Page 1

5-2014 www.batitech.ch

ELECTROTECHNIQUE

40 I Vérification de la chute de tension 46 I Tornade en Suisse 50 I Le bois pour la transition énergétique


TOSHIBA Climatisation

Chauffage par pompes à chaleur

Refroidissement temporaire

Froid à sorption

Trop chaud? Nous rafraîchissons votre climat. Des températures excessives diminuent le bien-être et le rendement. Nos climatiseurs TOSHIBA de la classe d’efficacité énergétique A veillent à un climat optimal au travail, dans les locaux de serveurs et à la maison. Des installations à sorption modernes et notre chauffage par pompes à chaleur air-eau TOSHIBA complètent l’offre rafraîchissante de Krüger. Pour les tentes de fêtes et halles de grand volume, nous utilisons nos puissants agrégats Rooftop proposés en location. Intéressé? Rafraîchir, déshumidifier, chauffer ou assainir, Krüger dispose d’une solution optimale pour tous les climats. Krüger + Cie SA ⁄ 1072 Forel ⁄ T 021 781 07 81 ⁄ forel@krueger.ch ⁄ www.krueger.ch

déshumidifier chauffer rafraîchir assainir


éditorial

bâtitech 5-14

Jeter ou faire du neuf avec du vieux? Aujourd’hui nous sommes arrivés au point où

pas en phase avec les canons ressassés dans le

quand un appareil ne fonctionne plus, il est plus

monde professionnel. Une entreprise qui prospère

simple, voire moins cher de le jeter pour le rem-

et innove est donc sensée faire du neuf avec du

placer par du neuf, que d’investir de l’énergie et du

neuf. Paradoxalement, le fait de savoir faire du

temps à le réparer.

neuf avec du vieux est de plus en plus reconnu

Cette expérience, la plupart d’entre nous la font.

comme étant une qualité. Les électriciens eux, sa-

C’est parfois avec un soupir que l’on jette un objet

vent faire! On leur reproche souvent leur côté con-

et que l’on se sent obligé d’acheter du neuf. Le

servateur, cette facette est logique, voire salutaire

geste est devenu habituel, on l’effectue sans être

quand il s’agit de sécurité. En effet, l’électricien est

trop accablé par des questions.

tenu de respecter des normes et des directives bien

Pourtant, la notion d’obsolescence programmée

en place. Notre rubrique Know-How NIBT est tout

des produits et de l’accélération du remplacement

à fait en phase avec cette réalité et notamment avec

des matériels techniques et technologiques fait

les questions émanant du terrain et relatives à la

également l’objet de réflexions et de remises en

modernisation des installations. Elle apporte des

questions. L’affiche ci-dessus trouvée sur le site

réponses avisées à ces questions, de même que les

commentréparer.com donne matière à réflexion et

analyses contenues dans notre partie technique.

suscitera assurément des réactions.

Depuis l’invention des outils et de la technique, on

En ce qui nous concerne, nous souhaitons évoquer

modernise, on progresse, c’est un vieux sujet. C’est

le sujet de la rénovation de bâtiments. Sont con-

avec plaisir que nous y revenons et reviendrons, en

cernés les installations et le matériel d’installation

jetant encore, en jetant à chaque fois … un regard

électrique. Ces produits figurent parmi ceux qui

neuf.

ont toujours été fabriqués pour durer et cela reste

C’est sûr, celui-là ne sera jamais jeté à la poubelle!

le cas pour la plupart d’entre eux. Compte tenu de la taille du parc de bâtiments à rénover en Suisse, le thème du remplacement du matériel est d’actualité et revêt une importance cruciale. L’installation électrique fait partie des éléments à traiter en priorité, puisqu’il s’agit du «système nerveux» du bâtiment. Et se pose inévitablement la question: «on laisse ou on remplace?». Par principe, faire du neuf avec du vieux libère une connotation négative, un «côté défensif» qui n’est

Pierre Schoeffel Rédacteur électrotechnique pierre.schoeffel@keyboost.ch

1


2

bâtitech 5-14

sommaire actuel I 10

actuel www.batitech.ch

4 Système de guidage pour les évacuations de sécurité 6 Journée professionnelle 10 Le mouvement de l’eau est toujours exploré 12 La baignoire et rien que la baignoire 14 Nouveau siège principal 16 Technique de maintien de pression et d’expansio 18 Gamme de services complète et compétence locale

produits I 32

32 La nouvelle génération d’appareils pour l’aération douce d’Oertli 33 Système L-ROC de Loytec 34 DEHNcare protège contre les arcs électriques parasites 35 Détecteur de mouvement à poussoir de commande 36 Plus sobre, plus mince, plus élégant 37 Distributeurs de courant et plus … Edition 2014 38 Enregistreur de données compact pour la gestion de l’énergie

produits Nouvel assortiment de pompes à chaleur Oertli La nouvelle génération de pompes à chaleur Oertli saura répondre de façon optimale à vos exigences et vos besoins, grâce à son assortiment large et complet. Walter Meier (Climat Suisse) SA Z.I. de la Veyre B, St-Légier CH-1800 Vevey Téléphone 021 943 02 22 ch.climat@waltermeier.com waltermeier.com Profi-Shops Chauffage Bâle, Berne, Coire, Fribourg, Genève, Hunzenschwil, Kestenholz, Lumino, Neuchâtel, Oberbüren, Romanel, Sion, Vevey, Winterthour, Zurich

20 Changement des générations de compteurs 21 Ventilation par refoulement dans les stands de tir 22 La lumière comme élément de design 23 L’installation sans problème 24 Retrofit pour l’assainissement d’anciennes installations de ventilation 25 Nouvelle pompe à chaleur gaz pour bâtiments de moyenne et grande taille 26 La cerise sur le gâteau 28 Radiateur «Duolino» 29 Portes de révision à encastrer dans maçonnerie ou gaines 30 Nouvelle pompe à chaleur air/eau à technologie Inverter

partie technique 40 Vérification de la chute de tension 42 A remplacer ou non? 46 Tornade en Suisse 50 Contribution du bois lors de la transition énergétique

exposition 55 39e Mostra Convegno Expocomfort

associations 56 Congrès annuel du groupe professionnel Technique


sommaire partie technique I 46

bâtitech 5-14

carnet I 67

formation 58 Know-how NIBT 14 61 Brain Food

carnet 63 Solar Impulse – et l’impossible devient possible 64 Comment du pétrole bon marché se transforme en essence chère 66 Nouveau PROFI-SHOP à Fribourg 66 Deux prix internationaux pour le nouveau parc aquatique 68 Prévention et gestion des déchets de chantier 68 Succès de la Foire des Machines de Chantier 69 Travailler par de fortes chaleurs

swiss perfection

swiss perfection

swiss perfection

swiss perfection

thePrema P360 KNX – une excellente puissance Le nouveau détecteur de présence KNX - Extraordinaire avec ses trois mesures de luminosité et ses deux réglages indépendants de communication ou de lumière constante - Economique grâce à ses fonctions de stand-by et de présence à court terme - Extravagant avec ses canaux supplémentaires - Génial par la détection carrée et la possibilité de montage jusqu’à une hauteur de 10 m

www.theben-hts.ch

thePrema P360 KNX blanc | 535 833 061

3


4

bâtitech 5-14

actuel

Pictogrammes et rubans photoluminescents

Système de guidage pour les évacuations de sécurité Un plan d’évacuation d’urgence donnant lieu régulièrement à des exercices de simulation, vous permet de faire sortir rapidement et en toute sécurité votre personnel en cas de coup dur. Lorsque tout un immeuble de bureaux ou une usine de production se retrouve dans l’obscurité, la présence d’une signalétique de sécurité parfaitement visible telle que pictogrammes et marqueurs, augmente les chances d’évacuer tout le monde sans dommages. «En étant judicieusement placée, une signalisation de sécurité de haute qualité continuera à briller afin de guider à travers le site les pompiers faisant face à la catastrophe en cas de panne de courant générale», explique Dominique Roosen, responsable produits EMEA Sécurité & Solutions d’identification des locaux de Brady Corporation, un fabricant et distributeur international de matériels de signalisation de sécurité. Choix d’une classe de photoluminescence Les matériaux photoluminescents se répartissent en différentes catégories (ou classes) en fonction de leur luminosité dans l’obscurité au bout de 10 et 60 secondes. La classe A regroupe les matériaux photoluminescents de base, présentant une restitution de 23 mcd/m² après 10 minutes et de 3 mcd/m² après une heure.

«La marque NiteGlo de Brady est une offre photoluminescente de classe B, avec une restitution de 50 mcd/m² après 10 minutes et de 7 mcd/m² après une heure. Notre marque XtraGlo est un matériau photoluminescent de classe C, avec 140 mcd/m² après 10 minutes et 20 mcd/m² après une heure dans l’obscurité.» «Les classes de photoluminescence donnent une vue d’ensemble claire de la qua-

lité disponible à la commande, en fonction de vos besoins. N’oubliez pas que de nombreux pays ont édicté des lignes directrices ou adopté des normes réglementant la luminescence minimale de la signalisation de sécurité photoluminescente», souligne Dominique Roosen. «Brady peut vous aider à choisir la classe de photoluminescence la mieux adaptée à vos besoins.»

«Un matériau photoluminescent de haute qualité brille encore suffisamment au bout d’une heure dans l’obscurité pour guider les pompiers à travers vos locaux.» Dominique Roosen

Systèmes de guidage pour cheminements d’évacuation de sécurité La signalisation de sécurité photoluminescente ne nécessite ni alimentation électrique, ni inspection ni maintenance.

«Les matériaux photoluminescents sont mentionnés dans les normes ISO 16069, ANSI et DIN 67510, visant à la standardi-


actuel

sation des systèmes de guidage pour cheminements d’évacuation de sécurité à travers le monde. L’ISO 16069 énonce les principes généraux applicables aux composants aussi bien électriques que photoluminescents. Elle fournit des informations spécifiques liées au type de composant, afin de contribuer à définir l’environnement d’utilisation, le choix de matériau, l’implantation, l’installation et la maintenance.» Dans certains cas, la signalisation électroluminescente peut s’utiliser en combinaison avec des éléments électriques. Les matériaux électroluminescents offrent en plus l’avantage de ne pas induire de coûts supplémentaires en inspection et maintenance.

Matériaux de signalisation photoluminescente «Chez Brady, nous proposons plusieurs matériaux de signalisation électroluminescente. Le choix du matériau est fonction de l’endroit où vous souhaitez apposer votre signalétique de sécurité.» Polyester adhésif: «Ce matériau est facile à appliquer et suffisamment fin pour les panneaux de sécurité de faibles dimensions. Le polyester adhésif nécessite une surface d’adhérence propre pour la fixation de la signalétique de sécurité.» Polypropylène rigide: «Le polypropylène rigide est utilisé pour les plus grands panneaux de sécurité, tels que les symboles d’issue de secours dans les salons professionnels. Il est essentiellement destiné à un usage intérieur. Le matériau standard n’est pas adhésif, mais peut se fixer sur des surfaces plus rugueuses à l’aide d’une colle bien adaptée.» Aluminium: «L’aluminium est à usage essentiellement extérieur et s’avère également très pratique sur les panneaux magnétiques ou sur les machines.» D’autres matériaux, comme le polypropylène adhésif, sont aussi proposés.

Meilleures pratiques d’applications photoluminescentes Une signalisation de sécurité photoluminescente bien placée dans un couloir, un atelier de production, un espace de bureau ouvert ou une vaste zone, couvre trois hauteurs. La signalisation au sol de type ruban photoluminescent indique au personnel le chemin de la sortie en cas d’accumulation de fumée ou d’incendie. Fixée au ni-

bâtitech 5-14

«Une signalisation de sécurité photoluminescente bien placée couvre trois hauteurs.» Dominique Roosen

Cet escalier et cette sortie de secours font courir de grands risques en cas d’évacuation dans l’obscurité.

et formes photoluminescentes sont placés à hauteur idéale de lecture. La signalisation en hauteur, à plus de 1,80 m, permet au personnel de repérer de loin la sortie de secours la plus proche. Elle aide aussi à garder son calme et son sang-froid car elle reste visible, y compris lorsque des centaines d’employés se ruent tous en même temps vers la sortie la plus proche. Une fois ces trois hauteurs couvertes, veillez à baliser clairement les obstacles ou les allées de dégagement, au moyen de rubans, formes ou accessoires photoluminescents. Le personnel pourra ainsi, en cas d’évacuation, emprunter plus facilement les escaliers dans l’obscurité, en évitant les salles de réunion, le mobilier ou les piliers de bureaux, les machines des zones de production, de façon à réduire les risques de blessures provoquées en tombant ou en heurtant des objets durs.

De brillantes étoiles de sécurité

Mais avec un marquage approprié, l’évacuation dans le noir sera rapide et sans incidents.

veau du sol ou du mur à une hauteur ne dépassant pas 40 cm, elle indique le chemin de fuite le plus direct, même s’il faut se pencher pour éviter d’inhaler une trop grande quantité de fumée. Brady recommande de marquer les deux côtés d’un couloir s’il dépasse deux mètres en largeur. La signalisation au niveau intermédiaire est placée entre 1,2 m et 1,5 m. Ces panneaux comportent davantage d’information, comme par exemple un plan indiquant où se trouve l’extincteur ou l’escalier le plus proche, le sens d’ouverture des portes ou l’emplacement de la trousse de premiers soins. Ces panneaux

La signalisation de sécurité photoluminescente de haute qualité s’utilise pour le marquage des obstacles et des allées de dégagement aux fins d’évacuation rapide. Elle brille toujours suffisamment au bout d’une heure dans le noir pour guider les pompiers à travers les locaux après évacuation du personnel. Les matériaux photoluminescents se chargent par exposition à la lumière (la source idéale étant la lumière du jour) et ne nécessitent ni inspection ni maintenance. Ils brillent dans l’obscurité et guident les personnes en toute sécurité vers la sortie, même en cas de panne de courant générale. Pour en savoir plus, n’hésitez pas à consulter notre site www.bradyeurope.com, ou à nous adresser un e-mail à emea_request@bradycorp.com pour recevoir notre brochure sur les panneaux et rubans photoluminescents. Brady B-9240 Zele Tél. +32 (0)473 78 49 37

5


6

bâtitech 5-14

actuel

Hoval

Journée professionnelle Depuis de longues années, Hoval, société familiale fondée en 1946, est présente au salon Habitat Jardin et invite le jeudi les installateurs, les bureaux d’ingénieurs et les services industriels à sa traditionnelle journée professionnelle d’information. Cette année, après la présentation des nouveautés de la société Hoval et Biral, les thèmes d’actualité abordés ont été le solaire thermique, la biomasse en Suisse et la présentation en avant-première de la nouvelle loi vaudoise sur l’énergie, qui sera mise en vigueur le 1er juillet 2014.

Jean-Frédéric Veith

UltraSol, le capteur solaire thermique Swiss Made Hoval qui se monte en un clip Après un café-croissant, Marc Tissot, adjoint à la direction Suisse romande, devant un parterre de 150 personnes, présente pour le premier thème de la journée les nouveaux capteurs Hoval UltraSol, le solaire Swiss Made qui se monte en un clip. Une rapide présentation du nouveau programme de capteur met en valeur ses spécificités techniques, sa faible épaisseur (57 mm) pour une intégration parfaite dans les toitures, sa robustesse, la possibilité de raccorder 12 capteurs sur un champ et surtout son système de raccordement à triple joint torique et clips. Un équipement complet qui permet un montage rapide et étanche dans toutes les situations.

L’évolution future du solaire thermique Martial Bujard, directeur de Swissolar Romandie, fait ensuite le point sur le marché du solaire thermique et donne quelques pistes pour redynamiser ce marché en Suisse. Il rappelle en préambule que l’énergie par m2 émise par le soleil au Sahara n’est que le double de celle émise sur le Plateau suisse (2500 kWh/m2 contre 1250 kWh/m2) et rappelle qu’un tiers de la surface des toits suisses est exploitable pour y installer du solaire. La vente des capteurs solaires thermiques stagnant ces dernières années à environ 140 000 m2 par an, un accroissement passera inévitablement par une diminution du prix des capteurs et par la bonne formation continue de tous les acteurs du solaire thermique en Suisse (les pros du solaire) pour garantir un fonctionnement optimal des installations.

Du soleil à l’eau

Stand Hoval.

C’est forcément Ulrich Lehmann, de la société Biral, qui présente les nouvelles directives européennes avec l’ECO Label applicable depuis le 1er janvier 2013 (IEE ⱕ 0,27) et celui en prévision du 1er août


bâtitech 5-14

Avant tout, demain aussi: une cuisine et une salle de bains de Sanitas Troesch.

Visitez nos expositions à Basel, Biel/Bienne, Carouge, Chur, Contone, Cortaillod, Crissier, Develier, Jona, Köniz, Kriens, Lugano, Rothrist, Sierre, St. Gallen, Thun, Winterthur et Zürich. Informations complémentaires sur: www.sanitastroesch.ch

Ruf Lanz

actuel

7


8

bâtitech 5-14

actuel

DataCenter. Une solution globale de filtration et de traitement de l’air, ProcessLine, pour les équipements industriels et toujours sa solution décentralisée pour chauffer, ventiler et rafraîchir des halles grâce à son diffuseur breveté Air-Injector à pulsion giratoire variable.

La biomasse, renouvelable, propre et disponible en Suisse Capteur solaire UltraSol,

2015 (IEE  0,23). Aujourd’hui Biral, société suisse basée à Münsingen, est fière d’annoncer que sa gamme de pompes à rotor noyés est ‹Best in Class› grâce à un IEE  0,20 beaucoup plus bas que la future directive 2015. Grande nouveauté également pour les pompes à rotor sec, elles peuvent recevoir le module VariA-E. Ce nouveau convertisseur de fréquence, de la même philosophie d’utilisation que celui de la ModulA, rendra vos anciennes pompes modulantes et économes en énergie. Grâce à son centre de formation ultramoderne, Biralcampus, les professionnels seront formés sur toutes ces nouvelles technologies du point de vue théorique et également pratique sur les bancs d’essais, inscriptions sur le site web de Biral ou chez Hoval.

Avant de passer la parole à Richard Golay, coordinateur Romandie Energie-bois,

que le matériel est encore en avance sur les normes. La politique bois énergie propre mise en place par l’agence est celle des quatre piliers: – une bonne planification et mise en œuvre des outils de l’assurance qualité – une optimisation du fonctionnement des installations – une nouvelle technique de séparation des poussières – le remplacement des vieilles installations.

Luis Marcos, Michel Lambelet, Ulrich Lehmann, Richard Golay, Martial Bujard (de gauche à droite).

Nouveautés Hoval 2014 La parole est redonnée aux ingénieurs conseils de la société Hoval, Marc Tissot, Cédric Mona et Jean Frédéric Veith, pour la présentation des nouveautés marquantes en 2014. Du renouveau de la MultiJet 12 (chaudière mazout inox à condensation de 12 kW) en passant par la nouvelle gamme de pompes à chaleur, la Bélaria AR (version compacte extérieure) et l’accroissement de la gamme HomeVent (aération douce) de 3 à 5 appareils pour des débits de 180 à 560 m3/h, c’est surtout sur les systèmes que Hoval a voulu marquer les esprits. En effet, pour rester fidèle à son leitmotiv «Responsabilité pour l’énergie et l’environnement», les différentes solutions présentées touchent des domaines très variés. Exemple: une solution globale pour le chauffage à distance avec la production de chaleur, d’électricité de distribution d’énergie décentralisée et surtout la régulation (Supervisor), le cœur du système. Une solution globale de climatisation, ServeLine, pour les

Hoval présente sa solution biomasse du silo à la chaudière en précisant que Hoval, par son service, est présent tant en assistance au montage qu’à l’entretiendépannage (TopSafe). La transition est toute trouvée car Energie-bois Suisse se positionne également comme un partenaire pour la promotion de l’utilisation énergétique judicieuse et efficace du bois. Ses informations, conseils et expertises aideront l’ensemble des clients et intervenants du chauffage à une utilisation optimale du combustible bois. Aujourd’hui sa part actuelle aux énergies renouvelables est de 4 % (8 % chaleur) et dans le cadre de la politique énergétique 2020, le but serait de passer à 6 % (12 % chaleur). L’objectif est de couvrir une part importante de la production de chaleur (20 à 25 %) grâce à l’efficience énergétique et aux progrès de la technique. Un petit rappel des normes des valeurs limites de l’OPair sur les rejets de particules fines, les taux de NOx et le CO pour conforter

La présentation se termine par une photo d’une jeune pousse d’arbre, clin d’œil à une bonne gestion de la forêt suisse, pour que ce combustible soit durable.

La nouvelle loi vaudoise sur l’énergie Pour le dernier thème, Michel Lambelet, directeur Hoval Suisse romande, remercie vivement la Direction générale de l’environnement d’avoir accepté de présenter la nouvelle loi vaudoise sur l’énergie et c’est M. Louis Marcos, architecte à la direction de l’énergie, qui entre directement dans le sujet. Après un bref rappel des enjeux énergétiques actuels, il présente les dispositions susceptibles d’influencer significativement la conception des installations de chauffage pour les permis de construire délivrés dès le 1er juillet 2014, que l’on peut résumer comme suit: 1. Pour les nouveaux bâtiments, obligation de couvrir au moins 20 % des be-


actuel

soins d’électricité (ménage) et 50 % de la consommation d’électricité des installations de ventilation de confort par une énergie renouvelable, dans la pratique des capteurs photovoltaïques (art. 28 b, al. 1, 2 et 3). 2. Pour les nouveaux bâtiments, l’obligation de couvrir au moins 30 % de la production d’eau chaude sanitaire par du solaire thermique ou photovoltaïque est maintenant étendue aux chaudières à bois de moins de 70 kW

bâtitech 5-14

9

Tous les bâtiments recevant un permis de construire à partir du 1er juillet 2014 devront donc répondre à ces exigences. M. Lambelet fait remarquer à M. Marcos qu’aux yeux des professionnels de la branche, la loi se concentre beaucoup trop sur les bâtiments neufs qui sont déjà soumis à de nombreuses exigences énergétiques. Actuellement, le grand potentiel d’économie d’énergie est à chercher dans les assainissements de bâtiments existants, dont se préoccupe malheureu-

Automatisation pour les plus hautes exigences

Solutions souples et durables pour l’automatisation des bâtiments, infrastructures et de l’énergie  Haute efficience énergétique  Technique d’appareils compatible et extensible  Modules de communication enfichables  Utilisation et maintenance simples

A+ + Apéritif dînatoire.

et aux chaudières de toutes puissances dans les zones soumises à immissions excessives (art. 28 a). 3. Pour les nouveaux bâtiments ou les extensions, les chaudières à mazout ou au charbon ne peuvent pas couvrir plus de 60 % des besoins de chaleur admissibles pour le chauffage (art. 30 b, al. 2). 4. Lors de la vente d’un bâtiment d’habitation, le propriétaire a l’obligation de faire établir à ses frais un certificat énergétique cantonal du bâtiment (CECB) et de le communiquer à l’acheteur. L’établissement d’un CECB n’est lié à aucune obligation d’assainissement (art. 39 a). 5. Lors du remplacement d’une installation de chauffage par une nouvelle installation fonctionnant au gaz, au mazout ou au charbon, le propriétaire doit faire établir à ses frais un certificat énergétique cantonal du bâtiment (CECB) (art. 30, al. 4).

Moniteur énergétique SBC

sement très peu la loi. Il rappelle également que notre premier but doit être l’économie d’énergie en améliorant l’isolation des bâtiments existants. Moins nous consommerons d’énergie, moins nous devrons substituer d’énergies fossiles par des énergies renouvelables. La meilleure énergie restera toujours celle qu’on ne consomme pas! Après de nombreuses questions et réponses avec les différents intervenants, Michel Lambelet remercie vivement tous les orateurs pour leurs claires et intéressantes présentations et convie l’ensemble de l’assemblée à un apéritif dînatoire amplement mérité.

Automate Saia PCD3

Compteur d’énergie SBC

Hoval SA CH-1023 Crissier Tél. 848 848 363 www.hoval.ch

Saia-Burgess Controls AG Bahnhofstrasse 18 | 3280 Murten, Suisse T +41 26 672 72 72 | F +41 26 672 74 99 www.saia-pcd.com | info@saia-pcd.com


10

bâtitech 5-14

actuel

Thomas Baettig, directeur de Hansgrohe, s’attend à une poursuite de la croissance

Le mouvement de l’eau est toujours exploré Interview: Franz Lenz Monsieur Baettig, Hansgrohe Suisse a été fondé il y a 22 ans, en 1992. A cette époque, plusieurs fabricants s’étaient divisé le marché suisse. Je suppose que ce n’était pas facile de réussir en Suisse, avec une marque étrangère? Thomas Baettig: Vous avez raison; en 1992, ce n’était pas une sinécure de s’immiscer parmi les acteurs locaux déjà bien organisés et il fallait des offres très spéciales pour être recommandé en tant qu’alternative. Nous avons appris, dès le premier instant, que pour avoir des chances de réussir, nous devions dynaThomas Baettig: «Hansgrohe n’a jamais cessé de réinventer le mouvement de l’eau, et il est arrivé à des solutions étonnantes, intelligentes et économiques qui ont été incorporées automatiquement dans nos gammes de produits et, plus tard, parfois dans celles de nos concurrents.»

miser la demande elle-même. Mais ce qui était déjà vrai hier l’est dans la même mesure aujourd’hui. La gamme des produits offerts était-elle égale et complète, ou bien Hansgrohe estil venu en Suisse avec des produits tests? Au début, nous avons délibérément mis l’accent sur les assortiments pour lesquels nous étions déjà connus et reconnus, c’était le cas des pommes de douche, de la robinetterie, puis avec des collections dont la sélection stéréotypée avait des fonctionnalités et un design en vigueur à ce moment-là.

Dans cinq ans, Hansgrohe Suisse se voit comme leader du marché dans le secteur des pommes de douche.

Quel est votre impact sur l’assortiment aujourd’hui ? Est-ce que, maintenant, le programme complet de la société-mère est repris ou existe-t-il une ligne suisse? Comme chaque marché, même à l’intérieur de l’Europe, est tout à fait différent, Hansgrohe a une grande variété de produits, qui, en principe, est également disponible pour nous. Cependant, nous nous limitons volontaire-

ment à des produits – des lignes de produits – pour lesquels nous voyons un marché. Il y a aussi un grand nombre de produits spécifiques à la Suisse, nous permettant de répondre aux standards des normes. Comment évaluez-vous l’exercice 2013? La construction est très active, elle a provoqué une demande correspondante forte, et nous avons été en mesure de terminer avec une bonne progression aussi bien au niveau du chiffre d’affaires que du nombre de pièces vendues. Toutefois, il ne faut pas oublier que le cours des prix s’est littéralement érodé ces dernières années et nos produits ont un niveau de prix d’avant 2008. Quels sont les points forts de Hansgrohe pour 2014? Au cours des dernières années, nous avons créé de nouvelles catégories de produits qui sont presque devenues la norme; elles ont des taux élevés de croissance (par exemple, les pommes de dou-


actuel

che, tuyaux de douche «Showerpipes»), et nous allons approfondir leurs facilités de fonctionnement. Dans la catégorie «Select», nous présentons de nouvelles batteries de douches et des pommes de douches qui peuvent être exploitées de manière intuitive via une simple pression sur un bouton; cela fonctionne mécaniquement, sans composants électroniques et sans installations. Aujourd’hui, tout est possible, créer de nouveaux bâtiments et le marché de la rénovation se présente comme un nouveau marché majeur. Seulement, comment peut-on encourager les propriétaires à partager leurs installations, par des incitations fiscales? Un ralentissement (pas la fin) des nouveaux bâtiments se produira si un certain niveau de saturation est atteint et si les taux d’inoccupation commencent à augmenter; actuellement, le marché de fournisseur se transforme en un marché d’acheteur. Comme la pression au renouvellement des standards d’aujourd’hui

n’augmentera plus automatiquement, les vieux actifs immobiliers suffisent. Cela ne nécessite pas d’incitations fiscales spéciales. Des arguments importants pourraient être: la consommation de l’énergie et l’eau. Mais les prestations de tous les fabricants de robinets correspondent. Alors, pourquoi un propriétaire devrait-il se décider pour les produits Hansgrohe? Qui a dit que le propriétaire n’est pas intéressé à l’épargne? L’économie commence activement et seulement quand on peut la faire sans compromis sur le confort; en dehors de l’incitation monétaire, il est même possible de l’anticiper avec un gadget spécial. Hansgrohe n’a jamais cessé de réinventer le mouvement de l’eau, et il est arrivé à des solutions étonnantes, intelligentes et économiques qui ont été incorporées automatiquement dans nos gammes de produits et, plus tard, parfois dans celles de nos concurrents.

bâtitech 5-14

Quelles seront les tendances dans les années à venir: se diriger vers le milieu de gamme ou atteindre encore des prix plus bas? Est-ce que la classe de luxe est capable de changer? Le fait est que la productivité ne cesse d’augmenter et de meilleurs produits pour moins d’argent sont offerts. Les économies seront plus idéalement réinvesties dans un confort et un «design» individuel et doivent donc conduire à une situation gagnant-gagnant classique! En général, où voyez-vous la position de Hansgrohe Suisse dans cinq ans, quelle part de marché envisagez-vous? Dans le secteur des pommes de douche, nous nous voyons comme leader et pour la robinetterie, avec environ 15 % de parts de marché. Si nous continuons à faire notre travail aussi bien et de manière durable et que les maîtres d’œuvre peuvent s’inspirer de nos innovations, nous pouvons espérer une poursuite de notre présence au-dessus de la croissance moyenne du marché. ■

Chers patrons, PME Office est le pack idéal pour la communication de votre entreprise: Internet à haut débit et téléphonie gratuite du réseau fixe vers tous les réseaux fixes et mobiles suisses – le tout pour un montant mensuel fixe, sans frais cachés. Vous trouverez de plus amples informations dans votre Swisscom Shop et sur swisscom.ch/pme-office

Vous aussi, boostez votre PME. PME Office dès CHF 95.–/mois Actuellement 3 mois gratuits* Scannez pour plus d’informations.

* Exonération des frais d’abonnement pendant les 3 premiers mois à la souscription d’un nouveau raccordement haut débit avec PME Office. PME Office CHF 95.–/mois (économie CHF 285.–), PME Office CHF 119.–/mois (économie CHF 357.–), PME Office CHF 149.–/mois (économie CHF 447.–). Promotion valable jusqu’au 30.6.2014.

PME Office vous procure un avantage concurrentiel, à prix fixe.

11


12

bâtitech 5-14

actuel

Le système complet pour baignoires autoportantes

La baignoire et rien que la baignoire Design et fonctionnalité forment avec une baignoire autoportante une unité harmonieuse. Avec la nouvelle robinetterie électronique «Comfort Select», le constructeur haut de gamme Kaldewei offre une baignoire avec des tabliers autoportants sans composants supplémentaires, tels que des mélangeurs externes standard et il peut être installé au centre du local. C’est ainsi qu’un système complet de baignoire devient un meuble et un objet design dans une architecture de salle de bain. Source: Kaldewei; article: Franz Lenz La robinetterie électronique de Kaldewei «Comfort Select» avec panneau de commande règle l’entrée et l’évacuation de l’eau, sa température ainsi que le contrôle de la douche ou la fonction digitale pour un bain convivial.

Panneau de commande avec une unité de réglage électronique Le système «Comfort Select» de Kaldewei se compose de trois éléments qui peuvent être combinés: un panneau de commande avec l’unité de contrôle électronique, une garniture d’écoulement avec trop-plein et un tuyau de douche. Le panneau de commande avec son unité de réglage électronique peut être intégré à peu près au niveau du rebord de la baignoire et permet, même avant l’admis-

neau de commande. Selon la largeur du rebord de la baignoire, le tuyau de douche peut s’escamoter ou il est fixé à l’extérieur grâce à un support spécifique attaché à la baignoire. La pomme de douche peut être choisie individuellement et correspondre ainsi au type d’accessoires défini par le client.

Le système de baignoire allie esthétique et confort

sion de l’eau, la sélection précise de la température désirée. Qu’elle soit préréglée à 38,5 °C, plus chaud ou plus froid: l’eau remplit la baignoire de façon uniforme à la température sélectionnée. Naturellement, au cours du remplissage, il est facile, étape par étape, de modifier du bout des doigts la température, ceci par pas de 0,5 °C. En plus de la température de l’eau, l’entrée et l’évacuation de cette eau sont commandées à partir du panneau. Le remplissage de la baignoire autoportante de Kaldewei se fait via le «Comfort Select» et sa fonction de remplissage intégrée dans la garniture d’évacuation avec trop-plein.

Avec ce système complet constitué de la baignoire, l’habillage et la robinetterie «Comfort Select», le client obtient un produit de qualité qui convainc non seulement par la technique et le confort, mais aussi par un langage esthétique harmonieusement équilibré. Kaldewei a développé avec le bureau Phoenix Design, Stuttgart/Tokyo dont la renommée n’est plus à faire, le montage «Comfort Select» et bien sûr la baignoire en acier émaillé de 3,5 mm également est disponible pour les plateaux de rangement classiques Kaldewei. Le tout peut être combiné avec les accessoires d’une salle de bains standard.

Les fonctions de douche réglable

Franz Kaldewei AG CH-5000 Aarau Tél. 062 205 21 00 info.schweiz@kaldewei.com www.kaldewei.de

Même la fonction de douche avec le tuyau de douche «Comfort Select» est contrôlée électroniquement par le pan-

Le système «Comfort Select» de Kaldewei se compose de trois éléments qui peuvent être combinés: un panneau de commande avec l’unité de contrôle électronique, une garniture d’écoulement avec trop-plein et un tuyau de douche. A droite: même la fonction de douche avec le tuyau de douche «Comfort Select» est contrôlée électroniquement par le panneau de commande. Selon la largeur du rebord de la baignoire, le tuyau de douche peut s’escamoter ou il est fixé à l’extérieur grâce à un support spécifique attaché à la baignoire. La pomme de douche peut être choisie individuellement et correspondre ainsi au type d’accessoires défini par le client.


bâtitech 5-14

Votre ancien utilitaire nous intéresse.

Echanger et profiter: laissez votre ancien utilitaire chez votre partenaire Mercedes-Benz et bénéficiez d’une prime à l’achat d’un modèle Citan, Vito ou Sprinter neuf.

13

Une marque Daimler

actuel

Exigez le meilleur: misez sur les vans économiques et fiables de Mercedes-Benz. Tous les utilitaires légers se distinguent par des standards de qualité très élevés qui vous garantissent une conduite économe en énergie et en coût. Les longs intervalles entre les opérations de maintenance et les services, qui peuvent atteindre 60 000 km, permettent de bénéficier de temps d’immobilisation réduits et d’une charge d’entretien minime. Ainsi, vous atteindrez tous vos objectifs. Vous trouverez des informations complémentaires chez votre partenaire Mercedes-Benz ou sur www.mercedes-benz.ch

Ne ratez pas la prime de reprise* allant jusqu’à

CHF 6000.–

10 ans de services gratuits, 3 ans de garantie complète inclus**

* Tous les utilitaires peuvent être échangés au prix estimé par Eurotax majoré d’une prime de reprise de CHF 2500.– (Citan), de CHF 5000.– (Vito) ou de CHF 6000.– (Sprinter). Le véhicule en reprise doit avoir été acheté au moins 12 mois auparavant. L’offre est valable jusqu’au 30 juin 2014, dans le cas d’une utilisation commerciale uniquement. Les prix s’entendent hors TVA et sont aussi valables pour la reprise d’autres marques. ** MERCEDES-SWISS-INTEGRAL: le pack service & garantie de série pour tous les modèles – une exclusivité de Mercedes-Benz Suisse SA. 10 ans de services gratuits, 3 ans de garantie complète (tous deux jusqu’à 100 000 km, selon premier seuil atteint).


14

bâtitech 5-14

actuel

Allianz Suisse

Nouveau siège principal Après une période de construction d’environ quatre ans, Allianz Suisse a mis en service son nouveau siège principal. Depuis le mois de novembre, quelque 1900 personnes travaillent sur 42 000 mètres carrés de surfaces bureaux. Les collaborateurs d’Allianz Suisse ont participé à la prise de diverses décisions, notamment pour ce qui concerne le choix du traiteur ou les noms des salles de réunion. Il s’agit probablement du plus important déménagement réalisé par une entreprise suisse cette année. Au cours des mois d’octobre et de novembre, Allianz Suisse a pris possession de son nouveau siège

Klaus-Peter Röhler. «Les processus et la rentabilité s’en trouvent améliorés, et nous pouvons ainsi offrir à nos collaborateurs un environnement de travail doté d’une infrastructure des plus modernes.»

Suisse a pu participer, dès le début, à la planification du bâtiment qui accueille son nouveau siège principal.

Environnement de travail flexible L’objectif était de proposer aux collaborateurs un environnement de travail stimulant, offrant de nombreuses ambiances différentes et garantissant une utilisation flexible. Des espaces de bureaux ouverts associés à des îlots de calme, des espaces de discussion, des locaux pour projets, des salles de conférence, des salons, des terrasses et des salles de réunion facilitent le passage rapide d’un cadre de travail formel à une discussion spontanée. Les ouvertures verticales y contribuent aussi, en offrant une vue partielle directe sur l’étage supérieur ou inférieur. La flexibilité de cet environnement de travail transparaît dès le rez-de-chaussée, où le grand hall d’entrée sert également de foyer aux visiteurs de l’auditorium situé au même niveau. Le restaurant du personnel remplit, lui aussi, une double fonction, car il permet non seulement de se restaurer, mais aussi de travailler.

Architecture non conventionnelle

Nouveau siège principal d’Allianz Suisse à Wallisellen.

principal à Wallisellen. Quelque 1900 employés de Zurich, Berne et Volketswil ont changé de lieu de travail – emportant avec eux pas moins de 12 000 cartons de matériel de travail. De plus, près de 10 000 pièces de mobilier ont également été déplacées.

Nouvelle perspective à long terme Allianz Suisse comptait jusqu’à présent sept sites administratifs en Suisse alémanique. «La concentration sur deux sites, Wallisellen et Genève, constitue une révolution pour nous», explique le CEO,

(OTS photo/Allianz Suisse)

Selon lui, ce rapprochement géographique est aussi un atout pour la culture d’entreprise.

Wallisellen, une «ville champignon» Le choix de Wallisellen pour l’implantation du siège principal d’Allianz Suisse n’est pas le fruit du hasard. Depuis plusieurs années, cette ville de la périphérie zurichoise connaît un essor considérable. Proche de l’aéroport, elle bénéficie d’un bon raccordement aux infrastructures de transport: autoroute, bus, tramway, S-Bahn et Glattalbahn. En outre, Allianz

Le nouveau siège principal d’Allianz Suisse se compose de deux bâtiments: une tour de 17 étages accueillant une terrasse sur le toit et une construction en rang d’îlot de cinq étages avec une cour intérieure verdoyante. Le concept a été imaginé par l’architecte néerlandais Wiel Arets. Les deux bâtiments sont reliés entre eux par des passerelles de verre, matière qui caractérise l’enveloppe extérieure du complexe. Les panneaux de verre ont été regroupés visuellement par deux et encadrés par un fin revêtement reproduisant un motif de pierre d’onyx afin de répondre à l’exigence urbanistique de structures à fenêtres clairement visibles.

Concept de couleurs: de quelle couleur est le monde? Les bureaux sont de couleurs neutres agrémentées de teintes plus vives au niveau du mobilier intérieur des postes de


actuel

travail personnels, des meubles d’appoint et des meubles de la zone centrale ainsi que des chaises des salles de réunion. Les couleurs supplémentaires confèrent discrètement à chaque étage sa propre identité visuelle. Pour définir le concept des couleurs, les créateurs se sont penchés sur la mappemonde pour déterminer la longitude de Zurich. Ensuite, ils se sont interrogés sur les différentes couleurs de la Terre sur ce méridien, du nord au sud, de l’Antarctique jusqu’en Norvège en passant par l’Afrique de l’Ouest, avant d’en retenir treize, une pour chaque étage.

Salles de réunion: des détails créatifs La géographie s’invite également dans le concept des salles de réunion. Pour assurer la protection visuelle, leurs parois vitrées ont été recouvertes d’une bande décorative semi-transparente de 120 cm de large, esquissant les paysages typiques que l’on rencontre aux différentes latitudes du huitième méridien, tels que les icebergs, la côte tropicale ou encore les étendues désertiques. La plupart des salles de conférence sont désignées par un degré de latitude. Enfin, 16 salles de réunion portent le nom d’un sommet suisse, notamment l’Eiger, le Cervin, le Pilate, le Säntis et le Weisshorn.

1700 plafonniers et lampadaires. Des détecteurs de mouvement et des minuteries empêchent égale-ment tout éclairage inutile. Enfin, des rideaux pare-soleil commandés par ordinateur contribuent à réguler la température.

bâtitech 5-14

Respirez un air meilleur grâce à l`évacuation

Alimentation électrique en cas de panne de réseau Les pannes de courant sont rares en Suisse. Néanmoins, le risque d’un «blackout» est de plus en plus présent dans les discussions, et ce, en raison du bouleversement du paysage énergétique européen et des cyber-attaques inlassablement menées contre les fournisseurs d’électricité. Si le courant est coupé, l’entreprise s’arrête de fonctionner ou subit pour le moins des perturbations dans son service à la clientèle. Le groupe électrogène de secours d’Allianz est une installation de fourniture permanente de courant. Cela signifie qu’en cas de défaillance du réseau, l’installation fournit immédiatement de l’électricité. Tous les générateurs de secours n’offrent pas cette réactivité et il faut souvent 10 à 15 secondes avant que le groupe électrogène au diesel prenne le relais. Dans le cadre de l’installation choisie par Allianz Suisse, la transition est assurée par des batteries, qui fournissent l’électricité nécessaire. Le cœur du

AERATION Info Ohnsorg et fils SA chaussée de Treycovagnes 17 1400 Yverdon-les-Bains Tél. 024 446 10 20 Fax 024 446 10 22 www.ohnsorg.biz info@ohnsorg.biz

Produit de qualité suisse

La géothermie remplace les énergies fossiles Le nouveau siège principal d’Allianz Suisse satisfait au standard Minergie. L’enveloppe est constituée d’un vitrage multiple présentant de très bonnes capacités d’isolation. L’espace entre les vitrages est en surpression, ce qui empêche l’apparition d’humidité. L’énergie pour le chauffage, le refroidissement et l’eau chaude est tirée de l’installation géothermique du quartier de Richti, ce qui réduit de près de 80 % les besoins en sources d’énergie extérieures. L’installation permet de renouveler 400 000 m3 d’air par heure. Cela correspond à un cube d’environ 70 mètres d’arête. La climatisation des bureaux d’Allianz Suisse est assurée par un plafond chauffant rafraîchissant spécialement conçu pour le siège principal et qui utilise le plafond en béton brut pour stocker l’énergie. La consommation d’énergie pour l’éclairage a également été réduite grâce à l’utilisation exclusive de diodes électroluminescentes (LED) pour les

• Sept anciens sites réunis sous un même toit à Wallisellen • Quelque 1900 collaborateurs sur 42 000 mètres carrés • Probablement le plus important déménagement réalisé par une entreprise suisse en 2013 • Réduction de 80 % des besoins énergétiques extérieurs

groupe électrogène de secours se compose de deux moteurs Diesel d’une puissance totale de 2200 kW – soit l’équivalent d’environ 20 VW Golf GTI.

Au cœur d’un quartier vivant Le quartier de Richti, sur lequel se situe désormais le siège principal d’Allianz Suisse, a longtemps été une zone indus-

trielle non exploitée. Le 23 juin 2009, l’assemblée communale de Wallisellen a autorisé le plan d’aménagement prévoyant la création d’un nouveau quartier à utilisation mixte. Quelque 500 logements locatifs et en copropriété pouvant accueillir 1200 personnes ont ainsi vu le jour, le reste des surfaces permettant la création de plus de 3000 postes de travail. Le quartier est attractif, favorisant la mobilité douce avec des places publiques, des allées, des arcades, des cours intérieures et des rues résidentielles agrémentées d’espaces verts. Le mélange entre habitations, artisanat, vente et prestations de service ainsi que la proximité immédiate du centre commercial Glatt donnent vie au quartier. Les magasins sont situés au rez-de-chaussée des immeubles; le siège principal d’Allianz Suisse abrite ainsi un restaurant ouvert au public ainsi qu’une garderie publique. www.allianz-suisse.ch

15


16

bâtitech 5-14

actuel

Reflex Schweiz GmbH avec son siège à Pratteln BL veut animer le marché

Technique de maintien de pression et d’expansion L’assortiment de la marque Reflex comprend des produits dans le domaine du chauffage, de l’énergie et des installations: vases d’expansion à diaphragme, des stations de maintien de pression, systèmes de dégazage et transmission de chaleur. Interview: Flavien Allenspach Roger Fisch, en tant que directeur de Reflex Schweiz GmbH, vous vous engagez sur un marché suisse déjà bien établi. Cela témoigne d’un certain courage. Qu’est-ce qui vous rend si certain que les installateurs suisses ont attendu vos produits? Roger Fisch: Le marché suisse est effectivement déjà pourvu; un équilibre entre les rares acteurs du marché de la pressurisation et de l’expansion fait par contre défaut. Les clients ne peuvent pas réellement choisir entre plusieurs offres comparables. En bref: il y a un manque de concurrence. Et lorsqu’aucune concurrence n’entre en jeu, le prix à payer pour la prestation et les produits est trop élevé. Une nouvelle impulsion ne peut être alors que bénéfique – et c’est précisément ce que fait Reflex. Votre stratégie, qui consiste à donner une mixité au marché, passe par conséquent par le prix? En tant que plus grand fabricant européen sur le marché de la pressurisation et de l’expansion, nous avons un avantage décisif en termes de structure des coûts; nous sommes en mesure de répercuter nos frais fixes sur le plus grand nombre d’unités, ce qui nous permet de proposer

des conditions intéressantes à nos clients. L’intensification de la concurrence n’a toutefois pas pour unique conséquence la réduction des prix; elle confère aux fabricants une tension productive et les incite à améliorer constamment leurs produits et prestations de services en vue de ne pas perdre de clients au profit de concurrents. Pour cette raison, nos clients peuvent également profiter de produits plus innovants et plus performants. L’obtention du Plus X AWARD confirme également que nous fabriquons des produits «excellents». L’an dernier, notre instrument de contrôle Reflex Control a obtenu le titre de «meilleur produit de l’année». Les clients Reflex font dans tous les cas partie des gagnants. Vous avez reçu ce prix pour le design et la fonctionnalité de vos produits. C’est très bien, mais cela ne saurait guère suffire en tant que seul argument de

vente. Comment voulez-vous, sinon, gagner du terrain ici, en Suisse? En premier lieu, nous avons l’immense opportunité de prouver à nos clients que nous avons tout simplement les meilleurs produits. Cela prend un certain temps, car des habitudes d’achat de produits déterminés doivent être éradiquées. Nous devons créer de nouveaux «réflexes» au sens propre du terme. Cela est uniquement possible si nos clients acceptent de découvrir une nouvelle technique et de nouveaux produits. Nous constatons dans notre centre d’entraînement du siège principal situé à Ahlen à quel point il est important non seulement de présenter le produit, mais aussi le fonctionnement du savoir-faire technique, le «comment» et le «pourquoi». Dans nos laboratoires, ils peuvent personnellement participer et «comprendre» la technique. Cela ouvre de nouvelles perspectives à nos clients – une expérience qui est fort appréciée.

Reflex propose un grand choix de solutions d’avenir dans le cadre d’un portefeuille innovant de produits.


actuel

bâtitech 5-14

tie. Nous avons bien réussi à faire ressentir ce qu’est et qui est Reflex.

Au centre d’entraînement Reflex à Ahlen.

Et comment préparez-vous vos collaborateurs à ces nouveaux défis? Dans notre centre d’entraînement, nos collaborateurs apprennent à penser en fonction de la manière dont nous voulons informer nos clients: sous forme de solutions, de systèmes complets. Nous leur montrons surtout l’importance de leur mode de pensée en termes de positionnement de nos clients par rapport à notre entreprise. Les clients assurent l’essor d’une entreprise en demandant une prestation et prouvent, en payant leur facture, que cette prestation a de la valeur pour eux. A l’inverse, ils peuvent causer la perte d’une entreprise. Nos collaborateurs doivent en avoir pleinement conscience; ce sont nos clients qui nous donnent notre perspective. Nous faisons de très bonnes expériences avec cette stratégie. Nos collaborateurs constatent qu’un nombre croissant d’installateurs, de responsables de la maintenance technique, d’entrepreneurs généraux, d’ingénieurs et de planificateurs testent nos produits avec les avantages qu’ils procurent et s’adressent à Reflex avec de nouveaux projets. Vous dites que vous pensez en solutions, en «Thinking Solutions»; qu’est-ce que cela signifie concrètement? Vendre un produit isolé est une prestation interchangeable; (pratiquement) chacun peut le faire. Une solution performante pour des clients nécessite toutefois une observation intégrée des différents systèmes. La complexité de notre département technique du bâtiment avec tou-

tes ses facettes est trop importante. Chauffer, climatiser, traiter et acheminer l’eau, etc.: tous ces éléments ne peuvent faire l’objet d’une prise en considération isolée et doivent être intégrés dans un système global. C’est ainsi seulement que nous pouvons mettre en pratique notre promesse «Nous pensons en solutions. Pour les marchés de demain.» Vous avez bénéficié d’une forte fréquentation lors du salon Swissbau 2014. Qu’est-ce que les futurs clients potentiels de Reflex voulaient savoir de vous? Nous entendions fréquemment les questions suivantes à notre stand: «Reflex? Jamais entendu! Qui êtes-vous? Quels produits fabriquez-vous?, etc.». Cela nous a donné l’opportunité de présenter avec passion Reflex et la technique de pressurisation et d’expansion. De plus, nos systèmes de démonstration sur notre stand ont convaincu. Nous avons reçu un grand nombre de retours positifs. Cela a naturellement donné des ailes à nos collaborateurs ainsi qu’une impulsion incroyable à notre organisation encore jeune. Parallèlement aux avantages cognitifs de nos produits et techniques, il était pour nous très important de faire connaître «l’esprit Reflex». Je suis convaincu que l’aspect émotionnel de l’expérience d’une marque et d’un produit est aussi important pour l’être humain. A mon avis, le contact avec nos collaborateurs, le style de communication, le design du produit, la perception haptique et la convivialité à l’utilisation de nos produits en font par-

Dans une publication spécialisée, vous avez évoqué les grands défis techniques et écologiques du domaine de la technique du bâtiment. Et vous avez dit que Reflex était bien armée pour affronter l’avenir. Dans quelle mesure? Notre devise «Thinking Solutions» y fait déjà référence. Nous élargissons notre compétence en abordant le thème de l’eau sous forme intégrale. Cela nous permet de réaliser aujourd’hui des innovations de produits pour le marché de demain; nous pouvons ainsi élargir en permanence notre éventail de produits et générer de nouvelles prestations de services. Le choix ciblé de matériaux et de techniques de production en fait partie, de même que le fait que nous placions sur le marché uniquement des produits d’un niveau maximal d’efficience. Pour finir, veuillez compléter la phrase suivante: des produits de Reflex sont nécessaires en Suisse parce que... les clients ont droit à des produits constamment perfectionnés, à un partenaire d’égal à égal et à des prix équitables. C’est ce qu’assure un marché composé de plusieurs offrants. Le marché suisse de la pressurisation et de l’expansion supporte une plus grande concurrence. Nous nous engageons dans ce sens. ■

Au sujet de Reflex Winkelmann Reflex Winkelmann GmbH compte parmi les premiers offrants de produits de grande qualité dans le domaine de la technique de chauffage et de l’approvisionnement en eau chaude. L’entreprise, qui a son siège principal à Ahlen en Westphalie, développe, produit et commercialise, parallèlement à des vases d’expansion à membrane, des composants innovants et des solutions systémiques complètes pour la pressurisation, la réalimentation, le dégazage et le traitement des eaux, ainsi que des réservoirs à eau chaude et des échangeurs de chaleur à plaques. Depuis 1987, Reflex Winkelmann GmbH est une entreprise indépendante de l’enseigne Winkelmann Group. Reflex Schweiz GmbH a son siège à Pratteln, BL. www.reflexch.ch

17


18

bâtitech 5-14

actuel ELECTROTECHNIQUE

Schneider Electric

Gamme de services complète et compétence locale Lors de l‘édition 2014 des «Powertage», du 3 au 5 juin prochain à Zurich, le secteur de l’électricité suisse abordera les défis à venir. L’un d’entre eux concerne l’optimisation et le renouvellement des infrastructures. En tant que partenaire de confiance des fournisseurs d‘énergie, Schneider Electric montre qu’il est possible de relever ce défi avec succès, grâce à son modèle de cycle de vie. Dans les années à venir, de nombreuses installations à moyenne tension des compagnies suisses de distribution d’électricité arriveront en fin de vie. La libéralisation du marché de l’électricité et

perts de Schneider Electric s’adresseront aux compagnies d’électricité et aux exploitants issus de l’industrie, pour leur présenter leurs solutions pour les soutenir dans cette mission difficile.

Bien plus qu’un constructeur d’équipements électriques Franz Bürgi, Vice-Président Energy chez Schneider Electric Suisse, souligne: «Dans cette conjoncture financière tendue, les compagnies d’électricité doivent plus que jamais veiller à ce qu’en matière d’investissement, elles se doivent de penser en terme de durabilité. Cela ne réussit qu’avec une perspective globale, qui tient compte de l’ensemble du cycle de vie de l’infrastructure.» Grâce à son modèle de cycle de vie ayant fait ses preuves dans d’autres secteurs, Schneider Electric répond à cette attente. Et M. Bürgi de rajouter: «Schneider Electric est bien plus qu’un Le cycle de vie éprouvé de Schneider Electric représente chaque constructeur d’équipe-ments phase d’une installation – de la planification au renouvellement. électriques. Nous sommes un partenaire doté d’une compéla part grandissante d’énergies renouve- tence locale élevée en matière de direclables placeront en même temps les opé- tion de projet, de service, de planification rateurs d’infrastructures de réseau face à de réseau, de développement et de fabrides défis majeurs. Une chose est sûre: les cation. Nous soutenons nos clients avec compagnies d’électricité devront investir une gamme complète de services et de massivement dans la rénovation et l’opti- solutions, allant jusqu’à proposer des sysmisation de leurs installations – et ceci tèmes de gestion numérique, sécurité en période de baisse des prix de l’électri- d’accès et cybersécurité.» cité. Lors des «Powertage 2014», les ex-

Transformateur Smart Grid en vedette Les solutions et services de Schneider Electric couvrent toute la durée de vie des installations: planification, construction et installation, fonctionnement, maintenance et remplacement aussi bien qu’optimisation et surveillance régulière. Durant les «Powertage», les produits suivants seront entre autres mis en vedette: le transformateur pour Smart Grid destiné aux installations à moyenne et basse tension, les concepts innovants de cybersécurité et un système intelligent de vidéosurveillance destiné aux compagnies d’électricité, les bornes de recharge pour véhicules électriques, les concepts de rétrofit pour le remplacement rapide des disjoncteurs basse et moyenne tension. Autre solution, les audits MP4 utilisés avec succès dans le monde entier, avec lesquels Schneider Electric vérifie, dans le cadre d’une procédure standardisée, la performance, la sécurité et l’efficacité des installations industrielles d’alimentation en énergie. Franz Bürgi se montre convaincu: «Les enjeux pour les compagnies d’électricité sont importants. Notre modèle de cycle de vie peut apporter une contribution importante dans ce domaine.» Toute l’équipe de Schneider Electric se fera un plaisir de faire découvrir aux visiteurs leur large gamme de solutions et de services. www.schneider-electric.com

«Powertage» Le rendez-vous du secteur suisse de l’électricité Du 3 au 5 juin 2014, Messe Zurich Schneider Electric: Halle 6, stand H12


produits

bâtitech 5-14

Souhait: une véritable puissance de chauffe pour la salle de bain Solution : le radiateur de salle de bain Duolino ®

Le radiateur de salle de bain Duolino ® assure une puissance calorifique élevée grâce à sa grande surface de chauffe. Son design intemporel crée une ambiance moderne agréable, unique grâce à son large choix de modèles et coloris. ■

Duolino® Flex – pour le remplacement simple

Duolino® Watt – pour le fonctionnement électrique pratique

Adapté aux systèmes à basse température (par exemple pompes à chaleur)

laissez-vous conseiller dès maintenant:

tél. +41 (0) 71 447 47 47 www.arbonia.ch

19


20

bâtitech 5-14

produits

Aquametro AG

Changement des générations de compteurs Des gains grâce à de nouvelles technologies de mesure? Avantages client et économies grâce à de réelles innovations. Si, à terme, un point de mesure doit être remplacé, le passage à une nouvelle technologie n’apporte pas que des avantages. De récentes techniques, comme par exemple les ultrasons, ont des exigences de montage particulières. Celles-ci sont beaucoup plus contraignantes que pour les compteurs mécaniques traditionnels. Il convient de veiller à respecter un tronçon rectiligne d’entrée et de sortie, sans élément de montage. Souvent, dix diamètres nominaux en amont et cinq en aval du compteur sont requis. Si l’appareil de mesure est situé après un ou plusieurs coudes, les sections de stabilisation sont multipliées par deux. Pour un diamètre nominal DN 150, cela peut représenter jusqu’à trois mètres en amont et un mètre et demi en aval du compteur. Avec l’appareil de mesure, cinq mètres de conduite droite sans la moindre pièce de montage doivent être disponibles dans l’installation. S’il s’agit de remplacer un compteur mécanique, cela s’avère difficile: ces sections de stabilisation ne sont pas nécessaires pour le compteur mécanique et n’ont donc pas été prises en compte lors de la construction de l’installation. De plus, les longueurs de montage des compteurs mécaniques sont nettement plus courtes que celles des compteurs à ultrasons. Si à présent un compteur mécanique doit être remplacé, dans la pratique cela n’est possible qu’au prix de transformations coûteuses.

Des solutions? L’innovation suisse! Une ingénieuse entreprise suisse a trouvé une solution extrêmement économique et parfaitement adaptée à ce défi. L’Amflo Sonic DryX d’Aquametro AG est un compteur basé sur la technologie à ultrasons, qui apporte de nombreux avantages par son concept novateur. Grâce à la géométrie particulière de son tube de mesure et à la disposition des capteurs, ce compteur est nettement moins sensible aux perturbations de mesure dus aux éléments de montage et aux coudes de la conduite. Cela permet son installation, même dans des conditions difficiles où les conditions de montage requises pour d’autres compteurs à ultrasons ne peuvent être respectées. L’Amflo Sonic DryX existe en plusieurs longueurs de montage standards. Des longueurs adaptées aux besoins spécifiques des clients sont également possibles. L’innovation réside également dans

A propos En tant que partenaire pour systèmes de mesure dans les domaines de l’approvisionnement en eau, l’énergie thermique (chaleur, froid), la mesure de consommation de carburant, les systèmes pour la marine et la gestion des données, Aquametro AG développe avec les clients de nouveaux produits, optimise les systèmes existants, aide lors de la mise en service et offre le service après-vente souhaité par le client. Entièrement Swiss Made.

le système modulaire avec un tube de mesure fermé et une électronique interchangeable. Lors de l’étalonnage ultérieur ou du calibrage, seule l’électronique amovible doit passer sur le banc d’essai. Aucune intervention n’est faite sur le système hydraulique, évitant ainsi un démontage fastidieux et contraignant.

Un exemple issu de la pratique Au cours de la rénovation d’une station de transfert d’une installation de chauffage à distance, la chaleur injectée d’un réseau partiel doit être mesurée pour contrôle. Un quartier entier dépend de ce tracé avec un diamètre nominal DN 250, c’est pourquoi une surveillance fiable et précise constitue une condition sine qua non. Le recours à une technique de mesure moderne s’imposait alors, mais le défi consistait désormais à l’intégrer dans l’installation existante en tenant compte des conditions de montage. Aucun compteur traditionnel ne pouvait être installé sans que de coûteuses transformations, qui auraient rapidement atteint quelques dizaines de milliers de francs, soient nécessaires. L’utilisation du compteur Amflo Sonic DryX a permis d’éviter ces dépenses. Grâce à la courte longueur et à la fiabilité de mesure élevée, le compteur a pu être intégré à la conduite existante sans grandes transformations, peu en aval d’une sortie et directement en amont d’un coude. Cet ingénieux concept a fait preuve ici de toute son ampleur – uniquement possible grâce à l’innovation suisse. Aquametro AG CH-4106 Therwil www.aquametro.com


produits

bâtitech 5-14

➊ Paroi de diffusion d’air avec fenêtre et porte (surveillance du tireur). ➋ Refoulement des polluants transportés par l’air. ➌ Flux refoulant (flux laminaire). ➍ Aspiration de l’air vicié. ➎ Cible.

Durrer Technik AG

Ventilation par refoulement dans les stands de tir Durrer-Technik AG fournit, pour les stands de tir modernes fermés, des parois de diffusion d’air spéciales générant un flux refoulant à faible turbulence.

ron 5000 m2 faisant appel à une technique ultramoderne avec des effets les plus divers d’éblouissement, d’éclairage et sonores et aussi avec de véritables véhicules de patrouille.

Ce principe de guidage de l’air garantit que, lors du tir d’une arme à feu, les polluants libérés sont efficacement repoussés dans la direction de l’aspiration de l’air vicié sur la cible selon le principe du flux laminaire. L’environnement des tireurs bénéficie ainsi d’une haute qualité de l’air, exempt de substances dangereuses pour la santé.

Aperçu des données

Le plus moderne stand de tir de police en Europe

• Quantité: 9 parois de diffusion d’air (type VA-RSA) de différentes dimensions (L × H) jusqu’à 9500 × 3000 mm • Débit d’air pulsé: 21 400–34 000 m3/h • Débit d’air: env. 1100–1200 m3/h par m2 de surface de sortie d’air • Incorporation de diffuseurs à induction pour la stabilisation du jet d’air • Intégration de fenêtres dans les parois de diffusion d’air • Aspiration de l’air vicié sur la cible

Entre autres, neuf parois de diffusion de tailles différentes (type VA-RSA de Kantz) ont été installées dans les neuf stands de tir du centre d’entraînement de la police de Hambourg. Environ 8500 policiers peuvent depuis lors s’entraîner dans des conditions proches de la réalité sur envi-

Selon le principe du flux laminaire, l’air pulsé est insufflé sur une grande surface derrière le tireur sur la totalité de la paroi. La construction spéciale des diffuseurs garantit une répartition uniforme. Les diffuseurs à induction incorporés ren-

Paroi de diffusion d’air avec fenêtre et porte (surveillance du tireur).

forcent cet effet et veillent à un flux laminaire optimal sur la totalité de la section du local. Durrer-Technik AG fournit tous les composants nécessaires préparés pour l’installation, de manière que l’assemblage sur place, y compris le contrôle du fonctionnement, soit facilement réalisable. Durrer-Technik AG Succursale de Gland CH-1196 Gland Tél. 022 354 80 80 gland@durer-technik.ch

Vo t r e l e a d e r d u c h a u f f a g e a u b o i s Chaudières à bûches, mixtes et pellets

» Planifiez

avec nous vos grandes installations

Nous ser

rons

toujours

plus gran Heit zm ann SA | Ro ute d’Ollon 52 | CH - 1860 A igle Télé p h o n e + 4 1 (0 ) 2 4 468 60 50 | inf o@heitzmann.ch | w w w.heitz mann.ch

Une exclusivité Heitzmann – Systèmes de chauffage Hargassner

d

21


22

bâtitech 5-14

produits

PALILINE LED

La lumière comme élément de design général d’une architecture de salle de bains moderne.

Une qualité de lumière exceptionnelle L’excellente qualité de lumière de l’armoire-miroir dépend aussi bien de la répartition de la lumière que de l’intensité lumineuse et de la couleur de la lumière des sources d’éclairage intégrées. La répartition homogène de la lumière et l’utilisation de LED de haute qualité permettent de créer une lumière sans ombre et non éblouissante, mais très intense, qui éclaire bien le visage. PALILINE LED se distingue aussi par sa qualité esthétique: grâce à une idée de conception astu-

PAL 100/2/LED.

Les armoires-miroirs font partie de l’équipement de base de toute salle de bains et leur fonctionnalité est tout aussi importante que leur design. PALILINE LED allie les deux facettes d’une manière innovante en utilisant la lumière indirecte comme un élément de la conception générale. Jour après jour, les armoires-miroirs doivent faire preuve de leur utilité en tant qu’espace de rangement et remplir leur fonction de miroir, et la qualité de la lumière y joue un rôle essentiel. La technologie LED a, ces dernières années, révolutionné de nombreux domaines et ainsi

rendu possible le développement de produits innovants tels que PALILINE LED. La nouvelle armoire-miroir de W. Schneider + Co AG séduit par sa technique de design et d’éclairage très raffinée, tout en mariant à la perfection l’esthétique avec la fonctionnalité au sein d’un concept

Assurez-vous maintenant une subvention pour une

solution d’éclairage efficace en énergie! Profitez de cette chance unique et inscrivez votre projet – cela vaut le coup!

Enregis tr en lign ement e sur: www.e ffeled .ch

Soutenu par le programme de promotion ProKilowatt sous la direction de l’Office fédéral de l’énergie.

Boîte d’accessoires, tablettes en verre réglables par degrés, amortisseur de porte.

cieuse, il a été possible d’intégrer la bande LED inférieure sans joint dans le profilé de l’armoire, ce qui apporte une solution élégante pour le montage en saillie et encastré. Elle diffuse une belle lumière indirecte, qui fait toute la différence et qui, en raison des LED commutables séparément, confère à la pièce une ambiance agréable. A l’intérieur de l’armoire-miroir, le confort est assuré par une bonne lumière ainsi que par un agencement et équipement réfléchis. PALILINE LED séduit aussi sur ce point.

W. Schneider + Co AG CH-8135 Langnau a. A. Tél. 043 377 78 78 www.wschneider.com info.ch@wschneider.com


produits

bâtitech 5-14

23

Chauffage mobile à pellets

L’installation sans problème Production mobile d’eau de chauffage – sans autorisations spéciales – installation même dans la zone de protection des eaux A – production d’énergie neutre. Mise en place sans problème, simplicité d’utilisation et installation de chauffage favorable à l’environnement constituent les attributs du container à chauffage à pellets mobile de RC-Klimatechnik GmbH.

Les caractéristiques en bref Dimensions: 6,0 × 2,4 × 2,5 m (l × lg × h) Puissance de chauffage progressive: 20–130 kW Raccordement électrique: 3 × 400 V Volume du réservoir: 12 m3 incorporé dans le container Télésurveillance: sur demande

Fonctionnement Fonctionnement avec des pellets, CO2 neutre Fonctionnement automatique piloté en fonction de la température Livré prêt à être raccordé, avec les tuyauteries hydrauliques, y compris la régulation/commande Limitation de sécurité de la température: intégrée dans la régulation Pas d’autorisations spéciales nécessaires Flexibilité du changement d’emplacement: faire le plein de pellets et mettre en marche Résidus de combustion particulièrement réduits

Domaines d’utilisation Chantiers de toute taille Cantines de manifestations Séchage du foin, circulant entre les communes Rapidité d’installation: pour le chauffage et le séchage Possibilité d’installation dans la zone de protection des eaux A Avec le chauffage mobile et flexible à pellets, vous achetez votre combustible sur place et bénéficiez de prix plus bas et plus stables qu’avec des combustibles fossiles. RC Klimatechnik GmbH CH-1010 Lausanne Tél. 021 651 49 00 lausanne@rc-klimatechnik.ch


24

bâtitech 5-14

produits

ebm-papst AG

Retrofit pour l’assainissement d’anciennes installations de ventilation ebm-papst présente la gamme RadiFit – ventilateurs radiaux à ailettes incurvées vers l’arrière dans la volute. Compacts à moteur EC interne! Des coûts, du temps et, grâce au moteur EC, des frais d’exploitation peuvent être économisés par un simple échange Plug & Play à l’occasion de la modernisation d’installations existantes. Les exploitants peuvent ainsi moderniser très simplement leur installation et réaliser durablement des économies.

Identique avec les dimensions de montage usuelles sur le marché La turbine, le moteur, l’électronique de commande et la volute ont été développés sous la forme d’une unité fonctionnelle livrée entièrement configurée. Le moteur à commutation électronique est directement intégré à la turbine. Ceci rend superflus des composants externes supplémentaires tels que l’entraînement à courroie ou le variateur de fréquence. Les dimensions de montage sont ainsi nettement réduites. Le fait que les dimensions de la volute de la gamme RadiFit sont iden-

tiques aux dimensions de montage des ventilateurs déjà sur le marché constitue un autre avantage. En conséquence ils conviennent non seulement pour être utilisés dans les installations neuves, mais également pour l’assainissement énergétique d’anciennes installations.

Mise en service très simple Les entraînements EC GreenTech efficaces à régulation de vitesse continue permettent aux ventilateurs radiaux de travailler avec un rendement élevé et simultanément une pression statique importante. Un bornier central pour le raccordement au réseau, des relais de signalisation de pannes, de même que la commande et la

4

0.1

u

Du

1.4

RIX

P

UX er ! A I C PÉ tact

S

as à

zp

ite ’hés

N

1 31.

S NET

ebm-papst AG Ch-8156 Oberhasli www.ebm-papst.ch Représentant pour la Suisse romande: Daniel Spurgeon, tél. 079 390 00 70 daniel.spurgeon@ebmpapst.ch

Petit format et grande classe. Chauffez aux pellets avec confort et fiabilité. Nos Logano PU et PC s’installent partout et laissent pénétrer la chaleur dans votre foyer. Savourez le plaisir de chauffer tout en préservant l’environnement, sans dépendre du gaz ni du mazout. Chaque Logano PU et PC Buderus est livrée de série avec une sonde lambda, un système de nettoyage automatique et une régulation complète qui permet de connecter l’ensemble de votre installation de chauffage à la régulation de la chaudière – tampon, circuits de chauffage et installation solaire. De cette manière, le soleil reste toujours prioritaire par rapport à la chaudière.

Logano PU 7, 11, 15 kW et Logano PC 20, 25 et 32 kW – Technique compacte et élaborée !

a .14

communication simplifient considérablement la mise en service. La volute et les buses d’injection sont optimisées à la turbine et garantissent un fonctionnement efficace et silencieux. La gamme couvre les grandeurs de 250 à 400 et, pour toutes, des positions de pieds variables sont possibles. Un montage bridé n’est pas impérativement nécessaire, en conséquence des ventilateurs sont également à disposition sans bride. Les grandeurs 315, 355 et 400 sont également disponibles avec un robuste cadre rectangulaire. Les ventilateurs RadiFit atteignent des débits d’air de 10 000 m3/h et seront livrables au second semestre 2014. Le ventilateur radial RadiFit allie des dimensions minimales et une efficacité énergétique maximale, tout en étant particulièrement durable et absolument sans entretien.

s nou

con

Vous trouverez des informations complémentaires auprès de votre conseiller Buderus ou sur notre site www.buderus.ch.

La chaleur est notre élément

Buderus Technique de chauffage SA Route du Bois-Genoud 8 1023 Crissier Tél. : 021 631 42 00 Fax : 021 631 42 50 info@buderus.ch


produits

bâtitech 5-14

Buderus Technique de chauffage SA

Nouvelle pompe à chaleur gaz pour bâtiments de moyenne et grande taille Avec des températures de départ jusqu’à 65 °C, les Logatherm GWPL de Buderus sont également adaptées à la modernisation des chauffages existants. Avec la Logatherm GWPL, Buderus, une marque de Bosch Thermotechnique, étend sa gamme de produits dans le secteur de la génération de chaleur régénérative. La Logatherm GWPL utilise l’air comme source de chaleur et est particulièrement adaptée aux constructions de moyenne et grande taille avec une puissance thermique nominale de 41 kW

Avec une température de départ élevée jusqu’à 65 °C, la pompe à chaleur à absorption gaz Logatherm GWPL est adaptée aux bâtiments de moyenne et grande taille. Elle représente également une solution idéale pour moderniser ou compléter les chauffages existants. (Source: Buderus)

(A7/W35). Avec des températures de départ élevées, 65 °C pour le chauffage et 70 °C pour la production d’eau chaude sanitaire, cette pompe à chaleur à absorption gaz peut être installée non seulement dans les constructions neuves avec des températures de système relativement faibles, mais également pour moderniser ou compléter un chauffage existant. Elle fonctionne de manière particulièrement efficiente avec un ren-

dement pouvant atteindre 164 % par rapport au pouvoir calorifique inférieur. Cette pompe à chaleur à absorption gaz, version évolutive de la technique de condensation gaz, s’est désormais implantée sur le marché – avec un rendement annuel supérieur de 30 % par rapport à une chaudière gaz à condensation et environ 30 % d’émissions de CO2 en moins. La technologie des pompes à chaleur gaz combine le chauffage au gaz naturel avec la récupération de la chaleur des sources renouvelables. Contrairement à une pompe à chaleur électrique, le système ne fonctionne pas avec du courant électrique mais avec une chaudière gaz à condensation intégrée. Du point de vue économique et écologique, les systèmes bivalents ont fait leurs preuves sur les installations de chauffage de moyenne et grande taille. Les charges de base sont couvertes par la pompe à chaleur gaz, les charges de pointe par la chaudière gaz à condensation. En raison de sa puissance élevée, la Logatherm GWPL peut également fonctionner en tant que générateur de chaleur seul ou – si les besoins sont importants – sous forme de cascade. Ce système combiné couvre une plage de puissance jusqu’à 500 kW. Avec les nouvelles pompes à chaleur gaz, les chauffagistes profitent des compétences de Buderus en matière de systèmes : les installations sont livrées sous forme d’unité complète avec tous les composants nécessaires à la génération, au stockage et à la distribution de la chaleur. Outre la Loga-

therm GWPL, sont également joints à la livraison, en fonction de l’installation : un ballon tampon, la régulation Logamatic 4323, divers modules de fonction pour la gestion tampon, des systèmes bivalents avec production d’eau chaude sanitaire, armoire de commande, amortisseur de vibrations, pompe de circuit primaire et pompe de circulation, contrôleur de pression d’eau glycolée. La nouvelle Logatherm GWPL de Buderus sera disponible en Suisse à partir du printemps 2014.

Buderus Technique de chauffage SA CH-1023 Crissier Tél. 021 631 42 00 www.buderus.ch

www.wschneider.com

25


26

bâtitech 5-14

produits

NeoVac ATA: deux nouveaux compteurs de chaleur pour les bâtiments résidentiels

La cerise sur le gâteau Du nouveau chez NeoVac ATA SA en matière de mesure de chaleur. Avec le Supercal 739 et le Superstatic 749, le spécialiste de la mesure de la chaleur offre d’un coup deux nouveaux produits pour les bâtiments résidentiels. Supercal 739, le digne successeur du Supercal 539 Le Supercal 739 est l’évolution logique des compteurs de chaleur compacts mécaniques de NeoVac ATA. Sur ce successeur du Supercal 539, le calculateur est séparable du débitmètre. Ainsi, même dans des endroits exigus, une flexibilité maximale est assurée lors de l’installation. Le calculateur peut pivoter à 360° pour une meilleure lisibilité de l’écran LCD à 8 chiffres. Dans le débitmètre, une roue à ailettes à échantillonnage électro-

Caractéristiques du Supercal 739 • Compteur mécanique à jet unique ou capsule de mesure multijets avec filetage G2" ou M77 × 1,5 • Débit de 0,6, 1,5 ou 2,5 m³/h • Calculateur séparable du débitmètre • Mémoire EEPROM imperdable • Mémorisation sur 18 mois • Fonction heating-cooling • Communication par M-Bus, radio ou optocoupleur • 2 entrées d’impulsion (en fonction du modèle) Le Supercal 739 est le successeur parfait du • Batterie lithium longue durée échangeable Supercal 539. • Classe de protection du boîtier: IP 65 • Conforme à la directive MID 2004/22/CE modules B et D, EN 1434, classe 3

nique mesure le débit. Nouveauté, le compteur de chaleur mécanique est disponible dans une version multijet à cap-

sule. Cette version permet de réduire le temps d’installation lors du remplacement sur des installations existantes

Le summum de la climatisation avec EC.

On nous les demande toujours moins longs et plus performants. C‘est pourquoi nous avons réalisé nos ventilateurs radiaux d‘appareils de climatisation encore plus courts et plus puissants en faisant appel à la technique de moteurs EC GreenTech, à une électronique de puissance de 3 à 12 kW et à une aérodynamique sophistiquée sous la forme d‘un système complet de construction particulièrement compacte dans des grandeurs de 400 - 900 pour montage horizontal et vertical. Ceci permet non seulement d‘économiser de la place mais également beaucoup de travail grâce à la technique Plug & Play. Dans ces ventilateurs, ce qui est grand c‘est le débit: jusqu‘à 25‘000 m ³/h à 1‘000 Pa. Plus d‘informations sur la climatisation avec la technique EC sous. www.ebmpapst.ch · ebm-papst AG · Rütisbergstrasse 1 · 8156 Oberhasli

Le choix des ingénieurs


produits

puisque le boîtier du raccord monotubaire reste sur la tuyauterie et seule la capsule est remplacée. Les capsules de mesure multijets de NeoVac ATA s’adaptent à pratiquement tous les systèmes courants.

Le compteur à oscillateur fluidique Superstatic 749 peut désormais être utilisé pour les bâtiments résidentiels En matière de mesure de chaleur dans les bâtiments résidentiels, le compteur de chaleur compact Superstatic 749 de NeoVac est une nouveauté absolue. Le débit est mesuré par l’innovant compteur à oscillateur fluidique Superstatic. Celui-ci repose sur le principe de mesure de débit hydrodynamique et fonctionne sans pièces mobiles. Le fluide se met à «osciller», la fréquence de l’oscillation étant proportionnelle à la vitesse du flux. Les avantages sont évidents: grande sécurité de fonctionnement, fonctionnement pratiquement sans usure et stabilité de mesure, même lorsque l’eau de chauffage est

bâtitech 5-14

Caractéristiques du Superstatic 749 • • • • • • • • • • •

Compteur à oscillateur fluidique Débit de 0,6, 1,5 ou 2,5 m³/h Calculateur séparable du débitmètre Mémoire EEPROM imperdable Mémorisation sur 18 mois Fonction heating-cooling Communication par M-Bus, radio ou optocoupleur Superstatic 749, le principe de l’oscillateur fluidique 2 entrées d’impulsion (en fonction du modèle) enfin utilisable pour les Batterie lithium longue durée échangeable bâtiments résidentiels. Classe de protection du boîtier: IP 65 Conforme à la directive MID 2004/22/CE modules B et D, EN 1434, classe 2

fortement souillée. Les deux produits peuvent être utilisés aussi bien comme compteur de chaleur, compteur de froid ou combiné. Pour la communication, différentes interfaces telles que le M-Bus ou des ondes radio sont disponibles. Le SC 739 et le SC 749 répondent tous deux aux exigences de la directive européenne

sur les instruments de mesure MID 2004/22/CE modules B et D ainsi qu’à celles de la norme EN 1434. NeoVac ATA SA CH-1630 Bulle Tél. 058 715 56 00 www.neovac.ch

C’est l’impact qui fait la différence. Dans le monde entier. Envoyez votre courrier à l’étranger depuis la Suisse et marquez deux fois plus de points auprès de votre public cible. Premièrement, parce que dans le pays de destination votre courrier publicitaire se distingue du courrier ordinaire. Deuxièmement, parce que vous signalez déjà sur l’enveloppe que son contenu est gage de qualité suisse. Faits, exemples de réussite et inspiration: poste.ch/impact En collaboration avec:

27


28

bâtitech 5-14

produits

Arbonia AG / Design intemporel – Puissance thermique élevée

Radiateur «Duolino» Le langage des formes droites du nouveau radiateur multicouche Duolino d’Arbonia incarne le minimalisme et l’intemporalité. Grâce à sa grande surface de chauffage, il convient idéalement à une utilisation dans les grandes pièces ainsi qu’à l’association avec des systèmes de chauffage basse température. Son rapport prix-performance sait lui aussi convaincre. Avec son design intemporel associant tubes ronds horizontaux et tubes collecteurs verticaux trapézoïdaux, le nouveau Duolino s’intègre en toute harmonie dans presque toutes les ambiances, qu’il s’agisse d’espaces privatifs ou de bâtiments de standing. De plus, il convainc par ses avantages pratiques: l’agencement par bloc des tubes de chauffage permet d’accrocher facilement les serviettes et de les saisir avec la même simplicité.

thermique augmentée d’environ 65 % par rapport aux radiateurs monocouches. Le radiateur design convient donc à l’utilisation dans les grandes pièces, spécialement pour les salles de bains qui se font toujours plus vastes. Dans les systèmes basse température, Duolino joue de ses forces en matière de répartition de la température. Sa grande surface en fait un complément idéal aux sources de chaleur à efficacité énergétique alternatives, comme les pompes à chaleur et les systèmes de chauffage solaires.

Dimensions compactes – puissance thermique élevée

Variantes de raccordement pratique

En raison de la construction à plusieurs niveaux, Duolino offre une puissance

De série, le Duolino est livré avec un raccord central de 50 mm. Lors de la planifi-

cation et du montage, ce raccord apporte beaucoup de flexibilité étant donné que le dimensionnement du radiateur peut se faire à un stade avancé. Pour la rénovation, Arbonia propose des versions Duolino Flex dotées d’un raccord latéral variable. Les écarts des moyeux sont parfaitement adaptés aux anciens radiateurs DIN à la technique et à l’esthétique désuètes. Le remplacement est rapide et se réalise sans effort de transformation.

Duolino en mode électrique Appoint du chauffage central ou version tout électrique, Duolino est livrable en quatre variantes, nouvelles solutions électriques comprises. Grâce à un menu structuré et simple à utiliser, la régulation du radiateur est un jeu d’enfant. La variante Comfort WFC est équipée d’un écran convivial à programmes prédéfinis et de profils de chauffage personnalisables. Sur les variantes standard WKS et WFS ainsi que sur la variante à bride FKS, l’utilisateur a le choix entre cinq niveaux ou la touche Booster pour bénéficier en un tournemain d’une agréable chaleur dans la pièce.

Flexibilité en matière de dimensions et de couleurs – fixation sûre Pour assurer un dimensionnement exact conformément au besoin thermique et à l’espace requis pour les hauteurs 1200, 1500 et 1800 mm et les longueurs 450, 600, 750 et 900 mm. La peinture standard du Duolino est blanc RAL 9016. Sur demande, le radiateur est livrable dans toutes les couleurs RAL, NCS et sanitaires ainsi que dans les peintures tendance de la palette Arbonia New Inspiration Colours. Les fixations sont généralement livrées dans la couleur du radiateur. Les éléments de fixation s’intègrent parfaitement au design et forment une unité optimale avec le radiateur. En outre, ils répondent aux nouvelles directives de la VDI 6036.

Design intemporel, associé à une puissance thermique élevée et un rapport prix-performance économique, le nouveau Duolino présenté en version onyx.

Arbonia AG CH-9320 Arbon www.arbonia.ch


produits

bâtitech 5-14

29

Lucoma AG

Swisslux IL1: Luminaires LED intelligents IL1 de Swisslux

Portes de révision à encastrer dans maçonnerie ou gaines

Luminaire intelligent IL1: Le luminaire qui passe à l’action

Les portes de révision Lucoma se distinguent par leur exécution particulière et leur qualité. Une fabrication de mm en mm – dans (presque) tous les matériaux – constitue la marque de tous les produits Lucoma. Grâce à une fabrication moderne, rationnelle, l’excellence ne doit pas nécessairement être coûteuse. Des délais de livraison rapides et un rapport prix/performances optimal sont les caractéristiques bien connues de nos produits en Europe.

Exécution Cadre: profilé Z, 3 mm Encastrement dans maçonnerie (avec ancrages) ou encastrement dans gaines Joint périphérique Poignée de fermeture sur les deux faces Battant de porte intégré dans le cadre Battant de porte isolé avec 25 mm de laine minérale (calorifugeage) Montant démontable pour les surlargeurs (porte à 2 battants) Isolation des panneaux de porte jusqu’à une épaisseur de 100 mm Exécution zinguée Cadres zingués, panneaux de porte zingués sendzimir Exécution avec couche de fond Cadres avec couche de fond grise, panneaux de porte zingués sendzimir Exécution inox ou dans d’autres matières sur demande Dimensions de base Exécution standard à partir de 400 × 400 mm ( (H × B) Echelonnement au millimètre selon souhaits du client Accessoires – Cylindre Kaba avec serrure – Regard en verre ø 200 mm ou grille pare-pluie Lucoma AG CH-3646 Einigen Tél. 033 655 00 44 info@lucoma.com

Luminaire intelligent pour montage apparent au plafond ou au mur Modèles entièrement automatiques ou semi-automatiques disponibles Détecteurs de mouvement ou de présence à infrarouge passif performants et anti-interférences Luminaire disponible également sans détecteur Délimitation claire de l’espace grâce au clip de recouvrement Télécommande disponible comme accessoire Flux lumineux 2000 lm (1772 lm avec couvercle) Température de couleur 3000 K Puissance nominale lampe: 21 W/LED Portée: Ø 10 m (mouvement tangentiel) Dimensions [mm]: Øxh 350x81 Description

No-E

IL1-R35M, avec détecteur de mouvement IL1-R35PA, avec détecteur de présence, automatique IL1-R35PH, avec détecteur de présence, semi-automatique IL1-R35, sans détecteur

941 304 079 941 305 079 941 306 079 941 303 079

Swisslux AG Industriestrasse 8 8618 Oetwil am See Tel: 043 844 80 80 Fax: 043 844 80 81 Technik-Hotline: 043 844 80 77

Swisslux SA Chemin du Grand Clos 17 1092 Belmont-sur-Lausanne Tél: 021 711 23 40 Fax: 021 711 23 41

www.swisslux.ch


30

bâtitech 5-14

produits

Vaillant

Nouvelle pompe à chaleur air/eau à technologie Inverter Vaillant, le spécialiste en technologie de chauffage, complète son offre en Suisse avec le nouveau système de pompe à chaleur aroTHERM air/eau. L’entreprise utilise pour la première fois une unité extérieure avec compresseur modulant. «Avec la nouvelle aroTHERM nous offrons une pompe à chaleur air/eau avantageuse avec laquelle nous satisfaisons tout de même les hautes normes de qualité Vaillant», explique Tobias Loher, chef de produit et marketing pour Vaillant Suisse. «Le développement et la production du nouveau système de pompe à chaleur a été et est entièrement réalisé par Vaillant.» Le produit peut être utilisé

place en étant montée près d’un mur de la maison. Le fluide frigorigène de la pompe à chaleur est enfermé dans un circuit hermétique, ce qui élude l’installation des tuyaux de réfrigérant. L’équipement comprend le contrôleur de système Vaillant VRC 470 et une station hydraulique appropriée, laquelle contient tous les composants nécessaires, par exemple un vase d’expansion, une soupape de sécurité et une vanne à trois voies pour préparer de l’eau chaude sanitaire. Ceci garantit une installation particulièrement simple et rapide. En outre il est proposé, dans le même design que la station hydraulique, un tampon mural compact d’environ 40 litres de capacité. Le tampon compact fournit la quantité d’eau de circulation nécessaire ou le dé-

couplage hydraulique. Les chauffe-eau existants et appropriés peuvent bien sûr encore servir. Durant les périodes chaudes, la nouvelle pompe à chaleur fournit un confort supplémentaire, grâce à la fonction économique et écologique de rafraîchissement actif. Un capteur d’humidité intégré dans le système de commande empêche un dépassement possible en dessous du point de rosée. La nouvelle pompe à chaleur air/eau est disponible en deux puissances, à savoir en 5.6 ou 8.4 kW (A2/W35). Vaillant Sàrl CH-8953 Dietikon Tel. 044 744 29 19 www.vaillant.ch

• Pompe à chaleur air/eau avantageuse avec les standards de qualité Vaillant élevés • Système complet avec circuit frigorifique hermétiquement fermé pour bâtiments neufs ou existants • Station hydraulique murale et tampon compact • Utilisation intuitive avec le régulateur de système Vaillant calorMATIC 470 • Fonction de rafraîchissement actif

Avec le nouveau système de pompe à chaleur air/eau aroTHERM, Vaillant offre aux installateurs un produit de grande qualité à un excellent rapport qualité-prix.

dans les constructions neuves ainsi que dans le parc immobilier existant et est axée sur un fonctionnement en mode mono-énergétique ou bivalent. La nouvelle pompe à chaleur est conçue de manière compacte et prend peu de

L’aroTHERM peut être installée rapidement et facilement, directement à proximité d’un mur de la maison.


produits

bâtitech 5-14

Le raccord à assemblage rapide en dimensions 16 à 25 mm, avec passage intégral et technique de raccordement sans outillage – une solution unique !

R. Nussbaum SA Fabricant de robinetterie et systèmes techniques sanitaires 4601 Olten www.nussbaum.ch

31


32

bâtitech 5-14

produits

Walter Meier

La nouvelle génération d’appareils pour l’aération douce d’Oertli En avril 2014, Walter Meier lancera une nouvelle génération d’appareils pour l’aération douce d’Oertli. À lui seul, le nom de la série exprime clairement à quoi s’attendre des nouveaux appareils. En espéranto, la langue internationale construite, le mot Spirado signifie respiration, souffle. En donnant ce nom à cette ligne de produits, on a voulu souligner l’orientation conséquente des installations vers l’être humain, son confort et sa santé. Série H: avec échangeur de chaleur rotatif Avec les deux modèles Spirado H300 et H400 d’Oertli, Walter Meier lance dans la course deux appareils à la pointe de la technologie, dotés d’un échangeur de chaleur rotatif avec technologie brevetée

En raison de leurs débits d’air allant de 80 à 400 m3/h, les nouveaux appareils sont employés principalement dans les appartements, les maisons individuelles, les immeubles collectifs ou les petits bâtiments industriels. Ils conviennent parfaitement tant aux constructions neuves qu’aux assainissements. Concernant les emplacements de montage, on les installe en particulier dans les réduits ou les locaux techniques, mais aussi dans les placards qui conviennent parfaitement. Les appareils Spirado de la série H convainquent aussi par leur très grande flexibilité côté montage. Pour assurer un cheminement de canal optimal, ils sont disponibles en exécution à gauche ou à droite. Leur installation est en outre facilitée grâce aux raccords rapides pour tous les branchements électriques. Sans compter qu’ils satisfont aussi aux exigences les plus personnelles grâce à un programme d’accessoires très vaste.

particulièrement étendue, ce qui privilégie leur emploi aussi bien dans les petits appartements, que dans les maisons individuelles et les immeubles collectifs, ainsi que dans les bureaux, les surfaces commerciales, les jardins d’enfants ou locaux similaires. Les appareils Spirado de la série S d’Oertli sont eux aussi faciles à monter et sont disponibles en exécution à gauche ou à droite.

Unité de commande haut de gamme Tous les appareils de la série Spirado d’Oertli sont dotés d’une unité de commande intuitive haut de gamme avec écran LCD intégré. Cette unité est installée dans une boîte de branchement encastrée ou au mur, et est raccordée à l’appareil via un câble modulaire. Pour commander l’appareil depuis plusieurs endroits, il existe la possibilité de raccorder une unité de commande supplémentaire ou de prévoir son intégration dans le système de gestion du bâtiment.

Walter Meier (Climat Suisse) SA CH-8603 Schwerzenbach Tél. 044 806 41 41 www.waltermeier.com

Série S: avec échangeur de chaleur en croix à contrecourant

Les appareils Spirado série H d’Oertli avec échangeur de chaleur rotatif pour une récupération efficace de la chaleur et de l’humidité.

pour une récupération efficace de la chaleur et de l’humidité. Avec un rendement thermique d’environ 80 % et des ventilateurs EC performants, ces deux appareils s’avèrent être énergétiquement très économiques. De plus, leur filtre pour l’hygiène de l’air de classe F7, tant pour l’air frais que pour l’air vicié, assure en permanence un air pur et sain.

Quant aux nouveaux appareils Spirado série S d’Oertli avec échangeur de chaleur en croix à contrecourant, ils sont eux aussi à la pointe de la technologie tant pour leur efficacité énergétique que pour leurs caractéristiques opérationnelles. L’échangeur de chaleur à plaque, le rendement thermique élevé, les filtres efficaces pour l’hygiène de l’air, de classe F7 pour l’air frais et G4 pour l’air vicié, les ventilateurs EC performants et économiques et l’unité de commande haut de gamme de série assurent une qualité de l’air toujours parfaite et une utilisation parcimonieuse de l’énergie. Grâce à leurs débits d’air allant de 80 à 650 m3/h, les appareils Spirado de la série S couvrent une plage d’utilisation

Echangeur de chaleur rotatif avec technologie brevetée.


produits

bâtitech 5-14

33

ELECTROTECHNIQUE

Automatisation souple et facile

Système L-ROC de Loytec Avec le système intelligent L-ROC de Loytec, l’automatisation flexible des locaux devient réalité, car ce système offre des solutions qui satisfont à toutes les exigences des bâtiments modernes. Le système est constitué de deux composants principaux: d’une part, d’un régulateur d’ambiance performant, le module L-ROC, et d’autre part, de l’outil de programmation L-Studio. Cet outil permet de réaliser des applications réparties, déclenchées par des évènements, ainsi que des visualisations en relation avec les modules L-ROC. Avec L-ROC et L-Studio, il est possible de concevoir des systèmes complets en une seule étape, en s’appuyant sur des concepts éprouvés et com-

plétés par des techniques de programmation modernes. Elément de base de chaque projet: un segment spatial régissant les fonctions disponibles. Les segments sont regroupés en locaux, les locaux à leur tour, en zones. Grâce au LROC-100 – un équipement informatique performant –, il est possible d’automatiser jusqu’à 16 segments spatiaux avec une seule commande, pour les fonctions chauffage/ refroidissement, ventilation, éclairage, ombrage ou protection contre l’intrusion. Avec un concept orienté objet et des bibliothèques intelligentes, L-Studio permet de réaliser un système réparti complet, qui rassemble une multitude d’appareils L-ROC dans un «Cloud Control» flexible. Les segments sont visuali-

sés sur des écrans tactiles L-VIS ou sur des terminaux mobiles, grâce à l’interface LWEB-802.

Omni Ray AG CH-8600 Dübendorf Tél. 044 802 28 80 info@omniray.ch www.omniray.ch

Une esthétique visionnaire avec système d’écoulement mural – la nouvelle surface de douche émaillée avec écoulement mural intégré se fond totalement dans le sol de la pièce. Aucun vidage ne vient perturber le design puriste. La solution système, facile à monter et dans laquelle tous les composants permettent une installation conforme, offre aux concepteurs de salles de bain des possibilités d’aménagement innovantes et esthétiques pour les espaces de douche à l’italienne.

XETIS


34

bâtitech 5-14

produits ELECTROTECHNIQUE

DEHN + SÖHNE GmbH + Co. KG

DEHNcare protège contre les arcs électriques parasites DEHN vient de mettre au point, dans le cadre de l’équipement de protection individuelle, un vêtement de protection testé pour protéger contre les arcs électriques. A côté du casque et des gants, le vêtement de protection est le troisième élément important pour réduire les risques de blessure dus aux arcs électriques parasites lors de travaux sur des installations électriques. Ce nouveau vêtement deux pièces sert à protéger contre les effets thermiques des arcs électriques lors de travaux sur des installations électriques. Lors du choix des matériaux, on a attaché une attention particulière à la fonction de protection (CEI 61482-1-2 classe 2) et au confort. Pour cela, il a fallu à nouveau avoir recours au cuir et au néoprène à respiration active déjà utilisé avec succès pour les gants. Avec la doublure intérieure ignifuge et les bandes réfléchissantes incrus-

tées, cet équipement garantit une protection totale. Tous les éléments insérés, tels que fermetures à glissière ou velcro, sont également en matériau ignifuge. En plus des avantages susmentionnés, des appli-

DEHNcare – équipement de protection testé contre les arcs électriques parasites.

cations comme les poches latérales recouvrables sur les manches et les jambes complètent l’apparence de ce vêtement. Celui-ci est proposé dans six tailles, et répond ainsi aux différents besoins individuels. Des essais normalisés démontrent l’efficacité de la protection des casques, gants et vêtements DEHN contre l’arc électrique. DEHNcare® offre à la fois un maximum de protection et un confort sans pareil. Le choix des matériaux utilisés et la finition haute qualité de ce vêtement le rendent particulièrement agréable à porter. Tous les appareils et équipements de sécurité de DEHN sont fabriqués et testés conformément aux prescriptions des normes en vigueur. Pour les essais répétitifs sur les accessoires de mise à la terre et en court-circuit, contrôleurs de tension, perches de travail, pinces de sécurité, perches isolantes et perches de mise à la terre, il est possible de bénéficier du concours de la société DEHN qui se positionne ainsi en tant que partenaire fiable. www.dehn.de www.elvatec.ch

A propos DEHN est une entreprise familiale présente sur le marché international, leader dans le domaine de l’électrotechnique, qui emploie dans le monde plus de 1400 collaborateurs et propose des produits et des solutions innovants ainsi qu’un service complet pour la protection contre les surtensions, la foudre et les risques électriques au travail. DEHN se concentre sur la protection dans de nombreuses branches et marchés d’avenir, comme le photovoltaïque, l’énergie éolienne et les installations au biogaz, les systèmes des techniques des télécommunications et de la circulation ainsi que dans les industries de type process. La croissance continue de l’entreprise repose sur plus de 100 ans de tradition et d’expérience mais avant tout sur des exigences de qualité élevées et la prise en compte cohérente des besoins des marchés et des clients.


produits

bâtitech 5-14

ELECTROTECHNIQUE

Interrupteur automatique PIR 160 R

Détecteur de mouvement à poussoir de commande L’interrupteur automatique PIR 160, dans le design EDIZIOdue et Standard, est un détecteur de mouvement comportant un poussoir de commande intégré. Il enclenche et déclenche l’éclairage automatiquement en fonction du mouvement et de la luminosité ambiante. Grâce au poussoir, il est possible de commander l’éclairage manuellement. Tout comme c’est le cas pour un interrupteur d’éclairage normal, on enclenche ou on déclenche l’éclairage en pressant une touche. Après une pression prolongée de la touche, l’état sélectionné est conservé pendant quatre heures. L’utilisateur profite ainsi du confort de l’automatisme et peut quand même adapter l’éclairage individuellement à ses besoins. L’interrupteur automatique PIR 160 se configure manuellement ou de manière beaucoup plus conviviale et plus simple avec l’application PIR 160 pour smartphone.

Domaine d’utilisation L’interrupteur automatique PIR 160 associe les fonctions d’un détecteur de mouvement et celles d’un interrupteur d’éclairage à commande manuelle: Les fonctions des touches Encl./Décl. et Encl./Décl. permanent (4 h) permettent d’assurer que l’éclairage ne s’éteint pas lorsqu’il n’y a que peu de mouvement ou qu’il reste éteint même en cas de mouvement. Ou bien on éteint l’éclairage en appuyant rapidement sur la touche en quittant une pièce (éco-décl.) afin d’éviter la temporisation du détecteur de mouvement. Ces fonctions font de l’interrupteur automatique PIR 160 l’accessoire idéal pour les entrées, les garages, les caves, les pièces de rangement, etc., ainsi qu’une alternative intelligente aux interrupteurs d’éclairage manuels.

Caractéristiques • Détecteur de mouvement à poussoir de commande • Champ de détection de 160 ° (réductible)

L’interrupteur automatique PIR 160 est livrable dans le design EDIZIOdue et Standard.

• Fonction de touche Encl./Décl., Encl./Décl. permanent (4 h) • Eclairage d’orientation en 5 couleurs • Configuration manuelle ou via l’application Fusionneuses • Modes de fonctionTelecom & Test Solutions INNO IFS-Série nement du détecteur de mouvement: La qualité des produits Sud-coréens vous convaincra ! automatique et semi-automatique • Sortie relais: IFS-10 10 A, 2300 watts ACentrage par le coeur • Connexion: AConçue pour une utilisation Bornes enfichables dans des conditions extérieures difficiles A3 ans de garantie

Types de charge • Lampes LED: 200 W/VA • Lampes halogènes HT: 1800 W • Lampes halogènes BT à transformateur conventionnel: 1200 VA • Lampes halogènes BT à transformateur électronique: 600 VA • Lampes basse consommation: 600 W/VA • Ballasts électroniques: 600 W/VA www.feller.ch

IFS-15H ACentrage par le coeur ADéveloppée pour des installations FTTx A3 ans de garantie Prix très attractifs

Le spécialiste des techniques de mesures Télécom Pour la Suisse Romande: Tel. 032 753 81 32

ISATEL Electronic AG Hinterbergstrasse 9 CH-6330 Cham Tel. 041 748 50 50 Fax 041 748 50 55 www.isatel.ch

35


36

bâtitech 5-14

produits ELECTROTECHNIQUE

Nouveau détecteur de mouvement au design compact

Plus sobre, plus mince, plus élégant Il est plus élégant que ses prédécesseurs – et plus mince. La technologie dont il est doté est meilleure – et plus précise. Le détecteur de mouvement extérieur theLuxa de thebenHTS se montre sous son meilleur jour. A monter sur n’importe quel mur. Et pour certaines versions, également au plafond. La plupart des gens ne le remarqueront même pas. Toute la gamme des nouveaux détecteurs de mouvement theLuxa affiche un design identique et se fond dans tout type d’architecture extérieure. theLuxa est un détecteur idéal pour les applications domestiques privées: voies d’accès et entrées, portes arrière et entrées latérales, mais également abris de voitures ou garages à vélo. Les détecteurs theLuxa sont actuellement

servant à délimiter partiellement la zone de détection. Les commutations intempestives peuvent ainsi être évitées.

Montage élégant au plafond Les détecteurs de mouvement sont généralement fixés au mur, mais grâce à sa tête de capteur pivotable, le modèle theLuxa S360, est adapté à un montage au plafond ou

ducteur de protection et au support pour bornes à enficher, le montage des détecteurs theLuxa est plus rapide et plus fiable. Plus compact pour un montage mural.

Protection anti angle mort (anti-reptation) La protection anti angle mort des détecteurs theLuxa permet de surveiller les zones situées directement en-dessous du capteur et même légèrement en arrière de celui-ci. Ainsi, la lumière s’allume uniquement quand cela est nécessaire. Immédiatement – pas après avoir trébuché sur les premières marches.

Fonctions essentielles Plus compact pour un montage mural theLuxa S150/180

Plus performant theLuxa S360

Le détecteur de mouvement peut également être activé manuellement. Cela est particulièrement pratique, lorsqu’on entend par exemple un bruit en dehors de la zone de détection. Avec la fonction impulsions, il est possible d’intégrer les détecteurs de mouvement à des installations électriques existantes avec minuteries d’escalier ou KNX, sans devoir procéder à des adaptations coûteuses. Grâce à sa commutation au passage à zéro de la tension, theLuxa admet des charges de commutation atteignant 10 A même pour des charges capacitives.

theLuxa S150/180 possède une lentille orientable permettant de surveiller uniquement la zone souhaitée.

Imperméable à la pluie

disponibles en versions standards S150/ S180 et S360, en noir ou blanc. Qu’il s’agisse des versions Standard ou Performance – toute la gamme de produits séduit par son design élégant et harmonieux.

Socle enfichable spacieux

L’indice de protection IP55 des détecteurs theLuxa n’est pas uniquement un gage de sécurité. Il a également un côté pratique: les détecteurs theLuxa peuvent être fixés n’importe où à l’extérieur, même dans des endroits non-protégés.

Le détecteur de mouvement dispose d’un socle enfichable spacieux facilitant les raccordements. Le détecteur n’est enfiché qu’à la fin de l’installation. Le marquage des bornes se situe au-dessus du raccordement correspondant. Grâce à sa borne de con-

Theben HTS AG CH-8307 Effretikon Tél. 052 355 17 00 sales@theben-hts.ch www.theben-hts.ch

Tête de capteur pivotable Grâce à sa tête de capteur pivotable à l’horizontale, theLuxa couvre uniquement les zones souhaitées. Chaque détecteur theLuxa S360 est livré avec des clips d’obturation

LOGICIEL POUR LA CONSTRUCTION ET SERVICES IT POUR LES INSTALLATEURS

sous les avancées de toit. Cela ouvre de nouvelles perspectives en matière d’optimisation de la zone de détection.

Travailler en réseau: Augmentez votre productivité grâce à une organisation efficace et des technologies innovantes. Demandez-nous conseil. › www.brz.eu/ch


produits

bâtitech 5-14

ELECTROTECHNIQUE

Les distributeurs de courant Demelectric garantissent la meilleure sécurité

Distributeurs de courant et plus … Edition 2014 L’époque où les chantiers et halls d’usine étaient équipés de boîtiers de distribution électrique de marque «construction maison» est définitivement révolue. Plus aucun entrepreneur ne veut plus prendre le risque d’interruptions de l’exploitation ni courir le danger d’une protection du personnel insuffisante. Demelectric a une offre complète à cet effet. La gamme assortie de distributeurs de courant et les accessoires associés sont adaptés à l’utilisation temporaire et aux installations fixes. Distributeurs de courant mobiles avec protection des personnes optimale Si une alimentation électrique doit être établie rapidement, les multi-prises mobiles prêtes à l’emploi en caoutchouc dur et les distributeurs de courant en forme de coffret sont appropriés. Il est possible, en très peu de temps, de mettre en place une alimentation électrique sécurisée selon les normes. Les enrouleurs de câble en caoutchouc dur Demelectric munis d’un câble EPR-PUR «Superflex» complètent cette gamme de manière optimale.

Pour une sécurité accrue des raccordements de chantier provisoires Pour la mise en place d’une distribution de courant pour les chantiers sans interrupteurs différentiels intermédiaires, Demelectric propose une gamme composée de coffrets de chantier, de distributeurs de courant en caoutchouc dur et de rallonges 32 A noires, codifiées 7 h. Ces prises de courant «fixes» sont destinées à l’alimentation provisoire des chantiers. Toutes les autres prises disposent d’un disjoncteur différentiel décentralisé.

courant et plus …» de Demelectric est disponible dès maintenant chez tous les grossistes en matériel électrique organisés. Pour plus d’informations, rendez-vous sur www.demelectric.ch

Des solutions idéales pour les manifestations et stands de marché Avec la gamme Powerbox, Demelectric propose des distributeurs de courant en plastique compacts et à prix avantageux en trois tailles, idéales pour l’utilisation universelle lors de manifestations en tous genres. Tous les modèles sont livrés prêts à l’emploi et équipés d’une poignée intégrée.

Distributeurs de courant dans les ateliers et les halles industrielles

Distributeur de chantier avec connexions et déconnexions codées spéciales pour la meilleure disponibilité.

Pour des installations durables, l’utilisation d’une alimentation à protection décentralisée figure au premier plan. Selon l’endroit où elle est installée, la question de l’usage de boîtiers en caoutchouc dur robustes ou en matière synthétique faciles d’entretien se pose.

Câble de raccordement et de rallonge avec contacts nickelés Les câbles de raccordement et de rallonge sont désormais équipés de contacts nickelés en série. Ces câbles sont ainsi protégés des effets de la corrosion. L’édition 2014 de la brochure «Distributeurs de

Powerbox compacte pratique pour l’utilisation universelle.

Solutions adaptées aux installations fixes.

Alimentation électrique temporaire rapidement disponible.

Câble de rallonge avec contacts nickelés résistant même aux environnements les plus difficiles.

37


38

bâtitech 5-14

produits ELECTROTECHNIQUE

Commande miniature BACnet décentralisée

Enregistreur de données compact pour la gestion de l’énergie Le CX8091 est le dernier né de la gamme CX8000, il est actuellement le plus petit PC Embarqué de Beckhoff. Avec la prise en charge du protocole BACnet, le CPU 400 MHz ARM9 et la large gamme de bornes d’E/S Beckhoff sont une commande pour l’automatisation des bâtiments. En outre, le CX8091 combiné aux bornes de mesure de puissance sert d’enregistreur de données compact, fournissant via BACnet toutes les données utiles pour une gestion globale de l’énergie.

énergétique. Beckhoff intègre BACnet/IP dans son logiciel d’automatisation TwinCAT, comme des solutions 100 % logicielles. Le serveur et le client BACnet/IP fonctionnent sur tous les PC industriels Beckhoff et PC embarqués. Ainsi, le CX8091 devient lui aussi un BACnet Building Controller. Les objets BACnet sont créés dans le système de gestion TwinCAT et peuvent y être paramétrés et reliés. Une interface cyclique permet de relier directement à un objet BACnet des données d’une borne d’entrée/sortie ou à partir du programme TwinCAT. Une interface acyclique est utilisée pour lire et écrire les «propriétés» d’un objet BACnet afin que pendant la durée de fonctionnement, il soit possible d’y accéder à partir du programme PLC. TwinCAT permet de scanner un réseau pour rechercher les appareils BACnet et d’accéder à leurs objets ou propriétés. En alternative, le PC Embarqué CX8091 gère également le standard de communication OPC UA (Unified Architecture). Avec ce protocole largement répandu pour l’intégration verticale, cette commande forme la base pour l’acquisition des données d’énergie. www.beckhoff.ch

Le PC Embarqué CX8091 est une commande miniature décentralisée qui, avec BACnet ou OPC UA, sert d’enregistreur de données pour un système de niveau supérieur.

Caractéristiques techniques Le PC Embarqué CX8091 est une commande compacte avec port Ethernet. Il prend en charge le protocole BACnet éprouvé dans l’automatisation des bâtiments et en particulier aux niveaux de gestion et de commande. Il permet de gérer l’ensemble de la gamme d’E/S modulaire Beckhoff. De nombreuses bornes d’E/S sont disponibles spécialement pour l’acquisition des données d’énergie. Par exemple, des compteurs de gaz, d’eau et d’électricité usuels peuvent être intégrés en toute simplicité grâce aux bornes d’E/S KL6781 et KL6401, par le biais d’une interface M-bus ou LON.

L’acquisition des variables électriques s’intègre au système via la borne de mesure de puissance KL3403. D’autres bornes d’E/S permettent d’intégrer aisément des sous-systèmes classiques comme EIB/KNX, DALI, MP-bus, EnOcean, DMX, SMI et Modbus.

BACnet pour la communication de niveau supérieur Le standard de communication BACnet convient idéalement pour la communication entre l’automatisation des bâtiments et les niveaux de gestion et de commande, ainsi que le système de gestion

– Système d’exploitation: Windows CE 6 – Contrôleur 32 bits avec CPU 400 MHz ARM9 – Mémoire flash: carte Micro SD 256 Mo (option 1 Go, 2 Go ou 4 Go) – Mémoire principale interne: RAM 64 Mo – Interfaces: 1 × Ethernet 10/100 Mbit/s, 1 × appareil USB (derrière le couvercle frontal) – Alimentation ondulée 1 seconde (pour 1 Mo de données persistantes)


F07

Distributeurs de courant: une solution pour chaque utilisation!

Armoires de chantier 69 kVA E-No 827 750 109

     

       

           

  !" # $%&'! (  ))  "# $ *** %+   %&'(  )  ** 

Pression adÊquate‌ ‌que ce soit au 1er sous-sol ou au 12e Êtage, les installations de surpression

Distributeurs de courant en caoutchouc 63 A E-No 834 790 297

Distributeurs de courant en matière synthÊtique 40 A E-No 834 790 627 Distributeurs de courant en caoutchouc 63 A E-No 834 796 087

Häny veillent à la pression requise afin que l'eau soit toujours et partout disponible. Quelles que soient les questions de surpression qui vous prÊoccupent, vous

Câble de rallonge avec CEE 32 A 20m E-No 119 082 327

n'avez plus de souci à vous faire. Un appel à Häny, et vos problèmes seront rÊsolus. En tant que fournisseur de systèmes dans la technique domestique,

Commandez maintenant la nouvelle brochure „Distributeurs et plus... 2014“!

nous avons toujours la solution qui vous convient.

Nous y veillons.

ReprÊsentation pour la Suisse: Häny SA - Pompes, turbines et systèmes TÊl. +41 44 925 41 11

•

•

Buechstr. 20

Fax +41 44 923 38 44

•

•

CH-8645 Jona www.haeny.com

Demelectric SA • Steinhaldenstrasse 26 • 8954 Geroldswil tÊlÊphone +41 (0)43 455 44 00 • fax +41 (0)43 455 44 11 info@demelectric.ch • www.demelectric.ch

Achat auprès des grossistes. Demandez notre documentation.


40

bâtitech 5-14

partie technique

Mise au point de sécurité électrique

Vérification de la chute de tension La vérification de la chute de tension est évoquée à plusieurs reprises dans les normes actuellement en vigueur. Toutefois, dans la pratique, cette vérification n’est pas encore effectuée régulièrement. La chute de tension fait très souvent l’objet d’une vérification uniquement à partir du moment où le client se plaint d’un dysfonctionnement. La vérification de la chute de tension devrait bien entendu être effectuée dès la phase de planification. La prise en compte de cette recommandation permettrait ainsi d’éviter certains dysfonctionnements et problèmes lors de la phase du projet. Michael Knabe*

tance de la canalisation (longueur et section), ainsi que de la charge.

Imaginez-vous le scénario suivant Dans une entreprise industrielle, un artisan branche une meuleuse dans une prise raccordée sur un groupe de luminaires. La lampe halogène située au-dessus de la découpeuse à commande numérique s’éteint immédiatement au moment de l’enclenchement de la meuleuse. Que s’est-il donc passé? La charge importante tirée de la prise a entraîné une telle chute de tension que la lampe s’est éteinte. Le scénario présenté dans ces quelques lignes ne relève pas de la fiction. Il repose sur des expériences pratiques et constitue un fléau qu’il est absolument nécessaire de combattre.

Norme Afin d’agir contre le phénomène mentionné ci-dessus, l’article 5.2.5 de la NIBT (SN SEV 1000 : 2010) stipule la recommandation suivante: «La chute de tension entre le coupe-surintensité général et un récepteur d’énergie ne devrait pas être supérieure à 4 % de la tension nominale du réseau.» Plusieurs indications de ce type sont également contenues dans la norme EN 50160 «Caractéristiques de la tension fournie par les réseaux publics de distribution». Bien que le verbe «devrait» soit employé dans la NIBT, l’application de cet article dans la pratique présente bel et bien un avantage considérable pour le client.

Définition de la chute de tension La chute de tension dépend de la résis-

Si un récepteur important est raccordé à la ligne, la tension chutera également de façon plus prononcée. Dans cet exemple, nous raccordons un poêle électrique nécessitant un courant de charge de 10 A. U = RL × I -›1,75  × 10 A = 17,5 V

Le graphique ci-dessus constitue un exemple présentant une longueur de ligne de 75 m et une section de 1,5 mm2. Il en résulte une résistance de ligne totale de 1,75  (conducteur d’aller et de retour). La chute de tension est le produit de la résistance de ligne et du courant de charge (U = RL × I). Cet exemple ne présente aucune charge raccordée et la chute de tension est par conséquent égale à zéro.

Une petite lampe nécessitant un courant de 0,6 A est à présent raccordée à cette canalisation. U = RL × I -›1,75  × 0,6 A = 1,05 V La tension du récepteur chutera donc à 233,95 V.

La tension qui en résulte est seulement de 217,5 V. Cette chute de tension de 17,5 V est susceptible d’entraîner un dysfonctionnement de certains appareils. Les exemples précédents permettent de bien se rendre compte que la chute de tension dépend directement de la charge du circuit électrique concerné.

Chute de tension admissible Pour déterminer la chute de tension admissible, il existe différentes variantes. La mesure de la résistance de boucle: La chute de tension résulte de la résistance de ligne et du courant de charge. La mesure ZI (Icc L-N) permet de définir la résistance de ligne comme suit: La valeur ZI mesurée au CSG (coupe surintensité général) moins la valeur ZI mesurée au récepteur nous donne la résistance de ligne du tronçon entre le CSG et le récepteur. Le courant de charge est mesuré et un calcul approprié est effectué en conséquence. Vérification avec une charge: Un voltmètre permet de mesurer la tension à un point de mesure. Un consommateur est ensuite branché et la tension est à nouveau mesurée. La chute de tension est alors donnée par la différence des deux mesures.


bâtitech 5-14

41

ELECTROTECHNIQUE

Commandez dès maintenant ! 3e

n

éditio

Livre : La sécurité dans les installations électriques Illustration 1: NIBT Figure 6.D.1; a) section du conducteur, b) longueur de la canalisation, c) courant de charge.

Illustration 2: Vérification de la chute de tension au moyen de NIBT digital.

L’application du nomogramme: La figure 6.D.1 de la NIBT (SN SEV 1000 : 2010) présente un nomogramme dont les paramètres de section et de longueur de ligne ainsi que le courant de charge permettent de définir la chute de tension (voir illustration 1). Mesure avec le testeur d’installation: Les testeurs d’installation modernes disposent d’une fonction de mesure destinée à déterminer la chute de tension. NIBT digital: L’outil de planification d’installations de la NIBT numérique permet de définir en toute simplicité la chute de tension pour toutes les sections de ligne (voir illustration 2).

Conclusion La vérification de la chute de tension fournit une valeur ajoutée significative au

client. Le non-respect de la chute de tension admissible est susceptible d’entraîner des dysfonctionnements imprévisibles aux appareils raccordés. Plusieurs dispositifs modernes (la NIBT digital, les instruments de mesure, etc.) permettent désormais d’effectuer la vérification de la chute de tension sans devoir réaliser d’ef■ forts considérables.

Pour les producteurs d’électricité et les exploitants des réseaux, l’absence d’accidents lors de l’utilisation de leurs produits présente une importance capitale. La nouvelle édition du livre spécialisé « La sécurité dans les installations électriques » publiée par Electrosuisse leur apporte une aide précieuse afin de réaliser cet objectif. Les connaissances clairement présentées dans la version actualisée de ce livre contribuent à faire rimer électricité et sécurité. Peter Bryner, Josef Schmucki: La sécurité dans les installations électriques Edition 2013, ISBN 3-905214-81-9, volume 312 pages, format 175 x 238, poids 750 g, prix: Fr. 69.– pour membre; Fr. 92.– pour non-membre

Auteur * Michael Knabe, installateur-électricien diplômé, exerce les fonctions d’inspecteur auprès de l’équipe d’inspection nord-est d’Electrosuisse. Son activité d’inspection lui a permis de devenir un connaisseur et un utilisateur avisé des techniques de mesure dans la pratique. Un tel savoir technique est également mis en œuvre dans la partie pratique de l’inspection, ainsi que dans divers exposés et articles spécialisés.

T +41 44 956 11 65 F +41 44 956 14 01 normenverkauf@electrosuisse.ch Electrosuisse Vente de normes Luppmenstrasse 1 CH-8320 Fehraltorf


42

bâtitech 5-14

partie technique ELECTROTECHNIQUE

Matériel endommagé par l’eau ou la fumée ou tout simplement vétuste

A remplacer ou non? La rénovation des installations électriques soulève rapidement la question, à savoir, s’il est possible de laisser en place les ensembles d’appareillages ou les composants isolés tels que disjoncteurs de canalisation, dispositifs à courant différentiel résiduel (DDR), contacteurs, etc., ou si, pour des raisons de sécurité, il vaut mieux les remplacer.

réutiliser, il doit répondre à des critères bien plus stricts que le matériel de commutation pur. En effet, entre la réutilisation d’un composant relatif à la sécurité et celle d’une partie d’un interphone, la différence est grande.

tifs de protection différentielle est incontournable. Cela implique fréquemment l’installation d’un nouvel ensemble d’appareillages. Mais continuer à utiliser du matériel électrique simple, ne se montre pas toujours rentable. L’extension et la mise en état de l’installation demandent du temps. Dans de nombreux cas, l’achat de nouveaux éléments simples est même

Les normes des disjoncteurs de protection de canalisation (LS/MCD) et des disjoncteurs différentiels (DDR) ont été adaptées ces dernières années. Dans la gamme des disjoncteurs de canalisation, les modèles les plus anciens L/V/Z, ont une caractéristique caduque. Ils correspondaient aux consommables typiquement utilisés il y a 20 ans, comme l’atteste la désignation L pour «lumière». Il s’agissait en priorité de lampes à incandescence et de lampes fluorescentes à ballasts traditionnels. Or les nouvelles sources lumineuses fonctionnent presque toutes grâce à des composants électroniques. Cela a nécessité l’application de nouvelles courbes de déclenchement. Les nouveaux disjoncteurs de canalisation sont par ailleurs également conçus pour la commutation de courants de court-circuit plus élevés. Les conditions d’utilisation des DDR ont également changé. Les circuits électriques sont souvent alimentés par des courants non-sinusoïdaux. Mais cela surcharge les anciens disjoncteurs différentiels FI. Le contrôle sur place ne permet pas de mesurer de tels détails. Alors si de tels éléments de sécurité restent en place, les besoins en matière de sécurité des utilisateurs ne seront pas entièrement couverts par les nouvelles parties des installations (Fig.2). Si l’ensemble d’appareillage n’est pas modifié, son exploitation peut en principe continuer en l’état, conformément aux normes. Les nouvelles normes ne sont pas rétroactives. Toutefois, avec des produits non-conformes, aucune restructuration ou modification de la distribution n’est possible, la conformité aux normes actuelles n’étant pas assurée. La déclaration de conformité garantit que le produit – dans ce cas précis le nouvel en-

Rico De Boni

Observations fondamentales Les ensembles d’appareillages et le matériel électrique installé sont comme neufs. Il est donc possible de continuer à les exploiter (fig. 1)? L’ancien ensemble d’appareillage a toujours parfaitement fonctionné, alors pourquoi le remplacer? Une

Presque neufs mais tout de même caduques.

rénovation est en cours ou un événement nous contraint à agir; faut-il renouveler tous les anciens appareils ou est-il possible de continuer à utiliser certains éléments? Pour qu’une installation soit conforme aux normes actuelles, l’ajout de disposi-

moins onéreux qu’une remise en état de l’installation. En outre, un fonctionnement en parallèle ancien/neuf est impossible. La question des coûts mise à part, d’autres éléments sont à prendre en considération. Si le matériel électrique est dédié à la sécurité et qu’on souhaite le

Non-conformité


partie technique

bâtitech 5-14

ELECTROTECHNIQUE

semble d’appareillage – répond aux normes en vigueur.

Disjoncteurs de protection de canalisations

Disjoncteurs différentiels résiduels

Vétusté du matériel Chaque équipement utilisé est soumis à un processus de vieillissement. Celui-ci peut engendrer une usure des pièces et donc une modification des caractéristiques d’origine. Cela peut toucher le déclenchement en soi, qui peut par exemple être retardé. Mais cela peut également induire un déclenchement intempestif. Le système de contact est aussi concerné par ce phénomène de vieillissement, et en cas de courants très élevés, la désactivation fiable du système n’est alors plus assurée. La durée de vie dépend de toute évidence de nombreux facteurs (Fig.3). En effet, le matériel électrique utilisé dans le secteur résidentiel fonctionnera plus longtemps que le matériel fortement sollicité dans l’industrie, les ateliers et au bureau. La

ancien

neuf

Type AC Plus autorisés

Courbe de déclenchement

Type A Sensibles au courant pulsé

Pouvoir de coupure

Type B Sensibles à tout courant

De nouvelles normes de produits.

Interphone-portier vidéo mobile Solutions réseau IP Avec la station extérieure vidéo IP, l’appel de porte retentit sur votre Smartphone, Tablet ou PC. Une installation interphone-portier vidéo conventionnelle peut également être reliée au réseau IP au moyen d’un SIP-Gateway et un serveur vidéo. Ainsi, vous êtes atteignable à tous moment. Idéal pour le domaine industriel, commercial et privé.

René Koch AG 8804 Au/Wädenswil 044 782 6000 info@kochag.ch www.kochag.ch

Station extérieure IP

Smartphone

iPad

Soft-Phone

Pour la Suisse romande 021 906 6767

43


44

bâtitech 5-14

partie technique ELECTROTECHNIQUE

Dégâts des eaux Environnement

Froid/chaud Humidité Contraintes mécaniques

Entretien Construction

Durée de vie

Sophistiqué

Nombre de commutations

Durée de fonctionnement

Charge

minimale permanente surcharge

De nombreux facteurs influencent la durée de vie.

durée de vie des équipements dépend plus de leur durée de fonctionnement que des cycles de commutation. Les indications des fabricants concernant la du-

rée de vie des LS ou des DDR renseignent toujours sur le nombre de cycles de fonctionnement suffisant pour cent ans, en fonctionnement normal.

Réenclencher des installations et appareils électrotechniques qui ont subi des dégâts des eaux constitue un réel danger pour les êtres humains, les animaux domestiques et les biens. Seuls les produits bénéficiant du degré de protection IP67 et plus sont protégés de manière structurelle contre l’immersion dans l’eau. Les appareils de commutation basse tension bénéficient uniquement d’une protection contre tout contact, mais sont très peu protégés contre l’humidité. Dans la plupart des cas, cela concerne également les ensembles d’appareillage domestiques et d’autres équipements électriques. Dans certains cas bien spécifiques, il est possible qu’un boîtier qui bénéficie de la classe de protection IP54 ait été utilisé. Ce dernier ne dispose pas non plus d’une protection suffisante en cas d’inondation. Les ensembles d’appareillages et tout le matériel doivent par conséquent être remplacés après une inondation (fig. 4). Après évacuation de l’eau, même s’il

La bête de somme sans concurrence. Pajero. Maintenant dès

CHF 34’999.– » Robuste, maniable, énormément de place » 3.2 DID diesel, 200 ch, 441 Nm » Super Select 4x4 permanent, avec réducteur

» 3 ou 5 portes, 5 ou 7 sièges, volume du coffre variable jusqu’à 1’790 litres

» Charge tractable 2.8 – 3.5 tonnes » 3 portes 3.2 DID Profi CHF 34’999.–* » 5 portes 3.2 DID Profi Plus CHF 39’999.–* » Crochet de remorque seul. CHF 599.– » Leasing 2.9%** Ill.: 3 portes 3.2 DID Intense automatique CHF 48’999.–

www.mitsubishi-motors.ch www.facebook.com/MitsubishiCH

Ill.: 5 portes 3.2 DID Intense automatique CHF 52’999.–

* BEST OFFER prix nets recommandés, TVA 8% et Cash Bonus 4’000.– inclus. ** Leasing 2.9%: 1.4–30.6.2014, contrat + immatriculation, prix leasing 3 portes Profi 35’999.–, dès 399.–/mois, paiement spécial 15%, 48 mois, 10’000 km/an, intérêt annuel eff. 2.92%, caution 5% (min. 1’000.–), casco complète oblig. MultiLease AG n’accorde aucun financement, si celui-ci peut provoquer le surendettement du preneur de leasing. Consommation normalisée 3 portes: 7.8 l/100 km (équivalent essence 8.7 l/100 km), CO2 207 g/km, eff. énergétique catégorie F, CO2: moyenne de toutes les voitures neuves vendues: 148 g/km.


partie technique

bâtitech 5-14

45

Efficacité énergétique

Swiss Garde 4000 Avec suppression animal!

Tout doit être remplacé!

(Source: elektropraktiker ep)

s’agit d’eau issue de la nappe phréatique, la corrosion provoquée, la saleté résiduelle et les particules en suspension dans les appareils telles que le calcaire, etc. ne garantissent plus la sécurité de l’installation nécessaire. Les connexions internes soudées par point peuvent être attaquées par la corrosion, après un laps de temps très court. Même si l’installation fonctionne encore dans un premier temps, un court-circuit ou une surcharge survenant dans les semaines suivantes, peut provoquer l’adhérence d’un contact et par conséquent une surcharge de l’installation. Les conséquences provoqueront certaine-ment des questionnements désagréables. Même les bornes sont encrassées et il est difficile de prévoir l’ampleur des conséquences. Nettoyer ou réparer est impossible. Alors après la décrue, même si tout semble fonctionner également au niveau des bornes, la corrosion naissante ne permet plus de garantir leur fonctionnement ultérieur. Ceci est valable pour tous les dispositifs de commutation et de protection, indépendamment des fabricants (source: Notice ZVEI). Et pour les dégâts dus aux émanations de fumées, les règles sont fondamentalement les mêmes.

Les contrôles doivent permettre de juger Bien sûr, avec des contrôles on obtient une vue d’ensemble de l’état de sécurité de l’installation. Il ne faut toutefois pas perdre de vue les points suivants: • La mesure de l’isolation n’indique en aucun cas ce qui se passe à l’intérieur des éléments de commutation. • Il n’est pas possible de vérifier sur le matériel, si les exigences en matière de puissance de coupure, établies par les normes de sécurité, sont encore remplies. • Les fabricants sont libérés de leur obligation de garantie, en cas de sollicitation non-conforme aux dispositions.

Bilan Le spécialiste doit par conséquent tenir compte de tous les critères, avant de prendre une décision. C’est finalement lui seul qui porte la responsabilité de l’installation. En cas de dégâts liés à l’eau et à la fumée, appareils électriques et bornes sont concernés et il est conseillé de les remplacer. En cas de rénovation à grande échelle, il est conseillé de remplacer les anciens DDR et LS par des nouveaux, car les anciens modèles ne sont plus conformes. ■

Pour éviter les commutations intempestives de l’éclairage dues aux petits animaux: www.zublin.ch

M. Züblin SA Neue Winterthurerstrasse 30 | CH-8304 Wallisellen Tél. 044 878 22 22 | Fax 044 878 22 33


46

bâtitech 5-14

partie technique

Le «cyclone» ne peut pas toujours être détecté par radar

Tornade en Suisse Chaque année, quelques tornades sont enregistrées en Europe. Habituellement, nous savons que de tels phénomènes se passent dans le Midwest américain. Mais même en Suisse, pendant un orage, des tornades peuvent parfois se produire. Andreas Walker Pendant longtemps, on a supposé que les tornades en Suisse étaient un phénomène extrêmement rare. Toutefois, même chez nous, ces ouragans peuvent se produire pendant les gros orages. Une des conditions préalables importantes pour la formation de tornades, c’est le cisaillement du vent, qui se produit à la limite de la masse d’air, c’est-à-dire que le vent change de direction ou de vitesse lorsqu’il prend de la hauteur. Souvent, un front froid pousse d’ouest en est et sur sa face avant, s’écoule de l’air chaud du sud vers le nord. Cela signifie que la cellule orageuse qui en résulte est placée en face de la face froide, dans une autorotation lente dans le sens inverse des aiguilles d’une montre. Les vents en hausse dans le nuage d’orage tournent également. L’eau sous forme de pluie et de grêle tombe sur le sol dans la zone de ces

courants condensés et donc n’entre pas dans la zone de courant ascendant, cela permet d’engendrer le mouvement tournant. Par ce mécanisme, les zones de vent ascendant et descendant sont clairement séparées et n’interfèrent pas les unes avec les autres. Quand les cellules orageuses ne tournent pas (ce qui est vrai dans la plupart des cas), la pluie tombe dans la zone de courant d’air ascendant, et freine la croissance du nuage orageux. Des recherches faites à l’ETH de Zurich ont montré cependant que certaines cellules orageuses en Suisse ont causé d’importants dégâts et ont fait une autorotation. Cependant, une tornade ne peut pas toujours être directement observée.

2005: plusieurs tornades sur la Suisse Le 5 juillet 2005, à 12 h 50, une petite tornade a fait quelques dégâts à Gossau ZH. Elle a endommagé des toits et des

arbres, laissant clairement des traces, couchant le maïs. Une tempête féroce et inattendue s’est développée en Suisse orientale, le 25 juillet 2005. Le premier de trois forts orages a causé de sévères dégâts principalement à Altenrhein SG. Selon des témoins oculaires, il était 18 h 30, heure locale, lorsque, brusquement, tout s’assombrit. MétéoSuisse a enregistré des rafales allant jusqu’à 144 kilomètres par heure. La tempête a sectionné l’ancrage d’un avion, arraché la toiture d’un hangar

Formation d’une tornade: un nuage d’orage est déplacé par les vents dans le sens contraire aux aiguilles de la montre. En raison de la forte poussée dans le nuage, se crée un cyclone, très près du sol, et la tornade commence sa course destructrice. (Source: Wetterzeichen am Himmel, p. 140)

de l’aéroport d’Altenrhein et causé de grands dommages à des voitures en stationnement sous des arbres déracinés. En outre, le vent a projeté un arbre à travers le toit de l’usine des wagons Stadler. Une image bizarre était ainsi offerte à divers endroits, sur les rives du

*Auteur: Andreas Walker

Un énorme nuage noir s’est constitué. Si un tel nuage est en rotation, une tornade peut se former. (Photos: Andreas Walker)

Il veut traiter, encore plus avant, le thème de la météo et les phénomènes du ciel. Andreas Walker et Thomas Bucheli ont déjà publié un livre en 2011: «Meteorologische Erscheinungen verstehen und richtig deuten»; AZ Verlag, 224 pages, ISBN 978-3-03800-464-6, 38 francs.


partie technique

bâtitech 5-14

47

Formation d’une tornade

16 mai 1991, tornade dans le sud du Kansas (USA). C’est dans le Midwest des Etats-Unis que se produisent la plupart des tornades du monde.

lac de Constance. De gros arbres sains ont été littéralement arrachés par le vent, et de nombreux autres, presque au même endroit, ont survécu à l’événement et sont indemnes. Ces dommages très localisés indiquent qu’il s’agissait de rafales ou d’une possible tornade.

Une tornade n’est pas toujours visible Les enquêtes faites par radar de divers nuages tempêtueux ont montré que les résultats météorologiques pour les tornades en Suisse peuvent être définis par le terme satisfaisant. Cependant, il y a

En été surviennent à la frontière des masses d’air chaudes et froides puissantes en nuages de tempête qui peuvent être compensées par divers courants de vent dans une autorotation lente dans le sens inverse aux aiguilles d’une montre. Avec une forte croissance du cumulonimbus et au pic de son développement, cela peut entraîner une tornade – un cyclone en forme d’entonnoir qui ressemble à une trompe d’éléphant gris et qui part de sous le fond du nuage en direction du sol. La trompe se compose de gouttelettes qui se condensent suite à la pression d’air réduite dans le cyclone. Le chemin d’une tornade peut varier de quelques centaines de mètres à plus de 50 km. Sa durée de vie est de quelques secondes jusqu’à une heure. Les énormes vitesses du vent pouvant atteindre jusqu’à 500 kilomètres par heure, transformant du verre brisé, des morceaux de bois et autres débris volants en projectiles mortels. La faible pression d’air, au centre de la tornade, peut faire exploser les maisons qui sont sur le trajet de la tornade.

Votre fournisseur de frigorigènes. 3 Vaste assortiment de fluides frigorigènes Plus de 20 produits 3 Réseau de livraison couvrant tout le territoire Plus de 45 points de vente 3 Service de livraison PanGas Livraison de toute commande passée avant 12 h 3 Disponibilité maximale Organisation des achats et du conditionnement propre au groupe d’entreprises 3 Concept optimal de récupération et de recyclage Retraitement / récupération au sein du groupe 3 Une offre étendue et avantageuse PanGas AG Siège principal, Industriepark 10, CH-6252 Dagmersellen Téléphone 0844 800 300, Fax 0844 800 301, www.pangas.ch


48

bâtitech 5-14

partie technique

Des trombes marines sur les lacs suisses

Le 13 septembre 2012 sur le lac de Constance: entre 6 h 40 et 10 h 05, sept trombes d’eau sont tombées sur le sol, dans la région du lac de Constance. Ces nombreuses trombes d’eau étaient visibles et comparables à des nuages en entonnoir.

une grande incertitude sur la fréquence d’apparition des tornades chez nous. Si aucun témoin oculaire n’a vu le cyclone, il n’est pas clairement démontré qu’une tornade s’est produite et le cyclone luimême ne peut être situé, car il est trop petit pour un radar. Ainsi, il pourrait se produire une forte tempête à court terme, une colonne de tornade se poser au sol,

Le 12 septembre 2012, un front froid a traversé la Suisse et a provoqué une diminution frappante de la température, qui a mis brusquement fin à l’été et sa période beau temps. Dans la nuit du 13 septembre la température a encore baissé, de sorte que le matin, elle était, en basse altitude, à environ 8,5 degrés. L’eau du lac de Constance – encore réchauffée pendant les beaux jours précédents – atteignait encore, dans ce froid matin, une température d’environ 20 degrés. Le flux d’air froid arrivant dans les hauteurs a fait que l’atmosphère est devenue instable. Il n’y avait presque pas de vent au sol, cela a été l’élément déclencheur pour stimuler la formation des trombes d’eau. La forte vague de froid signifie que sur les lacs encore chauds se forme un grand élan de masses d’air; c’est ce quil s’est produit sur les lacs de Zurich et de Zoug et a permis la formation de trombes d’eau sur le lac de Constance. Entre 6 h 40 et 10 h 05, ce sont sept trombes d’eau qui sont tombées dans la région du lac de Constance. A un certain moment, deux de ces cyclones ont pu être observés simultanément. Ces nombreuses trombes d’eau étaient visibles et comparables à des nuages en entonnoirs. Le 21 juillet 2012, une trombe d’eau bien formée s’est développée sur le lac de Zurich. Le lac de Constance et le lac Léman sont des zones où des trombes d’eau peuvent être observées presque chaque année.

sans qu’elle soit visible ou très brièvement visible et en raison des conditions d’observation très faibles, comme un rideau de pluie, un terrain accidenté ou dans l’obscurité, personne ne la voit. En outre, même une forte tornade peut rester invisible, surtout s’il y a trop peu d’humidité dans la formation de la colonne de la tornade.

Le 21 août 1992, une tempête de grêle spectaculaire avec des vents très forts a balayé la Suisse centrale. De nombreux arbres ont été cassés et des bâtiments endommagés. Ces cellules orageuses étaient en autorotation.

Ainsi, une tornade qui n’occasionne pas de dégâts et ne se voit pas n’est même jamais enregistrée.

Les Alpes empêchent la formation de tornades Heureusement, chez nous, les tornades sont rares. Toutefois, la force n’est pas comparable à l’énorme puissance destructrice d’énormes tornades dans le Midwest des Etats-Unis. Un orage tornade se formera chez nous surtout si un flux de sudouest qui transporte de l’air chaud et humide se dirige sur nous. Cependant, les Alpes empêchent que l’air humide du Sud avance trop rapidement sur le Plateau, comme c’est le cas par exemple dans les terrains plats de la région du Midwest des Etats-Unis. Néanmoins, des tornades ont souvent provoqué, en Suisse, des dégâts catastrophiques. Le 19 août 1890, ainsi que le 26 août 1971, à la vallée de Joux dans le Jura vaudois, et le 12 juin 1926 à La Chaux-de-Fonds, les tornades ont frappé du sud-ouest au nord-est; elles ont provoqué des saignées dans les forêts et de nombreux bâtiments ont été partiellement ou totalement détruits. Nous pouvons probablement vivre une à cinq tornades par décennie qui peuvent provoquer plus ou moins de dégâts. De faibles tornades se produisent pratiquement chaque année. Souvent, des tourbillons se


partie technique

bâtitech 5-14

Des vents exceptionnellement forts, pendant la tempête du 21 juillet 1992, ont démoli une grange à Frauenthal ZG.

Les vents de cette tempête ont cassé un arbre par rotation (à l’avant de la photo) et endommagé la toiture (tempête du 21 août 1992).

transforment en trombes d’eau qui se déchargent sur les lacs. A quelques exceptions près, les petites tornades qui se forment dans notre pays n’ont généré,

une augmentation de l’activité orageuse. Cela signifierait que les tornades augmenteront en fréquence et en force aussi dans notre pays. ■

jusqu’ici, que relativement peu de dégâts. Mais cela pourrait changer. Avec le réchauffement de la planète, les chercheurs météorologiques s’attendent également à

Articles de ferblanterie et couverture Avec son assortiment très complet, Debrunner Acifer est le partenaire unique idéal des ferblantiers et polyconstructeurs. Nous vous proposons entre autres: produits semi-finis, tôles de ferblanterie, articles pour toits plats ou en pente, matériaux de construction, toitures végéta-

lisées, systèmes de plastique liquide, protection contre la foudre selon les principes SEV 4022. Chez Debrunner Acifer, vous trouvez sous un seul toit tout ce qui concerne la technique du bâtiment. Partout près de chez vous!

www.d-a.ch

49


50

bâtitech 5-14

partie technique

Dans la stratégie 2050 de l’énergie, l’énergie fournie par le bois, pour le chauffage et l’électricité, est sous-estimée

Contribution du bois lors de la transition énergétique Aujourd’hui, le bois fournit environ 4 % de l’approvisionnement en énergie et laisse prévoir une augmentation à 6 % en 2020. Le bois en tant que source d’énergie stockable est idéal pour compléter les énergies solaire et éolienne. Puisque le potentiel est limité, le bois doit être utilisé de façon que l’efficacité de substitution des ressources fossiles soit maximale.

r

Prof. D Thomas Nussbaumer * Le facteur de récoltes énergétiques montre que la chaleur, l’électricité et le couple chaleur force remplacera jusqu’à 90 % les combustibles fossiles et le CO2 fossile. Nous avons donc besoin d’utiliser l’énergie du bois pour le chauffage et l’électricité. Ainsi, plus les énergies fossiles pourront être substituées, plus le bois sera converti en combustible et remplacera ainsi par la suite les combustibles fossiles. Cet article décrit les techniques et les avantages du bois d’énergie et tient compte des modifications pour sa mise en œuvre.

Changement dans l’approvisionnement en énergie pour la durabilité Notre approvisionnement en énergie est aujourd’hui dépendant des ressources non renouvelables. On peut rappeler que beaucoup de produits sont dérivés du pétrole et du gaz naturel tel que les engrais, les plastiques, les textiles, les peintures et les médicaments. Ainsi, les ressources fossiles sont limitées et leur consommation conduit, en plus de leur épuisement, au changement climatique. Il faut prendre des mesures pour un changement en douceur mais efficace. La première priorité est d’accroître l’efficacité énergétique, Figure 1: Chauffage au bois moderne avec installation d’élimination des particules fines. (Photo: Schmid AG energysolutions)

Figure 2: Flamme d’un foyer sur grille. (Photo: Verenum)


partie technique

ce qui est possible dans le secteur des bâtiments avec l’énergie faible, nulle et positive des constructions. Dans les transports, des progrès techniques sont également possibles, mais pas dans la même mesure. Actuellement, la mobilité électrique ne peut toujours pas atteindre le seuil de mobilité durable. Cela est aussi vrai pour les biocarburants qui ne couvrent pas la consommation et peuvent également devenir une concurrence à la production de nourriture et, en plus, provoquer des dommages environnementaux. Malgré ces différences, elles s’appliquent au logement et à la mobilité, pour accroître l’efficacité des unités électriques. Les exemples sont la ventilation contrôlée ou la mobilité électrique dans la circulation. On ne parle de progrès que si les économies atteignent un multiple de la consommation effective de l’électricité. L’objectif est donc d’utiliser l’énergie renouvelable directement comme substitution à l’énergie fossile dans le bâtiment et son utilisation.

bâtitech 5-14

Figure 3: Poêle à bois à combustion en deux étapes. (Photo: Thinkstock.com)

Dans les deux cas, l’énergie solaire peut apporter une contribution significative et peut être idéalement complétée par l’énergie stockable du bois. Puisque le bois est limité, ses hauts degrés d’efficacité et son effet de substitution maxi-

mum sont à saisir, donc à utiliser. La transition vers un approvisionnement durable en énergie a plus de chances de réussir, si non seulement de nouvelles technologies spectaculaires menées durant des décennies sont développées,

DESIGO – économiser de l’énergie de manière efficace Automatisation intelligente des bâtiments – utilisation flexible pour tous les bâtiments et toutes les applications www.siemens.ch/desigo

Grâce au système d’automatisation des bâtiments DESIGO™, vous économiserez nettement plus d’énergie tout en profitant d’un confort optimal: la qualité de réglage élevée du système réduit la consommation énergétique et garantit un climat d’ambiance particulièrement agréable. Les fonctions d’économie d’énergie innovatrices permettent de préserver durablement les ressources et donc de diminuer les coûts.

Answers for infrastructure.

51


52

bâtitech 5-14

partie technique

mais si maintenant elles sont utilisées et permettent d’atteindre un taux de substitution maximum de combustibles fossiles pour les décennies à venir. Cette approche, selon le principe de «pick the low hanging fruit first», est efficace du point de vue économique et raisonnable d’un point de vue écologique, parce que les ressources limitées sont utilisées pour un effet maximum.

Potentiel de la biomasse

Figure 4: Alimentation par-dessous du combustible bois à faible teneur en cendres.

Globalement, les biomasses, aujourd’hui avec une part d’environ 11 % de la consommation d’énergie primaire, sont les sources d’énergie renouvelables les plus importantes et cette part peut encore être doublée ou triplée. En Suisse également, la biomasse peut apporter une contribution importante à l’approvisionnement énergétique. Ainsi, en 2008, environ 4,3 millions de m³ de bois ont été utilisés pour l’énergie et ont couvert environ 4 % de la consommation d’énergie. En 2020, ce pourcentage peut être augmenté à environ 6 % de la consommation d’énergie ou même atteindre environ 1 million de m³ de plus par an.

Assortiment

Figure 5: Alimentation sur un foyer à grille. Exemple avec trois secteurs et recirculation des gaz de combustion.

Figure 6: Expériences de débit. Modèle expérimental avec laser et caméra haute vitesse pour l’image des particules Velocimetry (PIV).

Afin d’optimiser son utilisation, il est important de faire une distinction entre les types de bois. Il faut faire progresser les sortes de bois utilisables pour remplacer directement les ressources finies. Cette utilisation en cascade des rendements plus élevés permet de faire des économies en CO2 et a une plus grande valeur économique. Avec l’augmentation

de l’énergie du bois, la fermeture du cycle des matériaux est importante, tandis que les exigences sur l’élimination des cendres augmentent. Si les cendres sont traitées et les contaminants éliminés, l’utilisation énergétique du bois peut contribuer à une décontamination de l’environnement par le transport et l’agriculture; les métaux lourds sont libérés et éliminés de l’environnement par les cendres. Dans un même temps, il est souhaitable que le mâchefer ne soit remis en circulation qu’à partir de sites non pollués.

Utilisation du bois pour le chauffage et l’électricité En plus, le bois, générateur de chaleur, est également utilisé de plus en plus dans le processus chaleur force. Ces turbines à vapeur fonctionnent à des puissances de 1 MW à plus de 50 MW, sans oublier les dispositifs à cycle organique de 5 MW «Organic Rankine Cycle». En Suisse, si l’on veut rechercher à utiliser de l’énergie, il faut avoir une entreprise très spécialisée en chaleur. Pour que la rémunération couvre les coûts, l’utilisation totale de la chaleur en fonction de l’utilisation du courant produit doit se situer autour de 70 % de chaleur et 40 % d’électricité. Cela correspond à un facteur de 1 pour l’utilisation de la chaleur et de 1,75 pour l’utilisation du courant. Pour la production d’électricité pure, un rendement électrique de 40 % serait nécessaire, tandis que les turbines à vapeur, aujourd’hui en fonction, et selon leurs tailles, atteignent 10 à 25 %.


partie technique

Les tendances du développement Pour exploiter tout le potentiel énergétique du bois, des développements devront être encouragés afin d’optimiser le système et réduire la pollution, en particulier les particules fines. Pour les systèmes alimentés manuellement, des chaudières ont de faibles émissions; lors de combustion lentes, il faudra prioriser la prévention contre les dysfonctionnements (figure 3). Pour les grandes chaufferies, ce sont les chaudières à enfournement automatique qui sont utilisées, car grâce à l’approvisionnement continuel en combustible et au système de réglage, il est possible d’obtenir une combustion pauvre en émissions toxiques. Pour les combustibles à faible teneur en cendres, une alimentation pardessous est appropriée (figure 4), tandis

Combustible

Densité énergétique

Volume de stockage

Figure 7: La densité d’énergie des combustibles.

Copeaux de bois Bûches de bois Figure 8: Principe d’une centrale combinée avec gaz de bois (en bas).

Granulés de bois Mazout

Gaz brûlés

Bois

Laveur de gaz

La chaleur du bois et la chaleur de l’agrégat chaleur force atteignent une efficacité permettant le remplacement des combustibles fossiles. Le chauffage aux granulés de bois (sans séchage fossile) ou le chauffage urbain de bois permet une économie de 92 % en comparaison du mazout. Ainsi, on réalise un chauffage urbain à partir du bois et son facteur de 9,0 par rapport au mazout au facteur de 0,70. La chaleur produite par des bûches ou des chaudières automatiques réalise une substitution jusqu’à 95 %, et pour un ensemble chaleur force, d’environ 93 %. En revanche, réalisé en bois carburant (bioéthanol), l’effet de substitution est significativement plus faible, étant donné que la conversion initiale du bois en combustible a une efficacité inférieure, à peine plus de 50 %, mais, à la fin, le pétrole ou le gaz naturel devront également être remplacés. La conversion du bois carburant ne sera donc intéressante que lorsque la chaleur et l’alimentation en électricité seront couvertes à 100 % par des énergies renouvelables.

Gazéificateur de pression

Effets de la substitution du bois

bâtitech 5-14

Gaz de bois

Air

que dans les chaudières à alimentation sur grille, même le bois à haute teneur en cendres et en eau peut-être utilisé (figure 5). Un challenge est de fonctionner à charge partielle et teneur en eau variable, car le diagramme des performances montre que le domaine d’application indiqué doit être étendu. Dans le cas d’un foyer à grille, une transformation de combustible sectorielle s’opère sur la grille et demande des mesures aérodynamiques pour optimiser le fonctionnement à charge partielle. Il existe également des calculs numériques de courants (CFD) et des études expérimentales, avec méthode de mesure au laser, sont utilisées. La figure 6 montre le dispositif de mesure. Dans le futur, les oxydes d’azote auront

de plus en plus d’importance, ce qui est la raison pour laquelle la combustion étagée pour la réduction des oxydes d’azote est d’un intérêt certain. En outre, il est important de diminuer la disponibilité de séparateurs des particules fines

* L’auteur, Prof. Dr Thomas Nussbaumer, est professeur pour «les énergies renouvelables» à la Haute école de Lucerne, secteur Technique et Architecture (www.hslu.ch); il est propriétaire de l’entreprise Verenum à Zurich (www.verenum.ch)

53


54

bâtitech 5-14

partie technique

et d’augmenter les mesures de contrôles techniques. Pour la combustion automatique du bois, des filtres à fumées à précipitation électrostatique sont utilisés, ainsi que des filtres en tissu pour les combustibles secs. Pour les combustibles humides, l’efficacité peut être augmentée par la condensation des gaz d’échappement; elle peut être associée à une séparatrice électrostatique humide. Comme le montre la densité d’énergie dans la figure 7, les granulés de bois (pellets) sont avantageux dans les conditions où l’espace est limité et les investissements restreints. Lors de productions d’électricité à base de bois, les rendements électriques sont limités et il y a un effet de graduation claire (Economies of scale), d’où l’intérêt pour de nouvelles technologies fondées sur la gazéification du bois. Ainsi, les rendements électriques peuvent être presque doublés. Dans les petites installations, le gaz de bois peut être utilisé dans les moteurs de 50 kWe à 1 MW. Certaines évolutions existent et ne sont pas mises sur le marché, en raison

des coûts et des frais de fonctionnement trop élevés. C’est seulement au cours de ces dernières années qu’ont été installées, en Europe, plus de 200 usines de gazéification au bois d’une puissance de 50 kWe à 200 kWe avec combustible sec et homogène; elles n’attendaient que le bon moment pour percer. Pour les installations de plus de 10 M, il faut que la technique soit combinée à la centrale électrique à cycle de gazéification fluidisé avec du gaz et une turbine à vapeur d’un rendement électrique allant jusqu’à environ 40 % (figure 8). Avec ces techniques, le bois peut être rapidement utilisé à moindres coûts et ainsi maximiser sa contribution au redressement de l’énergie.

Contribution du bois, stratégie énergétique suisse en 2050 Depuis la décision de sortir du nucléaire en mai 2011, le gouvernement fédéral a élaboré la stratégie énergétique 2050 qui poursuit une réduction des émissions de CO2 fossile. A cet effet, les perspectives de l’énergie ont été élaborées avec un scé-

nario «nouvelle politique énergétique» spécifique au bois, source d’énergie.

Conclusion au point de vue de l’économie des ressources Les prévisions pour la stratégie énergétique 2050 privilégient l’augmentation des systèmes forces chaleur au bois, car il prend en charge la plus forte valeur ajoutée. En revanche, le pronostic de la baisse de près de 60 % de la consommation de bois pour le chauffage en tant que ressources économiques n’est pas justifié. Dans la mesure où la consommation de bois diminue tout en conduisant à un changement des biocarburants, la substitution des sources d’énergie fossiles pour la production de la chaleur et d’électricité à partir du bois, est réduite. Pour autant que le bois puisse apporter une contribution maximale à la transition énergétique, cela se développera rapidement; l’utilisation des hautes qualités du bois, comme des applications efficaces pour le chauffage et l’électricité à partir du bois, sont à promouvoir. ■


exposition

bâtitech 5-14

MCE 2014: de l’Europe aux îles du Pacifique

39e Mostra Convegno Expocomfort 156 000 visiteurs ont trouvé au Salon la fine fleur du secteur thermosanitaire italien et international. La manifestation se conclut sur des résultats qui en confirment le leadership mondial dans les secteurs de l’installation, de la climatisation et des énergies renouvelables.

MCE-Mostra Convegno Expocomfort se confirme au cœur des stratégies d’affaires des sociétés appartenant au secteur des installations civiles et industrielles, de la climatisation et des énergies renouvelables. Cette vitrine internationale clôt aujourd’hui l’édition 2014 sur des résultats plus que positifs, en dépit d’une semaine difficile pour les transports publics affrontée par MCE au travers d’interventions extraordinaires afin de prévenir et de réduire les inconvénients pour les exposants et les visiteurs. Plus de 2000 exposants y ont été dénombrés, dont 43 % venant de l’étranger et 156 000 visiteurs, avec une montée en puissance des flux de l’étranger à la hausse de 3 % encore par rapport à l’édition précédente. L’Allemagne, la France, l’Espagne, la Grande-Bretagne se confirment être les pays qui ont compté le plus grand nombre de présences. Tout aussi significatifs

sont les résultats relatifs au nombre de visiteurs venant de la Fédération de Russie, de Turquie et de Pologne, qui affichent une hausse particulièrement sensible par rapport à l’édition précédente. Il convient en outre de signaler des pays particulièrement intéressants vu le développement de nouveaux marchés, qui ont participé à MCE 2014 avec un nombre de visiteurs bien supérieur à celui de la dernière édition: Inde, Chine, Emirats Arabes Unis, Etats-Unis d’Amérique, Australie, les Pays baltes et ceux de l’ex-Yougoslavie, avec une progression particulièrement sensible également des visiteurs venant du continent africain (en particulier l’Algérie, l’Ethiopie, le Ghana, la Libye, le Nigeria). Un public spécialisé de professionnels qui a trouvé à MCE la vitrine des technologies les plus à la pointe et des installations qui conjuguent le confort et le bien-être avec des performances d’excellence en matière d’efficacité énergétique, d’économie d’eau,

de sécurité et de design. Un grand intérêt a été réservé au programme, couronné de succès, des plus de 200 colloques et ateliers ayant offert des occasions d’approfondissement et de formation sur les thèmes les plus actuels pour les professionnels de secteurs qui misent toujours plus sur l’innovation, la qualité et la durabilité environnementale afin de maintenir un leadership sur le marché qui nous permet de devancer des pays particulièrement prestigieux tels que l’Allemagne. Anima, Angaisa, Aicarr, Assistal qui réunissent le monde des entreprises et des professionnels présents à MCE, ont contribué à la réussite d’une édition qui adresse un message positif et lance un grand défi pour l’avenir: profiter des opportunités offertes par les deux marchés étrangers les plus intéressants et au développement potentiel pour le thermosanitaire et la climatisation, l’Arabie saoudite et le Sud-Est asiatique, en exportant la manifestation du 4 au 6 mai 2015 à Riyad avec MCE SAUDI et du 2 au 4 septembre 2015 avec MCE ASIA à Singapour, hub stratégique vers des pays tels que la Thaïlande, le Vietnam, l’Indonésie, les Philippines, la Malaisie, la Corée du Sud. Un investissement de plus de 214 milliards d’euros sur quatre ans, prévu en Arabie saoudite, dont 22 % dans le bâtiment résidentiel et 15 % dans le non résidentiel. Singapour travaille au développement d’un plan qui en fera, à l’horizon 2030, une ville leader au niveau mondial pour le bâtiment bio avec 80 % de bâtiments verts dans une région qui, au cours des quatre prochaines années, enregistrera une progression des investissements dans la construction à un rythme supérieur à 5 % par an (source: Cresme). Ces marchés s’avèrent particulièrement intéressants pour les sociétés du thermosanitaire et leurs produits de qualité pour le confort du logement, qu’accompagne la valeur ajoutée de l’origine Made in Italy. ■

55


56

bâtitech 5-14

associations

SICC

Congrès annuel du groupe professionnel Technique Le Building Information Modeling (BIM) est une méthode numérique de planification, réalisation et gestion. De tels modèles virtuels de bâtiments sont déjà utilisés de longue date dans l’environnement international. Les expériences de l’étranger montrent que le BIM permet d’atteindre une qualité supérieure, des coûts inférieurs, ainsi que des durées de planification et réalisation plus courtes. Larissa Wenger, Médias imprimés SICC

Accroître la compétitivité Le congrès annuel du groupe professionnel SIA Technique a eu lieu le 19 septembre 2013 à Lucerne. Plus de 100 participantes et participants ont suivi cette manifestation placée sous le thème «Coordination spécialisée avec le BIM». Le directeur du congrès Jobst Willers, président du groupe professionnel Technique de la SIA, a souligné que l’attribution de mandats dépendrait de plus en plus de la demande de BIM par les maîtres d’ouvrages. Ceci aura naturellement une influence considérable sur la compétitivité des bureaux de planification suisses.

Quelles sont les compétences demandées? «La planification et le processus de planification deviendront à l’avenir de plus en plus complexes», tel est l’avis d’Urs-Peter Menti, chef du centre de technique intégrale du bâtiment. Des coordinateurs BIM sont nécessaires pour maîtriser cette complexité. On a besoin de personnes connaissant les différents

composants et appréhendant le bâtiment comme un système et comme une partie d’un système supérieur. D’autre part il devrait s’agir de spécialistes particulièrement formés, pouvant mettre en œuvre de façon ciblée les outils disponibles dans l’avenir.

Contrôles de collision convaincants Marco Waldhauser, vice-président de la SICC, a souligné que les avantages résultant du BIM étaient importants pour la coordination. Le bureau Waldhauser + Hermann a en conséquence investi dans le BIM et y a déjà fait appel dans certains cas, même lorsque le maître de l’ouvrage ne le demandait pas expressément. La technique du bâtiment entend sous BIM des modèles digitaux basés sur une banque de données, une planification 3D continue, de même que des calculs spécifiques sur la base de modèles de données communs, pour ne mentionner que quelques aspects. Différentes simulations, analyses et visualisations constituent par exemple des applications intégrées. Les

Plus de 100 participantes et participants au Congrès annuel du groupe professionnel de la SIA Technique. (Photo: Martin Denz)


associations

bâtitech 5-14

Modération du congrès par Jobst Willers, président du groupe de travail Technique de la SIA. A droite: discussion autour du podium, de gauche à droite: Matthias Kohler, EPFZ Zurich; Paul Curschellas, président de buildingSMART Suisse; Philipp Dohmen, Drees & Sommer Suisse; Marco Waldhauser, Waldhauser + Hermann AG; Marie-Theres Caratsch, Haute école de Lucerne Technique & Architecture. (Photos: Larissa Wenger)

applications pour la coordination des conduites et lignes sont particulièrement utiles et impressionnantes: les collisions de lignes et conduites sont automatiquement indiquées et apparaissent clairement. D’autre part le coordinateur peut corriger de telles erreurs directement dans le modèle.

«Boum» plutôt que boom? Une présence dans les médias, un soutien par les associations et sociétés, de même que des informations sur la situation à l’étranger sont particulièrement importants pour que le BIM connaisse plus de succès en Suisse. Une formation ciblée des

coordinateurs BIM, des formations dans les domaines des applications CAD et des outils de calcul sont également incontournables. Par ailleurs des projets pilotes doivent être mis en œuvre et un manuel BIM élaboré. Avec le BIM, nous construirons vraisemblablement pour un coût plus avantageux, mais la méthode est malheureusement encore insuffisamment appliquée. La branche suisse de la construction va visiblement trop bien. Par exemple le BIM n’a connu de succès en Scandinavie qu’après la crise économique. Il est également possible qu’un «boum» plutôt qu’un boom soit nécessaire en Suisse. ■

Débitmètre à ultrasons innovant

Réétalonnage sans interruption du processus Le débitmètre AMLFO® SONIC DryX permet un échange périodique rapide durant le fonctionnement, sans interruption du processus. Ce débitmètre innovant ne nécessite aucune distance rectiligne de stabilisation en amont et en aval. Le concept de remplacement simplifié permet de réduire les coûts d’exploitation et d’éviter des arrêts de fonctionnement pour le client. Swiss Made

Contact: info@aquametro.com www.aquametro.com

57


58

bâtitech 5-14

formation ELECTROTECHNIQUE

Questions et réponses sur la NIBT

Know-how NIBT 14 «Peut-on en mettre plus?» demande la vendeuse derrière le comptoir. «Oui», dit le client. Ou bien avez-vous déjà répondu «Non» à cette question ? Dans les normes aussi, on trouve souvent des affirmations qui ne se limitent pas clairement à une échelle de valeurs. Par exemple, dans le cas de la chute de tension. Bien entendu, on trouve la valeur de 4 % dans la norme. La formulation «ne doit pas être supérieure à 4 %» laisse toutefois à nouveau une marge de manœuvre. Si je réponds «Oui» à la vendeuse, j’en fais mon affaire, de même que si en tant que propriétaire je dis «Oui» à une chute de tension légèrement supérieure. La norme laisse ce point ouvert, car un «Doit» n’est pas un «Il faut». Nous avons répondu à ces thèmes ainsi qu’à d’autres pour vous.

Installation dans un local à citerne

luminaire et une prise de courant. Voir illustration 1A. Je ne suis pas vraiment sûr, si je dois porter une réclamation. Je suis d’avis que cette façon d’installer n’est pas admissible, mais je n’ai pas trouvé d’information dans les normes. (A. B. par e-mail)

Hier j’ai effectué une vérification périodique et j’ai rencontré la situation suivante. Dans un local à citerne à mazout, on a installé un

D’après la brochure 2153.f (prévention des explosions, principes, prescriptions

David Keller, Pius Nauer Traduction Pierre Schoeffel

1

Citerne de stockage pour mazout/diesel

minimales, zones) de la SUVA, l’intérieur d’une cuve de stockage pour mazout est défini en tant que zone 1. Le local dans lequel se trouve la cuve n’est plus classé dans une zone à risque d’explosion. De ce fait, il peut être équipé de «matériel d’installation normal», c. à. d une lampe ou une prise de courant. Il y a lieu de prendre des précautions si une lampe est montée directement au-dessus de la cuve, particulièrement si cette cuve est fabriquée en matière plastique. Dans la norme EN 60079-14: Atmosphères explosives-partie 14: conception, sélection et construction des installations électriques, nous trouvons en résumé l’affirmation suivante dans l’Article 6.2.6: Si on monte un appareil au-dessus d’une zone à risques d’explosion, à une distance inférieure à 3,5 m et si cet appareil présente des parties ou des surfaces susceptibles de chauffer durant son fonctionnement, alors il faut monter des équipements de protection adéquats ou des grilles. De cette manière, on évite la chute de sources d’inflammation dans la zone à risques d’explosion. Dans votre cas, la lampe ne se trouve ni dans une zone à risques d’explosion, ni au-dessus d’une zone telle que nous l’avons décrite. C’est la raison pour laquelle on peut qualifier cette installation comme étant admissible et la valider. (pn)

2

Canalisation existante 3 × 400 V pour nouvelle pompe 230 V

Désormais on n’utilise pratiquement plus que des pompes 230 V pour les installations techniques du bâtiment. Quand il s’agit de procéder à des remplacements, faut-il changer la canalisation (noir, rouge, blanc, jaune-vert)? Justement dans le cas de canalisation de grande longueur, cela induit des surcoûts considérables pour le client. Ils sont toujours difficiles à justifier. (P. S. par e-mail)

Illustration 1

La pompe fait-elle partie d’une machine dans l’esprit de la norme EN 60204, ou fait-elle partie de l’installation domestique concernée par NIBT 2010 ? Il faut


formation

bâtitech 5-14

ELECTROTECHNIQUE

tout d’abord être en mesure de répondre à cette question, pour pouvoir décider ensuite, si la canalisation doit être remplacée ou non. En effet, contrairement à la NIBT, la norme EN 60204 ne contraint pas à utiliser un code couleur pour le conducteur neutre. Si la ligne d’amenée est raccordée à l’armoire électrique destinée à la technique du bâtiment (ventilation, chauffage, climatisation etc.), c’est la norme EN 60204 (Sécurité des machines – Équipement électrique des machines) qui entre globalement en application. On y effectue des recommandations pour le choix des couleurs. Par exemple noir pour les circuits électriques principaux, rouge pour les circuits électriques de commande en courant alternatif, bleu pour circuits de commande en courant continu, ou orange pour les circuits de commande d’interverrouillage. Par contre, dans la norme citée, il est également stipulé que si le conducteur neutre est identifiable uniquement par sa coloration, alors il faut utiliser la couleur bleue,

resp. bleu clair. Si dans l’armoire de commande de la technique du bâtiment, il existe déjà un conducteur neutre marqué en bleu, alors dans ce cas de figure également, il y a obligation de remplacer la canalisation. Si la ligne d’amenée est raccordée à la distribution de l’installation domestique, alors il n’existe aucune marge d’interprétation : la canalisation doit être obligatoirement remplacée. Nous ajoutons une remarque concernant la NIBT: durant la période de validité de la NIBT 2000, un conducteur marqué en bleu pouvait être utilisé (contrairement au cas décrit dans la demande) exceptionnellement en tant que conducteur extérieur (encore dénommé à l’époque par conducteur de phase), si dans le même circuit électrique on n’utilise pas de conducteur neutre. Heureusement cette spécialité a été supprimée depuis! (dk)

3

Chute de tension dans les installations d’extraction de fumée et de chaleur RWA

Dans NIBT 5.2.5.1, la norme exige une chute de tension maximale de 4 %. Pour les installations d’extraction de fumée et de chaleur, on pose parfois des canalisations de très grande longueur. Si par exemple, on prévoit un conducteur de section de 1,5 mm2 avec une protection de 13 A, alors on peut poser tout juste une longueur d’env. 27 m pour être en conformité avec la chute de tension de 4 %. De telles longueurs sont rapidement dépassées dans les installations d’extraction de fumée et de chaleur. La chute de tension peut-elle présenter des valeurs supérieures dans de telles installations? (B. E. par e-mail) D’après NIBT 5.2.5.1 la chute de tension ne doit pas excéder 4 % dans les installations de récepteurs. Dans la NIBT il n’est pas écrit que la chute de tension n’a pas le droit d’être supérieure à 4 %. En effet la norme utilise seulement la formulation

SMISSLINE TP Sous tension en toute sécurité

Pour travailler de manière absolument sûre. SMISSLINE TP permet de brancher et de débrancher hors charge des appareils sous tension sans équipement de protection individuelle contre les dangers électriques. Le nouveau Touch Proof System de SMISSLINE procure non seulement une sécurité accrue mais aussi un plus en termes de flexibilité et d’économicité. Pourquoi? Vous le découvrirez sous www.abb.ch/gebaeudeautomation

ABB Suisse SA, Produits basse tension Avenue de Cour 32 CH-1007 Lausanne Tél. +41 58 588 40 50 www.abb.ch/gebaeudeautomation

59


60

bâtitech 5-14

formation ELECTROTECHNIQUE

T15 sur la machine, elle est directement raccordée aux bornes d’alimentation. Faut-il prévoir un disjoncteur FI pour cette prise de courant T15? Nous partons du principe que l’alimentation est réalisée sur une prise de courant qui est déjà protégée par un DDR. (A. M. par e-mail)

Illustration 3

«ne doit pas». Bien sûr, il est particulièrement sensé de planifier et d’effectuer une installation de façon à ce que l’on puisse respecter cette chute de tension de 4%. Ainsi, on limite les fluctuations de tension et toutes les retombées qui en découlent. La longueur maximale de 27 m qui a été citée, est correcte dans les cas où l’on soumet un conducteur de 1,5 mm2 à une charge de 13 A. On retrouve ces données dans le diagramme 6.D de la NIBT ou dans l’illustration 3. La chute de tension d’une canalisation n’est toutefois pas dépendante du courant assigné du dispositif de protection contre les surintensités monté en amont, mais du courant nominal du circuit électrique. Dans les installations d’extraction de fumée et de chaleur il s’agit souvent de moteurs d’entraînement de portes et de fenêtres ayant des courants nominaux relativement faibles. J’ai représenté cela sur le diagramme de l’illustration 3 en prenant en compte un courant de 2 A, ce qui nous amène finalement à une longueur de 170 m. Dans le cas de petits courants de service, la canalisation peut présenter une grande longueur, tout en respectant la limite de 4% de la chute de tension. (pn)

4

Protection FI pour une prise de courant sur une machine roulante

Nous fabriquons nous-mêmes de petites installations d’impression de carton mobiles. La machine est installée sur des rouleaux mobiles et est alimentée avec une rallonge T15. Nous avons monté une prise de courant

Illustration 4

On peut considérer sûrement que cette installation est une machine telle qu’elle est décrite dans la norme EN 60204 (cf. aussi question/réponse 2). Dans la version actuelle de la norme EN 60204, la protection supplémentaire par un dispositif de protection à courant différentiel-résiduel est facultative. Le commettant devrait indiquer lui-même s’il souhaite protéger les prises de courant ou non. Si dans votre établissement, vous avez protégé toutes les prises de courant avec un DDR, alors il n’est pas nécessaire de monter un disjoncteur de protection supplémentaire pour cette prise de courant intégrée. En cas de défaut, c’est le DDR de l’installation qui se déclenche. (dk)


formation

bâtitech 5-14

ELECTROTECHNIQUE

Exercices 205 à 216

Brain Food Les moteurs électriques font partie du quotidien. Le raccordement, la mise en service et également la recherche de dérangements demandent beaucoup de connaissances de la part du professionnel. Les moteurs électriques, les éléments de commutation et les commandes font partie d’un ensemble et doivent aussi être considérés en tant que tels. Rico De Boni, Marcel Schöb Pratique d’installation Les questions suivantes font partie des objectifs évaluateurs suivants du plan de formation de l’installateur électricien CFC: Plan de formation L3/5.2.5: • Les personnes en formation installent des entraînements électriques et elles les mettent en service.

circulation. Faut-il apporter une modification?

Exercice 206 a) Quelle version de moteur triphasé utilise t-on principalement dans la technique d’entraînement?

Plan de formation L3/3.2.1: • Les personnes en formation utilisent des composants électrotechniques se rapportant aux mandats et déterminent les valeurs.

Exercice 207

Exercice 205

Exercice 208

Lors de l’installation du chauffage, on constate qu’on n’a pas prévu de protection moteur externe pour la pompe de

L’illustration 208 montre la plaque signalétique et le moteur. a) Que signifie la désignation S1?

Le moteur d’entraînement est protégé avec un disjoncteur moteur. Lors du démarrage, celui-ci se déclenche toujours. a) Quelle peut-être l’origine? b) Comment peut-on localiser la panne?

www.osram.ch

Lumilux Combi LED Design moderne, efficacité élevée Jusqu‘à 20 pièces assemblables comme bandeau lumineux.

Light is OSRAM

61


62

bâtitech 5-14

formation ELECTROTECHNIQUE

Classe d’isolation

Illustration 208 Illustration 213

b) De quel type de construction de moteur s’agit-il? c) Le raccordement est réalisé avec 3LPE. Comment doit-on disposer les ponts au niveau du raccordement? d) Comment faut-il régler le disjoncteur moteur?

guration de raccordement pour un moteur branché en triangle?

Exercice 214 Dans une ventilation il faut raccorder un moteur ayant une plaque de puissance selon illustration 214. a) De quel type de moteur s’agit-il? b) Comment le disjoncteur moteur doitil être réglé?

Exercice 209 Quelles sont les affirmations exactes concernant le moteur selon illustration 208 ? 1) Le moteur consomme instantanément 3 kW 2) Le moteur peut fournir instantanément 3 kW 3) Le moteur peut fournir 3 kW en fonctionnement continu 4) Le moteur est protégé contre le contact avec les doigts et contre les projections d’eau 5) Le moteur est protégé contre la poussière et l’eau 6) Le moteur peut aussi fonctionner en 230 V

Exercice 210 Un moteur triphasé asynchrone fonctionne à charge nominale avec une sous-tension.

Illustration 214

Quelles sont les conséquences auxquelles il faut s’attendre?

Exercice 215

a) Pourquoi ne peut-on pas démarrer directement les gros moteurs? b) Où est la limite pour une commutation directe?

Un moteur d’entraînement 15 kW nécessite une canalisation de 20 m de longueur. Celle-ci est posée dans un chemin de câble en fil. Le disjoncteur moteur est placé dans l’ensemble d’appareillage. Quelle est la section de canalisation nécessaire?

Exercice 212

Exercice 216

Quelles sont les possibilités de démarrage si le moteur ne peut pas être démarré directement?

Un moteur triphasé asynchrone doit fonctionner en courant monophasé. Existe t-il des limitations? Réalisez un schéma avec les composants nécessaires. Solutions voir page 70

Exercice 211

Exercice 213 Quel graphique montre la bonne confi-

Les contacts pour vos annonces: Rolf Niederberger Tél. 058 200 56 18 (CVS) André Fluri Tél. 058 200 56 27 (E)


carnet

bâtitech 5-14

Solar Impulse – et l’impossible devient possible Le 9 avril 2014 à Payerne, Solar Impulse a officiellement présenté «Solar Impulse 2», le premier avion solaire conçu pour faire le tour du monde. Schindler est l’un des principaux partenaires de ce projet innovant, qu’il soutient notamment grâce au savoir-faire de ses ingénieurs. Le 9 avril 2014, le projet de tour du monde sans combustibles fossiles a pris une tournure très concrète: Bertrand Piccard, initiateur et président de Solar Impulse, et André Borschberg, co-fondateur et CEO de Solar Impulse, ont officiellement présenté à Payerne leur nouveau avion monoplace solaire «Solar Impulse 2» conçu pour faire le tour du monde, devant un parterre de quelque 500 invités. Les premiers vols d’essai auront lieu en mai 2014 et seront suivis de vols d’entraînement au-dessus de la Suisse. «Il y a douze ans, lorsque nous avons simulé notre vision de Solar Impulse sur ordinateur, les experts ont rigolé. Aujourd’hui nous présentons l’avion le plus efficace de tous les temps sur le plan énergétique, prouvant par-là que l’impossible est devenu possible», a résumé Bertrand Piccard pour souligner l’importance de cette journée mémorable. Dans son allocution, le conseiller fédéral Ueli Maurer a fait valoir qu’il fallait «savoir prendre des risques en toute connaissance de cause pour obtenir l’impossible».

Jusqu’à cinq jours de vol sans escale L’équipe autour des pilotes Bertrand Piccard et André Borschberg s’est véritablement fixé des objectifs exceptionnels: en 2015, avec «Solar Impulse 2», ils relèveront le défi d’un tour du monde avec un avion exclusivement propulsé par l’énergie solaire. Les vols d’essai du prototype «Solar Impulse 1» ont prouvé que les Clean-Techs pouvaient réaliser des prouesses incroyables: pour la première fois, un avion solaire a volé de jour comme de nuit, rallié deux continents et traversé les Etats-Unis. «A présent, il s’agit d’aller encore plus loin», indique André Borschberg pour résumer la mission de «Solar Impulse 2». Pour effectuer un tour du monde, l’avion devra voler sans escale durant jusqu’à cinq jours et cinq nuits. Les deux pilotes se relayeront aux commandes. Tant pour eux que pour l’avion,

le trajet d’environ 35 000 kilomètres sera un exploit de taille. C’est pourquoi le «Solar Impulse 2» a été conçu pour être 15 % plus grand et encore plus stable que le prototype. Tout est prévu pour permettre aux pilotes de vivre dans le nouveau cockpit durant toute une semaine. En principe, ces modifications auraient dû se traduire par une charge accrue et donc une efficacité réduite. Toutefois, grâce aux efforts de l’infatigable équipe du projet, le «Solar Impulse 2» est encore plus léger proportionnellement et plus efficace que son prédécesseur.

Bertrand Piccard (à gauche) et André Borschberg ont officiellement présenté à Payerne leur nouveau avion monoplace solaire «Solar Impulse 2» conçu pour faire le tour du monde.

Repousser les limites supposées A l’instar de Solar Impulse, Schindler estime aussi que l’avenir réside dans les solutions de technologies propres et met tout en œuvre pour rendre ses produits encore plus efficaces d’un point de vue énergétique. C’est pourquoi Schindler soutient Solar Impulse depuis 2011 en qualité de partenaire principal. «Le vrai progrès va au-delà d’une amélioration de l’existant. Il faut adopter des approches totalement nouvelles, susceptibles de s’affranchir des limites supposées», explique Alfred N. Schindler, président du Conseil d’administration de Schindler Holding SA, pour souligner l’importance de l’innovation. Le partenariat avec Solar

Impulse comprend aussi l’intégration d’ingénieurs maison dans le réseau unique de chercheurs et de techniciens issus de divers secteurs et pays. Andrea Cambruzzi, collaborateur de Schindler New Technology, a fait partie durant sept mois de l’équipe de calcul qui a œuvré à alléger l’avion: «Nous avons poussé les matériaux dans leurs derniers retranchements, un état d’esprit que je conserve pour mon activité chez Schindler. En d’autres termes, faire preuve d’une curiosité constante et toujours chercher à obtenir davantage que ce qui semble possible de prime abord.» ■

En 2015, avec «Solar Impulse 2», l’équipe autour des pilotes Bertrand Piccard et André Borschberg relèveront le defi d’un tour du monde avec un avion exclusivement propulsé par l’énergie solaire. Schindler soutient ce projet innovant.

63


64

bâtitech 5-14

carnet

Le prix de l’essence et du diesel à la colonne

Comment du pétrole bon marché se transforme en essence chère Dès que l’on parle du prix de l’essence ou du diesel à la colonne, les soupçons se portent aussitôt sur les compagnies pétrolières. En particulier au début des vacances, les prix sont jugés «abusifs». Alors passons en revue les mécanismes et facteurs qui déterminent réellement le prix final! Le scénario se répète chaque année, notamment au printemps. Les organismes de défense des consommateurs – surtout à l’étranger, précisément dans les pays de langue allemande – accusent les sociétés pétrolières d’«abus sur les prix» et de «réaliser des profits» sur le dos des automobilistes et des propriétaires immobiliers. C’est systématique, dès que le prix

croît légèrement, ils montent au créneau. De nombreux médias en font leurs choux gras, reprenant l’information sans autre forme d’explication. Il y a quelques mois, l’industrie pétrolière s’est ainsi retrouvée sur le banc des accusés car la baisse du pétrole ne s’était pas répercutée dans les mêmes proportions sur les prix à la pompe. Les organismes de protection des

consommateurs ont immédiatement crié au scandale.

Taxes, transport, négoce et cours du dollar: les vrais perturbateurs de prix Les raisons, Rolf Hartl, président de l’Union Pétrolière, tente de les expliquer aux médias. «Si le prix à la colonne ne fluctue pas dans les mêmes proportions que le cours du pétrole à la bourse, c’est que les coûts de production pour l’essence n’entrent qu’à hauteur de 40 % seulement dans le prix final payé dans les stationsservice suisses.» La moitié du prix, ce sont des impôts et taxes versés à la Confédération et les 10 % restants sont imputables aux coûts de distribution. En Suisse, ces derniers sont au-dessus de la moyenne. «Ainsi, environ 60 % du prix affiché à la pompe ne dépend pas des marchés internationaux», poursuit M. Hartl. Un autre facteur est entré en scène depuis plusieurs mois: le niveau du dollar. Car aussi bien le pétrole que l’essence raffinée sont négociés en dollars à la bourse. Or, rien qu’en été, la monnaie américaine s’est appréciée de quelque 7 %, au détriment du prix de l’essence, et ce indépendamment des cours du pétrole. On peut comprendre que ces nombreuses fluctuations de prix puissent désorienter l’homme de la rue. C’est pourtant bien la logique des marchés qui prévaut en ce domaine, n’en déplaise aux organismes de protection des consommateurs déjà cités. A chaque instant surgissent différents facteurs susceptibles de peser dans la balance. Il y a certes la loi de l’offre et la demande, mais n’oublions pas les événements politiques, les fluctuations de devises, les effets météorologiques, etc.

De nombreux acteurs entrent en jeu, de l’exploitation jusqu’à la vente

Au 1er janvier 2012, la Suisse comptait 3594 stations de marques.

Autre question récurrente: pourquoi le prix du pétrole est-il à ce point majoré tout au long du processus de valorisation, qui va de l’extraction jusqu’à sa commercialisation sous forme de carburant ou de combustible? Du champ pé-


carnet

trolier jusqu’au consommateur, de nombreux acteurs entrent en jeu. A chaque maillon de cette chaÎne de valorisation, le prix augmente jusqu’au consommateur final. Ainsi, un baril de brut (159 litres) d’une entreprise pÊtrolière d’Etat basÊe dans la rÊgion du Golfe revient entre 1 et 5 dollars, alors que la même quantitÊ de pÊtrole est finalement nÊgociÊe sur les bourses de Londres ou New York à 100 dollars ou plus. Il ressort clairement ici que les grands gagnants sont les pays producteurs de pÊtrole. Dès que l’or noir quitte le pipeline pour remplir les cuves des supertankers des grandes compagnies pÊtrolières, les prix sont dÊjà multipliÊs de 20 à 30 fois par rapport au prix de production. Les Etats qui produisent de grandes quantitÊs de pÊtrole, tel le Koweït, ont donc largement profitÊ de cette marge actuellement très ÊlevÊe. Une marge qui s’accentue encore lorsque les pays producteurs de pÊtrole possèdent leurs propres compagnies de tankers. C’est le cas du Koweït, qui livre les grandes compagnies pÊtrolières via la Kuwait Oil

#.#&+0#)

Tanker Company. Dans ce cas de figure, la marge est de l’ordre de 50 %! Si des compagnies pÊtrolières se fournissent en pÊtrole koweïtien directement dans le port de transbordement de Rotterdam, elles devront payer 30 à 40 fois le prix de production. A ce stade, l’industrie pÊtrolière n’a rien empochÊ.

Quelques centimes par litre pour couvrir l’ensemble des coÝts S’ajoutent d’autres facteurs. En premier lieu, le pÊtrole brut doit être raffinÊ et transformÊ en produits finis, comprenez carburants, mazout de chauffage, etc. Puis les produits sont transportÊs et stockÊs avant d’être acheminÊs vers le client. L’imposition reprÊsente une part considÊrable du prix en Suisse, en particulier l’impôt sur les huiles minÊrales et la taxe sur la valeur ajoutÊe. Viennent se greffer les fluctuations monÊtaires entre le dollar (avec lequel le pÊtrole et les produits finis sont nÊgociÊs à l’Êchelle internationale) et le franc suisse (avec lequel le client paie le produit). Tout aussi im-

bâtitech 5-14

prÊvisible, l’Êvolution des prix en bourse oÚ sont nÊgociÊs les principaux produits. En effet, les cours rÊagissent très vite et souvent de manière irrationnelle face aux ÊvÊnements politiques, ce qui peut à la limite entraÎner une pÊnurie de l’offre. Les entreprises pÊtrolières suisses ne sont finalement responsables que des coÝts de stockage et de distribution des produits dans notre pays. Dans ce secteur, c’est la concurrence entre fournisseurs qui joue à plein. Il en va de même pour les raffineries nationales et internationales. Ces coÝts ne reprÊsentent qu’une portion congrue par rapport au prix du brut et aux impôts nationaux. Sur un litre d’essence, les compagnies n’ont que quelques centimes pour couvrir tous les coÝts. La marge de manœuvre est limitÊe, ajoute le prÊsident de l’Union PÊtrolière. Tous ceux qui parlent d’abus sur les prix et de profits ÊhontÊs en visant les sociÊtÊs pÊtrolières mÊconnaissent les vÊritables tenants et aboutissants, conclut M. Hartl. www.mazout.ch

6GEJPKSWG FÂľoVCPEJoKVo RQWTNGURNWU JCWVGUGZKIGPEGU

0QVTGCVGNKGTOoECPKSWGOQFGTPGGUVGPOGUWTGFG RTQFWKTGFGUCPPGCWZF´oVCPEJoKVoUGNQPXQUFoUKTU CPPGCWZF´oVCPEJoKVoEQPHQTOGCWZFKTGEVKXGUFG N´QHHKEGHoFoTCNRQWTNCRTQVGEVKQPFGNCRQRQNCVKQP  1(22 UQPVFKURQPKDNGUWTFGOCPFG

#NCFKP#) +PFWUVTKGUUVTCUUG 9CVVYKN 6oNoRJQPG 6GNGHCZ '/CKNKPHQ"CNCFKPCIEJ +PVGTPGVYYYCNCFKPCIEJ

#PPGCWFÂľoVCPEJoKVoV[RG#NCFKP

ntie Gara ans 15

Après ProtÊgÊ

Pendant SablĂŠ

Avant RouillĂŠ

STOP AUX ATTAQUES DE ROUILLE ET CORROSION pour une eau propre et uide! > > > > >

Nettoyage mÊcanique par sablage. Revêtement intÊrieur par rÊsine (colmate même les perforations cuivre). Protection anti-corrosion garantie, sans entretien ultÊrieur. IdÊal pour conduites d’eau sanitaire, de chauffage (Êgalement au sol), piscines, etc. Equipe de professionnels, compÊtente, expÊrimentÊe et dynamique à votre service.

ch. des Cormiers 14 – 1470 Estavayer-le-Lac T 026 664 00 04 – F 026 664 00 07 info@solutubes.ch – www.solutubes.ch

65


66

bâtitech 5-14

carnet

Walter Meier (Klima Schweiz) AG

Nouveau PROFI-SHOP à Fribourg En ce 25 avril, Walter Meier a inauguré son nouveau Profi-Shop au «Centre Artisanal» de Corminbœuf, une commune aux portes de Fribourg. Il s’agit du 15e Profi-Shop en Suisse qui est à la disposition exclusive des installateurs en chauffage. Ce même bâtiment abrite aussi le centre de service et la Vente Chauffage. Moderne, attrayant et bien visible. Voici comment se présente le nouveau ProfiShop de Walter Meier au «Centre Artisanal» de Corminbœuf en région fribourgeoise. Début avril, le 15e Profi-Shop en Suisse a ouvert ses portes et son inauguration officielle a eu lieu ce 25 avril. Grâce à son vaste assortiment, qui comprend actuellement 1340 articles, les installateurs peuvent se procurer ici tout ce

dont ils ont besoin pour accomplir leur travail quotidien, de la chaudière au radiateur.

Le contact personnel comme priorité Comme responsable du nouveau ProfiShop, Walter Meier a engagé Jan Schneider qui connaît parfaitement la branche et le marché local. Ses priorités

sont le contact personnel avec ses clients, un service de conseils compétent et l’organisation dynamique de l’assortiment. «En connaissant les exigences de mes clients, je peux adapter l’assortiment en conséquence et l’ajuster en fonction de la demande.»

Renforcer notre présence dans la région de Fribourg Pour Walter Meier, l’ouverture du nouveau Profi-Shop représente une étape fondamentale pour renforcer davantage sa présence en région fribourgeoise. Comme l’explique Christian Kaelin, responsable de la Vente Chauffage en Ro-

Actuellement, l’assortiment de Jan Schneider comprend 1340 articles. (Photos: Walter Meier)

L’équipe Walter Meier au Centre Artisanal. Debout de gauche: Jan Schneider, Carlos Da Silva, Jean-Luc Morel et Frédéric Barrelet. A genoux de gauche: Hans-Peter Mischler, Bernard Perrenoud et Jessica Hug.

mandie: «Avec l’ouverture du Profi-Shop et le regroupement du centre de service et de la Vente Chauffage au ‹Centre Artisanal›, à Fribourg, nous proposons maintenant tous nos services sous le même toit, ce qui représente un avantage fort intéressant pour nos clients et partenaires. L’emplacement est lui aussi idéal : il n’est qu’à cinq minutes de la sortie d’autoroute Fribourg Sud et il est facilement atteignable depuis la ville de Fribourg et depuis le reste de la région.» Le Profi-Shop de Walter Meier qui est à disposition des installateurs en chauffage se trouve à la route du Pâqui 4 à 1720 Corminbœuf. Il est ouvert tous les jours de 7 h à 11 h 45 et de 13 h 15 à 17 h (vendredi jusqu’à 16 h). www.waltermeier.com


carnet

bâtitech 5-14

Le parc aquatique Splash & Spa Tamaro à Rivera (Tessin) est honoré

Deux prix internationaux pour le nouveau parc aquatique Splash & Spa, parc aquatique extraordinaire, a reçu le prix «Leading Edge Award» de l’association World Waterpark. A l’Expo Real à Munich, Splash & Spa a obtenu la troisième place de la JJ Compétition Astor, grâce à son architecture prodigieuse. Silvia Mettler Avec ses 10 000 m², Splash & Spa est l’un des parcs aquatiques les plus grands et les plus modernes d’Europe. L’Association World Waterpark a décerné le prix Leading Edge au parc aquatique tessinois. Le prix a été remis pour le premier établissement au monde avec ses cinq parcours époustouflants. Et Diana Invanisevic se plaît à dire: «En collaboration avec notre partenaire Pro Slide, nous avons créé un parc aquatique ultramoderne: il est équipé des dernières technologies avec une

large gamme de divertissements, de loisirs et des activités de bien-être, le tout sous un même toit. Nous sommes très fiers d’être désormais perçus comme un chef de file à l’échelle internationale.»

Le prix de l’architecture A l’EXPO REAL, le plus grand salon européen de l’immobilier, à Munich, Splash & Spa a également reçu un prix prestigieux. Le bâtiment en forme de dôme a obtenu la troisième place sur les 38 projets présentés lors de la compétition John Jacob Astor. L’innovation dans l’architec-

ture, la conception de l’éclairage intelligent, ainsi que le système de récupération d’énergie écologique et sophistiqué ont convaincu le panel des visiteurs. Marco Guissani, architecte de Splash & Spa, s’en réjouit «C’est une grande reconnaissance pour notre travail. L’utilisation de la technologie de pointe dans la conception et la construction, le respect de l’environnement et le souci du détail ont été récompensés et motivent ainsi tous les employés et les professionnels qui ont participé à ce projet unique.» Pour d’autres informations: Splash & SPA Tamaro SA Diana Ivanisevic diana.ivanisevic@splashespa.ch Tél. 091 936 22 22

67


68

bâtitech 5-14

carnet

fe3.ch – Plateforme de formation – Efficacité énergétique & environnementale

Prévention et gestion des déchets de chantier La plateforme de formation continue fe3.ch créée par le Bureau EHE propose une palette de cours variée pour les professionnels du bâtiment dans les domaines de l’efficacité énergétique et environnementale, ainsi que dans les énergies renouvelables. Un nouveau cours sur la prévention et la gestion des déchets de chantier sera dispensé en juin et en novembre 2014. En Suisse, le secteur de la construction est non seulement le plus gros consommateur de ressources, mais aussi le plus gros producteur de déchets. Suite à ce constat, il est indispensable de remettre en cause l’approvisionnement et l’impact des matériaux de construction choisis. Cependant, la mise en œuvre est encore trop souvent lacunaire, autant dans le cadre du projet, qu’ensuite sur le chantier.

Pourtant, les solutions existent: prise en compte de l’énergie grise lors de la conception du projet, bâtiments adaptés à la déconstruction et/ou à la réaffectation, diagnostic matériaux dangereux, déconstruction soignée des objets existants sur la parcelle, etc. Ce cours propose une approche permettant de prévenir, puis de mieux gérer les déchets de chantier. Le label Minergie-Eco apporte également sa contribution sur ce sujet en fixant plusieurs critères, obligatoires ou facultatifs. Les principes de base et les exigences de ce label seront aussi abordés lors de ce cours.

Public cible: Architectes, ingénieurs et bureaux techniques Prérequis: Expérience de la construction, phase projet et/ou phase exécution Formateur: Sébastien Piguet, Ing. EPFL/SIA, Bird-RDS SA Dates: Yverdon, 11 juin 2014 / Yverdon, 5 novembre 2014 Horaires: 13 h 30–17 h 30 Prix: CHF 270.–, documentation de cours et pause-café comprises Nombre de participants: Max. 20 personnes. Les inscriptions seront traitées dans l’ordre d’arrivée. Retrouvez l’ensemble des formations proposées et les possibilités d’inscription sur le site www.fe3.ch

Succès de la Foire des Machines de Chantier Les prévisions favorables de la Foire des Machines de Chantier 2014 se sont concrétisées: le déroulement positif de la foire reflète le vif intérêt porté aux secteurs des machines de chantier, du coffrage et des accessoires. Les organisateurs tirent un bilan positif.

Déjà avant le début de la foire, une forte demande émanant de la branche était perceptible: plus de 250 exposants occupaient jusqu’au dernier des 80 000 mètres carrés du parc d’exposition. «Nous nous réjouissons que plus de 23 000 visiteuses et visiteurs soient venus confirmer ces signes positifs», déclare Rolf Krähenbühl, responsable de la Foire des Machines de Chantier. Malgré un temps au beau fixe, la foire a en effet réussi à enregistrer le deuxième meilleur résultat de son histoire. L’Association suisse de l’industrie des machines de chantier VSBM, initiatrice de la manifestation, est elle aussi très satisfaite du déroulement de la plus grande foire nationale de la branche, comme le confirme son président Marcel Hartl: «La qualité des visiteurs s’est révélée excellente et les exposants ne cachent pas leur satisfaction. La foire a permis de nouer des contacts très prometteurs et de conclure de nombreuses ventes.»

La Foire des Machines de Chantier VSBM à Berne est la plus grande plate-forme d’innovations et de tendances de la branche de la construction en Suisse. Elle en est déjà à sa 14e édition. Pendant six jours, plus de 250 exposants ont présenté les nouveautés et les tendances en matière de machines de chantier, de coffrage et d’accessoires sur le parc d’exposition de Bernexpo. Les visiteuses et visiteurs provenaient en grande partie du secteur de la construction et des branches apparentées.

Bernexpo AG www.bernexpo.ch


carnet

bâtitech 5-14

Suva

Travailler par de fortes chaleurs Les ventilateurs et les climatiseurs sont particulièrement sollicités durant les journées de fortes chaleurs et rafraîchissent agréablement les bureaux. Pourtant, de nombreux postes de travail se situent en plein air, où les travailleurs sont exposés à des chaleurs torrides. Irene Kunz, spécialiste en médecine du travail et en médecine interne à la Suva, répond aux principales questions au sujet des travaux effectués à l’extérieur par de fortes chaleurs. Docteur Kunz, quand la chaleur peut-elle mettre la santé en danger lors de travaux effectués en plein air? Irene Kunz: Lorsque la régulation de la température corporelle se déséquilibre, que l’organisme produit plus de chaleur et en même temps absorbe plus de chaleur de l’environnement qu’il ne peut en évacuer par la sudation.

nement et les travaux doivent être choisis de façon à empêcher une déshydratation et une élévation trop importante de la température du corps. Les méthodes et les processus de travail utilisés doivent permettre d’éviter une exposition exces-

écran de protection. Les travaux en plein air exigeant des efforts intenses doivent être effectués le matin. Il faut éviter les travaux lourds ou très lourds en cas de fortes chaleurs. La situation peut-elle être telle que même des travaux légers doivent être évités ou qu’aucun travail ne puisse plus être effectué? Cette situation est extrêmement rare. En général, des mesures techniques, organisationnelles et personnelles permettent de poursuivre les activités.

Quels sont les troubles typiques liés à la chaleur? Que peut-il se passer dans le pire des cas? Fatigue, épuisement, céphalées et baisse de concentration peuvent constituer les premiers symptômes, auxquels peuvent s’ajouter vertiges, nausées et perte de connaissance. Le coup de chaleur est le pire tableau clinique et nécessite une intervention médicale. Que peuvent faire les travailleurs pour se protéger de la chaleur? L’une des principales mesures consiste à boire suffisamment avant et pendant le travail. En été, le corps peut avoir besoin de plusieurs litres d’eau par jour. Les travailleurs doivent porter des vêtements appropriés (y compris couvre-chef) permettant l’évacuation de la transpiration. Il est important qu’ils s’appliquent de la crème solaire et qu’ils portent des lunettes de protection contre les UV. S’ils ont le choix, ils ont avantage à effectuer les activités exigeant des efforts intenses le matin, à adapter leur rythme de travail et à rechercher l’ombre. Ils doivent prendre au sérieux les signaux d’alarme de leur organisme. Quelles sont les mesures que l’employeur peut prendre lors de fortes chaleurs? Des boissons appropriées doivent être mises à disposition afin de prévenir les risques de déshydratation. Le café n’est pas adapté. Les vêtements, l’environ-

Irene Kunz est spécialiste en médecine du travail et en médecine interne à la Suva à Lucerne. (Photo: Alma Johanns)

sive à la chaleur ambiante. Les postes de travail peuvent être protégés contre le rayonnement solaire direct à l’aide d’auvents, de bâches ou de parasols. Il est également important de prévoir des dispositifs de ventilation assurant le refroidissement de l’air. Pour les postes de travail fixes, il est parfois également possible d’installer un système de refroidissement ou de climatisation. Afin de limiter le dégagement de chaleur des machines, celles-ci peuvent être équipées d’une isolation supplémentaire ou d’un

Avez-vous d’autres conseils pour les travaux effectués par de fortes chaleurs? Le corps humain dispose d’un système de régulation de la chaleur très sensible qui nous «prévient» quand la prudence est de mise. Les travailleurs doivent prendre au sérieux les signaux de leur organisme, rechercher l’ombre, boire suffisamment et adapter le rythme de travail ou faire des pauses plus fréquentes. C’est le moyen le plus sûr d’éviter les pathologies liées à la chaleur. ■

69


70

bâtitech 5-14

carnet ELECTROTECHNIQUE

Brain Food Solutions 205 à 216

b) Mesurer la résistance des enroulements séparément ainsi qu’en opposition, déterminer la résistance d’isolement bobinage/boîtier.

Solution 208 a) S1 = pour fonctionnement continu b) Type de construction = B3 c) Raccordement 400 V 3L branché en étoile, ponts disposés horizontalement d) Régler le disjoncteur moteur sur 6,3 A

Solution 209 Les affirmations 3, 5 et 6 sont exactes.

Solution 210 En charge nominale et en sous-tension la vitesse de rotation du moteur chute. De ce fait la consommation en courant augmente et le moteur chauffe de façon non autorisée, dans la mesure où le disjoncteur moteur ne se déclenche pas. Illustration 213

Solution 205 La plupart des pompes pour chauffage sont à sécurité intrinsèque, c.-à-d. qu’elles disposent d’une protection contre les courts-circuits ou qu’elles sont équipées d’une électronique de protection du bobinage. Elles ne nécessitent plus de protection externe. La fiche technique du moteur fournit des indications précises en cas de doute.

Solution 206 a) Moteurs triphasés asynchrones à rotor en court-circuit. b) Le moteur est constitué d’un stator fixe et d’un rotor tournant. Le stator est fabriqué à partir de tôles de fer isolées. Il reçoit le bobinage incorporé dans des rainures. Le rotor comporte des enroulements constitués de conducteurs en court-circuit. Le rotor ressemble à une cage, c’est de là que vient l’expression «bobinage en cage d’écureuil». L’entraînement et la ventilation sont disposés sur l’axe du rotor.

Fonctionnement 40 ␮F

gauche

Solution 207 a) Il peut s’agir d’un court-circuit à la masse ou d’un défaut entre bobinage.

Illustration 216

droite

Démarrage


carnet

bâtitech 5-14

ELECTROTECHNIQUE

Solution 211

Solution 214

a) Le grand courant d’appel lors du démarrage direct provoque des chutes de tension dans les canalisations pouvant être à l’origine de perturbations. b) Les limites du démarrage direct sont décrites dans les recommandations des distributeurs d’énergie. Ce qui est déterminant c’est la fréquence des démarrages par exemple un démarrage par heure = courant de démarrage de 40 A possible avec 400 V. Dans le cas d’un nombre de démarrage croissant, le courant de démarrage direct probable baisse.

a) Il s’agit d’un moteur avec 2 enroulements séparés pour 2 vitesses de rotation différentes (moteur à pôles variables; 4/6 pôles) b) Les deux relais de protection contre les surintensités sont à régler sur: – petite vitesse de rotation = 3,9 A – grande vitesse de rotation = 5,2 A

Solution 212

Solution 216

Pour réduire le courant de démarrage, il est possible d’employer un montage en étoile-triangle ou le démarrage soft.

Pour faire fonctionner un moteur triphasé asynchrone en monophasé, il faut tenir compte de certaines limitations: • La puissance du moteur ne doit pas être trop élevée. Si le moteur dispose d’une puissance ‹ 2 kW, cela devient irréaliste du point de vue économique.

Solution 213 Le graphique 3 montre le montage en triangle (voir illustration 213).

Solution 215 Moteur 15 kW = IN = 27 A Type de pose = E Section choisie d’après le tableau NIBT = 4 mm2/PVC/30 °C / sans groupement

La petite puissance sur 230 V correspond aussi aux recommandations des distributeurs d’énergie. • Le montage n’est pas adapté aux démarrages difficiles. Il est possible d’y remédier avec un condensateur de démarrage supplémentaire, mais les moyens mis en œuvre deviennent de plus en plus importants. • Avec le montage monophasé, le moteur enregistre une perte de couple. La puissance en fonctionnement monophasé s’élève à près de 70 % de la puissance nominale, le couple à rotor bloqué chute à environ 30 % du couple nominal. • Il faut un condensateur: valeur indicative pour le condensateur permanent avec tension nominale 230 V/50 Hz: 60 à 80 ␮F/kW de puissance nominale triphasée (voir illustration 216). ■

La bonne solution dès le départ... ... C'est ce qui intéresse notre donneur d'ordre. L'entreprise familiale, qui emploie 70 collaborateurs s'est faite un nom dans le domaine de l'assainissement des conduites d'eau potable et des systèmes de chauffage au sol. Son siège est basé dans l'agglomération, au sud-est de Zurich. La demande en produits et services va croissante, c'est pourquoi la direction a décidé de créer un nouveau point de vente en Romandie. Nous sommes en charge du processus de recrutement et de sélection des candidats. Pour ce poste, nous recherchons une personne ouverte et combative (h/f)

« PARTENAIRE DE CONFIANCE » AVEC UNE GRANDE FORCE DE CONVICTION domaine de l'équipement des bâtiments et plus précisément du chauffage / sanitair Vous gagnerez notre confiance si vous possédez une formation artisanale ou technique dans le domaine de l'équipement du bâtiment. Vous êtes ouvert au dialogue et disposez d'une grande force de conviction. Une expérience dans le domaine commercial sera un atout supplémentaire. Dans l'organisation et l'exercice de vos fonctions, vous faites preuve d'une grande autonomie. Vous parlez français et maîtrisez la langue allemande. Vous maîtrisez également l'outil MS-Office. Vous gagnez la confiance de vos clients grâce à vos compétences, vos conseils aux consommateurs finaux, aux sociétés de gestion des propriétés foncières et immobilières. Vous élaborez les concepts de traitement des offres qui vous sont communiquées par le service interne. Par la suite, vous faites preuve de conviction et aboutissez à la conclusion de contrats. Le projet est piloté par un collaborateur interne, mais vous restez l'interlocuteur entre le client et l'entreprise. La confiance, ancrée dans la culture de notre entreprise, est une philosophie vécue au quotidien qui vous séduira. La qualité est une priorité à tous les niveaux. Les conditions d'embauche sont attrayantes. En plus du bureau mis à votre disposition ou des conditions de travail en home office, les outils et moyens de travail requis sont mis à votre disposition. De même, une voiture de fonction vous est fournie et il vous est possible de l'utiliser à titre privé. Des collaborateurs imaginatifs sont au cœur de l'entreprise et seront heureux de collaborer avec vous. 99% de satisfaction au travail, vous en avez envie? Appelez-nous pour un premier contact ou envoyez-nous toute la documentation relative à votre propre expérience. De par nos compétences, nous vous assurons 100% de discrétion. Au plaisir de vous lire.

Ihr Partner – Ihr Gewinn

PERMACO Personal Management Consulting Fredi Heidelberger ∙ Bernstrasse 390 ∙ CH-8953 Dietikon Tel 044 586 85 11 info@permaco.ch ∙ www.permaco.ch

71


72

bâtitech 5-14

impressum/registre

bâtitech: Parution: 10 fois par an, prix de l’abonnement: Fr. 95.– (à l’étranger port en sus) ISSN 1421 6704 Tirage et diffusion (Authentification WEMF/SW 2013) Tirage 5700 ex*., Tirage diffusé: 3234 ex., Tirage vendu 2045 ex. * sont compris: ex. à l’essai, ex. de promotion, de manifestations et de foires. Rédaction: Bernard Dätwyler et Michel Hottinger Potteilaz 123, 1030 Bussigny, natel 079 310 99 80 batitech@batinfotec.ch, www.batitech.ch Responsable électrotechnique: Pierre Schoeffel, tél. 061 485 90 80 pierre.schoeffel@keyboost.ch Edition, Copyright: © AZ Fachverlage AG Zeitschriften, Neumattstrasse 1, 5001 Aarau tél. 058 200 56 50, fax 058 200 56 61, www.az-verlag.ch Directeur général: Axel Wüstmann a. i. Editrice: Ratna Irzan Marketing: Valentin Kälin, valentin.kaelin@azmedien.ch Direction de la vente: Jürg Rykart, juerg.rykart@azmedien.ch Régie des annonces: Rolf Niederberger, tél. 058 200 56 18 (CVS) rolf.niederberger@azmedien.ch André Fluri, tél. 058 200 56 27 (E) andre.fluri@azmedien.ch Personne compétente: Verena Müller, tél. 058 200 56 42 verena.mueller@azmedien.ch Layout: Toni Zürcher, toni.zuercher@azmedien.ch Impression: Vogt-Schild Druck AG Gutenbergstrasse 1, 4552 Derendingen, www.vsdruck.ch

Droits d’auteur et de traduction: Avec l’acceptation des manuscrits par la rédaction et le paiement d’éventuels honoraires aux auteurs par l’éditeur, ce dernier acquiert le copyright et tous les droits de traduction et de publication des articles, soit dans d’autres revues éditées par l’éditeur, soit pour la publication de tirages à part. Un produit de Editeur: Peter Wanner CEO: Axel Wüstmann Participations importantes de AZ Medien AG en vertu de l’article 322, al. 2 du CP: AZ Anzeiger AG, AZ Fachverlage AG, AZ Management Services AG, AZ Regionalfernsehen AG, AZ TV Productions AG, AZ Verlagsservice AG, AZ Vertriebs AG, AZ Zeitungen AG, Belcom AG, Dietschi AG, Media Factory AG, Mittelland Zeitungsdruck AG, Vogt-Schild Druck AG, Vogt-Schild Vertriebs GmbH, Weiss Medien AG Association: USTSC Union suisse des professionnels de la technique sanitaire et chauffage VSSH, Hubrain 10, 8124 Maur, tél. 044 908 40 89 info@vssh.ch suissetec: Association suisse et liechtensteinoise de la Technique du bâtiment (suissetec), Secrétariat romand, rte des Longues Raies 11, CP 251, 2013 Colombier tél. 032 843 49 50, fax 032 843 49 55 romandie@suissetec.ch www.suissetec.ch REPRODUCTION INTERDITE

Registre des annonceurs ABB Schweiz AG 59 Aladin AG 65 Aquametro AG 57 Beckhoff Automation AG 23 BRZ Schweiz AG 36 Buderus Heiztechnik AG 24 Debrunner Koenig Management AG 49 Demelectric AG 39 ebm-papst AG 26 Electrosuisse 41 Fischer Otto AG Page de couverture 3 Franz Kaldewei GmbH & Co. KG 33 FVB Schweiz, Fachverband der Beleuchtungsindustrie 22 Geberit Vertriebs AG Page de couverture 4 Häny AG 39 Heitzmann AG 21 Heizkörper Prolux AG 19 Inter Protection SA 47 Isatel Electronic AG 35 Iseli & Co. 39 Koch René AG 43 Krüger + Co. AG Page de couverture 2 M. Züblin AG 45 Mercedes-Benz Schweiz AG 13 MM Automobile Schweiz AG 44 Ohnsorg Söhne AG 15 Osram AG 61 PanGas AG 47 Post CH AG 27 R. Nussbaum SA 31 Saia-Burgess Controls AG 9 Sanitas Troesch AG 7 Schmid AG, energy solutions 53 Schneider W. + Co. AG 25 Siemens Schweiz AG 51 Solu’Tubes SA 65 Swisslux AG 29 Swisscom (Schweiz) AG 11 Techem (Schweiz) AG 54 Theben HTS AG 3

Page de titre Walter Meier (Climat Suisse) SA

Annonces d’emplois Permaco

71


ProfShop

Les électriciens commandent ici de manière professionnelle. Sur smartphone, tablette ou PC, appeler otto fischer.ch, se connecter et c’est fait: avec une recherche sensationnelle et polyvalente sur les produits, l’outil KombiTool fortement amélioré pour la configuration des interrupteurs et des prises, les détails des produits, un filtre pour trouver les produits sans halogène et de nombreuses autres nouvelles fonctions.

www.ottofischer.ch


Excellent et avantageux. Geberit Mapress.

Geberit Mepla.

Avantageux et excellent. Prix et qualité: chez Geberit, les deux s’accordent à la perfection. Les systèmes d’alimentation vous offrent la solution adaptée à chaque exigence. Avec Geberit Mapress, vous bénéficiez d’une sécurité sans compromis au meilleur prix. Geberit Mepla convainc en tant qu’alternative avantageuse de première qualité, appréciée pour la rapidité de sa mise en œuvre, sa flexibilité et sa stabilité. Le système à emboîter rapide, flexible et économique Geberit PushFit complète la gamme destinée à la distribution d’étage. Vous trouverez de plus amples informations auprès de votre commerçant en technique du bâtiment Geberit ou sur → www.geberit.ch.

Bâtitech 05/2014  

Technique du bâtiment et énergie

Advertisement