail@redcross.org.au. VOLUNTEERS – Geelong Ardoch Youth Foundation seeks volunteers to help support children’s education in local schools. Enquiries 5257 3633 or info@ardoch.asn.au PHOTOGRAPHY – Vigex International Photographic Salon displays 70 prints at Geelong Gallery during August. Enquiries 5258 3213.

The Independent, Friday August 6, 2010

49


487331-JF31-10

An Independent Advertising Feature

487330-JF31-10

An Independent Advertising Feature

Where parties for kids Rock arents can’t help but smile as their children reach out with a hand at the top of a 10-metre wall before shouting “I made it”. The Rock Adventure Centre shares in the excitement and pride as the indoor facility provides a safe and fun birthday party that children will remember for a lifetime. Children and parents alike love The Rock’s no mess, no fuss kids’ parties. The Rock’s party package is ideal for children aged six years and over, with two hours of fully supervised games, bouldering and rock climbing. Party decorations, invitations, a birthday cake, soft drinks and lolly bags are special features of the package. A self-catering option is also available. Parents wanting more information on celebrating their children’s next birthday at The Rock can phone 5221 3101 or visit www.rockadventures.com.au.

P

Volunteers needed for world UCI event vent organisers are calling on community members to be part of the action by volunteering for the UCI Road World Championships from September 29 to October 3. Staged outside Europe only once every seven years, the UCI world cycling championships will be the most significant event hosted by Victoria since the 2006 Commonwealth Games. The world championships are second in prestige only to the Tour De France and attract the world’s most exciting athletes from more

E

than 50 nations. The event presents a unique opportunity for residents to join a world-class volunteer team and experience elite international cycling first hand. Local knowledge or experience in volunteering is a plus but, according to the event organisers, enthusiasm is the only prerequisite. Volunteers will act as representatives of the event and enjoy unique insights into the world of professional racing. Whether prospective volunteers are dedicated cyclists, devoted

sports fans, students or just looking for something new and exciting, they shouldn’t miss this opportunity to be involved in such a massive international event. Volunteers can apply in groups of 10 or more friends or colleagues. Preference will be given to volunteers available on multiple days, particularly applicants willing to volunteer for the full event period. Applications are open online at www.melbourne2010.com.au. With less than eight weeks to go, now is the time to complete the application process to prepare for the most exciting event of 2010.

Children can enjoy indoor climbing in a safe environment at The Rock.

IC! MUSHTS! LIG ION! ACT

Book your next Birthday Party here! y k your part o o b o t il a • Call/em e packages u l a v t s e B • included s e d a l b r o • Skates

6 Lambert Avenue, Newtown Enquiries: 0411 33 55 44

Phone: 5223 2481

r o l l e r wa y. c o m . a u

487318-JF31-10

Volunteers will be able to get up close and personal with the world’s best road racing cyclists at this year’s UCI championships in Geelong.

2010 UCI ROAD WORLD CHAMPIONSHIPS 29 SEPTEMBER TO 3 OCTOBER

BECOME A VOLUNTEER FOR THE BIGGEST EVENT GEELONG HAS EVER SEEN

MINIMUM OF 10 PER GROUP

The 2010 UCI Road World Championships will bring the world’s best cyclists to your doorstep. So don’t miss your opportunity to play a role in one of the world’s greatest cycling events.

• Children’s Birthday Parties • Playgroups • Preschool/Primary • Aged Residential Care Outings • Special Needs Groups 487319-TB31-10

The team is seeking enthusiastic volunteers with a passion for world class events and a ‘can do’ attitude to perform the following roles:

SPORT SPECIFIC SERVICES

SPECTATOR SERVICES

TRAFFIC AND TRANSPORT SERVICES

Course Marshals

Information Services

Many Roles Available

Essential to the safety of spectators and athletes, course marshals are required to assist with pedestrian flow and course safety. Positioned in critical areas around the course, marshals also get to experience all the action first hand.

Enthusiastic volunteers are required to engage with the local community and international visitors. As representatives of the event a positive attitude is essential in communicating the significance of this world class event.

With roles ranging from Load Zone Assistant to Airport Dignitary Meet and Greet, the traffic and transport roles ensure all volunteers, spectators and officials are appropriately informed and transported to their required destination.

Preference will be given to those volunteers who are available on multiple days, and in particular those that are available for the full event period.

The Carousel is a great indoor venue for children to celebrate their birthday amongst family and friends. Self-Catered and Catered Packages are available seven days a week.

Applications are now open online at www.melbourne2010.com.au For volunteer team enquiries contact volunteers@melbourne2010.com.au DI060810_1

For bookings and enquiries, contact: The Carousel on 5224 1547 or email carousel@geelongcity.vic.gov.au

487943-KC31-10

50

The Independent, Friday August 6, 2010.

Each package includes your own party area with tables and chairs, and best of all, a fun filled one and a half hours of unlimited Carousel rides!

487948-RMB31-10


487322-SAH31-10

osts thinking of throwing a party should think Lombard. Lombard The Paper People, the largest party shop in the universe, has 11 retail outlets operating throughout Victoria, making it a one-stop party shop for all party supplies. Starting out in packaging over 40 years ago, Lombard has made a successful transition to party products. Lombard makes partying an art form, according to marketing coordinator Mariana Broz. “We stock thousands of party, novelty, coordinated theme, packaging and display products suitable for all types of celebrations, functions, businesses and events,” she says. “We’re always on the lookout for new and exciting party products, so no matter when you visit you’ll find the best range of party and theme decorations on display, including, balloons, hats, masks, costumes, decorations, tableware, pinatas, leis, novelties, streamers, noisemakers and so much more.” Lombard’s latest store opened in October at a new Homemaker Centre in Corio. “We had been looking at a store there for a while – it was just the obvious next move,” Mariana says. Lombard is at its busy end of the year with AFL finals,

487317-JJ31-10

Party on with new Lombards H

GEELONG AQUATIC CENTRE Geelong’s No.1 Swim School ‘Swimming lessons, a gift for life’

Victoria’s spring racing carnival, Halloween, Christmas and New Year’s Eve all coming up. As official licensees of the AFL, Lombard The Paper People produces and sells the official range of team flags, inflatable hands, posters, balloons and deco-

rations. This year Lombard will also produce a range of display merchandise including posters, balloons and mobiles for the UCI World Road Cycling Championships in Geelong from late September.

Contact Debbie for more information • Quality Water • Quality Teachers • Quality Facilities

3 Bridge Street, Newtown Phone: 5222 5530, Fax: 5222 5518

AFL TEAM GEAR

487324-KS31-10

Lombards’ Danielle Campbell, Joan Steinman and Michael Lindsay at the Corio store.

• Childrens Birthday Parties • Saturday afternoons and Sundays • Lifeguards provided • Sole use of pool • Contact us now to book your next party

BALLOON DECORATIONS

KIDS COSTUMES KIDS PARTY RANGES

PINATAS

BIRTHDAY BANNERS

GEELONG GATE HOMEMAKER CENTRE - 470 PRINCES HWY, CORIO PH: 5275 0858

WWW.LOMBARD.COM.AU

487817-TB31-10

The Independent, Friday August 6, 2010

51


487322-SAH31-10

Hassle-free catering ingerfood Company has catering covered for parties, special occasions and children’s birthdays, according to spokesperson Judy Myers. “Whether customers need catering for a birthday next month or next week, Fingerfood Company can help from just $4 per head,” Judy says. “Packages can be tailor made for children’s parties, husbands’ work events or parent’s social gettogethers for less that 30 people or more than 70. “Customers can call the Fingerfood Company for great value, expert advice and the ultimate convenience.” Fingerfood Company has DIY packages available to suit any customers’ needs. Last-minute catering for unplanned events can also be supplied. Judy says Fingerfood Company can organise food packages as well as beverage options and catering staff. “Even master chefs and lovers of food don’t want to be tied to a kitchen during their own functions and birthdays - that’s why they call the Fingerfood Company. “Our punctual staff deliver the food precisely when customers need it and for just a little more Fingerfood Company will stay and serve the food to guests.” Judy says Fingerfood Company makes catering stress free and simple “The bottom line is that with over 8000 parties under our belts we know parties. “That’s why we’re the party food professionals and a one-stop catering shop.” Judy says customers can

CIRCUS ACROBATIC THEMED BIRTHDAY PARTIES FOR ALL AGES. • Fun acrobatic/circus sport games • Fun floor circus/acrobatic activities • Fun circus program: juggling, hula hoops, spinning plates, diabolos, rola bola, tightrope and more.... • Jumping castle • Trampoline • Free lollies, chips, biscuits, cordial and soft drinks. • Free tea & coffee for parents • Free special circus birthday gift for birthday girl/boy. • You may bring other food and we supply cutlery, napkins etc.

487320-TB31-10

F

Ph: 5242 8458 • Email: Ph E il iinfo@kidsplace.com.au f @kid l • www.kidsplace.com.au kid l

486868-IA18-10

A place where your kids can run a muk! State of the art play equipment that is safe, clean and soft. 800m2 of play areas, jumping castles, bike track, obstacle course, large 3 lane slide, ball pool, ying fox and much more. Kids parties a speciality, book now. Café with light meals, cakes and fresh ground coffee. After hours functions. School holiday discos. Address: 24-26 Apparel Close Breakwater Geelong (turn off Fellmongers Road near BP station) Ph: 5229 3499 Web: www.kidsrunamuk.com.au

487326-MD31-10

Welcome to Geelong’s purpose built indoor party and play adventure centre where the fun never ends!

The Finger Food Company is now available in Geelong to help hosts deliver first-class functions without the hassles of self-catering. receive 10 per cent off their next booking by mentioning this advert. Valid until the end of August 2010. Call 1300 Finger or go online at www.fingerfoodcompany.com.au

to browse menu and package options. To win a $500 voucher for your next function SMS Fingerfood, your name and phone number to 19 19 18.

SMS ‘Fingerfood’ on 191 918 to win a $500 voucher Valid only until Aug 31st, 2010

487691-JF31-10

• Kids Parties a specialty • Quality Fingerfood from only $4 per guest • Cater for any event • Optional staff catering

52

The Independent, Friday August 6, 2010.


487323-SAH31-10

Warehouse leader for trailers

Moolap’s experts for stainless steel ooking inside Vic Stainless Sales it’s easy to see how the Moolap retailer fully encompasses the one-stop shop philosophy. “When you’re looking for quality stainless steel products, there’s only one place to go,” says Shane Herbert, of Vic Stainless Sales. Located on the corner of Albert Street and Portarlington Road, Vic Stainless Sales focuses on providing quality products at competitive prices with reliable, friendly service and prompt deliveries. The business stocks a large range of stainless steel products including sheets, tubes, pipes, bars, valves, flanges and fittings. The top range in hardware essentials includes chains, hinges, shackles, turnbuckles, wire ropes, DIY handrail fittings and marine fittings. Shane says the Vic Stainless Sales team has more than 20 years experience in the industry to help customers find exactly what they need. “With so much to choose from in our handrail and balustrade range, our staff can assist you on materi-

raeme Hutchings’ Trailer Warehouse Victoria is Geelong’s leading retail outlet for trailers, boasting the widest range available under one roof. After returning to his home state for what he expected to be retirement close to his daughter and grandchildren, Graeme ended up taking a gamble during the global financial crisis when he became the Victorian distributor for European-designed Erde trailers. He has since expanded his range of state-of-the-art, lightweight, fully-galvanised trailers. Graeme initially traded secondhand stock, developing a range of trailers including caravan and boat models. With an emphasis on providing fair deals, Graeme continued adding to his range.

G

L

Shane Herbert at Vic Stainless Sales. al selection, design and affordability.” Vic Stainless Sales caters for a variety of industries through to home handyman. The staff can provide delivery, saw and plasma cutting, folding, section-rolling and guillotining to make DIY jobs even easier. Vic Stainless Sales is open 8am to 4.30pm Monday to Friday, phone 5248 1911.

Graeme Hutchings at Trailer Warehouse Victoria. Now his business also stocks Dunbier boat trailers, Australiandesigned Volt trailers and other Australian-made box, cage and camper trailers. With years of various trades experience behind him, straighttalking Graeme and his staff can

recommend the right trailer for each customer’s requirements. “If you’re looking for any type of trailer, a boat trailer or a second-hand caravan, visit Trailer Warehouse Victoria to see what’s available before I really do retire,” Graeme says.

Balustrade & Marine Fittings Sheet

Plate

Tube & Fittings Plate

Pipe Bar

Handrail Systems Hardware

Struts

Abrasives

Cnr Albert St & Portarlington Hwy, Moolap - Ph : 5 248 1 9 1 1 487810-JF31-10

TRAILERS ALL TYPES OF TRAILERS NEW AND USED

CAMPING/ LUGGAGE

STOCK CRATE

BOAT TRAILERS DUNBIER

MOTOR BIKES CAGED TRAILER

NEW 6X4 TRAILERS FROM $599

SMALL BOAT TRAILERS

TANDEM TRAILERS

FREE JOCKEY WHEEL WITH EVERY TRAILER SOLD WE BUY ALL TYPES OF TRAILERS & CARAVANS TRAILER 1/56 Sun Street, Moolap WAREHOUSE GEELONG Phone 5248 6070

Victoria’s Largest Range of Trailers VISA - MASTERCARD ACCEPTED 487693-KC31-10

The Independent, Friday August 6, 2010

53


fridaymotor Independent

Friday, August 6, 2010

Nash survives the tip Wane’s Wheels

Trimmed: A renowned Geelong motor trimmer created a new hood and reuphostered the interior.

GREG WANE

A

Rally car: Ray and Judith Matthews have taken their restored 1926 Nash on 275 vintage rallies across Victoria and South Australia Pictures: John Conway 51137 running chassis, with the bodies built locally. However, he had since discovered his car was fully imported. “When I got the car most of the accessories were missing but I was able to get most of them by going around to all the swap meets,” Ray said. “I had to remake the hood and I had to build the hood bows from timber I made the bows up.” Ray was advised to contact renowned Geelong auto trimmer Charlie Scherson, who was about to

25

IN T S FYANS

retire, but there was a possibility he wouldn’t get the seats and hood made. “By the time I got to him, during the 1970s, he had retired but he agreed to come out of retirement and do the car at his home for me. He did a lovely job of it,” Ray said. “At that stage he was in his early’ 70s. Because of the urgency to get Charlie to do the trimming job because of his age, I did the restoration back to front and ended up getting the hood and seat upholstery done before I did any work restoring the body.” Ray said the motor was original and required little work. It is a six-cylinder, side-valve engine with three-inch (75mm) diameter pistons, which is about a two-litre, and puts out about 21 horsepower. The car can cruise at 38 mph “although if it gets up to 40 it starts to get a little bit frenzied,” Ray laughed. The car was still running with the original pistons and original radiator, he said. “The Nash car company was also ahead of their time in 1926 when they introduced anti theft devices to their cars,” Ray said. “The car has a means of locking the gearbox with a large Yale key, so it can’t be operated and the spare wheel, that is mounted at the back, has a large padlock securing the wheel to the car.” Ray said the restoration took about 1000 hours to complete.

e On Sit e Financ Pics for illustrative purposes only. Prices subject to change without notice

Sales Consultant Doug Lawson

LMCT 1433

2003 HOLDEN ASTRA SEDAN

2001 HOLDEN RODEO TRAY

5 SPEED

5 Speed, A/C, P/S, XVL-809.

DRIVEAWAY

$10,000

$10,000

2002 TJ MAGNA SEDAN

2002 AU FALCON SR III SEDAN

5 SPEED

4 Cylinder, 5 Speed, Aluminium Tray. UKP-114. DRIVEAWAY

420786-KS31-10

bought the car for $10. “After that I’ve never seen another Nash since they might have been the only three in the area.” The first part of the restoration required the body to be lifted off the chassis. Ray supported it on four 44 gallon drums in his cramped garage. “Each day I pushed the chassis and running gear out into the carport where I could work on it,” he said. Ray believed the Nash cars were mostly imported as

YEARS

1926 Nash recovered from a landfill site at Modewarre has been brought back to its original glory by Belmont car enthusiast Ray Matthews. “I bought the Nash from a farm at Moriac,” Ray said. “It had been dumped into a landfill site at Modewarre. A scrap dealer had recovered it from the tip and sold it to a young farmer at Moriac, David Hutton. “I bought the remains of the car from David in 1970.” Ray said he didn’t think the Nash had been left for too long in the Modewarre tip. “When I got it the bodywork had deteriorated quite a lot because somebody had placed super phosphate bags over the top of it,” Ray said. He described the bonnet as resembling a lace handkerchief, with more rust holes than could be repaired. Fortunately, Ray was able to buy another identical model Nash from Torquay to use body panels in the restoration. “However, neither of the cars still had their original speedoes but I was fortunate to find another old Nash at Balliang that had been stripped down and used for spotlighting. “It was in poor condition but it had a speedo. I

AUTO

Auto, A/C, P/S, Spoiler. DRIVEAWAY RSM-967.

$10,000

AUTO

Auto, A/C, P/S, ABS. Local Car. RTN-051 DRIVEAWAY

$9,000

LARGE VARIETY OF MAKES & MODELS - Wagons, Sedans, Utes, Autos & Manuals - LOTS OF LOW KM VEHICLES. ALL PRICES ARE DRIVEAWAY! SELECTED QUALITY HOLDENS

SELECTED QUALITY FORDS

2002 WH STATESMAN INTER. LS8 SEDAN, Auto, V8, 5.7 Ltr, A/C. SEW-908 2005 VZ COMMODORE WAGON, Auto, A/C, Long Rego, Local. TVR-369 2001 VU HOLDEN S UTILITY, V6, Auto, A/C, P/S. 239-JLN 2006 VIVA WAGON, Auto, A/C, P/S, Low Kms. UPV-653 2002 VX COMMODORE EQUIPE WAGON, Auto, A/C, P/S. RPW-665 2002 HOLDEN BERLINA WAGON, V6, A/C, P/S, ABS, Alloys. RUQ-690 2001 VX COMMODORE SEDAN, V6, A/C, P/S, Body Kit, Local. XQD-460 2002 VX COMMODORE SEDAN, Auto, A/C, P/S, Mod Kms. RLS-048 2000 VT COMMODORE EXEC WAGON, Auto, A/C, P/S, CD, Alloys. QNM-416 2003 HOLDEN ASTRA SEDAN, 5 Speed, A/C, P/S. XVL-809 1998 VT COMMODORE 50TH ANNIVERSARY SEDAN, A/C, P/S, Auto. PHB-844 2001 HOLDEN BARINA HATCH, 5 Speed A/C, P/S. TBW-119 1998 HOLDEN BARINA CABRIO, OUH-671

WAGONS 2003 SUBARU FORESTER WAGON, Auto, A/C, P/S, 4WD. SKX-078 2002 VX COMMODORE EQUIPE WAGON, Auto, A/C, P/S. RPW-665 2003 SUZUKI IGNIS WAGON, 5 Door, Auto, Low Kms. XLT-274 2000 COMMODORE WAGON, Auto, A/C, P/S, CD, Alloys. QNM-416 2001 MAGNA TJ WAGON, V6, Auto, A/C, P/S. XTL-257 1999 DAEWOO NUBIRA X WAGON, 5 Speed, A/C, P/S, Local. PQP-940

DUAL FUEL 2002 FORD AU III FALCON SEDAN, Auto, A/C, P/S, Dual Fuel. RJW-901 2002 MITSUBISHI TJ MAGNA SEDAN, Auto, A/C, P/s, ABS, Local Car. RTN-051

2002 HOLDEN BERLINA WAGON

$18,000 $16,000 $15,000 $14,000 $13,500 $13,500 $11,000 $11,000 $10,000 $10,000 $7,000 $7,000 $5,000

54

DRIVEAWAY

$13,500

The Independent, Friday August 6, 2010.

$12,000 $10,000 $10,000 $10,000 $8,000 $4,500

2006 NISSAN TIDA STL SEDAN, Auto, A/C, P/S, Low Kms. UCY-536 2003 SUZUKI IGNIS WAGON, 5 Door, Auto, Low Kms. XLT-274 1994 SUBARU LIBERTY GX SEDAN, Auto, A/C, P/S, Low Kms. FOW-744 1999 DAEWOO LAGANZA, Auto, A/C, P/S, mod Kms. PXM-580 1992 COROLLA SECA HATCH, Auto, P/S, 5 Door. EXL-075

$10,000 $10,000 $9,000 $8,000 $6,000 $5,000 $5,000 $5,000

1999 FORD FALCON FUTURA SEDAN, Auto, A/C, P/S. PQD-511

$3,000

1990 TOYOTA CRESSIDA SEDAN, Auto. ELJ-558

$2,000

SELECTED QUALITY CARS

2001 HONDA CIVIC HATCH, 5 Speed, A/C, P/S, Long Reg. UIC-114 2003 NISSAN PULSAR ST SEDAN, 5 Speed, A/C, P/S, Mod Kms. SEZ-592 2003 DAEWOO LACETTI SX SEDAN, 5 Speed, A/C, P/S, Service Books. STG-981 1999 SUZUKI BALENO SEDAN, 5 Speed, A/C, P/S, Mod Kms. PMI-303 1998 DAEWOO NUBIRA SE SEDAN, 5 Speed A/C, P/S, Local. OWJ-557 2000 HYUNDAI ACCENT HATCH, 5 Speed, A/C, P/S, Low Kms. QJL-400 $16,000 1995 HYUNDAI EXCEL 4DR SEDAN, 1 Owner, A/C, P/S. XWL-153 $13,500 1995 FORD FESTIVA GLXI 5 DR, 5 Speed, A/C, Books, Long Rego. OME-367 SELECTED QUALITY MITSUBISHIS $11,000 $10,000 2002 TJ MAGNA SEDAN, Auto, A/C, P/S, V6 UMI-867 $8,000 2002 TJ MAGNA SEDAN, Auto, A/C, P/S, ABS, Dual Fuel, Local Car. RTN-051 $5,000 2001 MAGNA TJ WAGON, V6, Auto, A/C, P/S. XTL-257 2000 MAGNA SEDAN, Auto, A/C, P/S, ABS. QJL-972 PRESTIGE $10,000 $9,000 2002 WH STATESMAN INTER. LS8 SEDAN, Auto, V8, 5.7 Ltr, A/C. SEW-908

2003 NISSAN PULSAR ST SEDAN

ALLOYS

V6, A/C, P/S, ABS, Alloys. RUQ-690

FOUR CYLINDER AUTOMATICS

2004 BA FALCON FUTURA SEDAN, Auto, A/C, P/S, Mod Kms. TPM-900 2002 AU III FALCON SEDAN, Auto, A/C, P/S, Dual Fuel. RJW-901 2002 AU III FALCON FORTE, Auto, A/C, Airbag, CD. RIJ-672 2002 AU FALCON SR III SEDAN, Auto, A/C, P/S, Spoiler. RSM-967 2001 KN LASER LXI SEDAN, 5 Speed, A/C, P/S, Local. QVQ-768 2000 FORD KA HATCH, 5 Speed, Sunroof, A/C, P/S. QKQ-389

$10,000

AS TRADED - NO RWC

1989 HOLDEN RODEO ALUMINIUM TRAY, 5 Speed, 4 Cylinder. WTO-716

$1,500

1984 TARAGO WAGON, 5 Speed.

$1,499

COMMERCIALS AND UTES 2001 VU HOLDEN S UTILITY, V6, Auto, A/C, P/S. 239-JLN

PEOPLE MOVERS $18,000 2000 HYUNDAI TRAJET, Auto, 7 Seater, A/C, P/S, Local. QHR-336

2003 SUZUKI IGNIS WAGON

DRIVEAWAY

$11,000

$12,000

2004 FORD FALCON FUTURA SEDAN AUTO

LOW KMS

5 Door, Auto, Low Kms. XLT-274

$15,000

$10,000 2001 AU II FALCON SUPERCAB UTE, A/C, P/S, 5 Speed, Tonneau Cover, Local. UBM-222 $10,000 $9,000 2001 HOLDEN RODEO TRAY, 4 Cylinder, 5 Speed, Aluminium Tray. UKP-114 $10,000 $9,000 $8,000 1990 RODEO TWIN CAB, 5 Speed, P/S, Local. EHX-964 $8,000

5 SPEED

5 Speed, A/C, P/S, Mod Kms. DRIVEAWAY SEZ-592.

$15,000 $11,000 $6,500 $6,000 $4,000

Auto, A/C, P/S, Mod Kms. TPM-900

DRIVEAWAY

$12,000


Geelong’s CHEAPEST used cars NO DEPOSIT FINANCE T.A.P.* 06 Holden Rodeo

01 Nissan Xtrail

06 Ford BF Falcon XT

06 Ford BF Futura

02 Holden VXII Exec

06 Ford BF Falcon XT

Dual Cab

Wagon

Wagon

Sedan

Wagon

Wagon

• • • •

• • • •

• • • • •

• • • • •

• • • •

White • 3.0Ltr Manual • A/C P/S • P/Windows • Airbags CD Player • 106,000 Kms XUL-953

TURBO

Gold • 2.5 Ltr Auto • A/C P/S • P/Windows • Airbags Cruise • CD Player 150,000 Kms • XRT-251

Grey • 4.0 Ltr Auto • A/C P/S • P/Windows • Airbags Cruise • ABS • Alloys CD Player • 167,000 Kms UBT-619

DEDICATED LPG

AUTO

4X4

Icon • 4.0 Ltr Auto • A/C P/S • P/Windows x2 Airbags x2 • Cruise • ABS CD Player • 102,000 Kms XOF-958 XO

White • 3.8 Ltr Auto • A/C P/S • Airbags • Cruise • ABS CD Player • 216,000 Kms SDG-739

• • • •

DEDICATED LPG

Silver • 4.0 Ltr Auto • A/C P/S • P/Windows • Airbags Cruise • ABS • CD Player 172,000 Kms • ULQ-405

DEDICATED LPG

$26,990 DRIVEAWAY$12,990 DRIVEAWAY$ $14,990 DRIVEAWAY$13,990 DRIVEAWAY $ $7,990 DRIVEAWAY $ $12,990 DRIVEAWAY 95 Mazda Bravo

99 Ford Laser LXI

Tray

Sedan

VOUCHER

• White • 2.6 Ltr Manual • P/S • Green • 1.6 Ltr Manual • A/C • 111,000 Kms • NIY-870 • P/S • 132,000 Kms • PVN-144

For signed contracts between 6/8/10 - 14/8/10.

$6,990 DRIVEAWAY $6,990 DRIVEAWAY 00 Holden VSIII Exec

Hatch

Utility

• • • •

• Silver • 1.6 Ltr Manual • A/C • P/S • P/Window • Airbags • Alloys • CD Player • 111,000 Kms • REQ-507

00 Ford Laser GLXI

Sedan

Sedan

• • • •

FREE WINDOW TINT or FREE

4X2

01 Mazda Astina

99 Holden VTII Exec

or FREE $200 WESTFIELD VOUCHER

DUAL FUEL 3 SEATER

$8,990 DRIVEAWAY $9,990 DRIVEAWAY

AUTO

FE2

$7,990 DRIVEAWAY $8,990 DRIVEAWAY

6 MONTH SERVICE

Black • 3.8 Ltr Auto • A/C P/S • Cruise • Alloys Dual Fuel • CD Player 174,000 Kms • QZM-154

Tungsten • 3.8 Ltr Auto • A/C • Silver • 1.8 Ltr Auto • A/C P/S • Airbags • Cruise • ABS • P/S • Only 118,000 Kms Alloys • CD Player • XNE-550 204,000 Kms • QIB-077

(FOR MINOR SERVICES)

00 Toyota Corolla Ascent 02 Toyota Camry Altise

Sedan

Hatch • • • •

Silver • 1.8 Ltr Manual A/C • P/S • Airbags Only 115,000 Kms QLY-534

• • • • •

CHOOSE ONE OF 3 SPECIAL OFFERS

Silver • 2.4 Ltr Manual • A/C P/S • P/Windows • Airbags Cruise •Abs • Alloys Only 107,000 Kms SAJ-070

N

5 SPEED MA

MUST PRESENT THIS VOUCHER

$9,990 DRIVEAWAY $ $10,990 DRIVEAWAY

03 Mitsubishi Lancer MR 02 Holden VY Accliam

04 Holden VZ Exec

05 Hyundai Elantra FX

06 Toyota Camry Altise

05 Holden VZ Executive

Coupe

Sedan

Sedan

Sedan

Sedan

Sedan

• • • • •

• • • • •

Silver • 1.8 Ltr Auto • A/C P/S • P/Windows • Airbags Alloys • CD Player Only 86,000 Kms SNW-874

Martini • 3.8 Ltr Auto • A/C P/S • P/Windows • Airbags Cruise • ABS • Alloys CD Player • 170,000 Kms RYL-724

• • • • •

Grey • 3.6 Ltr Auto • A/C P/S • P/Windows x2 Airbags • Cruise • ABS CD Player • 169,000 Kms TFP-772

• • • •

Blue • 1.8 Ltr Auto • A/C P/S • P/Windows • Airbags CD Player • 112,000 Kms XVP-184

• • • • •

Silver • 2.4 Ltr Auto • A/C P/S • P/Windows • Airbag Cruise • ABS • Alloys CD Player • 111,000 Kms UFV-203

• • • • •

White • 3.6 Ltr Auto • A/C P/S • P/Windows x2 Airbags x2 • Cruise • ABS Alloys • Only 101,000 Kms XTH-823 XTH

AUTO

$11,990 DRIVEAWAY$ $11,990 DRIVEAWAY$ $12,990 DRIVEAWAY$12,990 DRIVEAWAY$ $14,990 DRIVEAWAY$ $14,990 DRIVEAWAY

LMCT 9844

Pics for illustrative purposes.

*To approved purchasers.

487297-KS31-10

www.bloodtoyota.com.au Cnr Moorabool & Fyans Streets, Geelong Phone 5221 9672 AH: Adam 0425 811 176 motormart@geelongce.net.au

P AY M E N T S T O O H I G H ? W H Y N O T B A C K T R A D E • O N E S T O P S H O P F O R F I N A N C E • Q U I C K A N D E A S Y F I N A N C E & I N S U R A N C E • C A S H B A C K O N T R A D E - I N S •

P AY M E N T S T O O H I G H ? W H Y N O T B A C K T R A D E • O N E S T O P S H O P F O R F I N A N C E • Q U I C K A N D E A S Y F I N A N C E & I N S U R A N C E • C A S H B A C K O N T R A D E - I N S

• QUICK AND EASY FINANCE & INSURANCE • CASH BACK ON TRADE-INS • BACK TRADE • TRADE-INS WELCOME •

E&OE.

• QUICK AND EASY FINANCE & INSURANCE • BACK TRADE • TRADE-INS WELCOME • ONE STOP SHOP FOR FINANCE The Independent, Friday August 6, 2010

55


Deadline: 5pm Tuesdays Photo Deadline: 4pm Tuesdays

MOTOR VEHICLES

BARINA, City, black, 1992, 1.4lt, 5 speed, PS, AC, CD, 05/09 reg. RWC, 63,000kms. ROQ-549. $8,000. 0401 492 890.

FORD, AU, C2R sedan, auto, twin air bags, alloys, tinted windows, RWC, AC, ABS, EC, must sell. TGO606. $9,000 ono. 0433 991 920. FORD, Courier, d/cab, ute, dual fuel, 12 months reg, 1994 model, FPP-143, $2,000, as is. 0421 135 147 Whittington.

BMW, 523i, 1998, auto, 2.3L, prestige, black, sunroof, leather interior. TYC-057. $16,900 . 0412 844 217. FORD, F250, 2004, 5.4, 12 months reg, dual fuel, auto, 125,000kms, XWL329, $52,000, 0424 720 424 Moolap. BMW, 535, 1988, silver, auto, sun roof, leather interior, 163,000kms, GC, RWC, reg.10 months. XKP-610. $6,000. 0432 444 501. BOAT MOTOR, 6HP, Seahorse, short shaft, just serviced, new waterpump, ear muffs, fuel line, 12 litre tank, hear running, always garaged, well maintained. $450ono. 0409 404 093. Ocean Grove.

CITROEN, C5, 2007. 18,456kms, as new, leather seats, 7 airbags, alloy wheels, xexon headlights, UVC-357. $29,999. 0408 593 715. DAEWOO, hatch, 1998, silver, RWC, 12 months reg., VGC. NRZ-902. $2,400. 0434 831 012. Highton. DAEWOO, Nubira, station wagon, auto, AC, power windows, window tint, reg 7/11, RWC, TQU-806, $5,500. 0450 794 291 Geelong South. FALCON, XLS with canopy, gas, grey, EC, $21,500. 0457 Lara.

ute, 2006, dedicated UZH-227, 940 729

FORD Festiva, 2000, white, 5 speed manual, AC, 138,000kms, RWC, TBK-790. $4,200. 0403 863 543. Corio. FORD, 2003, 1 tonne tray, white, auto, tint, GC. SLW733. $12,500ono. 0432 154 099.

FORD, Falcon, BF-XT, 2006, wagon, auto, petrol, EC, 144,000kms, RWC, EGO colour, tow bar, factory tint, garaged, XJT403, $12,900. 0414 649 004 Torquay. FORD, Falcon, BA-XT, 2003, sedan, dedicated gas, cruise control, auto, service history, RWC, 110,000 kms. SBO-116. $19,750. 0400 091 854. FORD, Focus, CL, auto, 2003, sedan, white, 2lt, RWC, 93,000kms, FCR662. $12,500. 0403 156 772. Highton.

FORD, Focus, auto, 2004, 5 door hatch, serviced, RWC, reg.12 months, 50,000kms. TGB-824. $17,500 ono. 5275-5839.

MOTOR VEHICLES

MOTOR VEHICLES

FORD, Laser, 1990, KF, Ghia, auto, alloy wheels, no RWC, 228,000kms, slight front damage, EHZ802, $900. 0425 795 331 Newtown. FORD, Laser, 1988, 12 months reg as of 23/05/10, RWC, XBI-632. $2,000ono. 0437 756 696. Newtown.

FORD, Probe, coupe, 1995, auto, VGC, RWC, 210K, reg 4/10. RYM-283, $6,750. 0415 941 179. FORD, station wagon, 1993, dual fuel, auto, H/Reece towbar, tyres 80%, new brakes, body ok, motor good, needs auto, drive away, JGWAPK47980, no reg, no RWC. $500. 0409 404 093, Ocean Grove. FORD, Transit van, 2001, diesel man, white, registered until 03/11, USG-750. $10,500. 0419 003 273, Port Arlington.

FORD, ute, BA, XR6, turbo, 2003, auto, grey, 142,000km, EC, SNB-933, $18,000 neg. 0428 585 657 Leopold.

FORD, Laser, GLXI, 1998, 5 speed, hatch, 175,000kms, books, all electrics, RWC. UOK-764. $3,950 bargain. 0419 514 777. Newtown.

HOLDEN, Jackaroo, 1982. PVR-305. As is $800 ono. 0448 907 623. HOLDEN, Astra, CD, hatch, 2000, AC, manual, silver, all extras, 12 months reg, EC. QDE-233. $8,990. 0448 260 460 Ocean Grove.

HOLDEN, Nova, 1990, sedan, white, 5 speed manual, AC, PS, 11 months reg., PWP-880. $1,500ono. 0406 380 510. Geelong West.

Advertise your item For Sale in this local newspaper for great results!

AVAILABLE FROM NEWSAGENTS EVERY FRIDAY!

Book your advert now

1300 666 808

MITSUBISHI, Lancer, 2 door coupe, 1998, 5 speed, manual, 123,000kms, RWC, $4,000 ono, OII-MN. 0409 701 362 Geelong West.

HONDA, Jazz, 2007, VTI, 1.5L hatch, auto, PS, power windows, factory warranty 2 years, 1 lady owner, UVH-688. $16,000ono. Must sell. 0401 931 416, Bannockburn.

NISSAN, Navara, 2000, 3.2l Diesel, 4x4, tray, AC, 193,000kms, EC. QDC077. $10,900 ono. 0422 477 682. Waurn Ponds.

HONDA, Prelude, 1985, Sports coupe, one owner last ten years, very reliable, must sell purchased later model, QOR-663, $1,500 without RWC. 5258-3374 or 0458 001 837 Point Lonsdale.

HYUNDAI, Lantra, SE, sedan, 5 speed manual, silver, 1.8L, 98,500kms, VGC, excellent fuel economy. OKW-887. $5,000 ono. 0417 303 681, 5242-8375.

HOLDEN, Astra City, 2000, 165,000kms, AC, PS, CD, auto sedan. 10 months rego., blue, UNC309. $9,000 ono. GC. Sarah 0427 831 375. HOLDEN, Commodore, station wagon, VX Acclaim, CC, electrics, ideal family wagon, REK895. $9,750. 0417 539 732. Belmont. HOLDEN, Commodore, station wagon, 1992, VP, dual fuel, RWC, 261,000kms, EC, EWG274. $3,400. 0447 882 017, 5284-1336. Anakie.

HOLDEN, HQ, 1974 V8 ute, 4 speed, dual fuel, 6 months reg, QQX-136. $3,800ono. 0409 218 056, Whittington.

HOLDEN, ute, 2004, VZ, HSV, Maloo, 6lt, 6 speed, manual, damaged door, bent pillar, damaged right rear panel, IHX-587, $20,000 ono. 0414 486 892 St Albans Park. HOLDEN, VS ute, series 3, 235,000kms, good reliable first car, 12mths reg, RWC, PNC-433. $7,000 ono. 0413 955 570, Corio. HOLDEN, VT, Calais, 1999, black, tints, SKN226, must sell $3,900 as is ono, 0404 181 789 Bell Park. HOLDEN, VY SS ute, 5.7L 6 speed manual, white, reg 05/09, RWC, SFG904, great car, EC. $22,500. 0417 358 357. HOLDEN, VZ, Crewman F, 2004, GC, RWC. XMU426. $15,000 ono. 0412 928 130. Grovedale.

KIA, Optima, 2005, V6, 34,000kms, 2.7L, full service, auto, cruise control, electric mirrors, windows, CD, leather seats, towbar, more, EC. TRH-009. $13,000. 52741272, 0412 765 257. MAGNA, Verada, 1993, auto, AC, CC, alloys, electric, sports kit, needs new motor, FIY-213. $1,800. 0430 078 170. MAZDA, 1993, sedan, 626, auto, new tyres, cruise control, central locking, electric windows, 2Lt, mechanically A1, great car, RWC, eng no FS46902, quick sale $2,300 ono, 0404 634 632. West Geelong. MAZDA, MX-6, 1992, reco motor trans, keyless entry, QAU-507, $2,200 ono. 0401 442 881 South Geelong. MERCEDES BENZ, 280SE, white, immaculate condition, mags, sun roof, AC, PS, pleasure to drive. CXA-784. $9,950. 53497433, 0418 497 434.

Fill in this coupon and attach a photo of your item with $34.10* and your advertisement will run for 6 weeks. You only have to call our office if you have sold the item or, at the end of the 6 weeks to take advantage of the half price deal.

ADVERTISE FOR 6 WEEKS AND GET THE NEXT 6 WEEKS HALF PRICE! Regulations require the registration to be included, or if the car is unregistered, the engine number.

Minimum 15 words (one item only) *Must include suburb at end of advert

MERCEDES, wagon, 300TE, 124, mod, 7 seat, beaut family wagon, pristine condition, 12 months reg, RWC, NR390, only $6,900. 52581522 Point Lonsdale.

Complete this form and lodge to First Floor, 78 Moorabool Street, Geelong 3220 by no later than 4pm Tuesdays Name and Address (not for publication) Name: ....................................................................................................... Address: .................................................................................................... ............................................................... Post Code:................................. Mobile: ......................................................................................................

15 words $34.10 20 words $36.30 25 words $38.50 30 words $40.70

I would like to pay by:

■ Cash ■ Cheque ■ Visa ■ Bankcard ■ Mastercard My credit card number is:

■■■■ ■■■■ ■■■■ ■■■■ Expiry date:

■■ ■/■ ■■

Signature: ................................................... Cash Paid: .................................................. Receipt: ...................... Paid at: ...................

*This offer is made to private advertisers only. *Offer only available for items normally advertised in the Wheel and Deal section. All adverts, must be pre-paid. For $34.10 you get a 15 word ONE ITEM ONLY advert with a photo. Adverts are restricted to “Wheel and Deal” items only for private advertisers, and will be run for 6 weeks. Once your item is sold you have to call our office to cancel. *Sale price must be included in the advert. Alteration to PRICE ONLY to advertisements will be accepted. Not included in the offer are any business adverts, rental hire etc., for the purpose of ongoing profit. or Real Estate Listings. The publisher reserves the right to decline any booking for the purpose of continuing gain.

The Independent, Friday August 6, 2010.

SELL YOUR CAR - GELBTHTILSOLD

Phone:.......................................................................................................

56

PROTON, Jumbuck, GLSi, 2003, 152,000km, EC, tinted windows, electric windows, electric mirrors, AC, CD player, many extras, RWC, reg 11/10, WUX-680, $6,900 neg. 0438 305 633. Barwon Heads.

SAAB 1987, 900 GLE, 4 door hatch, manual, sunroof, PS, AC, GC, reliable. TZC-170. $2,200. 0434 929 435.

MOTOR VEHICLES

MERCEDES, Sprinter van, 413CDI, manual, 2005, long wheel base, 163,000km, TOI-845, $24,800 will trade cheaper vehicle. 0409 869 550 Lara. MITSUBISHI, Magna, sedan sports, 1998, 5 speed manual, V6, 3.0Lt, mags, airbags, good kms, GC, 12 months reg, RWC, XVU-645. $5,400. 0414 935 257. Drysdale.

TOYOTA, Camry sedan, October 1999, auto, white, AC, PS, central locking, 3L engine, tinted windows, 179,000kms, EC, service history, PPC-396, $7,500 ono. 5223-1448 Newtown.

TOYOTA, Camry Altise, 2006, well cared for vehicle low Km 38,000 RWC, complete service history, XNR-460. $17,900 0403 251 266, Highton.

TOYOTA, Corolla, CSI, 1998, AC, manual, 180,000kms, reg 12/09, WSN-525. $5,900 with RWC, $5,490 without 0422 446 784. TOYOTA, Corolla Conquest, 2004, auto, dark blue, 12mths reg, VGC, stereo, CD player TGN-717. $10,900ono 0402 184 347, Corio/Lara.

TO REMOVE A SOLD ADVERT PLEASE CONTACT US!

Advertise for 6 weeks for only $34.10* If your item has not sold, re-advertise for another 6 weeks at half price!

SEND US YOUR PHOTO! Photo to appear in Black and White - Free of charge Photo to appear in Colour for an extra $6.50

MOTOR VEHICLES

HONDA, Accord, 1992, auto, 184,000kms, reg 11/10, EC. ETB-979. $3,600 ono. 0411 957 587. Leopold.

HYUNDAI, Elantra, sedan, mannual, 2001, AC, PS, CD, EC, REQ-451. $8,500 ono. 0407 502 767.

It will also appear FREE in the all new

HOLDEN, Commodore, SS ute, 2009, 6ltr, manual, GC, racks and tarp, WZE678, $31,500 ono. 0416 271 735. Belmont. GRAND CHEROKEE, Jeep, Larado, 2000, will swap for caravan or sell $11,500, dual fuel, TWV633. 5241-1338 or 0433 145 336. Belmont.

HOLDEN, HR 1967, ute, new paint, tyres, shockers, exhaust and tarp, VGC inside and out, 6 cyl, manual, reg, RWC, JRM302. $13,500ono. 0407 814 565, Corio. May consider swap.

SELL YOUR CAR, BOAT, CARAVAN OR TRAILER • Geelong, Lara, Meredith, Teesdale, Inverleigh, Highton, Belmont • Torquay, Jan Juc, Moriac, Anglesea, Aireys Inlet, Deans Marsh • Leopold, Clifton Springs, Portarlington, St Leonards, Ocean Grove,Barwon Heads

MOTOR VEHICLES

TOYOTA, Camry, 1996, station wagon, auto, PS, CC, towbar, centra locking, reg Nov 2010, VGC, RWC, UDH-300, $4,500. 5275-0752 Corio. HOLDEN, 1998, Commodore sedan, V6, 146,000kms, auto, AC, PS, EC, QOQ-804, $6,800 ono. 0413 381 268 or 5277-1357 Geelong.

FORD, XR6, 2006, silver sedan, low kms, EC, auto. UDQ-686. $17,000. 52612641. Torquay.

FORD, Laser, 1994, KH manual, 1 lady owner, 180,000kms, RWC, full service history, EC, TLV246, $3,700. 0402 203 125. Wandana Heights.

MOTOR VEHICLES

FORD, Laser, 1991, 5 speed, manual, central locking, AC, stereo, mechanically VG, reg 7/10, SBK-650, $2,000ono. 0439 488 061 Newcomb.

C784811-KK17-10

MOTOR VEHICLES BARINA, 1998, auto, 5 door hatch, reg May 2011, RWC, low k’s, WKS-625, $4,200 ono. 0432 056 319. Norlane.

SAAB, 2006, 2 door convertible, 5 speed, auto, 4 cylinders, turbo, 37,000km, RWC, 17’’ alloy wheels, air steer, electric windows, CC, remote entry, air bags, new condition, UKC-193, $32,900, 0425 726 027 Geelong. SUBARU, Impreza, 2002, RS, 2.5L, sedan, silver AC, PS, 5 speed manual, brand new tyres, RWC, EC. Must sell. RNC-870. $15,000 ono. 0407 804 226.

TOYOTA, Conquest, 2000, 1.8lt, 5 speed, 239,000kms, manual, AC, PS, EC, $5,500 with RWC, PYG-643. 5243-0451 Belmont. TOYOTA, Echo, 1999, 3 door, 5 speed, manual, silver, rego Dec 2010, RWC, AC, alarm, remote central locking, alloy wheels, RHN-154, $5,000 0413 525 851 Grovedale.

SUBARU, Liberty, 2004, Luxury model, wagon, full electrics, AC, leather interior, 140,000kms, tinted windows, SRD-373. $20,900. 0411 720 092.

TOYOTA, Hilux, tray, November 1999, 2.7Lt, petrol, with canopy, 280,000kms, RWC, PYQ527, $8,500. 0417 520 136 Drysdale.

SUBARU, Outback, 2007, MYO8, 1,6000kms, manual, AC, electric sunroof, WGF-711. $39,425. 0438 221 021.

TOYOTA, Prado, GXL, diesel, auto, 2007, 12 months reg, new tyres, just serviced, 90,000kms, UWX-252. $45,000. 0408 366 608. Wallington.

TOYOTA, Camry, sedan, 2001, 2.4 ltr, auto, 85,000kms, RWC, full service history, RJU-988, $10,000. 0412 695 584 Newcomb.

TOYOTA, Camry, parchment, 1998, auto, central locking, new tyres, low kms, like new, RWC, OYL141, $9,000. 03 52614351 Torquay. TOYOTA, Camry, Conquest, 2001, 4 cylinder, auto, AC, PS, central locking, electric windows, airbags, RWC, EC, RJW-940, $6,900. 0409 381 757 Ocean Grove. TOYOTA, Camry, ALtise, 2005, 2.4lt, auto, low kms, sedan, full service history, RWC, many extras, TJJ130. $23,600ono. 0419 612 583.

TOYOTA, Seca, hatch, 1991, GC, second owner, 169,000kms, blue, QZZ660. $2,800 with RWC, or $1,800ono. 0400 359 107 Geelong.

TOYOTA, Starlet, 1997, manual, hatch, CD, AC, 226,000kms, great condition, fuel economical, RWC, OLW-071, $3,200 0434 054 336 Geelong West. TOYOTA, Yaris, 2007 series, auto, 1.3L, 5 door, 15,400kms, EC $17,200neg. UJO-829 0401 737 591. TOYOTA, Yaris, 2006, auto, 1.5L, 3 door, blue, EC, 63,000kms, UBF-148, $12,750. 0423 712 842 Geelong.

AUTO SERVICES /REPAIR TOYOTA, Camry, 2004, V6, auto, sedan, 103,000kms, black, reg 10/10, RWC, full service history, TDC-388, $15,900. 0418 533 050. Moriac.

AAA Mitch’s Car Removals and Towing. Cash paid for complete vehicles, also scrap metal and farm machinery. Phone 0420 671 711. LMCT 10724


GENUINE FORD, BF, BA, XR car bra, and mirror covers, EC. $250 ono. 0404 178 948. LANDROVER, Discovery, II, TD5, owner handbook $70. 5243-6424.

BOAT TRAILER, custom made, drive on/off, to suit 4 metre, never been used. 597-747. Cost $2,500. Sell $1,850. 0407 560 410, St Albans Park.

TRAILERS 6’ x 4’ Trailers NEW - $599 Huge range available

TRAILER WAREHOUSE 1/56 Sun Street, Moolap

WINDSOR, pop top, 16’, 1998, roll out awning, full annexe, 3 way fridge, electrical brakes, single beds, GC. $16,000. 52751893, Corio.

WRECKING

ABC CAR REMOVALS CASH PAID  $50 - $500 

C826949-KK31-10

AA FREE CAR REMOVAL Prompt, friendly service. 5248-1122, all hours. Portside Auto Wreckers. All makes and models. Open 6 days a week.

Cars, utes, trucks & vans. 25hrs 8 days/week Ph 0419 002 323

CORIO AUTO WRECKERS CAR REMOVAL

C753959-MD1-10

LMCT 10471W

COMPASS, poptop, 1993, 16ft with annexe, 2 single beds and many extras, $14,500. 5275-2795 Corio. EVERNEW, poptop, 1996 model, 18ft, dual axle, large awning, 2 single beds, 12 volt/240 volt lights, dual gas bottles, wind up aerial and extras, very nice condition van, reg: F16019, $17,700. 0419 570 893 Teesdale. FREEDOM, caravan, immaculate condition, many extras, plus annexe, awning, $21,000. 52554368 Ocean Grove.

Top Prices

LMCT 4464

264 Thompsons Road North Geelong

5278 8588

SUZUKI, DRZ400E, full Yoshi system among approx $3,000 worth of extras, super reliable, fast and ready for the trails, regretful sale, 4,000kms, rec reg 84431. $4,000ono. 0400 122 825, Newtown.

FARM VEHICLES/ MACHINERY WATER TANK TRAILER, custom made, ideal for fire control, 1000lt, 5.5hp pump, BFI hose reel, as new. $500 deposit, 2 weeks wait. $2,990. Email for pictures, matskinner@yahoo.com. au. 0407 677 359. Lara.

WANTED TO BUY

CARAVANS WANTED Anything Considered Phone: 5248 6070

ISLANDER, caravan, slide on, EC, DB, 4 x 2080, many extras, (fits onto a Ford F250). $20,000 ono. 0424 720 424. Moolap.

MOTORCYCLES KAWASAKI, ZZR1100, 1992, great sports touring bike, RWC, September 2010 rego, FO-128, $5,000. 0439 048 636 after 4pm North Geelong.

C784964-KK17-10

C774643-JL12-10

TUB, for sale, 2006 Holden Rodeo, king cab, white, $550 neg, 52743154 Corio.

CAMPER TRAILER, off road, electric brakes, 85 litre water tank, stainless steel kitchen, queen bed, tent annexe, EC, registered, $9,000 ono. 5245-6829 Waurn Ponds.

CASH FOR CARS & CAMPERVANS

JAYCO, caravan, 1985, full annexe, bunks, stove, 3 way fridge, $9,000. 0428 418 722 Leopold. MOTORHOME, Bedford, 30ft, petrol motor, goes well, fitted out with all new fittings, shower, toilet, hot water etc. $34,000 neg. Vin6172005. 5593-3229, 0437 661 197.

C753966-MD1-10

RIMS, Sunrasia, x 5, Goodyear, 5 stud Ford, 235/75, 80% rubber, VGC. $600. 5258-3516.

Ph: 5248-6070

Phone: 5222 1606 LMCT 1433

Geelong Property

Geelongs largest

BOATS & MARINE

DINGHY, 8ft 6in, brand new, fibreglass, large volume, from $580. 0412 437 157 Geelong.

Newspaper

distributed to homes every week in Geelong, the

Bellarine Peninsula and Surf Coast. Geelong Independent

$15,631.90

$26,031.90DRIVEAWAY Auto, A/C, P/S, P/Windows, ABS, Alloys, Leather Trim, 7 Seater, Genuine 61,000 Kms. RXZ-540

DRIVEAWAY

1

2

Auto, Climate Control A/C, P/S, P/W, Alloys, Dual Airbags, ABS, 7 Seater, Turbo Diesel. PWM-377

$86.68pw

$53.36pw

01 LANDROVER OVER FREELANDERR SE

06 NISSAN X-TRAIL ST-S 40TH ANNIVERSARY VERSARY

AUTO, V6, HARD TOP

5 SPEED MANUAL was $16,671.90 NOW

$11,471.90

$15,631.90 DRIVEAWAY 5 Speed Man, A/C, P/S, P/Windows, Alloys, Front Nudge Bar, Factory Sunroof, Get in Quick. UEU-034

DRIVEAWAY

3

$51.69pw

02 PROTON WAJA SEDAN 01 VW GOLF HATCH

4

Auto, V6, A/C, P/S, ABS, Dual Airbags, Alloys, Comes with Hard Top. RON-644

$40.02pw

04 TOYOTA COROLLA ASCENT HATCH

97 TOYOTA TARAGO GLI

AUTO

$7,311.90

$26.70pw

DRIVEAWAY Auto, A/C, P/S, P/Windows, ABS, Alloys, Rear Spoiler, Low Kms. QYC-546

$10,431.90

$36.69pw

$10,431.90

$36.69pw

$11,471.90

$40.02pw

DRIVEAWAY DRIVEAWAY DRIVEAWAY 5 Speed, A/C, P/S, Airbags, ABS, 5 Speed Manual, 1.8 Ltr 4 Cylinder, Auto, Dual A/C, P/S, 8 Seater, 2.4 Ltr Looks & Goes Like New, 1 of the A/C, P/S, Excellent Service History. 4 Cylinder Economy, Great People 5 best, 3YR RACV Warranty. RNA-647 6 SZW-748 7 Mover. SAB-885 8

MY04 MAZDA BRAVO TRAY

03 VY HOLDEN COMM EXECUTIVE SEDAN

04 RENAULT SCENIC EXPRESSION

04 FORD BA XL TRADESMAN TRAY

$11,471.90

$11,471.90

$12,511.90

$13,551.90

$40.02pw

$40.02pw

$43.36pw

$46.69pw

DRIVEAWAY DRIVEAWAY DRIVEAWAY DRIVEAWAY Auto, A/C, P/S, P/Windows, Alloys, Column Auto, Bench Seat, A/C, P/S, 5 Speed Manual, A/C, P/S, 3 Seat Auto, A/C, P/S, ABS, Cruise, 16" Cruise Airbags 2 0 Cruise, 8 Airbags, 2.0 Ltr 4 Cylinder Alloys, Alloy Tray, Tow Bar, and Only Bench, Tow Bar, Only 135,000 Kms. Alloys, Only Travelled 141,000 Kms, 9 Silver Duco. SMX-096 10 Economy, Great Value. TKK-978 11 132,000 Kms. TBF-553 12 XVY-005

98 SAAB 9.3 CONVERTIBLE

02 VW BORA 2.0 LITRE SEDAN

99 MAZDA MX5 SPORTS 04 VW GOLF SPORT COUPE HATCH

LEATHER, ABS

$13,551.90

$46.69pw

$14,591.90

$50.03pw

$14,591.90

$50.03pw

$14,591.90

$50.03pw

DRIVEAWAY DRIVEAWAY DRIVEAWAY DRIVEAWAY 5 Speed Manual, A/C, P/S, Hard Auto, A/C, P/S, Dual Airbags, ABS, P/ Auto, P/S, Climate Control, Leather Auto, A/C, P/S, Dual Airbags, ABS, Cover & Soft Top, Alloys, Excellent Windows, Sport Seats, only Travelled Trim, Factory Sunroof, Alloys, Silver Cruise, Alloys, Electric Soft Top. 13 Duco, Only 83,000 Kms. SAC-248 14 History. QJC-034 15 113,000 Kms. TFW-627 16 PLM-960

01 SAAB 9.3 DESIGN EDITION CONVERTIBLE

03 SAAB 9.3 ARC SPORT 08 PEUGEOT 307 HDI WAGON SEDAN

AUTO, ALLOYS

$15,631.90

$53.36pw

$15,631.90

$53.36pw

MY04 HONDA CRV W WAGON

TURBO DIESEL

$16,671.90

$56.69pw

DRIVEAWAY DRIVEAWAY DRIVEAWAY Black Duco, Leather, Climate 5 Speed Manual, A/C, P/S, P/ Auto Dual Zone Climate Control Auto, Control, S Alloys, Excellent Controlled A/C, P/S, P/Windows, Rear P/S, P/Windows, Full Leather Trim, Windows, ABS, 17 Factory Sunroof, Alloys. TEE-813 18 Service History. WDH-955 Spoiler, 97,000 Kms. RDA-514

07 FORD XR6 MKII BF UTE

1 OWNER, 58,000 KMS

$23,951.90

$80.03pw

07 PEUGEOT 407 HDI TOURING WAGON

04 VOLVO XC 90 A 22.5T AWD 5T

7 SEATS, ABS

$30,191.90

$17,711.90

$60.02pw

DRIVEAWAY Hard To Find, Auto, A/C, P/S, Dual Airbags, 2.0 Ltr 4 Cylinder, Silver 19 Duco. SQB-177 20

BMW X5 EXECUTIVE WAGON

ONLY 82,000 KMS

TURBO DIESEL

$103.36pw $35,391.90 $117.13pw

$36,431.90

$131.80pw

DRIVEAWAY DRIVEAWAY DRIVEAWAY DRIVEAWAY Twin Turbo Diesel, Diesel Auto Auto, Climate Service Books Books, Black Leather Trim Trim, 1 Owner, Only 58,000 Kms, Auto, A/C, Navy with Black Leather Trim, Auto, Sunroof, Alloy Side Steps, All BMW P/S, Tonneau Cover, Rear Sports Bars, Climate Control, ABS, T/Control, 7 Seats, Control, Leather Trim, Alloys, ABS, 22 74,000 Kms, Full Books. S/N: 743 23 Luxury Appiontments. XSW-429 24 Tint, New Car Warranty. UZT-615 21 Alloys, Great History. TAB-7736 PAYMENTS BASED ON 60 MONTHS WITH 35% DEPOSIT EXCLUDING ON ROAD COSTS @ 11.95% T.A.P. TOTAL REPAYMENTS 1. $22,536. 2. $19,939. 3. $9,973. 4. $12,139.40. 5. $13,439. 6. $13,007. 7. $11,273. 8. $13,439. 9. $14,305. 10. $14,305. 11. $14,305. 12. $11,707. 13. $12,139. 14. $11,707. 15. $10,839. 16. $9,107. 17. $7,373. 18. $11,273. 19. $9,973. 20. $12,571. 21. $17,339. 22. $14,739. 23. $20,802.

Mike Hanneysee Car Sales LMCT 900

139 FYANS STREET, SOUTH GEELONG / www.hanneyseecarsales.com.au

PH: 5221 8888 Justin: 0409 549 247 Mike: 0414 985 970

nd

stil

46 YRS

in

l

TANDEM CAR TRAILER, used, heavy duty, checker plate floor, (11’ x 6.3’) electric brakes and control console, winch, load sharing suspension, 90% 8 ply tyres, 12 months reg, $3,200. 0407 776 393 Portarlington.

circulating

was $28,111.90 NOW

go

SAVAGE, Osprey, OECB, 5.4, 2006, 115 mercury outboard, 26hrs, drive on/drive off trailer with brakes, trans door, rear lounge, canopy and sides, carpet, under floor tank, all guages and instruments, always garaged, as new, suit new buyer, includes all safey gear, boat and trailer, reg. until 2011. $30,000. 0418 519 078. 5257-1767. St Leonards.

REGAL, pop top, caravan, 15’ 6’’, new microwave, new tyres, new inner spring mattresses, electric brakes, awning, Hayman Reece sway bar system, annex, water proof cover, one year reg, $23,000ono. 5253-2747 Clifton Springs.

7 SEATER, DIESEL, AUTO

ONLY 61,000KMS

g str o

Some pics for illustrative purposes only. E & OE

46 YEARS CONTINUOUS TRADING IN GEELONG : RACV

420784-JF31-10

CARAVANS AND TRAILERS

TRAILER, full tilt car trailer, 17’ fully enclosed with winch, EC. $6,200ono. 0418 565 041.

99 SERIES III LANDROVER TD5 WAGONN

ng

AUTO PARTS/ ACCESSORIES

02 MITSUBISHI SHI NM PAJERO EXCEED EED

a

Ph or txt HELEN on 0433 761 963

TANDEM, trailer, 8’ x 5’, in excellent condition, reg S69071, $1,900. 0418 144 620 Corio.

GREEN LIGHT APPROVED DEALER : RACV WARRANTY : RACV TESTED VEHICLES : 46 YEARS CONTINUOUS TRADING IN GEELONG : RACV WARRANTY

C828716-JM31-10

LEARNING THE SAFE SYSTEM OF CAR CONTROL

CARAVANS AND TRAILERS

APPROVED CARS

RACV TESTED VEHICLES : 46 YEARS CONTINUOUS TRADING IN GEELONG : RACV GREEN LIGHT APPROVED DEALER : RACV WARRANTY : RACV TESTED VEHICLES :

DRIVING SCHOOLS

: RACV GREEN LIGHT APPROVED DEALER : RACV WARRANTY :

gecirc9x1-417355

The Independent, Friday August 6, 2010

57


AN INDEPENDENT ADVERTISING FEATURE 04MS263526 19DC266341

UTES

HIRE

Call our friendly staff for a quote

8288

215 Station St CORIO

Independent

Land Rover & BMW

403212-SH19-10

PH: 5275

Specialists

Darby’s Paint Place expert staff Anthony Spanninga, Gayle Gordon, Megan Brown and Sam Martin.

Offering the right product to 5229 4299 make your car look new again

Latest Computer Diagnostics. Over 30 Years Experience.

9 Autumn St, Geelong West

2004 SUZUKI BURGMAN SCOOTER 400CC

DRIVEAWAY

$4,000

CAMPERS

W

172 Fyans St, South Geelong frankburgecars.motorsm.com

487011-KS27-10

58

The Independent, Friday August 6, 2010.

W NO ING IC V R SE SKI’S T JE

Ph: 5248 8813

336 Portarlington Rd, Moolap

TUNE UP FOR WINTER Fork Seals Suspension set ups Chain & Sprockets Tyres & Spares All major brands

Touch Up Guys Peter McLaren and Ron Ford.

LOCATED AT 10B MAXWELL AVE, BELMONT Behind BJT www.motocraft.com.au

BARWON TYRE CENTRE STEEL RADIAL 205/65R15

CUSTOM MIXED PAINT We can mix it for you while you wait, in aerosol to 20lt. Just bring in your paint code. ★ Automotive

★ Industrial

30AA301476

$79

482826-FB25-10

5222 1606

Where they live, eat, sleep & breathe Motorcycles

www.motorcycleservicecentre.com

WANTED CASH PAID LMCT 1433

• Manufacturer Approved Servicing of all Japanese, European and American Motorcycles, Scooters and ATV’s including First Service • Personal Watercraft and Powerski servicing and repairs • REFLEX engine management Tune-Scope and fault diagnostics to suit all fuel-injected bikes • Engine & transmission reconditioning including crankshafts & cylinder heads

420781-JF32-10

Auto, 15,500 Kms, 400cc. FD-477

hether it’s harsh weather conditions or an unfortunate bingle that has caused paint damage, Darby’s Paint Place is always available to help clients choose the right products to get their vehicles looking brand new again. Darby’s Paint Place prides itself on quality service with qualified and experienced staff on board. Manager Anthony Spanninga says Darby’s has a full range of stock in store, including automotive paints, industrial finishes and specialty coatings. “Why go anywhere else,” Mr Spanninga says. “We are the only automotive paint specialists in Geelong and we are dedicated to providing the right advice for customers to do the job once and do it right.” “So whether it’s a car, truck, tractor, motorbike or a boat you need to re-paint, drop into Darby’s Paint Place for reliable advice and a great selection of quality products. “Think paint, think Darby’s,” Mr Spanninga says. Darby’s Paint Place is at 413 Moorabool Street, Geelong, opposite Kardinia Park. For more information phone 5229 3884.

5221 8877

WHEEL ALIGNEMENT, ROTATE BALANCE AND TYRE PRESSURE

STEEL RADIAL 215/60R16

$99

Suit Large Car

TRUCKS

9 Gordon Ave Geelong West

PROUD SPONSORS OF:

$55

Ph: h: 5241 19 1944 15 Settlement Road, Belmont

413 Moorabool Street, Geelong

5229 3884

(Corner Curtis Street)

487676-JF28-10

HIRE

cuffed and damaged bumpers are ugly. They diminish the value and appearance of the best cared for vehicle. Stone chips and dull paint can make your vehicle look tired and years older. Let Touch Up Guys renew the look of your vehicle. Touch Up Guys can save you considerable time, money and minimise inconvenience as we come to you. Most basic repairs cost less than your insurance excess. We can repair minor damage to your vehicle on site, with most jobs completed within a few hours – all that’s required is access to a power point. Payment by Credit and Debit card is now accepted so it’s even easier Touch Up Guys has serviced the Geelong region of more than 10 years and has been an established national entity within the motor vehicle industry for more than 15 years. There are currently in excess of 140 vans covering Australia and New Zealand. Touch Up Guys use a computerised colour system that enables us to mix and match the required colour for your vehicle with quality two-pack paint. The service includes the repair and re-spraying of bumpers, mirrors, grilles, mag wheels, door and body moulds. Sun affected (yellowed) headlights can also be restored. Major panels can be tidied up with a cut and polish and repairs to minor scratches and stone chips. Children behind vehicles can’t always be seen. Reversing sensors have proven to be effective in detecting obstacles, greatly reducing the chances of damage, and even minor, but costly car park mishaps. Touch Up Guys is also authorised to supply and fit the CouplerTec electronic rust proofing system. For information contact www.touchupguys.com.au or phone Ron 0410 622 629 or Peter 0414 852 477 for a no-obligation quote.

S

BUSES

30DC301472

VANS

422706-FB36-9

CARS

Get tomorrow’s window tint today

Suit Large Car

HIRE

Vehicle paint repairers come to you with new products

333274-KS09-10

TRUCK CAR RENTALS


ELECTRICIANS

CONCRETE SERVICES

• Sheds • Exposed Aggregate • Colour • Garages • Driveways • Paths • Crossovers • Quality Workmanship

SOLUTIONS

• Extensions • Period Restorations • Site Management • Decks • Pergolas • Carports • Staircases • Arbours • Gates • Balustrades

Ph: 5250 4638 RELIABLE & FRIENDLY SERVICE - HIA MEMBER LIC NO: DBM - 34081

Antenna Works

Ph: Phil

For all types of asbestos products Type A & B. Prompt Service FREE QUOTES

0468 600 249

3 rooms $70, 4 rooms $80

EXPERIENCED TRADE QUALIFIED CARPET & VINYL LAYER House Lots Small Jobs Repairs Enquiries & Free Quotes NOW OVERLOCKING CALL DEAN 5257 3826 or 0412 047 731

C753846-KS01-10

C684914-JM2-9 685014-JM2-9

CARPETS/CARPET LAYING

• CUSTOM DESIGNED • QUALITY MATERIALS All work guaranteed - For professional & friendly service

Ph: Steve 5256 1887, 0438 561 887

n l y US NOW! o s m o Bathro 0401 517 954 RUTHERFORD EARTHMOVING EARTHMOVI EA

JUST PALING FENCES

Services all points on the Bellarine ************************************************************** A quality fence at an affordable price For a FREE quote & friendly advice

CALL DARRYL on 5255 1931 or 0407 694 422

✭ Mini Bins also available ✭ Site Cuts

0408 521 806

Phone Dominic 0418 315 889

Di Pasquale Concreting ✔ All types of paving ✔ House Slabs and commercial work

0423 427 764

C753874-SJ1-10

THE FENCING PEOPLE FREE QUOTE ON ALL TYPES OF FENCING AND GATES

TELEPHONE 0432 085 336 5248 0005

Specialising in:  Paling  Picket  Merbeau  Gates made to order  Demolition & Removal

C808388-KK25-10

ELECTRICIANS

0424 386 398

GROVE ELECTRICAL All types of electrical work. No job too small. Free Quotes. Pensioner Discounts.

0404 022 952 Rec No. 16943

For all types of Fencing in the Geelong and Bellarine Peninsula area.

C753879-MD1-10

✭ Post Hole Digger

C753828-SJ1-10

0408 106 033 040

LEVIGRIND CONCRETE GRINDING AND POLISHING • Glue Removal • Floor Prep and Levelling • Flake Flooring • Concrete Sealing

WANT A QUALITY FENCE? AT A COMPETITIVE PRICE? THEN CALL

TOM’S FENCING C824968-SH30-10

• 2 tonne back hoe & tipper • Grass Slashing • Site/Rubbish Removal • Cheap Rates

C684994-SJ2-9

AUZ FENCE

• Paling • Pickets • Gates • Repairs • Domestic & High Wind Areas For a free quote contact

Gimme Shelter

CONCRETE SERVICES

C749601-JL50-9

C779106-JL15-10

C819917-JL28-10

Call Charlie 0413 580 990 or 5255 5749

Kirt 0450 557 191 or Noel 0416 659 357

BOBCAT/EARTHMOVING

HIRE

Specialising in • Paling • Colorbond • Merbau Free Quote with the right price advice

For obligation free measure & quote CALL 1800 676 448

C820648-KK29-10

CALL

C684939-BG2-9

BOBCAT & EXCAVATOR

AFFORDABLE FENCING BY BASIC FENCING

We custom build to your budget

CARPORTS - VERANDAHS PERGOLAS - DECKS - PVC BLINDS * TIMBER * STEEL * COLORBOND

FENCING

Phone: 5255 4366 Fax: 5255 4388 Mobile: 0408 547 129

0418 338 720

Tired of your outdated bathroom?

Brett’s

C753870-SJ1-10 C684987-BG2-9

DECKS & PERGOLAS DECK RESTORATION

RESIDENTIAL

Servicing Geelong, the Surf Coast & Bellarine Peninsula Quality workmanship Call Grant Finlayson

Using Lysaght Colorbond Structural Beams or Timber Framework • Garages • Carports • Pergolas • Decking Ph/Fax 5255 5535

the best COSTS LESS than you think Want a FREE quote?

FENCING AND GATES

BARWON

Outdoor living and Entertainment Areas

CLEANING SERVICES

1300 673 532

Geelong, Surfcoast, Bellarine Peninsula, Northern Suburbs

DECKS/ PERGOLAS

& ns Plarmits Pe

7 days a week anywhere

Call us for a Free No Obligation Quote

✓ Install, service and repair ✓ Clean, courteous & professional ✓ Licensed and insured, REC 20221 ✓ 24hr Emergency Service

C684982-BG2-9

C827894-JL31-10

• Pensioner discounts • Fast Drying • Includes Deodorising

ALL TYPES OF CONCRETING COMPETITIVE PRICES NO JOB TOO SMALL FREE QUOTES Darren Brett 0410 062 144 0415 499 903

CEILING INSULATION - ELECTRICAL SAFETY INSPECTIONS

✓ No Call Out Fee (Bus. hrs) ✓ Most jobs within 48 hours ✓ Small Jobs Welcomed ✓ Locally Owned and Operated

450218-JF11-10

Carpets, Curtains, Lounge Suites Free deodorising. Quick dry method.

CONCRETERS

C734177-KK41-9

Andy’s Carpet Steam Clean

☎ Carlo 0417 145 126

C815678-JL27-10

435

APPROVED REMOVALISTS

BATHROOMS & KITCHENS

REC 13420

Carlocal

➤ Palings ➤ Pickets

➤ Gates ➤ Colorbond

All manufactured locally

➤ Powdercoated ➤ Balustrades Competitive Rates

Call for a free quote on 5253 1750, 0412 545 183, 0411 272 080

The Independent, Friday August 6, 2010

269651-TJ45-4 C269651-KK26-8 C753886-MD1-10

Bricklaying - Paving Maintenance & Repairs Tony 0417 350 5253 2490

GARY’S ANYTIME CARPET STEAM CLEAN

ac A s b e s t o s C l e a r A w a y a Specialist in all types of Domestic and ac Commercial Asbestos removal a FREE QUOTES ac 5282 5099 / 0419 886 018 a

0409 865 988

0409 865 988 Free Quotes Reasonable Rates Domestic• • Commercial • Industrial Installation • Repairs • Maintenance Prompt Professional Service • Servicing all areas

C800909-JL23-10

Masonry & Green

ASBESTOS REMOVALS AND CONSULTANTS

Ph KPS on 5221 1030

Dallas Beasley Dallas Beasley

CONCRETING Quality Work Guaranteed

BRICKLAYERS

Free quotes 0449 181 975

ASBESTOS REMOVAL

Nick 0403 496 007, Joe 0402 015 506

(REC 17122)

Southern Stars Electrical

Specialising in exposed aggregate and colour concrete.

C688809-JL5-9

Ph: 5241 6111 or 0438 880 066

Call Paul 0438 882 338

• All types • Domestic and Commercial • Prompt Service • Free quotes

DBL 17206

C782916-SJ16-10

C753821-KS01-10

ALL AREAS 7 DAYS

Domestic Electrical Specialist

REGISTERED BUILDING PRACTITIONER

CARPET CLEANING

• TV Antennas • Digital Set-Top Units • TV Outlets • Tuning TV / VCR • Phone Points • Home Theatre Set-Up • Boosters / Amplifiers • MATV

NEW WAVE ELECTRICS

C754841-JL2-10

Same Day Service Available

Steve 0408 365 216

Prompt Service No Job Too Small

C780426-JL15-10

C684934-JM2-9

C722787-SJ32-9

 131 546 www.jimsantennas.com.au

0413 319 744

All Domestic & Commercial Work All Work Guaranteed 24Hr Emergency Service Pensioner Discounts

C797471-JM22-10

Same Day Response Local Technicians Phone & Data Points Home Theatre Installations FREE on-site Signal Test and Quote

M.B.A.V. NO. 37780

ADI Electrical Services

• New homes • Extensions • Re-wires • Free Quotes • All types of maintenance & repairs • No Job too small

Prompt Service. No job too small

Timber Verandahs, Carports, Decking and New Distributor for STRATCO OUTBACKS

Ph: 0431 730 449

C755441-JL2-10

Scotty German 0400 211 961

Free quotes

CRYSTAL CLEAR TV RECEPTION!

C792761-JL20-10

For friendly service call

• Garage Floors • Extensions • House Slabs

Westcoast Pergolas

Nth Geelong 5277 2466, Leopold 5250 5858

Antennas

SPECIALISING IN: • Exposed • Footpath • Faux Brick • Crossovers • Colour • Layback • Plain • Curb PHONE FOR FREE QUOTE

N& J Concreting • Driveways • Crossovers • Paths

C781468-KK16-10

p

Qualified Technicians, All Areas, 7 Days

Bellarine & Geelong

DRIVEWAYS ONLY

Restorations, Repair timberwork ready for paint, Timber window rebuilds, Decks, Pergolas, All concrete works, General carpentry, Bathrooms, Insurance job specialists.

C753835-KS01-10

 Amplifiers  Home Theatre Installations  Supply & Install Set top boxes  Television & Phone Outlets  Satellite Television  TV, VCR, DVD Tuning

C753824-KS01-10

Same Day Service Free onsite signal test and quote

JIMA103

Friendly Service

0409 705 598 ASK FOR JOHN.

We guarantee the best reception in town

    

REC: 17790

Ph: 0417 005 081 C79284 C792843-JL20-10

Email: beechmor@bigpond.com

Rob 0439 785 703

ELECTRICIAN Always on time.

Domestic & Commercial Geelong Owned/Operated

Rec 17513

Building

ALAN POPPING

C717334-SJ27-9

QUALITY WORKMANSHIP

PHILLIPSC O N C R E T E c o n s t r u c t i o n s p t y l t d

C755444-JL2-10

BEECHMORE

C755507-SJ2-10

BUILDERS

C780320-JL15-10

>Digital Reception >Free Quotes - Servicing all Areas > All work guaranteed >Satellite Installation >Wi fi Networks > Difficult Reception Areas >Home Theatre Systems >Telescopic Masting 20-50ft

DEADLINE: 2PM MONDAY PHONE: 1300 666 808

C819772-JL28-10

C777654-JL14-10

•FREE QUOTES & ADVICE •EXTRA POINTS •TV TUNING •AMPLIFIERS (BOOSTERS) •DIGITAL ANTENNAS •DIGITAL SET TOP BOXES

C727889-KS36-9

ANTENNAS

startrades.com.au

59


DEADLINE: 2PM MONDAY PHONE: 1300 666 808

startrades.com.au

Mob: 0417 314 987

Call Mike on 0418 389 865

0419 273 527 AH 5267 2008

130670

C819944-JL28-10

C796831-JL22-10

Winter! PREPARE FOR THE GROWING SEASON Gardening, Rubbish removal, Gutters cleared, landscaping, Expert pruning, Mulching, Ride-on mowing

Gateway

C802812-JL24-10

• Bathrooms • Kitchens • Laundries

60

C803372-JL24-10

The Independent, Friday August 6, 2010.

KEVIN MURRAY’S LANDSCAPING & PAVING PAVING & LANDSCAPING JOBS 26 years exp. PHONE FOR A FREE QUOTE

C812153-JL26-10 C827184-KK31-10

No job too small! Suspended ceilings, office fit outs. Doors and windows fixed. Ph: 5255 2751

Mob: 0417 512 252

• Extensions • Renovations • Patch Ups

• No Job Too Small • Pensioner Discounts

Phone Dave 0415 507 113 AH: 5243 5810

C685061-BG2-9

0417 263 624 OR 5244 1558

PLUMBING

MGP

PPONDS LUMBING

LANDSCAPING ★ Retaining Walls ★ Paving ★ Turf ★ Ponds ★ Decking ★ All aspects of gardening Friendly prompt service

Michael 0433 900 811

& GASFITTING

SPOUTING & DOWNPIPES REPLACED

• Hot water service change over • New homes & Renovations, rainwater tank installations Gasfitting, repairs and service & all general plumbing

Member of Building Services Australia

Precision Plumbing Lic. No. 42245

All Plumbing and Gas fitting • Sewer Blockages • “For good old fashioned service at affordable rates”

LIC NO. 40250

341 967

ALL AREAS 7 DAYS

PENSIONER DISCOUNTS

P.O. BOX 1756 GEELONG 3220 PH: DALE 0407 007 743

Ben Costin Plumbing & Gas • Heaters installed, serviced & repaired • All domestic & commercial gas fitting • All general plumbing, drain blockages, burst pipes & hot water changeovers • 24 hour emergency service

C746842-KK49-9

Turf n Scape Solutions

0437 940 074

LIC NO 49068

All Domestic Plumbing Hot Water Leaking Gas Services Taps Stoves

0412 594 991

• Sheds • Decking • Pergolas

Prompt & Reliable service

D.S.M. PLUMBING

• Landscaping & Garden Creations • Retaining Walls • Decking • Paving • Feature Screens • Brick & Garden Edging PH

☎ David Lafranchi 0408 146 270

Contact Dan Field 0402

DOM’S HANDYMAN & GARDENING SERVICE

• Synthetic Grass • Mini Excavations • Carpentry

Good Old Fashioned Home Maintenance Ph John 0408 194 926 / 5251 1448

ROBBO’S

PLASTERING, CARPENTRY & HANDYMAN

D B Plastering

Call Steve 0437 249 819

• rental property repairs & maintenance • carpentry • tiling • pergolas • kitchen & bathroom renovations • locks/doors• plastering • painting • concreting • rubbish removal

All jobs large and small, inside and out. Affordable Prices. Pensioner Discount.

FULLY QUALIFIED ED • Paving • Concreting • Exposed Aggregate ggregat • Decking • Pergolas • Brickwork • Retaining aining i g Walls ing Wa W • Garden Lighting • New Lawns/Synthetic Lawns cL Law • Plant Design & Installation • Complete Garden Makeover FREE QUOTES

Timber & Brick experts Site Cuts Excavator & Bobcat Hire

Ph/Fax 5250 4646

0410 491 352

Design  Construction on  Mai Maintenance Ma M aint inte t nc

Retaining wall specialist’s

0425 729 603

Ph: Kevin NOW!

Janleigh Landscapes andsc sc ca apes p

CUT PRICE WALLS

Carpentry Tiling Painting Maintenance

A.Y.N Home Repairs

WATTLE BIRD Gardening & Lawn Mowing Services MOWING REMOVAL We take theAND hard RUBBISH work out of your garden Steve, Ben & Monika 5281 1448 / 0439 811 330 Steve & Monika 5281 1448 / 0439 811330

• • • •

ALL AREAS & FULLY INSURED • CREDIT CARD FACILITIES • FREE QUOTES

Winter = Pruning time

• MOWING • WEEDING • LIGHT PRUNING GARDENING, LAWN • SOIL ALL PREPARATION • RUBBISH REMOVAL

Fences Bathrooms Kitchens Plastering

HOME MAINTENANCE

131 546

Call David Forbes 0437 381 872

C806265-JM25-10

• • • •

ABN 48403745679

PETER

MORE than just mowing!

Lawn Mowing Weed Suppression & Control Winter Pruning Fruit Trees, Ornamental Pruning Gutter Cleaning Green Waste Removal Pre Auction Makeovers Let us get our hands dirty, not yours! Geelong & Surfcoast Garden Maintenance

Imants The renovator man, all jobs big & small he can, DO Coz he has lots of glue, tools, nail gun & ladders too! Don’t stall, give him a call, for a quote or hourly rate, he’s ya mate!

Paving Brick Laying Stone Work Mini Bobcat DIY Assistants Over 20 Years Experience

PLASTERERS

Call Ashleigh: 0407 001 041

All Carpentry Repairs & Maintenance • Weatherboard Replacement • Timber Window Repairs • Sash Cord Replacement

0417 524 214

☎ Scott

0418 138 141

LANDSCAPING

C822433-JL30-10

Ray Williams - Carpenter

Ph: 5229 2517

• GARDEN TIDY UPS • RUBBISH REMOVAL Free Quotes Professional Service 0422 063 or 5241 5330, 5241322 5330 or 0422 063 Grovedale 322 Gary Rochow (cert in horticulture)

www.jimsmowing.net

or 5241 4889 AH

* * * *

S&K Paving 5229 8557

C706200-KK18-9

• HEDGE TRIMMING • MOWING • PRUNING • GARDEN TIDIES • GARDEN LAYOUTS • MULCHING • PAVING/LANDSCAPING • PRE SALE CLEAN UPS • SYNTHETIC/NEW TURF LAID • WATER TANKS INSTALLED

DIAL-A-GARDENER ☎ • LAWN MOWING • RIDE ON MOWING

es c hi s FranNow le il a b Ava

0419 894 442

Greg Meehan

• Specialising in Bathroom Renovations • General Carpentry / Pergolas Decks / Verandahs • Painting/ Plaster Repairs/ Tiling • Landscaping & Irrigation Systems

GARDEN SERVICES

Cert. in landscaping

• Gutters Cleared • Rubbish Removed

Mike Smith - Home Maintenance

5278 0408 662 687 147 100 5265 4811 1104,/ 0438

C753974-SJ1-10

• Painting • Bathroom Renovations • Pergolas

C747266-SJ1-10

Acute Floors

GKM HOME MAINTENANCE • Carpentry • Kitchens • Tiling

Specialising in the sale and installation of • Hydronic heating • Unit changeovers • Evaporative Cooling • Split systems • Gas ducted heating • Nobo panels Please telephone or visit our new showroom for a no obligation free in home appraisal. Suite4, Level 1, 186-192 Latrobe Tce, Geelong 5224 2911



C780239-SJ15-10

Floor Sanding & Polishing Dustless Machines New & Old Floors Free Quotes Quality Guaranteed

13 11 98

C754988-JM2-10

All Areas

C703876-KK16-9

www.jims.net

One call, all trades

C753917-MD1-10

131 546

www.greyarmy.com.au

• Lawn Mowing • Cabinet Makers • Rubbish Removal • Pergolas, Decks • Gutter Cleaning • Carpets Layed • Tilers-Pavers • Roof Repairs • Tree Lopping • Window Cleaners • Appliance Repairs

C685022-SJ2-9

C753895-MD1-10

C684949-JM2-9

• Floor Sanding • Polishing • New and Old Floors • Dustless Sanders

C685019-SJ2-9

• FLOOR SANDING • POLISHING NEW AND OLD FLOORS • PARQUETRY • TIMBER DECKING • DUSTLESS TECHNOLOGY • SUPPLY & LAY

• Handymen • Painters • Gardeners • Electricians • Concreters • Carpenters • Plumbers • Pest Control • Bricklayers • Plasterers

PAVING 300434-TJ10-4

Skilled, courteous, trustworthy tradesmen trustworhy tradesmen

TRENNED PTY LTD TRADING AS

0423 547 765

C755537-SJ2-10

0412 345 257

“For excellence in quality and professional service”

Allan: 0401 989 120 Kev: 0413 159 435

HEATING

C754210-KS01-10

Home, Office, Business, Light Engineering Fabrication Telephone Brain Stap

FLOOR SERVICES

• Boudoirs • Powderooms • Chillout Spaces • Nurserys • Playrooms

C758481-JL4-10

C755548-SJ2-10

painter & decorator TOXIC FREE PAINT AVAIL.

Stap Coastal Services

Rob Holt 0409 222 112

Sam 0402 310 506 or 5275 3897

Any job around the home, quality work. Prompt service. Competitive pricing Tom 0466 614 812

Phone: 0402 174 541

Quality & Affordable Maintenance Service

C684910-JM2-9

C754167-KS01-10

HANDYMAN

HANDYMEN/HOME SERVICES Quality Residential Fencing and Gates Geelong, Bellarine and Surf Coast.

❖ FREE quotes all area ❖ Pensioner Discount ❖ Quality Service

685054-JM2-9 C753933-SJ1-10

C777809-JL14-10

Interior & Exterior

“This product pays for itself” Qualified Horticultural Trainer Free of pesticides & chemicals

C702685-JM15-9

Rob 0415 307 986

Construction and training

Highlight Painting

Ph: 0434 151 950 Lic 52353

C787690-JL18-10

Competitive Prices Free Quotes No Obligation

hireahubby.com.au

C824914-SH30-10

C827742-JL31-10

Pickets & Palings

Start 10%Immediate OFF ALL JOBS

FREE CALL 1800 803 339

Organic Garden

seaview Painting Services 0439 858 298

Fully insured & police checked

C740541-SJ45-9

O’NEIL FENCING

C749608-SJ50-9

• Rubbish Removal • General Garden Care LOCALLY OWNED • Prompt Reliable Service Phone TTom 0400 933 535 5253 2889 Ph

C824135-JL30-10

We supply Contractors and Public, Gates made to order Fencing materials from $25.90 per metre 0413 580 990 or 0407 694 422 38 Marine Parade, Ocean Grove

Plastering Decks & pergolas Painting Tiling Product assembly Doors & locks General home repairs Maintenance & more!

C815656-JL27-10

MOWING AND GARDEN CARE

PAINTERS/DECORATORS

C819874-JL28-10

BELLARINE TIMBER AND FENCING SUPPLIERS

HANDYMEN/HOME SERVICES

Mr. Tap Man C776499-SJ13-10

GARDEN SERVICES

C74955-JL1-10

FENCING AND GATES

• All Types of Maintenance Plumbing • Leaking Taps and Cisterns • Suppliers and fitters of Tapware and Water Filters • Hot water service change over LOCALLY OWNED MARK PODBURY

1300 135 495

0408 599 424 FREE CALL OUT Licence No 37785

C753931-SJ1-10 C685026-JM2-9


PLUMBING

RUBBISH REMOVAL

C768239-JL9-10

RUBBISH REMOVED C705287-KK17-9

We load it for you!

Call Ed for a free quote Phone 0427 700 997

It's Easy to place a Classified Advertisement in the

Junk -We Load It & Take It Away

RUBBISH REMOVAL

Lic 38798

0415 801 334

• Domestic Commercial Rubbish • Estate Clean Outs • Pre Sale Clean Ups • Shop Stripouts C820026-JL28-10

FREE QUOTES FREE PICKUP OF WHITEGOODS & SCRAP METAL THE NO FUSS SOLUTION TO RUBBISH REMOVAL

Telephone: 1300 858 178 (local call) 8.30am-5pm

Fax: 5945 0667, 5222 5320 In Person: Geelong First Floor, 78 Moorabool St

BRETT’S

MINI BINS

0408 521 806 bobcat also available

C751075-JL51-9

FREE QUOTES C753938-MD1-10

Ph: 5244 4591 or 0418 714 674 LOCALLY OWNED & OPERATED

See our range of skylights & ventilation systems, visit

www.scotscoskylights.com.au Call Adrian on 0409 823 177 or 5261 7515

TELEVISION/VIDEO/AUDIO

ROOF www.lookatthisroof.com.au

1800 007 411

INSTALLED TODAY

50% DIGITAL ANTENNAS 7AM - 9PM

0409 888 228 TILING

RUBBISH REMOVAL

Rubbish to Remove?

ANGA K MINI BINS Cleaning up Geelong and surrounding districts. 2.5m, 3m, 4m, 6m & 8m bins

UP TO 7 DAYS HIRE FOR THE PRICE OF 1

SERVICING GEELONG

5248 7199

Call Ron

ASSORTED, dining table, Baltic, seats 6-8 with 6 chairs, mirror with gold edged frame, 73ms x 198cm, Baltic mirror, Baltic shadow boxes x2. $1,200 the lot. 0407 814 438 North Geelong.

ANTIQUE WARDROBE, circa 1900, needs some restoration, $100. 52673051. Winchelsea. AQUARIUMS, with cabinets, 3ft x 2ft x 18”, 4ft x 2ft x 18”, EC. $440 the lot. 0430 222 260, Belmont. ASSORTED FURNITURE, Ottoman, buffet (required assembling), CD rack, entertainment unit, lamp table, dark brown solid hard wood, never been used except for entertainment unit, like new. $770 the lot. 0416 200 063. Norlane West.

0400 023 420

BATTERY, Deep Cycle, 12V, 100Ah, gel battery, suit solar, marine and camping use, in carton with 2 year warranty. $398. 0400 238 731. Portarlington. BBQ, Companion, 4 burner, auto ignition with lid and cover, GC, $150 ono. 5263-3270 or 0432 369 613 Anglesea. BED FRAME, queen, black iron, wooden slats, solid, VGC. $49.95. 0409 857 221. Highton. BED, and base, QS, timber bedhead. Matching dressing table, solid timber, 6 drawers and mirror. $800 for both. 0438 525 010. Leopold. BED, girls three quarter, with mattress, black wrought iron frame with hearts. EC, $400. 52456562.

TREE LOPPING/SURGERY

The Wiz Mobile Computer Service

PROFESSIONAL TREE SERVICES

New Computers

Upgrades

Repairs

Virus and Spyware Removal Dialup and Broadband connections Networking and Firewall Installation

Phone Jeoff on 5244 3701 or Mob 0425 728 336

FULLY INSURED, FREE QUOTES

Tree /Stump Removal, Pruning or Reductions Hedges, Cable Bracing, Root Barriers, Mulching

Phone

5243 7442

For all your advertising needs phone 1300 666 808

489122-JF27-10

geph4x2-793395

SELL YOUR CAR, BOAT, CARAVAN OR TRAILER

Onsite repairs 9am-9pm 7 Days ✔ Computer repairs/upgrades ✔ Virus Removal & software support ✔ Internet & networks set up productiveit.com.au 79 Moorabool St

0402 064 094

Aqua Computers ■ ■ ■ ■ ■ ■

Sales Upgrades Onsite & Workshop Service & Repairs Networking Internet ph: 5229 1357 273a Myers St, East Geelong

BEDROOM SUITE, Girls single bed, mattress, tallboy, bedside table, and shadow box, GC, stained timber. $400 the lot. 0416 286 867. Leopold.

DEB DRESS, size 14, white tafetta, subtle dainty beadwork, lace-up back, worn once, immaculate condition, inspection will impress, dry-cleaned. Cost $500, sell $375. 5241-3789. DINING SETTING, extenable table, 6 chairs, timber, VGC. $350 ono. 5222-8284. Newtown. DINING SETTING, 7 piece, wood, country style, GC, freezer, Kelvinator, large, upright, GC. $410 the lot. 5250-2211 Leopold. DINING SETTING, 7 piece, padded chairs, country style, GC. $300. 0414 742 299. DINING TABLE, extends to 2760cm, 8 chairs, matching buffet and corner unit, E/C. $2,500. Phone. 0409 065 000.

BOOKCASE, 775mm x 1535mm, 5 shelves, $50, TV cabinet, glass doors, 860mm wide, 670mm high, $50. 0414 633 145 Anglesea.

DOLLS OF THE WORLD, x 80, collector’s porcelain dolls, never unpackaged, original costumes. $500. 5941-1412.

BOWLING BALL, with carry bag, size 2v26853, EC. $40. 0435 789 886. Grovedale.

DOORS, new sliding flywire, Woodland Grey, 2x 90cm x210cm, 1x 120cm x210cm. $450. 0412 934 936.

BRICK SAW, as new, B.T. Engineering. $1,750. 52552566, 0412 580 173, Ocean Grove. BUFFET MIRROR, and bar. $25. 0412 524 805. Newcomb. CAMP BEDS, 2, folding beds, only used once, EC. $120 both. 5278-1296. Bell Post Hill. CD HOLDER, timber stained, holds 80 CDs’, EC. Paid $150 sell $30 ono. 5241-8250 or 0422 814 672. Waurn Ponds. CHAINSAW, new in box, Baumr-AG-pro, 62 CC, 22 inch bar, great farm saw, warranty, retails for $895. Sell $275. 0449 594 226. CHAIR, half round tapestry upholstered, VGC $200. 5267-2373. Geelong. CHEF GAS STOVE, upright, fan forced, EC, $250 ono. 0405 210 945 Hamlyn Heights.

COFFEE TABLE, rustic solid timber, 2 full width drawers, EC, 140cm x 78cm $250. 5267-2373. Geelong.

DOORS, three 2.4m x 1.0m tinted mirror sliding wardrobe doors with tracks. $450. 5259-3594. DRIFTWOOD BENCH SEAT, solid construction, very unique. $250 delivered. 0410 521 636. ENTERTAINMENT UNIT, Ledlight, pine, large, and 80cm Sharp TV, both EC. $650. 0408 301 327. ENTERTAINMENT UNIT, large, 2m x 1.2m, and Sony 68cm TV, EC. $350ono. 0417 312 288. ENTERTAINMENT UNIT, 3 piece, Baltic pine, 2 x (2m x 1m), 1 x corner (2m x 75cm), $490. 0415 434 669. Herne Hill. FILING CABINETS, 4 drawer, showroom condition. $100. 0412 381 018. FILING CABINET, 2 drew, metal, cream colour. $20. 0402 072 694. Bell Park. FITNESS, multicardio station, GC, $180. 5277-0512 or 0404 952 421. FLEXI TOOL MOTOR, complete. $400ono. 52419369, 0429 637 543. FREE, Bricks, yellow, pick up only. 0419 597 556. Belmont.

COMMERCIAL, kebab machine, EC, stainless steel. $1,000. 5278-5667. COMMERCIAL EXHAUST canopy, 152cm x 64cm, plus boxes of plastic food packaging containers. $1,300 the lot. 5224-1661.

COLD ROOM / FREEZER CONDENSING UNIT, 18KW, Refrigerant R134a, VGC, ring for details. $1,000. 0434 995 307. Pakenham.

COMPUTER REPAIRS

PC CELERON, 2.4GHZ, 504MB ram, 40GB, HD, 2XCD, drives XP, professional office 2003, KB wireless mouse, Lexmark printer. $500. 0414 203 435.

COMPUTER TUITION

gewheel4x4-793020

BED, single, antique, wooden bedhead, good mattress, wooden slat base, EC, $100 ono. 0414 633 145 Anglesea.

COFFEE TABLE, solid timber, unique carved pattern. $200 delivered. 0410 521 636.

COMPUTERS

50 Point Henry Rd, Moolap

Ph: 1300 666 808

ANY ITEM UNDER $50 can be placed for free as a Bargain Basement. See coupon, conditons and details on our website at www.geelongindependent.com.au

Specialising in Ceramic Wall & Floor Tiling DOMESTIC - COMMERCIAL FREE QUOTES - SCREEDS - TILED SHOWER BASES

C753948-MD1-10

C684998-SJ2-9

1800 89 89 79 ON TIME EVERY TIME

C684940-BG2-9

Ablaze Tiling

BIN HIRE 2-10m HOOK & SKIP WEEKEND SPECIALS

C753943-MD1-10

THE BEST ANTENNAS LOCAL TECH 10 YEAR GUARANTEE

TX6294193-J36

FREE QUOTES Call Rory 0429 040 121

ANTENNAS

POINTS + BOOSTERS

C791403-JM20-10

• Re-roofs & Extensions • Cleaning & De-mossing • Rebedding & Flexible Pointing & Painting • Storm Damage/Callouts • Insurance Work

AERIAL

FOR SALE

AIR CONDITIONER, portable, Dimplex, barely used, EC, all parts and accessories . $400. 52561655.

Off

RSN ROOFING 13 years experience Qualified Roof Tiler

AAA

FOR SALE

AIR CONDITIONER, portable, not evaporative, EC, $300 ono. 5241-2698.

THIS

oCement & Terracotta Restorations oAll Roof Repairs oCleaning, Pointing & Rebedding oGuttering & Insurance Quotes oRe-coating o10 year guarantee oFree Quotes

www.geelongindependent.com.au

0418 524 416

Scotsco Skylights

C753940-MD1-10

Cheques, money orders and cash payment can be posted or hand delivered to our office.

C683652-JL2-9

ROOF - PAINTING ROOF RESTORATION

experience

CURTAINS, block out pencil pleat drapes with tracks, Ivory. 4950 x 2450, 3 years old. $400. 0409 501 194.

BLANKET BOX, with tapestry lid, handmade, ideal storage, sewing, 800 x 500. $250. 5248-7975 St Albans Park.

WE ACCEPT PAYMENT BY

C753947-MD1-10

Treatment

C753949-MD1-10

SKYLIGHTS

Roof

20 years’

BED, QS, solid, wooden, with 2 matching units, orthapedic mattress included, EC, must sell. $550. 0423 192 784, 5241-9501, Marshall.

BIKE, girls, pink and white, suit age 4-7, with training wheels, EC. $35. 0403 795 667. Norlane West.

Real Estate - Wednesday 1pm Trades Directory – Monday 2pm Classifieds – Wednesday 3pm Wheel & Deal – Tuesday 5pm

SKYLIGHTS

Lee’s

AT

Deadlines

C826924-JL31-10

QUOTES • Rebedding Recolouring Colourbond Roofs Competitive Prices. Pensioner Discounts • Repointing ☎ John 0417 505 234 - 5277 9248

address and phone number classies@geelongindependent.com.au

C684493-JL2-9

• Repairs

Email: Include your name,

C753942-MD1-10

LJ’S ROOFING

LOOK

and phone number. Geelong Independent, Attn: Classified Advertising, P.O. Box 407, Geelong 3220

Servicing all areas 7 days a week. Household rubbish, renovators, builders 2, 3, 4 & 6 METRE BINS AVAILABLE Call to compare our prices

ROOFING

TILED OR TIN ROOFS CLEANED, FREE SEALED & PAINTED

Mail: Include your name, address

FOR SALE

BED, Queen size, wrought iron and solid timber ends, mattress included. $500. 5282-8820. ITS EASY TO PLACE - GELBTHEASY

C753934-SJ1-10 C685053-JM2-9

REBLOCKING/UNDERPINNING

FOR SALE

GRANDKIDS urging you to learn to use a computer? May I teach you at home? Call Gillian on 5244-5182 or 0427 003 422.

HIGHTON COMPUTER SOLUTIONS • Professional on-site repairs • Spyware & virus removal • Networking PH: 5244 2277 MOB: 0408 884 467 C684494-JL2-9

LOOKING FOR A PET? Look under Pets & Services in today’s paper

gepet2x1-417635

COMMERCIAL benchtop display fridge, as new, EC, suit cafe/club. $1,200. 0408 574 549. COMPUTER DESK, laminate with neutral tones, VGC. $150. 52456562. COMPUTER, P4, 20g HD, 256 RAM, WIN XP. $130. Phone 0409 345 128. CURTAINS, one set, deep cream, 2900 x 244, tracks included. Near new. $450. 0408 758 988. CURTAINS, gold, triple pinch pleat, heavy block out, 2.1m drop, 4 x 1.4m wide, 2 x 0.7m wide, would suit theatre/lounge room. $200ono. 52515771. Clifton Springs.

FRIDGE, Harley Davidson, custom designed to suit your shed or bar, looks great, $2,400 ono. Phone 5243-2889 Geelong. FRIDGE, Mistral, two door, no frost, small, suit one person or second fridge, $150. 5267-3051. Winchelsea.

FRIDGES, FREEZERS, W/M AND DRYERS Sales and service. Cheapest and best in town. Cool Cats Refrigeration. 18 Gordon Avenue, Geelong West. 5229-6246.

The Independent, Friday August 6, 2010

61


FURNITURE, lounge suite, 3 seater, 2 arm chairs, dining table (extension), chairs, VGC, $300. 5243-9347 Belmont. FURNITURE, dining table, extends, 6 chairs, 3 piece fabric lounge suite, 3 piece wall unit, coffee table, side table, GC. $1,500ono the lot. Anglesea. 5263-2725. FURNITURE, buffet and hutch, tub chair x 2, couch x 2 seater, queen size bed, single bed, entertainment unit, portable air conditioner. $860 or ono. 5277-0512 or 0404 952 421. FUTON BED, 204cm x 153cm, thick black mattress, VGC. $225. 0408 365 188. Geelong West. GARDEN HOSE, Nylex, ideal for Hobby farm, 100m long on mobile metal reel and stand with fitting, GC. $450. 0438 782 022. GEELONG, Football Club, 2007, Premiers Weg poster, personally signed by Weg and Norm Smith Medalist, Steve Johnson. The poster is framed with set of limited edition premiership cards and comes with a certificate of authenticity. $700 ono. 5241-1503. GO CATS, brand new, 120L bar fridge, with hand painted cats picture, can email photo. Dont miss out. Bargain $570. 94355279. GRAPHIC ARTS CAMERA, AGFA reprom, great for screen printing, prepress, $20. Phone 5255-2562.

Advertise your item For Sale in this local newspaper for great results!

LOUNGE SUITE, Chesterfield, burgundy, leather, 3 seater couch, 2 wing backed chairs, VGC. $1,800. 9749-8629 Werribee. LOUNGE SUITE, Art/Deco, bargain, as new, solid timber frame, fully sprung cushions, 2 footstolls and arm covers. $1,200ono. 0415 045 038. LOUNGE SUITE, 3 seater, 2 chairs, velvet, very comfortable, EC, like new. $450. 0425 829 088. LOUNGE SUITE, 3 seater, 2 chairs, velvet, very comfortable, EC, like new. $390. 5224-1661. LOUNGE SUITE, 3 seater and 2 recliners, brand new this year, blue suede. $1,850 ono. 0403 902 003. Grovedale. LOUNGE SUITE, 1 X 3 seater, 1 x 2 seater, 2 recliner chairs, all as new, $1,200 ono. 0419 384 327.

HEATER, Rinnai, with gas connections, GC. $250 ono. 5256-1655. Ocean Grove.

MALVERN, Star, mountain bike, 21 gears, alloy wheels, very lttle use, EC, $150. 5253-2991.

IRONING PRESS, Singer, excellent working condition. $50. 5242-8681. Herne Hill.

MATTRESS, King single, inner spring, Slumbercare, as new. $49. 5257-1500. St Leonards.

KITCHEN TASMANIAN OAK, 10 cabinets, includeing 2 overhead leadlight cupboards, EC, $1,980 ono. 0417 011 927 Newcomb.

MOBILITY SCOOTER, Fisher and Paykel, 3 wheel, electric, recent service, new batteries, EC. $1,200. 0428 195 646. MOTOR SCOOTER, 50cc, TGB, low kms, plenty of warranty, reg., RWC, FU424. $1,750 ono. 52779677.

KNITTING MACHINE, Brother Computermatic, ribber, lace maker, table, wool, books and extras. $300ono. 5248-0399, Newcomb. LAMP SHADE, new. $15. 0425 756 908. Bell Post Hill. LAMP SHADE, gold tonnings, new. $25. 0425 756 908. Bell Post Hill. LAMP, touch, new. $15. 0425 756 908. Bell Post Hill. LOUNGE SUITE, Victorian Jacobean, 3 piece, genuine rattan, original upholstery, GC. $3,500. 0428 526 565.

AVAILABLE FROM NEWSAGENTS EVERY FRIDAY!

Book your advert now

LOUNGE SUITE, European, scatter cushion style, 2.5 seater and 2 seater, solid wooden frame, must sell, GC. $350. 0423 192 784, 5241-9501, Marshall. LOUNGE SUITE, Cream, 3 seater and 2 chairs, GC. $450. 5241-9269. Belmont.

ORGAN, Yamaha, electric, EL-7 model, EC, slight use. $2,200neg. Includes chair. 5343-5113, 0402 222 312. ORGANISER, Sharp, ZQ160, electronic, calculator, calendar, currency converter, world clock, new batteries and manual included. $20. 0427 442 753. Highton. OUTDOOR SETTING, timber. $120. 5241-3606. Highton.

1300 666 808 TO REMOVE A SOLD ADVERT PLEASE CONTACT US! OUTDOOR SETTING, Kane, 2 chairs, 1 2 seater sofa and coffee table. $120. 5241-9269. Belmont. OUTLETS, for wall socket, various. $20 the lot. 52242735 and leave a message. Geelong. PAINTINGS, oil etc. From $10. Phone 5243-9347. Belmont.

PARTITION, folding, 4 panels, ornately carved, wooden, 7ft x 6ft, EC, $350. 5248-3421 St Albans Park. PINBALL, machine, Gottlieb, mid 1990’s, feature, excellent working order and condition, collectable. $3,500. 0434 955 947. PINE PEDESTAL TABLE, 105cm and 4 colonial chairs, solid setting in VGC, $150 ono. Phone 0422 935 881 Geelong. PLATTER, Noritake, oval, Harwood design. $20. 5241-9310. Belmont. PUMP, Davey, powerace, 1kw, GC. $150. 52412158. Highton. RIDING BOOTS, ladies, long, black, all leather, slim leg, size 38, $250. 5267-3051. Winchelsea. RUG, cobalt blue, large, excellent quality, EC. $265. 5241-9269. Belmont.

SOLAR PANEL, 100w portable folding. Top quality including w/proof smart charge regulator. Still in carton with 2yr warranty. Rated 5.9amps. Only $729. 0400 238 731. Portarlington. STOVE, Chef, 4 x gas burners, benchtop, oven on lefthand side, consul fan forced, select-conventional, converted to LPG, new, still packaged. Paid $1,700, sell $700 cash. 5281-3377, 0417 109 120. SURVEILLANCE Security System, Samsung Viewsonic, 4 camera digital recorder, 750gig harddrive, 17” flat screen ICD monitor, 2 dome (day/night) cameras , 2 full body Fujinon ultrawide cameras (day/night), all colour (all wall brackets and keypads), lots more, suit new buyer. $3,700ono. (ring for more details) 0427 946 589, 0427 679 671 or 5253-1905, Clifton Springs. TANK, suitable as aquarium or reptile enclosure on 700mm high cabinet, lots of extras, 1600mm x 400mm x 600mm. $1,000 ono. 5255-4445. TV, Sony Trinitron, 68cm, colour TV. $150. 0447 517 423. Lara. UTE TUB LID, solid, for Rodeo, 2004, VGC. $800. 0408 397 417. VACUUM CLEANERS, 2, Electrolux, with parts. $100. 5241-3606. Highton.

MUSIC/ INSTRUMENTS

WINDOW, wooden double hung, 1800mm wide x 1400mm high, VGC, $230 ono. 5257-2200 Queenscliff.

AUCTIONS

ANTIQUE AUCTION Sun 15 August 10.30am WOODLANDS AUCTIONS 16 Grubb Rd, Ocean Grove 40ft UK container & local vendors Antique furniture, bric-a-brac, clocks including long case, epergnes, Beswick, Moore Bros., pictures, toys, jewellery and items of interest etc. Ph 5256 1674 woodlandsauctions.com.au C822588-JL30-10

GARDEN/ OUTDOOR LAWN MOWER, Victa, 2 stroke, with catcher, good working order. $49. 93077709 or 0409 436 269. Taylors Hill. LAWN MOWER, electric, slymo, used once, perfect condition, RRP $289. $150. 5221-0997. East Geelong. TREES CUT and pruned. Pension discount. 52782320, 0431 152 031.

BABY GOODS ASSORTED, cot, halo set, mattress, linen sets, bumper, quilt etc. $280 ono. 0404 293 297. Bell Park. CHANGE TABLE, wood, as new mattress, 3 levels. $49.95. 0408 365 188 Geelong West. PRAM, twin jogger, Love ‘n Care, blue, excellent condition. $200. 0403 305 463. Highton.

WALL HEATER, Vulcan, dual outlet, works very well, GC. $200 ono. 52553160, 0408 679 890.

ANTIQUES & COLLECTABLES

SCHOOL UNIFORM, Norlane High School, complete winter and summer. Size 10. $150 the lot. 5278-3265.

WASHING MACHINE, Centrex, 5.5kg, working. $50. 0431 196 446. Norlane.

SHOP, display, glass cabinets. $350. 0409 360 299.

WASHING MACHINE, 9kg, does not spin though cheap to fix. $50. 0432 346 169. Whittington.

DRESSING TABLE, antique, Victoria Circa, 1880, 3 drawers, mahogany colour, EC. $1,500. 0408 785 489.

SAND, paving, 2 c/m, crushed rock 1 c/m, $75 the lot. Collect only. 0415 799 332.

SLIDE, childrens, Hills brand, GC. $30ono. 52241885. Herne Hill. SOFA, 2 seater, floral, wingback style with arm covers, VGC. $40. 0417 166 955. Grovedale. STOVE, side by side, VGC, $120 ono. 52756346 or 0439 852 103 Corio.

WATER TANK, 4,500 litre, low profile, only 3 months old. $800. 5243-9594, Highton. WEIGHT LIFTING BARS, Olympic commercial, new, $350 full set. 0408 299 286. WHEELCHAIR, push type, GC. $150. 52412158. Highton.

3 rooms and hall. Phone Tony 0423 473 595.

Address:............................................................

Receipt:........................ Paid at: ....................

ADVERTISE - GEELTILSOLD

Phone:...............................................................

SITUATIONS VACANT

geelong jobs.com.au

DRUM, kit, black, GC, $480. 0414 486 892.

SITUATIONS VACANT

MASSAGE THERAPISTS

To find out more about any of the positions below, go to

AMAZING TOUCH

www.geelongjobs.com.au

Asian full body relaxation massage, 10am-midnight. Geelong, 0433 308 382. SWEDISH RELAXATION MASSAGE, Werribee, 10am-8pm. MondaySaturday. Cost $50p/h, $30 half an hour, shaving also available. 0425 805 090.

PET SERVICES/ ACCESSORIES

DOG KENNELS – ALL SIZES Solid timber, insulated Colorbond roof. Ex lge suit Shepherd $135 Lge suit big Lab $115 Med $80 Sm $45

WE DELIVER.

5241 3531

FISH TANK, 6’ x 2’x 2’ fully equipped for tropical / fresh water, includes live fish and plants, fully enclosed cabinet, suit business or restaurant as a display. $5,000 ono. 0419 734 007. FISH TANK, 2.5x1x1.5, fully equipped includes, fish, substrate, live rocks, H800 filter, heater, test kit. $350. 0448 913 389. Belmont. FISH, tank including accessories and fish, $50. 5277-0512 or 0404 952 421.

FLOATS AND TRANSPORT

and search for the job ID. CONSTRUCTION JUNIOR ESTIMATOR/SUPERVISOR - FULL TIME You will have relevant Trade Experience (3 years +) and/or Tertiary qualifications. Good organizational and communication skills are a must as part of the role with be to deal directly with client ....ID:1248

DESIGN FAMILY DISPUTE RESOLUTION PRACTITIONER As part of the selection criteria you will hold a degree in Law, Social Science, or Psychology, and be registered with the Federal Attorney-General’s Department as an Accredited Family Dispute Resolution Practitioner. The successful applicant will ...ID:1247

FASHION & BEAUTY SOUL SKIN TORQUAY Soul Skin in Torquay is seeking a Nail Technician for Business Enterprise. If you feel you are an exceptional Nail Technician and possess Energy & Passion for your craft we want to hear from you. This is your opportunity to set up your own business... ID:1249

HEALTHCARE & MEDICAL BELLARINE COMMUNITY HEALTH LTD Would you like to work in food services at Bellarine Community Health which is a dynamic health service providing a range of health, welfare and residential aged care services across the Bellarine Peninsula....ID:1246

TRAVEL & TOURISM WORKS MANAGER OTWAY COAST COMMITTEE The Otway Coast Committee is seeking a suitably experienced and qualified manager for our outdoor works program. This position will be responsible for supervising works, projects and the day-to-day management of a permanent Workforce., Hospitality... ID:1250

FRONT OF HOUSE STAFF Bistro C in Lorne is looking for front of house staff for ongoing casual work. Both day & night work will be required & you must be available weekends., Hospitality...ID:1251

INSURANCE & SUPERANNUATION ASSISTANT INSURANCE BROKING Due to business growth they have a vacancy for an Assistant Broker. Working alongside another Assistant, you will provide administrative support ensuring clients expectations are met. Key duties will include processing of new business, endorsements, ...ID:1270

TRANSPORT & LOGISTICS

HORSE FLOAT, double, reg Feb 2011, P87807, very clean, GC, $4,500 ono. 0407 801 168. Little River.

REMOVALIST DRIVER A friendly, professional removalists company in Geelong, ALLIED PICKFORDS, is looking for an experienced removalist - driver (min 2 years experience), preferably with HC licence and own transport....ID:1268

VOLUNTARY WORK

BRIDAL AND DEB WEAR

NORTH SHORE STATIONEERS - MEET & GREET

DEB DRESS, size 10, Grecian style, one shoulder, EC. $280. 52444158. 0430 580 321. Highton. DEB/WEDDING DRESS, size 14, Duchess satin, off the shoulder, drop waist. paid $500, sell $350ono. 0424 249 463. NEW WEDDING DRESS, size 14-18, lace up back, train, white, beads, embroidery, $400 ono. 0413 453 764 Geelong.

Meet & Greet team volunteers meet passengers alighting from the Overland from Adelaide and provide any assistance to passengers and those waiting to collect them....ID:1252

FACILITATOR KINT & SIP CRAFT GROUP Assist a group of interested people with instructions on HOW TO KIT in an informal social setting and generally having fun....ID:1253

HANDYPERSON/BIKE REPAIRER Assist in a handyman role including fixing bikes, wheel chairs and other items for donations to pacific island countries...ID:1254

OP SHOP COORDINATOR Bright person with retail experience and some supervisory skills. Customer service, banking and paperwork skills essential along with a very good standard of the English language....ID:1255

KITCHEN HAND Assist in kitchen at local sports club serving food, collecting plates and cleaning up. Saturdays 5.30-9.30pm and Sundays 10am-2pm....ID:1256

PROJECT OFFICER

WEDDING DRESS, stunning, large size, satin/ pattern, size 10-12, EC, dry cleaned, $500. 0434 355 044. Lara.

Our Communications and Development section – which includes Discovery Press – needs admin support on various projects. Duties include conducting mailouts, compiling databases, working on media/fundraising campaigns. Writing, editing and researchi...ID:1257

WEDDING DRESS, bridal white, size 12-14, 2 piece satin finish. $600 0410 450 004.

Work alongside a current club volunteer to maintain club facilities. Gardening, turf maintenance, grass cutting (ride-on-mower), line marking and minor Repair jobs where applicable....ID:1258

WEDDING DRESS, 1416, ivory beaded and matching beaded veil, EC. Been drycleaned. $700. 0409 968 002.

To develop a number of data bases using MS Access 2007. Skills and knowledge in scoping and developing SQL databases, and/alternatively a reasonably high level of skills and knowledge of MS...ID:1259

WEDDING DRESS and shawl, EC, 10-12, dry cleaned. $500. 0422 284 788. Lara.

PERFORMING ARTS - EAST GEELONG

Geelong’s largest circulating newspaper with very reasonable rates. From Geelong to the Bellarine Peninsula and Surf Coast gecirc1.5x1-417365

..........................................Post Code:...............

*This offer is made to private advertisers only. *Offer only available for items normally advertised in the For Sale section. All advts, must be pre-paid. For $37.20 you get a 15 word ONE ITEM ONLY advt. Advts are restricted to “For Sale” items only for private advertisers, and will be run until it's sold. Once your item is sold you can call our office to cancel. *Sale price must be included in the advert. Alteration to PRICE ONLY to advertisements will be accepted. Not included in the offer are any business advts., rental hire etc., for the purpose of ongoing profit. or Real Estate Listings. The publisher reserves the right to decline any booking for the purpose of continuing gain. * Publishers estimate based on 1.6 readers per copy

WANTED

CARPET CLEAN

Minimum 15 words (one item only)

15 words $37.20 My credit card number is: 20 words $39.40 ■ ■ ■ ■ ■ ■ ■ ■ ■ ■ ■ ■ ■ ■ ■ ■ 25 words $41.60 Expiry date: ■ ■ ■/■ ■■ Signature: ...................................................... 30 words $43.80 Cash Paid: .....................................................

ADVICE and cash, for deceased estates. 52444521.

$60

ADVERTISE UNTIL IT’S SOLD

■ Cash ■ Cheque ■ Visa ■ Bankcard ■ Mastercard

Working or not, fridges, freezers, washers, dryers. Not too old. Cash Paid. 5229-6246.

HOME SERVICES

Fill in this coupon and enclose $37.20* and your advertisement will be run until it's sold. You only have to call our office to cancel your advertisement when your item has been sold. Complete this form and lodge to First Floor, 78 Moorabool St, Geelong 3220 No later then 3pm Wednesdays Name and Address (not for publication) Name: ...............................................................

Mobile: .............................................................. I would like to pay by:

$$$ ATTENTION $$$

OLD CARS REMOVED, $100 cash if complete. Call John 0430 446 730.

• Geelong, East Geelong, North Geelong, Leopold, Lara, Little River, Moriac, Winchlesea, Bannockburn, Meredith, Teesdale, Inverleigh, Highton, Belmont • Torquay, Jan Juc, Moriac, Anglesea, Aireys Inlet, Deans Marsh • Drysdale, Clifton Springs, Portarlington, St Leonards, Ocean Grove, Barwon Heads

*Must include Suburb at end of advert

WANTED TO BUY

FREE DISPOSAL of unused white goods, hot water services, scrap iron. Call Allan 0400 629 830.

for only $37.20*

The Independent, Friday August 6, 2010.

WHEELCHAIR, blue suede, head, foot and knee rests, ideal for tall or larger person. $550. 52752249. Corio.

VCR, National, NV.730, in excellent working condition. $10. 5243-2315. Highton.

ADVERTISE UNTIL SOLD

62

FOUND, Nintendo DSi, outside Safeway at Torquay Shopping Centre last week. Phone 0417 568 514.

WINDOW, double hung, 2500mm high x 900mm wide, VGC, Geelong West, $280. 5229-7522.

LOUNGE SETTING, indoor/outdoor, wicker charcoal setting, 4 piece, EC, inc covered high density foam. $300ono. 5241-7057. Grovedale.

HEATER, Noroi, electric, white, portable, wall convector heater, VGC. $250. 5256-1655. Ocean Grove.

KITCHEN SINK, stainless steel, single bowl, 1525x455, as new. $45. 0412 128 641. Highton.

It will also appear FREE in the all new

LEG MAGIC, brand new in box, $50. 5272-1474, 0408 131 967.

WHEEL CHAIR, electric glide, fully reclining stand up, black, GC. $1,100 ono. 0418 891 325.

C770917-KK10-10

FOR SALE

LOST & FOUND

SITUATIONS VACANT

Call Phil 0438 622 499

DATABASE DEVELOPER - MICROSOFT ACCESS

OUTPOST VOLUNTEER Serving to the homeless and others who are suffering extreme hardship....ID:1260 Work with teachers in delivering a music and/or language program to assist students in performing arts: music including instrumental playing &/or singing, drama including public speaking and acting, oral language work....ID:1261

OP SHOP ASSISTANT - SORTING Sorting and pricing stock in a team environment. Customer service and use of cash register may be available further on....ID:1262

OFFICE ASSISTANT Assist the Neighbourhood House Networker with day-to-day office tasks. Could include: typing, filing, mail, photocopying, answering the phone and compiling a regular newsletter....ID:1263 Route Marshalls are strategically placed along the rider route & have varying responsibilities; informing motorists/pedestrians, cheering on the riders, assisting struggling riders, giving directions, notifying Route control of any issues....ID:1264

REMOVALIST - DRIVER A friendly, professional removalists company in Geelong, ALLIED PICKFORDS, is looking for an experienced removalist - driver (min. 2 years experience), preferably with HC licence and own transport. Casual (may lead to full-time). Uniform supplied. Wage negotiable.

GROUNDSMAN / HANDYMAN

ROUTE MARSHALL

ADMINSTRATION ASSISTANT Filing, data entry and other basic administrative duties as required. 2-3 hours per week....ID:1265 C823775-JF29-10

FOR SALE

C784804-KK17-10

FOR SALE

FOR SALE

You can find many more jobs at: www.geelongjobs.com.au






0DUF3XUFHOO 5HFUXLWPHQW0DQDJHUIRU 0DOYHUQ1XUVHV$JHQF\6WDIILQJ6\QHUJ\ 3&&   3K (PDUFSXUFHOO#PQDQXUVHVFRPDX

Catalogue distributors and collectors required. Earn $100 to $200 for approx. 10 hours per week. No outlay. Call 1300 663 161.

AREA MANAGERS Required for catalogue distribution. Earn $300 to $500 cash weekly for 20 hours. Car and internet required.

Call 1300 663 161

FENCING CONTRACTOR Required for timber and steel fencing. Consistent work available. For details contact Dobson Enterprises on 52531750.

EMPLOYMENT SERVICES

Forced to resign Redundancy

Just Relations C797017-JL21-10

www.justrelations.com C753770-SJ1-10

C819787-JL28-10

Healthcare Australia- Geelong is proud to announce that St John of God Hospital Geelong has chosen Healthcare Australia and its agencies MNA, StafďŹ ng Synergy & ASEPS to ďŹ ll all of their temporary nursing staff needs. Please call 1300 139 366 to join our team working together with St John of God Geelong to provide quality care.

PUBLIC NOTICES

Applications close 5pm 20th of August. Contact Doris Hamilton on 5237 8500 or visit our website www.otwayhealth@swarh.com.au for positions.

in the Geelong area, your choice of shifts on what days you choose. â&#x20AC;˘ Excellent rates â&#x20AC;˘ Free Education â&#x20AC;˘ Personalised Service

Unfair Dismissal No Win - No Fee

9650 0735 IMPORTANT NOTICE

97886

Apply today on 1300 984 400 or visit www.ďŹ rstcallhealth.com.au to apply online.

Make sure your property is advertised in the Independent.

Ask your agent.

KIDS PARTIES

INDOOR ROCK CLIMBING

No Mess, No Fuss, Great FUN!

Security Licensing Courses In GEELONG: â&#x20AC;˘ Cert II Security Operations Aug 23 - Sept 14 2010 â&#x20AC;˘ Cert III in Security Operations Sept 20 - Sept 29 2010

(03) 9620 3207 www.ista.com.au RTO: 3877.

BUSINESS OPPORTUNITIES MAKE AN EASY $250. Doing simple typing tasks on the internet. www.10WPM.com.

PUBLIC NOTICES TAX RETURNS $50. Couples $90. Agent. 2 Windmill St. 5221-2725.

www.rockadventures.com.au

QUIT SMOKING Reg. OfďŹ ce - 78 Moorabool St., Geelong 3220 P.O. Box 407, Geelong 3220 Ph: 5221 5200 Fax: 5221 3823 Published by: Star News Group. Print Post 31027900004 Email: advertising@geelongindependent.com.au Managing Editor: Tony Galpin Sales Manager: Jason Stratford Production Manager: Chris Beale Managing Director: Paul Thomas General Manager & Editor-in-Chief Geelong-North West Division: Jim Lawrence Audited Circulation 92,674 (March. 2010)

REGISTERED NURSES DIVISION 1â&#x20AC;&#x2122;S, 2â&#x20AC;&#x2122;S and PCAâ&#x20AC;&#x2122;S REQUIRED

SACKED?



Otway Health in Apollo Bay is seeking suitably qualiďŹ ed and experienced Registered Nurses Division One to ďŹ ll the positions of After hours coordinator and Associate nurse unit manager. Hours negotiable. The facility provides Acute, Aged and Emergency Care in a supportive working environment. BeneďŹ ts include Salary Packaging.

C735808-KK42-9

FLEXIBLE HOURS

AFTER HOURS COORDINATOR/ASSOCIATE NURSE UNIT MANAGER

Geelongâ&#x20AC;&#x2122;s largest circulating newspaper distributed in Geelong, the Bellarine Peninsula and the Surf Coast. All advertising and editorial content of this issue is the copyright of Geelong Independent P/L and cannot be reproduced without the companyâ&#x20AC;&#x2122;s permission. Terms and Conditions of Competitions and the Privacy statement are available at www.starnewsgroup.com.au

Success in 1 hour WEIGHT LOSS Stress/Anxiety John Simmons Clinical Hypnotherapist 240 La Trobe Terrace 5333 1565 (7 days)

simmonshypnotherapy.com.au

C685092-KK23-10

7LQD3KLOOLSV 5HFUXLWPHQW0DQDJHU $6(369,&  3K (WLQDSKLOOLSV#DVHSVFRPDX

5224 1225

paul@europeanaffair.com.au

C755103-JL2-10

+HDOWKFDUH$XVWUDOLDLV7:2  +$/) 7,0(6 /$5*(5 WKDQRXUQHDUHVWFRPSHWLWRU7KDWPDNHV XV$XVWUDOLD VODUJHVW1DWLRQDO+HDOWKFDUH$JHQF\JURXS XV$XVWUDOLD VODUJHVW1DWLRQDO+HDOWKFDUH$JHQF\JURXS  :KDWWKLVPHDQVIRU\RX+&$HQMR\VSUHIHUUHGVXSSOLHUVWDWXVDWDOPRVWHYHU\3ULYDWH+RVSLWDOLQ 0HOERXUQH *HHORQJ7KLVPHDQVWKDWRQO\ RQO\RXUQXUVHVJHWWKHILUVWFKRLFHRIDJHQF\VKLIWVEHIRUHWKH\ RQO\ DUHJLYHQWRRWKHUDJHQFLHV:LWKQH[WGD\SD\IUHHRQJRLQJHGXFDWLRQVDODU\VDFULILFHIUHHFULPLQDO UHFRUGFKHFNVUHIHUDIULHQGERQXVHVDQGIXOOSURIHVVLRQDOLQGHPQLW\LQVXUDQFHZK\ZRXOG\RXJRDQ\ ZKHUHHOVH"  :HFDQRIIHU\RXDZRUOGRIRSSRUWXQLW\LQ\RXUVSHFLDOW\ :HFDQRIIHU\RXDZRUOGRIRSSRUWXQLW\LQ\RXUVSHFLDOW\ :HFDQRIIHU\RXDZRUOGRIRSSRUWXQLW\LQ\RXUVSHFLDOW\  $6(36XUJHQWO\QHHG7KHDWUH6FUXE6FRXW$QDHVWKHWLF5HFRYHU\5RRP7KHDWUH7HFKV,QVWUXPHQW $6(36 7HFKV&ULWLFDO&DUH,&8&&8+'8$ (  01$ KDYH ZRUN IRU$FXWH  $JHG &DUH 'LYLVLRQ œV 'LY œV 0HG (QGRUVHG 'LY œV DQG 3&$œV  $OO 3&$œVPXVWKDYHD&HUWLILFDWHLQ$JHG&DUHRUEHQG\U'LYLVLRQ6WXGHQWV  6WDIILQJ6\QHUJ\KDYHVKLIWVIRU0LGZLYHVDFURVVDOODUHDV²'HOLYHU\6XLWH6SHFLDO&DUH1XUVHU\ 6WDIILQJ6\QHUJ\ $QWHQDWDO 3RVWQDWDO  3&& &&² &&²3V\FKLDWULF&DUH&RQVXOWDQWVKDYH$FXWH )RUHQVLFVKLIWVDYDLODEOHDFURVV0HOERXUQH  +&$UHTXLUHDOOQXUVHVWRKDYHDPLQLPXPRIPRQWKVH[SHULHQFHLQ$XVWUDOLD  7RILQGRXWPRUHFDOOXVWRGD\ 7RILQGRXWPRUHFDOOXVWRGD\  :HRIIHU\RX :HRIIHU\RX  x /RWVRIZRUN3UHERRNHGVKLIWV  x *UHDWSD\UDWHV x 3UHIHUUHGWRVXSSOLHUWRPRVWPDMRUKRVSLWDOVDFURVV0HOERXUQH *HHORQJ x :HHNO\3D\ x 4XLFN3D\²:RUNWRGD\JHWSDLGWRPRUURZ  x )UHHDQGRQOLQHHGXFDWLRQ x H1XUVLQJRQOLQHDFFHVV x 6DODU\VDFULILFH x 7ZLOLJKWVKLIWV &RQGLWLRQVDSSO\ 

C829109-JM31-10

European vehicle exp essential. Excellent working conditions.

C826363-KK31-10

C828938-JM31-10

Australian IT Institute Configuring Windows 7 training â&#x2014;? Commencing 17 Sept. â&#x2014;? Suitable for Microsoft Exam 70-680 â&#x2014;? Sat 4 hrs for 8 weeks. â&#x2014;? Book, Moc provided. â&#x2014;? Experienced trainer. â&#x2014;? Small group, limited seats â&#x2014;? $1,250 ex gst only. Contact for details: Australian IT Institute Tel: 5221-3982 or 0414-391584 piyushj@iprimus.com.au

TRAINING AND DEVELOPMENT

C822436-JL29-10

MOTOR MECHANIC REQUIRED

TRAINING AND DEVELOPMENT

C825169-JL30-10

MEDICAL/NURSING

YOGA TEACHER training YTAA accredited course NEXT INTAKE October 2010 March 2011

C828073-JL31-10

SITUATIONS VACANT

C829262-JM31-10

SITUATIONS VACANT

Book Now

ph: 5244 1130 info@innercor.com.au www.innercor.com.au/trinity

TRAINING AND DEVELOPMENT

gemake3.5x1-417299

SITUATIONS VACANT

CATALOGUE WALKERS WANTED

C828964-JM31-10

Contact FACTS on 5248 6055 for brochures on these courses and many more. Email facts_solutions@hotmail.com or go to our website www.factsgeelong.com.au

C828967-JM31-10

Geelongâ&#x20AC;&#x2122;s largest circulating newspaper with very reasonable rates. From Geelong to the Bellarine Peninsula and Surf Coast gecirc1.5x2-417353

TRAINING AND DEVELOPMENT

ENT GOVERNM NOW S SUBSIDIE BLE! A IL AVA

BUS DRIVERS (FULL TIME AND CASUAL POSITIONS)

1300 558 348 EMAIL: fermax@fermax.com.au

Please send your resume to PO Box 273 Belmont, Vic 3216 or email: recruitment@mcharrys.com.au. For further information contact 5223 2111 during ofďŹ ce hours

Apply Today to commence your Nationally Accredited ASIC Registered Course * This training is delivered with Victorian & Commonwealth Government funding. Conditions Apply.

C828936-JM31-10

If you are interested, please call

C793399-JL20-10

WANTED â&#x20AC;˘ REGULAR, REPLACEMENT & RELIEF WORK AVAILABLE â&#x20AC;˘ GREAT EXERCISE â&#x20AC;˘ SUIT RETIRED, OR STAY AT HOME PARENT â&#x20AC;˘ ALL AGES WELCOME

â&#x20AC;&#x2DC;â&#x20AC;&#x2DC;

I became a fully qualiďŹ ed Financial Planner for just $495*

â&#x20AC;&#x2DC;â&#x20AC;&#x2DC;

WALKERS

McHarryâ&#x20AC;&#x2122;s Buslines is a major provider of public transport in the Geelong region committed to both our customers and employees. Continued growth in our operations has created a number of full-time and casual driving positions based in Geelong and on the Bellarine Peninsula. Applicants require a heavy vehicle licence & will need to obtain a Driverâ&#x20AC;&#x2122;s Accreditation and Working with Children Check ABOVE AWARD WAGES & CONDITIONS WILL APPLY

C793043-JL20-10

Salmat Targeted Media

C827109-KK31-10

Deliver catalogues in your local area. Rounds available for immediate start in: Norlane, Belmont, Grovedale, Highton Plan your own hours (within timeframes) Register on www.deliverfordollars.com.au or call 1800 178 119 and quote ref 9832

You must meet criteria â&#x20AC;˘ Diploma of Childrenâ&#x20AC;&#x2122;s Services - $200.00 â&#x20AC;˘ Diploma of Beauty â&#x20AC;˘ CertiďŹ cate II in Animal Studies â&#x20AC;˘ CertiďŹ cate IV in Disability â&#x20AC;˘ CertiďŹ cate II in Community Pharmacy

C784073-SJ16-10

Discounted Fees at FACTS

Geelong Campus: Day & Evening Classes Available www.ibi.edu.au info@ibi.edu.au

1300 669 786 The Independent, Friday August 6, 2010

63


sport

Supercats into finals face-off A simple way for job seekers and employers to come together

BY ERIN PEARSON GEELONG Supercats will fight to keep their finals hopes alive tomorrow night when they match-up against ladder-leaders Nunawading in South East Australia Basketball League’s semi-finals. The Supercats were dealt a painful blow last weekend in a five-point loss to the Kilsyth Cobras. Forward Nathan Herbert said the Geelong side was determined to heal its wounds and “tackle their defence”. “I think our defence needs to be strong because, coming into finals, defence is what wins them,” he said. “It will really come down to who can play the better defence. Herbert, who scored 24 points against Kilsyth, believed that shooting points presented little problem for his side. “We do have a lot of guys who offensively are hard to stop, so we must just play the way we want to play,” he said. “I think that will get us over the line. We need to have fast breaks and a free flowing game.” Herbert said the match against the tall-timbered Nunawading side would be a “challenge”. “Last time we played them at Nunawading we beat them in overtime in a close game,” he said. “We were down by 12 points with five minutes to go and got up

W36W36-GEEL-VH 6-GEEL L-VH

ALL NEW

Confident: Nathan Herbert in action for Geelong against Kilsyth. in over time by 10 points.” Herbert said the Supercats were confident they could beat Nunawading. “We are always confident going into games because we’ve been playing well,” he said. “That’s certainly given us the belief we can definitely beat Nunawading again. “The boys are looking forward to the challenge.” The Supercats finished the reg-

ular season after the loss to Kilsyth in second place on the ladder with a record of 18 wins and nine losses. The Supercats will travel to Nunawading for the south conference major semi-final this Saturday night. Depending on the result of this weekend’s match, the Supercats will host the preliminary final on August 14 or the conference grand final on August 21.

SATISFY YOUR WEEKLY FIX FOR BARGAINS

1000s of local bargains in a traditional newspaper

EVERY FRIDAY Visit www.geelongjobs.com.au 372441-RMB38-8

64

The Independent, Friday August 6, 2010.

ONLY

1.50

$

UNBEATABLE VALUE! Your weekly fix for local bargains!

482880-VH20-10

TO ADVERTISE CALL 1300 858 178

From your local Newsagent


sport

Seagulls to end on zip

Salmon, squid and snapper top catches THE REGION was cold, wet and windy in the past week but, boy, were there some outstanding captures from both fresh and saltwater. Surf anglers found the fishing red hot at Fairhaven where John Mole caught and released huge numbers of fish to 1.5kg on lures. Brendan Sheedy had similar results in the same area on soft plastics, which is a method of catching salmon practiced by few but extremely effective. Paul Hunter caught 11 salmon to 2kg on surf poppers and Surf Snatchers at Eastern View, with low tide bringing the fish on the bite. Salmon to 2.5kg were also landed at Jan Juc and Breamlea on a variety of methods, with lure and poppers performing best. Fishing after dark at Point Roadknight, Damien Jacobs tussled with a few monsters. He lost all but one fish, a magnificent gummy shark of 17kg caught on fresh salmon fillets. Queenscliff rewarded anglers with quality whiting from the bight and Edwards Point. Fresh squid was the hot bait. Reports of squid to 2.5kg have been coming in from this area, so the captures should only get better over the coming weeks. Queenscliff’s cut attracted plenty of attention, with good numbers of silver trevally nailing soft plastics. Curl-tail grubs in the Motor Oil colour and Turtleback worms in Green Pumpkin are the best bet here when fished an hour either side of high or low tide. Swan Bay again produced small gummy shark along with salmon to 900g and similar size trevally on high tides from

On the bite BRIAN LONG the jetty. Squid numbers have gone from strength to strength, with most of the inshore grass beds working brilliantly. Stan Stevens found his biggest squid at Kirks Point but Hermsley and Clifton Springs has rewarded most with bag-limit catches. Small, natural-coloured jigs seem to be the best performers, with the best results where the bottom can be seen, which is generally under 3.5m of water. Snapper anglers found the fishing patchy in the outer-harbour, with drifting on the spoilgrounds using soft plastics again producing the best results. This week fish to 3.5kg were taken on Gulp four-inch minnows in the Prawn colours. Inner-harbour anglers have been fairing better, taking fish pushing close to 7kg from Stingaree Bay, Yarra Street and off the mud out from Corio Quay. Andre Cip finally landed a magnificent 6kg snapper, which he put down to the help he received from mate Aaron Trainor who pointed out one of his recommended locations. Peter Fitzgerald got among the salmon action casting soft plastics while trolling along Alcoa Pier. His best fish was around 1.5kg.

Beached: John Mole with a pair of salmon from Fairhaven. Salmon were also found close to the entrance to Limeburners Point boat ramp most mornings, with soft plastics working best. The wall in front of Royal Geelong Yacht Club has also been hosting salmon along with good numbers of small snapper. Bait anglers have been showing up soft plastics enthusiasts along Geelong’s waterfront, with chicken working well if soaked in tuna oil first. This area should be fished just as the tide starts to run off from high. Garfish continued showing up in great numbers, with Nathan Hope catching good numbers from the platforms near Pivot Pier whenever conditions have been calm. In freshwater, Wurdee Boluc Reservoir has been the best option close to Geelong, with lures working best. Most anglers have found that the middle of the day when conditions warm a little has produced the best fishing. Lake Bullen Merri contin-

ued yielding good numbers of rainbow trout for land-based anglers using Powerbait. Most fish have been under 1kg but anglers trolling the lake have been nailing browns close to 3.5kg, with gold-coloured Tassie Devils working best. Lake Purrumbete has also been fishing well for rainbow and brown trout. A variety of methods have been working, with trolling again has accounted for the best fish. The best results have come from using bibbed lures such as the SX 40s in the natural minnow versions. I had a beautiful Murray cod left with me this week for local taxidermist Trevor Lumb. I don’t know the full details of where or how the fish was caught but at 21kg it’s a prime example of the quality native fishery in Victoria. Send reports and photos to info@raylongtackle.com.au or visit Brian at Ray Long’s Fishing World, 105 Shannon Avenue, Manifold Heights.

BFL This weekend’s round of Bellarine Football League games pits the top three sides against the challenging fourth, fifth and sixth teams. With the composite of the top five still up in the air, maybe this round will reveal who will take fifth spot. But does it really matter now that the top three are so far ahead of the pack? The pick of the games is at Ocean Grove where the Grubbers host second placed Queenscliff. Ocean Grove has plenty to play for because its finals spot is still up in the air. However, the Grubbers will go into the game with some confidence after beating the second placed Coutas once already this year. Queenscliff has looked mean and

Local Footy FRANK MASON hungry recently and is building up for a real crack at the premiership. Its only dilemma is whether the forward line of Ed Grout and Tom Limb can accommodate the inclusion of tall forward Jon Ansell. The answer will be yes and the Coutas will continue their roll with a solid victory. Expect top side Drysdale to beat fifth placed Torquay and third placed Amateurs to get the better of sixth placed Anglesea. This will leave the ladder unchanged, with next week’s final round deciding who will make the final five. Other selections: DRYSDALE v Torquay, Newcomb v BARWON HEADS, MODEWARRE v Portarlington, AMATEURS v Anglesea.

GDFL With only two rounds of Geelong and District Football League homeand-away games left, Thomson finds itself just outside the five by percentage and two hard games ahead. It starts tomorrow for the Tigers when they host premiership favourite Bell Post Hill at Godfrey Street. If they can win this one anything is possible. Steve MacLeod looks a likely type up forward and Adrian Saltalamacchia is firing, making goal scoring look easy. Standing in Thomson’s way are the Panthers who have stepped up a notch and are grand final bound for the third time in three years. Chris Moreland, Shaun Lewis and Matthew Jovanovic are class acts and, with ruckman Andrew Venner returning from injury, the side looks even better. Thomson will come out like it’s a final but the Panthers will win. Other selections: Anakie v WINCHELSEA, Inverleigh v WERRIBEE CENTRALS, EAST GEELONG v Belmont Lions, Corio v NORTH GEELONG, Geelong West v BANNOCKBURN.

DRINK DRIVING

■ Programs ■ Assessments ■ Advice

.0 5

(03) 9654 3321

1800 654 332 COUNTRY FREE CALLS - CHEAPEST PRICES

440241-JM37-8

Big time: Andre Cip with his personal-best 6kg snapper.

NORTH Shore will be out to win its first game of the year on Saturday when it hosts Geelong West Saint Peters at Windsor Park. With only three games left in the season, time is running out for the Seagulls to get on the board and there is no doubt first-year coach Peter Riccardi would have earmarked this game as a possible victory with the Roosters second last on the ladder. Maybe Riccardi will make it onto the field himself like he did with the reserves a few weeks ago in its only victory of the year. James Byrne and Paul Licuria could also play, making the Seagull line up the strongest it has fielded all year. Things are pretty grim out at Windsor Park, with its three Geelong Football League sides only registering one win between them so far. Winning this one would give a much needed boost of confidence to shining lights Nathan Peoples, Tim Ivermee and James Chandler. The Roosters are also battling this year with only three wins so far and coach Doug Scott knows this is not good enough. On the plus side is the victory over St Albans last week when the talent of Leye Meleisea, Gareth Donald and Brydon Coles showed there is light at the end of the tunnel. Expect the brave Seagulls to go down fighting. Other selections: Newtown v LARA, St Josephs v BELL PARK, ST MARY’S v Grovedale, SOUTH BARWON v Leopold, ST ALBANS v Colac.

Photos with punch! If you like a photo that has appeared in your local Star News Group newspaper why not buy a copy for yourself? We offer both quality prints and digital copies. A huge range of local photos are on offer! Go to www.starphotos.com.au and see for yourself... The Independent, Friday August 6, 2010

65


420801-JL31-10

WEEK 19

They know business... what do they know about footy? Find out each week with Independent Tip Stars

96

92

87

85

94

92

88

82

LW 5

LW 4

LW 3

LW 6

LW 4

LW 4

LW 4

LW 4

Jessica Jones

Renae Duncan

Chris Goodhand

Keith Burns

Jason Barnett

Shelley Stavenuiter

Andrew Mathieson

Jason McLaughlin

Groove Train

Westpac Local Business Banker

Harvey Norman Furniture

Peninsula Hotel

Allpoints Carr

Tates Toyworld

Sports Journalist

Harvey Norman, Computers

Essendon Sydney Fremantle Collingwood West Coast St Kilda Melbourne Western Bulldogs

Carlton Hawthorn Fremantle Geelong West Coast St Kilda Melbourne Western Bulldogs

Carlton Hawthorn Fremantle Collingwood West Coast St Kilda Richmond Western Bulldogs

Carlton Sydney Fremantle Collingwood West Coast St Kilda Melbourne Western Bulldogs

Essendon Hawthorn Fremantle Geelong West Coast St Kilda Melbourne Western Bulldogs

Essendon Sydney North Melbourne Geelong West Coast St Kilda Melbourne Western Bulldogs

Carlton Hawthorn North Melbourne Geelong West Coast St Kilda Melbourne Adelaide

Carlton Hawthorn Fremantle Geelong Brisbane St Kilda Melbourne Western Bulldogs

Ph 5222 1488

Ph 5222 4201

Ph 5221 5200

Ph 5272 9900

Waurn Ponds

Ph 5229 0229

Ph 0408 582 796

Ph 5240 6200

The Peninsula Hotel

Ph 5248 2606

Corio

92

88

88

84

85

96

90

89

LW 4

LW 5

LW 4

LW 5

LW 6

LW 6

LW 5

LW 5

Trevor Elsworthy

Joe Marruso

Jessie Betz

Leigh Keen

Vanessa Scarfone

Joe Grgic

John Northwood

Melanie Cauchi

Elsworthy Retravision

Harvey Norman Electrical

Contours Geelong West & East Gelong

Forty Winks Geelong

Harvey Norman Bedding

North Geelong Real Estate

Harvey Norman Flooring

Hot Shots Paintball Skirmish

Carlton Hawthorn Fremantle Geelong West Coast St Kilda Melbourne Western Bulldogs

Essendon Hawthorn North Melbourne Collingwood Brisbane St Kilda Richmond Western Bulldogs

Essendon Sydney Fremantle Geelong West Coast St Kilda Melbourne Western Bulldogs

Essendon Hawthorn North Melbourne Geelong West Coast St Kilda Melbourne Western Bulldogs

Carlton Sydney Fremantle Geelong West Coast St Kilda Richmond Western Bulldogs

Essendon Hawthorn Fremantle Geelong West Coast St Kilda Richmond Western Bulldogs

Essendon Sydney North Melbourne Collingwood West Coast St Kilda Richmond Western Bulldogs

Essendon Sydney North Melbourne Coilingwood West Coast St Kilda Melbourne Western Bulldogs

Ph 5222 1533

Waurn Ponds

Waurn Ponds

Waurn Ponds

Ph 5240 6200

Ph 5229 8335 5248 5545

Ph 5221 4399

92

Ph 5240 6200

Ph 5278 7011

96

97

Ph 5240 6200

Ph 1300 803 001

93

Round 19

TOP 8

Friday August 6

LW 6

Essendon v Carlton (MCG) (N) Saturday August 7 Sydney v Hawthorn (SCG) North Melbourne v Fremantle (ES) Geelong v Collingwood (MCG) (N) West Coast v Brisbane (S) (N) Sunday August 8 St Kilda v Port Adelaide (ES) (E)

LW 5

LW 4

LW 6

Robert Keoylian

Frank Burge

Paul (Chicken) Dyer

Oliver Dojcinovski

Harvey Norman Computers

Frank Burge Cars

K-Rock Breakfast

OJâ&#x20AC;&#x2122;s Homemakers

Essendon Sydney North Melbourne Geelong West Coast St Kilda Melbourne Western Bulldogs

Essendon Sydney Fremantle Geelong West Coast St Kilda Melbourne Western Bulldogs

Carlton Hawthorn North Melbourne Collingwood West Coast St Kilda Melbourne Western Bulldogs

Essendon Hawthorn North Melbourne Geelong West Coast St Kilda Richmond Western Bulldogs

Ph 5222 1606

Ph 5223 1955

Ph 5277 1300

Frank Burge

97

Jessie Jones

96

Joe Grgic

96

Paul (chicken) Dyer

96

Ben Riddle

96

Jason Barnett

94

Seb Williams

94

Oliver Dojcinovski

93

Melbourne v Richmond (MCG) Waurn Ponds

Adelaide v Western Bulldogs (AS) (T)

Ph 5240 6200

42 MONTHS

).4%2%34 &2%% ing Bedd  &   ture  Furni 

rical, Comp

 , on Elect uters   

NO DEPOSIT - NO INTEREST with monthly repayments ./ $%0/3)4 s ./ ).4%2%34 WITH REPAYMENTS UNTIL -ARCH 

â&#x20AC;˘ GEELONG

Harvey Norman stores are operated by independent franchisees. Product offers end 03/04/10. Savings are off normal ticketed prices.

www.harveynorman.com.au

1493

Terms and conditions apply. See in store for details. 66

The Independent, Friday August 6, 2010.

â&#x20AC;˘ WAURN PONDS

33 Princes Hwy (Homemakers Centre). 5240 6200

487742-RMB31-10

420 Princes Highway, Corio. 5272 9900


420802-JL31-10

sport

90

83

LW 6

85

LW 4

92

LW 5

LW 4

Jason Zaher

Warren Pisano

TTony Marruso

IIan Dart

Harvey Norman Flooring

Andrews & Parker

Harvey Norman Electrical

Allpoints Grovedale

Essendon Hawthorn Fremantle Geelong West Coast St Kilda Melbourne Western Bulldogs

Essendon Sydney North Melbourne Geelong Brisbane St Kilda Melbourne Adelaide

Carlton Hawthorn North Melbourne Collingwood West Coast St Kilda Melbourne Western Bulldogs

Essendon Hawthorn Fremantle Geelong West Coast St Kilda Melbourne Western Bulldogs

Corio

Ph 5272 9900

par arke ar a rk ker ke er &ppa

andr an a nd drew dr re ews ew ws

Corio

furnitu fur ffu urnitu ur u rrn niture nitu ni n itu iit ttu urre e Service Quality & Integrity

Ph 5222 4583

Ph 5272 9900

Ph 5244 4777

91

76

88

96

LW 5

LW 5

LW 7

LW 4

Tim O’Toole

Karren Burr

Daniel Roach D

Ben Riddle

Gold Diggers Arms

Admin Corio

Prestige Ink

Buxton

Carlton Sydney Fremantle Collingwood West Coast St Kilda Melbourne Western Bulldogs

Essendon Hawthorn North Melbourne Collingwood West Coast St Kilda Richmond Western Bulldogs

Essendon Hawthorn Fremantle Geelong West Coast St Kilda Melbourne Western Bulldogs

Carlton Hawthorn Fremantle Collingwood West Coast St Kilda Melbourne Western Bulldogs

Ph 5245 7117

Ph 5228 2999

Cats ‘might win from loss’ BY ANDREW MATHIESON GEELONG coach Mark Thompson has joked the Cats should “probably go out and lose this game” to help their premiership chances. Pointing to the record books from over the past decade, he noted the propensity for premiers to have dropped their reciprocal home-and-away clash before coming over the top of their grand final opponent. In a forerunner to a possible premiership decider, Geelong still remains a slight favourite to hold off Collingwood on Saturday night at the MCG. But Thompson painted the game as “business as usual”, with a loss only costing four points. “If we do end up meeting in the grand final, based on recent events, the team that ends up winning the premiership ends up getting beaten (the last time) during the season by the other team,” he said. “So we probably should go out and lose this game.” The Cats famously lost thrillers

against St Kilda last year and Port Adelaide in 2007 before capturing their last two flags, while beating the Hawks first did little for the defending premiers in the 2008 grand final. On the eve of arguably the blockbuster of the season, former captain Tom Harley said Collingwood was on the same path this year that Geelong trod toward its historic 2007 premiership. “There’s no reason they can’t go on and win the premiership because they’re a great unit and they’ve got some superstars in the ranks,” Harley told a Melbourne newspaper this week. A less-enthusiastic Thompson dismissed the claims, saying the premiership landscape had dramatically changed. “2007 was a very exciting year for us – we were quite a ruthless team,” he responded. “But we didn’t have to play against a Geelong either. There was no other team that was a standout. “I think that this year there are

four or five really good teams in it. “I think it’s closer than any other year in recent history.” Thompson said the players and coaching staff primed themselves every time Geelong returned to the big stage. But he was also quick to give the Magpies the edge in pressure games despite his team having recent grand final appearances on its side. “I think Collingwood has an advantage there because its following is such that it does get to play with 80,000-plus a lot of times over (the players’) careers,” Thompson said. “What we’re got is a lot of experience in our team and the more you do this sort of thing helps. “I can remember my first 2007 grand final and I was absolutely terrified as a coach. “In 2008, I was more prepared and in 2009 it just got a bit easier. “The more you coach in these big games the better you get at it.”

Corio

79

94

LW 5

LW 6

Simon Uridge

Seb Williams S

Harvey Norman Furniture

Geelong Independent

Essendon Sydney Fremantle Geelong West Coast St Kilda Richmond Western Bulldogs

Essendon Sydney Fremantle Collingwood West Coast St Kilda Richmond Western Bulldogs

2nd Prize: 1 night in Melbourne for 2 at the Central Sky Lounge Apartment Hotel

3rd Prize: 2 people half day play, gear and 800 rounds at Hot Shots Paintball

See terms and conditions on starnewsgroup.com.au

Corio

Ph 5272 9900

1st Prize: 5 nights to the Gold Coast with Airfares

Ph 5221 5200

Oarsome: Mayor John Mitchell and Rowing Victoria chief Nick Gall promote the indoor series on Geelong’s waterfront. Picture: John Conway 51096

Call for indoor rowing series entries ROWERS will have the chance to take on gym junkies during an indoor rowing event in Geelong this month. The city’ Arena will host the second round of a Victorian Indoor Rowing Tri-Series on August 21, with prizes up for grabs in age categories and race distances of 100, 500, 2000 and a

four by 2000-metre relay. Mayor John Mitchell, who holds council’s sport portfolio, called for entries. “This event is not just for elite rowers, it’s for anyone who enjoys a challenge,” he said. “Indoor rowing is a great form of exercise. It’s a low-impact and high-calorie-burning workout.

“Try something different – get a few friends together and register for the relay.” Mitchell said the event would have a “giant screen” at the Arena so spectators and competitors could keep track of leaders. Registrations were available at rowingvictoria.asn.au or by phoning 9820 8888, he said.

417350-RMB31-10

Ph 5272 9900

Ph 5221 5441

The Independent, Friday August 6, 2010

67


17

TH BIRTHDAY

I7B;

180W 6â&#x20AC;? 2 WAY SPEAKERS

JEC;H$ B?C?J(F;H9KI9A DEH7?D9>; I$

1200W MONO AMP Low pass filter & adjustable bass boost. SKU ME07144

SKU ME10684

$

15

49

389

$

SAVE $32.99

$

+&E<<

PENNZOIL SYNTHETIC BLEND 10W40 5L

)+E<< 208W FRONT AUX IN MP3 CD TUNER

SKU OA001662

Features EQ3 & album search. SKU ME10356

99

$

C7II?L;:;7B I ED97H7K:?E KFJE)&E<<

20

CF)

E ID W E R O T S %OFF ,

% off Regular Ticketed Price. Excludes advertised & in store specials Navigation, Rhino-Rack, Carryboy & Gift Cards.

HOUR OF POWER :;7B I SUNDAY

SATURDAY

FRIDAY PETROL INJECTOR CLEANER 500ML

TOP DOG XDO 15W40 20L

HIGH PRESSURE CLEANER

Treats 3 tanks. Concentrated. SKU DI01156

Premium grade heavy duty diesel oil suitable for modern & older engines including turbos. SKU OA32012

1300W, 1450PSI. Auto start/stop. Aluminium pump. Includes trigger gun with 5m hose, tornado & turbo nozzles, foam sprayer & hose storage hook. SKU TO10812

'&7C#''7C

'&7C#''7C

'&7C#''7C LIMIT 2 PER CUSTOMER

LIMIT 2 PER CUSTOMER

5

99

$

$ LIMIT 2 PER CUSTOMER

69

$

I7L;+$// PLASTIC JERRY CAN 5LT A must for your car, boat, motorbike, lawn mower or caravan. Australian Standards Approved AS2906:2001. SKU AC01486

I7L;,&

I7L;+&$// K&H PRIMER 400G*

FIRE EXTINGUISHER 1KG 1A:10BE

A single pack grey primer surfacer for use under automotive finish coats. SKU DI00746 *PHOTO ID MAY BE REQUIRED WHEN PURCHASING.

(FC#)FC

LIMIT 2 PER CUSTOMER

)FC#*FC

LIMIT 2 PER CUSTOMER

5

LIMIT 2 PER CUSTOMER

5

$

20

$

I7L;'*$//

$

I7L;/$//

I7L;''$//

O A#HE 9A=?7DJIJ;H;E7JIJEH;:;CE97HIED:?IFB7 J>?II7JKH:7OEDB O Edbo7lW_bWXb[7j

GEELONG 82 SEPARATION STREET

PH: 5278 1200

Sale Ends 9th August 2010. *Savings are off regular ticketed price.

68

The Independent, Friday August 6, 2010.

AUTOVICN03678

487738-RMB31-10

+FC#,FC

Includes metal bracket. Tested & approved to AS/NZS 1841:5. SKU AC27019


487444-RMB31-10

The Independent, Friday August 6, 2010

OPTUS page 3


487445-RMB31-10

OPTUS page 4

The Independent, Friday August 6, 2010.


Bellarine Independent 06/08/2010 | Star News Group Local News, Sport, Entertainment