Issuu on Google+

CYAN MAGENTA GUL SVART

No02 februari 2012

Barcelona – fotboll, sol och mat Camilla ger gymmet ett mänskligt ansikte

Peter Flack – med Hjalmars Jul-Burlesque

Carina Hultquist – framgångsrik Örebroentreprenör Marknad Örebro


CYAN MAGENTA GUL SVART

Marknad Örebro HKM Publishing AB Näbbtorgsgatan 2

INNEHÅLL No 02 2012

702 23 Örebro Fax 019-10 84 30 Besöksadress Näbbtorgsgatan 2

4

Nyheter

8

Kommun & Näringsliv

Chefredaktör och ansvarig utgivare Stefan Hallenius

10 10 16

20 24 24 28 28

070-483 59 47

Porträtt – Carina Hultquist

10

stefan.hallenius@hkm.se Medverkande

Business

Camilla Johansson Ulf Hjelting

Barcelona – fotboll, sol och mat

Richard Ström Dixie Ericson

Camilla på Aspholmens Wellnessclub

Catharina Bergman Paul Dahlgren

Hjalmars Jul-Burlesque

Anders Bromsjö Per Å Knutsson

30

Reklam & Media

32

Lönsam arbetsglädje

34

Incuberabolag pitchade i Silicon Valley

36

Technopolis

38

Inredning

40

Travellista

42

Fashionista

44

Internet

46

Angelica dubbelsatsar

47

Mötesteknologier

48

Margareta Rosengren

50

Bokmalen

52

Businessmatch

54

Hur är läget?

B. Johansson Annika Wihlborg Peter Steen-Christensen Jonas Källgren

20

Annonser Dennis Karlsson 070-637 20 85 dk@hkm.se Regina Kjellström 070-686 21 53 rk@hkm.se Henrik Andersson 070-832 37 30 henrik@hkm.se Utgivare HKM Publishing AB

24

Redaktionell och grafisk produktion HKM Publishing AB Tryck MittMediaPrint Periodicitet Elva nummer per år

Tidningen är tryckt på Solaris, 60 gr papper. Redaktionen ansvarar ej för icke beställt material. HKM Publishing AB ger även ut tidningarna: Nollnitton, Nollnitton Sommarguide, Nollnitton Campus, Utmärkt Örebro, Totally Stockholm och Handelsstaden Örebro. För gratis prenumeration eller adressändring kontakta material@hkm.se eller fax 019 - 10 84 30. Glöm inte att ange namn och fullständig adress.

28

LEDARE » Lojal? Är det viktigt att vara lojal? Vilka skall vi vara lojala gentemot? Vilka är viktiga? Är det den nära kretsen eller är det samhället i sin helhet. Personligen är jag övertygad om att lojalitet måst komma ifrån personligheten. Vill du vara lojal mot dig själv och riskera vara egoistisk eller är det så att du bryr dig om dina närmaste? Jag är övertygad om att vi måste komma bort från “sköt dig själv och skit i andra-attityden”. Du måste kliva ur dig själv och se hur du själv ser ut. Vi måste börja bry oss mer om varandra. Om alla mår bra då mår

2 Marknad

även du bra. Börja med det idag. Se till att bidra. Var en givare och inte en tagare. Ju fler som tänker så ju bättre värld kommer vi snart att leva i.

Trevlig läsning Stefan Hallenius


Har du en innovativ affärsidé? Har du en innovativ affärsidé, produkt eller tjänst, som du vill ta ut på marknaden? Saknar du finansiering, strategiska kontakter, bemanning, eller annan affärsutvecklingsexpertis? Kontakta oss på Inkubera för att få veta mer om hur vi kan hjälpa dig! Vi kan bidra till en snabbare och effektivare kommersialisering av din affärsidé. Vi kan göra skillnad! Hör av dig till Julie Ammer på Inkubera, tel. 019-33 30 46.

din

u aR

stin

K ri Inkubera i Örebro AB är regionens företags- och tillväxtinkubator som utvecklar nya livskraftiga företag i Örebro län. Vi bidrar till en effektivare kommersialisering av innovativa affärsidéer med stor marknadsoch tillväxtpotential. Våra ägare är Örebro universitet, Regionförbundet i Örebro, Örebro kommun, Karlskoga kommun, Örebro läns landsting och ALMI Företagspartner. Vi är en naturlig del av Örebroregionens totala entreprenörs- och innovationssystem.

Inkubera, Forskarvägen 1, 702 18 Örebro.

Bäst på jobbet

Framgångsrik? ramgån

rs

nG

Da

V Vill ill du ut utveckla veckla dittt företag? för ö etag? Då kan kan Almi Almi Mälardalen Mälardalen vara vara det stöd st öd du behöver behöver på vägen. vägen. Vi Vi kan kan finansier finansiering, ing, marknad marknad och mycket mycket mer mer.. TTag ag kontakt kontakt med oss idag, idag, så berättar berättar vi mer mer..

efo ärd

www.almi.se/malardalen www.almi.se/malardalen tfn: 019-174800

Linde lanserar nu en helt ny serie elmotviktstruckar i lyftkapaciteterna 2,0 – 5,0 ton. Var ni än vill använda dessa unika truckar har vi en modell som exakt matchar era behov – från truckens storlek och specifika dimensioner till det följsamma och exakta styrsystemet och mycket, mycket mera. Som du kommer att upptäcka är varje truck tillverkad av Linde – Bäst på jobbet!.

Linde Material Handling

Kontakta oss så får du veta mera.

www.linde-mh.se


CYAN MAGENTA GUL SVART

Marieberg nominerad

Företagen som skickar ut bluffakturor är ett återkommande problem vi nämnt förr i Marknad. Nu har kreditupplysningsföretag som UC fått nog av deras förehavanden. Får man en faktura på något man inte beställt eller gått med på är den naturliga reaktionen att inte betala den. Vill det sig riktigt illa så resulterar det i att fakturan hamnar hos Kronofogden, och som ett brev på posten kommer betalningsanmärkningen. Men nu har alltså kreditupplysningsföretagen bestämt sig för att på sitt sätt slå tillbaka mot de falska företagen och deras fakturor. Det sker genom att man helt enkelt rensar bort alla betalningsanmärkningar som är kopplade till bluffakturor med Svensk Handels lista över dessa som utgångspunkt. Det innebär att drabbade företag slipper den extra börda det innebär att bli stämplade som icke-kreditvärdigt, och man kan därför helt bortse från bedragarnas hot om betalningsanmärkningar ifall betalning inte sker.

Marieberg Galleria är en av tre nominerade gallerior. Omröstningen går av stapeln i Stockholm i mars, och för segraren finns möjligheten att få titeln ”Nordens populäraste galleria”. – Det är en stor ära för oss att bli nominerade till detta pris, säger Håkan Jacobsson Center Manager för Marieberg Galleria. Vi har lagt stor kraft och engagemang på att skapa en shoppingdestination som inte enbart erbjuder shopping utan också ger en upplevelse, säger Håkan Jacobsson. Tävlingen är i regi av Nordic Council of Shopping Centres, NCSC, vilket är en intresseorganisation för köpcentrumverksamhet i Norden med cirka 1 100 medlemmar. Förfarandet för att få fram de tre kandidaterna har gått till så att 100 stadigvarande kunder vid varje galleria har fått betygssätta ”sin” galleria utifrån en rad kriterier. Till det kommer att centret själv får lämna uppgifter om utveckling, yteffektivitet, ekonomi, samt miljö- och samhällsarbete.

Foto Mark Earthy

Kreditupplysningsföretag slår tillbaka

Inte ens ett år har gått sedan Marieberg Galleria mottog det prestigefyllda priset som Europas bästa galleria i klassen ”Refurbishments & Expansions” (utveckling, om- och utbyggnad) av ICSC förrän det är dags igen. Nu har Marieberg Galleria blivit nominerad som Sveriges bästa galleria.

Detta har lagts fram för en jury som sedan besökt varje köpcentrum. Efter cirka en månads betänketid kommer denna jury att meddela vilket galleria det blir som i maj har en chans att bli Nordens bästa galleria.

Coaching i sociala medier

Inkubera belönas Lagom till jul kom ett glädjande besked för Inkubera. Från den 1:a januari är man antagen i B.I.G Sweden Summit, något som bland annat innebär en finansering på 1 miljon kronor per år. Till B.I.G Sweden, Business Incubation for Growth Sweden, antas endast inkubatorer på vilka det ställts mycket höga krav gällande förmåga att bland annat utveckla affärsidéer, förfogande över resurser för affärs- och företagsutveckling samt förankring och legitimitet i innovationssystemet och näringslivet. – Att Inkubera blivit antagna till BIG Sweden SUMMIT är belöningen efter flera års uppbyggnadsarbete för att bli en framgångsrik inkubator, som arbetar utifrån vältrimmade processer. Det brukar heta att framgång föder framgång och det här är verkligen ett kvitto på att vi satsar på rätt innovationer. Inkuberas kunder gör stora framsteg och det smittar av sig även på Örebroregionens inkubator, säger Mikael Melitshenko, tillförordnad vd på Inkubera.

Detta med sociala medier är något som säkerligen är här för att stanna, åtminstone till nästa hopp den kommunikativa utvecklingen kommer. Det är på nätet det händer, och de flesta företag har insett värdet av att vara med.

Anette Waldemarsson har via sitt företag Marknadskompetens de senaste åren hållit kurser i sociala medier där företag startat Facebookkonton, börjat twittra och på andra sätt get sig ut i den virtuella världen. Slutresultatet har dock inte varit det önskade, det har varit svårt för företagen att marknadsföra sig via internet. – Relativt få av företagen har lyckats hänga i efter utbildningen med de nyvunna kunskaperna. Det är mycket annat som kommer före, konstaterar Anette Waldemarsson. Därför dras nu ett nytt koncept igång, som helt enkelt består av träning i sociala medier. Istället för att företagen ska behöva lägga tid på att efterforska den utveckling som sker på området som kommer istället Anette Waldemarsson att tillsammans med Lars-Eric Gustafsson att besöka intresserade företag någon gång i månaden för att få hjälp och möjlighet att fokusera på sina mål. – Det kan handla om att visa en ny funktion på datorn, hjälpa till att formulera en strategi eller diskutera hur man bäst hanterar kritik i sociala medier, säger Lars-Eric Gustafsson.

Vi tycker som du. Helgen är bäst! Vi har utdelning på helgen när observationen är som högst och folk har mer tid att läsa. Läs mer på www.sdr.se. Välkommen att kontakta Martin Säretun och Mikael Ollas

4 Marknad

OSMUNDGATAN 2, 703 63 ÖREBRO TEL 019-10 49 40, MOBIL 0703-09 25 58 E-MAIL sdr512@sdr.se


HÄR BLIR DRÖMMAR LEVANDE!

99:-

PER PERSON OCH DAG (ORD.PRIS 175KR / DAG) För konferenslokal och kreativt fröjdepaket. Gäller er som bokar konferens senast 29/2-2012 TEL: 0587-802

00

WWW.BREDSJOHERRGARDAR.SE INFO@BREDSJOGARDEN.SE HÄLLEFORS

HOTELL Våra rum är inredda med personlig stil, internet gratis för gäster. Starta dagen med vår härliga frukostbuffé!

KONFERENS 6 olika storlekar, största rummet upp till 130 pers. Alla rum har internet och övrig AV-utrustning, grupprum.

Välkommen till LUNCH MIDDAG Ring för bokning 0220-380 90

Tel: 0220-380 90 www.ramnaskonferens.se bokning@ramnaskonferens.se

Vi lanserar årets stora IT-nyhet i Örebro. Han heter Mattias. På Koneo är vi övertygade om att man bara kan erbjuda rätt IT-lösningar, rätt tjänster och rätt support om man har tid att träffas och lära känna varandra. Prata med Mattias Andershed så hjälper han dig. Ring honom på 019-27 87 00 eller skriv en rad till mattias.andershed@koneo.se Koneo gör IT enklare. Vi finns alltid nära, på mer än 40 platser över hela landet. Vår ambition är att vara den bästa leverantören av IT på alla de platser i landet där vi finns. Dessutom kan vi erbjuda det stora företagets fördelar med support, specialistkompetens och effektiva tjänster. Koneo är en del av Konica Minolta. Läs mer på koneo.se

Vi ger kraft åt din ambition

Engelbrektsgatan 4, Örebro eller ring 019-764 10 00.


CYAN MAGENTA GUL SVART

Gustavsvik håller ställningarna väl med nytt rekord! Camping & Stugbyn vid Gustavsvik slår nytt rekord med antalet övernattningar 2011. Det är visserligen med bara några hundra gästnätter fler än föregående år. Men det är fjärde året i rad som man passerar 110 000 gästnätter. Det mest anmärkningsvärda är dock att det inte finns någon campingplats på hela den svenska västkusten som sommartid redovisar lika många gästnätter som Gustavsvik i Örebro. Hela Gustavsviksanläggningen – med inomhusoch utomhusbad, camping och stugby – registrerade 604 000 besök under 2011, vilket innebär att anläggningen är den enskilt största turist- och fritidsanläggningen i landet utanför Stockholm och Göteborg. Inomhusbadets Relaxavdelning har genomgått rejäla ”ansiktslyftningar” i två etapper. Trots att Relaxen då varit stängd i en hel månad slår man 2010 års besökssiffra. Det är Örebro Fritidscenter AB som äger Gustavsviksanläggningen. Under året har företaget fått ett breddat ägande genom en nyemission som riktades till både Örebroporten Fastigheter AB och ett antal lokala intressenter. Avsikten har varit att dessa intressenter ska tillföra företaget dels ökat eget kapital, dels kompetens från flera skilda verksamhetsområden.

Ny kross till E.ON E.ONs fjärrvärmeverk i Örebro blir först i Sverige med att installera en kross som med hög kapacitet klarar av att bereda alla typer av biobränslen. Det är finska BHM Technology och Saalasti som fått i uppdrag att leverera krossen under 2012. Byggandet har redan kommit igång vid E.ONs Åbyverk, och resultatet ska vid slutförandet vara en ny och effektiv biobränsleeldad kraftvärmeanläggning vilken förväntas vara i drift vintern 2012-13. Den helautomatiska krosslinje som levereras av BHM Technology och Salaasti Oy är den första av sitt slag i Sverige, med redan väl beprövad i Finland, vid ett av världens största biobränsledrivna kraftverk i Jakobstad. Krossen har en kapacitet på 120 ton per timme och kan ta emot och bearbeta cirka 200 000 ton per år. Ett alternativ som stod tillbuds var annars flera långsamtgående krossar vid fjärrvärmeverket eller vad som är dagens praxis; dieseldrivna krossar och flisare i skogen och vid bränsleterminaler.

Samarbete mellan näringsliv och kommun Det var redan 1945 som skofabriken Ymer startades i Kumla av Ragnar Karlsson. Produktionen har fortsatt och stått sig mot en ständigt ökande mängd skor importerade från låglöneländer. Sedan 1975 är dock tillverkningen, och skorna, kända under namnet ”Kavat” för de allra flesta föräldrar. För det har varit just barnskor som har varit Kavat AB:s, tidigare Ymers, kännetecken. Sedan några år tillbaka ligger dock produktionen av barnskorna förlagd till en fabrik i Bosnien. I Kumla började man 2010 tillverka damskor av hög kvalitet och i ekologiskt material, och i år har man tagit ytterligare ett steg i utvecklingen. Under den andra helgen i januari lanserades en kollektion herrskor på skomässan i Riva del Garda i Italien. Nu hoppas man på att Anders, Bengt, Carl-Eric och Ragnar, som skorna heter, ska falla i god jord så väl i Sverige som ute i Europa.

I Örebro kommun, precis som i många andra kommuner i landet, är arbetslösheten bland ungdomar alldeles för hög. Nu startar dock näringslivet i Örebro och Örebro kommun ett projekt för att öka antalet praktikplatser i kommunen för denna målgrupp. Samarbetet kommer att fungera som så att mot att ett företag erbjuder en arbetslös ungdom en praktikplats, kommer kommunen i sin tur att erbjuda företaget hjälp med rekryteringen av den samma och administrationen där om kring. – Vi vet att det finns flera företag som skulle ha nytta av feriepraktikanter, men tiden räcker inte riktigt till för administrationen som det innebär. Därför ser vi det som en stor fördel att kommunen sköter både rekryteringen och innehar arbetsgivaransvaret, säger Jenny Emerén, Kommunikationschef på Handelskammaren Mälardalen. Lena Baastad (s) konstaterar att under de senaste två åren har 2 000 feriepraktikanter åldrarna 15-17 år anställts inom de kommunala verksamheterna.

Foto Ulla-Carin Ekblom

Kavat AB tar nya steg i herrskor

Lena Baastad.

– Ser man till andra jämförbara kommuner är vi bland de bästa i landet. 2012 kan kommunen erbjuda cirka 1 500 ungdomar feriepraktik och tillsammans med näringslivet kan vi skapa många fler, säger Lena Baastad. Projektet stödjs av ÖSK, Handelskammaren Mälardalen och Företagarna.

Ta med dig en vän och spela tennis, badminton, pingis eller squash i Backahallen BADMINTON SQUASH TENNIS PINGIS RACKETSHOP

6 Marknad

Boka tid på : 019-33 11 10 eller www.backahallen.com


Caddy X. Offroad feeling.

Caddy X 2,0 T TDI DI 110 hk 4M 4MOTION OTION

Caddy X 2,0 T TDI DI 110 hk 4M 4MOTION OTION DSG

219.900:2 19.900:- exkl moms (ord (or d pris 240.000:- exkl moms)

249 249.900:.900:- exkl moms (ord (ord pris 274.000:274.000:- exkl moms)

eller 2.390:-/mån* /mån*

eller 2.715:-/mån* 2.715:-/mån* 15:-

N y a C a d d y ® X ä r d e n k a x i g a s t e C a d d y n n å g on s i n . E n bi l s om i nte t vek a r f ör k r äv a nde ut m a n i ng a r el ler omöj l ig a uppg i f ter. Sjä l v k l a r t h a r C add y X 4 Mot ion s om ger överl ä g s en f r a m koml i g h e t o c h g ör d e n t i l l e n p e r f e k t bi l f ör s v e n s k a f ör h å l l a nd e n och ot i l lg ä ng l ig a a r bet spl at s er. D u h a r oc k s å möj l ig het at t k om p l e t t e r a m e d D S G a u t om a t l å d a . N y a C a d d y X g e r d i g e n r i k t i g o f f r o a d-k ä n s l a . D e n t o r n a d o r ö d a bi l e n ä r f ör s e d d m e d u nd e r k ör n i n g s s k y d d , s k ä r m br e d d a r e , r a i l s och 17- t u m s a lu m i n iu m f ä lg a r. I ut r u st n i ng s l i st a n h it t a r d u o c k s å C r u i s e -p a k e t m e d C l i m a t i c , f a r t h å l l a r e , r a d i o m e d C D o c h k om f or t f ör a r s ä t e. D e n h a r ä v e n lj u s & s i k t p a k e t , mu l t i r a t t , n a v i g a t i on , p a r k e r i n g s v ä r m a r e o c h d r a g k r o k s om s t a n d a r d . I nu t i s i t t e r e n s p e c i a l d e s i g n a d o c h i n k l ä d d m e l l a nv ä g g o c h l a s t r u m s b e k l ä d n a d . F i n n s me d 2 ,0 l T DI C R 1 10 h k el ler 14 0 h k .

B r ä n s l e f ör br u k n i n g b l k ör n i n g f r å n 6 ,4 l /10 0 k m ( 16 8 g C O 2 / k m ) . * Vo l k s w a g e n L e a s i n g 3 6 m å n , 3 0 % s ä r s k i l d l e a s i n g a v g i f t , 4 0 % r e s t v ä r d e , r ör l i g r ä n t a b a s e r a d p å S T I B OR 9 0 . Te c k n a d e s s u t om f ör m å n l i g f ör s ä k r i n g o c h s e r v i c e a v t a l , a l l t p å s a m m a f a k t u r a . S a m t l i g a p r i s e r ä r r e k . c i r k a p r i s e r e x k l m om s . B i l e n p å bi l d e n ä r e x t r a u t r u s t a d . E r bj u d a n d e t g ä l l e r e n b e g r ä n s a d m ä n g d bi l a r o c h m e d l e v e r a n s s e n a s t 2 01 2- 0 4 - 3 0 . ®P rod u k t n a m n e t C a d d y ä r e t t r e g i s t r e r a t v a r u m ä r k e o c h a n v ä n d s a v Vo l k s w a g e n C om m e r c i a l Ve h i c l e s m e d t i l l s t å n d a v C a d d i e S . A .

Magnus Lars Larsson son 019-20 0 19-20 55 23

Tommy Tomm o yS Stylin tylin 019-20 019-20 55 43

Ozongatan 1 , Örebro Tfn. 019-20 55 00 mollerbil.se

Konferens med lyxiga Relaxen Konferera i något av våra konferensrum, för 50 respektive 12 personer. De är utrustade med all teknik ni behöver och ligger i anslutning till Relaxen. Relaxen har under hösten byggts om och kan nu erbjuda ett nytt, öppet och fräscht varmrum. Även en ny bastu med stora glaspartier ut mot relaxrummet – båda är gemensamma för damer och herrar. Relaxrummet har blivit ljusare och öppnare. Barmenyn frestar med många läckra smårätter. Dryckesmenyn är omfattande med bl a ett mycket spännande ölsortiment. Lunchen avnjuter ni i Restaurang Gustavsvik.

Arbete och Relax är en oslagbar kombination! Välkommen att boka: Telefon 019-19 69 40 E-post relaxen@gustavsvik..se

Öppet: mån-fre 9.00-21.00, lör-sön 9.00-19.00


CYAN MAGENTA GUL SVART

NCC bygger nytt utbildningsoch forskningscentrum Text B. Johansson Illustration White arkitekter AB

NCC Construction, avdelning Hus i Örebro län fortsätter framgångsrikt att få byggentreprenader i Örebro. Nu har man fått uppdraget att bygga nya utbildnings- och forskningslokaler åt Örebro läns landsting. Lokalerna ska nyttjas bl a för Örebro universitets läkarutbildning och byggs strax intill Universitetssjukhuset.

Södra Grev Rosengatan läggs om Byggnaden kommer att uppförs norr om den befintliga Södra Grev Rosengatan – i sjukhusområdets nordöstra läge. Den del av Södra Grev Rosengatan som ligger öster om rondellen vid Trädgårdsgatan kommer därför att läggas om och få ett nordligare läge i öst-västlig sträckning än tidigare – allt för att ge plats för ett nytt forskningscentrum och senare ytterligare utbyggnad av USÖ. Projektet genomförs som en samverkansentreprenad eller som NCC föredrar att kalla det – partnering. Det är en samarbetsform ordnad så att byggherre, konsulter och entreprenörer gemensamt löser bygguppgiften. Partnering grundas på ett öppet och 8 Marknad

förtroendefullt samarbete där de skilda parternas yrkeskunskaper och kompetens kompletterar varandra i projektets samtliga skeden. Byggkostnaderna för de nya utbildnings- och forskningslokalerna beräknas till närmare 300 miljoner kronor.

men, laboratorier, hörsalar, bibliotek, kontor och restaurang – allt i fyra våningar samt källare. Bruttoarean blir 11 600 kvadratmeter. Cirka 50 personer beräknas bli sysselsatta i projektet. White arkitekter i Örebro står för arkitekturen.

Klart inför vårterminen 2014 De första läkarstudenterna vid Örebro universitet började i januari 2011. När utbildningen är fullt utbyggd kommer 700 läkarstudenter att läsa vid universitetet. Under större delen av utbildningen anses det mycket viktigt med närhet till universitetssjukhuset. Campus USÖ har därför hela tiden varit en förutsättning för att driva en högklassig läkarutbildning i Örebro. Man har beräknat att läkarstudenterna vuxit sig ur de befintliga lokalerna efter sex terminer, varför man inför vårterminen 2014 behöver nya lokaler för läkarutbildningens Örebropionjärer. Även universitetets medicinska forskning liksom universitetssjukhusets egen forskning lokaliseras till den nya byggnaden. Den kommer att rymma undervisningsutrym-

Kortfakta NCC Construction Sverige NCC Construction är verksamt inom hus- och anläggningsbyggande samt inom byggservice i Sverige. Inom dessa tre områden arbetar NCC Construction Sverige i nära samarbete med kunden genom hela värdekedjan. Omsättningen inom NCC Construction Sverige var under 2011 cirka 23,5 MDR SEK och antalet anställda runt 7 500.


: JUST NU r Chaufföre ratörer CNC-ope e Truckförar m.m.

RES KOSTNADSEFFEKTIVT OCH BEKVÄMT I TJÄNSTEN Genom Länstrafikens Företagskort för företag, myndigheter, kommuner, landsting och andra organisationer blir tjänsteresandet:

T Å M A R F RT A F L L U R F A G N I R E T Y R K E R MED

• enkelt och smidigt • prisvärt och flexibelt • miljövänligt och hälsosamt • effektivt och avkopplande

Läs mer på: www.lanstrafiken.se/foretag

HÄR HITTAR DU DITT NYA JOBB

För oss som är på väg i Mälardalen

www.arenapersonal.com

www.lanstrafiken.se

ELFA

Inredning

ri går startskottet för då? Jo, den 23 februa Var r. ise apr gal a låg ord r 100 bygghandlare, Just nu har vi rek ing eller hoppa in till öve Spr na. Are be Glo n sso om trä och bygg! för XL-Galan i Eric sonliga rekord i kunskapen per slå att o red och rm vilka är i toppfo

33% Gäller på leverantörens bruttoprislista.

BAHCO

Galapris på kvalitetsgolv!

Handsåg Tvåkomponenthandtag. Antifriktionsbehandlad. Superior 2600 XT. Rek. ca pris 269:-

169:-

Spara 1000:-

219:-/m2

BOSCH

PARADOR

Skruvdragare

Parkettgolv Ek Rustik

Proffsig 14,4 Volts skruvdragare med inbyggd LED-arbetsbelysning. Kompakt skruvdragare som bara väger 1,3 kg. Levereras med 2 batterier. GSR 14,4-2 LI. Rek. ca pris 2495:-

Ett rustikt 3-stavs golv. Lackad yta och 13 mm tjockt. Limfri fog. Pris/kvm 349:-/m2

En riktig bygghandel Kumla-Björka 206, Telefon 019-57 09 05 Öppet: Måndag – onsdag 7–17, Torsdag 7–18.30, Fredag 7–17, Lördag 10–13, www.xlbjorka.se

1495:-


10 Marknad


Carina Hultquist – framgångsrik Örebroentreprenör Text Per Å Knutsson Foto richardstrom.com

– Att sköta sina kort väl, att slita hårt, att vara ödmjuk, en god lyssnare och att visa respekt för människor har blivit mina honnörsord, berättar Carina Hultquist för Marknad Örebros utsände. Carina Hultquist startade för drygt 11 år sedan företaget Rent Hus. Nu är hon en framgångsrik entreprenör i städbranschen med uppmärksammade nomineringar som årets Affärsnätverkare 2008 i Svergie av BNI efter att ha vunnit det regionala priset i Örebro län och som en av de tio finalisterna i regiontävlingen Svealands Bästa Entreprenör 2011 – ”The Entrepreneur Of The Year”. Vi träffas för ett samtal på ett av Örebros många populära caféer. Det är en vardagseftermiddag mitt i veckan. Tjugondedag jul står för dörren. Caféet är

fullsatt trots att julhandel och mellandagsreor är förbi. De moderna stolarna med retrofärgat möbeltyg påminner om den tid då Krämaren en gång öppnade i början av 1960-talet – orange, brunt och pistage.

Snabb tillväxt Rent Hus i Örebro AB har idag 45 anställda samt ytterligare ett 30-tal behovsanställda. Personalen är handplockad. Företagets omsättning har bara under de senaste åren ökat från 12 miljoner kronor 2008 till 17 miljoner kronor 2011. I takt med att miljöoch hälsofrågor allt mer har hamnat i fokus har städning blivit en allt viktigare del i människors medvetande. – Rengöringsmedel kan innehålla starkt allergiframkallande ämnen som även

kan vara skadliga för miljön. Därför har vi valt att arbeta med miljögodkända produkter i enlighet med vår miljöcertifiering. De produkter vi använder är av toppkvalitet, både från miljö- och hälsosynpunkt, säger Carina uttrycksfullt och fortsätter försiktigt. – I kombination med vår mångåriga erfarenhet och kompetenta personal kan vi garantera mycket hög städkvalitet. Rent Hus startade hösten 2000. Vår uppfattning är att städning kan betyda så mycket mer än bara rent och välstädat. Det skapar välmående och välstånd, menar Carina engagerat.

Påläst och uttrycksfull Ur högtalarna flödar musiken i ett svagt och trivsamt sorl. Golvet under fötterna är klätt i keramiska plattor i

grått och beigevitt, mönstrade i parallella band. Väggarna domineras av vitt med inslag av gråsvarta plattor och med detaljer i rostfritt stål. Krämaren ger ett generöst luftigt, ljust och elegant intryck. Ljudet omkring oss förefaller alls inte störa Carina när hon berättar. Hon har lätt för att prata. Hon är kunnig och påläst och hon utrycker sig väl. Carinas entusiasm över sitt jobb smittar. Hennes kunskaper om förutsättningarna för ett fåmansbolag kan tyckas vara elementära – men ack så ofta dessa kunskaper saknas! Carina Hultquist ger ett professionellt intryck. Carina är född i Örebro. Hon växte upp i både Göteborg och Västerås för att sedan återkomma till Örebrotrakten, närmare bestämt Vintrosa och Lanna. Forts. 12

»

Nummer 2 2012 11


» Hästintresset – hopp och dressyr – var

stort i unga år precis som fotboll. Carina började med tjejfotboll i Latorps IF och blev senare ”värvad” till Närkes Kil. Sina gymnasiestudier bedrev hon vid Risbergska skolan i Örebro. Carina har bland annat arbetat som undersköterska, vid Videobiljarden på Järntorget och på Sannakroa utmed E 18.

Idéen om ett eget företag – När jag jobbade vid Berifors hade jag tankarna på att komma bort från industrin – jag ville göra något som jag verkligen brann för. Eftersom jag alltid har varit intresserad av ordning och reda, snyggt och stilrent utvecklades mina idéer, berättar Carina och fortsätter. – Under mammaledigheten till vårt tredje barn blev jag alltmer övertygad om att jag ville starta en egen städfirma. Jag utbildade mig i Stockholm och fann en mentor som då betydde och även senare har betytt väldigt mycket för mig. – Så skulle jag finna kunder. Det var telefonkatalogen, vänner och bekanta och mängder av telefonsamtal som gällde. Men det gick och efter bara ett par år hade den enskilda firman vuxit så att det var dags att bilda ett aktiebolag – Rent Hus i Örebro AB, säger Carina och ler.

Tuff bransch – Tidigt lärde jag mig att personalen är A och O – det är personalen som är företaget. De första åren deltog jag hela dagarna i det praktiska arbetet, berättar Carina. Marknads utsände kan konstatera att Carinas jobb de första åren med firman måste ha varit mångfacetterad – hon var inte bara trebarnsmamma och hustru utan ägnade veckans alla dagar även åt att städa, fungera som säljare, inköpare och kvalitetsansvarig, leda personalen och vårda kunderna. – Det blev en livsstil och i takt med att firman växte ökade också administrationen i omfattning. Jag lade ned allt mer arbete på att Rent Hus skulle uppträda proffsigt – kollektivavtal, säkra bilar, miljötänk, återkoppling och närhet till kunderna blev allt viktigare. Idag finns det ett 40-tal städföretag I Örebro. Konkurrensen är knivskarp även om det sk RUT-avdraget för privata hushållstjänster har bidragit till större efterfrågan på bland annat städtjänster. – Vi arbetar efter ett världstäckande och respekterat golvvårdssystem som funnits sedan 1978. Med fasta kon-

trakt och ständig kvalitetssäkring är Rent Hus en trygg och säker leverantör, förklarar Carina och fortsätter. – Det är en tuff bransch men jag älskar det. Det måste vara ordning och reda i bokföringen, betalningar och faktureringar måste ske i tid. För mig gäller det att ständigt ha koll på vad som sker i företaget och med våra kunder, säger Carina med bestämdhet. Rent Hus i Örebro AB bedriver verksamhet inte bara i Örebro utan även i Eskilstuna, Jönköping, Karlstad, Linköping, Uppsala och Västerås. Häften av de anställda verkar i Örebro.

Hela familjen gillar fotboll Hur Carina Hultquist hinner med allt är svårt att förstå. Familjen äldsta dotter jobbar i företaget medan en dotter och en son på 13 och 11 år ska köras till fotbollsträning med Karlslund på Rosta Gärde och med ÖSK Ungdom på Ekäng – tre gånger vardera per vecka året runt! Att köra sina barn till träningstillfällen och matcher gör Carina och hennes man Pelle med glädje. – Vi delar fotbollsintresset. Såväl Pelles arbetsgivare som Rent Hus är samarbetspartners till ÖSK Fotboll, berättar Carina förtjust och påpekar att det är

hela familjen som delar fotbollsintresset. Genom de väldiga panoramarutorna i glas utanför oss där vi sitter visar sig det vanligtvis trista Våghustorget i sin bästa dager. Skymningen har redan fallit och juldekorationerna uppträder i ”full blom”. Ett av de relativt nyplanterade träden på Våghustorget är klädd i en flod av ljus och dekorationerna på Vågen Gallerians fasad skänker ännu julstämning. Till vänster genom glasrutorna skymtar man de traditionella julgirlanderna över Drottninggatan – visserligen nya inför den gångna julen. Carina Hultquist skyndar till jobbet. Forts. 14

12 Marknad

»


Grattis Lilla Örebro Vilken succé!

Stora Örebro med plats för fler!

Välkommnen att boka representationsmiddag och personalträffar, eller kanske komma på en skön after-work redan nu på fredag! För bokning och funderingar ring 070-482 16 17 www.storaorebro.se


CYAN MAGENTA GUL SVART

Carinas favoriter Mat – Maken Pelles italienska Dryck – Rött italienskt vin, bubbel och vatten Film – ”Bridget Jones dagbok” med bland andra Renée Zellweger, Colin Firth och Hugh Grant samt ”When a Man Loves a Woman” med bland andra Meg Ryan och Andy Carcia Bil – Volvo Idrott – Fotboll Hobby – Tidigare hästar – numer familjen och barnens idrott

Rent Hus i Örebro AB Rent Hus är ett komplett städoch serviceföretag, varför man utför bland annat golvvård, fönsterputsning, hem-, kontoroch lokalstädning och fasadtvätt – ej flyttstädning.

14 Marknad


MAT MÖTEN MINNEN HÜst, vinter, vür och sommar – i Katrinelund är alla ürstider vackra. Det känns därfÜr fantastiskt att vi nu kan hälsa er välkomna hit üret runt! Vürt alldeles nyrenoverade Gästgiveri ligger ett stenkast frün SjÜkrogen vid Hjälmarens strand. Vi hjälper er gärna med:

• • • •

HĂśgtidsdagar Konferenser Aktiv matlagning Catering

6HUYLFHDY LQGXVWULSRUWDU 0HGYnUQ\DVHUYLFHDYGHOQLQJWDUYLKDQGRP XQGHUKnOOHWDYHUDLQGXVWULSRUWDUJULQGDU PDVNLQHULHUPP9nUSHUVRQDOKDUHUIDUHQKHW DYVDPWOLJDIDEULNDWSnPDUNQDGHQRFKDUEHWV RPUnGHWVWUlFNHUVLJ|YHUKHODgUHEUROlQ .RQWDNWD5RJHU.OHPHGVVRQI|UHQGLVNXVVLRQ KXUYLNDQWDKDQGRPMXVWHUWXQGHUKnOOVEHKRY 6MlOYNODUWWDUYLKDQGRPDNXWDHOOHUEUnGVNDQGH VHUYLFHlUHQGHQ bUQLLEHKRYDYQ\DSRUWDUJULQGDUPRQWDJH PPRUGQDUYLQDWXUOLJWYLVGHWWDRFNVn 

Varmt välkomna! *DUDJHSRUWDU ,QGXVWULSRUWDU 6HUYLFH 0RQWDJH ZZZJDUDJHSRUWH[SHUWHQVH

Clarion À la carte Clarion Afterwork, Fredagar Happy Bubbel 15.30-17.00 Clarion Brunch, LÜrdagar 11.30 – 15.00

Boka bord 019- 670 67 07 Kungsgatan 14, Ă–rebro - www.clarionorebro.se

Tel. 019-44 90 60


CYAN MAGENTA GUL SVART

Business

Föreläsningar och inspiration

Skydden för lagerinredningen

First Relations Örebro erbjuder After Work med föreläsning och inspiration på First Hotel där du ges möjlighet att knyta nya kontakter över branschgränserna. Under dessa tillfällen ges du därför möjlighet att träffa artister, konstnärer, företagare, anställda, privatpersoner och hotellgäster. Människor som du kanske aldrig skulle ha träffat annars. Nästa After Work är den 15:e februari då författaren Sanna Nova Emilia föreläser under rubriken “Vem är jag och vem vill jag vara?”. – Den här kvällen lyfter jag det mycket ur ett allmänt perspektiv. Om hur vi som vuxenvärld försakat många av de som vi kallar för "barnegenskaper". Det vill säga nyfikenhet, lekfullhet, kreativitet, spontanitet, glädje, tillit, självkänsla, fantasi, säger Sanna Nova Emilia. Sanna är också aktuell med boken ”Att lära med Hjärtat – När kunskap och värde blir ett”.

Text Ulf Hjelting

För företag med pallställslager ger påkörningsskador med truckar kostsamma reparationer. Hittills har det inte funnits någon bra skyddslösning – det finns det nu i form av Rack Armour och allroundskyddet ON^OFF. En olycka händer så lätt. Trycket på orderingången ökar och kunderna vill ha sina varor så fort som möjligt. Företaget implementerar just-in-time för att ytterligare öka kundernas krav på leverans och leveranssäkerhet. Lagret går för högtryck och det är då det händer… en av företagets truckförare tar en kurva lite lite för snävt och hörnet på pallställslagret får sig en smäll. Stålbalkar vrids och en reparation är oundviklig. Även trucken har fått några rejäla skrapmärken… Känns scenariot igen? Hittills har det inte funnits något bra och enkelt skydd för pallställslager. AB ÖLM Lagerinredningar i Örebro har dock lösningen på problemet och det heter Rack Armour. – Rack Armour-skyddet är av samma material, HDPE, som i skottsäkra västar och rymdfärjor – ett ballistiskt polymer, säger Alric Jinghede på AB ÖLM Lagerinredningar samtidigt som han visar upp det gula skyddet. Det 60 centimeter långa skyddet är

16 Marknad

häpnadsväckande lätt och lite hårdplastigt i strukturen. Montaget av denna Rack Armour går också blixtsnabbt och kräver inget som helst ingrepp av en borrmaskin. – En Rack Armour snäpps på och det tar bara några sekunder, säger Alric Jinghede. I dag finns Rack Armour på IKEA, Försvarets lager i Arboga, Spendrups och i Norge där bland annat Asko Nord använder det i sitt centrallager i Tromsö. – Enbart Spendrups uppger att man sparar minst 100 000 per år i reparationer av sina pallställslager genom att använda Rack Armour, inflikar Alric. Men Rack Armour är bara en del för att uppnå ett fullgott skydd i pallställslagret. För att uppnå ett 100-procentigt skydd bör Rack Armour kompletteras med skyddet ON^OFF. Först i Sverige att använda denna lösning till sitt pallställslager var Ahlsells i Hallsberg. – Det här skyddet nyttjar truckens låga frigående gång och finns i tre olika storlekar. Skyddets utformning gör att trucken inte rycker loss någon betong från golvet vid en kollision. Visserligen måste ONÔFF fästas i golvet med bultar, men mot de traditionella skydden måste inte detta bytas varje gång det sker en påkörning, säger Alric.

Största utbildningsföretaget Sveriges största utbildningsföretag finns bland annat i Örebro och på 30 orter i Sverige. I Utbildningsbarometern för våren 2012 via utbildningsportalen Utbildning.se rankas Lexicon som nummer ett och ledande bland Sveriges 30 största utbildningsföretag. Över en miljon människor har hittills valt att utveckla sin kompetens hos Lexicon. – Vår styrka är att vi finns på så många orter i Sverige och att vi därför kan erbjuda företag som är spridda över hela landet en och samma utbildning oberoende på stad, säger Fredrik Forell säljare på Lexicon i Örebro. Under 2012 kommer Lexicon att lansera sex helt nya utbildningar: inköp, digital solution, service, chairpoint, effekt och affärsmannaskap.


Bångbro Herrgård Bångbro Herrgård

— I hjärtat av Bergslagen —

HOTELL t RESTAURANG KONFERENS 25 år som familjeföretag i Bångbro, Kopparberg. Öppet året runt. Vardagar öppnar vi kl. 18.00 Andra tider och helger förbokas.

Affärs och familjehotell, trivsamma rum med dusch/wc, TV och trådlöst internet.

Boka gärna ert möte/sammankomst/konferens hos oss. Företagsträffar, kick off, gruppresor, bröllop, vigsel, dop, andra högtidsdagar, minnesstunder, föreningar, möten, årsmöten. Vi tar även emot beställningar på smörgåstårtor, catering mm. Förfrågningar eller övriga önskemål, ring gärna för besked. Bokning/förfrågan 0580-120 00, info@bangbro.se www.bangbro.se Välkommen hit hälsar Åsa och Thomas med personal


CYAN MAGENTA GUL SVART

Business

Charter till Mexico Text Ulf Hjelting

Den 14 januari 2013 avgår en Airbus A330-200 från Örebro Airport till Cancun i Mexiko. Detta är första gången en regional flygplats i Sverige kan erbjuda charter västerut. Intresset för Karibien har ökat betydligt de senaste åren och därför gör man nu en stor satsning till nästa vinter, där bland annat Jamaica är en av nyheterna. Det blir också charterflyg till Punta Cana i Dominikanska republiken och ökande antal avgångar till Mexiko och Aruba. Bakom denna satsning står researrangören Ving. Mexiko är det där lite mystiska landet beläget mellan Nordamerika och Mellanamerika och som består av långsträckta stränder, kristallklart vatten och som har en uråldrig historia fylld med spännande saker. Det här är landet med de vänliga människorna och den mytomspunnena spritdrycken tequila som kan drickas med eller utan tillhörande larv. Vem har inte fredagsmyst någon gång med taco till kvällsmat? Maten är vi redan bekanta med här i kalla Norden och nu får vi ytterligare möjligheter att se och njuta av denna pärla till turistmål. Till nästa vinter utökar nämligen Ving antalet platser till Mexiko med 30 procent. En av de flygplatser som får ta del av dessa ökade antal avgångar är Örebro Airport. – Charterutbudet närmaste året är större än någonsin härifrån och dessutom är det extra roligt att Ving satsar på ett så exotiska resmål som Mexiko från Örebro Airport, säger Håkan Nilsson, marknadschef Örebro Airport. I och med detta kan Örebro Airport erbjuda elva destinationer utanför Norden till sina resenärer.

– Intresset för att resa västerut ökar hela tiden. Resorna till Aruba, Mexiko och Kuba är populära och med reguljärflyg ligger USA med Florida och New York i topp. Den billiga dollarn är självklart en bidragande orsak, säger Magdalena Öhrn, informationschef på Ving.

IT med Henrik Kugelberg Gummidörr någon? – När mobiler och surfplattor är lika vanliga surfverktyg som datorer. – Ding dong!, dörrklockan plingar. – Jag öppnar! Scenen känns igen. Det kommer besök. Inget konstigt, det är bara att öppna så kan gästen kliva på. Men om gästen: har åkt skridskor hem till er och inte kan ta av dem? Kommer med permobil utan att ni visste om det? Förväntar sig att kunna rida in genom dörren? – Shit! Var tredje kommer inte in Om plötsligt var tredje person kommer in på tvären, i en rullsäng eller åkande på en sån där skylift som man styr med en dosa medan man står i korgen – då är det dags att bygga om sin entré. Eller undanbe sig var tredje besökare. Eller försöka bestämma hur de ska ta sig fram. En gummidörr i en gummivägg eller en sluss med flera dörrar? Många fordon på nätet OK och vad har det med webben att göra? För det första börjar mobilsurfandet komma ikapp datorsurfandet i delar av landet och hos vissa grupper. 20 procent av allt surfande i Sverige skedde redan 2010 från mobila enheter – exklusiva surfplattor (Ny Teknik). Mobil datatrafik växte med 92 procent mellan 2010 och 2011 och de som surfar med mobilen har ökat uppkopplad tid med mellan 500-1000 procent beroende på åldersgrupp och utbildningsnivå.

Grön leverantör

Val Du har således tre val som tydligt speglar tre olika attityder:

Staples finns med butik på Aspholmen och säljer kontorsmaterial. Inom företaget har man länge arbetat med att få sina kunder att välja mer miljömässiga produktalternativ och anpassar också sitt sortiment efter kundernas milijökrav. Detta resulterade i att Staples fick tilldelades utmärkelsen “Årets grön leverantör” av Miljöstyrningsrådet för 2011. Det här var fjärde året som priset delades ut och den 25:e februari är det dags att nominera nya kandidater till priset. – Det är verkligen roligt att få ta emot det här priset. Det är en bekräftelse på att det arbete vi gör lönar sig. Vi är övertygade om att det ger oss fler affärer på sikt där miljö-, och socialt ansvarstagande är en

18 Marknad

avgörande faktor för framgång, säger Johanna JigmoLinde miljö- och kvalitetschef på Staples. I år är det femte gången Miljöstyrningsrådet delar ut priset Utmärkt Grön Upphandlare och Utmärkt Grön Leverantör.

– Det som inte dödar härdar Låt mobilsurfarna försöka klara av att zooma, swipea, peka etc på din breda fina datorwebb. Ta i alla fall reda på vilket lidande de måste gå igenom och bedöm hur stor risken är att de ger upp och surfar till en konkurrent (stor!). – Ok, men de får nöja sig med lite Du skapar en ny mall som – om du har en bra teknisk plattform – serverar innehållet i en smalare form och staplar allt ovanför vartannat. Bered dig på kvarstående lidande och tappade kunder. – Jag älskar er, välkomna! Bygg en webb som känner av vilket fordon och browser som kommer in och ger dem ett gränssnitt anpassat därefter. Se www.moelvenbyggmodul.se för ett exempel vi kodat (på uppdrag av NPP Reklambyrå som formgivit).


Välkommen till Jobbmässan pü Conventum Arena 8 mars 2012 kl. 11.00-16.00

RESTAURANG

Med rekrytering, yrkesutbildningar och utlandsjobb

FRI ENTRÉ fÜr dig som sÜker eller vill byta jobb.

Ă–ppet: MĂ?N TORS FRE LĂšR SĂšN

FÜretag, anmäl er senast 15/2 2012 till: Thomas StrÜmberg 019-21 19 20 thomas.stromberg@orebro.se Roger Larsson 010-486 60 80 roger.larsson@arbetsformedlingen.se

FĂśr mer information se: orebro.se/jobbmassan

 

$ROTTNINGGATANs4EL sWWWRST HELLASSE

 



 

     

n n n n





 



 

 





   



 













MILJĂ–KL. EU5. AUDI LEASING 36 MĂ…N, 30% SĂ„RSKILD LEASINGAVGIFT, 50% RESTVĂ„RDE, RĂ–RLIG RĂ„NTA BASERAD PĂ… STIBOR 90. LEASING EXKL. MOMS, FĂ–RMĂ…NSVĂ„RDE NETTO/MĂ…N VID 50% MARGINALSKATT. LEASING EXKL. MOMS. VI RESERVERAR OSS FĂ–R EV Ă„NDRINGAR/AVVIKELSER. BILEN PĂ… BILDEN Ă„R EXTRAUTRUSTAD.

Mün-fre 9-18, lÜr 11-15 Ozongatan 1 ¡ mollerbil.se

Ted Hällmark &'/#(&++),

HĂĽkan RĂśsiĂś &'/#(&++/*

Linda Snäll &'/#(&++(/


cmyk

Gastro

Barcelona – fotboll, sol och mat

Text Paul Dahlgren

Barcelona är Spaniens näst största stad med nära två miljoner invånare. Den Katalanska staden Barcelona är världens fjärde mest besökta turiststad. Idag förknippar vi den populära staden mest med fotboll, sol och mat. Värt att se, kulturellt, är den medeltida stadskärnan, gotiska kvarteret, Picassomuseet samt den spektakulära arkitekturen. Det katalanska köket har influenser från hela medelhavsområdet. Det är naturligt då området varit ockuperat av många stormakter. Särskilt förädlas och serveras idag en mångfald av det egna lokala fisk- och skaldjursutbudet. I Barcelona finns ett enormt stort utbud av restauranger vilket garanterar att alla kan hitta sitt eget ställe efter den egna smaken. Lunch äts vanligen kl 14.00 medan middagen äts sent på kvällen, mellan nio och elva. Spanien är känt för sina goda tapas vilka i stor mängd äts mellan måltiderna. Ett gastronomiskt besök i Barcelona startas lämpligen upp med ett besök på den berömda matmarknaden La Boqueria. Dagens gastronomiska Barcelona har utvecklats i skuggan av matgeniet Ferran Adrias och dennes katalanska restaurang El Bulli. El Bulli rankades under många år som världens bästa restaurang. Ferran Adrias själv och ett stort antal av hans lärjungar har öppnat nya egna restauranger i Barcelona.

Stjärnkrogar Den som vill unna sig att äta riktigt gott och lyxigt har kommit till rätt stad. Barcelona har inte mindre än 18 restauranger med Michelin-stjärnor i 2012 års guide!

Några mil norrut, i Girona, ligger trestjärniga El Celler De Can Rocca. Rankad som världens näst bästa restaurang efter danska NoMa. De tre bröderna Joan, Josep och Jordi Roca bjuder på en enastående matupplevelse, mycket baserat på traktens utsökta fisk och skaldjur. En av Ferran Adrias lärljungar Carles Abellan driver den innovativa restaurangen Comerc 24. Här bjuds lyxtapas, perfekt tillagade. Atmosfären i restaurangen är avslappnat elegant med en utmärkt service.

Väl inne i restaurangen och till bords får alla gäster snabbt en tallrik Serranoskinka och tomatbröd tillsammans med en flaska Cava. Först serveras vi gratinerade sniglar, musselsoppa kokt i vin och en bläckfiskrisotto. Denna kaskad av härliga havets läckerheter fullföljs med att en kraftigt vitlöksdoftande panna kommer in fylld med grillad hummer, havskräftor och räkor. Himmelskt! Efter en Creme Catalyana bjuder huset avslutningsvis på ett glas citronlikör till espresson.

Tapas

Matmarknad

Ovanför Plaza Catalunya finner vi en av Barcelonas mest kända och bästa tapasrestauranger Ciudad Condal. Du kan välja mellan att sitta i baren eller vid borden i matsalen. I baren finns en disk med alla kalla tapas medan de varma fixas till i köket och bärs fram av de smokingklädda kyparna. En bra start är den lufttorkade Serranoskinkan Bellota tillsammans med tomatbröd. Denna, världens dyraste och godaste skinka, är tillverkad av en speciell svinras med svarta klövar och föds upp på ekollon och gräs. På Ciudad Condal är det alltid god stämning och mycket folk. Cal Pep är en uppskattad tapasbar med fisk och skaldjur som specialitet. Varje dag erbjuds ett 70-tal olika tapas vilka råvaror ägaren Pep köper in beroende på säsong. Sköljs lämpligen ned med några glas Cava.

Längs Las Ramblas ligger matmarknaden La Boqueria som har varit igång sedan 1836. Byggnaden är bara ett stort tak varunder allt i matväg finns. Det är en njutning att bara gå runt och se på uppläggen och de vackra färgerna på de delikata matvarorna. I hjärtat av saluhallen finns de dignande fiskdiskarna. Runt dem finns diskar med kött, frukt, grönsaker, kryddor, kaffe, the, bröd och godis.

Fisk

Restaurangfavoriter i Barcelona STJÄRNKROGAR El Cellar De Can Roca www.elcellardecanroca@com Comerc 24 www.comerc24.com TAPAS Ciudad Condal Rambla Catalunya 18 Cal Pep www.calpep.com FISK Passadis del Pep www.passadis.com MATMARKNAD La Boqueria market www.boqueria.info FAVORITBAR Boadas 1 Carer des Tallers

Favoritbar Den bästa början och/eller slutet på en kväll i Barcelona är ett besök på baren Boadas. Den är belägen på en tvärgata vid början av Las Ramblas. Boadas är den mest klassiska cocktailbaren i Barcelona med kunniga, vänliga och välklädda bartenders. Alla drinkarna tillreds med perfektion. Väggarna i lokalen pryds av foton på de celebriteter vilka gästat baren – namn som Hemingway, Miro och Sophia Loren.

Fiskälskarnas restaurang är Passadis del Pep. Ingången är noterbart en vanlig port till ett hyreshus nära hamnen. Forts. 22

20 Marknad

»


Nummer 2 2012 21


Gastro

Comerc 24 – innovativa tapas Carles Abellan driver den populära tapaskrogen Comerc 24. Carles är en av matgeniets Ferran Adrias främsta lärljungar. Comerc 24s atmosfär och elegans i inredningen skapar en behaglig 70-tals känsla. Konceptet är att servera smakfulla och innovativa lyxtapas. Innan festivalmenyn tar sin början sker vår vinbeställning. Vi följer sommelierens rekommendation och får in en enastående flaska vitt vin, Tomada Do Sapo 2007 från Domaine Rias Baixas. En av Spaniens mest intressanta vinregioner.

22 Marknad

Under tiden för vinbeställningen har fyra sorters olika olivolja och tre sorters bröd placerats på vårt bord. Middagen börjar spektakulärt med att ur en rykande skål serveras ett läckert ostron. En rätt vilken direkt följs av små babybläckfiskar serverade på en isbädd samt en stark japansk soppa, Dashi, med bläckfisk. Det av spanjorerna mest eftertraktade skaldjuret percebes blir nästa rätt, goda men svårätna. Ett avbrott från fiskrätterna blir en klassisk kycklingsoppa med bröd, champinjoner och ett pocherat ägg.

Men de nästa rätterna är åter fisk i form av färska sardiner med apelsin och wasabi och ytterligare en smaklig bläckfiskrätt denna gång serverad varm med apelsin och örter. En färsk nykokt räka på saltbädd är en ren och behaglig smaksensation. Höjdpunkten för kvällen är Sashami på tonfisk. Tonfisken serveras i en god sås med kaviar. Tonfisken är ljuvlig och bara faller isär när vi söker dela den och smälter när vi för in den i munnen. Efter denna höjdpunkt följer två kötträtter, skogskanin med ris, äpplen

och senap samt en mycket smakfull sirloinstek med potatis och grönsaker. Antalet desserter är generöst många innehållande chokladparfait med flarn och chokladägg fyllda med varm choklad, saffran och äppleglass samt ananas och citronparfait. Comerc 24 och Carles Abellan ger oss en magisk afton med gastronomi av högsta nivå samt mönstergill service. Ett bestående minne är alla havsdofterna från de olika fiskrätterna. Färsk fisk doftar hav.


HÄR BLIR DRÖMMAR LEVANDE! KONFERERA I EN GENUIN OCH PRISBELÖNT MILJÖ.

OLYMPIC OLYM O LY MPIC M DAY D AY I Sveriges Bästa Idrottsstad IDROTTSMÄSSA ID ROTTSMÄSSA Lördag & söndag 18 –19 februari Kl. 11–16 6 på Conventum Arena

Håll era konferenser och kurser hos oss! Vi är flexibla och ger personlig service och är här för att uppfatta era behov och göra vårt bästa för att vistelsen hos oss ska bli

ditt bröllop eller fest till något utöver det vanliga. Här i Bredsjö finns möjligheten att disponera två vackra Herrgårdar, den ena från 1760 och den andra från början av 1900-talet. Vi är lyhörda för våra gästers behov och lovar att göra era drömmar levande.

VÄLKOMMEN TILL MÖTEN MED SMAK.

HÄLLEFORS

• TEL: 0587-802 00 • WWW.BREDSJOHERRGARDAR.SE

En mässa med

Prova

30

olikaer idrott

A M ER ? V IL L D UicdVayET .se

www.olymp brro reb ore /o e/ .se a.s r na sutbilldarn otttsu www.sisuidrrot

NG G N IIN N V IIG IN 0 .00 3.0 ruari kl 13

b 1 feb g 18 ag da Lörrd er mpie Olym Medverkan av arr ga ng tällnin stä t Ut /U r/ ga in isn Uppv

vin, ost, choklad, delikatess & avec

Örebro Slott 23-24 mars 2012 Fredag 23 mars kl. 13 - 20 | Lördag 24 mars kl. 11 - 19

Entré fredag: 200:- | Entré lördag: 250:- | Båda dagarna inkl. glas & garderob Dryckeshäfte: 100:- | Biljetter: Örebrokompaniet 019-212121 / www.ticnet.se Åldersgräns: 20 | www.conventum.se/cgc

Foto: Scanpix

en minnesvärd upplevelse. Här kan du uppleva äventyr och vildmark eller låta oss göra


cmyk

Camilla ger gymmet ett mänskligt ansikte Text Dixie Ericson Foto richardstrom.com

En liten fontän porlar i en blomkruka i fiket strax innanför entrén till Aspholmens Wellnessclub. I gymmet ljuder dämpad popmusik. Det mäktiga maskinlandskapet mjukas upp av strategiskt utplacerade små gröna oaser av växter.

Alla medlemmar ska hitta både in i kramen och en effektiv och rolig träning. – Vi vill ha hit dom. Det är stort steg att bara komma hit.

En mångfacetterad mötesplats Camilla Sinclair jagar genast de flesta fördomar om kroppsbyggare och gym på flykten. Delägare, vd, personlig tränare, medlemsrådgivare och massör är titlar som platsar på hennes visitkort. Hon har en vänlig framtoning och rör sig mjukt och med den kroppskontroll man finner hos elitgymnaster. Balans går igen som ett ledord i intervjun. – Många har gymskräck. Det hade jag inte riktigt förstått med tanke på min bakgrund. Den skräcken finns verkligen och vi har botat många här. Somliga tror att gymmen är för ”spännputtar” och Jane Fonda-typer med snygga kroppar. Och att man rent av måste vara i form för att börja träna.

Hela människan i centrum – Det är verkligen inte meningen. Du ska ju komma hit för att må bättre, gå ner några kilo och komma i form. Målen är olika. Därför måste det till medlemsrådgivning så att vi får veta vad du vill och vad vi kan hjälpa till med. Alla medlemmar möter en medlemstränare. Var och en ska bli sedd och saknad när man inte kommer. Individen står i centrum. Om man inte vet vad man vill når man inga resultat. Dessutom måste medlemstränaren kartlägga nya medlemmars ålder och hälsotillstånd. Högt blodtryck, hjärtbesvär och åldersfaktorn påverkar hur träningen ska läggas upp. Skaderisken finns hela tiden. Det är viktigt med välutbildad personal. – Vi har skapat ett träningskoncept där nyckelorden är systematiskt, regelbundet, varaktigt och varierat och med glädje. Vi går på medlemskap och vill också få till en gemytlig atmosfär. Man ska stiga in i en varm kram. – För många är gymmet den enda sociala träffpunkten förutom jobbet. Så kan det vara när man springer på i livet. 24 Marknad

Aspholmens Wellnessclub vittnar om tjänstesamhällets framväxt och individualiseringens möjligheter. Här möter medlemmarna många kompetenser och tjänster. Personalen består av cirka sju fast anställda av totalt cirka tjugo. Däri ingår konsulter, en lokalvärdinna, personliga tränare, gruppträningsinstruktörer, receptionister och en spaterapeut. – Jag och Sofia Tungfelt ville skapa ett ställe som inte fanns. För att hjälpa människor att må bättre. Och då ville vi ha mycket på samma ställe. Barnpassning kan också ordnas med hjälp av ett Nanny Bell-företag. – Ensamstående mammor vill kunna träna. Jag skulle aldrig komma på att dra iväg vissa kvällar utan en bra lösning av barnvaktsfrågan. Här kan de äldre banens vistas i ett särskilt rum och till exempel leka med mammas dator och yngre barn kan få barnpassning. Det är bra att veta att det finns när man köper ett medlemskort. Det breda utbudet av träningsprogram och former efter olika koncept, ibland utvecklade av andra specialiserade företag, vittnar åter om fokuset på individuella preferenser. Allt från gruppträning med Spinning och den nya FortGjort-träningen till individuell styrketräning under ledning av medlemstränare; personliga tränare finns på menyn.

Högre kvalitet och antistress Fun, shape, power, sport, move och balance är olika träningstyper vars namn i viss mån är självförklarande. Camilla gillar att ”shapa” kroppar men Sofia är mer för fun: gillar allt som har med gruppträning att göra. Kost- och hälsorådgivning och olika typer av tester ingår i utbudet. Och efter träningen kan man besöka relax och spa.

Jag ber Camilla beskriva en typisk medlem Det visar sig inte vara så lätt. Åldersspridningen är stor. – Kanske är det en 45+ som har lite tid för sig själv. Som vill må bra, gå ner några kilo och som vill ha lite högre kvalitet och inte trängas med två tusen andra på en maskin. Få helheten och lite lugnare miljö. Det är viktigt att hålla sig i f orm från 45 och uppåt. Jag känner mig lite träffad. Det kostar heller ingen förmögenhet. För den genomsnittliga medlemmen som tränar två gånger i veckan är kostnaden 55 kronor per pass och då ingår en massa saker förutom träningen.

Disciplinerad kroppsbyggare Camilla Sinclair har i många år gett råd om kost och träning i kraft av sin karriär som kroppsbyggare. Många har helt enkelt frågat henne. Hon tänkte inte på det som ett möjligt yrke då eftersom hon var så koncentrerad på sin egen utveckling. Två impulser lockade henne till bodybuildingen. En lite stickig kommentar av en kroppsbyggande klasskompis i nian: Du ska inte hålla på med bodybuilding. Du kommer inte att klara av det för du gillar ju mammas bullar och då kan man inte gå på diet. Ett utmanade citat som hon sparat. Den andra var en bild på ett tidningsomslag av en snygg vältränad tjej som hennes blick föll på när hon var inne och handlade i en affär. – Det var då jag bestämde mig och tog det slutgiltiga steget. Jag började träna nitton år gammal. Camilla ställde upp på sin första tävling, ett Stockholms-DM, 1989. Då hade hon tränat i tre år och triggades av ett bra omdöme om sin konstitution där hon hade en del gratis: smal midja, lätt att bygga muskler – men svårare med dieten. Två år senare kvalade hon in till EM. – 1997 gjorde jag min sista bodybuilding-tävling. Då kom jag nia i VM och vann SM. Jag hade tagit min karriär så långt jag hade lust. Kände mig mätt.

Hon hade ett steg kvar internationellt. För att ta det måste hon bli proffs och hon ville inte se ut som proffsen. Det var inte hennes ideal. I åtta år hade hon gått på dieter, i åtta år hade hon levt och andats kroppsbyggande tjugofyra timmar om dygnet. – När man tävlade i Europa fick man skriva autografer. Där var man idrottsstjärna på samma sätt som i andra idrotter. Stort, lärorikt och fantastiskt roligt, sammanfattar hon sin karriär.

Mångsysslare hittar hem Parallellt med kroppsbyggandet måste Camilla också arbeta för att försörja sig. Hon började inom krog- och hotellbranschen. Hon fick jobb i Grand Hotels reception och var med vid öppnandet i mitten av 80-talet. En av nio som anställdes av 300 sökande. Efter några år bar det av till ett nytt hotelljobb i Stockholm. I bagaget hade hon en inbjudan till ett huvudstadsgym där tidens stjärnor tränade. Den kontakten hade hon skapat 1986 vid ett studiebesök på en bodybuildingtävling i Örebro. Hon lämnade hotelljobbet för jobb på ett bemanningsföretag. Ett extrajobb på Statoil blev heltid. – Sedan sökte jag mig tills väktarbranschen där jag arbetade till jag blev överfallen på väg till jobbet. 53 vältränade kilo Camilla, nyss hemkommen från EM lyckades värja sig – och lunchlådan. Den fick jag för mig att han inte skulle få ta. Jag blev slutligen slagen med en luftpistolskolv. Rån- eller våldtäktsförsök? Ingen vet, inte ens hon. Gärningsmannen dömdes för rånförsök. Hon har inga men fysiskt, men psykiskt har hon fortfarande känningar. Camilla återvände till arbetslöshetens Örebro 1992 och utbildade sig till fastighetsmäklare. En bransch som tyngdes av den ekonomiska krisen. Hon började på Larmcentralen där hon suttit i femton år.

Forts. 26

»


cmyk

Nummer 2 2012 25


» Personlig tränare med lokalproblem

2003 läste hon till personlig tränare – men hade ingenstans att ta sina kunder. Köket fick duga ibland. En trevande början på den positiva nätverksprocess som ledde till att Camilla och Sofia lärde känna varandra och 2009 flyttade in i ett tidigare tryckeris lokaler på Aspholmen och skapade sin wellnessclub. Först var det meningen att hon skulle arbeta som personlig tränare hos Sofia som redan hade gymmet. Men chansen att bli delägarna öppnade sig plötsligt av en slump sedan Sofias kompanjon hoppat av. – Jag råkade ha lite pengar just då – och låg sömnlös. Men det kändes rätt i magen. Det var min dröm att skapa det personliga stället där man får individuell hjälp. Och där man inte är rädd att gå in. Vi hade samma mål. Hon och Sofia fick hjälp och stöttning på flera hål av nätverkande: Av Almi, Q-net och Örebro Promotion.

Nyttiga erfarenheter. – Många tror att man ska vara asketisk för att lägga på sig muskler. En del tjejer är rädda för det. Normalt sett brukar tjejer vilja bränna fett. Men det går inte att shapa en kropp utan muskler. För att få bort gäddhäng måste man träna armarna. Själv har hon tränat fyra gånger i veckan i stort sett i hela sitt liv. I kombination med dieter och långa promenader och mycket kardiovaskulär träning. Att tävla i kroppsbyggnad är att må extremt bra, berättar hon och punkterar mina fördomar. 26 Marknad

– Man tränar för att få en välbalanserad fysik och man äter rätt. Vanlig mat som ris, pasta, potatis, kyckling, tonfisk, torsk... Huden, håret och naglarna blir starkare och man mår bra, blir piggare och trivs med sig själv och andra. Det går inte att jämföra med något annat. Allt hon gjort i livet kommer till nytta här på gymmet. Även erfarenheterna från enstaka mörka perioder. Som då hon som tonåring kämpade sig igenom en bulimi. Eller som då hon ramlat ner i arbetsträsket, som hon uttrycker det, och misskötte sig, gick upp i vikt, blev trött och fick ont i hela kroppen. – Det är en av mina styrkor att jag har också den bakgrunden och vet vad det innebär. Hur jag hypertränade och hade bantningstänket och ångest.

tism är inte sund. Man kommer säkert inte att ha en övervikt på tjugo kilo om man tränar regelbundet och äter lite osunt ibland. Tre nyckelord fångar in hennes förhållningssätt till den stora bank av egna erfarenheter hon öser ur: balans, distans och realism. En bank med tillräckligt med stoff för en bok. I artikelformat går det inte att göra den rättvisa. Det gäller att hitta den egna balansen i allt. Ha distans till sig själv. Och en realistisk syn på kravbilden. – Livsstilsförändringen måste passa in i vardagen. Det får inte bli för krångligt. Vad det än gäller. Och man måste börja med små steg. En som aldrig tränat kan ju inte börja fyra gånger i veckan.

Inspiratör och förebild Balans, distans och realism Camilla Sinclair vill att vi ska sluta tänka i termer av bantning. Överhuvudtaget äter vi för lite mat. Hela hennes erfarenhet pekar på att endast en livsstilsförändring kan få oss att må bättre och gå ner några kilo i vikt. Hon har sett många underliga och skadliga ätbeteenden. Som att späka sig och äta lite i början av veckan för att sedan göra veckosluten till en brakfest. Ett attentat mot kroppens energibalans. Eller som det svartvita allteller-inget-tänket. Antingen ett totalsunt eller totalt osunt leverne. Man kan unna sig både ett glas vin, en bärs på krogen och lite onyttiga saker. – Jag brukar säga till ”extremisterna” att ni kan väl bli lite mer ”grå”. Aske-

Camilla Sinclair vill vara en förebild och stöd i liv och träning för alla som vill komma igång att träna. Och en inspiratör för dem som klagar över att man har barn och över att det inte finns någon tid efter jobbet. – Om jag som jobbar och har barn varannan vecka klarar det, klarar alla att ändra sin livsstil. Det finns tusen ursäkter. Gör på ditt vis. Jag frågor lite försiktigt vad som är den allra bästa vardagsmotionen. Gymmet och hennes genomtänkta ord inger respekt. Frågan känns plötsligt för trivial. – Den som blir av, svarar hon med ett pärlande skratt.

Kortfakta om Camilla Sinclair Karriär: Ägare av Aspholmens Wellnessclub tillsammans med Sofia Tungfelt, tillika vd, personlig tränare, medlemsrådgivare och massör. Arbetat inom bland annat hotell- och väktarbranschen och Larmcentralen. Svensk mästare i bodybuilding, deltagit i ett EM och två VM. Mat och dryck: Ris, pasta, potatis, räkor, vitt kött, sallad och grönsaker; kinamat, thai och sushi för lite fest; vatten, kaffe i mängder, rödvin och champagne i måttliga mängder. Musik: hårdrock och techno; musikalisk allätare men trött på schlager. Litteratur: Managementböcker till exempel Kenneth Blanchard: Från nöjda kunder till glödande fans. Livsviktigt: Dottern Amalia, trygghet, nära vänner, trivas med jobbet och att få utvecklas så långt det går. Motto: Live your dream.


Friska tänder 2012? Varmt välkommen till

Producenterna bakom publiksuccÊrna �Pengarna eller livet� och �Liket som visste fÜr mycket� presenterar stolt

STORTORGSPRAKTIKEN! Generationsskifte och personalfÜrstärkning! Vi blir er och vürt nya tandläkarteam har nu mÜjlighet att ta emot ytterligare patienter. Tidsbokning tandläkare: 019-13 82 20 Mürten Fransson • 019-12 02 36 Jonas LundstrÜm 019-18 25 60 Kerstin Abrahamsson

obert DrĂśse En FARS av R

RATT FE ST ! EN HĂ… RR ES AN DE SK CARINA

JANNE �LOFFE�

JOAKIM (FRĂ…N FILMEN ARN)

LIDBOM

CARLSSON

NĂ„TTERQVIST

SANNA

DANIEL

EKMAN

TRĂ„FF

MATTIAS

PALE

OLOFSSON OLOFSSON

LĂ–RDAG 3 MARS KL. 19.30 CONVENTUM, Ă–REBRO Biljetter: Ă–rebrokompaniet 019-21 21 21, Ticnet.se, 077 170 70 70, ATG- och Ticnetombud.

BesĂśk www.drosenorberg.se eller www.facebook.com/drosenorberg

4QFDJFMMUWĂŠMLPNNFOUJMM4WFSJHF TĂŠHFSWJUJMM WĂŒSBUWĂŒOZB4QFDJBM&EJUJPONPEFMMFS%VTPN SFEBOĂŠSCFLBOUNFE$37WFUBUUEFOĂŠSVUSVTUBE GĂšSWJMLFUĂŠWFOUZSTPNIFMTUNFMMBOEBHJTPDI KPCCFU PDITLJECBDLFO/VLBOEVOKVUBFYUSBNZDLFUBW WBEBMMUWĂŒSUBWMĂŒOHBMBOEIBSBUUCKVEB

COMFORT SPECIAL EDITION t"MDBOUBSBUZHLMĂŠETFM t,MJNBUBOMĂŠHHOJOH t'BSUIĂŒMMBSF t-ĂŠEFSSBUU t*OTZOTTLZEE t1BSLFSJOHTTFOTPSFSGSBNPDICBL t%JNMKVTGSBN

Pris frĂĽn

249.900 kr

ELEGANCE SPECIAL EDITION utĂśver COMFORT SPECIAL EDITION t"MDBOUBSB-ĂŠEFSLMĂŠETFM twBMVNJOJVNGĂŠMHBS t3FHOTLZEE t4LZNOJOHTTFOTPSFS t,SPNBUTMVUSĂšS

Pris frĂĽn

269.900 kr

5BLWJOHF *OTUFHTMJTUFS %JNMKVTEFLPS )BTQMĂŒUTJEB )BTQMĂŒUGSBNPDICBL

Pris frĂĽn

7.900 kr* Ord pris 21 600 kr

(VNNJNBUUPS #BHBHFSVNTNBUUB 7JOUFSIKVM

Pris frĂĽn

8.500 kr* Värde 18 300 kr

Motor: 2,0 i-VTEC, 150 hk / 2,2 i-DTEC, 150 hk. BränslefÜrbrukning: 6,5–8,4 l/100 km. Koldioxidvärde: 171 –195 g/km. Nybilsgaranti: 3 ür/10 000 mil. MiljÜklass: Euro 5 / Euro 5. * Erbjudandena gäller t.o.m. 31/3 2012. Gür ej att kombinera med andra avtal, kampanjer eller rabatter.

www.bilforum.se 019 - 601 20 50 Kyrkvägen 63, 703 75 Örebro. Mün-fre 9-18, lÜr 11-14.


cmyk

Flack-revyerna – en kulturgärning av ansenligt mått

Text M.Sandberg Foto richardstrom.com

Hjalmar Burlesque Revy på Nya Parkteatern i Brunnsparken, Örebro, ger sin sista föreställning lördag 25 februari. – Det har varit en tuff säsong med finanskris och mängder med andra evenemang på Örebros många scener. När vi slutligen drar för ridån för Hjalmars Burlesque den sista lördagen nu i februari kan vi konstatera att ekonomin ändå gått ihop för denna revy, konstaterar Peter Flack. Nya Parkteaterns produktionsteam består av Peter Flack, Marie Kühler, Monica Forsberg, Christer Linder och Jan Beime. Denna kvintett beslutar om det mesta som rör verksamheten.

Mycket stora investeringskostnader – Den så kallade produktionskostnaden ligger på åtskilliga miljoner kronor. Det innebär att alla dessa miljoner investerades före Burlesquens första föreställning i höstas. Denna investering skall sedan hämtas tillbaka i takt med att föreställningarna genomförs, förklarar Christer Linder, producent vid Nya Parkteatern i Örebro AB, och fortsätter. – Kruxet är att de intäkter Nya Parkteatern får in i form av förköp inte kan ses som ”riktiga” intäkter förrän respektive föreställning har genomförts. Detta beror på att om Peter Flack skulle bli till exempel långvarigt sjuk kan föreställningarna inte genomföras och de förköpta biljetternas intäkter måste betalas tillbaka. – Inför hösten planerar vi nu för ”Hjalmars Jul-Burlesque”. Den kommer delvis att rymma det bästa ur den senaste revyn och av det som kan anses vara aktuellt. Vi kommer att laborera med ensemblen men endast om det är aktörer som varit med i den senaste revyn och som inför nästa säsong inte har andra planer, berättar Peter Flack och fortsätter. – Därmed kommer vi att minska investeringen drastiskt genom att behålla stora delar av befintligt ljud, ljus, dekor och kläder. Hjalmars Jul-Burlesque kommer naturligtvis också att rymma en hel del julmusik och julsånger. Andra exempel på Nya Parkteaterns

28 Marknad

sätt att dra publik till sig är det så kallade ”Kafferepet”, där Peter Flack förra året hade gäster som Sten Nilsson, Eddie Oliva och Lasse Berghagen. Besöken visade sig bli mycket välbesökta. – Kafferepet fortsätter därför nu i februari där Peter får besök av Triple & Touch, i mars av Östen med Resten och i april av Ann-Louise Hansson/Josefine Glenmark, berättar Monica Forsberg.

En historisk kulturgärning – Ser man tillbaka är det fantastiskt att vi kunnat göra så stora produktioner i Örebro som Hjalmarrevyerna ändå är, menar Peter. Peter Flack satte 1976 upp sin första revy i Örebro – Rädda Hjalmar. På nyåret samma år presenterade han för första gången – i en blygsam sketch – sin revyfigur Hjalmar Berglund från Viby By på Närkesslätten. Figuren Hjalmar slog direkt hos publiken och den skulle visa sig bli riktigt långlivad. Ryktet om Hjalmar spred sig. Peter satte upp två revyer på Intiman i Stockholm tillsammans med Birgitta Götestam som Sex damer i leken, 1980, och, Änglar på stan 1982. De gjorde även flera barnprogram i TV bland annat Svenska Sesam med bland andra Magnus Härenstam och Lill Lindfors. Hjalmar var även centralfigur i flera TV-serier, bland annat Hjalmars EGenheter och Hjalmar i parken. I Örebro fortsatte revyerna med allt större framgång. Från att ha varit lokalrevy blev de en riksangelägenhet när TV började sända Hjalmarrevyerna i slutet av 1980-talet. Besökare från hela landet styrde kosan mot Örebro för att uppleva Peter Flack och hans revygäng.

Flackrevyerna – en av de största turistmagneterna Hotelldirektörerna i Örebro klappade händerna av glädje då busslasterna med passagerare och revybesökare behövde någon stans att övernatta på grund av de långa resorna. I slutet av 1990-talet bedömdes Flackrevyerna svara för cirka 6 procent av Örebro-

hotellens samlade besöksvolymer, vilket är en fantastiskt hög siffra! Det är därför ingen tvekan om att Peter Flack tillsammans med Gustavsviksanläggningen är Örebros största turistmagneter. Trots en mängd andra erbjudanden under alla år har Peter Flack valt att stanna kvar i Örebro med sina revyer, viket han motiverar så här. – Först och främst logistikmässigt. Örebro ligger ju väldigt bra till. Stan befinner sig precis mellan två storstäder, Göteborg och Stockholm. Skulle man dra en cirkel med en radie på ca 30 mil och med Örebro som centrum så fångar man upp väldigt många människor. Vi har således ett stort upptagningsområde. Men att vi sätter upp revyerna just här är samtidigt en viktig del av konceptet. Tidigare har vi fått förfrågningar om att gästspela i andra städer. Ibland har det varit nära för oss att acceptera det, men vi har till slut alltid sagt nej. Jag tror att vi har tjänat på det.

Busslast på busslast – Bussidén växte sig allt starkare. Bussarrangörerna erbjöds förtur på biljetter och hyfsad rabatt på några utvalda hotell i stan, inklusive supé, som de sedan kunde sälja som paket till sina resenärer, berättar Håkan Lindström som genom sitt företag L&S Marknadsföring AB under många år var ansvarig för marknadsföringen av Flackrevyerna. Att busslaster med publik färdades till teatrarna i Stockholm var inget nytt. Att genomföra det omvända förhållandet var något helt annat. När revyerna flyttade från Hjalmar Bergman Teatern till Parkteatern i Brunnsparken kunde den potential som Flackrevyerna uppenbarligen hade utvecklas till fullo. Bättre förutsättningar för scenografin – man slapp det jättestora golvet – och för de bussburna. – Det var perfekt för våra bussgäster. De kunde åka ända fram till teaterdörren och sedan gå rakt ut till bussen efter föreställningen för vidare transport till supébordet och hotellsängen, säger Håkan Lindström.

Betydelsefulla skatteintäkter till Örebro Efter dryga 35 år är Hjalmar svensk revys mest slitstarke seriefigur. Revyerna har spelats på flera platser i Örebro. Det började på Örebro Teater, fortsatte på Hjalmar Bergman Teatern, Parkteatern i Brunnsparken, det ombyggda Badhuset och Nöjeskrogen mitt i Örebro City. Med premiären ”På julkryss med Hjalmar” i november 2008, var man tillbaka till Parkteatern i Brunnsparken. Det var då 11 år sedan man senast var där. 85procent av revyns besökare är icke-örebroare, det vill säga turister. Flackrevyerna svarar därmed för ett betydelsefullt tillskott av arbetstillfällen i Örebro; direkt genom att till exempel den nuvarande ”Hjalmar Burlesque Revy” sysselsätter drygt 100 personer vid varje föreställning; indirekt genom de personer som sätts i arbete som vid taxi, hotell, gallerior och butiker med flera som tack vare revyerna ökar aktiviteterna i Örebro. Dessa genererar omsättningsökningar och därmed skatteintäkter i form av både större företagsvinster och ökade beskattade löner.

Kommunalt intresse Ur kommunens synvinkel kan man konstatera att Flackrevyerna är det enskilt största kulturevenemanget årligen i Örebro. Den nuvarande revysäsongen har dragit drygt 32 000 besökare, med andra ord nästan 11 proppfyllda Conventum Arena. Peter Flack tilldelades visserligen Örebro kommuns Näringslivspris 2003, men man kan fråga sig om Örebro kommun anser att dessa revyer är värda något för stans ekonomi – uttryckt i monetära termer? Kommunen placerar årligen stora belopp på bra event men som är väldigt lokala utan att det sannolikt lockar andra än Örebroare till dessa arrangemang, vilket naturligtvis är väl så gott. Med detta i åtanke kan man fråga sig om Flackrevyerna – som lockar konsumerande turister till sta’n, inte borde uppskattas i högre grad?


Kortfakta Ett axplock bland de mest kända artisterna genom åren i Flackrevyerna – här i bokstavsordning på efternamn. Lissi Alandh, Lars Amble, Hasse Andersson, Brasse Brännström, Berit Carlberg, Sharon Dyall, Annalisa Eriksson, Sussi Eriksson, Monica Forsberg, Inga Gill, Birgitta Götestam, Cilla Ingvar, Marie Kühler, Anders Linder, Pierre Lindstedt, Meta Roos, Anna Sundqvist, Hans Wahlgren, Sven Erik Vikström och Gunilla Åkesson.

Nummer 2 2012 29


CYAN MAGENTA GUL SVART

Reklam & Media

Think Happy Thoughts gjorde remake på Jakobssons Möbler

Mattias Bodin och Erik Stenbeck, NPP

Det går bra nu, NPP Text Jonas Källgren

2012 har börjat bra för reklambyrån NPP. På kort tid har företaget knutit till sig fem nya kunder, till exempel Pizza Hut och Izuzu, och planerar nu att nyanställa. Än så länge har 2012 varit ett fantastiskt år för NPP. Fem kunder har tillkommit – Pizza Hut, Atlas Copco, Bygg Hemma, Länsförsäkringar i Uppland och Izuzu (Asiens största tillverkare av transportfordon) har numera alla NPP som byrå. Dessutom köpte företaget i slutet av 2011 upp Uppsalabyrån WJOS och har numera cirka 50 anställda på Örebro-, Stockholms-, Västerås- och Uppsalakontoren. Vi ringde upp projektledaren och delägaren Mattias Bodin för att få veta vad som är på gång, och hur man hanterar en snabb expansion som den NPP i skrivande stund genomgår. Det går bra nu? – Det går bra nu. Vi har haft en bra start på året, en flygande start egentligen. Fem nya, ganska stora, kunder på 28 dagar. Det piggar upp! Det är alltid bra att starta året bra, 2011 var ett dystert år för många i branschen, så det är skönt med en bra start på 2012. Fem stora nya kunder i ett svep – vad är det som gör att ni kniper de här kontona? – Om man backar bandet så var det jaktsäsong nu kring årsskiftet, det är många som ser över sina samarbeten samtidigt som de ser över sina budgetar. Varför vi vinner kan bara våra kunder svara på, men när det gäller Atlas Copco så tävlade vi lokalt, mot Liljedals och Strateg. Och där sa Atlas Copco ungefär såhär: ”Alla är skitduktiga men ni är bäst, ni utmanar oss och tänker annorlunda”. Det är det vi hoppas och tror, att vi gör saker lite annorlunda än andra. Vi lägger mycket tid på att fundera och analysera istället för på hantverket – för hantverket kan vi efter 40 år i branschen. 30 Marknad

Berätta – vad är hemligheten bakom en bra pitch? – I alla arbeten generellt så är vår övertygelse att det gäller att ha insikt. Att veta vem man talar med, varför, och vad deras problem är. Sen måste man ha bra lösningar – ibland lite revolutionära – och förpacka dem rätt, jobba med den senaste tekniken, vara uppdaterad. Att ha insikt, att göra avtryck, och att göra en bra presentation. För att bli bättre på det så måste man träna, och vi har som avsikt att bli bäst, och då tränar vi mycket.

Under hösten har Think Happy Thoughts arbetat med ett nytt yttre åt Jakobssons Möbler utanför Örebro. Numera går det en röd tråd från tv- och tidningsannonser via lastbilar till butikskommunikation. Dessutom har byrån skapat en ny webbsajt åt Jakobssons, för att inte tala om en kundklubb som kommer att användas för att bjuda in till event, ge tips från butikens inredare, eller berätta om månadens medlemsvara. – När man får i uppdrag att arbeta med ett gammalt och väl inarbetat lokalt varumärke som Jakobssons möbler så gäller det att både ha stor respekt för de kärnvärden som tagit årtionden att bygga upp, men samtidigt våga vara öppen för nya synsätt och kommunikationsvägar. Inget får vara för heligt att ifrågasätta, men alla förändringar måste vara välgrundade och ha mycket tydliga syften och mål, säger Think Happy Thoughts vd Daniel Forneheim.

Kommer ni att anställa under 2012? – Absolut, vi har ett skriande behov inom webb just nu, både designers och programmerare. Det tror jag är en konsekvens av att hela branschen håller på att styra om. Vi nästan 50 personer nu, på kort sikt behöver vi anställa fem personer och på längre sikt två till. Vårt mål är att vara uppåt 60 personer i slutet av 2012. Växtvärk? – Framförallt 2011. Vi ökade inte omsättningen nämnvärt, vi planade ut på 45 miljoner, vilket i sin tur beror på att vi gjort många organisatoriska förändringar och jobbat med inre processer. Det har varit jättejobbigt och kostat en massa tid och pengar, men nu kan vi satsa 100 procent på att utveckla oss själva och kunderna. Att rekrytera och få rätt man på rätt plats blir en utmaning när man blir större, det kan bli mycket fokus på utbildning och rekrytering och det tar kraft från affären. – Vi siktar på större uppdrag, större utmaningar, större inkomster och mer framgång. Vi kan välja mellan att stå här på torget och slå oss för bröstet, eller så kan vi vara med och tävla med de bästa byråerna i Sverige. Och de finns företrädesvis i Stockholm. Vi brukar likna det med Idol – vi ska ha en av biljetterna till slutauditionen i Stockholm.

Lär dig branda i sociala medier Strategiarbetet blir allt viktigare inom digital marknadsföring. Det här har Marknadsföreningen i Örebro distrikt tagit fasta på och erbjuder 17 februari därför en workshop i just detta ämne. Då kommer Michael Nilsson från varumärkeskonsultföretaget Manifesto till Stora Hotellet för att ”visa vägen till ett socialt medielandskap som du själv äger och förfogar över”, vilket låter hur bra som helst. Målet är att skapa en personlig checklista för att sen kunna utveckla varumärket optimalt på den sociala webben. Workshopen följs upp med ett ett föredrag från samma Michael Nilsson, på temat social trendspaning. Här presenteras en rad digitala medietrender och vilka konsekvenser dessa kommer att få för marknadsförare. Mer information finns på www.miod.org.


CYAN MAGENTA GUL SVART

Förebygg karriärmässiga graviditetsfällor – rekrytera en ersättare som du har fullt förtroende för Text Annika Wihlborg

Det började när Jessica Löfström hade nått de sista månaderna av sin första graviditet. Hon märkte att hennes förmåga att tänka strategiskt, att fatta genomtänkta beslut som gynnade företagets utveckling och att leda och delegera arbetet stegvis försämrades. – Jag som alltid har betraktat mig själv som en driven, entreprenöriell och karriärinriktad kvinna kände knappt igen mig själv. Tidigare trodde jag att jag själv kunde avgöra i vilken utsträckning min graviditet och mitt nyfödda barn skulle påverka min karriär, men jag hade fel, hormonernas inverkan och kroppens omställning tog mig verkligen på sängen, säger Jessica Löfström.

Tappade motivation och drivkraft under första graviditeten Gradvis gick det upp för henne att kroppens hormonella förändringar inte

bara gjorde henne redo att ta emot ett barn, de bidrog också till att hjärnan började inrikta sig på att vara vårdande och omhändertagande snarare än rationell och beslutsfattande. Det är en del av kroppens sätt att förbereda sig inför barnets ankomst. – När min första son föddes var jag inte alls förberedd på vad som skulle ske, vilket ledde till att både jag och ExpanderaMera tappade riktning, drivkraft och motivation under en period. Vi tappade i omsättning eftersom jag inte insåg att jag behövde en ersättare förrän det var försent, säger Jessica Löfström. Innan hon förstod varför hon helt tappat den motivation och drivkraft som tidigare varit så stark funderade Jessica Löfström på att anställa en ny vd och trappa ner sitt engagemang i företaget. Men så en dag vände det, när hon slutade amma återfick Jessica sitt driv och sin målmedvetenhet.

Rekryterade en ersättare inför andra barnets ankomst När hon väntade sitt andra barn var Jessica Löfström noga med att förbereda sig själv och sin omgivning för att undvika att begå samma misstag igen. Denna gång tog hon graviditeten och föräldraledigheten med ro, inte minst eftersom hon visste varför den prestationsförmåga som värderas så högt på jobbet avtar rätt rejält när kroppen rustar sig för ett barns ankomst. – När jag väntade min andra son tog jag in en extern vd som fungerade som

min ersättare i samband med min föräldraledighet. Jag kunde fokusera på mindre strategiska och övergripande arbetsuppgifter, vilket passade mig perfekt under föräldraledigheten. Jag slapp dessutom ha dåligt samvete för att inte kunna hantera ”Business as usual” under dessa månader, vilket var jätteskönt, säger Jessica Löfström. – Jag har hittills aldrig mött någon kvinna som vittnar om samma problematik som jag hade. Det kan bero på att man väljer att tala tyst om det här fenomenet, eller att man känner dåligt samvete för att man borde ha kunnat prestera bättre och behållit skärpan på jobbet. Jag känner att det är hög tid att lyfta frågan, inte minst för att kunna hjälpa blivande föräldrar, säger Jessica Löfström. Jessica Löfström tipsar - så undviker du graviditetsfällan i karriären: – Förvarna din chef och dina kollegor i god tid. Eftersom din förmåga att fatta strategiska beslut och att leda medarbetare kan påverkas redan från din tredje graviditetsmånad så är det klokt att med god framförhållning informera chefen om hur din graviditet och din första tid som förälder kommer att påverka din prestationsförmåga på jobbet. – Inse att ”amningsdimman” inte varar för evigt. Ha tålamod med dig själv, barnens småbarnsår går oerhört fort, så unna dig att jobba precis så mycket eller lite som känns lagom för att du ska må bra och känna dig i balans.

Under graviditeten och de första månaderna med barnet får du en möjlighet att släppa din presterande roll på jobbet och upptäcka en annan sida av livet, vilket kan vara en stor tillgång även i karriären på sikt. – Hitta en ersättare som du känner fullt förtroende för. Agera förebyggande genom att hitta en ersättare som kan hantera de mer krävande och strategiska delarna av ditt jobb under de sista månaderna av graviditeten och de första månaderna i ditt nyfödda barns liv. Lägg lite extra krut på att hitta en person med de rätta egenskaperna och den rätta erfarenheten, en person du kan känna dig helt trygg med.

Foto Janne Danielsson

Entreprenören Jessica Löfström, som är vd för byggbemanningsföretaget ExpanderaMera, har i drygt tio års tid byggt upp ExpanderaMera till ett av Sveriges största bemanningsföretag inom bygg- och anläggningsbranschen. När hon väntade sitt första barn upptäckte Jessica hur mycket graviditeten och hennes nyblivna son påverkade hennes förmåga att leda och utveckla det företag hon lagt ner sin själ i under så många år. Hon drabbades av en karriärmässig graviditetsfälla som det ofta talas tyst om bland kvinnor i karriären.

Nummer 2 2012 31


CYAN MAGENTA GUL SVART

Lönsam arbetsglädje för första gången Text & Foto Ulf Hjelting

Allt började med att TS Lokalvård såldes ut till sina anställda. 15 år senare delas Arbetsglädjepriset ut på Örebrogalan. Handen på hjärtat – hur trivs du på arbetet? Slår söndagsångesten ned som en blytung sten inför varje ny arbetsvecka eller vaknar du på måndagen med ett leende och en iver att genast bege dig till din arbetsplats? När det kommunalägda städbolaget TS Lokalvård såldes till sina anställda för 15 år sedan hände något. – Man märkte snabbt hur sjukfrånvaron sjönk och hur personalomsättningen minskade drastiskt, säger Christer Eriksson på Chreson Sun som är säljare tillsamman med projektledaren Ulrika Franzén i projektet Lönsam arbetsglädje. Målsättningen med projektet Lönsam arbetsglädje är att öka och medvetandegöra arbetsglädjens roll för välbefinnandet på arbetsplatsen. I år delar man därför för första gången ut ett Arbetsglädjepris på Örebrogalan den 9:e februari. Projektet är ett samarbete mellan Örebro kommun, Handelskammaren, Företagarna, Örebro universitet och Svenskt Näringsliv. – Projektet är indelat i tre delar, där första delen är att dela ut en medarbetarenkät där man svarar på ett antal frågor om sin arbetsplats. Del två är Arbetsglädjepriset som delas ut till det företag som uppnått bäst enkätresultat och den tredje delen består av en halv dag med seminarier på Örebro universitet som vi kallar Arbetsglädjedagen, säger Christer Eriksson. Detta är första året som Lönsam Arbetsglädje genomförs och deltar gör 16 företag i Örebro och då handlar om allt från företag med tio anställda till större företag.

Årligen återkommande Projektet Lönsam arbetsglädje är tänkt att vara en årligen återkommande före-

32 Marknad

teelse och där deltagande företag kommer att få konkreta siffror på hur deras medarbetare mår och uppfattar sin arbetsplats. – Sedan kan man även jämföra sig med andra arbetsplatser och har man ett välmående företag där de anställda trivs så underlättar detta självfallet bland annat i rekrytering av nya medarbetare. Det blir en win-win situation för alla, inflikar Christer Eriksson. Det här menar Christer Eriksson också är ett argument för att loka nyetableringar av företag till Örebro och Örebro län. Överskottet som projektet genererar är tänkt att dels ett stipendium, andra liknande projekt och forskning vid Örebro universitet. Till Arbetsglädjedagen vid Örebro universitet kommer landshövding Rose-Marie Frebran och invigningstalar. – Framtiden? Det är ju tänkt att det här projektet ska återkomma varje år. Detta första år är det företag i Örebro som deltar, men jag ser att detta kan spridas över hela Örebro län. Det finns ingen begränsning i hur många företag som kan deltaga, avslutar Christer Eriksson.

Deltagande företag i Lönsam Arbetsglädje: Loka Brunn Strateg Nethouse Örebrokompaniet Almi Företagspartner Capio Läkargruppen Storstenshöjden Holmqvist Optik Contract IS Precio Systemutveckling TS Lokalvård TD Fiberoptik EKV Energi Paan System Best Western Hotell First Hotel


CYAN MAGENTA GUL SVART

Wrapping is everything – jacka upp priset med hjälp av en smart paketering av era tjänster

Text Annika Wihlborg

En professionell och genomtänkt paketering av produkter, tjänster och kringtjänster är i många fall en avgörande framgångsfaktor för företagare. Syftet med paketering är att göra det lätt för kunden att fatta ett köpbeslut och en attraktiv paketering kommer sannolikt att bli allt viktigare i framtiden. Det menar försäljnings- och förhandlingsexperten Karin Klerfelt, som är aktuell med boken ”Jacka upp priset! Sluta fega: paketera och sälj!” En strategisk paketering av företags tjänster och produkter har många fördelar för såväl kund som leverantör. På senare år har paketeringstrenden vuxit sig allt starkare. Ett sådant exempel är utvecklingen i resebranschen, där all inclusive-erbjudandena har ökat lavinartat. Många resenärer vill veta exakt vad semestern kommer att kosta och vill inte besvära sig med att chansa, känna sig osäkra på ett restaurangval eller vara osäkra på vad slutnotan hamnar på. Såväl privatsom företagskunder i alla branscher drivs av en önskan av att ha färre valmöjligheter och kanske också fatta färre beslut. Företag som paketerar sina tjänster underlättar du kundens beslutsprocess, vilket ofta innebär att steget från tanke till köpbeslut kan förkortas.

Baka in mervärden som tillför värde för såväl kund som leverantör - När du tänker paketering ska du alltid ha merförsäljning och kundnytta i bakhuvudet. Företagare som har lärt sig konsten att paketera sina tjänster och produkter på ett attraktivt sätt har goda möjligheter att jacka upp sina priser. I ett paketpris kan man baka in extra servicetjänster, sidotjänster och andra mervärden som betingar ett högt värde för kunden. Det genererar merförsäljningsmöjligheter för dig och mervärde för kunden, säger Karin Klerfelt.

Genom att rita upp en produktblomma, där företagets huvuderbjudande hamnar i mitten med presumtiva kringtjänster runtom, kan företagare få inspiration och hjälp på traven i paketeringen av sitt erbjudande. Fundera på vilken service du kan addera till ert huvuderbjudande, exempelvis fri utkörning av produkter, automatiska påminnelsemail, kundservice dygnet runt eller leverans inom 24 timmar. Det finns många exempel och alla företag har en uppsjö av möjliga kringtjänster som de kan addera till sitt huvuderbjudande. I vissa fall kan en utbildning av kunden och dess medarbetare eller kompletterande konsulttjänster eller finansieringslösningar vara värdefulla kringtjänster som kan öka kundens betalningsvilja,

aspekter från den till ert erbjudande. – Tänk före-under-efter. Fokusera inte bara på själva leveransen utan sätt på dig kundglasögonen. Vad händer hos kunden före och efter din leverans? Vad kan du mer hjälpa kunden med? – Vad ligger närmast dig? Paketera ditt erbjudande vertikalt, till nya kunder, eller horisontellt, paketera nya erbjudanden till befintliga kunder.

Vertikal eller horisontell paketering Tänk igenom hur kundens process ser ut före, under och efter din leverans. Fundera på hur du kan underlätta kundens tillvaro även i anslutning till att de köper din produkt eller tjänst och paketera in de mervärdena i ditt erbjudande till kund. Kom ihåg att ständigt sträva efter win-win, paketeringen ska vara en vinnande affär för såväl leverantör som kund. Företag som vill utöka sitt erbjudande kan satsa på vertikal eller horisontell paketering. – Vertikal paketering handlar om att applicera ett nytt erbjudande till nya kunder medan horisontell paketering går ut på att lansera ett nytt erbjudande till sina befintliga kunder. Vilken av dessa två modeller som passar bäst beror på i vilken bransch och i vilken situation företaget i fråga befinner sig i, säger Karin Klerfelt. Karin Klerfelt tipsar- så paketerar du företagets erbjudande i tre steg: – Ta fram produktblomman. Tänk kreativt och lägg till åtminstone två Nummer 2 2012 33


CYAN MAGENTA GUL SVART

Incuberabolag pitchade i Silicon Valley Text Ulf Hjelting

Två av bolagen i företagsinkubatorn Inkubera i Örebro, wec360 AB och Metacon AB, deltog på Svenska Institutets världsturnéstart i Silicon Valley i början av november. På plats fick de pitcha inför en mycket namnkunnig panel och Innovationsbron kunde efteråt konstatera att arrangemanget blev en succé. Det var den 2:a november förra året som pitcheventet ägde rum. Bolagen hade 60 sekunder var på sig att genomföra en ”innovation pitch”. Panelen och publiken, som bestod av 150 personer, var mycket imponerade av kvaliteten på både idéerna och entreprenörernas insatser.

34 Marknad

wec360 AB, som utvecklar fotografisk dokumentations- och visualiseringsteknik i 3D och 360-foto, är trötta men mycket nöjda efter vad de kallar ”den utan tvekan mest slitsamma veckan i vår företagshistoria”. – Vi har samlat på oss ett antal riktigt värdefulla och intressanta kontakter med ingångar till bra nätverk, sådant som vi aldrig skulle kunna uppnå utan att ha varit på plats i Silicon Valley. Vi har dessutom jobbat nästan dygnet runt med att visa upp vår teknik och intresset verkar av allt att döma väldigt stort, säger Per Hjalmarsson, vvd och fotograf på wec360 AB. Resan till Silicon Valley var värdefull också för Metacon AB, som ut-

vecklar och marknadsför energisystem för elektrokemisk omvandling av etanol, biogas och naturgas till el och värme. – Att presentera en ny, komplex verksamhet på 60 sekunder är en verklig utmaning. Responsen var enastående, och nivån och bredden på både panel och besökare med politiker, finansoch marknadsaktörer och professorer från Stanford University gör ju att vi känner oss ytterligare styrkta i att vi har en världsprodukt för den globala marknaden, säger Slavica Djuric, vd på Metacon AB. På Inkubera är man mycket stolt över att Innovationsbron bjöd med två av inkubatorns bolag till premiären av Svenska Institutets världsturné ”Inn-

ovation Sweden”, och man gläds över deras framgång. – Vi hade kontakt med bolagen under tiden de var på plats och kunde via uppdateringar över sms och mail följa deras framsteg, berättar Mikael Melitshenko, tf vd på Inkubera. – Deras omtalat professionella insats är en kvalitetsstämpel såväl för dem själva och deras produkter, som för Inkubera, avslutar Melitshenko. wec360 har bland annat Arenastaden/Swedbank Arena, Statens Fastighetsverk. Länsgården, Svensk Fastighetsförmedling, Läkare Utan Gränser och Lars Winnerbäck som kunder när det handlar om 3D-visualisering och 360-foto.


Vร„RLDENS RLDENS Hร…RDASTE Hร…RDAST Hร…RDASTE FOTBOLL & Hร…RDROCKSFESTIVAL! Hร…RDR Hร…RDROCKSFEST

R JUDER RBJU 6IIERB JETTTTERR6 ILILJE B S G A T TA E R RE รš ร F F P A P K S ERRFFรšรšRRATTTTBBO +ONTTAAKTTAAOOS (รšRRGร‹RRNNAAAVEAMTTMATTDDRRYYCKESPAKETT+ร‹DDARRSSYR RVII ENTTRRรBIILLJJEETTTTERRSMETTAALLLLSVENSKANCCOMSSรSSKRRร‹KEMรLL FFOORREETTAAG ENLLIIGTTERRAAรšรšNS E T L LT E H T T E K A P S G FFรšรšRREETTAA

www.metallsvenskan.com www.met w tallsvenskan.co om m 2 DAGARS FESTIV FESTIVALPASS VA ALPASS 495:-, :-, FREDAGSBILJETT 350:-, Lร–RDAGSBILJ Lร–RDAGSBILJETT JETT 395:-, 395:S (ENDAST AST TILLGร…NG TILL FOTBOLLEN) 100 :FOTBOLLSBILJETT (ENDAST 100:TTICNETSEsยพREBROKOMPANIET  s7E3#ยพREBRO  s4 3HIRT3TOREยพREBRO  ICNETSEsยพREBROKOMPANIET   s7E3#���พREBRO  s4 3HIRT3TOREยพREBRO  

ร…KERBY HERRGร…RD Mรถjligheternas mรถtesplats!

ร…kerby Herrgรฅrd รคr mรถjligheternas mรถtesplats fรถr alla โ€“ ett uppskattat och vรคlbesรถkt kurs- och konferenscentrum En plats fรถr alla former av arrangemang och aktiviteter โ€“ fรถr vardag som fest.

NIKIJA EVENT PRESENTERAR 25/2 MUSTASCH MUSTTA ASCH + FRANKY LEE, 9/3 HAMMERFALL, HAMM MERFFA ALL, 5/4 TAKIDA,13/4 TA AKIDA,13/ /4 IN FLAMES, 13/10 W.A.S.P. W.A .A.S.P P. 15/12 5/12 SABATON SABA ATTON FFร–R ร–R B BILJETTER ILJETTER O OCH CH M MER E R IINFO NFO S SEE W WWW.NIKIJA.SE W W. N I K I J A . S E

www.akerbyherrgard.se ยท 0587 91210 ยท info@akerbyherrgard.se


Technopolis ①

Från flytande högtalare till rullande väckarklocka Nu har vi hittat ljudet till poolen och en väckarklocka du bara måste gå upp för att kunna stänga av. Däremellan lagrar vi saker i flashminnet till den schweiziska Victorinoxen. Text Ulf Hjelting

① Flytande högtalare

② Rullande väckarkocka

③ Armékniv

Trött på att aldrig få till nått schyst ljud i poolen? Helst vill du lyssna på Sportradion eller Rockklassiker slappandes på en luftmadrass, men det går fanken inte... att hitta högtalare som funkar i vatten och som inte drivs med någon form av extern strömkälla. Vatten och el är ingen hit tillsammans, liksom... Jo, nu går det faktiskt att fixa bra ljud med hjälp av flytande högtalare. Lösningen heter Audio Unlimited PoolPOD Wirless Floating Speakers och allt kopplas samma trådlöst med din iPhone eller iPod. Ljudet utgår dock från en basenhet som drivs med fyra AA-batterier till den kan det kopplas upp till tio flytande högtalare. Praktiskt va? Räckvidden mellan basenheten och högtalarna är cirka 50 meter, så det gäller att grannen inte satsat på samma ljudsystem... Kostnad? Runt 1 000-lappen och Audio Unlimited PoolPOD Wirless Floating Speakers finns bland annat att köpa från coolstuff.se.

Tillhör du de som har förtvivlat svårt att vakna på morgonen? Det krävs nästan en Boforskanon för att väckas? Tricket med flera väckarklockor har också testats och misslyckats? Då kan Tocky vara nått att testa. Denna lilla klotrunda sak hoppar nämligen ned från nattduksbordet och rullar iväg när det är dags att kliva up. Allt under ett ilsket tjutande eller vad du nu väljer att den ska låta. Tocky har ett minne på 100 Mb vilket i mp3-filer ger cirka två timmars speltid. Sedan är det bara att välja om du vill vakna till ett ilsket brandalarm eller de ljuva tonerna av Bachs ”Air”... När den väl börjat tjuta finns det ingen annan återvändo än att hiva sig upp ur sängen för att jaga fatt i den rullande bollen. Denna Tocky drivs med tre stycken AAA-batterier och har ett tjockt skyddande skal av silikon. Färgerna orange, blå och vit finns och den är din för 560 kronor från smartasaker.se

Vem minns inte när det var högsta lyx att ha en armékniv typ fällkniv från schweiziska Victorinox– de där små röda pocketknivarna som innehöll allt från minisåg till kapsylöppnare, skruvmejsel, sax och nagelklippare. Nu har dock Victorinox uppdaterat sin ”fällkniv” för dataåldern och ”laddat” innehållet med ett flashminne. Den nya Victorinoxen kommer att finnas i lite olika utföranden med start från 64 gigabyte för den minsta versionen. Priset kommer också att variera från cirka 3 000 kronor till en bit över 10 000 för den största varianten. Detta blir det hittills minsta SSD-minnet på marknaden och det stöder både USB 2. 0 och 3.0 samt eSATA.Trolig säljstart för denna tingest lär bli någon gång april 2012. Victorinox utlovar även att det största flashminnet kommer att vara utrustad med en LCD-skärm med en upplösning på 48x96 bildpunkter. Automatisk säkerhetskopiering kommer också att erbjudas.

36 Marknad


Metallskrot Köpes

Töm vårt webblager!

- betalning direkt!

www.dagspris.se

Dags att städa firman, lagret, gården etc.

20% 50% 70%

Vi köper: Koppar, Mässing, Aluminium, Rostfritt, Elmotorer, Elkabel m.m. Järnskrot minst 5 ton. Vi erbjuder hämtning kväll och helg efter överenskommelse. Vi hämtar o lastar, egen bil med kran. besök oss på nätet

skrotman.se

Kent 0708-18 55 77

Vi köper både av privatpersoner och företag.

Välkommen till Örebros fräscha innerstadshotell! Best Western City Hotel Örebro erbjuder 96 rum mitt i stan. Vi är ett 4-stjärnigt Garni-hotell som håller hög kvalitet på våra rum och serverar riktigt bra frukost.

Kungsgatan 24 Tel. 019-601 42 00 • www.cityhotelorebro.se

%<**9$58)g50('/,1*(1%<**9$58)g50('/,1*(1%<**9$58)g50('/,1*(1%<**9$58)g50('/,1*(1%<**9$58)g50('/,1*(1

FÖNSTERDAGAR!

Erbjudande

Februari ut

Dags att byta fönster? upp Spara 00:0.0 till 10

FALSTERB

O 870S G

12 SP1:1

Besök Sveriges största dörr& fönsterutställning i Kumla

SNABBHETSPREMIE! Värde ca 11.125,Beställ dina fönster nu! - Få en ytterdörr på köpet!*

age mont t r e a Boka tnyttj och u s s o et! hos vdrag ROT-a Fordonsgatan 3 • KUMLA • 019-56 91 44 Öppettider: Torsdag 9.00-18.00 Måndag - Fredag 9.00-17:00 info@byggvaruformedlingen.se • www.byggvaruformedlingen.se * Gäller beställning före 12-02-28 vid köp över 50.000,-, ytterdörr som ingår är modell Falsterbo 870S G12 SP1:1 vit i modul M10x21. Kan inte kombineras med andra erbjudanden.

%<**9$58)g50('/,1*(1%<**9$58)g50('/,1*(1%<**9$58)g50('/,1*(1%<**9$58)g50('/,1*(1%<**9$58)g50('/,1*(1


Inredning

Från Sheriff till Concave Denna månad ställer vi in en Sheriff på kontoret för att sedan sjunka ned i soffan Berliner. Mot kvällen kravlar vi över i schäslongen Concave för att slappa riktigt ordentligt. Text Ulf Hjelting

① Concave

② Inbjudande soffa

③ Futuristisk kontorsstol

När Jonas Bohlin visade upp sitt examensarbete ”Concrete” från Konstfack 1981 var det som att ha avfyrat en smärre postmodernistisk bomb i ett designsverige som då dittills mest uppvisat funktionalistiska och ergonomiska funktioner. Bohlins ”Concrete” var som en direkt motbild mot all detta. Betong och stål – inget annat. Bekväm? Tja… så bekväm som en stol av betong kan vara. Den finns endast i 100 exemplar och tillverkades tillsammans med möbeltillverkaren Sven Lundh. Möbeltillverkaren Källemo har nappat på några av Jonas Bohlins designidéer och en av dessa är schäslongen Concave som består av en stomme av böjträspant och fundamentet är i svart stål. Sits och kudde i kallskum. Detta är något att slappa i för den bekväme och Concave har inget ”betong” över sig alls. För 33 000 kronor blir denna tingest din. För en skinnvariant i Elmo soft blir det ett litet tillägg och en Concave i detta utförande går lös på 49 525 kronor.

Soffan Berliner från Swedese har en massiv trästomme och stoppningen av kallskum med fiberfill. Underrede i krom eller lakad aluminiumfärg. För designen står Mårten Claesson, Eero Koivisto och Ola Rune. Claesson Koivisto Rune, är ett designföretag baserat i Stockholm. Företaget grundades 1995 och arbetar med att designa allt från smycken till tandborstar och stora byggnader. Företaget är idag representerat i Sverige, Japan, Frankrike, Tyskland, USA och Uruguay. Claesson Koivisto Rune var de första svenska arkitekterna som år 2004 blev utvalda till den internationella paviljongen på arkitekturbiennalen i Venedig. Möbler och produkter som har designats av dem produceras i Sverige, Finland, Danmark, Belgien, Tyskland, England, Italien, USA och Japan. Soffan Berliner är ett exempel på deras mycet stilrena design. En soffgrupp bestående av två fåtöljer och en tresitssoffa kommer på plats i ditt vardagsrum för ungefär 38 000 kronor.

Få svenska formgivare och designers har en så egen och personlig stil som Mats Theselius. Hans möbler andas på något märkligt sätt både retro och futurism på samma gång. Så gör även arbetsstolen Sheriff. Stommen består här av ett stålunderrede i svart eller alternativt i krom. Stolen är sedan klädd i lästformat kärnläder i natur, svart eller brunt. Givetvis är denna kontorsstol både höj-, sänk och vippbar för att kunna hitta bäst sittställning. Sheriff är som hämtad ur en film av Tim Burton eller varför inte från Frodos hus i Sagan om ringen? Kanske är det en sådan här som ”The Swede” planerar sin nästa komplott i tvserien ”Hell on Wheels” Mats Theselius debuterade redan 1985 med sin Älgskinnsfåtölj och förra året valdes han in i Konstakademin. Ingenting är främmande för hans förgivning och här passerar både möbler, kläder, textilier och cowboyboots… En Sheriff kontorsstol blir din för endast 36 170 kronor på Inda Interiör.

38 Marknad


Örebro läns månadstidning

– 26 smakerkap 26 lands ! extra

Örebro läns månadstidning

SEPTEMBER 2011 #8

Julkalendern på Rådhuset

Hus & Ha!em tem

Örebro läns månadstidning KROG+BAR KULTUR MAT MUSIK FILM TEATER

Örebrosonen tillbaka

JANUARI 2012 #1

Full fart med eliten

Tandläkarpraktiken mitt i centrum Välkommen att boka tid hos oss: Tandl. Kerstin Abrahamsson, tel 019-18 25 60 | Tandl. Bo Lundström, tel 019-12 02 36 | Tandl. Tommy Stackeryd, tel 019-13 82 20

Stortorgspraktiken, Stortorget 15, ÖREBRO

Örebro läns månadstidning

OKTOBER 2011 #9

TEMA VINTERSPORT | KROG+BAR | KULTUR | RESTAURANG | MUSIK | FILM | TEATER

Öppnar inom kort! Nygatan 27, Örebro

Örebro läns månadstidning

DECEMBER 2011 #11

Julen står för dörren

100 år med Hjalmar

MODE KROG+BAR KULTUR MAT MUSIK FILM TEATER

NOVEMBER 2011 #11

TEMA JULEN | KROG+BAR | KULTUR | RESTAURANG | MUSIK | FILM | TEATER

Vi har flyttat till

Tandläkarpraktiken mitt i centrum Välkommen att boka tid hos oss:

Nygatan 27, Örebro

Tandl. Kerstin Abrahamsson, tel 019-18 25 60 | Tandl. Bo Lundström, tel 019-12 02 36 | Tandl. Tommy Stackeryd, tel 019-13 82 20

Stortorgspraktiken, Stortorget 15, ÖREBRO

Örebro läns månadstidning

Örebro läns månadstidning

NOVEMBER 2011 #10

JUL & NYÅR 2011 #13

Ljust och Fräscht TEMA: BIL & MOTOR | KROG+BAR | RESTAURANG | KONST | MUSIK | FILM | TEATER

K`ghhaf_lahkœ=n]flaf^g d

da

Med dig alla dagar

!

=jZbm\Yf\]fœLndaf_Yj okk

ok

Eldkvarn på Konserthuset

Ga

TEMA MAT & DRYCK KROG+BAR KULTUR RESTAURANG MUSIK FILM TEATER

på Faceb

o

Öppnar inom kort! KROG+BAR | RESTAURANG | KONST | MUSIK | FILM | TEATER

Nygatan 27, Örebro

Träffa mitt i prick! Handelsstaden Örebro kommer hela vägen hem till dig och din målgrupp. Med intressant läsning och alla nyheter läsare behöver om sin stad. Handelstaden Örebro.

Telefon 019 - 10 84 90 Fax 019 - 10 84 30 Adress Näbbtorgsgatan 2, 702 23 Örebro. Web www.hkm.se


Travellista

Från Bruce Lee till Påskön Text Ulf Hjelting

Denna månad åker vi på kryssning i Asien och upplever städer som Bangkok och Hongkong. Sedan åker vi i Taubes fotspår till Argentina för att avsluta allt på den mystiska Påskön.

Kryssa i Asien När man pratar om att resa i Asien kanske inte alternativet ”kryssningsfartyg” är det första som så att säga dyker upp. Möjligtvis kommer ordet ”backpacker” upp, men alternativet med kryssningsfartyg finns och för en grundavgift på endast 27 900 kronor erbjuder Holland America Line en 14 dagar lång kryssning mellan Singapore och Hongkong. Då passerar man hamnar som Koh Samui, Bangkok, Phu My, Nha Trang och Halong Bay. I resan ingår självfallet flyg med Finnair från Stockholm, Göteborg eller Köpenhamn till Singapore och hem från Hongkong via Helsingfors. Nu passerar man inte bara hamnarna, utan i resan ingår både halvdags och heldagsutflykter och stadsrundtur i 40 Marknad

Singapore, Bangkok och Hongkong (passa exempelvis på att kolla in statyn över Bruce Lee). Givetvis är det helpension som gäller och all underhållning ingår. Det som tillkommer på resan är cirka en tusenlapp i dricks till servicepersonalen ombord och så går det givetvis att uppgradera hytten till en suite med egen balkong. Kryssar gör man med fartyget Zaandam som tar 1400 passagerare.

I Taubes fotspår ”I Samborombon, en liten by förutan gata, den ligger inte långt från Rio de la Plata, nästan i kanten av den blåa Atlanten och med Pampas bakom sig många hundra gröna mil...”. Så börjar Evert Taubes ”Fritiof och Carmensita” och som bekant är Pampas en del av Argentina. Explore Tours erbjuder en 15 dagar lång vistelse med kringresa för endast 33 550 kronor och då ingår allt flyg, bonde och alla frukostar under resan i detta fantastiska land. Under dessa dagar besöks bland annat

världsmetropolen Buenos Aires med sina 12 miljoner invånare – staden som bland annat kallats för Sydamerikas Paris. Här lärs grunden i att dansa tango ut och därefter tillbringas en heldag på en hacienda mitt ute på Pampas. Det blir även en utflykt till Paranadeltat och det mäktiga vattenfallet Iguazufallen besöks. Här finns cirka 430 olika fågelarter och 79 olika typer av däggdjur. För den vinintresserade blir det ett nedslag i Mendoza som är Argentinas främsta vinregion där man odlat vin sedan 1500-talet. Under resans näst sista dag korsas Rio de la Plata för ett besök i Uruguay och ett besök i Colonia de Sacramento som finns med på UNESCOs världsarvslista.

Rapa Nui Påskön, eller Rapa Nui som ön egentligen heter, har cirka 3 300 invånare och 900 statyer. Det är just dessa statyer som förbryllat så många – inte minst Thor Heyerdahl. Vad eller vilka

de föreställer, vilka som gjort dem och i vilket syfte de har tillverkats har för länge sedan gått förlorat. Om man nu vill besöka denna mytomspunna ö, så tar det cirka 30 timmar att nå dit med flyg från Arlanda. Ett stop i Santiago är att rekommendera för att sedan boka biljett via flygbolaget LanChile som är de som sköter transporterna till och från Påskön. Flyget från fastlandet, Chile, tar cirka fem timmar. Bor gör man i byn Hanga Roa på öns västkust. Vid landning gör man bäst att hålla i sig ordentligt – landningsbanan är anskrämligt kort. De flesta av dessa statyer finns kring Påsköns stränder, men det finns något mer som statyernas tillverkare lämnade efter sig. Nämligen rongo-rongotavlor av trä. På dessa finns ett hieroglyfliknande skriftspråk som ännu ingen lyckats tyda. Den dagen det sker kanske vi får veta mer om de mystiska statyerna och dess tillverkare.


/ZรถLFO (รšSTรŒIรŠS  -BEEBOFS"QQFO 233FBEFSHSBUJT  4DBOOB23LPEFO

Wonderville.se

019-27 48 55 tXXXIFEFOKVOHBOEFSTF


Fashionista

Smått och gott inför ljusare tider – Snygg i varma och kalla färger.

Tunika, som passerar precis lika väl som klänning, i varma nyanser från Rabalder, 799 kronor 95 procent modal, 5 procent elastan.

En djupt vinröd cardigan, Moira, som gör sig alldeles utmärkt både tillsammans med andra plagg och naturligtvis till den tunika den har sällskap av på denna sida. Även ”Moira” kommer från Rabalder och kostar 799 kronor. 60 procent linne, 40 procent viskos.

Till denna blå skjorta passar det alldeles utärkt med denna byxa från Oscar Jacobson i off white, vilken man också finner hos Johnells. 998 kronor kostar de.

Idén om att man inte får blanda mönster är tack och lov sedan länge avskaffad och maganiserad. Därför gör sig dessa randiga leggins alldeles utmärkt till tunikan med dess blomrankemönster. Nadia Leggins för 399 kronor på Rabalder. 68 procent modal, 28 procent bomull, 4 procent elastan.

Blå som den vårhimmel vi alla väntar på och i 100 procent bomull är denna skjorta av märket Eton från Johnells. 1 298 kronor.

Skulle det vara så att man känner att ett bälte vore på sin plats så finns detta i vit och marinblå flätning, av märket John Henric. 598 kronor hos Johnells.

42 Marknad


Visa vem du är Spoil

Har du hittat den rätta? Var lika noggrann när du väljer förlovnings. och vigselring. Vi har ett mycket brett utbud och kunskapen att göra något unikt och speciellt för dig.

Designa ditt eget arm- eller halsband med snygga, roliga och personliga berlocker. Det ÄUUZTrUNHH[[]pSQHWrZrK\ alltid kan hitta dina personliga favoriter. Spoil Yourseft.

Modernt eller tidlöst?

Vitt eller rött?

Designa din egen stil

Fler stenar, eller färre? Possibilities Är en serie med ringar, armband, halsband och örhängen från danska Heiring. Matcha och kombinera smycken av högsta kvalitet till en egen personlig stil med nya möjligheter.

Eller ingen?

Matcha

Nya möjligheter

Tillman United

Passar de ihop?

2€WTHUNH[HUkYLIYV‹ 


Webbtips

Ignorerad Hur man tystar en förespråkare för det fria ordet.

Text Peter Steen-Christensen

Den här återkommande avdelningen i Marknad har som utgångspunkt att handla om internet. Den här gången har jag valt att varken koncentrera mig på ovidkommande surftips till när man vill koppla bort hjärnan och bara fördriva tiden eller ge tips på hur man kan använda internet till fördel ifall man driver egen verksamhet. Istället ser jag på det som en möjlighet att framhäva internet som en enastående källa till information, och då framförallt information som kanske inte alltid serveras till medborgarna genom deras vanliga mediekanaler av en eller annan anledning. Ett ganska extremt exempel på att man inte får hela storyn, eller åtminstone att man inte får den väldigt vinklad, är medias bevakning av det amerikanska valet och republikanernas kandidater. Likt en Agatha Christie-story har flera av de uppskrivna kandidaterna media debatterat om fallit bort, medan den nedtystade kandidaten Ron Paul hänger kvar i ett fält som nu är nere på fyra stycken. Om vi spolar tillbaka bandet till sensommaren när valkampanjerna tog fart så ser man i rapporteringen i media runt Iowas Straw Poll att Ron Paul blev ignorerad, vilket bland annat uppmärksammades av Jon Stewart i The Daily Show i ett klipp som fått eget liv på internet.* Jon Stewart frågar sig hur Ron Paul blev den politiska motsvarigheten till 13:e våningen på ett hotell. Ur nyheterna från MSNBC: ”A new gallup survey showing Rick Parry running second to Mitt Romney, knocking down Iowa favourite Michele Bachman to fourth”. Och vem kom trea? I samband med New Hampshirevalet skrev den politiska nyhetswebsidan The Daily Caller från Washington: ”Poll: Romney leads New Hampshire, Huntsman in third, Perry in Fourth”. Gissa vem som kom tvåa. 44 Marknad

Dagens Nyheters USA-korrespondent Michael Winiarski nämnde faktiskt Ron Paul den 16:e december, enligt honom själv som en följd av flertalet läsarbrev. Winiarski skrev ”Det underförstådda budskapet är att DN och andra etablerade medier manipulerar och förtiger och ignorerar Ron Paul. Att påstå att Ron Paul skulle ignoreras och marginaliseras i amerikanska medier är helt enkelt inte sant. Men det är en mytbildning som stämmer med den martyrroll som en del av Pauls anhängare försöker anamma.” Ok – efter CNN:s politiska debatt i South Carolina, röstade tittarna vem som klarade sig bäst. Ron Paul fick 42%, Romney 29%, Gingrich 18% och Santorum 12%. Under experternas eftersnack i studion efter debatten nämndes Romneys namn 87 gånger, Gingrich 82 gånger, Santorum 76 gånger och Ron Paul en gång. EN gång – men enligt tittarna vann han debatten. Ändå var det han sa inte ens värt att nämna i rapporteringen. Det är ju lite underligt kan man tycka. Nu ska det här inte vara ett politiskt inlägg, det jag vill påpeka är istället att man kanske kritiskt måste granska medias vinkling då det är glasklart att ifall man kontrollerar informationsflödet, kontrollerar man publikens verklighetsuppfattning. Uppmärksammas inte folket på ett alternativ så är utgången given. Svensk media har knappast någon agenda i det här fallet, trots att såklart även svenska publikationer har ägarintressen och hållningar. De kan dock ändå inte påverka utfallet så svensk media utgår nog helt enkelt från amerikansk dito och fungerar lite som ett karbonpapper på de politiska favoritkommentatorer dessa individuella journalister råkar ha. När det kommer till amerikansk media är det dock inga tvivel. Men varför är det så svårt för Ron Paul att få uppmärksamhet för sin ståndpunkt? Varför nämns han bara i

nedlåtande termer, med ett hånleende och sällan utan tillägget att han inte kan tas som någon som verkligen kan vinna ett val? Well, han anses farlig för etablissemanget. Kapitalet har Washington i ett järngrepp sedan många år, när krisen slog i USA i samband med förra valrörelsen pekade kandidat Barrack Obama på Wall Streets girighet och misslyckandet att reglera finansindustrin som exempel på problem som behövde ändras i Amerika. Dock har några sådana förslag aldrig lämnats in. Väl vid makten ansatte Obama snabbt Timothy Geithner, Larry Summers och övriga ”usual suspects” med Goldmans Sachs-bakgrund eller tillhörighet och bevisade att status quo skulle fasthållas. Idag är Goldmans Sachs Barrack Obamas största bidragsgivare. Vilka som är Mitt Romneys största bidragsgivare? Goldman Sachs. Att det står ”demokrat” eller ”republikan” efter deras namn är likgiltigt. Finansindustrin har över 3 000 lobbyister anställda och plöjde ned över fem miljarder dollar i politiska bidrag och för påverkan och inflytande mellan 1998 och 2008 och har sedan dess ökat summorna. Ron Paul får dock inga sådana bidrag. Men Paul får, även om summorna inte kan jämföras, mer pengar än alla andra politiska kandidater tillsammans från militärer och militärorganisationer. Ron Pauls två viktigaste politiska spår är utrikespolitiken och finanspolitiken. Han vill skära ned på utgifterna, däribland ta hem alla amerikanska trupper utomlands, och vad det gäller finanspolitiken vill han gå tvärtemot nuvarande linje med bailouts, nytryckta pengar och att lägga över räkningen på skattebetalarna. Han står för något så enkelt som en balanserad budget. Detta kommer från någon som flera år i förväg pekade på en inledande husbubbla på grund av för lättillgängligt

kapital och dåliga lån som gavs av en avreglerad finansindustri som var de enda som tjänade på karusellen. Han menade att miljoner amerikaner skulle förlora stora värden på sina hus vilket också blev fallet. Han har dessutom länge lämnat in motioner om att granska räkenskaperna hos den amerikanske centralbanken (Federal Reserve) som ägs av privatägda banker – och därmed enbart har privat ägarintresse. Det gav till slut frukt och en liten delgranskning har genomförts. Nu vet man att denna centralbank har lånat ut 16 miljarder dollar räntefritt till de stora bankerna (att bankerna dessutom, i snitt, använder sig av leverage till tolv gånger kapitalet är en annan diskussion). Så är det fortfarande någon som undrar varför finansvärlden och medieindustrin inte vill uppmärksamma Ron Pauls sak? Och slutligen, för att komma tillbaka till internet, så är Ron Paul den enda kandidat som har sagt ifrån när det gäller lagförslagen att reglera internet – de så kallade SOPA och PIPA – som ska vara för att ”attackera piratkopiering” och användas i ”kriget mot terror”. Vad det faktiskt skulle innebära är en censur av internet – där sajter kommer anses skyldiga tills de bevisat sig själva oskyldiga istället för tvärtom. Kanske är det därför Ron Paul vinner omröstningarna i ålderskategorin under 30 år – de som för övrigt också kommer stå med räkningen för den extrema kreditexpansionens efterdyningar. De under 30 vill såklart ha sitt Wikipedia, Youtube och Flickr kvar. Eller också är det bara för att den gruppen – i alla fall än så länge – kan hitta fram till ovinklad information på ett ocensurerat internet. *Jon Stewart om att Ron Paul blir ignorerad sök på Google efter:The daily show ron paul indecision. För att se hur väl Ron Pauls förutsägelser 2002 har slagit in sök på Youtube efter: Ron Paul – Predictions in Due Time (Original)


IT-Hantverkarna presenterar Molnet! Office 365 erbjuder företag bättre affärsstöd och sänkta IT-kostnader. Ring 019-500 15 20 så berättar vi mer!

 : : : , 7 + $ 1 7 9 ( 5 . $ 5 1 $  6 (  


CYAN MAGENTA GUL SVART

Angelica Sörensson Text Anders Bromsjö Foto richardstrom.com

Efter två års uppehåll satsar Angelica Sörensson nu åter för fullt på sin volleyboll. Samtidigt är hon i början av en civil karriär som polis. För Marknad berättar hon om sin sina satsningar. Är det inte tufft att satsa hårt både på din idrott och civilt? – Jo, stundtals. Jag är ny i min yrkesroll och har dessutom inte satsat ordentligt på volleyboll på två år. Så hösten har krävt mycket energi till både jobb och träning. Har du tvekat? – När jag i somras fick frågan om jag var intresserad av en satsning med Örebro volley var jag först inte så sugen. Men när hösten sedan närmade sig började det att klia fingrarna. Det kändes både kul och utmanande att vara med från början med ett helt nytt lag. Ditt liv är väldigt intensivt – hur fyller du på med ny energi? – Jag försöker att ta det väldigt lugnt när jag kan, umgås med dem jag tycker om och ta långa promenader med hunden. 46 Marknad

– Samtidigt ger idrotten massor av glädje och energi. Att utöva sporten som man älskar tillsammans med ett underbart gäng tjejer ger mig massor. Hur viktigt är det för dig att ha ett stimulerande arbete utanför idrotten? – Förr var det inte lika viktigt. Då jag var helt insnöad på volleyboll och jobbet kändes mer som ett nödvändigt ont. Nu har jag kul både på jobbet och på träningen och livet känns mer stimulerande på alla plan. Vad hoppas du uppnå i din civila karriär? – Min ambition är att någon gång få arbeta som hundförare. Men det finns massor av spännande områden inom polisen – så det lär dyka upp fler idéer framöver. Försöker du att planera din poliskarriär? – Nej, jag lever nog mer i nuet. Vilka delar från idrotten tar du med till ditt arbete? – Främst är det nog vikten att vara en bra lagspelare och lagkamrat. Feed-

back, som jag tycker är väldigt viktigt för att kunna utvecklas, är också något jag fått med mig därifrån. Är du själv duktigt på att ge det? – Jag försöker. Jag gillar när det är raka rör och inte bara klappar på axeln. Vilka likheter finns det annars mellan det du presterar på volleybollplanen och i ditt arbete? – Mest är det nog att jag är väldigt engagerad – jag försöker att alltid ge 100 procent. Sedan ställer jag höga krav på mig själv när det gäller att prestera, oavsett om det gäller arbete, idrott eller privat. Du var inne på det här med lagspelare – är det viktigt för dig att tillhöra ett lag? – Ja, det är nog det jag har insett. När jag under vissa perioder inte tillhört ett lag har det alltid känts som att något saknats i mitt liv. Att vara med i ett bra och balanserat lag ger så mycket positivt – det är nog svårt att ersätta för en som är van vid det.

Vad med idrotten är det annars som driver dig? – Kombinationen av själva utmaningen och viljan att alltid kunna bli bättre. Jag är en riktig tävlingsmänniska och får jag inte tävla i någon idrott skulle nog mina stackars anhöriga bli lidande. Då skulle jag vilja tävla mot dem i allt möjligt... Hinner du något socialt liv utanför arbete och din sportliga satsning? – Nej, ärligt talat har jag inte mycket tid över att åka och träffa familj och vänner, som är utspridda över hela landet. – Dock ser jag umgänget med tjejerna i laget som en del av det sociala livet. Vi trivs väldigt bra tillsammans, så det går absolut ingen nöd på mig.

Namn: Angelica Sörensson Ålder: 24 Gör: Volleybollspelare i Örebro volley och polis.


CYAN MAGENTA GUL SVART

MĂśten blir effektivare Text Annika Wihlborg

Det finns en mängd intressanta och användbara tekniska verktyg som underlättar, effektiviserar och gĂśr organisationers mĂśten roligare. Tekniker som stĂśdjer mindmapping, mentometerknappar och Idea Builder powered by Zing ger gruppen hjälp pĂĽ traven i arbetet med att generera konstruktiva mĂśten som ger verkliga resultat. â&#x20AC;&#x201C; Trots att det finns en mängd tekniska lĂśsningar att välja mellan fĂśr organisationer som planerar och fĂśrbereder sina interna arbetsmĂśten sĂĽ används de i mycket liten utsträckning i svenska organisationer. Det beror ofta pĂĽ att kännedomen och vetskapen om dessa tekniska verktyg som rationaliserar och fĂśrhĂśjer effekten av sĂĽväl vardagsmĂśten som konferenser är relativt lĂĽg, säger mĂśtesexperten Caroline Dunne, som driver fĂśretaget MĂśteslabbet. Ett av de mest beprĂśvade verktygen fĂśr att effektivisera mĂśten är mindmapping. Tack vare mjukvaruprogram som Mindmanager och Mindmeister sĂĽ kan traditionell mindmapping tas ett steg längre. Med hjälp av modern teknik kan en mindmap skapas i realtid, under mĂśtets gĂĽng och i takt med att diskussionen växer fram. Det har en dokumenterad psykologisk effekt som visualiserar mĂśtets framsteg fĂśr deltagarna, samtidigt som dokumentationen sker i realtid. Mindmapen hjälper mĂśtesdeltagare att se samband och logiska kopplingar i resonemang. Efter mĂśtet kan alla snabbt ta del av den digitala tankekartan. â&#x20AC;&#x201C; Med hjälp av ett visuellt sprĂĽk kan vi lättare Ăśverblicka och fĂśrstĂĽ komplexa sammanhang. Mindmanager och Mindmaister är även utmärkta verktyg fĂśr presentationer och ett betydligt

mer dynamiskt alternativ till konventionella Powerpointpresentationer, säger Caroline Dunne.

Idea builder ger oanade mĂśjligheter till interaktivitet Ytterligare ett kraftfullt mĂśtesverktyg som verkligen ligger i tiden är Idea builder powered by Zing. MĂśtesdeltagarna delas in i smĂĽgrupper med minst tre deltagare i varje. Grupperna fĂśrses med trĂĽdlĂśsa tangentbord. De diskuterar de fĂśr mĂśtet kritiska frĂĽgeställningarna och skriver ner sina tankar och idĂŠer pĂĽ tangentborden. Samtliga inlägg presenteras i realtid pĂĽ en storbildsskärm. Idea Builder är ett kraftfullt verktyg fĂśr att skapa interaktiva mĂśten och seminarier exempelvis vid medarbetardagar, kundträffar, kickoffs, fĂśreläsningar och utbildningar. â&#x20AC;&#x201C; Flera sinnen används under mĂśtet, vilket har en god pedagogisk effekt. Deltagarna kan dela med sig av sina synpunkter och ĂĽsikter skriftligt och anonymt, utan att behĂśva prata infĂśr den stora gruppen. Grupper som vill fĂĽ ut mesta mĂśjliga av den här metoden gĂśr klokt i att anlita en certifierad facilitator, som bland annat kan konsten att formulera frĂĽgor pĂĽ bästa mĂśjliga sätt utifrĂĽn syftet med mĂśtet, säger Caroline Dunne. Idea Builder väcker engagemang och skapar intresse bland deltagarna eftersom det uppmuntrar till interaktivitet, säger Caroline Dunne, som tillägger att användandet av Idea Builder ger mĂśtesdeltagarna en rejäl AHA-upplevelse.

Mentometerknappar fĂśr snabb individuell respons En annan teknik som Ăśppnar upp mĂĽnga mĂśjligheter till delaktighet och

Välkommen till Bibby Financial Services Vi kĂśper och belĂĽnar fakturor. Genom fakturakĂśp och fakturabelĂĽning frigĂśr Bibby Financial Services likviditet ĂĽt fĂśretaget samt minimerar risken fĂśr framtida kreditfĂśrluster. t7JQSPEVDFSBSyt7JCFWBLBSyt7JLĂ&#x161;QFSy t7JCFMĂ&#x152;OBSyt7JJOLBTTFSBSyyEJOBGBLUVSPS 7JUJMMIBOEBIĂ&#x152;MMFSFYQPSUGJOBOTJFSJOH

inflytande Üver mÜtet är mentometerknappar. Med hjälp av mentometerknappar ges mÜtesdeltagarna en mÜjlighet att besvara frügor genom att rÜsta pü det alternativ de fÜredrar. Eftersom rÜstningen sker anonymt är sannolikheten stor att deltagarna vügar dela med sig av sina uppriktiga üsikter. MentometeromrÜstningar är ett effektivt sätt att snabbt ta pulsen pü publik-

HĂ&#x201E;R BLIR DRĂ&#x2013;MMAR LEVANDE! KONFERERA I EN GENUIN OCH PRISBELĂ&#x2013;NT MILJĂ&#x2013;. HĂĽll era konferenser och kurser hos oss! Vi är flexibla och ger personlig service och är här fĂśr att uppfatta era behov och gĂśra vĂĽrt bästa fĂśr att vistelsen hos oss ska bli en minnesvärd upplevelse. Här kan du uppleva äventyr och vildmark eller lĂĽta oss gĂśra ditt brĂśllop eller fest till nĂĽgot utĂśver det vanliga. Här i BredsjĂś finns mĂśjligheten att disponera tvĂĽ vackra HerrgĂĽrdar, den ena frĂĽn 1760 och den andra frĂĽn bĂśrjan av 1900-talet. Vi är lyhĂśrda fĂśr vĂĽra gästers behov och lovar att gĂśra era drĂśmmar levande. TEL: 0587-802

en del av Bibby Line Group

5FMWYMtTXFEFO!CJCCZGJOBODJBMTFSWJDFTDPN XXXCJCCZGJOBODJBMTFSWJDFTDPNtXXXCJCCZHSPVQDPVL

en och pejla av deras ĂĽsikt i en viss frĂĽga. â&#x20AC;&#x201C; I framtiden ersätts fĂśrmodligen mycket av den mjukvara och den tekniska utrustning som används idag av mĂśtesdeltagarnas egna mobiltelefoner och läsplattor. Det tyder inte minst det stora antal mĂśtesappar som regelbundet lanseras till smartphones, säger Caroline Dunne.

00

WWW.BREDSJOHERRGARDAR.SE INFO@BREDSJOGARDEN.SE HĂ&#x201E;LLEFORS

Nummer 2 2012 47


Välfyllt Skafferi som växt fram organiskt Text Dixie Ericson Foto richardstrom.com

Örter är livet för Margareta Rosengren. Matfilosof och entreprenör med ett sinnligt tilltal. Hon skyr det likriktade och fyrkantiga. Energisk som få. – Tänk om vi inte haft kryddorna och medicinalväxterna. Då skulle vi inte haft någon medicin. Tänk på alla parfymer, alla dofter och alla aromer. Det är väldigt kul med dofter och smaker. Nu, ny restaurangägare i Länsmuseet som satsar på en doftande, smakande och estetisk matupplevelse. Rosengrens Skafferi serverar en vegetarisk lunchbuffé. Att avnjutas i lokaler med en färgavstämd och formmedveten interiör med smak av örtagård. Där stolarna i restaurangens framficka mot Engelbrektsgatan lyser som solig grönska. Tyget är designat av en viss Ernst Kirchsteiger. Margareta har medverkat i Sommartorpet. Efter lunchen förvandlas Rosengrens skafferi till ett kafé med bland annat hembakade pajer. Där finns också en delikatessbutik med ostar, oljor, vinägrar, kryddor, keramik... Tre nyckelord bildar en filosofisk treklang för hela verksamheten: lokalt 48 Marknad

producerat, tillredning från grunden och ekologiskt så långt det går. Margareta vill satsa alltmer på lokalproducerat i butiken. Och på kvällarna blir det kurser, fester och vinprovning för grupper och företag. Nyligen firade en kvinna sin 40-årsdag genom att bjuda sina väninnor på en vegetariska matlagningskurs. Ett skafferi med fantasi och flexibla hyllor.

Mångsysslare och odlare – Jag har jobbat som pedagog i hela mitt liv. Pedagogiken finns med nu också i vår kursverksamhet. Waldorfpedagogikens kreativa sida gillar hon och en Marockoresa i ungdomen gav livslång inspiration. – Grönsakerna, växterna och lukterna, oj, oj, oj... Margareta är en mångsysslare med nästan trettio år i den offentliga sektorn. Efter några år som fritidspedagog började hon som arbetskonsulent och utbildare på Arbetsmarknadskontoret. Hon slutade 2001 efter att ha väglett invandrare, alkoholister och slutligen analfabeter.

Hon tog steget fullt ut som entreprenör. Fröet till den karriären såddes 1990. – Då flyttade vi till Hjälmarbaden och jag började odla örter. Det var himla kul. Det ena gav det andra. Hon började producera egen vinäger, örtsalter och örtprodukter till avsalu. Hon var med när Örtagården i Karlslund startades. Ett tag drev hon en matbutik i Wadköping innan delikatessbutiken blev verklighet. Och den senaste avknoppningen är restaurangen. Hennes affärsidé verkar ha vuxit fram och förverkligats nästan organiskt. Margareta har en annan vinkel. – Jag är ju tjej och har därför tagit många små steg i taget.

Tycke och visioner Må så vara. Tycke har uppstått mellan Länsmuseet och Rosengrens Skafferi. – Det känns som jag kommit rätt. Här har vi lite att växa i. Det känns spännande. I hennes vision ingår en örtagård i museets atriumgård.

– Jag har jättebra personal. Duktiga tjejer. Det börjar sätta sig. Jag vill vara kvar här och utveckla konceptet. Hon älskar att laga vegetariskt även om hon själv inte är vegetarian. – Det är roligare att laga vegetariskt för där är det mer av färg, form och kryddor. Mer kreativt. Lite mer lila här va? Lite mer grönt eller rött? Tjejerna, för det bara femininer i farten, diskuterar hela tiden färger i samspelet uppläggning och interiör. Margareta gillar indisk mat och sydfranska fruktiga viner. Det går bra med italienska viner också. I själva verket det mesta. Bara det är bra mat. Men hon får något speciellt i blick och röst när hon kommer in på nykokt hummer med fransk dragon och lite smör. Hon är nämligen bördig från västkusten vid det salta västerhavet – och sprungen ur en företagarsläkt. Tro det!


Vill ni ha lojala kunder? Tror du att din förmåga att kommunicera har påverkan på resultatet? Om du svarar ja på dessa frågor är Reffekt företaget för dig. Vi är R-licensierade med stark värdegrund som hjälper dig att sälja. Detta gör vi på två sätt. Vi kan utbilda dig och vi kan sälja åt dig. Reffekt kan hjälpa människor att kommunicera så att andra känner sig delaktiga och förstådda. Innebörden av detta blir en effektivare försäljning och påverkar lönsamheten positivt på lång sikt. Ring oss på 019-506 11 00 så svarar vi på dina frågor.

Micael Jönsson & Marie Ström

Varmt välkommen med ditt samtal.

www.reffekt.com • telefon: 019-506 11 00 Nästan hälften* av alla vuxna svenskar går och bär på onödiga kilon. På Itrim gör vi något åt den saken. Våra kunder går i snitt ner 10,8 kg de tio första veckorna, ett resultat som består i både ett och två år. Det gör oss till världsledande inom varaktig viktminskning. Gör Itrim-testet och ta reda på vad du går och bär på.

EVA LUNDIN -25 KG HAR BEHÅLLIT SIN NYA VIKT I 2 ÅR

*37% AV ALLA KVINNOR, 53% AV ALLA MÄN (SCB 2011)

Itrim Örebro, Rudbecksgatan 52 F (Behrn Arena) 019-18 22 00, orebro@itrim.se, itrim.se/orebro

tet Gör Itrim-tesu d d a v och se på! går och bär

Ta med annonsen så bjuder vi på startavgiften!


Bokmalen

3096 dagar

Utpressningen

Du gamla, du fria

Axess

Natascha Kampusch Bonnier Pocket

John Grisham Bonnier pocket

Liza Marklund Piratförlaget

#9 Axess Publishing AB

Natascha Kampusch är österrikiskan som 1998, tio år gammal, blev överfallen och bortförd av Wolfgang Priklopil och sedan gömdes i en källarhåla i åtta år. Den här boken handlar både om hennes tidiga barndom och åren i fångenskap. Hon fördrev en stor del av sin tid som undangömd med att skriva dagbok och hon dokumenterade också sina skador. Därför är hennes upplevelser skildrade med ackuratess. Hon berättar allting sakligt och beskrivande, men jag blir ändå riktigt illa till mods. Natascha berättar att hon misshandlades både fysiskt och psykiskt av gärningsmannen – som hon boken igenom kallar Priklopil – och hon var så totalt isolerad i sin håla att jag själv känner cellskräcken komma krypande. Du som redan har fullt utvecklad klaustrofobi bör definitivt inte ta dig an 3096 dagar. Sedan jag började läsa den här boken har jag faktiskt tänkt på Nataschas upplevelser varje dag, jag blev så berörd av hennes berättelse. Till slut blir hennes räddning att hon redan innan bortförandet lovat sig själv att flytta hemifrån, att göra sig fri från vuxna som bestämmer över henne, när hon blir myndig. Det löftet har också stor betydelse för att hon överhuvudtaget ska överleva. Trots att den som berövat henne hennes frihet bryter ner hennes självkänsla ganska rejält har hon till slut modet att fly. //CB

"Omöjlig att lägga ifrån sig", sägs det att New York Times skribent sa om den här boken. Det är en ren lögn. Det här är John Grishams tjugoförsta bok, troligtvis en av de fem-sex sämsta, och man behöver inte läsa den om man har bättre saker för sig. Det har man oftast. Utpressningen handlar om soon to be-advokaten Kyle McAvoy som hamnar i trubbel när han blir utpressad av den mystiska mannen Bennie visar Kyle en video som visar en händelse Kyle hoppades skulle vara bortglömd, en natt några år tidigare då Kyle var skitfull och däckade medan två av hans skitfulla vänner hade sex med en skitfull tjej. Tjejen hävdade senare att hon blev våldtagen men det blev aldrig något åtal. Bennie hotar Kyle med att skicka videon (som skulle kunna sätta Kyles vänner i klistret med rätt/fel jury) till åklagare, då skulle Kyles rykte vara förstört, då skulle han aldrig få jobb på en toppbyrå. Så Kyle går med på att göra som Bennie säger - nämligen att ta jobb på en stor byrå som precis börjat representera ena parten i en gigantisk rättstvist rörande militär teknik. Sen ska han, naturligtvis, börja stjäla hemligheter. Det är en utfyllnadsbok - aldrig speciellt spännande och aldrig speciellt engagerande. //JK

Jag har de senaste åren inte varit samma Liza Marklund-entusiast som jag var när hennes tre första Annika Bengtzon-deckare kom ut. Men att jag inte faller för Du gamla, du fria beror inte så mycket på mig: Liza Marklund verkar ha tappat stinget. Intrigen där Annika Bengtzons man Thomas blir kidnappad engagerar inte, jag bryr mig inte om huruvida han kommer helskinnad hem eller ej; alla egoister som befinner sig i Annikas omgivning känns bara klyschiga. Annikas bekymmer engagerar nästan lika lite som Thomas väl och ve; spänningen kunde varit större. Kort sagt: det här är ingen bra Liza Marklund-bok. Det kvinnomord som sker i bokens början skulle kunna vara huvudstory, men det blir bara en parentes. Istället handlar det mest om att Thomas och sex européer till blir kidnappade i Kenya där de befinner sig på konferens. Och det är upp till Annika och statssekreteraren Jimmy Halenius att få Thomas fri. Medan Halenius sätter upp sambandscentral i Annikas sovrum försöker Annika få tag på pengar till lösensumman. Thomas upplevelser ur hans perspektiv får vi också följa och det är inget för den kräsmagade (mask i maten, likvätskor etcetera). Marklund lyckas informera om situationen i delar av Östafrika och även påminna om kvinnofridsbrott, men så mycket mer än det får jag inte ut av den här boken. //CB

Antalet gånger jag sett ett helt program på tv-kanalen Axess kan räknas på ena handens fingrar. Det räcker faktiskt att räkna mittenfingret: ett. Det var filmatiseringen av Dostojevskis Bröderna Karamazov jag tog mig igenom – en film tar förvisso inte lika mycket tid i anspråk som en tegelsten till bok. Jag finner med andra ord Axess TV lite för intellektuell (i betydelsen tråkig) för min smak. Samma sak med tidningen Axess. Jag skulle gärna vilja vara den personen som ser fram emot att läsa varje nummer. Och egentligen är innehållet ganska intressant när jag väl läser den. I det här numret är temat Dante Alighieris Den gudomliga komedin och dess relevans idag och texterna är intressanta (om än innehåller en del svåra ord). Och Horace Engdahls text om litteraturprofessorn som gjorde Horace till den han är är riktigt fängslande. För att illustrera typen av människor som läser Axess, så att du vet om du bör vara en av dem, tänkte jag förmedla ett par citat från insändarsidan. Tycker du att "Jag efterlängtar i landet en tung klassisk bildning i målerisk gestaltning, lodet ner mot djupet, som endast en med stor möda tillägnad habilitet kan placera ut." eller "Först ska det sägas med eftertryck: Ett alltför konstlat språk är ett otyg." är något du skulle kläcka ur dig är det bara att go for it och starta en prenumeration. //CB

Text Catharina Bergman & Jonas Källgren

50 Marknad


HÄR BLIR DRÖMMAR LEVANDE! KONFERERA I EN GENUIN OCH PRISBELÖNT MILJÖ. Håll era konferenser och kurser hos oss! Vi är flexibla och ger personlig service och är här för att uppfatta era behov och göra vårt bästa för att vistelsen hos oss ska bli en minnesvärd upplevelse. Här kan du uppleva äventyr och vildmark eller låta oss göra ditt bröllop eller fest till något utöver det vanliga. Här i Bredsjö finns möjligheten att disponera två vackra Herrgårdar, den ena från 1760 och den andra från början av 1900-talet. Vi är lyhörda för våra gästers behov och lovar att göra era drömmar levande. TEL: 0587-802

00

WWW.BREDSJOHERRGARDAR.SE INFO@BREDSJOGARDEN.SE HÄLLEFORS

Vi erbjuder: • All typ av städning • Hemstäd allt inom RUT • 50% direkt på fakturan • Vi erbjuder även • Bygg- och kontorsstäd • Fönsterputs • Golvvård

Sweeplet HB Ring 0736-26 26 76

Vill du snabbt öka din likviditet?*

e-post: info@sweeplet.se

Försäljning, installation och service av IVT värmepumpar * Vi köper dina fakturor!

EKV Energi AB Idrottsvägen 31 B, 702 32 Örebro Tel. 019-16 75 90 • www.ekvenergi.se

Du får pengar på dagen. Ring 019 – 15 95 60 www.chieffinancial.se


cmyk

BusinessMatch inför ett fjärde aktivitetsfyllt år Text Camilla Johansson

Tre år har gått sedan BusinessMatch först såg dagens ljus, och sedan dess har det gått framåt och uppåt. Tanken om det mindre nätverket som underlättar nära relationer består och för att stärka kontakterna har man under det gångna året utökat träffarna med det mycket populära Club BusinessMatch. Att bara förmedla datum för träffar är inte alltid det bästa sättet att faktiskt få folk att träffas. Företagare är ofta upptagna och att hitta en lucka för att gå på ett nätverksmöte kanske inte alltid har högsta prioritet bland allt annat som måste göras. Därför är det viktigt med bra substans på nätverksträffarna, så som bl. a goda relationer och givande aktiviteter. Det har nätverket BusinessMatch tagit fasta på.

Fler träffar för medlemmarna Therése Hedén och Sven-Erik Jungander är initiativtagarna till BusinessMatch

52 Marknad

och har under åren arbetat upp konceptet till vad det är idag. Och idag har man även hjälp av Ulrika Persson som startade i september och är ett välkommet tillskott i styrkan på kontoret på Järntorgsgatan. Hennes arbete har bland annat inneburit tid till just den personliga kontakten inför och under de möten som erbjuds inom nätverket. – Vi upptäckte att endast företagsbesöken som vi tidigare hade inlagda i vår aktivitetsplan inte var riktigt tillräckligt för att medlemmarna i nätverket skulle få chans att lära känna varandra, som ju hela tiden varit det vi velat uppnå. Därför började vi med Club BusinessMatch. Club BusinessMatch innebär att nätverket träffas kvällstid en gång i månaden, under avslappnade former där innehållet under kvällen kan vara någon form av aktivitet, att medlemmarna själva presenterar något intressant material samt mingel med förtäring, berättar SvenErik Jungander.

Under det gångna året har Club BusinessMatch bland annat innefattat whiskyprovning, intressanta föredrag, teambuilding och studiebesök. I mars är det dags för en ”After Ski” på Kilsbergen Konferens & Lodge. Med andra ord träffar att komma till utan några större krav som att umgås och ha trevligt och som bonus knyta kontakter som kan vara gynnsamma för det egna företaget.

Golf i augusti Året är även fyllt med andra aktiviteter, så som det månatligen förekommande företagsbesöket då ett medlemsföretag får tillfälle att presentera den egna verksamheten för de övriga deltagarna under en trevlig frukoststund. Bland de medlemsföretag som i nuläget är inbokade för företagsbesök finns Workzone i slutet av februari, Beijer Byggmaterial AB i mars, NeH Direkt AB i maj och TD Fiberoptik i september.

Naturligtvis blir det även i år BusinessMatch Open där man som medlem i nätverket blir medarrangör. Man kommer att fortsätta avsätta dagar för andra organisationer och samarbetspartners, 2011 var det Företagarna som hade sin egen dag. I år går evenemanget av stapeln något senare under augusti månad än tidigare år, och för de som känner sig hugade gäller det att ha golfklubbor och bollar polerade och klara till den 30:e augusti. Sista anmälningsdag infaller dock något tidigare. – Vi byggde ju nätverket på sätt och vis kring golfen, men det är ju inte alla som spelar golf, och detta faktum ska ju inte på något vis ses som en anledning att inte gå med i nätverket. Vi kommer även i år, den 3:e juni, att göra en resa till Åland, där det finns, utöver nätverkandet, möjlighet att antingen spela golf eller följa med på en utflykt för de som inte är golfintresserade. Förra året gjorde vi ett mycket


cmyk

Affärskällan i Bergslagen I hĂśst, den 11:e november närmare bestämt, kommer aktiviteten â&#x20AC;?En källa fĂśr Affärerâ&#x20AC;? äga rum vid Loka Brunn. Under avslappnade former, där kostym är strängt fĂśrbjudet, kommer mĂśjligheter till erfarenhetsutbyten, inspiration och nya perspektiv att ges tillsammans med kreatĂśrer pĂĽ olika omrĂĽden. Vistelsen kommer att avslutas med middag och Ăślprovning, och fĂśrhoppningen är att deltagarna ska resa hem med känslan av att ha fĂĽtt bĂĽde kunskap inom nya omrĂĽden samt nya kontakter. â&#x20AC;&#x201C; Vi hoppas kunna fĂĽ besĂśk av olika intressanta fĂśredragshĂĽllare och fĂśretagsledare som kan inspirera och entu-

siasmera, säger Sven-Erik Jungander. Till detta evenemang, sĂĽ som ofta har varit brukligt hos BusinessMatch som vid Ă&#x2013;rebrogalan, BusinessMatch Open och den tidigare Hindersrocken, är medlemmarna välkomna att bjuda in en affärspartner/gäst som inte tillhĂśr nätverket, fĂśr att pĂĽ sĂĽ sätt bredda kontaktytan och därmed Ăśppna fĂśr ytterligare nätverkande. Idag är antalet medlemmar runt 50 stycken, och mĂĽlet är att detta antal ska Ăśka till 100 stycken, ett antal man ser som en Ăśnskvärd Ăśvre gräns. â&#x20AC;&#x201C; När ett medlemsantal Ăśverstiger 100 sĂĽ blir det inte längre personligt. Det blir svĂĽrare att knyta kontakter och lära känna varandra. I dagsläget har vi mĂĽnga tjänstefĂśretag med bland vĂĽra medlemmar sĂĽ vi ser gärna medlemmar frĂĽn andra branscher fĂśr att bredda kontaktomrĂĽdet, konstaterar SvenErik Jungander.

www.npp-reklam.se

omtyckt besÜk till en dykare som var med när det hittades gamla champagne flaskor pü ett skeppsvrak utanfÜr den üländska kusten, berättar Sven-Erik Jungander.

NU Ă&#x201E;R DEN HĂ&#x201E;R, BOKEN FĂ&#x2013;R DIG SOM VILL FĂ&#x2026; FART PĂ&#x2026; AFFĂ&#x201E;RERNA.

BesÜk www.par.se fÜr att skaffa ditt eget exemplar och fÜr att läsa om hur vi hjälper dig att behülla, utveckla och hitta nya kunder.

VI HJĂ&#x201E;LPER DIG BEHĂ&#x2026;LLA, UTVECKLA OCH HITTA NYA KUNDER. Telefon 019-21 70 40 | www.par.se | info@par.se

(ELAäNÂ&#x161;JESPARKENänäINTERNET äTVä OCHäTELEFONIänäIäENäENDAäläBER Dä KABELä.JUTäAVäETTäÂ&#x161;PPETäNĂ&#x2DC;TäME FRIäKONKURRENSäOCHäBRAäPRISER +OLLAäINäALLAäDINAäNYAäMÂ&#x161;JLIGHETERä PäSTADSNATSE

Nummer 2 2012 53


CYAN MAGENTA GUL SVART

Foto richardstrom.com

Foto richardstrom.com

Hur är läget?

Text Camilla Johansson

Lisa Vaahto på designbutiken Huldas som de senaste två åren huserat på Stallbacken och nu flyttar till Nettoköps gamla lokaler på Kungsgatan 19.

Martin Karaga, vd på på Koneo där man det senaste året gjort en satsning på IT-utveckling med bredare lösningar för kunderna.

Emma Makdesi, designer och inredare på LL Design, som kryddar arbetet här hemma med uppdrag ute i Europa.

Hur går det? – Det går bra, nu har vi utförsäljning inför flytten till vår nya lokal. Vi kommer att ha ett nästan dubbelt så stort utrymme som vi har idag.

Hur går det? – Det går jättebra! Vi har dragit igång en IT-satsning som fungerar bra, och vi har gått från 2 till 5 anställda på IT-sidan. Nu är vi totalt sexton stycken som arbetar här. Vi har ju varit ett kopieringsbolag, men nu har vi fått en helhetslösning som vi kan erbjuda kunderna.

Hur går det? – Det går bra. Jag designar de flesta tyger som vi säljer, och hittar min inspiration så väl under en promenad i skogen som genom att studera gamla tyger för att i dem hitta början till en ny design att utveckla. Vi har tagit fram ett tredimentionellt tyg, och det säljer vi till återförsäljare runt om Sverige. Våra textilier har blivit över förväntan populära.

Vad satsar ni på framåt? – Med större utrymme att förfoga över i den nya lokalen kommer vi att satsa mer på inredningsdetaljer, både i mer personlig stil och med industrikänsla. Det verkar som det romantiska, men lite rysch och pysch är på väg bort nu, och inredningsstilen blir mer stram och ren. Vad kan vi förvänta oss? – Som kund kan man förvänta sig produkter som vågar sticka ut och vara sig själva. Man kan också förvänta sig mycket färg, samtidigt som den kommande trenden är mer strikt än vad vi tidigare sett. Kunderna har tröttnat på det romantiska.

54 Marknad

Vad satsar ni på framåt? – Vi satsar på att se helhetslösningar för kundens behov. Tidigare har vi sålt dokumentlösningar, men nu kan vi också erbjuda scanningslösningar. Vi försöker hitta lösningar som minskar antalet hyllmetrar med pärmar på ett kontor. Genom scanningslösning kan man göra dokumenten sökbara på den egna datorn. Det ska vara lika lättarbetat som att söka på Google. Vad kan vi förvänta oss? – Som kund kan man framför allt förvänta sig att vi jobbar långsiktigt. Vi ser varje kund som ett livslångt åtagande, och med den närhet vi har skapar vi långa relationer.

Vad satsar ni på framåt? – Vi vill utveckla rörelsen och satsa mer på inredning av offentlig miljö. Jag har projekt på gång i både Bulgarien och Italien där jag ska inreda gallerior samt utbilda personal att fortsätta med det koncept vi utvecklar. Det är en intressant utmaning. Vad kan vi förvänta oss? – När jag gör inredningsuppdrag; att jag lägger ned tid på att ta fram en stil som passar just den kunden. Ingen kund är den andra lik, och det är roligt att hitta just rätt för den som anlitat mig. Att se vad man kan göra. Jag använder mig av den erfarenhet jag lagrat genom åren, då jag bland annat jobbat tolv år som florist. Även den kunskapen kommer till användning vid inredning.


Företagarna – för bättre affärer Så har vi påverkat!

Bestrid bluffakturorna

RUT skapade 800 företag och 1000 nya jobb under 2011 Företagarnas beräkningar visar att RUT-avdraget har skapat drygt 1000 nya arbetstillfällen under 2011 och antalet företag som är verksamma på RUT-marknaden nu är fler än 14300 stycken. I Norrbotten ökar användningen med 28 procent, vilket är snabbast i landet.

Hela 16 procent av småföretagarna i Sverige har drabbats av bluffakturor, enligt Företagarnas senaste Småföretagsbarometer. Nu får företagare chansen att diskutera bluffakturor när Företagarna lanserar facebooksidan Bestrid bluffakturorna. Läs mer på: www.foretagarna.se

Läs mer på: www.foretagarna.se

Vi hjälper dig med juridiken Frukostmöte 14 februari Missa inte, frukostmötet 14 februari på Hotell Clarion. Möt företag och företagare och nätverka tillsammans. 07.15 börjar mingel, frukost och senare program och håller på till 09.00. Anmälan sker på www.frukostmotet.se Som vanligt är Julia Rosqvist Konferencier.

Du kan ringa till Rådgivningen Bas och få råd av juristerna på Företagarna om hur du ska lösa olika juridiska problem. Telefonrådgivning kostar ingenting extra utöver medlemsavgiften i Företagarna. 3 Ring 0771-45 45 45 så hjälper vi dig.

DE TTA FÅR DU SOM MED D LE M

Läs mer på: www.foretagarna.se

Nätverk Företagarna är med och arrangerar 8 företagsfrukostar runt om i vårt län varje månad Du blir inbjuden till många av sveriges bästa och största evenemang, exempelvis Båstad tennisen, Almedalen, Vätternrundan, Pridefestivalen

Medlemsförmåner Kostnadsfri juridisk rådgivning Företagsförsäkringar 10% rabatt på BMW och Toyota med många flera

Joakim Bäck Regionchef Mobil 070-190 47 77 joakim.back@foretagarna.se www.foretagarna.se

Näringslivsfrågor som vi varit drivande i: Sänkning av aktiekapital vid start av aktiebolag från 100.000 till 50.000 Slopande av revisionsplikten ROT och RUT T är fortfarande kvar

”Gör företagandet lättare”


CYAN MAGENTA GUL SVART

POSTTIDNING AVSÄNDARE: HKM, Näbbtorgsgatan 2, 702 23 ÖREBRO

Örebro Konserthus Fre 27 april 19.30 Bilj: Örebrokompaniet 019-21 21 21, Ticnet 077-170 70 70, www.ticnet.se samt Ticnet- och ATG-ombud. www.lifeline.se

www.roaproduktion.se


Marknad 2-12